2P6EA

Crystal structures of saccharomyces cerevisiae n-myristoyltransferase with bound myristoyl-coa
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
451
structure length
442
Chain Sequence
DKAKKLENLLKLLQLNNDDTSKFDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 127
structure length 442
sequence length 451
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2007-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6eA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6eA02
1NSLA 5IV0A 3H4QA 4AVCA 4YRHA 4HKFA 4CRYB 3D8PA 1V0CA 1PU9A 4ONUA 1ON0A 3F5BA 1MK4A 4AVAA 1WK4A 4JJXA 3F0AA 4KUBA 4I49A 3UY5A 4F6AA 1S3ZA 2NMTA 4KOUA 5E96A 5F48A 2J8RA 5C82A 3BLNA 1QSNA 1NMTA 3W6SA 2FIAA 1BO4A 3P2FA 3DR8A 3TTHA 3S6KA 4UWIA 4H6UA 1NE9A 2BSWA 4KUAA 3EY5A 5JPHA 4JLYA 2PR1A 5EC4A 4Y49B 1IB1E 4L89A 1YVKA 3IWGA 3W6XA 2P6EA 3QAHA 4E8OA 2A4NA 2BUEA 3IGRA 4PK3A 5KTDA 2BL1A 1XIXA 4U5YA 2C27A 1YR0A 1S7NA 4NEXA 4LUAA 1Y7RA 3TCVA 1S7FA 4E2AA 1YK3A 3EFAA 3NE7A 1M1DA 3JUWA 1VHSA 1PUAA 2ZW4A 1YVOA 2R7HA 2FIWA 1MJBA 3D2PA 3TOAA 1YREA 2JDDA 2Q0YA 4X5KA 2PR8A 4JXQA 3DR6A 3FBUA 5KTCA 4MJ8A 2OZGA 2B3VA 3I9SA 3CXSA 2FL4A 3BJ7A 2PSWA 4XPDC 1KUVA 1XEBA 1Q2DA 2VZZA 4MY3A 1QSMA 4QVTA 2P6FA 2CY2A 2JEVA 2BEIA 2PRBA 2FT0A 1MJAA 4R57A 2JLMA 4KVXA 4XNHB 3FNCA 2D4OA 2IL4A 5DWMA 5H84A 3DDDA 3K9UA 4UBRA 5J8CA 2EVNA 5F49A 2Z0ZA 3GY9A 3G3SA 2VQYA 5ISVA 2PDOA 4QUSA 1L0CA 4GS4A 2QMLA 5H86A 4B5OA 3PP9A 2Y0MA 3G8WA 2ZW7A 3ZJ0A 2Q04A 3R9EA 4BMHA 4CS0B 2B58A 4KOWA 5J8FA 3PZJA 2OZHA 4R3LA 1LRZA 2FSRA 1IICA 1IYLA 2G3TA 2OU2A 4R87A 3S6FA 3TT2A 3CXPA 1Q2YA 4QBJA 1I1DA 4M3SA 1I21A 3V8IA 1XE4A 2ZW5A 4NXYA 2B4DA 4AVBA 5FVJA 3I3GA 1QSOA 2Z11A 4OLLA 2I00A 3S6GA 4J3GA 2QECA 1Z4EA 2Q4VA 4U9YA 2EUIA 1GHEA 1IYKA 4YGOA 4F0YA 5F46A 2VXKA 4JWPA 5HH1A 3D3SA 4HNYB 2REEA 4FD5A 2B4BA 4PSWA 3T9YA 2VI7A 5I0CA 2OB0A 4YFJA 2B5GA 4MBUA 2FE7A 1QSTA 3PGPA 1KZFA 1U6MA 4RS2A 2O28A 4HNXB 4NF1A 4B5PA 4ORFA 4PV6A 2OZUA 1B87A 3C26A 1WWZA 2AJ6A 1MJ9A 4U9ZA 1P4NA 4QC6A 3FRMA 2B4DB 4ZBGA 4KOYA 1XMTA 1RO5A 4EVYA 1TIQA 3GYAA 2PQ8A 1RXTA 3TOBA 2B3UA 2P6GA 3VWEA 4HNWB 4KVOE 2KCWA 3DSBA 2G0BA 4L8AA 3T90A 2AE6A 1J4JA 3EC4A 2GE3A 2J8MA 5DWNA 1R57A 3E0KA 3BJ8A 4LX9A 4UWJA 4MY0A 1YLEA 2Q44A 3FB3A 4AG7A 2CNTA 2Q4YA 2VZYA 4NSQA 5KTAA 4R3KA 2ZPAA 3R9GA 3LODA 2GANA 3R1KA 4H6ZA 1S7LA 1YGHA 1UFHA 4KLWA 4Y49C 2B5GB 4IF5A 3QB8A 2Q7BA 3B8GA 3N7ZA 4XPKA 4XPLA 4PK2A 4B5PB 3R96A 2X7BA 1CM0A 2F5IA 4XPDB 2CNMA 4MHDA 2RC4A 3R9FA 4DNCA 3MGDA 4UA3A 2HQYA 3JVNA 5JQ4A 2OH1A 3S6HA 4KOXA 4CAVA 5GCNA 1IIDA 3TFYA 4AG9A 2CNSA 4PSXA 3TO9A 4II9A 4FD6A 3TO6A 2P0WA 1I12A 2ARHA 4NCZA 1Y9KA 3TE4A 4KOSA 2HV2A 2ZW6A 4IUSA 2J8NA 5CNPA 5C88A 4MI4A 1S60A 1KUXA 1OZPA 3P2HA 1K4JA 3ZZIA 1CJWA 1Z9UA 1P0HA 4FD7A 2R98A 1S7KA 4KLVA 3SXOA 3VWDA 1M4GA 1Z4RA 4AB7A 3SXNA 4CAWA 2GIVA 4E0AA 4FD4A 4QB9A 1SQHA 3OWCA 2I79A 2H5MA 2ATRA 4RI1A 5HMNA 4XNHC 1N71A 3LD2A 1B6BA 4KOTA 2PC1A 2Z10A 4CRZB 4H89A 2DXQA 3CXQA 4JD6A 1QSRA 3W91A 3KKWA 1BOBA 3FYNA 4K30A 2FCKA 2D4PA 4KORA 2REFA 2VBQA 3FIXA 4KVME 2WPXA 1KUYA 3EO4A 1Q2CA 4KZTA 1Y9WA 3D2MA 3GKRA 4M85A 4R9MA 2R1IA 5IX3A 3F8KA 2WPWA 4JXRA 3DNSA 5F47A 2VEZA 1FY7A 2G3AA 4CAXA 3R95A 3WR7A 3SHPA 1XF8A 2HUZA 1S5KA 5IB0A 3RYOA 1VKCA 2FXFA 1M4DA 2ZXVA 1M4IA 4OAEA 2FS5A 2JDCA 3TO7A 4KOVA 2R8VA 4OADA 1YX0A 2QIRA 1M44A 2K5TA 3EXNA 3FXTA 5EBVA
chains in the Genus database with same CATH superfamily
1NSLA 5IV0A 1JQGA 2BOAA 3H4QA 1LANA 3LACA 4AVCA 4YRHA 2ZEOA 3KQZA 3IWEA 4WJBA 4HKFA 2ZELA 2PJ0A 3D8PA 5THWA 3VATA 4CRYB 3KL9A 2DF5A 1V0CA 4X2TA 2Z3MA 1DTDA 3D67A 4MFJA 1IGBA 1X10A 1PU9A 4ONUA 1ON0A 3F5BA 1MK4A 2PIYA 4AVAA 5K8MA 1WK4A 4JJXA 3F0AA 2XEFA 4NGPA 1VHEA 4I49A 4KUBA 3UY5A 4M6HA 4F6AA 4UCMA 5AG6A 1S3ZA 4B14A 4OC2A 2NMTA 4KOUA 5E96A 5ELYA 4NJRA 4P10A 2J8RA 3BI1A 5F48A 4C7HA 3BLNA 5C82A 4NGSA 2PCUA 1QSNA 1BPMA 3B3WA 4ZY2A 2PJ7A 4DYOA 1NMTA 2ZEDA 4Q7AA 3JTKA 4P4FA 2FIAA 4OC4A 1BO4A 3W6SA 3P2FA 3DR8A 3KR4A 3TTHA 3NH8A 3GUXA 3IJ3A 3S6KA 4EMEA 4UWIA 1AUGA 2PJ1A 1F2OA 4H6UA 1FNOA 1NE9A 2BSWA 3ISXA 4KUAA 4P4BA 2PVVA 3EY5A 4UEFA 5JPHA 4JLYA 2PR1A 5EC4A 4CGMA 4BD9A 4P4IA 4Y49B 1IB1E 4L89A 1TF9A 1YVKA 2I3CA 3IWGA 1LFWA 3W6XA 1YW6A 2P6EA 4MRIA 4C2XA 3QAHA 4FUUA 2A4NA 4E8OA 2PJCA 2BUEA 3IGRA 2AFMA 1XOVA 4JZ0A 4ZY1A 4OC3A 4PK3A 1QMUA 5KTDA 2BL1A 1XIXA 4PXEA 1ARMA 3MN8A 4U5YA 4PPZA 2Z3OA 2C27A 2QYVA 1YR0A 4RN7A 1S7NA 3DLJA 5HXDA 1EE3P 4NEXA 2ZEFA 4LUAA 4O23A 1Y7RA 3TCVA 1S7FA 2AFUA 4E2AA 1YK3A 3IU2A 3PB4X 4PXDA 3D7DA 4NJQA 4B6ZA 3EFAA 1QQ9A 1M1DA 2V8GA 3FEEA 3JUWA 2FVGA 3NE7A 3QNVA 1VHSA 1PUAA 2ZW4A 4NGTA 4A2ZA 4CGNA 3SI1A 1YVOA 2WYRA 3NH5A 2R7HA 2QJ8A 3LWUA 2FIWA 3PB9X 2ZEPA 1VIXA 1MJBA 3D2PA 2G9DA 3TOAA 1YREA 2GFQA 4CGOA 2JDDA 2Q0YA 1F57A 4X5KA 2PR8A 3V38A 4JXQA 5CBMA 4DUKA 3DR6A 3FBUA 5KTCA 2ANPA 3KGQA 4MJ8A 4PXBA 2OZGA 2B3VA 1YMEA 2VL1A 3I9SA 3CXSA 2FL4A 5AG4A 3BJ7A 4X3RA 2PSWA 4XPDC 1KUVA 1Z2LA 1XEBA 1Q2DA 2BCOA 3RO0A 2VZZA 4A33A 4K3NA 1CPSA 3K2KA 4MY3A 1GYTA 4A38A 4CAEA 1QSMA 4QVTA 3IEHA 2P6FA 1ELMP 2CY2A 2JEVA 2PVWA 2WZNA 3SJXA 2BEIA 4R8FA 4GXHA 2PRBA 2FT0A 1MJAA 1YW4A 4R57A 1H8LA 2ZEHA 3FX6A 2PJAA 2C6CA 2JLMA 4KVXA 4P6YA 4XNHB 1LAPA 3FNCA 2ZOGA 1BPNA 2D4OA 2IL4A 5DWMA 5H84A 3DDDA 2EK9A 1ELLP 3K9UA 4UBRA 2Z3KA 5J8CA 2XEGA 5D8NA 2EVNA 2Z3PA 3NFZA 2Z0ZA 3GY9A 5F49A 1IOFA 3G3SA 2VQYA 3RBUA 5ISVA 2PDOA 1VGYA 4MHZA 4P45A 2AFZA 4QUSA 4OP4A 1L0CA 3RAMA 3WC6A 3I1UA 4GS4A 2QMLA 5H86A 4B5OA 3PP9A 5A28A 1VHOA 2Y0MA 3G8WA 5LYIA 4NGRA 1ZO0A 2ZW7A 3FMCA 5G1ZA 4ONWA 4Z65A 3ZJ0A 4H2KA 4LQGA 2Q04A 4TWEA 4BBHA 3JRUA 2PJBA 2Z3LA 3R9EA 3GIUA 4YWYA 4BMHA 4CS0B 2B58A 3FF3A 3FEDA 4M6GA 4KOWA 5J8FA 4KSIA 2PE3A 1PCAA 3PB7X 5G20A 3NE8A 3PZJA 2WSAA 2OZHA 3D4UA 4R3LA 1LRZA 2FSRA 1IICA 1IYLA 2G3TA 2GLFA 4M6IA 4OC1A 2YNCC 2OU2A 2ZENA 3KASA 4ZGYB 4R87A 3S9NA 3S6FA 1Y0YA 5G22A 3N5FA 4OKOA 4B10A 2PJ2A 3CXPA 3TT2A 2V8HA 1Q2YA 4EFDA 4QBJA 1XFOA 1I1DA 4M3SA 1I21A 2OOTA 1XE4A 2ZW5A 3V8IA 4FWUA 4IHMA 4NXYA 5K8PA 2V77A 2AFXA 3PB8X 2B4DA 4AVBA 3NA6A 4MFZA 4A30A 5FVJA 3I3GA 1QSOA 5F09A 2Z11A 1CX8A 4OLLA 5JGFA 2PRQA 2I00A 3S6GA 5AGEA 5LRGA 4CYOA 4J3GA 4P4EA 3D7HA 2QECA 2O53A 2GLJA 3PFOA 4P4DA 1Z4EA 2HC9A 4UCNA 2Q4VA 1YQEA 4U9YA 2EUIA 1GHEA 1IYKA 4YGOA 1ZG7A 3RNZA 4CGLA 4F9VA 3KQXA 2CIJA 4MCPA 4PXCA 4F0YA 4FBEA 1AMPA 1FT7A 4UFXA 7CPAA 2GREA 2JEWA 4HPSA 1TKFA 3L2NA 4KSFA 5AG7A 2CF4A 3B3CA 4B11A 5F46A 4R7MA 2VXKA 4JWPA 5HH1A 1RTQA 4NGNA 4UIAA 1Z8LA 4BINA 1LAMA 3D3SA 2V8DA 3CZXA 4HNYB 5HVFA 1IOIA 1TKHA 4MHYA 2Q51A 3T8WA 2REEA 4FD5A 3KI9A 2BO9A 3QAYA 2B4BA 4IK2A 4OC0A 4PSWA 3T9YA 2VI7A 5I0CA 2YNEA 2OB0A 5A27A 4YFJA 2B5GA 4MBUA 5JM6A 2FE7A 1QSTA 3PGPA 2C6GA 3RZAA 1KZFA 2AFOA 4CPAA 1CP6A 4WWVA 1X12A 1U6MA 4RS2A 2O28A 4HNXB 4NF1A 2NSMA 4B5PA 1M4LA 3CDXA 1YSJA 4ORFA 4PV6A 2OZUA 2PIZA 1B87A 1TXRA 1ZG9A 3C26A 2PJ6A 1WWZA 4JYWA 2AJ6A 1MJ9A 4A32A 4P44A 1UWYA 3GLJA 5HVGA 4U9ZA 4ZX8A 2C1CA 2CTBA 1P4NA 4QC6A 3FRMA 2B4DB 2PJ8A 2QVPA 4ZBGA 3IU1A 4KOYA 1XMTA 2HB6A 1RO5A 3TC8A 4EVYA 3IO1A 1TIQA 2OR4A 3GYAA 2DPSA 2PQ8A 5CPAA 3S9LA 1RXTA 3TOBA 4A94A 2B3UA 2P6GA 1CP7A 3VWEA 4HNWB 4GM5A 4CAFA 3B2YA 4ZY0A 4KVOE 2KCWA 3DSBA 2G0BA 2PJ4A 4L8AA 3T90A 1R3NA 1DE4C 1J4JA 2AE6A 2RFHA 3WC7A 1PYTB 1YLOA 1Z8TA 2GE3A 2J8MA 3B7IA 3EC4A 4UFWA 5I4MA 5DWNA 1R57A 3E0KA 3BJ8A 4LX9A 4UWJA 4AXVA 4F8ZA 4ZYQA 4MY0A 1F2PA 4A39A 4ZX9A 2F7VA 1YLEA 2Q44A 3FB3A 4AG7A 5JH9A 2CNTA 1BLLE 2EWBA 2Q4YA 2VZYA 4NSQA 5KTAA 4R3KA 2ZPAA 4R6TA 6CPAA 5K8NA 5J1QA 2Q43A 3R9GA 4ZI6A 1XBUA 1Y0RA 2GANA 3LODA 3R1KA 2EK8A 2POKA 4H6ZA 4UF4A 1S7LA 4UCPA 2DPTA 5AG5A 1YGHA 4CYPA 4UIBA 5EMIA 2IJZA 1UFHA 4KLWA 4Y49C 2YNCA 1XRYA 2B5GB 2IMOA 3HLPA 4IF5A 3D7GA 2ODFA 4UEEA 2PJ3A 4YU9A 2AFWA 1TKJA 2DEAA 1BAVA 3QB8A 4MFLA 2Q7BA 1IU8A 4NGQA 3B8GA 3ISZA 3N7ZA 4XPKA 4XPLA 4A95A 2ABZA 4MFPA 3FXTA 2CXAA 4PK2A 4TNUA 4B5PB 4X8IA 3FJUA 3R96A 2X7BA 1CM0A 4C2YA 2F5IA 4XPDB 1LCPA 2CNMA 2XEJA 3PBBA 4MHDA 2RC4A 3R9FA 4DNCA 3MGDA 2CTCA 2F8HA 2HQYA 3CPAA 4UA3A 3JVNA 3KZWA 3VH9A 5JQ4A 3B35A 2JBJA 3H5ZA 2OH1A 3PFEA 4UFVA 2PJ5A 3S6HA 2YNDA 3IFEA 3KHZA 4KOXA 1IIDA 4OIWA 5GCNA 4CAVA 3TFYA 4AG9A 2CNSA 3BXMA 3V7ZA 4PSXA 2GU2A 3TO9A 1Q7LA 4II9A 4FD6A 3TO6A 2P0WA 1I12A 3SJGA 2ARHA 4IAVA 4LQ6A 4NCZA 4F0XA 1Y9KA 3TE4A 2HV2A 2IQ6A 2ZW6A 4IUSA 2J8NA 4KOSA 5CNPA 5G21A 4MI4A 5C88A 1S60A 3D7FA 2NYQA 1KUXA 3WC5A 4C7IA 3LMSA 4PQAA 3D68A 3PBEA 2Z3NA 1Y7EA 3PEIA 4C68A 1OZPA 4Q36A 3P2HA 1K4JA 3ZZIA 2C6PA 8CPAA 3H8FA 1CJWA 2YGWA 4G1PA 4MCRA 1Z9UA 1P0HA 3CT9A 2R98A 3FECA 4FD7A 3TX8A 1S7KA 3IIBA 4UEZA 4DJLA 3WT4A 4KLVA 3SXOA 3VWDA 1M4GA 1XMBA 1Z4RA 4AB7A 4KSAA 1AYEA 4F9UA 4OC5A 2PJ9A 1OBRA 1Z5RA 3FH4A 3SXNA 4CAWA 5K8OA 3B3VA 2GIVA 4E0AA 2WUUA 2ZEEA 4FD4A 4QB9A 1SQHA 3SI0A 3H8EA 3OWCA 2I79A 2H5MA 2ATRA 4RI1A 5HMNA 4XNHC 1N71A 3K9TA 3LD2A 4A37A 4Q38A 1B6BA 1HDQA 4KOTA 3SJFA 5HVHA 4MHNA 3PRTA 5LRJA 1A2ZA 2PC1A 2Z10A 4MHPA 3SI2A 4CRZB 3BI0A 4H89A 3S9MA 4W9YA 2DXQA 3CXQA 2ZEGA 4JD6A 3B3TA 1CBXA 3CPXA 3FVLA 5D29A 1QSRA 4B13A 3W91A 3KKWA 1IY7A 1BOBA 3FYNA 3KHXA 4K30A 3IC1A 1CG2A 2FCKA 2D4PA 4KORA 1XJOA 1CPXA 2REFA 2VBQA 3H8GA 3FIXA 4KVME 2WPXA 1KUYA 1TF8A 3EO4A 1Q2CA 2JBKA 4KZTA 4CGPA 4RUHA 4NFRA 1Y9WA 3D2MA 3A9LA 3BHXA 3GKRA 4M85A 4MMOA 4NGMA 4R9MA 2R1IA 5IX3A 4CYQA 5LYDA 4C2ZA 3F8KA 3SJEA 2RB7A 2WPWA 3DNSA 4JXRA 5F47A 5IB9A 2XEIA 2VEZA 4OIDA 1KWMA 5LYFA 1FY7A 4MFKA 2Q7SA 2EBJA 1ZG8A 5LRKA 2G3AA 4CAXA 3R95A 1Z8WA 3GB0A 3DGVA 4R76A 3WR7A 3SHPA 3NH4A 1XF8A 2HUZA 1S5KA 4MXUA 1JWQA 4OMEA 3KR5A 2EO8A 4B12A 2AFSA 4FAIA 2V8VA 5IB0A 1LOKA 2ZOFA 3RYOA 2J9AA 4EWTA 1HEEA 1VKCA 2FXFA 3PB6X 4CYNA 3VARA 1M4DA 5DS0A 2ZXVA 1M4IA 2O4HA 5LYLA 4OAEA 4A31A 2FS5A 2JDCA 4KS9A 1Z8XA 3TO7A 1HDUA 3IWWA 4KOVA 3B3SA 1ZLHA 3MRUA 2R8VA 4MCSA 3D66A 4P4JA 2Q4ZA 5BWAB 3HUVA 1ARLA 4MFQA 4MCQA 4OADA 1NSAA 1YX0A 3WABA 1ZLIA 2QIRA 1M44A 2K5TA 2ZEMA 3EXNA 1R43A 5EBVA
chains in the Genus database with same CATH topology
1NSLA 5IV0A 3H4QA 4AVCA 4YRHA 3IWEA 4HKFA 4CRYB 3D8PA 1V0CA 2Z3MA 4MFJA 1PU9A 4ONUA 1ON0A 3F5BA 1MK4A 4AVAA 1WK4A 4JJXA 3F0AA 4KUBA 4I49A 3UY5A 4F6AA 4UCMA 5AG6A 1S3ZA 4B14A 2NMTA 4KOUA 5E96A 5F48A 2J8RA 4C7HA 5C82A 3BLNA 1QSNA 1NMTA 3JTKA 3W6SA 2FIAA 1BO4A 3P2FA 3DR8A 3TTHA 3S6KA 4UWIA 4H6UA 1NE9A 2BSWA 4KUAA 3EY5A 5JPHA 4JLYA 2PR1A 5EC4A 4CGMA 4Y49B 1IB1E 4L89A 1YVKA 3IWGA 3W6XA 2P6EA 4C2XA 3QAHA 4E8OA 2A4NA 2BUEA 3IGRA 4PK3A 5KTDA 2BL1A 1XIXA 4U5YA 2Z3OA 2C27A 1YR0A 1S7NA 4NEXA 4LUAA 1Y7RA 3TCVA 1S7FA 4E2AA 1YK3A 3IU2A 3EFAA 3NE7A 1M1DA 3JUWA 1VHSA 1PUAA 2ZW4A 4A2ZA 4CGNA 1YVOA 2R7HA 2FIWA 1MJBA 3D2PA 3TOAA 1YREA 4CGOA 2JDDA 2Q0YA 4X5KA 2PR8A 4JXQA 3DR6A 3FBUA 5KTCA 4MJ8A 2OZGA 2B3VA 3I9SA 3CXSA 2FL4A 5AG4A 3BJ7A 2PSWA 4XPDC 1KUVA 1XEBA 1Q2DA 4A33A 2VZZA 4MY3A 4CAEA 1QSMA 4QVTA 2P6FA 2CY2A 2JEVA 2BEIA 2PRBA 2FT0A 1MJAA 4R57A 2JLMA 4KVXA 4XNHB 3FNCA 2D4OA 2IL4A 5DWMA 5H84A 3DDDA 3K9UA 4UBRA 2Z3KA 5J8CA 2EVNA 2Z3PA 5F49A 2Z0ZA 3GY9A 3G3SA 2VQYA 5ISVA 2PDOA 4QUSA 1L0CA 4GS4A 2QMLA 5H86A 4B5OA 3PP9A 5A28A 2Y0MA 3G8WA 1ZO0A 2ZW7A 5G1ZA 3ZJ0A 2Q04A 4BBHA 2Z3LA 3R9EA 4BMHA 4CS0B 2B58A 4KOWA 5J8FA 5G20A 3PZJA 2WSAA 2OZHA 4R3LA 1LRZA 2FSRA 1IICA 1IYLA 2G3TA 2YNCC 2OU2A 4ZGYB 4R87A 3S6FA 5G22A 4B10A 3TT2A 3CXPA 1Q2YA 4QBJA 1I1DA 4M3SA 1I21A 3V8IA 1XE4A 2ZW5A 4NXYA 2B4DA 4AVBA 4MFZA 4A30A 5FVJA 3I3GA 1QSOA 2Z11A 4OLLA 2I00A 3S6GA 5AGEA 4CYOA 4J3GA 2QECA 1Z4EA 4UCNA 2Q4VA 4U9YA 2EUIA 1GHEA 1IYKA 4YGOA 4CGLA 4F0YA 4UFXA 4KSFA 5AG7A 4B11A 5F46A 2VXKA 4JWPA 5HH1A 3D3SA 4HNYB 2REEA 4FD5A 2B4BA 4PSWA 3T9YA 2VI7A 5I0CA 2YNEA 2OB0A 5A27A 4YFJA 2B5GA 4MBUA 2FE7A 1QSTA 3PGPA 1KZFA 1U6MA 4RS2A 2O28A 4HNXB 4NF1A 4B5PA 4ORFA 4PV6A 2OZUA 1B87A 3C26A 1WWZA 2AJ6A 1MJ9A 4A32A 4U9ZA 1P4NA 4QC6A 3FRMA 2B4DB 4ZBGA 3IU1A 4KOYA 1XMTA 1RO5A 4EVYA 1TIQA 3GYAA 2DPSA 2PQ8A 1RXTA 3TOBA 2B3UA 2P6GA 4CAFA 3VWEA 4HNWB 4KVOE 2KCWA 3DSBA 2G0BA 4L8AA 3T90A 2AE6A 1J4JA 3EC4A 2GE3A 2J8MA 4UFWA 5DWNA 1R57A 3E0KA 3BJ8A 4LX9A 4UWJA 4MY0A 1YLEA 2Q44A 3FB3A 4AG7A 2CNTA 2Q4YA 2VZYA 4NSQA 5KTAA 4R3KA 2ZPAA 3R9GA 3LODA 2GANA 3R1KA 4H6ZA 1S7LA 4UCPA 2DPTA 5AG5A 1YGHA 4CYPA 1UFHA 4KLWA 4Y49C 2YNCA 2B5GB 4IF5A 3QB8A 4MFLA 2Q7BA 3B8GA 3N7ZA 4XPKA 4XPLA 4A95A 4MFPA 4PK2A 2CXAA 4B5PB 3R96A 2X7BA 1CM0A 4C2YA 2F5IA 4XPDB 2CNMA 4MHDA 2RC4A 3R9FA 4DNCA 3MGDA 4UA3A 2HQYA 3JVNA 5JQ4A 3H5ZA 2OH1A 4UFVA 3S6HA 2YNDA 4KOXA 4CAVA 5GCNA 1IIDA 3TFYA 4AG9A 2CNSA 4PSXA 3TO9A 4II9A 4FD6A 3TO6A 2P0WA 1I12A 2ARHA 4NCZA 4F0XA 1Y9KA 3TE4A 2HV2A 2ZW6A 4IUSA 4KOSA 2J8NA 5CNPA 5G21A 5C88A 4MI4A 1S60A 1KUXA 4C7IA 2Z3NA 4C68A 1OZPA 4Q36A 3P2HA 1K4JA 3ZZIA 1CJWA 2YGWA 1Z9UA 1P0HA 4FD7A 2R98A 1S7KA 4KLVA 3SXOA 3VWDA 1M4GA 1Z4RA 4AB7A 4KSAA 3SXNA 4CAWA 2GIVA 4E0AA 2WUUA 4FD4A 4QB9A 1SQHA 3OWCA 2I79A 2H5MA 2ATRA 4RI1A 5HMNA 4XNHC 1N71A 3LD2A 4Q38A 1B6BA 4KOTA 2PC1A 2Z10A 4CRZB 4H89A 2DXQA 3CXQA 4JD6A 1QSRA 4B13A 3W91A 3KKWA 1BOBA 3FYNA 4K30A 2FCKA 2D4PA 4KORA 2REFA 2VBQA 3FIXA 4KVME 2WPXA 1KUYA 3EO4A 1Q2CA 4KZTA 4CGPA 1Y9WA 3D2MA 3A9LA 3GKRA 4M85A 4R9MA 2R1IA 5IX3A 4CYQA 4C2ZA 3F8KA 2WPWA 4JXRA 3DNSA 5F47A 2VEZA 1FY7A 4MFKA 2G3AA 4CAXA 3R95A 3WR7A 3SHPA 1XF8A 2HUZA 1S5KA 4B12A 5IB0A 3RYOA 1VKCA 2FXFA 4CYNA 1M4DA 2ZXVA 1M4IA 4OAEA 4A31A 2FS5A 2JDCA 4KS9A 3TO7A 4KOVA 2R8VA 5BWAB 4MFQA 4OADA 1YX0A 2QIRA 1M44A 2K5TA 3EXNA 3FXTA 5EBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSL A;  5IV0 A;  3H4Q A;  4AVC A;  4YRH A;  4HKF A;  4CRY B;  3D8P A;  1V0C A;  1PU9 A;  4ONU A;  1ON0 A;  3F5B A;  1MK4 A;  4AVA A;  1WK4 A;  4JJX A;  3F0A A;  4KUB A;  4I49 A;  3UY5 A;  4F6A A;  1S3Z A;  2NMT A;  4KOU A;  5E96 A;  5F48 A;  2J8R A;  5C82 A;  3BLN A;  1QSN A;  1NMT A;  3W6S A;  2FIA A;  1BO4 A;  3P2F A;  3DR8 A;  3TTH A;  3S6K A;  4UWI A;  4H6U A;  1NE9 A;  2BSW A;  4KUA A;  3EY5 A;  5JPH A;  4JLY A;  2PR1 A;  5EC4 A;  4Y49 B;  1IB1 E;  4L89 A;  1YVK A;  3IWG A;  3W6X A;  2P6E A;  3QAH A;  4E8O A;  2A4N A;  2BUE A;  3IGR A;  4PK3 A;  5KTD A;  2BL1 A;  1XIX A;  4U5Y A;  2C27 A;  1YR0 A;  1S7N A;  4NEX A;  4LUA A;  1Y7R A;  3TCV A;  1S7F A;  4E2A A;  1YK3 A;  3EFA A;  3NE7 A;  1M1D A;  3JUW A;  1VHS A;  1PUA A;  2ZW4 A;  1YVO A;  2R7H A;  2FIW A;  1MJB A;  3D2P A;  3TOA A;  1YRE A;  2JDD A;  2Q0Y A;  4X5K A;  2PR8 A;  4JXQ A;  3DR6 A;  3FBU A;  5KTC A;  4MJ8 A;  2OZG A;  2B3V A;  3I9S A;  3CXS A;  2FL4 A;  3BJ7 A;  2PSW A;  4XPD C;  1KUV A;  1XEB A;  1Q2D A;  2VZZ A;  4MY3 A;  1QSM A;  4QVT A;  2P6F A;  2CY2 A;  2JEV A;  2BEI A;  2PRB A;  2FT0 A;  1MJA A;  4R57 A;  2JLM A;  4KVX A;  4XNH B;  3FNC A;  2D4O A;  2IL4 A;  5DWM A;  5H84 A;  3DDD A;  3K9U A;  4UBR A;  5J8C A;  2EVN A;  5F49 A;  2Z0Z A;  3GY9 A;  3G3S A;  2VQY A;  5ISV A;  2PDO A;  4QUS A;  1L0C A;  4GS4 A;  2QML A;  5H86 A;  4B5O A;  3PP9 A;  2Y0M A;  3G8W A;  2ZW7 A;  3ZJ0 A;  2Q04 A;  3R9E A;  4BMH A;  4CS0 B;  2B58 A;  4KOW A;  5J8F A;  3PZJ A;  2OZH A;  4R3L A;  1LRZ A;  2FSR A;  1IIC A;  1IYL A;  2G3T A;  2OU2 A;  4R87 A;  3S6F A;  3TT2 A;  3CXP A;  1Q2Y A;  4QBJ A;  1I1D A;  4M3S A;  1I21 A;  3V8I A;  1XE4 A;  2ZW5 A;  4NXY A;  2B4D A;  4AVB A;  5FVJ A;  3I3G A;  1QSO A;  2Z11 A;  4OLL A;  2I00 A;  3S6G A;  4J3G A;  2QEC A;  1Z4E A;  2Q4V A;  4U9Y A;  2EUI A;  1GHE A;  1IYK A;  4YGO A;  4F0Y A;  5F46 A;  2VXK A;  4JWP A;  5HH1 A;  3D3S A;  4HNY B;  2REE A;  4FD5 A;  2B4B A;  4PSW A;  3T9Y A;  2VI7 A;  5I0C A;  2OB0 A;  4YFJ A;  2B5G A;  4MBU A;  2FE7 A;  1QST A;  3PGP A;  1KZF A;  1U6M A;  4RS2 A;  2O28 A;  4HNX B;  4NF1 A;  4B5P A;  4ORF A;  4PV6 A;  2OZU A;  1B87 A;  3C26 A;  1WWZ A;  2AJ6 A;  1MJ9 A;  4U9Z A;  1P4N A;  4QC6 A;  3FRM A;  2B4D B;  4ZBG A;  4KOY A;  1XMT A;  1RO5 A;  4EVY A;  1TIQ A;  3GYA A;  2PQ8 A;  1RXT A;  3TOB A;  2B3U A;  2P6G A;  3VWE A;  4HNW B;  4KVO E;  2KCW A;  3DSB A;  2G0B A;  4L8A A;  3T90 A;  2AE6 A;  1J4J A;  3EC4 A;  2GE3 A;  2J8M A;  5DWN A;  1R57 A;  3E0K A;  3BJ8 A;  4LX9 A;  4UWJ A;  4MY0 A;  1YLE A;  2Q44 A;  3FB3 A;  4AG7 A;  2CNT A;  2Q4Y A;  2VZY A;  4NSQ A;  5KTA A;  4R3K A;  2ZPA A;  3R9G A;  3LOD A;  2GAN A;  3R1K A;  4H6Z A;  1S7L A;  1YGH A;  1UFH A;  4KLW A;  4Y49 C;  2B5G B;  4IF5 A;  3QB8 A;  2Q7B A;  3B8G A;  3N7Z A;  4XPK A;  4XPL A;  4PK2 A;  4B5P B;  3R96 A;  2X7B A;  1CM0 A;  2F5I A;  4XPD B;  2CNM A;  4MHD A;  2RC4 A;  3R9F A;  4DNC A;  3MGD A;  4UA3 A;  2HQY A;  3JVN A;  5JQ4 A;  2OH1 A;  3S6H A;  4KOX A;  4CAV A;  5GCN A;  1IID A;  3TFY A;  4AG9 A;  2CNS A;  4PSX A;  3TO9 A;  4II9 A;  4FD6 A;  3TO6 A;  2P0W A;  1I12 A;  2ARH A;  4NCZ A;  1Y9K A;  3TE4 A;  4KOS A;  2HV2 A;  2ZW6 A;  4IUS A;  2J8N A;  5CNP A;  5C88 A;  4MI4 A;  1S60 A;  1KUX A;  1OZP A;  3P2H A;  1K4J A;  3ZZI A;  1CJW A;  1Z9U A;  1P0H A;  4FD7 A;  2R98 A;  1S7K A;  4KLV A;  3SXO A;  3VWD A;  1M4G A;  1Z4R A;  4AB7 A;  3SXN A;  4CAW A;  2GIV A;  4E0A A;  4FD4 A;  4QB9 A;  1SQH A;  3OWC A;  2I79 A;  2H5M A;  2ATR A;  4RI1 A;  5HMN A;  4XNH C;  1N71 A;  3LD2 A;  1B6B A;  4KOT A;  2PC1 A;  2Z10 A;  4CRZ B;  4H89 A;  2DXQ A;  3CXQ A;  4JD6 A;  1QSR A;  3W91 A;  3KKW A;  1BOB A;  3FYN A;  4K30 A;  2FCK A;  2D4P A;  4KOR A;  2REF A;  2VBQ A;  3FIX A;  4KVM E;  2WPX A;  1KUY A;  3EO4 A;  1Q2C A;  4KZT A;  1Y9W A;  3D2M A;  3GKR A;  4M85 A;  4R9M A;  2R1I A;  5IX3 A;  3F8K A;  2WPW A;  4JXR A;  3DNS A;  5F47 A;  2VEZ A;  1FY7 A;  2G3A A;  4CAX A;  3R95 A;  3WR7 A;  3SHP A;  1XF8 A;  2HUZ A;  1S5K A;  5IB0 A;  3RYO A;  1VKC A;  2FXF A;  1M4D A;  2ZXV A;  1M4I A;  4OAE A;  2FS5 A;  2JDC A;  3TO7 A;  4KOV A;  2R8V A;  4OAD A;  1YX0 A;  2QIR A;  1M44 A;  2K5T A;  3EXN A;  3FXT A;  5EBV A; 
#chains in the Genus database with same CATH topology
 1NSL A;  5IV0 A;  1JQG A;  2BOA A;  3H4Q A;  1LAN A;  3LAC A;  4AVC A;  4YRH A;  2ZEO A;  3KQZ A;  3IWE A;  4WJB A;  4HKF A;  2ZEL A;  2PJ0 A;  3D8P A;  5THW A;  3VAT A;  4CRY B;  3KL9 A;  2DF5 A;  1V0C A;  4X2T A;  2Z3M A;  1DTD A;  3D67 A;  4MFJ A;  1IGB A;  1X10 A;  1PU9 A;  4ONU A;  1ON0 A;  3F5B A;  1MK4 A;  2PIY A;  4AVA A;  5K8M A;  1WK4 A;  4JJX A;  3F0A A;  2XEF A;  4NGP A;  1VHE A;  4I49 A;  4KUB A;  3UY5 A;  4M6H A;  4F6A A;  4UCM A;  5AG6 A;  1S3Z A;  4B14 A;  4OC2 A;  2NMT A;  4KOU A;  5E96 A;  5ELY A;  4NJR A;  4P10 A;  2J8R A;  3BI1 A;  5F48 A;  4C7H A;  3BLN A;  5C82 A;  4NGS A;  2PCU A;  1QSN A;  1BPM A;  3B3W A;  4ZY2 A;  2PJ7 A;  4DYO A;  1NMT A;  2ZED A;  4Q7A A;  3JTK A;  4P4F A;  2FIA A;  4OC4 A;  1BO4 A;  3W6S A;  3P2F A;  3DR8 A;  3KR4 A;  3TTH A;  3NH8 A;  3GUX A;  3IJ3 A;  3S6K A;  4EME A;  4UWI A;  1AUG A;  2PJ1 A;  1F2O A;  4H6U A;  1FNO A;  1NE9 A;  2BSW A;  3ISX A;  4KUA A;  4P4B A;  2PVV A;  3EY5 A;  4UEF A;  5JPH A;  4JLY A;  2PR1 A;  5EC4 A;  4CGM A;  4BD9 A;  4P4I A;  4Y49 B;  1IB1 E;  4L89 A;  1TF9 A;  1YVK A;  2I3C A;  3IWG A;  1LFW A;  3W6X A;  1YW6 A;  2P6E A;  4MRI A;  4C2X A;  3QAH A;  4FUU A;  2A4N A;  4E8O A;  2PJC A;  2BUE A;  3IGR A;  2AFM A;  1XOV A;  4JZ0 A;  4ZY1 A;  4OC3 A;  4PK3 A;  1QMU A;  5KTD A;  2BL1 A;  1XIX A;  4PXE A;  1ARM A;  3MN8 A;  4U5Y A;  4PPZ A;  2Z3O A;  2C27 A;  2QYV A;  1YR0 A;  4RN7 A;  1S7N A;  3DLJ A;  5HXD A;  1EE3 P;  4NEX A;  2ZEF A;  4LUA A;  4O23 A;  1Y7R A;  3TCV A;  1S7F A;  2AFU A;  4E2A A;  1YK3 A;  3IU2 A;  3PB4 X;  4PXD A;  3D7D A;  4NJQ A;  4B6Z A;  3EFA A;  1QQ9 A;  1M1D A;  2V8G A;  3FEE A;  3JUW A;  2FVG A;  3NE7 A;  3QNV A;  1VHS A;  1PUA A;  2ZW4 A;  4NGT A;  4A2Z A;  4CGN A;  3SI1 A;  1YVO A;  2WYR A;  3NH5 A;  2R7H A;  2QJ8 A;  3LWU A;  2FIW A;  3PB9 X;  2ZEP A;  1VIX A;  1MJB A;  3D2P A;  2G9D A;  3TOA A;  1YRE A;  2GFQ A;  4CGO A;  2JDD A;  2Q0Y A;  1F57 A;  4X5K A;  2PR8 A;  3V38 A;  4JXQ A;  5CBM A;  4DUK A;  3DR6 A;  3FBU A;  5KTC A;  2ANP A;  3KGQ A;  4MJ8 A;  4PXB A;  2OZG A;  2B3V A;  1YME A;  2VL1 A;  3I9S A;  3CXS A;  2FL4 A;  5AG4 A;  3BJ7 A;  4X3R A;  2PSW A;  4XPD C;  1KUV A;  1Z2L A;  1XEB A;  1Q2D A;  2BCO A;  3RO0 A;  2VZZ A;  4A33 A;  4K3N A;  1CPS A;  3K2K A;  4MY3 A;  1GYT A;  4A38 A;  4CAE A;  1QSM A;  4QVT A;  3IEH A;  2P6F A;  1ELM P;  2CY2 A;  2JEV A;  2PVW A;  2WZN A;  3SJX A;  2BEI A;  4R8F A;  4GXH A;  2PRB A;  2FT0 A;  1MJA A;  1YW4 A;  4R57 A;  1H8L A;  2ZEH A;  3FX6 A;  2PJA A;  2C6C A;  2JLM A;  4KVX A;  4P6Y A;  4XNH B;  1LAP A;  3FNC A;  2ZOG A;  1BPN A;  2D4O A;  2IL4 A;  5DWM A;  5H84 A;  3DDD A;  2EK9 A;  1ELL P;  3K9U A;  4UBR A;  2Z3K A;  5J8C A;  2XEG A;  5D8N A;  2EVN A;  2Z3P A;  3NFZ A;  2Z0Z A;  3GY9 A;  5F49 A;  1IOF A;  3G3S A;  2VQY A;  3RBU A;  5ISV A;  2PDO A;  1VGY A;  4MHZ A;  4P45 A;  2AFZ A;  4QUS A;  4OP4 A;  1L0C A;  3RAM A;  3WC6 A;  3I1U A;  4GS4 A;  2QML A;  5H86 A;  4B5O A;  3PP9 A;  5A28 A;  1VHO A;  2Y0M A;  3G8W A;  5LYI A;  4NGR A;  1ZO0 A;  2ZW7 A;  3FMC A;  5G1Z A;  4ONW A;  4Z65 A;  3ZJ0 A;  4H2K A;  4LQG A;  2Q04 A;  4TWE A;  4BBH A;  3JRU A;  2PJB A;  2Z3L A;  3R9E A;  3GIU A;  4YWY A;  4BMH A;  4CS0 B;  2B58 A;  3FF3 A;  3FED A;  4M6G A;  4KOW A;  5J8F A;  4KSI A;  2PE3 A;  1PCA A;  3PB7 X;  5G20 A;  3NE8 A;  3PZJ A;  2WSA A;  2OZH A;  3D4U A;  4R3L A;  1LRZ A;  2FSR A;  1IIC A;  1IYL A;  2G3T A;  2GLF A;  4M6I A;  4OC1 A;  2YNC C;  2OU2 A;  2ZEN A;  3KAS A;  4ZGY B;  4R87 A;  3S9N A;  3S6F A;  1Y0Y A;  5G22 A;  3N5F A;  4OKO A;  4B10 A;  2PJ2 A;  3CXP A;  3TT2 A;  2V8H A;  1Q2Y A;  4EFD A;  4QBJ A;  1XFO A;  1I1D A;  4M3S A;  1I21 A;  2OOT A;  1XE4 A;  2ZW5 A;  3V8I A;  4FWU A;  4IHM A;  4NXY A;  5K8P A;  2V77 A;  2AFX A;  3PB8 X;  2B4D A;  4AVB A;  3NA6 A;  4MFZ A;  4A30 A;  5FVJ A;  3I3G A;  1QSO A;  5F09 A;  2Z11 A;  1CX8 A;  4OLL A;  5JGF A;  2PRQ A;  2I00 A;  3S6G A;  5AGE A;  5LRG A;  4CYO A;  4J3G A;  4P4E A;  3D7H A;  2QEC A;  2O53 A;  2GLJ A;  3PFO A;  4P4D A;  1Z4E A;  2HC9 A;  4UCN A;  2Q4V A;  1YQE A;  4U9Y A;  2EUI A;  1GHE A;  1IYK A;  4YGO A;  1ZG7 A;  3RNZ A;  4CGL A;  4F9V A;  3KQX A;  2CIJ A;  4MCP A;  4PXC A;  4F0Y A;  4FBE A;  1AMP A;  1FT7 A;  4UFX A;  7CPA A;  2GRE A;  2JEW A;  4HPS A;  1TKF A;  3L2N A;  4KSF A;  5AG7 A;  2CF4 A;  3B3C A;  4B11 A;  5F46 A;  4R7M A;  2VXK A;  4JWP A;  5HH1 A;  1RTQ A;  4NGN A;  4UIA A;  1Z8L A;  4BIN A;  1LAM A;  3D3S A;  2V8D A;  3CZX A;  4HNY B;  5HVF A;  1IOI A;  1TKH A;  4MHY A;  2Q51 A;  3T8W A;  2REE A;  4FD5 A;  3KI9 A;  2BO9 A;  3QAY A;  2B4B A;  4IK2 A;  4OC0 A;  4PSW A;  3T9Y A;  2VI7 A;  5I0C A;  2YNE A;  2OB0 A;  5A27 A;  4YFJ A;  2B5G A;  4MBU A;  5JM6 A;  2FE7 A;  1QST A;  3PGP A;  2C6G A;  3RZA A;  1KZF A;  2AFO A;  4CPA A;  1CP6 A;  4WWV A;  1X12 A;  1U6M A;  4RS2 A;  2O28 A;  4HNX B;  4NF1 A;  2NSM A;  4B5P A;  1M4L A;  3CDX A;  1YSJ A;  4ORF A;  4PV6 A;  2OZU A;  2PIZ A;  1B87 A;  1TXR A;  1ZG9 A;  3C26 A;  2PJ6 A;  1WWZ A;  4JYW A;  2AJ6 A;  1MJ9 A;  4A32 A;  4P44 A;  1UWY A;  3GLJ A;  5HVG A;  4U9Z A;  4ZX8 A;  2C1C A;  2CTB A;  1P4N A;  4QC6 A;  3FRM A;  2B4D B;  2PJ8 A;  2QVP A;  4ZBG A;  3IU1 A;  4KOY A;  1XMT A;  2HB6 A;  1RO5 A;  3TC8 A;  4EVY A;  3IO1 A;  1TIQ A;  2OR4 A;  3GYA A;  2DPS A;  2PQ8 A;  5CPA A;  3S9L A;  1RXT A;  3TOB A;  4A94 A;  2B3U A;  2P6G A;  1CP7 A;  3VWE A;  4HNW B;  4GM5 A;  4CAF A;  3B2Y A;  4ZY0 A;  4KVO E;  2KCW A;  3DSB A;  2G0B A;  2PJ4 A;  4L8A A;  3T90 A;  1R3N A;  1DE4 C;  1J4J A;  2AE6 A;  2RFH A;  3WC7 A;  1PYT B;  1YLO A;  1Z8T A;  2GE3 A;  2J8M A;  3B7I A;  3EC4 A;  4UFW A;  5I4M A;  5DWN A;  1R57 A;  3E0K A;  3BJ8 A;  4LX9 A;  4UWJ A;  4AXV A;  4F8Z A;  4ZYQ A;  4MY0 A;  1F2P A;  4A39 A;  4ZX9 A;  2F7V A;  1YLE A;  2Q44 A;  3FB3 A;  4AG7 A;  5JH9 A;  2CNT A;  1BLL E;  2EWB A;  2Q4Y A;  2VZY A;  4NSQ A;  5KTA A;  4R3K A;  2ZPA A;  4R6T A;  6CPA A;  5K8N A;  5J1Q A;  2Q43 A;  3R9G A;  4ZI6 A;  1XBU A;  1Y0R A;  2GAN A;  3LOD A;  3R1K A;  2EK8 A;  2POK A;  4H6Z A;  4UF4 A;  1S7L A;  4UCP A;  2DPT A;  5AG5 A;  1YGH A;  4CYP A;  4UIB A;  5EMI A;  2IJZ A;  1UFH A;  4KLW A;  4Y49 C;  2YNC A;  1XRY A;  2B5G B;  2IMO A;  3HLP A;  4IF5 A;  3D7G A;  2ODF A;  4UEE A;  2PJ3 A;  4YU9 A;  2AFW A;  1TKJ A;  2DEA A;  1BAV A;  3QB8 A;  4MFL A;  2Q7B A;  1IU8 A;  4NGQ A;  3B8G A;  3ISZ A;  3N7Z A;  4XPK A;  4XPL A;  4A95 A;  2ABZ A;  4MFP A;  3FXT A;  2CXA A;  4PK2 A;  4TNU A;  4B5P B;  4X8I A;  3FJU A;  3R96 A;  2X7B A;  1CM0 A;  4C2Y A;  2F5I A;  4XPD B;  1LCP A;  2CNM A;  2XEJ A;  3PBB A;  4MHD A;  2RC4 A;  3R9F A;  4DNC A;  3MGD A;  2CTC A;  2F8H A;  2HQY A;  3CPA A;  4UA3 A;  3JVN A;  3KZW A;  3VH9 A;  5JQ4 A;  3B35 A;  2JBJ A;  3H5Z A;  2OH1 A;  3PFE A;  4UFV A;  2PJ5 A;  3S6H A;  2YND A;  3IFE A;  3KHZ A;  4KOX A;  1IID A;  4OIW A;  5GCN A;  4CAV A;  3TFY A;  4AG9 A;  2CNS A;  3BXM A;  3V7Z A;  4PSX A;  2GU2 A;  3TO9 A;  1Q7L A;  4II9 A;  4FD6 A;  3TO6 A;  2P0W A;  1I12 A;  3SJG A;  2ARH A;  4IAV A;  4LQ6 A;  4NCZ A;  4F0X A;  1Y9K A;  3TE4 A;  2HV2 A;  2IQ6 A;  2ZW6 A;  4IUS A;  2J8N A;  4KOS A;  5CNP A;  5G21 A;  4MI4 A;  5C88 A;  1S60 A;  3D7F A;  2NYQ A;  1KUX A;  3WC5 A;  4C7I A;  3LMS A;  4PQA A;  3D68 A;  3PBE A;  2Z3N A;  1Y7E A;  3PEI A;  4C68 A;  1OZP A;  4Q36 A;  3P2H A;  1K4J A;  3ZZI A;  2C6P A;  8CPA A;  3H8F A;  1CJW A;  2YGW A;  4G1P A;  4MCR A;  1Z9U A;  1P0H A;  3CT9 A;  2R98 A;  3FEC A;  4FD7 A;  3TX8 A;  1S7K A;  3IIB A;  4UEZ A;  4DJL A;  3WT4 A;  4KLV A;  3SXO A;  3VWD A;  1M4G A;  1XMB A;  1Z4R A;  4AB7 A;  4KSA A;  1AYE A;  4F9U A;  4OC5 A;  2PJ9 A;  1OBR A;  1Z5R A;  3FH4 A;  3SXN A;  4CAW A;  5K8O A;  3B3V A;  2GIV A;  4E0A A;  2WUU A;  2ZEE A;  4FD4 A;  4QB9 A;  1SQH A;  3SI0 A;  3H8E A;  3OWC A;  2I79 A;  2H5M A;  2ATR A;  4RI1 A;  5HMN A;  4XNH C;  1N71 A;  3K9T A;  3LD2 A;  4A37 A;  4Q38 A;  1B6B A;  1HDQ A;  4KOT A;  3SJF A;  5HVH A;  4MHN A;  3PRT A;  5LRJ A;  1A2Z A;  2PC1 A;  2Z10 A;  4MHP A;  3SI2 A;  4CRZ B;  3BI0 A;  4H89 A;  3S9M A;  4W9Y A;  2DXQ A;  3CXQ A;  2ZEG A;  4JD6 A;  3B3T A;  1CBX A;  3CPX A;  3FVL A;  5D29 A;  1QSR A;  4B13 A;  3W91 A;  3KKW A;  1IY7 A;  1BOB A;  3FYN A;  3KHX A;  4K30 A;  3IC1 A;  1CG2 A;  2FCK A;  2D4P A;  4KOR A;  1XJO A;  1CPX A;  2REF A;  2VBQ A;  3H8G A;  3FIX A;  4KVM E;  2WPX A;  1KUY A;  1TF8 A;  3EO4 A;  1Q2C A;  2JBK A;  4KZT A;  4CGP A;  4RUH A;  4NFR A;  1Y9W A;  3D2M A;  3A9L A;  3BHX A;  3GKR A;  4M85 A;  4MMO A;  4NGM A;  4R9M A;  2R1I A;  5IX3 A;  4CYQ A;  5LYD A;  4C2Z A;  3F8K A;  3SJE A;  2RB7 A;  2WPW A;  3DNS A;  4JXR A;  5F47 A;  5IB9 A;  2XEI A;  2VEZ A;  4OID A;  1KWM A;  5LYF A;  1FY7 A;  4MFK A;  2Q7S A;  2EBJ A;  1ZG8 A;  5LRK A;  2G3A A;  4CAX A;  3R95 A;  1Z8W A;  3GB0 A;  3DGV A;  4R76 A;  3WR7 A;  3SHP A;  3NH4 A;  1XF8 A;  2HUZ A;  1S5K A;  4MXU A;  1JWQ A;  4OME A;  3KR5 A;  2EO8 A;  4B12 A;  2AFS A;  4FAI A;  2V8V A;  5IB0 A;  1LOK A;  2ZOF A;  3RYO A;  2J9A A;  4EWT A;  1HEE A;  1VKC A;  2FXF A;  3PB6 X;  4CYN A;  3VAR A;  1M4D A;  5DS0 A;  2ZXV A;  1M4I A;  2O4H A;  5LYL A;  4OAE A;  4A31 A;  2FS5 A;  2JDC A;  4KS9 A;  1Z8X A;  3TO7 A;  1HDU A;  3IWW A;  4KOV A;  3B3S A;  1ZLH A;  3MRU A;  2R8V A;  4MCS A;  3D66 A;  4P4J A;  2Q4Z A;  5BWA B;  3HUV A;  1ARL A;  4MFQ A;  4MCQ A;  4OAD A;  1NSA A;  1YX0 A;  3WAB A;  1ZLI A;  2QIR A;  1M44 A;  2K5T A;  2ZEM A;  3EXN A;  1R43 A;  5EBV A; 
#chains in the Genus database with same CATH homology
 1NSL A;  5IV0 A;  3H4Q A;  4AVC A;  4YRH A;  3IWE A;  4HKF A;  4CRY B;  3D8P A;  1V0C A;  2Z3M A;  4MFJ A;  1PU9 A;  4ONU A;  1ON0 A;  3F5B A;  1MK4 A;  4AVA A;  1WK4 A;  4JJX A;  3F0A A;  4KUB A;  4I49 A;  3UY5 A;  4F6A A;  4UCM A;  5AG6 A;  1S3Z A;  4B14 A;  2NMT A;  4KOU A;  5E96 A;  5F48 A;  2J8R A;  4C7H A;  5C82 A;  3BLN A;  1QSN A;  1NMT A;  3JTK A;  3W6S A;  2FIA A;  1BO4 A;  3P2F A;  3DR8 A;  3TTH A;  3S6K A;  4UWI A;  4H6U A;  1NE9 A;  2BSW A;  4KUA A;  3EY5 A;  5JPH A;  4JLY A;  2PR1 A;  5EC4 A;  4CGM A;  4Y49 B;  1IB1 E;  4L89 A;  1YVK A;  3IWG A;  3W6X A;  2P6E A;  4C2X A;  3QAH A;  4E8O A;  2A4N A;  2BUE A;  3IGR A;  4PK3 A;  5KTD A;  2BL1 A;  1XIX A;  4U5Y A;  2Z3O A;  2C27 A;  1YR0 A;  1S7N A;  4NEX A;  4LUA A;  1Y7R A;  3TCV A;  1S7F A;  4E2A A;  1YK3 A;  3IU2 A;  3EFA A;  3NE7 A;  1M1D A;  3JUW A;  1VHS A;  1PUA A;  2ZW4 A;  4A2Z A;  4CGN A;  1YVO A;  2R7H A;  2FIW A;  1MJB A;  3D2P A;  3TOA A;  1YRE A;  4CGO A;  2JDD A;  2Q0Y A;  4X5K A;  2PR8 A;  4JXQ A;  3DR6 A;  3FBU A;  5KTC A;  4MJ8 A;  2OZG A;  2B3V A;  3I9S A;  3CXS A;  2FL4 A;  5AG4 A;  3BJ7 A;  2PSW A;  4XPD C;  1KUV A;  1XEB A;  1Q2D A;  4A33 A;  2VZZ A;  4MY3 A;  4CAE A;  1QSM A;  4QVT A;  2P6F A;  2CY2 A;  2JEV A;  2BEI A;  2PRB A;  2FT0 A;  1MJA A;  4R57 A;  2JLM A;  4KVX A;  4XNH B;  3FNC A;  2D4O A;  2IL4 A;  5DWM A;  5H84 A;  3DDD A;  3K9U A;  4UBR A;  2Z3K A;  5J8C A;  2EVN A;  2Z3P A;  5F49 A;  2Z0Z A;  3GY9 A;  3G3S A;  2VQY A;  5ISV A;  2PDO A;  4QUS A;  1L0C A;  4GS4 A;  2QML A;  5H86 A;  4B5O A;  3PP9 A;  5A28 A;  2Y0M A;  3G8W A;  1ZO0 A;  2ZW7 A;  5G1Z A;  3ZJ0 A;  2Q04 A;  4BBH A;  2Z3L A;  3R9E A;  4BMH A;  4CS0 B;  2B58 A;  4KOW A;  5J8F A;  5G20 A;  3PZJ A;  2WSA A;  2OZH A;  4R3L A;  1LRZ A;  2FSR A;  1IIC A;  1IYL A;  2G3T A;  2YNC C;  2OU2 A;  4ZGY B;  4R87 A;  3S6F A;  5G22 A;  4B10 A;  3TT2 A;  3CXP A;  1Q2Y A;  4QBJ A;  1I1D A;  4M3S A;  1I21 A;  3V8I A;  1XE4 A;  2ZW5 A;  4NXY A;  2B4D A;  4AVB A;  4MFZ A;  4A30 A;  5FVJ A;  3I3G A;  1QSO A;  2Z11 A;  4OLL A;  2I00 A;  3S6G A;  5AGE A;  4CYO A;  4J3G A;  2QEC A;  1Z4E A;  4UCN A;  2Q4V A;  4U9Y A;  2EUI A;  1GHE A;  1IYK A;  4YGO A;  4CGL A;  4F0Y A;  4UFX A;  4KSF A;  5AG7 A;  4B11 A;  5F46 A;  2VXK A;  4JWP A;  5HH1 A;  3D3S A;  4HNY B;  2REE A;  4FD5 A;  2B4B A;  4PSW A;  3T9Y A;  2VI7 A;  5I0C A;  2YNE A;  2OB0 A;  5A27 A;  4YFJ A;  2B5G A;  4MBU A;  2FE7 A;  1QST A;  3PGP A;  1KZF A;  1U6M A;  4RS2 A;  2O28 A;  4HNX B;  4NF1 A;  4B5P A;  4ORF A;  4PV6 A;  2OZU A;  1B87 A;  3C26 A;  1WWZ A;  2AJ6 A;  1MJ9 A;  4A32 A;  4U9Z A;  1P4N A;  4QC6 A;  3FRM A;  2B4D B;  4ZBG A;  3IU1 A;  4KOY A;  1XMT A;  1RO5 A;  4EVY A;  1TIQ A;  3GYA A;  2DPS A;  2PQ8 A;  1RXT A;  3TOB A;  2B3U A;  2P6G A;  4CAF A;  3VWE A;  4HNW B;  4KVO E;  2KCW A;  3DSB A;  2G0B A;  4L8A A;  3T90 A;  2AE6 A;  1J4J A;  3EC4 A;  2GE3 A;  2J8M A;  4UFW A;  5DWN A;  1R57 A;  3E0K A;  3BJ8 A;  4LX9 A;  4UWJ A;  4MY0 A;  1YLE A;  2Q44 A;  3FB3 A;  4AG7 A;  2CNT A;  2Q4Y A;  2VZY A;  4NSQ A;  5KTA A;  4R3K A;  2ZPA A;  3R9G A;  3LOD A;  2GAN A;  3R1K A;  4H6Z A;  1S7L A;  4UCP A;  2DPT A;  5AG5 A;  1YGH A;  4CYP A;  1UFH A;  4KLW A;  4Y49 C;  2YNC A;  2B5G B;  4IF5 A;  3QB8 A;  4MFL A;  2Q7B A;  3B8G A;  3N7Z A;  4XPK A;  4XPL A;  4A95 A;  4MFP A;  4PK2 A;  2CXA A;  4B5P B;  3R96 A;  2X7B A;  1CM0 A;  4C2Y A;  2F5I A;  4XPD B;  2CNM A;  4MHD A;  2RC4 A;  3R9F A;  4DNC A;  3MGD A;  4UA3 A;  2HQY A;  3JVN A;  5JQ4 A;  3H5Z A;  2OH1 A;  4UFV A;  3S6H A;  2YND A;  4KOX A;  4CAV A;  5GCN A;  1IID A;  3TFY A;  4AG9 A;  2CNS A;  4PSX A;  3TO9 A;  4II9 A;  4FD6 A;  3TO6 A;  2P0W A;  1I12 A;  2ARH A;  4NCZ A;  4F0X A;  1Y9K A;  3TE4 A;  2HV2 A;  2ZW6 A;  4IUS A;  4KOS A;  2J8N A;  5CNP A;  5G21 A;  5C88 A;  4MI4 A;  1S60 A;  1KUX A;  4C7I A;  2Z3N A;  4C68 A;  1OZP A;  4Q36 A;  3P2H A;  1K4J A;  3ZZI A;  1CJW A;  2YGW A;  1Z9U A;  1P0H A;  4FD7 A;  2R98 A;  1S7K A;  4KLV A;  3SXO A;  3VWD A;  1M4G A;  1Z4R A;  4AB7 A;  4KSA A;  3SXN A;  4CAW A;  2GIV A;  4E0A A;  2WUU A;  4FD4 A;  4QB9 A;  1SQH A;  3OWC A;  2I79 A;  2H5M A;  2ATR A;  4RI1 A;  5HMN A;  4XNH C;  1N71 A;  3LD2 A;  4Q38 A;  1B6B A;  4KOT A;  2PC1 A;  2Z10 A;  4CRZ B;  4H89 A;  2DXQ A;  3CXQ A;  4JD6 A;  1QSR A;  4B13 A;  3W91 A;  3KKW A;  1BOB A;  3FYN A;  4K30 A;  2FCK A;  2D4P A;  4KOR A;  2REF A;  2VBQ A;  3FIX A;  4KVM E;  2WPX A;  1KUY A;  3EO4 A;  1Q2C A;  4KZT A;  4CGP A;  1Y9W A;  3D2M A;  3A9L A;  3GKR A;  4M85 A;  4R9M A;  2R1I A;  5IX3 A;  4CYQ A;  4C2Z A;  3F8K A;  2WPW A;  4JXR A;  3DNS A;  5F47 A;  2VEZ A;  1FY7 A;  4MFK A;  2G3A A;  4CAX A;  3R95 A;  3WR7 A;  3SHP A;  1XF8 A;  2HUZ A;  1S5K A;  4B12 A;  5IB0 A;  3RYO A;  1VKC A;  2FXF A;  4CYN A;  1M4D A;  2ZXV A;  1M4I A;  4OAE A;  4A31 A;  2FS5 A;  2JDC A;  4KS9 A;  3TO7 A;  4KOV A;  2R8V A;  5BWA B;  4MFQ A;  4OAD A;  1YX0 A;  2QIR A;  1M44 A;  2K5T A;  3EXN A;  3FXT A;  5EBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...