2P6EA

Crystal structures of saccharomyces cerevisiae n-myristoyltransferase with bound myristoyl-coa
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
451
structure length
442
Chain Sequence
DKAKKLENLLKLLQLNNDDTSKFDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 127
structure length 442
sequence length 451
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2007-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6eA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6eA02
4PV6A 2AE6A 4CS0B 1K4JA 4CAWA 2GIVA 1QSRA 1S3ZA 3T90A 4DNCA 5IB0A 5FVJA 2J8NA 4QVTA 2WPWA 4GS4A 3UY5A 4J3GA 4PSWA 4B5PB 4M3SA 1WWZA 1I12A 5KTDA 1S60A 3S6GA 1NE9A 4OLLA 3I3GA 5EBVA 2A4NA 3V8IA 4KLVA 2EVNA 1Q2DA 1QSOA 3S6FA 1YVKA 2P6GA 3IWGA 4R3LA 1Z4RA 3SXNA 2D4OA 3F5BA 1YLEA 2HUZA 1QSNA 1M4GA 3BJ7A 2OU2A 1MK4A 1Z4EA 4NF1A 1IIDA 2QIRA 5F47A 3EO4A 2BEIA 2GANA 1WK4A 2B58A 2G3AA 4R9MA 4FD6A 4M85A 2NMTA 1R57A 4MBUA 2I79A 2Q44A 4H6ZA 3P2HA 3R95A 1N71A 2B5GB 4E2AA 4NXYA 4U9ZA 3D2MA 2JEVA 1QSMA 5JQ4A 2Q4VA 3R9EA 3BJ8A 2X7BA 2REEA 2Q7BA 4B5PA 2C27A 2PQ8A 3D2PA 5C82A 4HNYB 1Z9UA 3G3SA 4B5OA 4MJ8A 3GYAA 4QBJA 5H86A 2FS5A 4U9YA 1S7NA 3EC4A 4R3KA 1I1DA 3CXQA 1S7LA 1LRZA 2OZUA 2VZZA 3W6XA 4H6UA 4R87A 2R8VA 2CNSA 5CNPA 1CJWA 4KVXA 2B3VA 4EVYA 5KTCA 4MHDA 4XPKA 1YVOA 5KTAA 4CAVA 2PSWA 2CNTA 4UWJA 4CRZB 5C88A 3R1KA 4AG7A 3TOBA 2OH1A 5JPHA 4KUBA 1IB1E 2P0WA 1OZPA 2FSRA 4ZBGA 2BL1A 2G0BA 1S7FA 1YGHA 3D8PA 1M44A 2VZYA 2Z11A 3RYOA 2CNMA 4Y49C 4KOSA 3PZJA 2JDDA 5H84A 4XPDC 4JXRA 2O28A 1P4NA 2JLMA 1XEBA 3JUWA 5EC4A 2VXKA 2PDOA 1FY7A 4UBRA 4I49A 4FD7A 1RO5A 5ISVA 1PU9A 1KUXA 1RXTA 2Y0MA 3I9SA 3QB8A 4KOVA 4MY3A 4H89A 2OZHA 2Z10A 2P6FA 4FD4A 2ZW4A 2Q04A 5J8CA 1KUVA 3PGPA 4ONUA 3N7ZA 2ZW7A 1XMTA 4NEXA 1Q2YA 2ARHA 5F46A 2FXFA 3LD2A 4JD6A 4FD5A 1TIQA 4KORA 2QMLA 4L8AA 1S5KA 1P0HA 2DXQA 4JXQA 5E96A 4KOUA 4KLWA 4F0YA 5F48A 3CXPA 4K30A 2GE3A 1J4JA 2ZW5A 2VEZA 3DNSA 3GKRA 3TCVA 1IYKA 5IV0A 2PC1A 4AB7A 3TFYA 3S6HA 1KZFA 2Z0ZA 3FRMA 4F6AA 3S6KA 5HH1A 3W6SA 1GHEA 2BUEA 4YFJA 4PK3A 4MI4A 2FIWA 2BSWA 3R96A 1M1DA 2H5MA 3FIXA 2FIAA 2HQYA 3EFAA 3R9FA 2B4DB 3FBUA 1PUAA 4Y49B 3OWCA 3DSBA 1CM0A 2R7HA 4PSXA 4E8OA 1Q2CA 3FNCA 1NSLA 4KZTA 4XPDB 4JWPA 4XPLA 4AVBA 2J8MA 3WR7A 1IICA 3DDDA 2B5GA 2R1IA 1KUYA 3EXNA 4ORFA 4JJXA 4CAXA 2HV2A 3E0KA 3MGDA 4U5YA 3ZZIA 3TOAA 2PRBA 4AVCA 2QECA 1L0CA 2Q4YA 2ZW6A 3JVNA 4R57A 3IGRA 2J8RA 1XE4A 3QAHA 3SXOA 5I0CA 3ZJ0A 1YX0A 4BMHA 4KVOE 4PK2A 1M4DA 1Y9WA 4HNXB 3G8WA 2PR8A 2CY2A 1YK3A 5HMNA 3H4QA 2B4DA 4QB9A 2D4PA 2ZXVA 4IUSA 4OAEA 1V0CA 4NSQA 3TO6A 2OZGA 3D3SA 3R9GA 3F8KA 2G3TA 4JLYA 4II9A 1IYLA 4E0AA 2REFA 2VBQA 3CXSA 2F5IA 1VKCA 2B4BA 4MY0A 1XF8A 4QUSA 1MJ9A 4XNHB 4KOWA 4LX9A 3K9UA 4RI1A 2KCWA 2FE7A 3DR6A 2WPXA 3GY9A 1B6BA 3DR8A 1YREA 4NCZA 3F0AA 3TO9A 2OB0A 4KOTA 2I00A 2PR1A 1MJBA 4CRYB 2FL4A 5IX3A 2JDCA 4AG9A 3EY5A 4IF5A 2VQYA 3FYNA 1VHSA 1Y7RA 2FT0A 2K5TA 1BOBA 1BO4A 4XNHC 1MJAA 4HNWB 1U6MA 2P6EA 4QC6A 4UWIA 5DWMA 1B87A 3W91A 2ATRA 1SQHA 1QSTA 4KUAA 4X5KA 1YR0A 4KOYA 3KKWA 4LUAA 3TE4A 3NE7A 2RC4A 1ON0A 4KOXA 5GCNA 1NMTA 3LODA 3TT2A 1XIXA 4YRHA 3PP9A 1Y9KA 2B3UA 3C26A 4L89A 3T9YA 2FCKA 3FB3A 5F49A 3VWDA 1M4IA 1S7KA 2IL4A 4UA3A 2Q0YA 4HKFA 3B8GA 5J8FA 4KVME 4RS2A 2R98A 3FXTA 2VI7A 2AJ6A 3BLNA 3P2FA 5DWNA 1I21A 3TTHA 3TO7A 2EUIA 3SHPA 1UFHA 4YGOA 2ZPAA 4OADA 3VWEA 4AVAA
chains in the Genus database with same CATH superfamily
1LCPA 1Z8LA 3D7DA 1IOFA 4PV6A 5THWA 2ZEMA 2AE6A 4CS0B 1K4JA 5K8MA 4ZI6A 1YQEA 4CAWA 4UFXA 1F2PA 2GIVA 1QMUA 1QSRA 1S3ZA 2ZEHA 4OMEA 1HDQA 3T90A 1KWMA 4DNCA 8CPAA 4M6GA 1AUGA 2POKA 4PXBA 1BAVA 2PIZA 2V8VA 5FVJA 2J8NA 3KGQA 5G21A 1BPMA 5IB0A 4QVTA 4UCMA 2WPWA 4GS4A 3UY5A 2Z3KA 4J3GA 5LYFA 4NGTA 3IO1A 2ZELA 1JQGA 4PSWA 4B5PB 3IEHA 3PB9X 4M3SA 1WWZA 4UFVA 1I12A 1PCAA 2F8HA 2RFHA 2PVVA 5KTDA 4R76A 1S60A 4CGMA 3S6GA 5G20A 2ABZA 1NE9A 3KL9A 4A2ZA 4KSIA 4OLLA 4M6HA 3KASA 1HDUA 3I3GA 5EBVA 2A4NA 3V8IA 3PRTA 3H8GA 1DTDA 4KLVA 2CXAA 3SI1A 2EVNA 1IGBA 1Q2DA 1QSOA 3FVLA 4CGOA 3S6FA 4PQAA 1YVKA 3FJUA 2P6GA 2Z3MA 3IWGA 4R3LA 1Z4RA 5HVFA 3SXNA 1ELLP 1VGYA 2PIYA 2D4OA 2V77A 3F5BA 1YLEA 4P4JA 1BLLE 4B10A 4OC2A 2HUZA 1EE3P 1QSNA 1M4GA 3QAYA 3BJ7A 2OU2A 2ZENA 1MK4A 1Z4EA 4A33A 4NF1A 1IIDA 2QIRA 4A31A 5F47A 3KQXA 3EO4A 2BEIA 2GANA 4YU9A 1WK4A 4G1PA 2B58A 2G3AA 1TKJA 4R9MA 4FD6A 3H8FA 4M85A 1HEEA 2QYVA 2NMTA 4A30A 2AFXA 1R57A 3B2YA 2I79A 2Q44A 4H6ZA 2AFMA 3P2HA 3PBBA 4MBUA 3R95A 1N71A 3RZAA 5DS0A 2B5GB 4MRIA 4C2ZA 4E2AA 4CGPA 2J9AA 4CGLA 4MCRA 4IAVA 4HPSA 4NXYA 4U9ZA 4LQGA 5D8NA 3S9NA 1YSJA 4CPAA 3D2MA 3D4UA 3D7GA 5HVHA 4NFRA 1ARLA 3B3SA 1Z8TA 2JEVA 4MFKA 1QSMA 5JQ4A 2YNEA 2Q4VA 1YW6A 3R9EA 2FVGA 3BJ8A 2X7BA 3FMCA 2REEA 3MN8A 2Q7BA 4B5PA 5A28A 1IOIA 2C27A 2PQ8A 4H2KA 3GLJA 3D2PA 5C82A 3KI9A 4HNYB 3PEIA 1Z9UA 3V7ZA 3G3SA 4B5OA 2IMOA 4MJ8A 3GYAA 3WABA 2ZEEA 4QBJA 1TXRA 3H5ZA 2FS5A 4U9YA 2CIJA 5H86A 1S7NA 3EC4A 4MFPA 4OC3A 4R3KA 1I1DA 2ZEOA 2O53A 3CXQA 1S7LA 1LRZA 2OZUA 2VZZA 4GXHA 3W6XA 3PB6X 4EFDA 4H6UA 4R87A 2R8VA 1ZG7A 3D7HA 2CNSA 2JBJA 2DPTA 5CNPA 1Z5RA 1CJWA 3BHXA 3DLJA 4KVXA 2B3VA 3IFEA 3BI0A 4EVYA 1DE4C 5AG5A 4MHNA 4ZY1A 5KTCA 4MHDA 4XPKA 1YVOA 3K2KA 2OOTA 4UCNA 5KTAA 2JEWA 4CAVA 2PSWA 3ISZA 1H8LA 2CNTA 4UWJA 4B6ZA 4CRZB 4OC1A 5JM6A 5C88A 4CAFA 1ZO0A 3R1KA 4AG7A 2QVPA 2OH1A 3TOBA 5JPHA 1YMEA 4KUBA 1IB1E 2P0WA 1OZPA 2FSRA 4TNUA 2BL1A 2G0BA 4ZBGA 1S7FA 1YGHA 3D8PA 1LAPA 2G9DA 1M44A 1ELMP 2Q43A 2VZYA 4UEFA 2Z11A 3RYOA 2CNMA 2HB6A 2NYQA 4C68A 4Y49C 2PJ6A 3PB4X 5J1QA 4KOSA 3I1UA 1CPXA 3MRUA 4CYOA 2V8HA 1CP7A 2VL1A 3A9LA 3PZJA 4ZY2A 2JDDA 5H84A 3IU2A 1CPSA 4XPDC 3FECA 1XJOA 4JXRA 4UF4A 1F57A 4A38A 2O28A 1P4NA 2JLMA 4PPZA 1XEBA 3JUWA 4MXUA 5EC4A 1VIXA 5ELYA 3PB7X 4AXVA 2VXKA 2PDOA 1FY7A 3L2NA 4I49A 4NJQA 4UBRA 4FD7A 3N5FA 1RO5A 5ISVA 3HLPA 1PU9A 1KUXA 1RXTA 2Y0MA 3I9SA 4GM5A 4F9UA 3QB8A 4KOVA 3TX8A 3PFEA 3H8EA 1X12A 4MY3A 1XBUA 4H89A 4ONWA 1X10A 1AYEA 2OZHA 2P6FA 2Z10A 3JRUA 4PXCA 4FD4A 2ZW4A 4IHMA 3B7IA 2Q04A 5LYDA 5J8CA 1KUVA 2ZEGA 3PGPA 4CYPA 1YW4A 3NH8A 2DEAA 4ONUA 3N7ZA 3ISXA 4RN7A 1ZG8A 2ZW7A 1XMTA 2OR4A 4NEXA 1Q2YA 5LRGA 5LYIA 3KR5A 2AFZA 3B3VA 2ARHA 2Z3OA 4P10A 5F46A 4NGPA 2PRQA 2FXFA 2PJ0A 3LD2A 4JD6A 4FD5A 4MMOA 1TIQA 4OC0A 1CG2A 5AGEA 4KORA 2QMLA 3B3TA 3S9MA 4P45A 2PJ7A 2I3CA 4L8AA 1S5KA 2PE3A 3CDXA 4ZX8A 4K3NA 4P4EA 4Z65A 1P0HA 5A27A 2DXQA 3B3CA 3PFOA 2IQ6A 4JXQA 2YNCC 5E96A 5IB9A 4KOUA 4KLWA 3CT9A 4F0YA 5F48A 3CXPA 4K30A 3RAMA 5LRKA 2GE3A 3FEEA 4FUUA 5I4MA 2WYRA 1J4JA 4CYQA 2ZW5A 2BOAA 2ZEFA 1ARMA 1F2OA 2VEZA 3DNSA 3GKRA 3KR4A 3NA6A 3TCVA 4OC5A 4B14A 1IYKA 3LMSA 4P4BA 3IWEA 5IV0A 2PC1A 3NH4A 3NH5A 3VATA 4A37A 2CTBA 3S6HA 4MHYA 4AB7A 1KZFA 3TFYA 2PJ4A 1PYTB 2Z0ZA 4MCSA 1Z8WA 3FRMA 4F6AA 1A2ZA 2BO9A 3S6KA 5HH1A 2C6CA 4C2YA 3W6SA 2EBJA 4CGNA 3GB0A 3GIUA 1TKFA 1GHEA 2DF5A 4BBHA 2BUEA 4YFJA 4PK3A 2BCOA 3RBUA 2Q7SA 4MCPA 4A39A 4MI4A 2FIWA 4NGRA 2BSWA 2PJAA 3R96A 3FX6A 1M1DA 1R3NA 2H5MA 3FIXA 2FIAA 2HQYA 3EFAA 3R9FA 5CPAA 4F9VA 2B4DB 3FBUA 4P4IA 1PUAA 4Y49B 5G1ZA 3OWCA 3DSBA 1CP6A 1CM0A 1LFWA 4JYWA 4B11A 2R7HA 2Q51A 5HVGA 4PSXA 1LANA 4E8OA 1Y0YA 3LACA 1Q2CA 3BXMA 3FNCA 4MFZA 1NSLA 4KZTA 4XPDB 3PB8X 4R8FA 4BINA 2DPSA 2Z3NA 3LWUA 3RO0A 4JWPA 1XOVA 2JBKA 4X8IA 4XPLA 4AVBA 5HXDA 2J8MA 3WR7A 5BWAB 4CYNA 1IICA 3DDDA 3WC5A 4FBEA 2B5GA 4EWTA 3SI2A 4PXEA 2R1IA 1KUYA 1XRYA 3EXNA 4ORFA 4PXDA 4JJXA 4CAXA 2HV2A 3E0KA 3MGDA 4OKOA 4NGMA 4U5YA 1R43A 3TOAA 5G22A 4MFQA 2PRBA 3ZZIA 4AVCA 2QECA 1L0CA 1LAMA 3D7FA 4R6TA 1RTQA 5D29A 2Q4YA 2XEGA 3FH4A 5LRJA 2ZW6A 3FF3A 3JVNA 4UIAA 2GLFA 4OC4A 4R57A 3IGRA 3KZWA 2J8RA 4NJRA 1XE4A 1Y0RA 3QAHA 3SXOA 3T8WA 3VARA 3IIBA 5I0CA 3ZJ0A 1YX0A 2XEFA 3DGVA 4BMHA 4KVOE 4PK2A 4UEZA 2IJZA 1M4DA 1Y9WA 1M4LA 4HNXB 3G8WA 3RNZA 1UWYA 2PR8A 2XEJA 2CY2A 4FWUA 1YK3A 2PJ9A 5HMNA 2XEIA 3H4QA 2V8DA 2B4DA 4QB9A 3D66A 5AG7A 2D4PA 2F7VA 2EO8A 2PJ1A 2ZXVA 4IUSA 1Q7LA 4OAEA 1V0CA 4P44A 4A94A 4NSQA 4W9YA 4A95A 1CBXA 3TO6A 2GLJA 1ZG9A 2OZGA 3D3SA 4DYOA 2PJ5A 2CF4A 3F8KA 3GUXA 2G3TA 2GFQA 3R9GA 4JLYA 2WZNA 2AFSA 2QJ8A 4A32A 2GREA 1IYLA 5JGFA 4II9A 2PJBA 3PBEA 4C7HA 4UFWA 7CPAA 4DUKA 4UEEA 4E0AA 1IY7A 2REFA 2YNDA 2VBQA 3CXSA 2F5IA 1VKCA 4F0XA 2CTCA 4F8ZA 2PJ2A 2B4BA 3IC1A 4MY0A 1XF8A 3SJGA 1TKHA 4QUSA 1MJ9A 4UCPA 4MFLA 4MHZA 2EK9A 4XNHB 3WC6A 4KOWA 2WUUA 4LX9A 3K9UA 4NGNA 4YWYA 4B12A 2Z3PA 4RI1A 2KCWA 1BPNA 4R7MA 5AG6A 2FE7A 4M6IA 3DR6A 2EK8A 2WPXA 4EMEA 3GY9A 1VHEA 1B6BA 3DR8A 1YREA 4OP4A 3FEDA 4NCZA 3F0AA 3WC7A 3TO9A 2OB0A 3IU1A 2C1CA 4KOTA 2I00A 2PR1A 1MJBA 4WJBA 4CRYB 2RB7A 2HC9A 4X2TA 3WT4A 2FL4A 5IX3A 2JDCA 4AG9A 2C6GA 3EY5A 1FT7A 4IF5A 2VQYA 4KS9A 3FYNA 2PJ8A 2PJCA 2PCUA 4IK2A 4C7IA 2C6PA 1IU8A 1VHSA 4FAIA 1Y7RA 1Y7EA 2YNCA 3IWWA 2O4HA 4DJLA 2FT0A 3K9TA 2K5TA 1BO4A 1BOBA 1YLOA 1ZLIA 2PJ3A 1TF8A 2WSAA 1ZLHA 4NGSA 4B13A 2PVWA 1MJAA 4XNHC 4HNWB 1U6MA 2P6EA 4MCQA 4WWVA 4RUHA 4QC6A 4UWIA 5DWMA 4BD9A 1B87A 2AFOA 3W91A 2ATRA 1SQHA 4MFJA 3B35A 1QSTA 2AFUA 4KUAA 5F09A 5JH9A 4P4DA 4NGQA 4O23A 1XFOA 2YGWA 5K8OA 2AFWA 3IJ3A 1Z8XA 4X5KA 1YR0A 4KOYA 1FNOA 3KKWA 4LUAA 3TE4A 3NE7A 2RC4A 4KSFA 1GYTA 2Z3LA 3D68A 1XMBA 1ON0A 2ZOFA 4KSAA 4KOXA 1AMPA 2GU2A 4LQ6A 4ZY0A 5K8NA 5K8PA 4ZYQA 3KHZA 5GCNA 1NMTA 3LODA 3B3WA 4JZ0A 4Q7AA 4Q36A 2NSMA 3TT2A 1XIXA 4YRHA 3PP9A 1VHOA 1Y9KA 1CX8A 3SJEA 2B3UA 3C26A 4CAEA 4L89A 2EWBA 3T9YA 3QNVA 5LYLA 2FCKA 3FB3A 4P4FA 2ODFA 5F49A 3CPAA 4X3RA 3VWDA 1M4IA 3CZXA 3KHXA 1S7KA 2IL4A 5EMIA 3D67A 3VH9A 3S9LA 5AG4A 4UA3A 1TF9A 2Q0YA 2ZOGA 4HKFA 3SJFA 1NSAA 4ZGYB 3CPXA 3V38A 3B8GA 4UIBA 2V8GA 4P6YA 5J8FA 3HUVA 4KVME 2ANPA 4RS2A 4C2XA 1Z2LA 2R98A 3FXTA 4OIWA 2VI7A 2AJ6A 3BLNA 3P2FA 5DWNA 1I21A 3BI1A 3NFZA 6CPAA 1LOKA 3TTHA 3JTKA 2ZEPA 3NE8A 4MHPA 2EUIA 4TWEA 3TO7A 4Q38A 1OBRA 3KQZA 3SHPA 2ZEDA 4ZX9A 3SI0A 1UFHA 3TC8A 4YGOA 3SJXA 5CBMA 1JWQA 4OIDA 2ZPAA 4OADA 3VWEA 2Q4ZA 1QQ9A 4AVAA
chains in the Genus database with same CATH topology
4PV6A 2AE6A 4CS0B 1K4JA 4CAWA 4UFXA 2GIVA 1QSRA 1S3ZA 3T90A 4DNCA 5IB0A 5FVJA 5G21A 2J8NA 4QVTA 4UCMA 2WPWA 4GS4A 3UY5A 2Z3KA 4J3GA 4PSWA 4B5PB 4M3SA 1WWZA 4UFVA 1I12A 5KTDA 1S60A 4CGMA 3S6GA 5G20A 1NE9A 4A2ZA 4OLLA 3I3GA 5EBVA 2A4NA 3V8IA 4KLVA 2CXAA 2EVNA 1Q2DA 1QSOA 4CGOA 3S6FA 1YVKA 2P6GA 2Z3MA 3IWGA 4R3LA 1Z4RA 3SXNA 2D4OA 3F5BA 1YLEA 4B10A 2HUZA 1QSNA 1M4GA 3BJ7A 2OU2A 1MK4A 1Z4EA 4A33A 4NF1A 1IIDA 2QIRA 4A31A 5F47A 3EO4A 2BEIA 2GANA 1WK4A 2B58A 2G3AA 4R9MA 4FD6A 4M85A 2NMTA 4A30A 1R57A 4MBUA 2I79A 2Q44A 4H6ZA 3P2HA 3R95A 1N71A 2B5GB 4C2ZA 4E2AA 4CGPA 4CGLA 4NXYA 4U9ZA 3D2MA 2JEVA 4MFKA 1QSMA 5JQ4A 2YNEA 2Q4VA 3R9EA 3BJ8A 2X7BA 2REEA 2Q7BA 4B5PA 5A28A 2C27A 2PQ8A 3D2PA 5C82A 4HNYB 1Z9UA 3G3SA 4B5OA 4MJ8A 3GYAA 4QBJA 3H5ZA 2FS5A 4U9YA 5H86A 1S7NA 3EC4A 4MFPA 4R3KA 1I1DA 3CXQA 1S7LA 1LRZA 2OZUA 2VZZA 3W6XA 4H6UA 4R87A 2R8VA 2CNSA 2DPTA 5CNPA 1CJWA 4KVXA 2B3VA 4EVYA 5AG5A 5KTCA 4MHDA 4XPKA 1YVOA 4UCNA 5KTAA 4CAVA 2PSWA 2CNTA 4UWJA 4CRZB 5C88A 4CAFA 1ZO0A 3R1KA 4AG7A 3TOBA 2OH1A 5JPHA 4KUBA 1IB1E 2P0WA 1OZPA 2FSRA 4ZBGA 2BL1A 2G0BA 1S7FA 1YGHA 3D8PA 1M44A 2VZYA 2Z11A 3RYOA 2CNMA 4C68A 4Y49C 4KOSA 4CYOA 3A9LA 3PZJA 2JDDA 5H84A 3IU2A 4XPDC 4JXRA 2O28A 1P4NA 2JLMA 1XEBA 3JUWA 5EC4A 2VXKA 2PDOA 1FY7A 4UBRA 4I49A 4FD7A 1RO5A 5ISVA 1PU9A 1KUXA 1RXTA 2Y0MA 3I9SA 3QB8A 4KOVA 4MY3A 4H89A 2OZHA 2Z10A 2P6FA 4FD4A 2ZW4A 2Q04A 5J8CA 1KUVA 3PGPA 4CYPA 4ONUA 3N7ZA 2ZW7A 1XMTA 4NEXA 1Q2YA 2ARHA 2Z3OA 5F46A 2FXFA 3LD2A 4JD6A 4FD5A 1TIQA 5AGEA 4KORA 2QMLA 4L8AA 1S5KA 1P0HA 5A27A 2DXQA 4JXQA 2YNCC 5E96A 4KOUA 4KLWA 4F0YA 5F48A 3CXPA 4K30A 2GE3A 1J4JA 4CYQA 2ZW5A 2VEZA 3DNSA 3GKRA 3TCVA 4B14A 1IYKA 5IV0A 3IWEA 2PC1A 4AB7A 3TFYA 3S6HA 1KZFA 2Z0ZA 3FRMA 4F6AA 3S6KA 5HH1A 4C2YA 3W6SA 4CGNA 1GHEA 4BBHA 2BUEA 4YFJA 4PK3A 4MI4A 2FIWA 2BSWA 3R96A 1M1DA 2H5MA 3FIXA 2FIAA 2HQYA 3EFAA 3R9FA 2B4DB 3FBUA 1PUAA 4Y49B 5G1ZA 3OWCA 3DSBA 1CM0A 4B11A 2R7HA 4PSXA 4E8OA 1Q2CA 3FNCA 4MFZA 1NSLA 4KZTA 4XPDB 2DPSA 2Z3NA 4JWPA 4XPLA 4AVBA 2J8MA 3WR7A 5BWAB 4CYNA 1IICA 3DDDA 2B5GA 2R1IA 1KUYA 3EXNA 4ORFA 4JJXA 4CAXA 2HV2A 3E0KA 3MGDA 4U5YA 3ZZIA 3TOAA 5G22A 4MFQA 2PRBA 4AVCA 2QECA 1L0CA 2Q4YA 2ZW6A 3JVNA 4R57A 3IGRA 2J8RA 1XE4A 3QAHA 3SXOA 5I0CA 3ZJ0A 1YX0A 4BMHA 4KVOE 4PK2A 1M4DA 1Y9WA 4HNXB 3G8WA 2PR8A 2CY2A 1YK3A 5HMNA 3H4QA 2B4DA 4QB9A 5AG7A 2D4PA 2ZXVA 4IUSA 4OAEA 1V0CA 4NSQA 4A95A 3TO6A 2OZGA 3D3SA 3R9GA 3F8KA 2G3TA 4JLYA 4II9A 4A32A 1IYLA 4C7HA 4UFWA 4E0AA 2REFA 2YNDA 2VBQA 3CXSA 2F5IA 1VKCA 4F0XA 2B4BA 4MY0A 1XF8A 4QUSA 1MJ9A 4UCPA 4MFLA 4XNHB 4KOWA 2WUUA 4LX9A 3K9UA 4B12A 2Z3PA 4RI1A 2KCWA 5AG6A 2FE7A 3DR6A 2WPXA 3GY9A 1B6BA 3DR8A 1YREA 4NCZA 3F0AA 3TO9A 2OB0A 3IU1A 4KOTA 2I00A 2PR1A 1MJBA 4CRYB 2FL4A 5IX3A 2JDCA 4AG9A 3EY5A 4IF5A 2VQYA 4KS9A 3FYNA 4C7IA 1VHSA 1Y7RA 2YNCA 2FT0A 2K5TA 1BOBA 1BO4A 2WSAA 4B13A 4XNHC 1MJAA 4HNWB 1U6MA 2P6EA 4QC6A 4UWIA 5DWMA 1B87A 3W91A 2ATRA 1SQHA 4MFJA 1QSTA 4KUAA 2YGWA 4X5KA 1YR0A 4KOYA 3KKWA 4LUAA 3TE4A 3NE7A 2RC4A 4KSFA 2Z3LA 1ON0A 4KSAA 4KOXA 5GCNA 1NMTA 3LODA 3TT2A 4Q36A 1XIXA 4YRHA 3PP9A 1Y9KA 2B3UA 3C26A 4CAEA 4L89A 3T9YA 2FCKA 3FB3A 5F49A 3VWDA 1M4IA 1S7KA 2IL4A 5AG4A 4UA3A 2Q0YA 4HKFA 4ZGYB 3B8GA 5J8FA 4KVME 4RS2A 4C2XA 2R98A 3FXTA 2VI7A 2AJ6A 3BLNA 3P2FA 5DWNA 1I21A 3TTHA 3JTKA 3TO7A 2EUIA 4Q38A 3SHPA 1UFHA 4YGOA 2ZPAA 4OADA 3VWEA 4AVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PV6 A;  2AE6 A;  4CS0 B;  1K4J A;  4CAW A;  2GIV A;  1QSR A;  1S3Z A;  3T90 A;  4DNC A;  5IB0 A;  5FVJ A;  2J8N A;  4QVT A;  2WPW A;  4GS4 A;  3UY5 A;  4J3G A;  4PSW A;  4B5P B;  4M3S A;  1WWZ A;  1I12 A;  5KTD A;  1S60 A;  3S6G A;  1NE9 A;  4OLL A;  3I3G A;  5EBV A;  2A4N A;  3V8I A;  4KLV A;  2EVN A;  1Q2D A;  1QSO A;  3S6F A;  1YVK A;  2P6G A;  3IWG A;  4R3L A;  1Z4R A;  3SXN A;  2D4O A;  3F5B A;  1YLE A;  2HUZ A;  1QSN A;  1M4G A;  3BJ7 A;  2OU2 A;  1MK4 A;  1Z4E A;  4NF1 A;  1IID A;  2QIR A;  5F47 A;  3EO4 A;  2BEI A;  2GAN A;  1WK4 A;  2B58 A;  2G3A A;  4R9M A;  4FD6 A;  4M85 A;  2NMT A;  1R57 A;  4MBU A;  2I79 A;  2Q44 A;  4H6Z A;  3P2H A;  3R95 A;  1N71 A;  2B5G B;  4E2A A;  4NXY A;  4U9Z A;  3D2M A;  2JEV A;  1QSM A;  5JQ4 A;  2Q4V A;  3R9E A;  3BJ8 A;  2X7B A;  2REE A;  2Q7B A;  4B5P A;  2C27 A;  2PQ8 A;  3D2P A;  5C82 A;  4HNY B;  1Z9U A;  3G3S A;  4B5O A;  4MJ8 A;  3GYA A;  4QBJ A;  5H86 A;  2FS5 A;  4U9Y A;  1S7N A;  3EC4 A;  4R3K A;  1I1D A;  3CXQ A;  1S7L A;  1LRZ A;  2OZU A;  2VZZ A;  3W6X A;  4H6U A;  4R87 A;  2R8V A;  2CNS A;  5CNP A;  1CJW A;  4KVX A;  2B3V A;  4EVY A;  5KTC A;  4MHD A;  4XPK A;  1YVO A;  5KTA A;  4CAV A;  2PSW A;  2CNT A;  4UWJ A;  4CRZ B;  5C88 A;  3R1K A;  4AG7 A;  3TOB A;  2OH1 A;  5JPH A;  4KUB A;  1IB1 E;  2P0W A;  1OZP A;  2FSR A;  4ZBG A;  2BL1 A;  2G0B A;  1S7F A;  1YGH A;  3D8P A;  1M44 A;  2VZY A;  2Z11 A;  3RYO A;  2CNM A;  4Y49 C;  4KOS A;  3PZJ A;  2JDD A;  5H84 A;  4XPD C;  4JXR A;  2O28 A;  1P4N A;  2JLM A;  1XEB A;  3JUW A;  5EC4 A;  2VXK A;  2PDO A;  1FY7 A;  4UBR A;  4I49 A;  4FD7 A;  1RO5 A;  5ISV A;  1PU9 A;  1KUX A;  1RXT A;  2Y0M A;  3I9S A;  3QB8 A;  4KOV A;  4MY3 A;  4H89 A;  2OZH A;  2Z10 A;  2P6F A;  4FD4 A;  2ZW4 A;  2Q04 A;  5J8C A;  1KUV A;  3PGP A;  4ONU A;  3N7Z A;  2ZW7 A;  1XMT A;  4NEX A;  1Q2Y A;  2ARH A;  5F46 A;  2FXF A;  3LD2 A;  4JD6 A;  4FD5 A;  1TIQ A;  4KOR A;  2QML A;  4L8A A;  1S5K A;  1P0H A;  2DXQ A;  4JXQ A;  5E96 A;  4KOU A;  4KLW A;  4F0Y A;  5F48 A;  3CXP A;  4K30 A;  2GE3 A;  1J4J A;  2ZW5 A;  2VEZ A;  3DNS A;  3GKR A;  3TCV A;  1IYK A;  5IV0 A;  2PC1 A;  4AB7 A;  3TFY A;  3S6H A;  1KZF A;  2Z0Z A;  3FRM A;  4F6A A;  3S6K A;  5HH1 A;  3W6S A;  1GHE A;  2BUE A;  4YFJ A;  4PK3 A;  4MI4 A;  2FIW A;  2BSW A;  3R96 A;  1M1D A;  2H5M A;  3FIX A;  2FIA A;  2HQY A;  3EFA A;  3R9F A;  2B4D B;  3FBU A;  1PUA A;  4Y49 B;  3OWC A;  3DSB A;  1CM0 A;  2R7H A;  4PSX A;  4E8O A;  1Q2C A;  3FNC A;  1NSL A;  4KZT A;  4XPD B;  4JWP A;  4XPL A;  4AVB A;  2J8M A;  3WR7 A;  1IIC A;  3DDD A;  2B5G A;  2R1I A;  1KUY A;  3EXN A;  4ORF A;  4JJX A;  4CAX A;  2HV2 A;  3E0K A;  3MGD A;  4U5Y A;  3ZZI A;  3TOA A;  2PRB A;  4AVC A;  2QEC A;  1L0C A;  2Q4Y A;  2ZW6 A;  3JVN A;  4R57 A;  3IGR A;  2J8R A;  1XE4 A;  3QAH A;  3SXO A;  5I0C A;  3ZJ0 A;  1YX0 A;  4BMH A;  4KVO E;  4PK2 A;  1M4D A;  1Y9W A;  4HNX B;  3G8W A;  2PR8 A;  2CY2 A;  1YK3 A;  5HMN A;  3H4Q A;  2B4D A;  4QB9 A;  2D4P A;  2ZXV A;  4IUS A;  4OAE A;  1V0C A;  4NSQ A;  3TO6 A;  2OZG A;  3D3S A;  3R9G A;  3F8K A;  2G3T A;  4JLY A;  4II9 A;  1IYL A;  4E0A A;  2REF A;  2VBQ A;  3CXS A;  2F5I A;  1VKC A;  2B4B A;  4MY0 A;  1XF8 A;  4QUS A;  1MJ9 A;  4XNH B;  4KOW A;  4LX9 A;  3K9U A;  4RI1 A;  2KCW A;  2FE7 A;  3DR6 A;  2WPX A;  3GY9 A;  1B6B A;  3DR8 A;  1YRE A;  4NCZ A;  3F0A A;  3TO9 A;  2OB0 A;  4KOT A;  2I00 A;  2PR1 A;  1MJB A;  4CRY B;  2FL4 A;  5IX3 A;  2JDC A;  4AG9 A;  3EY5 A;  4IF5 A;  2VQY A;  3FYN A;  1VHS A;  1Y7R A;  2FT0 A;  2K5T A;  1BOB A;  1BO4 A;  4XNH C;  1MJA A;  4HNW B;  1U6M A;  2P6E A;  4QC6 A;  4UWI A;  5DWM A;  1B87 A;  3W91 A;  2ATR A;  1SQH A;  1QST A;  4KUA A;  4X5K A;  1YR0 A;  4KOY A;  3KKW A;  4LUA A;  3TE4 A;  3NE7 A;  2RC4 A;  1ON0 A;  4KOX A;  5GCN A;  1NMT A;  3LOD A;  3TT2 A;  1XIX A;  4YRH A;  3PP9 A;  1Y9K A;  2B3U A;  3C26 A;  4L89 A;  3T9Y A;  2FCK A;  3FB3 A;  5F49 A;  3VWD A;  1M4I A;  1S7K A;  2IL4 A;  4UA3 A;  2Q0Y A;  4HKF A;  3B8G A;  5J8F A;  4KVM E;  4RS2 A;  2R98 A;  3FXT A;  2VI7 A;  2AJ6 A;  3BLN A;  3P2F A;  5DWN A;  1I21 A;  3TTH A;  3TO7 A;  2EUI A;  3SHP A;  1UFH A;  4YGO A;  2ZPA A;  4OAD A;  3VWE A;  4AVA A; 
#chains in the Genus database with same CATH topology
 1LCP A;  1Z8L A;  3D7D A;  1IOF A;  4PV6 A;  5THW A;  2ZEM A;  2AE6 A;  4CS0 B;  1K4J A;  5K8M A;  4ZI6 A;  1YQE A;  4CAW A;  4UFX A;  1F2P A;  2GIV A;  1QMU A;  1QSR A;  1S3Z A;  2ZEH A;  4OME A;  1HDQ A;  3T90 A;  1KWM A;  4DNC A;  8CPA A;  4M6G A;  1AUG A;  2POK A;  4PXB A;  1BAV A;  2PIZ A;  2V8V A;  5FVJ A;  2J8N A;  3KGQ A;  5G21 A;  1BPM A;  5IB0 A;  4QVT A;  4UCM A;  2WPW A;  4GS4 A;  3UY5 A;  2Z3K A;  4J3G A;  5LYF A;  4NGT A;  3IO1 A;  2ZEL A;  1JQG A;  4PSW A;  4B5P B;  3IEH A;  3PB9 X;  4M3S A;  1WWZ A;  4UFV A;  1I12 A;  1PCA A;  2F8H A;  2RFH A;  2PVV A;  5KTD A;  4R76 A;  1S60 A;  4CGM A;  3S6G A;  5G20 A;  2ABZ A;  1NE9 A;  3KL9 A;  4A2Z A;  4KSI A;  4OLL A;  4M6H A;  3KAS A;  1HDU A;  3I3G A;  5EBV A;  2A4N A;  3V8I A;  3PRT A;  3H8G A;  1DTD A;  4KLV A;  2CXA A;  3SI1 A;  2EVN A;  1IGB A;  1Q2D A;  1QSO A;  3FVL A;  4CGO A;  3S6F A;  4PQA A;  1YVK A;  3FJU A;  2P6G A;  2Z3M A;  3IWG A;  4R3L A;  1Z4R A;  5HVF A;  3SXN A;  1ELL P;  1VGY A;  2PIY A;  2D4O A;  2V77 A;  3F5B A;  1YLE A;  4P4J A;  1BLL E;  4B10 A;  4OC2 A;  2HUZ A;  1EE3 P;  1QSN A;  1M4G A;  3QAY A;  3BJ7 A;  2OU2 A;  2ZEN A;  1MK4 A;  1Z4E A;  4A33 A;  4NF1 A;  1IID A;  2QIR A;  4A31 A;  5F47 A;  3KQX A;  3EO4 A;  2BEI A;  2GAN A;  4YU9 A;  1WK4 A;  4G1P A;  2B58 A;  2G3A A;  1TKJ A;  4R9M A;  4FD6 A;  3H8F A;  4M85 A;  1HEE A;  2QYV A;  2NMT A;  4A30 A;  2AFX A;  1R57 A;  3B2Y A;  2I79 A;  2Q44 A;  4H6Z A;  2AFM A;  3P2H A;  3PBB A;  4MBU A;  3R95 A;  1N71 A;  3RZA A;  5DS0 A;  2B5G B;  4MRI A;  4C2Z A;  4E2A A;  4CGP A;  2J9A A;  4CGL A;  4MCR A;  4IAV A;  4HPS A;  4NXY A;  4U9Z A;  4LQG A;  5D8N A;  3S9N A;  1YSJ A;  4CPA A;  3D2M A;  3D4U A;  3D7G A;  5HVH A;  4NFR A;  1ARL A;  3B3S A;  1Z8T A;  2JEV A;  4MFK A;  1QSM A;  5JQ4 A;  2YNE A;  2Q4V A;  1YW6 A;  3R9E A;  2FVG A;  3BJ8 A;  2X7B A;  3FMC A;  2REE A;  3MN8 A;  2Q7B A;  4B5P A;  5A28 A;  1IOI A;  2C27 A;  2PQ8 A;  4H2K A;  3GLJ A;  3D2P A;  5C82 A;  3KI9 A;  4HNY B;  3PEI A;  1Z9U A;  3V7Z A;  3G3S A;  4B5O A;  2IMO A;  4MJ8 A;  3GYA A;  3WAB A;  2ZEE A;  4QBJ A;  1TXR A;  3H5Z A;  2FS5 A;  4U9Y A;  2CIJ A;  5H86 A;  1S7N A;  3EC4 A;  4MFP A;  4OC3 A;  4R3K A;  1I1D A;  2ZEO A;  2O53 A;  3CXQ A;  1S7L A;  1LRZ A;  2OZU A;  2VZZ A;  4GXH A;  3W6X A;  3PB6 X;  4EFD A;  4H6U A;  4R87 A;  2R8V A;  1ZG7 A;  3D7H A;  2CNS A;  2JBJ A;  2DPT A;  5CNP A;  1Z5R A;  1CJW A;  3BHX A;  3DLJ A;  4KVX A;  2B3V A;  3IFE A;  3BI0 A;  4EVY A;  1DE4 C;  5AG5 A;  4MHN A;  4ZY1 A;  5KTC A;  4MHD A;  4XPK A;  1YVO A;  3K2K A;  2OOT A;  4UCN A;  5KTA A;  2JEW A;  4CAV A;  2PSW A;  3ISZ A;  1H8L A;  2CNT A;  4UWJ A;  4B6Z A;  4CRZ B;  4OC1 A;  5JM6 A;  5C88 A;  4CAF A;  1ZO0 A;  3R1K A;  4AG7 A;  2QVP A;  2OH1 A;  3TOB A;  5JPH A;  1YME A;  4KUB A;  1IB1 E;  2P0W A;  1OZP A;  2FSR A;  4TNU A;  2BL1 A;  2G0B A;  4ZBG A;  1S7F A;  1YGH A;  3D8P A;  1LAP A;  2G9D A;  1M44 A;  1ELM P;  2Q43 A;  2VZY A;  4UEF A;  2Z11 A;  3RYO A;  2CNM A;  2HB6 A;  2NYQ A;  4C68 A;  4Y49 C;  2PJ6 A;  3PB4 X;  5J1Q A;  4KOS A;  3I1U A;  1CPX A;  3MRU A;  4CYO A;  2V8H A;  1CP7 A;  2VL1 A;  3A9L A;  3PZJ A;  4ZY2 A;  2JDD A;  5H84 A;  3IU2 A;  1CPS A;  4XPD C;  3FEC A;  1XJO A;  4JXR A;  4UF4 A;  1F57 A;  4A38 A;  2O28 A;  1P4N A;  2JLM A;  4PPZ A;  1XEB A;  3JUW A;  4MXU A;  5EC4 A;  1VIX A;  5ELY A;  3PB7 X;  4AXV A;  2VXK A;  2PDO A;  1FY7 A;  3L2N A;  4I49 A;  4NJQ A;  4UBR A;  4FD7 A;  3N5F A;  1RO5 A;  5ISV A;  3HLP A;  1PU9 A;  1KUX A;  1RXT A;  2Y0M A;  3I9S A;  4GM5 A;  4F9U A;  3QB8 A;  4KOV A;  3TX8 A;  3PFE A;  3H8E A;  1X12 A;  4MY3 A;  1XBU A;  4H89 A;  4ONW A;  1X10 A;  1AYE A;  2OZH A;  2P6F A;  2Z10 A;  3JRU A;  4PXC A;  4FD4 A;  2ZW4 A;  4IHM A;  3B7I A;  2Q04 A;  5LYD A;  5J8C A;  1KUV A;  2ZEG A;  3PGP A;  4CYP A;  1YW4 A;  3NH8 A;  2DEA A;  4ONU A;  3N7Z A;  3ISX A;  4RN7 A;  1ZG8 A;  2ZW7 A;  1XMT A;  2OR4 A;  4NEX A;  1Q2Y A;  5LRG A;  5LYI A;  3KR5 A;  2AFZ A;  3B3V A;  2ARH A;  2Z3O A;  4P10 A;  5F46 A;  4NGP A;  2PRQ A;  2FXF A;  2PJ0 A;  3LD2 A;  4JD6 A;  4FD5 A;  4MMO A;  1TIQ A;  4OC0 A;  1CG2 A;  5AGE A;  4KOR A;  2QML A;  3B3T A;  3S9M A;  4P45 A;  2PJ7 A;  2I3C A;  4L8A A;  1S5K A;  2PE3 A;  3CDX A;  4ZX8 A;  4K3N A;  4P4E A;  4Z65 A;  1P0H A;  5A27 A;  2DXQ A;  3B3C A;  3PFO A;  2IQ6 A;  4JXQ A;  2YNC C;  5E96 A;  5IB9 A;  4KOU A;  4KLW A;  3CT9 A;  4F0Y A;  5F48 A;  3CXP A;  4K30 A;  3RAM A;  5LRK A;  2GE3 A;  3FEE A;  4FUU A;  5I4M A;  2WYR A;  1J4J A;  4CYQ A;  2ZW5 A;  2BOA A;  2ZEF A;  1ARM A;  1F2O A;  2VEZ A;  3DNS A;  3GKR A;  3KR4 A;  3NA6 A;  3TCV A;  4OC5 A;  4B14 A;  1IYK A;  3LMS A;  4P4B A;  3IWE A;  5IV0 A;  2PC1 A;  3NH4 A;  3NH5 A;  3VAT A;  4A37 A;  2CTB A;  3S6H A;  4MHY A;  4AB7 A;  1KZF A;  3TFY A;  2PJ4 A;  1PYT B;  2Z0Z A;  4MCS A;  1Z8W A;  3FRM A;  4F6A A;  1A2Z A;  2BO9 A;  3S6K A;  5HH1 A;  2C6C A;  4C2Y A;  3W6S A;  2EBJ A;  4CGN A;  3GB0 A;  3GIU A;  1TKF A;  1GHE A;  2DF5 A;  4BBH A;  2BUE A;  4YFJ A;  4PK3 A;  2BCO A;  3RBU A;  2Q7S A;  4MCP A;  4A39 A;  4MI4 A;  2FIW A;  4NGR A;  2BSW A;  2PJA A;  3R96 A;  3FX6 A;  1M1D A;  1R3N A;  2H5M A;  3FIX A;  2FIA A;  2HQY A;  3EFA A;  3R9F A;  5CPA A;  4F9V A;  2B4D B;  3FBU A;  4P4I A;  1PUA A;  4Y49 B;  5G1Z A;  3OWC A;  3DSB A;  1CP6 A;  1CM0 A;  1LFW A;  4JYW A;  4B11 A;  2R7H A;  2Q51 A;  5HVG A;  4PSX A;  1LAN A;  4E8O A;  1Y0Y A;  3LAC A;  1Q2C A;  3BXM A;  3FNC A;  4MFZ A;  1NSL A;  4KZT A;  4XPD B;  3PB8 X;  4R8F A;  4BIN A;  2DPS A;  2Z3N A;  3LWU A;  3RO0 A;  4JWP A;  1XOV A;  2JBK A;  4X8I A;  4XPL A;  4AVB A;  5HXD A;  2J8M A;  3WR7 A;  5BWA B;  4CYN A;  1IIC A;  3DDD A;  3WC5 A;  4FBE A;  2B5G A;  4EWT A;  3SI2 A;  4PXE A;  2R1I A;  1KUY A;  1XRY A;  3EXN A;  4ORF A;  4PXD A;  4JJX A;  4CAX A;  2HV2 A;  3E0K A;  3MGD A;  4OKO A;  4NGM A;  4U5Y A;  1R43 A;  3TOA A;  5G22 A;  4MFQ A;  2PRB A;  3ZZI A;  4AVC A;  2QEC A;  1L0C A;  1LAM A;  3D7F A;  4R6T A;  1RTQ A;  5D29 A;  2Q4Y A;  2XEG A;  3FH4 A;  5LRJ A;  2ZW6 A;  3FF3 A;  3JVN A;  4UIA A;  2GLF A;  4OC4 A;  4R57 A;  3IGR A;  3KZW A;  2J8R A;  4NJR A;  1XE4 A;  1Y0R A;  3QAH A;  3SXO A;  3T8W A;  3VAR A;  3IIB A;  5I0C A;  3ZJ0 A;  1YX0 A;  2XEF A;  3DGV A;  4BMH A;  4KVO E;  4PK2 A;  4UEZ A;  2IJZ A;  1M4D A;  1Y9W A;  1M4L A;  4HNX B;  3G8W A;  3RNZ A;  1UWY A;  2PR8 A;  2XEJ A;  2CY2 A;  4FWU A;  1YK3 A;  2PJ9 A;  5HMN A;  2XEI A;  3H4Q A;  2V8D A;  2B4D A;  4QB9 A;  3D66 A;  5AG7 A;  2D4P A;  2F7V A;  2EO8 A;  2PJ1 A;  2ZXV A;  4IUS A;  1Q7L A;  4OAE A;  1V0C A;  4P44 A;  4A94 A;  4NSQ A;  4W9Y A;  4A95 A;  1CBX A;  3TO6 A;  2GLJ A;  1ZG9 A;  2OZG A;  3D3S A;  4DYO A;  2PJ5 A;  2CF4 A;  3F8K A;  3GUX A;  2G3T A;  2GFQ A;  3R9G A;  4JLY A;  2WZN A;  2AFS A;  2QJ8 A;  4A32 A;  2GRE A;  1IYL A;  5JGF A;  4II9 A;  2PJB A;  3PBE A;  4C7H A;  4UFW A;  7CPA A;  4DUK A;  4UEE A;  4E0A A;  1IY7 A;  2REF A;  2YND A;  2VBQ A;  3CXS A;  2F5I A;  1VKC A;  4F0X A;  2CTC A;  4F8Z A;  2PJ2 A;  2B4B A;  3IC1 A;  4MY0 A;  1XF8 A;  3SJG A;  1TKH A;  4QUS A;  1MJ9 A;  4UCP A;  4MFL A;  4MHZ A;  2EK9 A;  4XNH B;  3WC6 A;  4KOW A;  2WUU A;  4LX9 A;  3K9U A;  4NGN A;  4YWY A;  4B12 A;  2Z3P A;  4RI1 A;  2KCW A;  1BPN A;  4R7M A;  5AG6 A;  2FE7 A;  4M6I A;  3DR6 A;  2EK8 A;  2WPX A;  4EME A;  3GY9 A;  1VHE A;  1B6B A;  3DR8 A;  1YRE A;  4OP4 A;  3FED A;  4NCZ A;  3F0A A;  3WC7 A;  3TO9 A;  2OB0 A;  3IU1 A;  2C1C A;  4KOT A;  2I00 A;  2PR1 A;  1MJB A;  4WJB A;  4CRY B;  2RB7 A;  2HC9 A;  4X2T A;  3WT4 A;  2FL4 A;  5IX3 A;  2JDC A;  4AG9 A;  2C6G A;  3EY5 A;  1FT7 A;  4IF5 A;  2VQY A;  4KS9 A;  3FYN A;  2PJ8 A;  2PJC A;  2PCU A;  4IK2 A;  4C7I A;  2C6P A;  1IU8 A;  1VHS A;  4FAI A;  1Y7R A;  1Y7E A;  2YNC A;  3IWW A;  2O4H A;  4DJL A;  2FT0 A;  3K9T A;  2K5T A;  1BO4 A;  1BOB A;  1YLO A;  1ZLI A;  2PJ3 A;  1TF8 A;  2WSA A;  1ZLH A;  4NGS A;  4B13 A;  2PVW A;  1MJA A;  4XNH C;  4HNW B;  1U6M A;  2P6E A;  4MCQ A;  4WWV A;  4RUH A;  4QC6 A;  4UWI A;  5DWM A;  4BD9 A;  1B87 A;  2AFO A;  3W91 A;  2ATR A;  1SQH A;  4MFJ A;  3B35 A;  1QST A;  2AFU A;  4KUA A;  5F09 A;  5JH9 A;  4P4D A;  4NGQ A;  4O23 A;  1XFO A;  2YGW A;  5K8O A;  2AFW A;  3IJ3 A;  1Z8X A;  4X5K A;  1YR0 A;  4KOY A;  1FNO A;  3KKW A;  4LUA A;  3TE4 A;  3NE7 A;  2RC4 A;  4KSF A;  1GYT A;  2Z3L A;  3D68 A;  1XMB A;  1ON0 A;  2ZOF A;  4KSA A;  4KOX A;  1AMP A;  2GU2 A;  4LQ6 A;  4ZY0 A;  5K8N A;  5K8P A;  4ZYQ A;  3KHZ A;  5GCN A;  1NMT A;  3LOD A;  3B3W A;  4JZ0 A;  4Q7A A;  4Q36 A;  2NSM A;  3TT2 A;  1XIX A;  4YRH A;  3PP9 A;  1VHO A;  1Y9K A;  1CX8 A;  3SJE A;  2B3U A;  3C26 A;  4CAE A;  4L89 A;  2EWB A;  3T9Y A;  3QNV A;  5LYL A;  2FCK A;  3FB3 A;  4P4F A;  2ODF A;  5F49 A;  3CPA A;  4X3R A;  3VWD A;  1M4I A;  3CZX A;  3KHX A;  1S7K A;  2IL4 A;  5EMI A;  3D67 A;  3VH9 A;  3S9L A;  5AG4 A;  4UA3 A;  1TF9 A;  2Q0Y A;  2ZOG A;  4HKF A;  3SJF A;  1NSA A;  4ZGY B;  3CPX A;  3V38 A;  3B8G A;  4UIB A;  2V8G A;  4P6Y A;  5J8F A;  3HUV A;  4KVM E;  2ANP A;  4RS2 A;  4C2X A;  1Z2L A;  2R98 A;  3FXT A;  4OIW A;  2VI7 A;  2AJ6 A;  3BLN A;  3P2F A;  5DWN A;  1I21 A;  3BI1 A;  3NFZ A;  6CPA A;  1LOK A;  3TTH A;  3JTK A;  2ZEP A;  3NE8 A;  4MHP A;  2EUI A;  4TWE A;  3TO7 A;  4Q38 A;  1OBR A;  3KQZ A;  3SHP A;  2ZED A;  4ZX9 A;  3SI0 A;  1UFH A;  3TC8 A;  4YGO A;  3SJX A;  5CBM A;  1JWQ A;  4OID A;  2ZPA A;  4OAD A;  3VWE A;  2Q4Z A;  1QQ9 A;  4AVA A; 
#chains in the Genus database with same CATH homology
 4PV6 A;  2AE6 A;  4CS0 B;  1K4J A;  4CAW A;  4UFX A;  2GIV A;  1QSR A;  1S3Z A;  3T90 A;  4DNC A;  5IB0 A;  5FVJ A;  5G21 A;  2J8N A;  4QVT A;  4UCM A;  2WPW A;  4GS4 A;  3UY5 A;  2Z3K A;  4J3G A;  4PSW A;  4B5P B;  4M3S A;  1WWZ A;  4UFV A;  1I12 A;  5KTD A;  1S60 A;  4CGM A;  3S6G A;  5G20 A;  1NE9 A;  4A2Z A;  4OLL A;  3I3G A;  5EBV A;  2A4N A;  3V8I A;  4KLV A;  2CXA A;  2EVN A;  1Q2D A;  1QSO A;  4CGO A;  3S6F A;  1YVK A;  2P6G A;  2Z3M A;  3IWG A;  4R3L A;  1Z4R A;  3SXN A;  2D4O A;  3F5B A;  1YLE A;  4B10 A;  2HUZ A;  1QSN A;  1M4G A;  3BJ7 A;  2OU2 A;  1MK4 A;  1Z4E A;  4A33 A;  4NF1 A;  1IID A;  2QIR A;  4A31 A;  5F47 A;  3EO4 A;  2BEI A;  2GAN A;  1WK4 A;  2B58 A;  2G3A A;  4R9M A;  4FD6 A;  4M85 A;  2NMT A;  4A30 A;  1R57 A;  4MBU A;  2I79 A;  2Q44 A;  4H6Z A;  3P2H A;  3R95 A;  1N71 A;  2B5G B;  4C2Z A;  4E2A A;  4CGP A;  4CGL A;  4NXY A;  4U9Z A;  3D2M A;  2JEV A;  4MFK A;  1QSM A;  5JQ4 A;  2YNE A;  2Q4V A;  3R9E A;  3BJ8 A;  2X7B A;  2REE A;  2Q7B A;  4B5P A;  5A28 A;  2C27 A;  2PQ8 A;  3D2P A;  5C82 A;  4HNY B;  1Z9U A;  3G3S A;  4B5O A;  4MJ8 A;  3GYA A;  4QBJ A;  3H5Z A;  2FS5 A;  4U9Y A;  5H86 A;  1S7N A;  3EC4 A;  4MFP A;  4R3K A;  1I1D A;  3CXQ A;  1S7L A;  1LRZ A;  2OZU A;  2VZZ A;  3W6X A;  4H6U A;  4R87 A;  2R8V A;  2CNS A;  2DPT A;  5CNP A;  1CJW A;  4KVX A;  2B3V A;  4EVY A;  5AG5 A;  5KTC A;  4MHD A;  4XPK A;  1YVO A;  4UCN A;  5KTA A;  4CAV A;  2PSW A;  2CNT A;  4UWJ A;  4CRZ B;  5C88 A;  4CAF A;  1ZO0 A;  3R1K A;  4AG7 A;  3TOB A;  2OH1 A;  5JPH A;  4KUB A;  1IB1 E;  2P0W A;  1OZP A;  2FSR A;  4ZBG A;  2BL1 A;  2G0B A;  1S7F A;  1YGH A;  3D8P A;  1M44 A;  2VZY A;  2Z11 A;  3RYO A;  2CNM A;  4C68 A;  4Y49 C;  4KOS A;  4CYO A;  3A9L A;  3PZJ A;  2JDD A;  5H84 A;  3IU2 A;  4XPD C;  4JXR A;  2O28 A;  1P4N A;  2JLM A;  1XEB A;  3JUW A;  5EC4 A;  2VXK A;  2PDO A;  1FY7 A;  4UBR A;  4I49 A;  4FD7 A;  1RO5 A;  5ISV A;  1PU9 A;  1KUX A;  1RXT A;  2Y0M A;  3I9S A;  3QB8 A;  4KOV A;  4MY3 A;  4H89 A;  2OZH A;  2Z10 A;  2P6F A;  4FD4 A;  2ZW4 A;  2Q04 A;  5J8C A;  1KUV A;  3PGP A;  4CYP A;  4ONU A;  3N7Z A;  2ZW7 A;  1XMT A;  4NEX A;  1Q2Y A;  2ARH A;  2Z3O A;  5F46 A;  2FXF A;  3LD2 A;  4JD6 A;  4FD5 A;  1TIQ A;  5AGE A;  4KOR A;  2QML A;  4L8A A;  1S5K A;  1P0H A;  5A27 A;  2DXQ A;  4JXQ A;  2YNC C;  5E96 A;  4KOU A;  4KLW A;  4F0Y A;  5F48 A;  3CXP A;  4K30 A;  2GE3 A;  1J4J A;  4CYQ A;  2ZW5 A;  2VEZ A;  3DNS A;  3GKR A;  3TCV A;  4B14 A;  1IYK A;  5IV0 A;  3IWE A;  2PC1 A;  4AB7 A;  3TFY A;  3S6H A;  1KZF A;  2Z0Z A;  3FRM A;  4F6A A;  3S6K A;  5HH1 A;  4C2Y A;  3W6S A;  4CGN A;  1GHE A;  4BBH A;  2BUE A;  4YFJ A;  4PK3 A;  4MI4 A;  2FIW A;  2BSW A;  3R96 A;  1M1D A;  2H5M A;  3FIX A;  2FIA A;  2HQY A;  3EFA A;  3R9F A;  2B4D B;  3FBU A;  1PUA A;  4Y49 B;  5G1Z A;  3OWC A;  3DSB A;  1CM0 A;  4B11 A;  2R7H A;  4PSX A;  4E8O A;  1Q2C A;  3FNC A;  4MFZ A;  1NSL A;  4KZT A;  4XPD B;  2DPS A;  2Z3N A;  4JWP A;  4XPL A;  4AVB A;  2J8M A;  3WR7 A;  5BWA B;  4CYN A;  1IIC A;  3DDD A;  2B5G A;  2R1I A;  1KUY A;  3EXN A;  4ORF A;  4JJX A;  4CAX A;  2HV2 A;  3E0K A;  3MGD A;  4U5Y A;  3ZZI A;  3TOA A;  5G22 A;  4MFQ A;  2PRB A;  4AVC A;  2QEC A;  1L0C A;  2Q4Y A;  2ZW6 A;  3JVN A;  4R57 A;  3IGR A;  2J8R A;  1XE4 A;  3QAH A;  3SXO A;  5I0C A;  3ZJ0 A;  1YX0 A;  4BMH A;  4KVO E;  4PK2 A;  1M4D A;  1Y9W A;  4HNX B;  3G8W A;  2PR8 A;  2CY2 A;  1YK3 A;  5HMN A;  3H4Q A;  2B4D A;  4QB9 A;  5AG7 A;  2D4P A;  2ZXV A;  4IUS A;  4OAE A;  1V0C A;  4NSQ A;  4A95 A;  3TO6 A;  2OZG A;  3D3S A;  3R9G A;  3F8K A;  2G3T A;  4JLY A;  4II9 A;  4A32 A;  1IYL A;  4C7H A;  4UFW A;  4E0A A;  2REF A;  2YND A;  2VBQ A;  3CXS A;  2F5I A;  1VKC A;  4F0X A;  2B4B A;  4MY0 A;  1XF8 A;  4QUS A;  1MJ9 A;  4UCP A;  4MFL A;  4XNH B;  4KOW A;  2WUU A;  4LX9 A;  3K9U A;  4B12 A;  2Z3P A;  4RI1 A;  2KCW A;  5AG6 A;  2FE7 A;  3DR6 A;  2WPX A;  3GY9 A;  1B6B A;  3DR8 A;  1YRE A;  4NCZ A;  3F0A A;  3TO9 A;  2OB0 A;  3IU1 A;  4KOT A;  2I00 A;  2PR1 A;  1MJB A;  4CRY B;  2FL4 A;  5IX3 A;  2JDC A;  4AG9 A;  3EY5 A;  4IF5 A;  2VQY A;  4KS9 A;  3FYN A;  4C7I A;  1VHS A;  1Y7R A;  2YNC A;  2FT0 A;  2K5T A;  1BOB A;  1BO4 A;  2WSA A;  4B13 A;  4XNH C;  1MJA A;  4HNW B;  1U6M A;  2P6E A;  4QC6 A;  4UWI A;  5DWM A;  1B87 A;  3W91 A;  2ATR A;  1SQH A;  4MFJ A;  1QST A;  4KUA A;  2YGW A;  4X5K A;  1YR0 A;  4KOY A;  3KKW A;  4LUA A;  3TE4 A;  3NE7 A;  2RC4 A;  4KSF A;  2Z3L A;  1ON0 A;  4KSA A;  4KOX A;  5GCN A;  1NMT A;  3LOD A;  3TT2 A;  4Q36 A;  1XIX A;  4YRH A;  3PP9 A;  1Y9K A;  2B3U A;  3C26 A;  4CAE A;  4L89 A;  3T9Y A;  2FCK A;  3FB3 A;  5F49 A;  3VWD A;  1M4I A;  1S7K A;  2IL4 A;  5AG4 A;  4UA3 A;  2Q0Y A;  4HKF A;  4ZGY B;  3B8G A;  5J8F A;  4KVM E;  4RS2 A;  4C2X A;  2R98 A;  3FXT A;  2VI7 A;  2AJ6 A;  3BLN A;  3P2F A;  5DWN A;  1I21 A;  3TTH A;  3JTK A;  3TO7 A;  2EUI A;  4Q38 A;  3SHP A;  1UFH A;  4YGO A;  2ZPA A;  4OAD A;  3VWE A;  4AVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...