2P6EA

Crystal structures of saccharomyces cerevisiae n-myristoyltransferase with bound myristoyl-coa
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
451
structure length
442
Chain Sequence
DKAKKLENLLKLLQLNNDDTSKFDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 127
structure length 442
sequence length 451
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2007-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6eA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6eA02
1GHEA 2D4PA 2AJ6A 3BLNA 1YVOA 4NCZA 3I3GA 4HNYB 4KVOE 4M3SA 4XNHC 3PGPA 4R3KA 3ZJ0A 4H6ZA 1YX0A 1WK4A 3TFYA 2REFA 2PR1A 2I00A 4HNXB 2OH1A 4GS4A 1XE4A 4KOYA 2O28A 5F47A 5IX3A 4AVAA 4JJXA 5F49A 5EBVA 4KOTA 4R3LA 4KUAA 3LODA 3B8GA 3EO4A 5DWNA 2WPXA 4KOUA 3TCVA 1M1DA 2I79A 4L89A 5FVJA 3D8PA 3SXNA 4U9YA 4BMHA 3DNSA 4QC6A 3FBUA 2ARHA 3R9EA 2FIWA 4IF5A 4E8OA 4B5OA 2FT0A 2P6FA 3TTHA 3W91A 3D3SA 4E0AA 1PU9A 3EY5A 3NE7A 3S6GA 2JEVA 4FD6A 1XEBA 3GY9A 1QSRA 1M4DA 5JPHA 5GCNA 1Z4RA 3F5BA 1MJAA 1M4GA 1S7NA 5CNPA 3D2PA 5H86A 2HQYA 4OADA 1CJWA 1VHSA 4YFJA 4KOSA 1I21A 2ZW6A 2PC1A 3TOBA 4MY3A 3OWCA 4QBJA 5KTDA 4EVYA 2B4DA 4CAXA 2BUEA 4NSQA 1YVKA 2B3UA 3CXQA 2R7HA 2B58A 2ZXVA 1XF8A 3PZJA 3BJ7A 4XPDC 4HNWB 2ZPAA 3JVNA 4UBRA 3D2MA 3FRMA 3DSBA 4J3GA 3TO6A 1LRZA 2R98A 4OAEA 3PP9A 4KVXA 4L8AA 2B3VA 3FB3A 4I49A 2FL4A 3VWEA 4LX9A 4R57A 3CXSA 2P6EA 4YRHA 1P4NA 5C82A 1RO5A 1KZFA 2VZZA 1IB1E 1Y9KA 1KUVA 3EFAA 4Y49C 3DR6A 2K5TA 1I12A 3K9UA 4KLVA 1B6BA 4H89A 1S7LA 4F0YA 2PRBA 4FD5A 3I9SA 2PDOA 4KOVA 4ORFA 2OZUA 2VEZA 2B4BA 4JLYA 3TT2A 3S6KA 1M4IA 4AVCA 2P0WA 4MBUA 2Z11A 5J8FA 1Q2CA 3P2FA 4E2AA 3CXPA 2JLMA 3MGDA 5I0CA 3FYNA 3TO7A 2PSWA 4LUAA 5HMNA 2G3AA 5J8CA 4R87A 3TE4A 4CS0B 4KZTA 3GYAA 2Y0MA 1S7KA 3ZZIA 2HUZA 2D4OA 2G0BA 4QB9A 2J8NA 3W6SA 2J8MA 2OZGA 2ZW5A 2JDDA 4II9A 1FY7A 2A4NA 1Y7RA 2DXQA 2J8RA 2R1IA 5KTAA 2C27A 2VXKA 4XPLA 1KUYA 2FE7A 3WR7A 4UWIA 3SXOA 3TO9A 2ZW7A 4PSWA 2IL4A 1MJBA 1YGHA 1Q2YA 1Q2DA 2F5IA 4NF1A 2REEA 4KOXA 1SQHA 1UFHA 3S6HA 2NMTA 3QB8A 1OZPA 1YLEA 4KOWA 4CAWA 2QECA 2CNSA 3R9GA 4F6AA 4PSXA 1YK3A 4IUSA 1V0CA 1N71A 2EVNA 4OLLA 1IICA 2CNMA 5ISVA 4DNCA 4PK2A 1XMTA 4KLWA 4ONUA 2Z0ZA 4AG7A 1CM0A 1XIXA 2QMLA 2KCWA 4KORA 1BO4A 5EC4A 3FIXA 2QIRA 2GANA 4HKFA 4KVME 3FXTA 1NSLA 5IB0A 1ON0A 5IV0A 4R9MA 2P6GA 1KUXA 5JQ4A 2FSRA 2Q44A 4M85A 5HH1A 4XNHB 1IIDA 4X5KA 4U5YA 1IYKA 4JD6A 2EUIA 2FCKA 4FD7A 4MI4A 5KTCA 5F48A 1K4JA 1P0HA 4H6UA 2ZW4A 2CNTA 3G3SA 4B5PA 3DDDA 3EC4A 2GIVA 5DWMA 5H84A 3BJ8A 1M44A 3E0KA 3QAHA 4U9ZA 3T9YA 3P2HA 1BOBA 1S7FA 4MJ8A 1VKCA 1NE9A 3C26A 1TIQA 4MHDA 2BEIA 1QSOA 1MK4A 4AG9A 4AB7A 5F46A 3IWGA 2JDCA 2X7BA 3SHPA 3KKWA 1MJ9A 2R8VA 2VBQA 4NXYA 4CRZB 1J4JA 3R1KA 1RXTA 4CAVA 5C88A 5E96A 3R95A 2CY2A 1QSNA 4CRYB 2B4DB 2RC4A 1S3ZA 4UA3A 1I1DA 3R9FA 3FNCA 3UY5A 4KUBA 2OB0A 4MY0A 2FIAA 2B5GA 2AE6A 1IYLA 4AVBA 3JUWA 2OU2A 1PUAA 2G3TA 1S60A 4JXRA 3EXNA 3R96A 4QVTA 1L0CA 1B87A 3G8WA 4JXQA 2BSWA 1NMTA 2WPWA 4K30A 4PV6A 1R57A 3F0AA 4FD4A 4RI1A 2Q04A 3V8IA 1YR0A 3N7ZA 3TOAA 2Q4YA 4XPDB 4B5PB 3IGRA 3RYOA 2VZYA 1QSTA 4XPKA 3F8KA 1QSMA 2Q7BA 3VWDA 1U6MA 4RS2A 4ZBGA 4JWPA 1Y9WA 4NEXA 2PR8A 2Z10A 2ATRA 4QUSA 4UWJA 4Y49B 2BL1A 2FS5A 2PQ8A 2VQYA 2OZHA 4YGOA 3LD2A 1YREA 3DR8A 2H5MA 1WWZA 1S5KA 2Q4VA 3T90A 2GE3A 3H4QA 1Z4EA 1Z9UA 3W6XA 2FXFA 2HV2A 3GKRA 3S6FA 2B5GB 4PK3A 2VI7A 2Q0YA
chains in the Genus database with same CATH superfamily
3FEDA 3LMSA 1GHEA 3CPAA 3D7HA 4A38A 2D4PA 4IHMA 1AYEA 2AJ6A 3MRUA 3BLNA 4PQAA 1YVOA 3HLPA 3KZWA 2GU2A 3B3SA 3I3GA 4MFJA 4HNYB 4NCZA 4JYWA 4CPAA 2ZEEA 3NH4A 4KVOE 4M3SA 4XNHC 3TX8A 3VARA 5HVGA 3PGPA 4P45A 1Y0RA 4R3KA 3WT4A 2BO9A 3FECA 4Q38A 2ZOGA 3ZJ0A 4H6ZA 8CPAA 2O4HA 2Q43A 1YX0A 1TKHA 1WK4A 3TFYA 2REFA 1X10A 1XFOA 4NJQA 2PJ1A 3DGVA 1YW6A 2YNCA 2PR1A 2I00A 4HNXB 2OH1A 2PJ7A 4GS4A 4GM5A 1XE4A 5G1ZA 1OBRA 3PFOA 2ABZA 4MFQA 4KOYA 4FWUA 2PJ6A 2O28A 5D29A 5F47A 5IX3A 4OC0A 2AFMA 4A30A 4AVAA 3IU2A 5D8NA 3QAYA 4JJXA 4CYOA 2ZEPA 1HDQA 5F49A 4ZY2A 4BBHA 5EBVA 1EE3P 4KOTA 2V8VA 4KUAA 4R3LA 3LODA 1X12A 2CTCA 3B8GA 3EO4A 1Y0YA 3IWEA 4WWVA 5DWNA 4CGOA 1IY7A 2WPXA 3FJUA 3LACA 4K3NA 4KOUA 1GYTA 2ZEGA 4HPSA 4B11A 3NE8A 4G1PA 3TCVA 1M1DA 3SJGA 3PB9X 2I79A 4L89A 3ZZIA 4C68A 1XOVA 4OMEA 4PPZA 5FVJA 5BWAB 4F0XA 1Z2LA 4YU9A 3D8PA 3CPXA 3SXNA 4C2ZA 1BLLE 2PIZA 4U9YA 4X2TA 4BMHA 3DNSA 4X8IA 1IGBA 5LRKA 4UF4A 5IB9A 4QC6A 3FBUA 2ARHA 5AGEA 1TKFA 1VHOA 3PB6X 5EMIA 3R9EA 2FIWA 4DYOA 3S9MA 1ZG7A 2AFUA 5AG7A 1ELLP 4NGTA 4LQ6A 4IF5A 4P4JA 4E8OA 4B13A 4B5OA 2FT0A 2P6FA 3K9TA 3TTHA 3PB8X 3W91A 3D3SA 3D67A 4B14A 4C7IA 4E0AA 2V8GA 1PU9A 3NFZA 3FMCA 1FNOA 1XMBA 4W9YA 2PRQA 1TXRA 3GUXA 4CGNA 4ZI6A 2C1CA 2PJAA 3EY5A 3BXMA 3NE7A 2V8HA 2JEVA 4OC2A 1XEBA 3GY9A 4FD6A 1QSRA 1M4DA 3S6GA 2WZNA 5GCNA 5JPHA 1ARLA 1Z4RA 3F5BA 4GXHA 2YNDA 1MJAA 2CF4A 2ZOFA 1M4GA 1NSAA 1S7NA 5CNPA 1LAPA 1Z8XA 3D2PA 5H86A 2HQYA 2YGWA 4OADA 4ZYQA 1CJWA 1VHSA 4YFJA 3D66A 4KOSA 1I21A 2ZW6A 2PC1A 3B3VA 2PJBA 2HC9A 4PXEA 3TOBA 4MY3A 1LCPA 5G21A 3OWCA 1IOFA 4QBJA 5KTDA 1CG2A 4ZY1A 4MFKA 4EVYA 2B4DA 1TF9A 4CAXA 2QJ8A 2QVPA 2BUEA 4NSQA 4C7HA 1YVKA 2B3UA 2IJZA 2JBJA 3CXQA 2CIJA 2B58A 2R7HA 2ZXVA 4RUHA 3D7DA 4FBEA 1XF8A 2EWBA 1RTQA 2Z3MA 3BJ7A 3PZJA 4HNWB 4XPDC 3PFEA 3QNVA 3WABA 2ZPAA 3BI0A 3JVNA 3KQXA 3D2MA 3FRMA 3DSBA 4J3GA 4UBRA 3TO6A 4NGNA 1LRZA 2R98A 3B3CA 2XEFA 4OAEA 4CGPA 3PP9A 2EO8A 4KVXA 2BOAA 4L8AA 3VATA 2B3VA 3SI2A 3PB7X 1Z8TA 3FB3A 4I49A 1BPNA 2FL4A 3VWEA 2EBJA 4LX9A 4R57A 3CXSA 2P6EA 4YRHA 3A9LA 1P4NA 5C82A 2DEAA 1YMEA 1RO5A 4NGMA 1KZFA 2EK8A 2VZZA 2Z3NA 3LWUA 2PCUA 1IB1E 1KUVA 1Y9KA 3H8FA 3D7FA 2PIYA 4TNUA 5ELYA 3EFAA 4MXUA 4Y49C 3RZAA 3DR6A 1ZLIA 2K5TA 2NYQA 1I12A 3K9UA 4KLVA 2ZENA 1B6BA 4A2ZA 3WC7A 3V38A 4PXBA 5LYDA 4F9VA 2AFOA 1S7LA 4H89A 4F0YA 2PRBA 4O23A 4FD5A 2RFHA 3I9SA 2PDOA 4MHNA 5AG5A 4OC4A 4KOVA 1YW4A 4ORFA 2CXAA 2OZUA 3SI1A 1DE4C 2PJ5A 2VEZA 4ZX8A 4MRIA 2B4BA 4JLYA 3TT2A 2GLJA 2PVVA 4KSIA 3S6KA 2V8DA 1M4IA 4CYNA 4AVCA 2P0WA 4MBUA 2Z11A 2DPTA 1Q2CA 3IC1A 5J8FA 2F8HA 3P2FA 4E2AA 1ARMA 4CAEA 2F7VA 3CXPA 2JLMA 2PVWA 2O53A 3MGDA 2Q7SA 4Q36A 3WC5A 4UCNA 3KGQA 1YLOA 4F9UA 1ZG9A 5I0CA 1H8LA 4UFWA 2PJ9A 3S9NA 3FYNA 1BAVA 3TO7A 2PSWA 1Z8LA 4LUAA 4NGRA 5A28A 5HMNA 2G3AA 2PJ8A 4MHZA 1VGYA 4DJLA 3D68A 5J8CA 2ODFA 5HXDA 3ISXA 3GIUA 4R87A 3TE4A 4IK2A 4CS0B 1CBXA 3ISZA 3WC6A 4KZTA 3FF3A 3GYAA 1S7KA 2Y0MA 1Q7LA 2WYRA 2HUZA 2G0BA 1CP6A 1R3NA 2D4OA 4MCQA 4P4BA 4KSAA 4QB9A 4CGLA 2J8NA 5AG4A 4NGQA 5K8NA 3W6SA 2J8MA 2AFZA 4UEFA 2OZGA 2ZW5A 2JDDA 4II9A 4JZ0A 1FY7A 2A4NA 1Y7RA 2DXQA 2ZEFA 4A31A 4UIAA 2J8RA 3IEHA 2R1IA 5KTAA 2C27A 2VXKA 4XPLA 1KUYA 2FE7A 3WR7A 2CTBA 4UWIA 4EWTA 4WJBA 3SXOA 3TO9A 5THWA 2ZW7A 4PSWA 2IL4A 4NGSA 1LOKA 1MJBA 3NA6A 5K8MA 4KSFA 4DUKA 1Z8WA 1LAMA 1LFWA 1YGHA 1JWQA 4H2KA 2C6PA 4NFRA 2DF5A 1Q2YA 3L2NA 1Q2DA 2F5IA 3KHXA 4MCSA 4NF1A 1AUGA 2REEA 4KOXA 3SJXA 1SQHA 1CP7A 1IOIA 1UFHA 3S6HA 4R8FA 2NMTA 4UEZA 3QB8A 1OZPA 1IU8A 1F2PA 1YLEA 2I3CA 3I1UA 4KOWA 2GFQA 4CAWA 5F09A 1FT7A 2QECA 2RB7A 2CNSA 3R9GA 2OR4A 4RN7A 4C2XA 4PSXA 4OIWA 4P4DA 1YK3A 4IUSA 1V0CA 4F6AA 1N71A 2EVNA 4OLLA 5LRJA 1IICA 4M6HA 4A32A 1ZO0A 2CNMA 2QYVA 3RO0A 5ISVA 4OC3A 4OC5A 4DNCA 4PK2A 3H5ZA 1XMTA 4KLWA 4ONUA 2Z0ZA 3FH4A 3IFEA 2Z3OA 4Q7AA 3BHXA 2AFXA 2ZELA 4AG7A 1CM0A 1XIXA 2QMLA 4R76A 4TWEA 2KCWA 4KORA 1BO4A 5EC4A 3FIXA 2QIRA 5DS0A 7CPAA 2GANA 4HKFA 4KVME 1BPMA 3RAMA 5JGFA 1YQEA 4OP4A 3SI0A 3FXTA 1NSLA 5IB0A 1ON0A 5IV0A 4R9MA 2NSMA 3T8WA 5LYLA 1A2ZA 1KUXA 2P6GA 2VL1A 3PRTA 5JQ4A 2FSRA 5HVFA 4CYPA 2Q44A 4M85A 4KS9A 1VHEA 1F57A 2Q51A 4XNHB 2GLFA 1IIDA 2EK9A 5HH1A 3IJ3A 1VIXA 2G9DA 3KASA 4X5KA 3V7ZA 4U5YA 4A39A 6CPAA 4P6YA 3CDXA 1IYKA 2Z3PA 4JD6A 2EUIA 2FCKA 4FD7A 2PE3A 3JTKA 4MI4A 1R43A 5KTCA 3GLJA 4P10A 4UCPA 3KHZA 4EFDA 2YNCC 1QQ9A 4UIBA 5F48A 1K4JA 1P0HA 4H6UA 4CAFA 2ZW4A 2CNTA 3G3SA 4B5PA 3DDDA 3EC4A 2GIVA 2WUUA 5DWMA 3BJ8A 1M44A 3FX6A 3KR5A 5H84A 4BINA 4F8ZA 3E0KA 3QAHA 4U9ZA 3T9YA 4MHYA 3P2HA 3KL9A 1BOBA 1S7FA 4MJ8A 1VKCA 1NE9A 4P4FA 3C26A 1TIQA 4MHDA 2BEIA 4P4IA 4B10A 1QSOA 3BI1A 4OIDA 1MK4A 2PJ4A 4NJRA 3B3WA 4AG9A 1CX8A 4AB7A 1F2OA 1TF8A 3H8EA 3JRUA 4C2YA 3KI9A 5K8PA 5F46A 3IWGA 4P4EA 5LYIA 2JDCA 2X7BA 3SHPA 2ZEHA 2R8VA 1MJ9A 2VBQA 3KKWA 4NXYA 2XEGA 4CRZB 2HB6A 2C6CA 3FVLA 1J4JA 2ZEOA 1UWYA 1Y7EA 3PEIA 3R1KA 1TKJA 3B35A 1PCAA 3N5FA 2PJ0A 1QMUA 2Z3LA 3B2YA 1RXTA 3B3TA 4CAVA 5C88A 5HVHA 5E96A 3R95A 3HUVA 4PXDA 4A94A 2CY2A 1QSNA 2GREA 2JEWA 4CRYB 2Q4ZA 4R7MA 2B4DB 4A33A 4X3RA 3RBUA 2ANPA 5JH9A 2RC4A 4YWYA 5LYFA 3KQZA 1S3ZA 3FEEA 4NGPA 4UA3A 3MN8A 1I1DA 2PJ2A 3R9FA 4AXVA 4MFZA 5G20A 2ZEDA 2WSAA 3FNCA 4UFXA 3UY5A 5J1QA 4KUBA 4BD9A 2OB0A 4MY0A 4ZX9A 3RNZA 1KWMA 2FIAA 2B5GA 3IWWA 4FUUA 2AE6A 3PBEA 1YSJA 1IYLA 4AVBA 3JUWA 3B7IA 4ZY0A 1Z5RA 2OU2A 1PUAA 2G3TA 1S60A 2ZEMA 4JXRA 3EXNA 4B6ZA 4MCPA 4ONWA 2YNEA 3R96A 4MMOA 4QVTA 4CYQA 1L0CA 1B87A 3G8WA 4JXQA 2V77A 2BSWA 5K8OA 3VH9A 1ZLHA 1XJOA 5CBMA 1NMTA 2WPWA 4K30A 3CZXA 4PV6A 1R57A 4UEEA 3F0AA 4A95A 4FD4A 1HDUA 4RI1A 2Q04A 3V8IA 1YR0A 2Z3KA 4P44A 1HEEA 4M6GA 3N7ZA 3TOAA 2Q4YA 4XPDB 2PJ3A 4PXCA 4B5PB 3IGRA 1ELMP 4OC1A 4B12A 3RYOA 1JQGA 4MCRA 1ZG8A 4MHPA 4MFPA 4A37A 2J9AA 1DTDA 2VZYA 1QSTA 3PBBA 2DPSA 4XPKA 1LANA 5A27A 3S9LA 3NH5A 4R6TA 2PJCA 3F8KA 2JBKA 1QSMA 3D7GA 4UFVA 2Q7BA 3VWDA 3DLJA 1U6MA 4RS2A 4ZBGA 4JWPA 1Y9WA 3H8GA 4NEXA 3K2KA 4UCMA 2PR8A 3SJEA 3KR4A 2Z10A 4IAVA 2ATRA 3TC8A 2AFWA 4QUSA 4UWJA 4M6IA 4Y49B 2BL1A 3PB4X 1M4LA 1XBUA 2FS5A 2IMOA 3SJFA 2PQ8A 2FVGA 2VQYA 4CGMA 4FAIA 4ZGYB 2OZHA 3CT9A 4YGOA 3LD2A 3IO1A 1YREA 3DR8A 5CPAA 5G22A 5AG6A 3D4UA 2OOTA 4Z65A 2C6GA 2XEIA 2IQ6A 1AMPA 2H5MA 1WWZA 3NH8A 1CPSA 2AFSA 2BCOA 1XRYA 1S5KA 2Q4VA 4MFLA 3T90A 2GE3A 3IIBA 1CPXA 3H4QA 2POKA 4LQGA 1Z4EA 1Z9UA 5LRGA 3W6XA 2FXFA 2HV2A 2XEJA 3GB0A 5I4MA 3GKRA 4EMEA 3S6FA 5JM6A 2B5GB 4OKOA 4PK3A 2VI7A 2Q0YA 3IU1A 1PYTB
chains in the Genus database with same CATH topology
1GHEA 2D4PA 2AJ6A 3BLNA 1YVOA 4MFJA 4NCZA 3I3GA 4HNYB 4KVOE 4M3SA 4XNHC 3PGPA 4R3KA 4Q38A 3ZJ0A 4H6ZA 1YX0A 1WK4A 3TFYA 2REFA 2YNCA 2PR1A 2I00A 4HNXB 2OH1A 4GS4A 1XE4A 5G1ZA 4MFQA 4KOYA 2O28A 5F47A 5IX3A 4A30A 4AVAA 3IU2A 4JJXA 4CYOA 5F49A 4BBHA 5EBVA 4KOTA 4R3LA 4KUAA 3LODA 3B8GA 3EO4A 3IWEA 5DWNA 4CGOA 2WPXA 4KOUA 4B11A 3TCVA 1M1DA 2I79A 4L89A 4C68A 5FVJA 5BWAB 4F0XA 3D8PA 3SXNA 4C2ZA 4U9YA 4BMHA 3DNSA 4QC6A 3FBUA 2ARHA 5AGEA 3R9EA 2FIWA 5AG7A 4IF5A 4E8OA 4B13A 4B5OA 2FT0A 2P6FA 3TTHA 4C7IA 3W91A 3D3SA 4B14A 4E0AA 1PU9A 4CGNA 3EY5A 3NE7A 3S6GA 2JEVA 4FD6A 1XEBA 3GY9A 1QSRA 1M4DA 5JPHA 5GCNA 1Z4RA 3F5BA 2YNDA 1MJAA 1M4GA 1S7NA 5CNPA 3D2PA 5H86A 2HQYA 2YGWA 4OADA 1CJWA 1VHSA 4YFJA 4KOSA 1I21A 2ZW6A 2PC1A 3TOBA 4MY3A 5G21A 3OWCA 4QBJA 5KTDA 4MFKA 4EVYA 2B4DA 4CAXA 2BUEA 4NSQA 4C7HA 1YVKA 2B3UA 3CXQA 2R7HA 2B58A 2ZXVA 1XF8A 2Z3MA 3PZJA 3BJ7A 4XPDC 4HNWB 2ZPAA 3JVNA 4UBRA 3D2MA 3FRMA 3DSBA 4J3GA 3TO6A 1LRZA 2R98A 4CGPA 4OAEA 3PP9A 4KVXA 4L8AA 2B3VA 3FB3A 4I49A 2FL4A 3VWEA 4LX9A 4R57A 3CXSA 2P6EA 4YRHA 3A9LA 1P4NA 5C82A 1RO5A 1KZFA 2VZZA 2Z3NA 1IB1E 1Y9KA 1KUVA 3EFAA 4Y49C 3DR6A 2K5TA 1I12A 3K9UA 4KLVA 1B6BA 4A2ZA 4H89A 1S7LA 4F0YA 2PRBA 4FD5A 3I9SA 5AG5A 2PDOA 4KOVA 4ORFA 2CXAA 2OZUA 2VEZA 2B4BA 4JLYA 3TT2A 3S6KA 1M4IA 4CYNA 4AVCA 2P0WA 4MBUA 2Z11A 2DPTA 1Q2CA 5J8FA 3P2FA 4E2AA 4CAEA 3CXPA 4Q36A 2JLMA 3MGDA 4UCNA 5I0CA 4UFWA 3FYNA 3TO7A 2PSWA 4LUAA 5HMNA 5A28A 2G3AA 5J8CA 4R87A 3TE4A 4CS0B 4KZTA 3GYAA 2Y0MA 1S7KA 3ZZIA 2HUZA 2D4OA 2G0BA 4CGLA 5AG4A 4KSAA 4QB9A 2J8NA 3W6SA 2J8MA 2OZGA 2ZW5A 2JDDA 4II9A 1FY7A 2A4NA 1Y7RA 2DXQA 4A31A 2J8RA 2R1IA 5KTAA 2C27A 2VXKA 4XPLA 1KUYA 2FE7A 3WR7A 4UWIA 3SXOA 3TO9A 2ZW7A 4PSWA 2IL4A 1MJBA 4KSFA 1YGHA 1Q2YA 1Q2DA 2F5IA 4NF1A 2REEA 4KOXA 1SQHA 1UFHA 3S6HA 2NMTA 3QB8A 1OZPA 1YLEA 4KOWA 4CAWA 2QECA 2CNSA 3R9GA 4C2XA 4F6AA 4PSXA 1YK3A 4IUSA 1V0CA 1N71A 2EVNA 4OLLA 1IICA 4A32A 1ZO0A 2CNMA 5ISVA 4DNCA 4PK2A 3H5ZA 1XMTA 4KLWA 4ONUA 2Z0ZA 2Z3OA 4AG7A 1CM0A 1XIXA 2QMLA 2KCWA 4KORA 1BO4A 5EC4A 3FIXA 2QIRA 2GANA 4HKFA 4KVME 3FXTA 1NSLA 5IB0A 1ON0A 5IV0A 4R9MA 2P6GA 1KUXA 5JQ4A 2FSRA 4CYPA 2Q44A 4M85A 4KS9A 5HH1A 4XNHB 1IIDA 4X5KA 4U5YA 1IYKA 2Z3PA 4JD6A 2EUIA 2FCKA 4FD7A 3JTKA 4MI4A 5KTCA 4UCPA 2YNCC 5F48A 1K4JA 1P0HA 4H6UA 4CAFA 2ZW4A 2CNTA 3G3SA 4B5PA 3DDDA 3EC4A 2GIVA 2WUUA 5DWMA 3BJ8A 1M44A 5H84A 3E0KA 3QAHA 4U9ZA 3T9YA 3P2HA 1BOBA 1S7FA 4MJ8A 1VKCA 1NE9A 3C26A 1TIQA 4MHDA 2BEIA 4B10A 1QSOA 1MK4A 4AG9A 4AB7A 4C2YA 5F46A 3IWGA 2JDCA 2X7BA 3SHPA 3KKWA 1MJ9A 2R8VA 2VBQA 4NXYA 4CRZB 1J4JA 3R1KA 2Z3LA 1RXTA 4CAVA 5C88A 5E96A 3R95A 2CY2A 1QSNA 4CRYB 2B4DB 4A33A 2RC4A 1S3ZA 4UA3A 1I1DA 3R9FA 4MFZA 5G20A 2WSAA 3FNCA 4UFXA 3UY5A 4KUBA 2OB0A 4MY0A 2FIAA 2B5GA 2AE6A 1IYLA 4AVBA 3JUWA 2OU2A 1PUAA 2G3TA 1S60A 4JXRA 3EXNA 2YNEA 3R96A 4QVTA 4CYQA 1L0CA 1B87A 3G8WA 4JXQA 2BSWA 1NMTA 2WPWA 4K30A 4PV6A 1R57A 3F0AA 4A95A 4FD4A 4RI1A 2Q04A 3V8IA 1YR0A 2Z3KA 3N7ZA 3TOAA 2Q4YA 4XPDB 4B5PB 3IGRA 4B12A 3RYOA 4MFPA 2VZYA 1QSTA 2DPSA 4XPKA 5A27A 3F8KA 1QSMA 2Q7BA 4UFVA 3VWDA 1U6MA 4RS2A 4ZBGA 4JWPA 1Y9WA 4NEXA 4UCMA 2PR8A 2Z10A 2ATRA 4QUSA 4UWJA 4Y49B 2BL1A 2FS5A 2PQ8A 2VQYA 4CGMA 4ZGYB 2OZHA 4YGOA 3LD2A 1YREA 3DR8A 5G22A 5AG6A 2H5MA 1WWZA 1S5KA 2Q4VA 4MFLA 3T90A 2GE3A 3H4QA 1Z4EA 1Z9UA 3W6XA 2FXFA 2HV2A 3GKRA 3S6FA 2B5GB 4PK3A 2VI7A 2Q0YA 3IU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHE A;  2D4P A;  2AJ6 A;  3BLN A;  1YVO A;  4NCZ A;  3I3G A;  4HNY B;  4KVO E;  4M3S A;  4XNH C;  3PGP A;  4R3K A;  3ZJ0 A;  4H6Z A;  1YX0 A;  1WK4 A;  3TFY A;  2REF A;  2PR1 A;  2I00 A;  4HNX B;  2OH1 A;  4GS4 A;  1XE4 A;  4KOY A;  2O28 A;  5F47 A;  5IX3 A;  4AVA A;  4JJX A;  5F49 A;  5EBV A;  4KOT A;  4R3L A;  4KUA A;  3LOD A;  3B8G A;  3EO4 A;  5DWN A;  2WPX A;  4KOU A;  3TCV A;  1M1D A;  2I79 A;  4L89 A;  5FVJ A;  3D8P A;  3SXN A;  4U9Y A;  4BMH A;  3DNS A;  4QC6 A;  3FBU A;  2ARH A;  3R9E A;  2FIW A;  4IF5 A;  4E8O A;  4B5O A;  2FT0 A;  2P6F A;  3TTH A;  3W91 A;  3D3S A;  4E0A A;  1PU9 A;  3EY5 A;  3NE7 A;  3S6G A;  2JEV A;  4FD6 A;  1XEB A;  3GY9 A;  1QSR A;  1M4D A;  5JPH A;  5GCN A;  1Z4R A;  3F5B A;  1MJA A;  1M4G A;  1S7N A;  5CNP A;  3D2P A;  5H86 A;  2HQY A;  4OAD A;  1CJW A;  1VHS A;  4YFJ A;  4KOS A;  1I21 A;  2ZW6 A;  2PC1 A;  3TOB A;  4MY3 A;  3OWC A;  4QBJ A;  5KTD A;  4EVY A;  2B4D A;  4CAX A;  2BUE A;  4NSQ A;  1YVK A;  2B3U A;  3CXQ A;  2R7H A;  2B58 A;  2ZXV A;  1XF8 A;  3PZJ A;  3BJ7 A;  4XPD C;  4HNW B;  2ZPA A;  3JVN A;  4UBR A;  3D2M A;  3FRM A;  3DSB A;  4J3G A;  3TO6 A;  1LRZ A;  2R98 A;  4OAE A;  3PP9 A;  4KVX A;  4L8A A;  2B3V A;  3FB3 A;  4I49 A;  2FL4 A;  3VWE A;  4LX9 A;  4R57 A;  3CXS A;  2P6E A;  4YRH A;  1P4N A;  5C82 A;  1RO5 A;  1KZF A;  2VZZ A;  1IB1 E;  1Y9K A;  1KUV A;  3EFA A;  4Y49 C;  3DR6 A;  2K5T A;  1I12 A;  3K9U A;  4KLV A;  1B6B A;  4H89 A;  1S7L A;  4F0Y A;  2PRB A;  4FD5 A;  3I9S A;  2PDO A;  4KOV A;  4ORF A;  2OZU A;  2VEZ A;  2B4B A;  4JLY A;  3TT2 A;  3S6K A;  1M4I A;  4AVC A;  2P0W A;  4MBU A;  2Z11 A;  5J8F A;  1Q2C A;  3P2F A;  4E2A A;  3CXP A;  2JLM A;  3MGD A;  5I0C A;  3FYN A;  3TO7 A;  2PSW A;  4LUA A;  5HMN A;  2G3A A;  5J8C A;  4R87 A;  3TE4 A;  4CS0 B;  4KZT A;  3GYA A;  2Y0M A;  1S7K A;  3ZZI A;  2HUZ A;  2D4O A;  2G0B A;  4QB9 A;  2J8N A;  3W6S A;  2J8M A;  2OZG A;  2ZW5 A;  2JDD A;  4II9 A;  1FY7 A;  2A4N A;  1Y7R A;  2DXQ A;  2J8R A;  2R1I A;  5KTA A;  2C27 A;  2VXK A;  4XPL A;  1KUY A;  2FE7 A;  3WR7 A;  4UWI A;  3SXO A;  3TO9 A;  2ZW7 A;  4PSW A;  2IL4 A;  1MJB A;  1YGH A;  1Q2Y A;  1Q2D A;  2F5I A;  4NF1 A;  2REE A;  4KOX A;  1SQH A;  1UFH A;  3S6H A;  2NMT A;  3QB8 A;  1OZP A;  1YLE A;  4KOW A;  4CAW A;  2QEC A;  2CNS A;  3R9G A;  4F6A A;  4PSX A;  1YK3 A;  4IUS A;  1V0C A;  1N71 A;  2EVN A;  4OLL A;  1IIC A;  2CNM A;  5ISV A;  4DNC A;  4PK2 A;  1XMT A;  4KLW A;  4ONU A;  2Z0Z A;  4AG7 A;  1CM0 A;  1XIX A;  2QML A;  2KCW A;  4KOR A;  1BO4 A;  5EC4 A;  3FIX A;  2QIR A;  2GAN A;  4HKF A;  4KVM E;  3FXT A;  1NSL A;  5IB0 A;  1ON0 A;  5IV0 A;  4R9M A;  2P6G A;  1KUX A;  5JQ4 A;  2FSR A;  2Q44 A;  4M85 A;  5HH1 A;  4XNH B;  1IID A;  4X5K A;  4U5Y A;  1IYK A;  4JD6 A;  2EUI A;  2FCK A;  4FD7 A;  4MI4 A;  5KTC A;  5F48 A;  1K4J A;  1P0H A;  4H6U A;  2ZW4 A;  2CNT A;  3G3S A;  4B5P A;  3DDD A;  3EC4 A;  2GIV A;  5DWM A;  5H84 A;  3BJ8 A;  1M44 A;  3E0K A;  3QAH A;  4U9Z A;  3T9Y A;  3P2H A;  1BOB A;  1S7F A;  4MJ8 A;  1VKC A;  1NE9 A;  3C26 A;  1TIQ A;  4MHD A;  2BEI A;  1QSO A;  1MK4 A;  4AG9 A;  4AB7 A;  5F46 A;  3IWG A;  2JDC A;  2X7B A;  3SHP A;  3KKW A;  1MJ9 A;  2R8V A;  2VBQ A;  4NXY A;  4CRZ B;  1J4J A;  3R1K A;  1RXT A;  4CAV A;  5C88 A;  5E96 A;  3R95 A;  2CY2 A;  1QSN A;  4CRY B;  2B4D B;  2RC4 A;  1S3Z A;  4UA3 A;  1I1D A;  3R9F A;  3FNC A;  3UY5 A;  4KUB A;  2OB0 A;  4MY0 A;  2FIA A;  2B5G A;  2AE6 A;  1IYL A;  4AVB A;  3JUW A;  2OU2 A;  1PUA A;  2G3T A;  1S60 A;  4JXR A;  3EXN A;  3R96 A;  4QVT A;  1L0C A;  1B87 A;  3G8W A;  4JXQ A;  2BSW A;  1NMT A;  2WPW A;  4K30 A;  4PV6 A;  1R57 A;  3F0A A;  4FD4 A;  4RI1 A;  2Q04 A;  3V8I A;  1YR0 A;  3N7Z A;  3TOA A;  2Q4Y A;  4XPD B;  4B5P B;  3IGR A;  3RYO A;  2VZY A;  1QST A;  4XPK A;  3F8K A;  1QSM A;  2Q7B A;  3VWD A;  1U6M A;  4RS2 A;  4ZBG A;  4JWP A;  1Y9W A;  4NEX A;  2PR8 A;  2Z10 A;  2ATR A;  4QUS A;  4UWJ A;  4Y49 B;  2BL1 A;  2FS5 A;  2PQ8 A;  2VQY A;  2OZH A;  4YGO A;  3LD2 A;  1YRE A;  3DR8 A;  2H5M A;  1WWZ A;  1S5K A;  2Q4V A;  3T90 A;  2GE3 A;  3H4Q A;  1Z4E A;  1Z9U A;  3W6X A;  2FXF A;  2HV2 A;  3GKR A;  3S6F A;  2B5G B;  4PK3 A;  2VI7 A;  2Q0Y A; 
#chains in the Genus database with same CATH topology
 3FED A;  3LMS A;  1GHE A;  3CPA A;  3D7H A;  4A38 A;  2D4P A;  4IHM A;  1AYE A;  2AJ6 A;  3MRU A;  3BLN A;  4PQA A;  1YVO A;  3HLP A;  3KZW A;  2GU2 A;  3B3S A;  3I3G A;  4MFJ A;  4HNY B;  4NCZ A;  4JYW A;  4CPA A;  2ZEE A;  3NH4 A;  4KVO E;  4M3S A;  4XNH C;  3TX8 A;  3VAR A;  5HVG A;  3PGP A;  4P45 A;  1Y0R A;  4R3K A;  3WT4 A;  2BO9 A;  3FEC A;  4Q38 A;  2ZOG A;  3ZJ0 A;  4H6Z A;  8CPA A;  2O4H A;  2Q43 A;  1YX0 A;  1TKH A;  1WK4 A;  3TFY A;  2REF A;  1X10 A;  1XFO A;  4NJQ A;  2PJ1 A;  3DGV A;  1YW6 A;  2YNC A;  2PR1 A;  2I00 A;  4HNX B;  2OH1 A;  2PJ7 A;  4GS4 A;  4GM5 A;  1XE4 A;  5G1Z A;  1OBR A;  3PFO A;  2ABZ A;  4MFQ A;  4KOY A;  4FWU A;  2PJ6 A;  2O28 A;  5D29 A;  5F47 A;  5IX3 A;  4OC0 A;  2AFM A;  4A30 A;  4AVA A;  3IU2 A;  5D8N A;  3QAY A;  4JJX A;  4CYO A;  2ZEP A;  1HDQ A;  5F49 A;  4ZY2 A;  4BBH A;  5EBV A;  1EE3 P;  4KOT A;  2V8V A;  4KUA A;  4R3L A;  3LOD A;  1X12 A;  2CTC A;  3B8G A;  3EO4 A;  1Y0Y A;  3IWE A;  4WWV A;  5DWN A;  4CGO A;  1IY7 A;  2WPX A;  3FJU A;  3LAC A;  4K3N A;  4KOU A;  1GYT A;  2ZEG A;  4HPS A;  4B11 A;  3NE8 A;  4G1P A;  3TCV A;  1M1D A;  3SJG A;  3PB9 X;  2I79 A;  4L89 A;  3ZZI A;  4C68 A;  1XOV A;  4OME A;  4PPZ A;  5FVJ A;  5BWA B;  4F0X A;  1Z2L A;  4YU9 A;  3D8P A;  3CPX A;  3SXN A;  4C2Z A;  1BLL E;  2PIZ A;  4U9Y A;  4X2T A;  4BMH A;  3DNS A;  4X8I A;  1IGB A;  5LRK A;  4UF4 A;  5IB9 A;  4QC6 A;  3FBU A;  2ARH A;  5AGE A;  1TKF A;  1VHO A;  3PB6 X;  5EMI A;  3R9E A;  2FIW A;  4DYO A;  3S9M A;  1ZG7 A;  2AFU A;  5AG7 A;  1ELL P;  4NGT A;  4LQ6 A;  4IF5 A;  4P4J A;  4E8O A;  4B13 A;  4B5O A;  2FT0 A;  2P6F A;  3K9T A;  3TTH A;  3PB8 X;  3W91 A;  3D3S A;  3D67 A;  4B14 A;  4C7I A;  4E0A A;  2V8G A;  1PU9 A;  3NFZ A;  3FMC A;  1FNO A;  1XMB A;  4W9Y A;  2PRQ A;  1TXR A;  3GUX A;  4CGN A;  4ZI6 A;  2C1C A;  2PJA A;  3EY5 A;  3BXM A;  3NE7 A;  2V8H A;  2JEV A;  4OC2 A;  1XEB A;  3GY9 A;  4FD6 A;  1QSR A;  1M4D A;  3S6G A;  2WZN A;  5GCN A;  5JPH A;  1ARL A;  1Z4R A;  3F5B A;  4GXH A;  2YND A;  1MJA A;  2CF4 A;  2ZOF A;  1M4G A;  1NSA A;  1S7N A;  5CNP A;  1LAP A;  1Z8X A;  3D2P A;  5H86 A;  2HQY A;  2YGW A;  4OAD A;  4ZYQ A;  1CJW A;  1VHS A;  4YFJ A;  3D66 A;  4KOS A;  1I21 A;  2ZW6 A;  2PC1 A;  3B3V A;  2PJB A;  2HC9 A;  4PXE A;  3TOB A;  4MY3 A;  1LCP A;  5G21 A;  3OWC A;  1IOF A;  4QBJ A;  5KTD A;  1CG2 A;  4ZY1 A;  4MFK A;  4EVY A;  2B4D A;  1TF9 A;  4CAX A;  2QJ8 A;  2QVP A;  2BUE A;  4NSQ A;  4C7H A;  1YVK A;  2B3U A;  2IJZ A;  2JBJ A;  3CXQ A;  2CIJ A;  2B58 A;  2R7H A;  2ZXV A;  4RUH A;  3D7D A;  4FBE A;  1XF8 A;  2EWB A;  1RTQ A;  2Z3M A;  3BJ7 A;  3PZJ A;  4HNW B;  4XPD C;  3PFE A;  3QNV A;  3WAB A;  2ZPA A;  3BI0 A;  3JVN A;  3KQX A;  3D2M A;  3FRM A;  3DSB A;  4J3G A;  4UBR A;  3TO6 A;  4NGN A;  1LRZ A;  2R98 A;  3B3C A;  2XEF A;  4OAE A;  4CGP A;  3PP9 A;  2EO8 A;  4KVX A;  2BOA A;  4L8A A;  3VAT A;  2B3V A;  3SI2 A;  3PB7 X;  1Z8T A;  3FB3 A;  4I49 A;  1BPN A;  2FL4 A;  3VWE A;  2EBJ A;  4LX9 A;  4R57 A;  3CXS A;  2P6E A;  4YRH A;  3A9L A;  1P4N A;  5C82 A;  2DEA A;  1YME A;  1RO5 A;  4NGM A;  1KZF A;  2EK8 A;  2VZZ A;  2Z3N A;  3LWU A;  2PCU A;  1IB1 E;  1KUV A;  1Y9K A;  3H8F A;  3D7F A;  2PIY A;  4TNU A;  5ELY A;  3EFA A;  4MXU A;  4Y49 C;  3RZA A;  3DR6 A;  1ZLI A;  2K5T A;  2NYQ A;  1I12 A;  3K9U A;  4KLV A;  2ZEN A;  1B6B A;  4A2Z A;  3WC7 A;  3V38 A;  4PXB A;  5LYD A;  4F9V A;  2AFO A;  1S7L A;  4H89 A;  4F0Y A;  2PRB A;  4O23 A;  4FD5 A;  2RFH A;  3I9S A;  2PDO A;  4MHN A;  5AG5 A;  4OC4 A;  4KOV A;  1YW4 A;  4ORF A;  2CXA A;  2OZU A;  3SI1 A;  1DE4 C;  2PJ5 A;  2VEZ A;  4ZX8 A;  4MRI A;  2B4B A;  4JLY A;  3TT2 A;  2GLJ A;  2PVV A;  4KSI A;  3S6K A;  2V8D A;  1M4I A;  4CYN A;  4AVC A;  2P0W A;  4MBU A;  2Z11 A;  2DPT A;  1Q2C A;  3IC1 A;  5J8F A;  2F8H A;  3P2F A;  4E2A A;  1ARM A;  4CAE A;  2F7V A;  3CXP A;  2JLM A;  2PVW A;  2O53 A;  3MGD A;  2Q7S A;  4Q36 A;  3WC5 A;  4UCN A;  3KGQ A;  1YLO A;  4F9U A;  1ZG9 A;  5I0C A;  1H8L A;  4UFW A;  2PJ9 A;  3S9N A;  3FYN A;  1BAV A;  3TO7 A;  2PSW A;  1Z8L A;  4LUA A;  4NGR A;  5A28 A;  5HMN A;  2G3A A;  2PJ8 A;  4MHZ A;  1VGY A;  4DJL A;  3D68 A;  5J8C A;  2ODF A;  5HXD A;  3ISX A;  3GIU A;  4R87 A;  3TE4 A;  4IK2 A;  4CS0 B;  1CBX A;  3ISZ A;  3WC6 A;  4KZT A;  3FF3 A;  3GYA A;  1S7K A;  2Y0M A;  1Q7L A;  2WYR A;  2HUZ A;  2G0B A;  1CP6 A;  1R3N A;  2D4O A;  4MCQ A;  4P4B A;  4KSA A;  4QB9 A;  4CGL A;  2J8N A;  5AG4 A;  4NGQ A;  5K8N A;  3W6S A;  2J8M A;  2AFZ A;  4UEF A;  2OZG A;  2ZW5 A;  2JDD A;  4II9 A;  4JZ0 A;  1FY7 A;  2A4N A;  1Y7R A;  2DXQ A;  2ZEF A;  4A31 A;  4UIA A;  2J8R A;  3IEH A;  2R1I A;  5KTA A;  2C27 A;  2VXK A;  4XPL A;  1KUY A;  2FE7 A;  3WR7 A;  2CTB A;  4UWI A;  4EWT A;  4WJB A;  3SXO A;  3TO9 A;  5THW A;  2ZW7 A;  4PSW A;  2IL4 A;  4NGS A;  1LOK A;  1MJB A;  3NA6 A;  5K8M A;  4KSF A;  4DUK A;  1Z8W A;  1LAM A;  1LFW A;  1YGH A;  1JWQ A;  4H2K A;  2C6P A;  4NFR A;  2DF5 A;  1Q2Y A;  3L2N A;  1Q2D A;  2F5I A;  3KHX A;  4MCS A;  4NF1 A;  1AUG A;  2REE A;  4KOX A;  3SJX A;  1SQH A;  1CP7 A;  1IOI A;  1UFH A;  3S6H A;  4R8F A;  2NMT A;  4UEZ A;  3QB8 A;  1OZP A;  1IU8 A;  1F2P A;  1YLE A;  2I3C A;  3I1U A;  4KOW A;  2GFQ A;  4CAW A;  5F09 A;  1FT7 A;  2QEC A;  2RB7 A;  2CNS A;  3R9G A;  2OR4 A;  4RN7 A;  4C2X A;  4PSX A;  4OIW A;  4P4D A;  1YK3 A;  4IUS A;  1V0C A;  4F6A A;  1N71 A;  2EVN A;  4OLL A;  5LRJ A;  1IIC A;  4M6H A;  4A32 A;  1ZO0 A;  2CNM A;  2QYV A;  3RO0 A;  5ISV A;  4OC3 A;  4OC5 A;  4DNC A;  4PK2 A;  3H5Z A;  1XMT A;  4KLW A;  4ONU A;  2Z0Z A;  3FH4 A;  3IFE A;  2Z3O A;  4Q7A A;  3BHX A;  2AFX A;  2ZEL A;  4AG7 A;  1CM0 A;  1XIX A;  2QML A;  4R76 A;  4TWE A;  2KCW A;  4KOR A;  1BO4 A;  5EC4 A;  3FIX A;  2QIR A;  5DS0 A;  7CPA A;  2GAN A;  4HKF A;  4KVM E;  1BPM A;  3RAM A;  5JGF A;  1YQE A;  4OP4 A;  3SI0 A;  3FXT A;  1NSL A;  5IB0 A;  1ON0 A;  5IV0 A;  4R9M A;  2NSM A;  3T8W A;  5LYL A;  1A2Z A;  1KUX A;  2P6G A;  2VL1 A;  3PRT A;  5JQ4 A;  2FSR A;  5HVF A;  4CYP A;  2Q44 A;  4M85 A;  4KS9 A;  1VHE A;  1F57 A;  2Q51 A;  4XNH B;  2GLF A;  1IID A;  2EK9 A;  5HH1 A;  3IJ3 A;  1VIX A;  2G9D A;  3KAS A;  4X5K A;  3V7Z A;  4U5Y A;  4A39 A;  6CPA A;  4P6Y A;  3CDX A;  1IYK A;  2Z3P A;  4JD6 A;  2EUI A;  2FCK A;  4FD7 A;  2PE3 A;  3JTK A;  4MI4 A;  1R43 A;  5KTC A;  3GLJ A;  4P10 A;  4UCP A;  3KHZ A;  4EFD A;  2YNC C;  1QQ9 A;  4UIB A;  5F48 A;  1K4J A;  1P0H A;  4H6U A;  4CAF A;  2ZW4 A;  2CNT A;  3G3S A;  4B5P A;  3DDD A;  3EC4 A;  2GIV A;  2WUU A;  5DWM A;  3BJ8 A;  1M44 A;  3FX6 A;  3KR5 A;  5H84 A;  4BIN A;  4F8Z A;  3E0K A;  3QAH A;  4U9Z A;  3T9Y A;  4MHY A;  3P2H A;  3KL9 A;  1BOB A;  1S7F A;  4MJ8 A;  1VKC A;  1NE9 A;  4P4F A;  3C26 A;  1TIQ A;  4MHD A;  2BEI A;  4P4I A;  4B10 A;  1QSO A;  3BI1 A;  4OID A;  1MK4 A;  2PJ4 A;  4NJR A;  3B3W A;  4AG9 A;  1CX8 A;  4AB7 A;  1F2O A;  1TF8 A;  3H8E A;  3JRU A;  4C2Y A;  3KI9 A;  5K8P A;  5F46 A;  3IWG A;  4P4E A;  5LYI A;  2JDC A;  2X7B A;  3SHP A;  2ZEH A;  2R8V A;  1MJ9 A;  2VBQ A;  3KKW A;  4NXY A;  2XEG A;  4CRZ B;  2HB6 A;  2C6C A;  3FVL A;  1J4J A;  2ZEO A;  1UWY A;  1Y7E A;  3PEI A;  3R1K A;  1TKJ A;  3B35 A;  1PCA A;  3N5F A;  2PJ0 A;  1QMU A;  2Z3L A;  3B2Y A;  1RXT A;  3B3T A;  4CAV A;  5C88 A;  5HVH A;  5E96 A;  3R95 A;  3HUV A;  4PXD A;  4A94 A;  2CY2 A;  1QSN A;  2GRE A;  2JEW A;  4CRY B;  2Q4Z A;  4R7M A;  2B4D B;  4A33 A;  4X3R A;  3RBU A;  2ANP A;  5JH9 A;  2RC4 A;  4YWY A;  5LYF A;  3KQZ A;  1S3Z A;  3FEE A;  4NGP A;  4UA3 A;  3MN8 A;  1I1D A;  2PJ2 A;  3R9F A;  4AXV A;  4MFZ A;  5G20 A;  2ZED A;  2WSA A;  3FNC A;  4UFX A;  3UY5 A;  5J1Q A;  4KUB A;  4BD9 A;  2OB0 A;  4MY0 A;  4ZX9 A;  3RNZ A;  1KWM A;  2FIA A;  2B5G A;  3IWW A;  4FUU A;  2AE6 A;  3PBE A;  1YSJ A;  1IYL A;  4AVB A;  3JUW A;  3B7I A;  4ZY0 A;  1Z5R A;  2OU2 A;  1PUA A;  2G3T A;  1S60 A;  2ZEM A;  4JXR A;  3EXN A;  4B6Z A;  4MCP A;  4ONW A;  2YNE A;  3R96 A;  4MMO A;  4QVT A;  4CYQ A;  1L0C A;  1B87 A;  3G8W A;  4JXQ A;  2V77 A;  2BSW A;  5K8O A;  3VH9 A;  1ZLH A;  1XJO A;  5CBM A;  1NMT A;  2WPW A;  4K30 A;  3CZX A;  4PV6 A;  1R57 A;  4UEE A;  3F0A A;  4A95 A;  4FD4 A;  1HDU A;  4RI1 A;  2Q04 A;  3V8I A;  1YR0 A;  2Z3K A;  4P44 A;  1HEE A;  4M6G A;  3N7Z A;  3TOA A;  2Q4Y A;  4XPD B;  2PJ3 A;  4PXC A;  4B5P B;  3IGR A;  1ELM P;  4OC1 A;  4B12 A;  3RYO A;  1JQG A;  4MCR A;  1ZG8 A;  4MHP A;  4MFP A;  4A37 A;  2J9A A;  1DTD A;  2VZY A;  1QST A;  3PBB A;  2DPS A;  4XPK A;  1LAN A;  5A27 A;  3S9L A;  3NH5 A;  4R6T A;  2PJC A;  3F8K A;  2JBK A;  1QSM A;  3D7G A;  4UFV A;  2Q7B A;  3VWD A;  3DLJ A;  1U6M A;  4RS2 A;  4ZBG A;  4JWP A;  1Y9W A;  3H8G A;  4NEX A;  3K2K A;  4UCM A;  2PR8 A;  3SJE A;  3KR4 A;  2Z10 A;  4IAV A;  2ATR A;  3TC8 A;  2AFW A;  4QUS A;  4UWJ A;  4M6I A;  4Y49 B;  2BL1 A;  3PB4 X;  1M4L A;  1XBU A;  2FS5 A;  2IMO A;  3SJF A;  2PQ8 A;  2FVG A;  2VQY A;  4CGM A;  4FAI A;  4ZGY B;  2OZH A;  3CT9 A;  4YGO A;  3LD2 A;  3IO1 A;  1YRE A;  3DR8 A;  5CPA A;  5G22 A;  5AG6 A;  3D4U A;  2OOT A;  4Z65 A;  2C6G A;  2XEI A;  2IQ6 A;  1AMP A;  2H5M A;  1WWZ A;  3NH8 A;  1CPS A;  2AFS A;  2BCO A;  1XRY A;  1S5K A;  2Q4V A;  4MFL A;  3T90 A;  2GE3 A;  3IIB A;  1CPX A;  3H4Q A;  2POK A;  4LQG A;  1Z4E A;  1Z9U A;  5LRG A;  3W6X A;  2FXF A;  2HV2 A;  2XEJ A;  3GB0 A;  5I4M A;  3GKR A;  4EME A;  3S6F A;  5JM6 A;  2B5G B;  4OKO A;  4PK3 A;  2VI7 A;  2Q0Y A;  3IU1 A;  1PYT B; 
#chains in the Genus database with same CATH homology
 1GHE A;  2D4P A;  2AJ6 A;  3BLN A;  1YVO A;  4MFJ A;  4NCZ A;  3I3G A;  4HNY B;  4KVO E;  4M3S A;  4XNH C;  3PGP A;  4R3K A;  4Q38 A;  3ZJ0 A;  4H6Z A;  1YX0 A;  1WK4 A;  3TFY A;  2REF A;  2YNC A;  2PR1 A;  2I00 A;  4HNX B;  2OH1 A;  4GS4 A;  1XE4 A;  5G1Z A;  4MFQ A;  4KOY A;  2O28 A;  5F47 A;  5IX3 A;  4A30 A;  4AVA A;  3IU2 A;  4JJX A;  4CYO A;  5F49 A;  4BBH A;  5EBV A;  4KOT A;  4R3L A;  4KUA A;  3LOD A;  3B8G A;  3EO4 A;  3IWE A;  5DWN A;  4CGO A;  2WPX A;  4KOU A;  4B11 A;  3TCV A;  1M1D A;  2I79 A;  4L89 A;  4C68 A;  5FVJ A;  5BWA B;  4F0X A;  3D8P A;  3SXN A;  4C2Z A;  4U9Y A;  4BMH A;  3DNS A;  4QC6 A;  3FBU A;  2ARH A;  5AGE A;  3R9E A;  2FIW A;  5AG7 A;  4IF5 A;  4E8O A;  4B13 A;  4B5O A;  2FT0 A;  2P6F A;  3TTH A;  4C7I A;  3W91 A;  3D3S A;  4B14 A;  4E0A A;  1PU9 A;  4CGN A;  3EY5 A;  3NE7 A;  3S6G A;  2JEV A;  4FD6 A;  1XEB A;  3GY9 A;  1QSR A;  1M4D A;  5JPH A;  5GCN A;  1Z4R A;  3F5B A;  2YND A;  1MJA A;  1M4G A;  1S7N A;  5CNP A;  3D2P A;  5H86 A;  2HQY A;  2YGW A;  4OAD A;  1CJW A;  1VHS A;  4YFJ A;  4KOS A;  1I21 A;  2ZW6 A;  2PC1 A;  3TOB A;  4MY3 A;  5G21 A;  3OWC A;  4QBJ A;  5KTD A;  4MFK A;  4EVY A;  2B4D A;  4CAX A;  2BUE A;  4NSQ A;  4C7H A;  1YVK A;  2B3U A;  3CXQ A;  2R7H A;  2B58 A;  2ZXV A;  1XF8 A;  2Z3M A;  3PZJ A;  3BJ7 A;  4XPD C;  4HNW B;  2ZPA A;  3JVN A;  4UBR A;  3D2M A;  3FRM A;  3DSB A;  4J3G A;  3TO6 A;  1LRZ A;  2R98 A;  4CGP A;  4OAE A;  3PP9 A;  4KVX A;  4L8A A;  2B3V A;  3FB3 A;  4I49 A;  2FL4 A;  3VWE A;  4LX9 A;  4R57 A;  3CXS A;  2P6E A;  4YRH A;  3A9L A;  1P4N A;  5C82 A;  1RO5 A;  1KZF A;  2VZZ A;  2Z3N A;  1IB1 E;  1Y9K A;  1KUV A;  3EFA A;  4Y49 C;  3DR6 A;  2K5T A;  1I12 A;  3K9U A;  4KLV A;  1B6B A;  4A2Z A;  4H89 A;  1S7L A;  4F0Y A;  2PRB A;  4FD5 A;  3I9S A;  5AG5 A;  2PDO A;  4KOV A;  4ORF A;  2CXA A;  2OZU A;  2VEZ A;  2B4B A;  4JLY A;  3TT2 A;  3S6K A;  1M4I A;  4CYN A;  4AVC A;  2P0W A;  4MBU A;  2Z11 A;  2DPT A;  1Q2C A;  5J8F A;  3P2F A;  4E2A A;  4CAE A;  3CXP A;  4Q36 A;  2JLM A;  3MGD A;  4UCN A;  5I0C A;  4UFW A;  3FYN A;  3TO7 A;  2PSW A;  4LUA A;  5HMN A;  5A28 A;  2G3A A;  5J8C A;  4R87 A;  3TE4 A;  4CS0 B;  4KZT A;  3GYA A;  2Y0M A;  1S7K A;  3ZZI A;  2HUZ A;  2D4O A;  2G0B A;  4CGL A;  5AG4 A;  4KSA A;  4QB9 A;  2J8N A;  3W6S A;  2J8M A;  2OZG A;  2ZW5 A;  2JDD A;  4II9 A;  1FY7 A;  2A4N A;  1Y7R A;  2DXQ A;  4A31 A;  2J8R A;  2R1I A;  5KTA A;  2C27 A;  2VXK A;  4XPL A;  1KUY A;  2FE7 A;  3WR7 A;  4UWI A;  3SXO A;  3TO9 A;  2ZW7 A;  4PSW A;  2IL4 A;  1MJB A;  4KSF A;  1YGH A;  1Q2Y A;  1Q2D A;  2F5I A;  4NF1 A;  2REE A;  4KOX A;  1SQH A;  1UFH A;  3S6H A;  2NMT A;  3QB8 A;  1OZP A;  1YLE A;  4KOW A;  4CAW A;  2QEC A;  2CNS A;  3R9G A;  4C2X A;  4F6A A;  4PSX A;  1YK3 A;  4IUS A;  1V0C A;  1N71 A;  2EVN A;  4OLL A;  1IIC A;  4A32 A;  1ZO0 A;  2CNM A;  5ISV A;  4DNC A;  4PK2 A;  3H5Z A;  1XMT A;  4KLW A;  4ONU A;  2Z0Z A;  2Z3O A;  4AG7 A;  1CM0 A;  1XIX A;  2QML A;  2KCW A;  4KOR A;  1BO4 A;  5EC4 A;  3FIX A;  2QIR A;  2GAN A;  4HKF A;  4KVM E;  3FXT A;  1NSL A;  5IB0 A;  1ON0 A;  5IV0 A;  4R9M A;  2P6G A;  1KUX A;  5JQ4 A;  2FSR A;  4CYP A;  2Q44 A;  4M85 A;  4KS9 A;  5HH1 A;  4XNH B;  1IID A;  4X5K A;  4U5Y A;  1IYK A;  2Z3P A;  4JD6 A;  2EUI A;  2FCK A;  4FD7 A;  3JTK A;  4MI4 A;  5KTC A;  4UCP A;  2YNC C;  5F48 A;  1K4J A;  1P0H A;  4H6U A;  4CAF A;  2ZW4 A;  2CNT A;  3G3S A;  4B5P A;  3DDD A;  3EC4 A;  2GIV A;  2WUU A;  5DWM A;  3BJ8 A;  1M44 A;  5H84 A;  3E0K A;  3QAH A;  4U9Z A;  3T9Y A;  3P2H A;  1BOB A;  1S7F A;  4MJ8 A;  1VKC A;  1NE9 A;  3C26 A;  1TIQ A;  4MHD A;  2BEI A;  4B10 A;  1QSO A;  1MK4 A;  4AG9 A;  4AB7 A;  4C2Y A;  5F46 A;  3IWG A;  2JDC A;  2X7B A;  3SHP A;  3KKW A;  1MJ9 A;  2R8V A;  2VBQ A;  4NXY A;  4CRZ B;  1J4J A;  3R1K A;  2Z3L A;  1RXT A;  4CAV A;  5C88 A;  5E96 A;  3R95 A;  2CY2 A;  1QSN A;  4CRY B;  2B4D B;  4A33 A;  2RC4 A;  1S3Z A;  4UA3 A;  1I1D A;  3R9F A;  4MFZ A;  5G20 A;  2WSA A;  3FNC A;  4UFX A;  3UY5 A;  4KUB A;  2OB0 A;  4MY0 A;  2FIA A;  2B5G A;  2AE6 A;  1IYL A;  4AVB A;  3JUW A;  2OU2 A;  1PUA A;  2G3T A;  1S60 A;  4JXR A;  3EXN A;  2YNE A;  3R96 A;  4QVT A;  4CYQ A;  1L0C A;  1B87 A;  3G8W A;  4JXQ A;  2BSW A;  1NMT A;  2WPW A;  4K30 A;  4PV6 A;  1R57 A;  3F0A A;  4A95 A;  4FD4 A;  4RI1 A;  2Q04 A;  3V8I A;  1YR0 A;  2Z3K A;  3N7Z A;  3TOA A;  2Q4Y A;  4XPD B;  4B5P B;  3IGR A;  4B12 A;  3RYO A;  4MFP A;  2VZY A;  1QST A;  2DPS A;  4XPK A;  5A27 A;  3F8K A;  1QSM A;  2Q7B A;  4UFV A;  3VWD A;  1U6M A;  4RS2 A;  4ZBG A;  4JWP A;  1Y9W A;  4NEX A;  4UCM A;  2PR8 A;  2Z10 A;  2ATR A;  4QUS A;  4UWJ A;  4Y49 B;  2BL1 A;  2FS5 A;  2PQ8 A;  2VQY A;  4CGM A;  4ZGY B;  2OZH A;  4YGO A;  3LD2 A;  1YRE A;  3DR8 A;  5G22 A;  5AG6 A;  2H5M A;  1WWZ A;  1S5K A;  2Q4V A;  4MFL A;  3T90 A;  2GE3 A;  3H4Q A;  1Z4E A;  1Z9U A;  3W6X A;  2FXF A;  2HV2 A;  3GKR A;  3S6F A;  2B5G B;  4PK3 A;  2VI7 A;  2Q0Y A;  3IU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...