1IGBA

Aeromonas proteolytica aminopeptidase complexed with the inhibitor para-iodo-d-phenylalanine hydroxamate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title The structure of the Aeromonas proteolytica aminopeptidase complexed with a hydroxamate inhibitor. Involvement in catalysis of Glu151 and two zinc ions of the co-catalytic unit.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 98
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1996-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1igbA00
3PB4X 3S9LA 3PBEA 4MCPA 3D66A 1DTDA 4MHNA 4AXVA 2RFHA 4G1PA 1H8LA 2ANPA 4MCQA 3D4UA 3IIBA 2PJCA 4PXEA 2BCOA 3N5FA 2CF4A 3GUXA 5IB9A 2EWBA 1IY7A 2AFOA 3VH9A 2XEJA 4NGPA 1Y7EA 5HVFA 4K3NA 2Q4ZA 3SI2A 3IEHA 1FNOA 3GLJA 2F7VA 4UIBA 4PXBA 3CPXA 3QNVA 4A38A 1CPSA 1CX8A 1TKHA 4EMEA 3B35A 2V8HA 4P45A 4IAVA 2V8GA 4UEFA 2XEGA 2C6CA 4KSIA 1XBUA 4B6ZA 2C1CA 3CDXA 1YMEA 2AFXA 3HLPA 2Q43A 1LOKA 3D7HA 2AFZA 5JH9A 5F09A 4DUKA 3KQXA 5LRKA 3FX6A 3KGQA 2ZEMA 2AFUA 4NGNA 1ZG7A 2G9DA 1PCAA 4MHPA 1TF8A 3K2KA 2IMOA 1CG2A 2PJ8A 3MN8A 4F8ZA 1ELMP 3DGVA 3FVLA 4P4EA 1CP6A 5D29A 2BOAA 1FT7A 4R76A 3IJ3A 4A94A 4H2KA 2QVPA 5DS0A 4ZY0A 4LQGA 1AMPA 4FWUA 5I4MA 2ZEPA 3WT4A 4NGQA 5HVGA 4OKOA 2PVWA 2JBJA 1QMUA 2XEIA 1JQGA 4MHZA 2GLFA 2CTBA 4NGSA 4ZI6A 2HB6A 4JYWA 3PB7X 4CPAA 3FEEA 2PCUA 3D68A 2CIJA 3T8WA 1ZLIA 3H8EA 4ZX9A 2ZENA 1HEEA 1VHOA 3KHZA 3FH4A 2HC9A 3GB0A 1XMBA 3PB6X 4P4FA 1VGYA 1LFWA 1BPMA 3SJEA 4MRIA 2V8DA 1VHEA 1RTQA 4P4BA 2GREA 1YW4A 4FAIA 2PRQA 3SI0A 3MRUA 2PVVA 1F2OA 2XEFA 5J1QA 1ARMA 2ZEDA 3ISXA 4P4IA 2QJ8A 3B3VA 3KZWA 4R8FA 4BD9A 5LYFA 1R43A 4OC3A 1GYTA 4X2TA 4R6TA 5CBMA 5JGFA 5ELYA 3SJGA 4ZX8A 4MCSA 4OC0A 3FMCA 3NFZA 2PJBA 1BLLE 5LYDA 1EE3P 2C6GA 3PEIA 3KI9A 2ABZA 3PFEA 4X8IA 5JM6A 3L2NA 3KHXA 2ZEEA 4P44A 2DEAA 2VL1A 2F8HA 4PXCA 1LANA 5LRJA 3FF3A 3VARA 1YW6A 3CT9A 3ISZA 3RAMA 4OIWA 4F9VA 2C6PA 1YSJA 4MXUA 4A37A 4A39A 2V8VA 4R7MA 4UF4A 4OIDA 2NYQA 5THWA 2ZEOA 4GM5A 3BHXA 3IC1A 4YU9A 1Y0RA 3VATA 2PE3A 3LWUA 3B3SA 1HDUA 1CPXA 3K9TA 2EK8A 3BXMA 1BPNA 2JBKA 2CTCA 1DE4C 2IQ6A 3LMSA 3KQZA 4UIAA 2PJ3A 1TKJA 5K8PA 1F57A 2PIYA 5LYLA 2ZELA 1VIXA 3PB8X 1TKFA 3NH5A 4X3RA 4UEZA 3WC7A 2Q51A 2AFMA 2O4HA 1NSAA 2ZOFA 3FEDA 1ARLA 4IK2A 3IWWA 4ONWA 1ELLP 4P6YA 4DYOA 2PJAA 4OC5A 4ZY1A 4OMEA 3TX8A 3B7IA 4O23A 4OC1A 4PXDA 5CPAA 2WYRA 6CPAA 1YLOA 4JZ0A 1UWYA 3SJFA 2PJ5A 1XRYA 2OOTA 3SI1A 4YWYA 4NFRA 4NGTA 2ZEGA 3CPAA 4WWVA 1KWMA 4ZYQA 3V38A 1QQ9A 4NGRA 1Y0YA 3NA6A 3I1UA 4P4DA 1CBXA 3KR4A 4W9YA 2V77A 3B3WA 4NJQA 2RB7A 3PBBA 3IO1A 1Z5RA 2WZNA 1LCPA 4UEEA 4OP4A 3H8FA 4MMOA 4OC4A 1XFOA 3KL9A 2PJ7A 3RZAA 1R3NA 1AYEA 3DLJA 1Z8LA 3PB9X 4IHMA 4F9UA 3D7DA 2POKA 5K8NA 1Q7LA 3TC8A 3B2YA 3BI1A 3H8GA 3PFOA 3S9NA 2PJ9A 1TXRA 5D8NA 2I3CA 5HVHA 2GLJA 3WC5A 2AFSA 4WJBA 3RBUA 2O53A 2ZEFA 4ZY2A 1ZG9A 3B3TA 3FJUA 3PRTA 4PPZA 4MCRA 2PJ1A 3V7ZA 2BO9A 1BAVA 4Z65A 1PYTB 3IFEA 2PJ2A 5HXDA 2QYVA 4OC2A 2GU2A 5LYIA 4TNUA 5LRGA 4Q7AA 2EK9A 4FUUA 3S9MA 3D67A 1M4LA 2J9AA 3D7GA 4P4JA 3NH8A 2FVGA 8CPAA 1HDQA 2PJ0A 1OBRA 4TWEA 4PQAA 2PIZA 1IGBA 4NGMA 3JRUA 4EWTA 4P10A 1LAPA 1CP7A 1LAMA 1TF9A 1Z2LA 3FECA 2ZEHA 1ZLHA 2PJ4A 2OR4A 3B3CA 2JEWA 1ZG8A 4FBEA 2ZOGA 4RUHA 3BI0A 2AFWA 4DJLA 3NH4A 3KASA 5K8OA 1XJOA 3SJXA 3WC6A 3KR5A 4EFDA 4NJRA 3D7FA 2NSMA 2PJ6A 1F2PA 3HUVA 4MHYA 5K8MA 7CPAA 2IJZA 3WABA
chains in the Genus database with same CATH superfamily
3PB4X 3S9LA 4MBUA 3PBEA 4MCPA 3F0AA 3D66A 1DTDA 4MHNA 4Y49C 3QB8A 3PP9A 2RFHA 4G1PA 4KOWA 4AXVA 1H8LA 4CS0B 2ANPA 4MCQA 3D4UA 4II9A 4C7HA 3IIBA 3TOAA 2PJCA 4PXEA 2BCOA 3EXNA 3N5FA 2IL4A 2CF4A 3P2FA 3GUXA 2PR8A 4AVBA 4AG9A 4CYOA 5IB9A 2EWBA 2Y0MA 1IY7A 4KSFA 2AFOA 1YLEA 2P6GA 5G20A 4AVCA 3VH9A 1IOIA 2XEJA 1P4NA 2HUZA 4NGPA 1Y7EA 5HVFA 4K3NA 2Q4ZA 4MFPA 3SI2A 2J8MA 3IEHA 5J8FA 1FNOA 3GLJA 2F7VA 4UIBA 3VWDA 4PXBA 4RN7A 2PQ8A 4M6HA 3CPXA 3QNVA 1ON0A 1IYKA 4A38A 1CPSA 2Q7SA 1CX8A 1TKHA 4EMEA 2EO8A 3B35A 5CNPA 1IOFA 2V8HA 4P45A 4IAVA 1JWQA 2J8RA 2V8GA 4UEFA 2XEGA 2P6EA 2C6CA 4KSIA 1XBUA 2B5GA 4L8AA 4B6ZA 4K30A 3TO7A 2C1CA 3CDXA 3FYNA 1YMEA 2AFXA 2WUUA 3HLPA 2Q43A 1LOKA 3D7HA 4CRZB 4JXRA 2AFZA 4KUBA 5JH9A 3C26A 5F09A 4DUKA 4PK2A 4E0AA 1I12A 3IWEA 1S7FA 2B4DA 3KQXA 2VI7A 3FX6A 4FD7A 2EUIA 4QVTA 4RI1A 3R9EA 2ZW5A 1YQEA 5LRKA 3H4QA 3KGQA 4B12A 2ZEMA 5KTCA 2AFUA 1FY7A 4NGNA 1ZG7A 3FNCA 4FD6A 2G9DA 3G8WA 1PCAA 3A9LA 3LD2A 4YRHA 1QSNA 4MHPA 2G3TA 3S6GA 1TF8A 2B3UA 3K2KA 2IMOA 2FCKA 1CG2A 4E8OA 2PJ8A 3MN8A 1ZO0A 4F8ZA 1ELMP 3DGVA 1KUVA 2JLMA 3FVLA 2PC1A 4C2XA 4P4EA 1CP6A 2FL4A 5KTAA 5D29A 2BOAA 3SXNA 1FT7A 2PR1A 1VHSA 3IJ3A 4R76A 4A94A 2NMTA 2R98A 4H2KA 2GE3A 2ARHA 2QVPA 4CAXA 2YGWA 5DS0A 4ZY0A 4QB9A 4LQGA 3JTKA 1XF8A 4KUAA 1AMPA 1YVKA 4FWUA 4J3GA 3OWCA 5I4MA 4NCZA 2ZEPA 4R57A 3WT4A 3TO6A 4NGQA 5HVGA 4OKOA 1Z9UA 3S6HA 2PVWA 2F5IA 1QMUA 2JBJA 4M6IA 2XEIA 1Z4RA 4U5YA 1L0CA 1Q2CA 1JQGA 1PU9A 1QSRA 3G3SA 3RYOA 4MHZA 2GLFA 2Q4VA 3JVNA 2CTBA 4NGSA 4HNYB 4ZI6A 5KTDA 2HB6A 4JYWA 3PB7X 3WR7A 4B5OA 4CPAA 3FEEA 2PCUA 2ZW6A 3D68A 4KLWA 2CIJA 3T8WA 3GYAA 1Z8XA 1ZLIA 5A27A 3R9FA 4C2ZA 1XIXA 1WWZA 2K5TA 2CXAA 3H8EA 2D4PA 3GKRA 4ZX9A 2ZENA 2EVNA 4U9YA 1HEEA 1VHOA 3PGPA 3KHZA 2VEZA 3FH4A 3CXQA 2HC9A 4MFQA 3GB0A 1XMBA 3PB6X 4P4FA 1VGYA 1QSMA 4CAFA 4XPKA 1LFWA 1BPMA 2P0WA 2VZYA 3SJEA 4MRIA 1S3ZA 2V8DA 5J8CA 1VHEA 4HKFA 1RTQA 4P4BA 1S5KA 3CXSA 5IB0A 2GREA 4BINA 1CJWA 2PRBA 4H6ZA 1YW4A 4FAIA 4MFZA 3NE7A 1XOVA 4JLYA 1IB1E 3EO4A 1YR0A 2PRQA 1M4DA 4CYPA 3SI0A 4KOSA 3MRUA 2DF5A 2PVVA 1F2OA 1QSTA 1Y9WA 2XEFA 3W6SA 5J1QA 2OZUA 1ARMA 2ZEDA 4UFVA 3ISXA 4P4IA 2QJ8A 3B3VA 1Y7RA 3KZWA 4UCNA 2OZGA 5BWAB 4KVOE 4FD4A 4R8FA 2ZW4A 5FVJA 4BD9A 5LYFA 1R43A 2REFA 2REEA 4OC3A 1GYTA 4X2TA 4MY3A 2BSWA 4UBRA 4A95A 4OADA 4R6TA 1B87A 1YK3A 2YNCC 5CBMA 5JGFA 5ELYA 3SJGA 3W6XA 3I3GA 4ZX8A 4L89A 4MCSA 4OC0A 3FMCA 4KVME 1MJBA 2Z3NA 3NFZA 4JXQA 5C88A 5A28A 1M4GA 2BL1A 5AG6A 1RO5A 2PJBA 1BLLE 2VZZA 4ONUA 5LYDA 3TCVA 1EE3P 2C6GA 3PEIA 3KI9A 4F0XA 4MHDA 2ABZA 3DDDA 4CGLA 3PFEA 4R87A 4X8IA 3QAHA 2FSRA 2DXQA 3R1KA 4QUSA 3I9SA 3RNZA 5JM6A 3L2NA 3KHXA 2ZEEA 1XMTA 2H5MA 2DEAA 2VL1A 4P44A 3GIUA 2WSAA 2F8HA 4PXCA 1B6BA 1LANA 1Z8TA 2YNDA 5LRJA 3FF3A 1BOBA 2FIWA 2HQYA 3SXOA 3VARA 2Q04A 1YW6A 2Z3OA 4CYQA 5JQ4A 2CY2A 1YVOA 3D2PA 5EMIA 3CT9A 4UFXA 2ATRA 3GY9A 3ISZA 3RAMA 4OIWA 5JPHA 4F9VA 2C6PA 2ZPAA 2RC4A 3CZXA 5DWNA 1YSJA 4E2AA 4YFJA 4MXUA 1VKCA 2JDCA 2ZXVA 4A37A 3DR8A 3P2HA 4A39A 2V8VA 4R7MA 4UF4A 4HNWB 4OIDA 4Q38A 2NYQA 4B10A 2YNCA 5THWA 2Z3LA 2J8NA 2ZEOA 4KSAA 1IYLA 4GM5A 3BHXA 3IC1A 4M6GA 4YU9A 1Y0RA 1I1DA 3VATA 5GCNA 2X7BA 4IUSA 2PE3A 4KOVA 2BUEA 3TTHA 3LWUA 4UFWA 4CAVA 4OAEA 3B3SA 1HDUA 2OU2A 4LQ6A 1CPXA 4LX9A 3K9TA 2EK8A 3BXMA 1BPNA 5H84A 1V0CA 2JBKA 2CTCA 1DE4C 3IU2A 4QC6A 2PDOA 4R3LA 1WK4A 2IQ6A 3LMSA 4NEXA 2FE7A 3KQZA 4UIAA 2PJ3A 4A2ZA 5AG4A 1TKJA 4M85A 5G1ZA 3FBUA 5K8PA 5HH1A 1F57A 2PIYA 5LYLA 2ZELA 5EC4A 4FD5A 1VIXA 2ODFA 1TKFA 3PB8X 5AGEA 1MJ9A 3NH5A 4ZGYB 4X3RA 2R8VA 3R96A 4UEZA 3WC7A 2Q51A 2AFMA 1N71A 2Z11A 2O4HA 4KVXA 2FIAA 1NSAA 2I79A 4KLVA 3SHPA 2ZOFA 4KOUA 2HV2A 3FEDA 3S6FA 1ARLA 4IK2A 1AUGA 3D3SA 4NXYA 2D4OA 4B13A 1OZPA 2AJ6A 3IWWA 4ONWA 4H89A 1NSLA 3JUWA 1ELLP 5H86A 2Q4YA 3R9GA 4NSQA 4P6YA 2I00A 2B58A 2PJAA 4DYOA 4OC5A 4C2YA 4ZY1A 4OMEA 1Q2YA 4UWJA 3TX8A 3B7IA 4HNXB 3RO0A 4M3SA 1S7LA 3FXTA 1NMTA 1XEBA 3KKWA 4AG7A 1LRZA 1IIDA 1GHEA 4O23A 2KCWA 3CXPA 4OC1A 4PXDA 3TT2A 5IV0A 3QAYA 5CPAA 2WYRA 2C27A 5G22A 4A32A 4CGOA 4CAEA 6CPAA 1PUAA 1YLOA 4JZ0A 3ZJ0A 1RXTA 3IU1A 1TIQA 1UWYA 2OZHA 1YREA 1IU8A 3SJFA 2PJ5A 2FXFA 2O28A 4UCPA 1XRYA 2OOTA 3SI1A 4BMHA 2DPTA 3F8KA 4YWYA 4YGOA 4NFRA 4KOYA 4NGTA 1BO4A 3D8PA 2G3AA 4AVAA 4B5PB 4EVYA 2ZEGA 3CPAA 4WWVA 1KWMA 4ZBGA 2Q7BA 3BJ7A 3V38A 4ZYQA 4F0YA 1QQ9A 3V8IA 4NGRA 1Y0YA 3NA6A 5AG5A 3I1UA 4P4DA 4NF1A 5DWMA 1CBXA 4A30A 3T9YA 1QSOA 2GANA 3KR4A 4UA3A 5HMNA 1KZFA 1KUYA 4W9YA 2V77A 3B3WA 4NJQA 2CNMA 2QECA 2RB7A 3BLNA 4PSWA 4XPDC 3PBBA 3IO1A 4Q36A 1Z5RA 4KOTA 2VBQA 2WZNA 3LACA 2OB0A 4A33A 1LCPA 4UEEA 4BBHA 4OP4A 5F48A 3H8FA 4MMOA 4OC4A 5IX3A 1Q2DA 1XFOA 3KL9A 4R3KA 2ZW7A 3IGRA 3K9UA 1R57A 2PJ7A 4A31A 4LUAA 3RZAA 4MFJA 1R3NA 1AYEA 3DLJA 3W91A 1Z8LA 3TE4A 2VXKA 3PB9X 4GXHA 4IHMA 4F9UA 3D7DA 4DNCA 3IWGA 2POKA 3MGDA 5K8NA 1Q7LA 2WPXA 1Z4EA 3TC8A 4PV6A 3B2YA 3BI1A 3H8GA 3PFOA 3S9NA 3EC4A 2PJ9A 3D2MA 5I0CA 1S60A 1TXRA 2EBJA 2YNEA 2I3CA 5D8NA 5HVHA 4KORA 2GLJA 5F47A 3WC5A 2AFSA 4WJBA 3RBUA 2O53A 2ZEFA 2VQYA 4MFKA 4ZY2A 1MK4A 1ZG9A 4X5KA 1YX0A 3B3TA 3TOBA 3BJ8A 3E0KA 3FJUA 3PRTA 2B5GB 1X10A 3VWEA 4PPZA 3S6KA 4MCRA 1J4JA 2PJ1A 3DR6A 2AE6A 4PSXA 1S7NA 3V7ZA 1M4IA 2BO9A 1P0HA 4I49A 2BEIA 4XNHC 4Y49B 1BAVA 3EY5A 4Z65A 1PYTB 2B4DB 2WPWA 1X12A 3DNSA 1Y9KA 2A4NA 3IFEA 3FB3A 2PJ2A 5F49A 4XPDB 2QMLA 2QYVA 5HXDA 4OC2A 1XE4A 4C7IA 2GU2A 3NE8A 4R9MA 5EBVA 3DSBA 4PK3A 5LYIA 2Z0ZA 4TNUA 5LRGA 2QIRA 2GIVA 3LODA 1CM0A 3EFAA 4Q7AA 2EK9A 4C68A 4MI4A 4FUUA 2JDDA 5AG7A 2Z3PA 3S9MA 1I21A 3D67A 1M4LA 2J9AA 3D7GA 2R1IA 5ISVA 1YGHA 4P4JA 3NH8A 2Z3MA 2FVGA 4HPSA 8CPAA 4UWIA 2PSWA 1SQHA 2Z10A 4B11A 1HDQA 2PJ0A 1OBRA 2Z3KA 4TWEA 2FT0A 4PQAA 5C82A 2PIZA 2Q0YA 1IGBA 1IICA 4NGMA 3JRUA 4JD6A 4CYNA 4EWTA 3N7ZA 4P10A 1LAPA 3T90A 3UY5A 4XPLA 2GFQA 1CP7A 2JEVA 4RS2A 1LAMA 1TF9A 1Z2LA 3FECA 4CGNA 1KUXA 2ZEHA 4U9ZA 4JWPA 2DPSA 2P6FA 4CGPA 4ORFA 1M1DA 1MJAA 1ZLHA 4H6UA 4XNHB 4AB7A 2PJ4A 2OR4A 1NE9A 1Z8WA 2R7HA 3B3CA 2JEWA 2OH1A 4KOXA 4QBJA 3R95A 1K4JA 2CNTA 1ZG8A 3FIXA 4IF5A 4FBEA 4KS9A 2ZOGA 4GS4A 4CAWA 4CRYB 4RUHA 4MJ8A 3BI0A 2AFWA 4OLLA 4B14A 1UFHA 4UCMA 4DJLA 1U6MA 4JJXA 3NH4A 3KASA 5K8OA 1A2ZA 1XJOA 2B4BA 2FS5A 4MY0A 5E96A 3SJXA 3WC6A 3KR5A 2B3VA 3F5BA 3FRMA 4EFDA 3ZZIA 4NJRA 1M44A 3B8GA 4MFLA 3D7FA 2NSMA 4CGMA 4B5PA 2G0BA 3TO9A 5F46A 5G21A 2PJ6A 4F6AA 4KZTA 1F2PA 3HUVA 4MHYA 3TFYA 5K8MA 2CNSA 7CPAA 2Q44A 3PZJA 2IJZA 3WABA 3H5ZA 1S7KA
chains in the Genus database with same CATH topology
3PB4X 3S9LA 3PBEA 4MCPA 3D66A 1DTDA 4MHNA 4AXVA 2RFHA 4G1PA 1H8LA 2ANPA 4MCQA 3D4UA 3IIBA 2PJCA 4PXEA 2BCOA 3N5FA 2CF4A 3GUXA 5IB9A 2EWBA 1IY7A 2AFOA 3VH9A 2XEJA 4NGPA 1Y7EA 5HVFA 4K3NA 2Q4ZA 3SI2A 3IEHA 1FNOA 3GLJA 2F7VA 4UIBA 4PXBA 3CPXA 3QNVA 4A38A 1CPSA 1CX8A 1TKHA 4EMEA 3B35A 2V8HA 4P45A 4IAVA 2V8GA 4UEFA 2XEGA 2C6CA 4KSIA 1XBUA 4B6ZA 2C1CA 3CDXA 1YMEA 2AFXA 3HLPA 2Q43A 1LOKA 3D7HA 2AFZA 5JH9A 5F09A 4DUKA 3KQXA 5LRKA 3FX6A 3KGQA 2ZEMA 2AFUA 4NGNA 1ZG7A 2G9DA 1PCAA 4MHPA 1TF8A 3K2KA 2IMOA 1CG2A 2PJ8A 3MN8A 4F8ZA 1ELMP 3DGVA 3FVLA 4P4EA 1CP6A 5D29A 2BOAA 1FT7A 4R76A 3IJ3A 4A94A 4H2KA 2QVPA 5DS0A 4ZY0A 4LQGA 1AMPA 4FWUA 5I4MA 2ZEPA 3WT4A 4NGQA 5HVGA 4OKOA 2PVWA 2JBJA 1QMUA 2XEIA 1JQGA 4MHZA 2GLFA 2CTBA 4NGSA 4ZI6A 2HB6A 4JYWA 3PB7X 4CPAA 3FEEA 2PCUA 3D68A 2CIJA 3T8WA 1ZLIA 3H8EA 4ZX9A 2ZENA 1HEEA 1VHOA 3KHZA 3FH4A 2HC9A 3GB0A 1XMBA 3PB6X 4P4FA 1VGYA 1LFWA 1BPMA 3SJEA 4MRIA 2V8DA 1VHEA 1RTQA 4P4BA 2GREA 1YW4A 4FAIA 2PRQA 3SI0A 3MRUA 2PVVA 1F2OA 2XEFA 5J1QA 1ARMA 2ZEDA 3ISXA 4P4IA 2QJ8A 3B3VA 3KZWA 4R8FA 4BD9A 5LYFA 1R43A 4OC3A 1GYTA 4X2TA 4R6TA 5CBMA 5JGFA 5ELYA 3SJGA 4ZX8A 4MCSA 4OC0A 3FMCA 3NFZA 2PJBA 1BLLE 5LYDA 1EE3P 2C6GA 3PEIA 3KI9A 2ABZA 3PFEA 4X8IA 5JM6A 3L2NA 3KHXA 2ZEEA 4P44A 2DEAA 2VL1A 2F8HA 4PXCA 1LANA 5LRJA 3FF3A 3VARA 1YW6A 3CT9A 3ISZA 3RAMA 4OIWA 4F9VA 2C6PA 1YSJA 4MXUA 4A37A 4A39A 2V8VA 4R7MA 4UF4A 4OIDA 2NYQA 5THWA 2ZEOA 4GM5A 3BHXA 3IC1A 4YU9A 1Y0RA 3VATA 2PE3A 3LWUA 3B3SA 1HDUA 1CPXA 3K9TA 2EK8A 3BXMA 1BPNA 2JBKA 2CTCA 1DE4C 2IQ6A 3LMSA 3KQZA 4UIAA 2PJ3A 1TKJA 5K8PA 1F57A 2PIYA 5LYLA 2ZELA 1VIXA 3PB8X 1TKFA 3NH5A 4X3RA 4UEZA 3WC7A 2Q51A 2AFMA 2O4HA 1NSAA 2ZOFA 3FEDA 1ARLA 4IK2A 3IWWA 4ONWA 1ELLP 4P6YA 4DYOA 2PJAA 4OC5A 4ZY1A 4OMEA 3TX8A 3B7IA 4O23A 4OC1A 4PXDA 5CPAA 2WYRA 6CPAA 1YLOA 4JZ0A 1UWYA 3SJFA 2PJ5A 1XRYA 2OOTA 3SI1A 4YWYA 4NFRA 4NGTA 2ZEGA 3CPAA 4WWVA 1KWMA 4ZYQA 3V38A 1QQ9A 4NGRA 1Y0YA 3NA6A 3I1UA 4P4DA 1CBXA 3KR4A 4W9YA 2V77A 3B3WA 4NJQA 2RB7A 3PBBA 3IO1A 1Z5RA 2WZNA 1LCPA 4UEEA 4OP4A 3H8FA 4MMOA 4OC4A 1XFOA 3KL9A 2PJ7A 3RZAA 1R3NA 1AYEA 3DLJA 1Z8LA 3PB9X 4IHMA 4F9UA 3D7DA 2POKA 5K8NA 1Q7LA 3TC8A 3B2YA 3BI1A 3H8GA 3PFOA 3S9NA 2PJ9A 1TXRA 5D8NA 2I3CA 5HVHA 2GLJA 3WC5A 2AFSA 4WJBA 3RBUA 2O53A 2ZEFA 4ZY2A 1ZG9A 3B3TA 3FJUA 3PRTA 4PPZA 4MCRA 2PJ1A 3V7ZA 2BO9A 1BAVA 4Z65A 1PYTB 3IFEA 2PJ2A 5HXDA 2QYVA 4OC2A 2GU2A 5LYIA 4TNUA 5LRGA 4Q7AA 2EK9A 4FUUA 3S9MA 3D67A 1M4LA 2J9AA 3D7GA 4P4JA 3NH8A 2FVGA 8CPAA 1HDQA 2PJ0A 1OBRA 4TWEA 4PQAA 2PIZA 1IGBA 4NGMA 3JRUA 4EWTA 4P10A 1LAPA 1CP7A 1LAMA 1TF9A 1Z2LA 3FECA 2ZEHA 1ZLHA 2PJ4A 2OR4A 3B3CA 2JEWA 1ZG8A 4FBEA 2ZOGA 4RUHA 3BI0A 2AFWA 4DJLA 3NH4A 3KASA 5K8OA 1XJOA 3SJXA 3WC6A 3KR5A 4EFDA 4NJRA 3D7FA 2NSMA 2PJ6A 1F2PA 3HUVA 4MHYA 5K8MA 7CPAA 2IJZA 3WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB4 X;  3S9L A;  3PBE A;  4MCP A;  3D66 A;  1DTD A;  4MHN A;  4AXV A;  2RFH A;  4G1P A;  1H8L A;  2ANP A;  4MCQ A;  3D4U A;  3IIB A;  2PJC A;  4PXE A;  2BCO A;  3N5F A;  2CF4 A;  3GUX A;  5IB9 A;  2EWB A;  1IY7 A;  2AFO A;  3VH9 A;  2XEJ A;  4NGP A;  1Y7E A;  5HVF A;  4K3N A;  2Q4Z A;  3SI2 A;  3IEH A;  1FNO A;  3GLJ A;  2F7V A;  4UIB A;  4PXB A;  3CPX A;  3QNV A;  4A38 A;  1CPS A;  1CX8 A;  1TKH A;  4EME A;  3B35 A;  2V8H A;  4P45 A;  4IAV A;  2V8G A;  4UEF A;  2XEG A;  2C6C A;  4KSI A;  1XBU A;  4B6Z A;  2C1C A;  3CDX A;  1YME A;  2AFX A;  3HLP A;  2Q43 A;  1LOK A;  3D7H A;  2AFZ A;  5JH9 A;  5F09 A;  4DUK A;  3KQX A;  5LRK A;  3FX6 A;  3KGQ A;  2ZEM A;  2AFU A;  4NGN A;  1ZG7 A;  2G9D A;  1PCA A;  4MHP A;  1TF8 A;  3K2K A;  2IMO A;  1CG2 A;  2PJ8 A;  3MN8 A;  4F8Z A;  1ELM P;  3DGV A;  3FVL A;  4P4E A;  1CP6 A;  5D29 A;  2BOA A;  1FT7 A;  4R76 A;  3IJ3 A;  4A94 A;  4H2K A;  2QVP A;  5DS0 A;  4ZY0 A;  4LQG A;  1AMP A;  4FWU A;  5I4M A;  2ZEP A;  3WT4 A;  4NGQ A;  5HVG A;  4OKO A;  2PVW A;  2JBJ A;  1QMU A;  2XEI A;  1JQG A;  4MHZ A;  2GLF A;  2CTB A;  4NGS A;  4ZI6 A;  2HB6 A;  4JYW A;  3PB7 X;  4CPA A;  3FEE A;  2PCU A;  3D68 A;  2CIJ A;  3T8W A;  1ZLI A;  3H8E A;  4ZX9 A;  2ZEN A;  1HEE A;  1VHO A;  3KHZ A;  3FH4 A;  2HC9 A;  3GB0 A;  1XMB A;  3PB6 X;  4P4F A;  1VGY A;  1LFW A;  1BPM A;  3SJE A;  4MRI A;  2V8D A;  1VHE A;  1RTQ A;  4P4B A;  2GRE A;  1YW4 A;  4FAI A;  2PRQ A;  3SI0 A;  3MRU A;  2PVV A;  1F2O A;  2XEF A;  5J1Q A;  1ARM A;  2ZED A;  3ISX A;  4P4I A;  2QJ8 A;  3B3V A;  3KZW A;  4R8F A;  4BD9 A;  5LYF A;  1R43 A;  4OC3 A;  1GYT A;  4X2T A;  4R6T A;  5CBM A;  5JGF A;  5ELY A;  3SJG A;  4ZX8 A;  4MCS A;  4OC0 A;  3FMC A;  3NFZ A;  2PJB A;  1BLL E;  5LYD A;  1EE3 P;  2C6G A;  3PEI A;  3KI9 A;  2ABZ A;  3PFE A;  4X8I A;  5JM6 A;  3L2N A;  3KHX A;  2ZEE A;  4P44 A;  2DEA A;  2VL1 A;  2F8H A;  4PXC A;  1LAN A;  5LRJ A;  3FF3 A;  3VAR A;  1YW6 A;  3CT9 A;  3ISZ A;  3RAM A;  4OIW A;  4F9V A;  2C6P A;  1YSJ A;  4MXU A;  4A37 A;  4A39 A;  2V8V A;  4R7M A;  4UF4 A;  4OID A;  2NYQ A;  5THW A;  2ZEO A;  4GM5 A;  3BHX A;  3IC1 A;  4YU9 A;  1Y0R A;  3VAT A;  2PE3 A;  3LWU A;  3B3S A;  1HDU A;  1CPX A;  3K9T A;  2EK8 A;  3BXM A;  1BPN A;  2JBK A;  2CTC A;  1DE4 C;  2IQ6 A;  3LMS A;  3KQZ A;  4UIA A;  2PJ3 A;  1TKJ A;  5K8P A;  1F57 A;  2PIY A;  5LYL A;  2ZEL A;  1VIX A;  3PB8 X;  1TKF A;  3NH5 A;  4X3R A;  4UEZ A;  3WC7 A;  2Q51 A;  2AFM A;  2O4H A;  1NSA A;  2ZOF A;  3FED A;  1ARL A;  4IK2 A;  3IWW A;  4ONW A;  1ELL P;  4P6Y A;  4DYO A;  2PJA A;  4OC5 A;  4ZY1 A;  4OME A;  3TX8 A;  3B7I A;  4O23 A;  4OC1 A;  4PXD A;  5CPA A;  2WYR A;  6CPA A;  1YLO A;  4JZ0 A;  1UWY A;  3SJF A;  2PJ5 A;  1XRY A;  2OOT A;  3SI1 A;  4YWY A;  4NFR A;  4NGT A;  2ZEG A;  3CPA A;  4WWV A;  1KWM A;  4ZYQ A;  3V38 A;  1QQ9 A;  4NGR A;  1Y0Y A;  3NA6 A;  3I1U A;  4P4D A;  1CBX A;  3KR4 A;  4W9Y A;  2V77 A;  3B3W A;  4NJQ A;  2RB7 A;  3PBB A;  3IO1 A;  1Z5R A;  2WZN A;  1LCP A;  4UEE A;  4OP4 A;  3H8F A;  4MMO A;  4OC4 A;  1XFO A;  3KL9 A;  2PJ7 A;  3RZA A;  1R3N A;  1AYE A;  3DLJ A;  1Z8L A;  3PB9 X;  4IHM A;  4F9U A;  3D7D A;  2POK A;  5K8N A;  1Q7L A;  3TC8 A;  3B2Y A;  3BI1 A;  3H8G A;  3PFO A;  3S9N A;  2PJ9 A;  1TXR A;  5D8N A;  2I3C A;  5HVH A;  2GLJ A;  3WC5 A;  2AFS A;  4WJB A;  3RBU A;  2O53 A;  2ZEF A;  4ZY2 A;  1ZG9 A;  3B3T A;  3FJU A;  3PRT A;  4PPZ A;  4MCR A;  2PJ1 A;  3V7Z A;  2BO9 A;  1BAV A;  4Z65 A;  1PYT B;  3IFE A;  2PJ2 A;  5HXD A;  2QYV A;  4OC2 A;  2GU2 A;  5LYI A;  4TNU A;  5LRG A;  4Q7A A;  2EK9 A;  4FUU A;  3S9M A;  3D67 A;  1M4L A;  2J9A A;  3D7G A;  4P4J A;  3NH8 A;  2FVG A;  8CPA A;  1HDQ A;  2PJ0 A;  1OBR A;  4TWE A;  4PQA A;  2PIZ A;  1IGB A;  4NGM A;  3JRU A;  4EWT A;  4P10 A;  1LAP A;  1CP7 A;  1LAM A;  1TF9 A;  1Z2L A;  3FEC A;  2ZEH A;  1ZLH A;  2PJ4 A;  2OR4 A;  3B3C A;  2JEW A;  1ZG8 A;  4FBE A;  2ZOG A;  4RUH A;  3BI0 A;  2AFW A;  4DJL A;  3NH4 A;  3KAS A;  5K8O A;  1XJO A;  3SJX A;  3WC6 A;  3KR5 A;  4EFD A;  4NJR A;  3D7F A;  2NSM A;  2PJ6 A;  1F2P A;  3HUV A;  4MHY A;  5K8M A;  7CPA A;  2IJZ A;  3WAB A; 
#chains in the Genus database with same CATH topology
 3PB4 X;  3S9L A;  4MBU A;  3PBE A;  4MCP A;  3F0A A;  3D66 A;  1DTD A;  4MHN A;  4Y49 C;  3QB8 A;  3PP9 A;  2RFH A;  4G1P A;  4KOW A;  4AXV A;  1H8L A;  4CS0 B;  2ANP A;  4MCQ A;  3D4U A;  4II9 A;  4C7H A;  3IIB A;  3TOA A;  2PJC A;  4PXE A;  2BCO A;  3EXN A;  3N5F A;  2IL4 A;  2CF4 A;  3P2F A;  3GUX A;  2PR8 A;  4AVB A;  4AG9 A;  4CYO A;  5IB9 A;  2EWB A;  2Y0M A;  1IY7 A;  4KSF A;  2AFO A;  1YLE A;  2P6G A;  5G20 A;  4AVC A;  3VH9 A;  1IOI A;  2XEJ A;  1P4N A;  2HUZ A;  4NGP A;  1Y7E A;  5HVF A;  4K3N A;  2Q4Z A;  4MFP A;  3SI2 A;  2J8M A;  3IEH A;  5J8F A;  1FNO A;  3GLJ A;  2F7V A;  4UIB A;  3VWD A;  4PXB A;  4RN7 A;  2PQ8 A;  4M6H A;  3CPX A;  3QNV A;  1ON0 A;  1IYK A;  4A38 A;  1CPS A;  2Q7S A;  1CX8 A;  1TKH A;  4EME A;  2EO8 A;  3B35 A;  5CNP A;  1IOF A;  2V8H A;  4P45 A;  4IAV A;  1JWQ A;  2J8R A;  2V8G A;  4UEF A;  2XEG A;  2P6E A;  2C6C A;  4KSI A;  1XBU A;  2B5G A;  4L8A A;  4B6Z A;  4K30 A;  3TO7 A;  2C1C A;  3CDX A;  3FYN A;  1YME A;  2AFX A;  2WUU A;  3HLP A;  2Q43 A;  1LOK A;  3D7H A;  4CRZ B;  4JXR A;  2AFZ A;  4KUB A;  5JH9 A;  3C26 A;  5F09 A;  4DUK A;  4PK2 A;  4E0A A;  1I12 A;  3IWE A;  1S7F A;  2B4D A;  3KQX A;  2VI7 A;  3FX6 A;  4FD7 A;  2EUI A;  4QVT A;  4RI1 A;  3R9E A;  2ZW5 A;  1YQE A;  5LRK A;  3H4Q A;  3KGQ A;  4B12 A;  2ZEM A;  5KTC A;  2AFU A;  1FY7 A;  4NGN A;  1ZG7 A;  3FNC A;  4FD6 A;  2G9D A;  3G8W A;  1PCA A;  3A9L A;  3LD2 A;  4YRH A;  1QSN A;  4MHP A;  2G3T A;  3S6G A;  1TF8 A;  2B3U A;  3K2K A;  2IMO A;  2FCK A;  1CG2 A;  4E8O A;  2PJ8 A;  3MN8 A;  1ZO0 A;  4F8Z A;  1ELM P;  3DGV A;  1KUV A;  2JLM A;  3FVL A;  2PC1 A;  4C2X A;  4P4E A;  1CP6 A;  2FL4 A;  5KTA A;  5D29 A;  2BOA A;  3SXN A;  1FT7 A;  2PR1 A;  1VHS A;  3IJ3 A;  4R76 A;  4A94 A;  2NMT A;  2R98 A;  4H2K A;  2GE3 A;  2ARH A;  2QVP A;  4CAX A;  2YGW A;  5DS0 A;  4ZY0 A;  4QB9 A;  4LQG A;  3JTK A;  1XF8 A;  4KUA A;  1AMP A;  1YVK A;  4FWU A;  4J3G A;  3OWC A;  5I4M A;  4NCZ A;  2ZEP A;  4R57 A;  3WT4 A;  3TO6 A;  4NGQ A;  5HVG A;  4OKO A;  1Z9U A;  3S6H A;  2PVW A;  2F5I A;  1QMU A;  2JBJ A;  4M6I A;  2XEI A;  1Z4R A;  4U5Y A;  1L0C A;  1Q2C A;  1JQG A;  1PU9 A;  1QSR A;  3G3S A;  3RYO A;  4MHZ A;  2GLF A;  2Q4V A;  3JVN A;  2CTB A;  4NGS A;  4HNY B;  4ZI6 A;  5KTD A;  2HB6 A;  4JYW A;  3PB7 X;  3WR7 A;  4B5O A;  4CPA A;  3FEE A;  2PCU A;  2ZW6 A;  3D68 A;  4KLW A;  2CIJ A;  3T8W A;  3GYA A;  1Z8X A;  1ZLI A;  5A27 A;  3R9F A;  4C2Z A;  1XIX A;  1WWZ A;  2K5T A;  2CXA A;  3H8E A;  2D4P A;  3GKR A;  4ZX9 A;  2ZEN A;  2EVN A;  4U9Y A;  1HEE A;  1VHO A;  3PGP A;  3KHZ A;  2VEZ A;  3FH4 A;  3CXQ A;  2HC9 A;  4MFQ A;  3GB0 A;  1XMB A;  3PB6 X;  4P4F A;  1VGY A;  1QSM A;  4CAF A;  4XPK A;  1LFW A;  1BPM A;  2P0W A;  2VZY A;  3SJE A;  4MRI A;  1S3Z A;  2V8D A;  5J8C A;  1VHE A;  4HKF A;  1RTQ A;  4P4B A;  1S5K A;  3CXS A;  5IB0 A;  2GRE A;  4BIN A;  1CJW A;  2PRB A;  4H6Z A;  1YW4 A;  4FAI A;  4MFZ A;  3NE7 A;  1XOV A;  4JLY A;  1IB1 E;  3EO4 A;  1YR0 A;  2PRQ A;  1M4D A;  4CYP A;  3SI0 A;  4KOS A;  3MRU A;  2DF5 A;  2PVV A;  1F2O A;  1QST A;  1Y9W A;  2XEF A;  3W6S A;  5J1Q A;  2OZU A;  1ARM A;  2ZED A;  4UFV A;  3ISX A;  4P4I A;  2QJ8 A;  3B3V A;  1Y7R A;  3KZW A;  4UCN A;  2OZG A;  5BWA B;  4KVO E;  4FD4 A;  4R8F A;  2ZW4 A;  5FVJ A;  4BD9 A;  5LYF A;  1R43 A;  2REF A;  2REE A;  4OC3 A;  1GYT A;  4X2T A;  4MY3 A;  2BSW A;  4UBR A;  4A95 A;  4OAD A;  4R6T A;  1B87 A;  1YK3 A;  2YNC C;  5CBM A;  5JGF A;  5ELY A;  3SJG A;  3W6X A;  3I3G A;  4ZX8 A;  4L89 A;  4MCS A;  4OC0 A;  3FMC A;  4KVM E;  1MJB A;  2Z3N A;  3NFZ A;  4JXQ A;  5C88 A;  5A28 A;  1M4G A;  2BL1 A;  5AG6 A;  1RO5 A;  2PJB A;  1BLL E;  2VZZ A;  4ONU A;  5LYD A;  3TCV A;  1EE3 P;  2C6G A;  3PEI A;  3KI9 A;  4F0X A;  4MHD A;  2ABZ A;  3DDD A;  4CGL A;  3PFE A;  4R87 A;  4X8I A;  3QAH A;  2FSR A;  2DXQ A;  3R1K A;  4QUS A;  3I9S A;  3RNZ A;  5JM6 A;  3L2N A;  3KHX A;  2ZEE A;  1XMT A;  2H5M A;  2DEA A;  2VL1 A;  4P44 A;  3GIU A;  2WSA A;  2F8H A;  4PXC A;  1B6B A;  1LAN A;  1Z8T A;  2YND A;  5LRJ A;  3FF3 A;  1BOB A;  2FIW A;  2HQY A;  3SXO A;  3VAR A;  2Q04 A;  1YW6 A;  2Z3O A;  4CYQ A;  5JQ4 A;  2CY2 A;  1YVO A;  3D2P A;  5EMI A;  3CT9 A;  4UFX A;  2ATR A;  3GY9 A;  3ISZ A;  3RAM A;  4OIW A;  5JPH A;  4F9V A;  2C6P A;  2ZPA A;  2RC4 A;  3CZX A;  5DWN A;  1YSJ A;  4E2A A;  4YFJ A;  4MXU A;  1VKC A;  2JDC A;  2ZXV A;  4A37 A;  3DR8 A;  3P2H A;  4A39 A;  2V8V A;  4R7M A;  4UF4 A;  4HNW B;  4OID A;  4Q38 A;  2NYQ A;  4B10 A;  2YNC A;  5THW A;  2Z3L A;  2J8N A;  2ZEO A;  4KSA A;  1IYL A;  4GM5 A;  3BHX A;  3IC1 A;  4M6G A;  4YU9 A;  1Y0R A;  1I1D A;  3VAT A;  5GCN A;  2X7B A;  4IUS A;  2PE3 A;  4KOV A;  2BUE A;  3TTH A;  3LWU A;  4UFW A;  4CAV A;  4OAE A;  3B3S A;  1HDU A;  2OU2 A;  4LQ6 A;  1CPX A;  4LX9 A;  3K9T A;  2EK8 A;  3BXM A;  1BPN A;  5H84 A;  1V0C A;  2JBK A;  2CTC A;  1DE4 C;  3IU2 A;  4QC6 A;  2PDO A;  4R3L A;  1WK4 A;  2IQ6 A;  3LMS A;  4NEX A;  2FE7 A;  3KQZ A;  4UIA A;  2PJ3 A;  4A2Z A;  5AG4 A;  1TKJ A;  4M85 A;  5G1Z A;  3FBU A;  5K8P A;  5HH1 A;  1F57 A;  2PIY A;  5LYL A;  2ZEL A;  5EC4 A;  4FD5 A;  1VIX A;  2ODF A;  1TKF A;  3PB8 X;  5AGE A;  1MJ9 A;  3NH5 A;  4ZGY B;  4X3R A;  2R8V A;  3R96 A;  4UEZ A;  3WC7 A;  2Q51 A;  2AFM A;  1N71 A;  2Z11 A;  2O4H A;  4KVX A;  2FIA A;  1NSA A;  2I79 A;  4KLV A;  3SHP A;  2ZOF A;  4KOU A;  2HV2 A;  3FED A;  3S6F A;  1ARL A;  4IK2 A;  1AUG A;  3D3S A;  4NXY A;  2D4O A;  4B13 A;  1OZP A;  2AJ6 A;  3IWW A;  4ONW A;  4H89 A;  1NSL A;  3JUW A;  1ELL P;  5H86 A;  2Q4Y A;  3R9G A;  4NSQ A;  4P6Y A;  2I00 A;  2B58 A;  2PJA A;  4DYO A;  4OC5 A;  4C2Y A;  4ZY1 A;  4OME A;  1Q2Y A;  4UWJ A;  3TX8 A;  3B7I A;  4HNX B;  3RO0 A;  4M3S A;  1S7L A;  3FXT A;  1NMT A;  1XEB A;  3KKW A;  4AG7 A;  1LRZ A;  1IID A;  1GHE A;  4O23 A;  2KCW A;  3CXP A;  4OC1 A;  4PXD A;  3TT2 A;  5IV0 A;  3QAY A;  5CPA A;  2WYR A;  2C27 A;  5G22 A;  4A32 A;  4CGO A;  4CAE A;  6CPA A;  1PUA A;  1YLO A;  4JZ0 A;  3ZJ0 A;  1RXT A;  3IU1 A;  1TIQ A;  1UWY A;  2OZH A;  1YRE A;  1IU8 A;  3SJF A;  2PJ5 A;  2FXF A;  2O28 A;  4UCP A;  1XRY A;  2OOT A;  3SI1 A;  4BMH A;  2DPT A;  3F8K A;  4YWY A;  4YGO A;  4NFR A;  4KOY A;  4NGT A;  1BO4 A;  3D8P A;  2G3A A;  4AVA A;  4B5P B;  4EVY A;  2ZEG A;  3CPA A;  4WWV A;  1KWM A;  4ZBG A;  2Q7B A;  3BJ7 A;  3V38 A;  4ZYQ A;  4F0Y A;  1QQ9 A;  3V8I A;  4NGR A;  1Y0Y A;  3NA6 A;  5AG5 A;  3I1U A;  4P4D A;  4NF1 A;  5DWM A;  1CBX A;  4A30 A;  3T9Y A;  1QSO A;  2GAN A;  3KR4 A;  4UA3 A;  5HMN A;  1KZF A;  1KUY A;  4W9Y A;  2V77 A;  3B3W A;  4NJQ A;  2CNM A;  2QEC A;  2RB7 A;  3BLN A;  4PSW A;  4XPD C;  3PBB A;  3IO1 A;  4Q36 A;  1Z5R A;  4KOT A;  2VBQ A;  2WZN A;  3LAC A;  2OB0 A;  4A33 A;  1LCP A;  4UEE A;  4BBH A;  4OP4 A;  5F48 A;  3H8F A;  4MMO A;  4OC4 A;  5IX3 A;  1Q2D A;  1XFO A;  3KL9 A;  4R3K A;  2ZW7 A;  3IGR A;  3K9U A;  1R57 A;  2PJ7 A;  4A31 A;  4LUA A;  3RZA A;  4MFJ A;  1R3N A;  1AYE A;  3DLJ A;  3W91 A;  1Z8L A;  3TE4 A;  2VXK A;  3PB9 X;  4GXH A;  4IHM A;  4F9U A;  3D7D A;  4DNC A;  3IWG A;  2POK A;  3MGD A;  5K8N A;  1Q7L A;  2WPX A;  1Z4E A;  3TC8 A;  4PV6 A;  3B2Y A;  3BI1 A;  3H8G A;  3PFO A;  3S9N A;  3EC4 A;  2PJ9 A;  3D2M A;  5I0C A;  1S60 A;  1TXR A;  2EBJ A;  2YNE A;  2I3C A;  5D8N A;  5HVH A;  4KOR A;  2GLJ A;  5F47 A;  3WC5 A;  2AFS A;  4WJB A;  3RBU A;  2O53 A;  2ZEF A;  2VQY A;  4MFK A;  4ZY2 A;  1MK4 A;  1ZG9 A;  4X5K A;  1YX0 A;  3B3T A;  3TOB A;  3BJ8 A;  3E0K A;  3FJU A;  3PRT A;  2B5G B;  1X10 A;  3VWE A;  4PPZ A;  3S6K A;  4MCR A;  1J4J A;  2PJ1 A;  3DR6 A;  2AE6 A;  4PSX A;  1S7N A;  3V7Z A;  1M4I A;  2BO9 A;  1P0H A;  4I49 A;  2BEI A;  4XNH C;  4Y49 B;  1BAV A;  3EY5 A;  4Z65 A;  1PYT B;  2B4D B;  2WPW A;  1X12 A;  3DNS A;  1Y9K A;  2A4N A;  3IFE A;  3FB3 A;  2PJ2 A;  5F49 A;  4XPD B;  2QML A;  2QYV A;  5HXD A;  4OC2 A;  1XE4 A;  4C7I A;  2GU2 A;  3NE8 A;  4R9M A;  5EBV A;  3DSB A;  4PK3 A;  5LYI A;  2Z0Z A;  4TNU A;  5LRG A;  2QIR A;  2GIV A;  3LOD A;  1CM0 A;  3EFA A;  4Q7A A;  2EK9 A;  4C68 A;  4MI4 A;  4FUU A;  2JDD A;  5AG7 A;  2Z3P A;  3S9M A;  1I21 A;  3D67 A;  1M4L A;  2J9A A;  3D7G A;  2R1I A;  5ISV A;  1YGH A;  4P4J A;  3NH8 A;  2Z3M A;  2FVG A;  4HPS A;  8CPA A;  4UWI A;  2PSW A;  1SQH A;  2Z10 A;  4B11 A;  1HDQ A;  2PJ0 A;  1OBR A;  2Z3K A;  4TWE A;  2FT0 A;  4PQA A;  5C82 A;  2PIZ A;  2Q0Y A;  1IGB A;  1IIC A;  4NGM A;  3JRU A;  4JD6 A;  4CYN A;  4EWT A;  3N7Z A;  4P10 A;  1LAP A;  3T90 A;  3UY5 A;  4XPL A;  2GFQ A;  1CP7 A;  2JEV A;  4RS2 A;  1LAM A;  1TF9 A;  1Z2L A;  3FEC A;  4CGN A;  1KUX A;  2ZEH A;  4U9Z A;  4JWP A;  2DPS A;  2P6F A;  4CGP A;  4ORF A;  1M1D A;  1MJA A;  1ZLH A;  4H6U A;  4XNH B;  4AB7 A;  2PJ4 A;  2OR4 A;  1NE9 A;  1Z8W A;  2R7H A;  3B3C A;  2JEW A;  2OH1 A;  4KOX A;  4QBJ A;  3R95 A;  1K4J A;  2CNT A;  1ZG8 A;  3FIX A;  4IF5 A;  4FBE A;  4KS9 A;  2ZOG A;  4GS4 A;  4CAW A;  4CRY B;  4RUH A;  4MJ8 A;  3BI0 A;  2AFW A;  4OLL A;  4B14 A;  1UFH A;  4UCM A;  4DJL A;  1U6M A;  4JJX A;  3NH4 A;  3KAS A;  5K8O A;  1A2Z A;  1XJO A;  2B4B A;  2FS5 A;  4MY0 A;  5E96 A;  3SJX A;  3WC6 A;  3KR5 A;  2B3V A;  3F5B A;  3FRM A;  4EFD A;  3ZZI A;  4NJR A;  1M44 A;  3B8G A;  4MFL A;  3D7F A;  2NSM A;  4CGM A;  4B5P A;  2G0B A;  3TO9 A;  5F46 A;  5G21 A;  2PJ6 A;  4F6A A;  4KZT A;  1F2P A;  3HUV A;  4MHY A;  3TFY A;  5K8M A;  2CNS A;  7CPA A;  2Q44 A;  3PZJ A;  2IJZ A;  3WAB A;  3H5Z A;  1S7K A; 
#chains in the Genus database with same CATH homology
 3PB4 X;  3S9L A;  3PBE A;  4MCP A;  3D66 A;  1DTD A;  4MHN A;  4AXV A;  2RFH A;  4G1P A;  1H8L A;  2ANP A;  4MCQ A;  3D4U A;  3IIB A;  2PJC A;  4PXE A;  2BCO A;  3N5F A;  2CF4 A;  3GUX A;  5IB9 A;  2EWB A;  1IY7 A;  2AFO A;  3VH9 A;  2XEJ A;  4NGP A;  1Y7E A;  5HVF A;  4K3N A;  2Q4Z A;  3SI2 A;  3IEH A;  1FNO A;  3GLJ A;  2F7V A;  4UIB A;  4PXB A;  3CPX A;  3QNV A;  4A38 A;  1CPS A;  1CX8 A;  1TKH A;  4EME A;  3B35 A;  2V8H A;  4P45 A;  4IAV A;  2V8G A;  4UEF A;  2XEG A;  2C6C A;  4KSI A;  1XBU A;  4B6Z A;  2C1C A;  3CDX A;  1YME A;  2AFX A;  3HLP A;  2Q43 A;  1LOK A;  3D7H A;  2AFZ A;  5JH9 A;  5F09 A;  4DUK A;  3KQX A;  5LRK A;  3FX6 A;  3KGQ A;  2ZEM A;  2AFU A;  4NGN A;  1ZG7 A;  2G9D A;  1PCA A;  4MHP A;  1TF8 A;  3K2K A;  2IMO A;  1CG2 A;  2PJ8 A;  3MN8 A;  4F8Z A;  1ELM P;  3DGV A;  3FVL A;  4P4E A;  1CP6 A;  5D29 A;  2BOA A;  1FT7 A;  4R76 A;  3IJ3 A;  4A94 A;  4H2K A;  2QVP A;  5DS0 A;  4ZY0 A;  4LQG A;  1AMP A;  4FWU A;  5I4M A;  2ZEP A;  3WT4 A;  4NGQ A;  5HVG A;  4OKO A;  2PVW A;  2JBJ A;  1QMU A;  2XEI A;  1JQG A;  4MHZ A;  2GLF A;  2CTB A;  4NGS A;  4ZI6 A;  2HB6 A;  4JYW A;  3PB7 X;  4CPA A;  3FEE A;  2PCU A;  3D68 A;  2CIJ A;  3T8W A;  1ZLI A;  3H8E A;  4ZX9 A;  2ZEN A;  1HEE A;  1VHO A;  3KHZ A;  3FH4 A;  2HC9 A;  3GB0 A;  1XMB A;  3PB6 X;  4P4F A;  1VGY A;  1LFW A;  1BPM A;  3SJE A;  4MRI A;  2V8D A;  1VHE A;  1RTQ A;  4P4B A;  2GRE A;  1YW4 A;  4FAI A;  2PRQ A;  3SI0 A;  3MRU A;  2PVV A;  1F2O A;  2XEF A;  5J1Q A;  1ARM A;  2ZED A;  3ISX A;  4P4I A;  2QJ8 A;  3B3V A;  3KZW A;  4R8F A;  4BD9 A;  5LYF A;  1R43 A;  4OC3 A;  1GYT A;  4X2T A;  4R6T A;  5CBM A;  5JGF A;  5ELY A;  3SJG A;  4ZX8 A;  4MCS A;  4OC0 A;  3FMC A;  3NFZ A;  2PJB A;  1BLL E;  5LYD A;  1EE3 P;  2C6G A;  3PEI A;  3KI9 A;  2ABZ A;  3PFE A;  4X8I A;  5JM6 A;  3L2N A;  3KHX A;  2ZEE A;  4P44 A;  2DEA A;  2VL1 A;  2F8H A;  4PXC A;  1LAN A;  5LRJ A;  3FF3 A;  3VAR A;  1YW6 A;  3CT9 A;  3ISZ A;  3RAM A;  4OIW A;  4F9V A;  2C6P A;  1YSJ A;  4MXU A;  4A37 A;  4A39 A;  2V8V A;  4R7M A;  4UF4 A;  4OID A;  2NYQ A;  5THW A;  2ZEO A;  4GM5 A;  3BHX A;  3IC1 A;  4YU9 A;  1Y0R A;  3VAT A;  2PE3 A;  3LWU A;  3B3S A;  1HDU A;  1CPX A;  3K9T A;  2EK8 A;  3BXM A;  1BPN A;  2JBK A;  2CTC A;  1DE4 C;  2IQ6 A;  3LMS A;  3KQZ A;  4UIA A;  2PJ3 A;  1TKJ A;  5K8P A;  1F57 A;  2PIY A;  5LYL A;  2ZEL A;  1VIX A;  3PB8 X;  1TKF A;  3NH5 A;  4X3R A;  4UEZ A;  3WC7 A;  2Q51 A;  2AFM A;  2O4H A;  1NSA A;  2ZOF A;  3FED A;  1ARL A;  4IK2 A;  3IWW A;  4ONW A;  1ELL P;  4P6Y A;  4DYO A;  2PJA A;  4OC5 A;  4ZY1 A;  4OME A;  3TX8 A;  3B7I A;  4O23 A;  4OC1 A;  4PXD A;  5CPA A;  2WYR A;  6CPA A;  1YLO A;  4JZ0 A;  1UWY A;  3SJF A;  2PJ5 A;  1XRY A;  2OOT A;  3SI1 A;  4YWY A;  4NFR A;  4NGT A;  2ZEG A;  3CPA A;  4WWV A;  1KWM A;  4ZYQ A;  3V38 A;  1QQ9 A;  4NGR A;  1Y0Y A;  3NA6 A;  3I1U A;  4P4D A;  1CBX A;  3KR4 A;  4W9Y A;  2V77 A;  3B3W A;  4NJQ A;  2RB7 A;  3PBB A;  3IO1 A;  1Z5R A;  2WZN A;  1LCP A;  4UEE A;  4OP4 A;  3H8F A;  4MMO A;  4OC4 A;  1XFO A;  3KL9 A;  2PJ7 A;  3RZA A;  1R3N A;  1AYE A;  3DLJ A;  1Z8L A;  3PB9 X;  4IHM A;  4F9U A;  3D7D A;  2POK A;  5K8N A;  1Q7L A;  3TC8 A;  3B2Y A;  3BI1 A;  3H8G A;  3PFO A;  3S9N A;  2PJ9 A;  1TXR A;  5D8N A;  2I3C A;  5HVH A;  2GLJ A;  3WC5 A;  2AFS A;  4WJB A;  3RBU A;  2O53 A;  2ZEF A;  4ZY2 A;  1ZG9 A;  3B3T A;  3FJU A;  3PRT A;  4PPZ A;  4MCR A;  2PJ1 A;  3V7Z A;  2BO9 A;  1BAV A;  4Z65 A;  1PYT B;  3IFE A;  2PJ2 A;  5HXD A;  2QYV A;  4OC2 A;  2GU2 A;  5LYI A;  4TNU A;  5LRG A;  4Q7A A;  2EK9 A;  4FUU A;  3S9M A;  3D67 A;  1M4L A;  2J9A A;  3D7G A;  4P4J A;  3NH8 A;  2FVG A;  8CPA A;  1HDQ A;  2PJ0 A;  1OBR A;  4TWE A;  4PQA A;  2PIZ A;  1IGB A;  4NGM A;  3JRU A;  4EWT A;  4P10 A;  1LAP A;  1CP7 A;  1LAM A;  1TF9 A;  1Z2L A;  3FEC A;  2ZEH A;  1ZLH A;  2PJ4 A;  2OR4 A;  3B3C A;  2JEW A;  1ZG8 A;  4FBE A;  2ZOG A;  4RUH A;  3BI0 A;  2AFW A;  4DJL A;  3NH4 A;  3KAS A;  5K8O A;  1XJO A;  3SJX A;  3WC6 A;  3KR5 A;  4EFD A;  4NJR A;  3D7F A;  2NSM A;  2PJ6 A;  1F2P A;  3HUV A;  4MHY A;  5K8M A;  7CPA A;  2IJZ A;  3WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...