4XPKA

The crystal structure of campylobacter jejuni n-acetyltransferase pseh
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
141
Chain Sequence
PLIKLKNFTELNSQEIELIFKWKTKYIDFEEHLRFLKKLHQDSSKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAKPNLKGVGQILMNEIIKYAFESLKVNTLKAYVFKSNHKALKLYQQNHFTIYDEDKDFYYVYLKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-Acetyltransferase, PseH
publication title Structural analysis of PseH, the Campylobacter jejuni N-acetyltransferase involved in bacterial O-linked glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni pt14
total genus 42
structure length 141
sequence length 151
ec nomenclature
pdb deposition date 2015-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xpkA00
3F0AA 2J8MA 4U5YA 4HNXB 1Q2CA 3D3SA 4KLVA 3TE4A 1PUAA 4EVYA 1KUYA 3QB8A 2RC4A 2FT0A 4KOTA 2WPXA 2Q4VA 5CNPA 1WWZA 3ZZIA 1XE4A 1YVOA 3VWDA 4AG9A 4JWPA 1WK4A 2D4OA 4Y49C 2EUIA 2FL4A 1ON0A 1IICA 1S7LA 1BO4A 3D2PA 3BJ7A 3CXQA 1XF8A 3FRMA 2A4NA 4KORA 1IIDA 4OADA 4AB7A 4IUSA 2FS5A 5F46A 3S6KA 2P6GA 4XPKA 4I49A 4RI1A 1IB1E 4J3GA 4X5KA 4FD5A 2ATRA 3D8PA 5JQ4A 2Y0MA 3JVNA 2CNSA 3DR8A 2B4BA 4KUAA 3W6SA 2PQ8A 5F48A 3TOAA 1U6MA 4KZTA 4IF5A 2R1IA 3CXSA 3QAHA 2REEA 3TT2A 3B8GA 1L0CA 3LD2A 5GCNA 4E8OA 3H4QA 2C27A 3C26A 3EO4A 3FB3A 3K9UA 2GANA 1YVKA 4BMHA 5F49A 2B4DA 1V0CA 3IWGA 4ZBGA 4UBRA 2BL1A 3DR6A 3G8WA 3W91A 4R87A 2Q04A 4NXYA 5J8CA 3S6FA 4XNHC 1KUXA 1LRZA 4H6UA 2NMTA 4R3LA 1Y7RA 4R9MA 2OH1A 3GKRA 1M1DA 5EC4A 2VQYA 4AVCA 4KVXA 4JD6A 2OZGA 3I3GA 4UWJA 5DWNA 4ORFA 1I21A 3R9GA 4CS0B 3G3SA 4KVOE 4GS4A 5DWMA 2G0BA 2ZW4A 1YX0A 3TFYA 4L89A 3W6XA 1IYLA 4JXQA 2P0WA 4FD4A 4XPDB 5I0CA 1SQHA 1Y9WA 4PK2A 3DSBA 3R9EA 1NMTA 5C82A 1VHSA 1YREA 3BLNA 2OB0A 2REFA 4XNHB 3S6GA 2ZPAA 5ISVA 1KUVA 4KVME 2FIWA 1NSLA 2VBQA 4CAXA 5HH1A 2KCWA 2VZYA 1M44A 1XIXA 4KOXA 1M4IA 2J8RA 4QUSA 5F47A 4AVAA 4CRZB 1M4DA 4U9YA 3PGPA 5E96A 4KOWA 3EY5A 4L8AA 1QSNA 2Z0ZA 1BOBA 1RXTA 3EFAA 5HMNA 3I9SA 1P4NA 4NEXA 2ZW7A 1QSTA 3R1KA 4LX9A 2OU2A 4AVBA 2Q7BA 1N71A 2VI7A 4QB9A 2JDCA 2ZW5A 3F5BA 4MI4A 2Q44A 3R9FA 1K4JA 4F0YA 1CM0A 2FCKA 2HV2A 3FXTA 2QIRA 2X7BA 1MJBA 2VZZA 4MY3A 4U9ZA 1KZFA 1XEBA 4YFJA 5H86A 5IX3A 3SXNA 2ZXVA 2OZHA 4CAWA 4KOVA 2Q0YA 2Z11A 1I1DA 1S7NA 3MGDA 4FD7A 2AE6A 4B5PA 2P6EA 1Z4RA 4XPDC 4DNCA 5IV0A 2B5GA 2FXFA 1S3ZA 1S60A 2HUZA 1YK3A 3NE7A 4JXRA 1YGHA 2R98A 4M85A 5IB0A 1S5KA 3BJ8A 2B3UA 3FIXA 4OAEA 3ZJ0A 1QSOA 1M4GA 4UA3A 3N7ZA 2BUEA 2QECA 5EBVA 4NF1A 5KTAA 5H84A 1RO5A 4KOYA 4LUAA 1P0HA 2B58A 4H6ZA 1Q2YA 2J8NA 4PSWA 3SXOA 3TCVA 4MBUA 1GHEA 4R57A 4KLWA 2BEIA 1S7KA 1NE9A 1Q2DA 4H89A 5J8FA 2B4DB 4MJ8A 1TIQA 3OWCA 2IL4A 2WPWA 2Z10A 3RYOA 2CY2A 5KTCA 3CXPA 4II9A 2G3AA 4CAVA 1QSMA 2VEZA 4E2AA 3KKWA 3FNCA 1B6BA 4KUBA 2H5MA 3DNSA 1Z9UA 4F6AA 4QBJA 4PK3A 4HNYB 2R7HA 3TO7A 2P6FA 5FVJA 2PR8A 2O28A 4MHDA 2QMLA 4OLLA 3PZJA 4RS2A 1VKCA 1I12A 4KOSA 1QSRA 2Q4YA 1Z4EA 3F8KA 4HKFA 1B87A 4K30A 4QC6A 1XMTA 2FSRA 2PSWA 2I00A 4YRHA 1YLEA 4NCZA 3IGRA 2ARHA 3TO9A 4AG7A 3FBUA 4JLYA 4MY0A 4M3SA 2JLMA 3E0KA 1OZPA 4ONUA 4B5OA 2JEVA 3GY9A 1CJWA 4PSXA 3D2MA 3PP9A 1Y9KA 2D4PA 2OZUA 2FIAA 3FYNA 2HQYA 2F5IA 1J4JA 5KTDA 2PRBA 3TO6A 3EC4A 3TOBA 1UFHA 4QVTA 1YR0A 2VXKA 4KOUA 4PV6A 4CRYB 4NSQA 2DXQA 2PDOA 4Y49B 3P2HA 2GIVA 3GYAA 3VWEA 3P2FA 2EVNA 2CNTA 4UWIA 1MJAA 2FE7A 3TTHA 1PU9A 1FY7A 2R8VA 3R95A 2ZW6A 2PC1A 2I79A 1R57A 4XPLA 4R3KA 2BSWA 3DDDA 3SHPA 3JUWA 3UY5A 1MJ9A 4HNWB 5JPHA 2GE3A 2AJ6A 3T9YA 1MK4A 3S6HA 3LODA 3T90A 2JDDA 2B3VA 4JJXA 3R96A 4FD6A 5C88A 4E0AA 2K5TA 1IYKA 3EXNA 4YGOA 4B5PB 2PR1A 3WR7A 2CNMA 3V8IA 2B5GB 1S7FA 2G3TA
chains in the Genus database with same CATH superfamily
4IAVA 4KS9A 2Z3LA 3F0AA 3NA6A 2ZENA 3B7IA 5AG5A 2J8MA 4U5YA 2JBJA 4HNXB 3CT9A 4UFVA 1Q2CA 4P4IA 2PRQA 3B3VA 3D3SA 1CBXA 4F9UA 2CIJA 4KLVA 3DLJA 2V8VA 3IJ3A 2ZEFA 4M6IA 4KSFA 5HXDA 1PUAA 3TE4A 4EVYA 5A28A 1QQ9A 2GLFA 1KUYA 2PJ9A 3QB8A 1YW6A 2RC4A 3PB8X 4NGNA 3T8WA 1UWYA 2FT0A 4Q36A 4B12A 3S9NA 4KOTA 2WPXA 5BWAB 2Q4VA 5CNPA 3SJGA 1WWZA 3ZZIA 3FVLA 1XE4A 1YVOA 3VWDA 4AG9A 1ZG9A 4JWPA 3PB6X 2AFWA 2CXAA 1WK4A 4C2XA 5AGEA 2D4OA 2RB7A 3TX8A 1YSJA 3NH4A 2EO8A 2CTCA 4Y49C 4OC2A 2EUIA 2FL4A 5IB9A 5JH9A 3RNZA 3PB7X 3KL9A 1ON0A 1IICA 1S7LA 3PFOA 1BO4A 2PIZA 4A2ZA 3D2PA 3IWEA 5HVHA 1ARMA 4Z65A 4ZY2A 2Z3KA 5D29A 3VH9A 4WJBA 2POKA 3BJ7A 3CXQA 1XF8A 4LQGA 3FRMA 4CYQA 2A4NA 4KORA 4BINA 1IIDA 2XEFA 2ABZA 4OADA 4AB7A 2HB6A 4IUSA 4ZGYB 2FS5A 3FF3A 5F46A 5D8NA 3S6KA 2P6GA 4XPKA 3NH5A 4I49A 3FEEA 4RI1A 4OC0A 5K8OA 4FAIA 1IB1E 2PE3A 1CP6A 3KHZA 1PYTB 4J3GA 4UCNA 4TWEA 4LQ6A 4X5KA 3D7DA 4FD5A 2ATRA 3IFEA 3KHXA 3D8PA 5JQ4A 2OR4A 1X10A 2Y0MA 3JVNA 2CNSA 4C68A 3DR8A 2B4BA 4KUAA 3W6SA 4C7IA 2PQ8A 3BI0A 5F48A 3TC8A 1A2ZA 3KQZA 3TOAA 5K8MA 2BOAA 3FMCA 4UF4A 3FH4A 1TKHA 1U6MA 1LAPA 4IF5A 4KZTA 2JEWA 1IU8A 2R1IA 3DGVA 3CXSA 3QAHA 2REEA 3TT2A 3B8GA 1L0CA 3LD2A 4UFXA 5LYLA 4M6HA 5GCNA 3SI1A 3PBBA 4UIBA 3CDXA 3R9FA 3L2NA 4E8OA 3H4QA 3D66A 3PFEA 2C27A 3C26A 4P45A 3EO4A 4NGQA 5I4MA 3FB3A 4OC4A 2HC9A 3K9UA 2GANA 4JZ0A 3KASA 2PJ3A 1YVKA 5A27A 4BMHA 5F49A 2B4DA 2YNDA 2BO9A 1V0CA 1AYEA 2ZEHA 3PBEA 3IWGA 4ZBGA 5HVGA 5JM6A 2OOTA 4UBRA 5LYDA 4C7HA 2AFSA 4X8IA 2BL1A 2AFZA 2GLJA 1JWQA 3DR6A 3G8WA 3W91A 4CYOA 4R87A 2Q04A 4NXYA 5J8CA 3RBUA 4MCQA 3RO0A 1S7FA 3SJXA 4WWVA 4ZY0A 4F9VA 1F2OA 3ISXA 4MHZA 3S6FA 4XNHC 1KUXA 1LRZA 4P4BA 5LYFA 4H6UA 2F7VA 4Q7AA 2WUUA 2NMTA 4R3LA 3QAYA 4UEFA 1Y7RA 4GXHA 4P4EA 4R9MA 2OH1A 3GKRA 1M1DA 5EC4A 1CPXA 3GLJA 2VQYA 4RN7A 3IWWA 3H8GA 4AVCA 4KVXA 1F2PA 3V7ZA 4JD6A 2OZGA 3I3GA 4UWJA 5DWNA 3LMSA 4ORFA 1I21A 4A30A 1XBUA 1ZG7A 3R9GA 4CS0B 3G3SA 2JBKA 4MCRA 4KVOE 3BI1A 4GS4A 3FX6A 5DWMA 2G0BA 1TF9A 2ZW4A 6CPAA 7CPAA 1YX0A 3TFYA 4L89A 3W6XA 4MFZA 1CP7A 1IYLA 4JXQA 2C6GA 4DJLA 1BAVA 2P0WA 2PCUA 4FD4A 4XPDB 5I0CA 1SQHA 1TKFA 1Y9WA 4CYPA 4PK2A 3DSBA 4ZI6A 2XEGA 4MFQA 3R9EA 1NMTA 2ZEMA 5C82A 1FNOA 4EFDA 1VHSA 1R43A 1GYTA 1VHEA 3D68A 5LRGA 4CYNA 4MRIA 5CBMA 5JGFA 1YREA 3BLNA 2OB0A 2REFA 2ZEDA 2ZEEA 4XNHB 1IOFA 3S9MA 3S6GA 2ZPAA 4CAFA 5ISVA 3VARA 1BPNA 4OMEA 4EMEA 1KUVA 5LRKA 4KVME 4C2YA 4ZX9A 2ZOGA 1H8LA 2FIWA 1NSLA 3BXMA 2WZNA 2XEIA 3IC1A 2VBQA 1CG2A 1XJOA 4OP4A 3FJUA 4UCPA 4CAXA 5HH1A 2KCWA 2VZYA 1ZG8A 1YQEA 1M44A 1XIXA 5AG4A 2Q7SA 3KQXA 3SI0A 4NGMA 3SJEA 4KOXA 5DS0A 1M4IA 2PJ6A 2J8RA 2VL1A 4QUSA 5F47A 4AVAA 3D7FA 4OC1A 4CRZB 4C2ZA 1ELMP 1M4DA 1Z5RA 4U9YA 5AG7A 3PGPA 5E96A 4DUKA 4YWYA 2V8DA 4OIWA 2I3CA 4KOWA 3EY5A 4L8AA 4A37A 1YLOA 1QSNA 1VGYA 2WSAA 2Z0ZA 4GM5A 3FEDA 1BOBA 1RXTA 3EFAA 1LOKA 5HMNA 2C6CA 3I9SA 1P4NA 4NEXA 3PB4X 2ZW7A 1QSTA 4P6YA 2Q43A 3R1KA 4LX9A 2OU2A 1IGBA 1LANA 4AVBA 2DEAA 3K9TA 4A94A 2Q7BA 1TKJA 1M4LA 1N71A 4B14A 1XFOA 2AFOA 2VI7A 2YNEA 4QB9A 4MFJA 2JDCA 2ZW5A 3F5BA 5ELYA 4MI4A 4NFRA 2PJCA 2Q44A 4UEZA 1K4JA 2CF4A 1CM0A 3GIUA 2FCKA 4G1PA 2HV2A 5AG6A 3FXTA 4F0YA 2QIRA 3KR4A 2X7BA 1MJBA 2VZZA 2PJ1A 3D4UA 4MY3A 4BD9A 1EE3P 1HEEA 4U9ZA 1KZFA 4F0XA 1LCPA 1XEBA 1NSAA 1FT7A 2DPTA 4PXCA 4YFJA 5H86A 5IX3A 3SXNA 2ZXVA 2OZHA 4X3RA 4CAWA 2C6PA 1ZLHA 2Q0YA 4KOVA 4K3NA 3K2KA 2Z11A 1I1DA 2Q4ZA 1S7NA 2PIYA 3MGDA 4FD7A 2XEJA 4ONWA 5EMIA 2AE6A 1HDQA 1ELLP 4B5PA 2P6EA 1Z4RA 4M6GA 4XPDC 4A31A 4B6ZA 1DTDA 4DNCA 2AFXA 5IV0A 2B5GA 2FXFA 1S3ZA 2C1CA 1S60A 2HUZA 2V8GA 8CPAA 1YK3A 4KSIA 4PXDA 3NE7A 4JXRA 1YGHA 4P4DA 1X12A 2R98A 5HVFA 3WC5A 4M85A 5J1QA 5IB0A 3B3CA 1S5KA 3BJ8A 2B3UA 3FIXA 1CPSA 4OAEA 4A39A 3ZJ0A 2DPSA 1QSOA 1M4GA 3PEIA 3N7ZA 2PVWA 4UA3A 2BCOA 2BUEA 4A38A 1TXRA 2QECA 4R8FA 1Z8WA 4NF1A 3H8FA 5EBVA 1AMPA 4ZYQA 5KTAA 4NGRA 5H84A 1RO5A 2ZEGA 2YNCA 3PRTA 4KOYA 3SJFA 4LUAA 1P0HA 2ZOFA 2B58A 4H6ZA 4PXBA 1YMEA 3IIBA 2IJZA 1Q2YA 4NGTA 1Z8LA 4OIDA 5G20A 5G21A 3HLPA 2J8NA 4Q38A 2PJBA 3SI2A 4PSWA 1XMBA 3SXOA 3TCVA 3NFZA 4MBUA 1GHEA 2V8HA 4R57A 5K8PA 1LFWA 4KLWA 2Z3OA 2BEIA 1S7KA 2Z3NA 1NE9A 1Q2DA 4X2TA 4H89A 3PB9X 5J8FA 2B4DB 4MJ8A 1TIQA 3OWCA 1KWMA 1Q7LA 2NSMA 2CTBA 2IMOA 3B2YA 2IL4A 2WPWA 4TNUA 4A95A 2Z10A 3RYOA 2CY2A 1LAMA 1OBRA 1VHOA 1ZLIA 2WYRA 5KTCA 2EK9A 2AFMA 3CXPA 4II9A 4MHPA 5THWA 4ZX8A 2PVVA 2G3AA 4CAVA 3NE8A 1QSMA 2VEZA 3JRUA 4NGSA 4E2AA 3KKWA 4MHYA 4NJRA 2EWBA 3FNCA 4MMOA 1QMUA 3RAMA 4OC3A 1B6BA 4P4JA 3ISZA 2DF5A 4KUBA 2H5MA 3DNSA 4P44A 1Z9UA 4F6AA 1CX8A 3FECA 1ARLA 3B3WA 4PPZA 4QBJA 4PK3A 4HNYB 1Z2LA 2GU2A 2R7HA 3TO7A 1VIXA 2P6FA 5FVJA 2PR8A 2NYQA 2O28A 4MHDA 2QMLA 4OLLA 3PZJA 1PCAA 3I1UA 4RS2A 4B10A 3B3TA 1VKCA 1I12A 4KOSA 3B3SA 3WC6A 3KZWA 2ODFA 3IU2A 5LYIA 1QSRA 2Q4YA 3KGQA 4OKOA 1Z4EA 3F8KA 2V77A 1B87A 4FWUA 4HKFA 4K30A 4QC6A 1XMTA 2FSRA 2QYVA 2EK8A 4NGPA 2G9DA 2PSWA 3IU1A 4CAEA 4CPAA 1Y7EA 2I00A 2RFHA 2YGWA 4MFPA 4YRHA 4CGNA 3GB0A 1YLEA 3LACA 2ZEOA 3GUXA 2O4HA 3MRUA 2PJ0A 4NCZA 4CGOA 3IGRA 4R7MA 5G22A 2ARHA 3TO9A 4UEEA 2PJ5A 1ZO0A 3KR5A 4CGMA 4AG7A 3FBUA 4JLYA 5K8NA 4PQAA 4MY0A 1R3NA 4M3SA 4MCPA 4R6TA 2Q51A 3WC7A 2JLMA 3E0KA 3MN8A 1OZPA 1XRYA 1DE4C 1BLLE 2QVPA 4KSAA 4ONUA 3N5FA 1Y0RA 4B5OA 4EWTA 2JEVA 3GY9A 2PJAA 1CJWA 2PJ8A 4H2KA 4PSXA 3D2MA 3PP9A 1Y9KA 2D4PA 2OZUA 1Z8XA 2FIAA 3FYNA 3KI9A 2HQYA 3QNVA 2F5IA 1J4JA 5KTDA 2PRBA 3TO6A 2ZELA 1HDUA 3EC4A 2ANPA 3TOBA 1UFHA 3D7GA 1YR0A 1F57A 4QVTA 5F09A 2VXKA 4KOUA 1YW4A 3LWUA 3RZAA 5CPAA 4AXVA 4ZY1A 4UIAA 4PV6A 4PXEA 4RUHA 3S9LA 4CRYB 3CZXA 4NSQA 5G1ZA 4FBEA 2DXQA 3BHXA 4MFKA 2PDOA 4F8ZA 4Y49B 4JYWA 2F8HA 3H5ZA 1Z8TA 2GIVA 3P2HA 3GYAA 3VWEA 3P2FA 3CPAA 2EVNA 4O23A 4R76A 5LRJA 3WT4A 1IOIA 4DYOA 2CNTA 2Z3PA 2ZEPA 3D67A 1BPMA 4FUUA 4A33A 4UWIA 2IQ6A 1MJAA 2FE7A 3TTHA 2PJ2A 1PU9A 4W9YA 4UFWA 1FY7A 4MXUA 2R8VA 1IY7A 4P10A 3R95A 2ZW6A 2PC1A 1TF8A 2I79A 4HPSA 1R57A 2YNCC 3IEHA 4XPLA 4CGPA 3V38A 4B11A 2AFUA 3JTKA 4UCMA 4R3KA 2BSWA 4A32A 3CPXA 3B35A 3DDDA 4P4FA 3SHPA 3JUWA 4NJQA 3UY5A 1MJ9A 4HNWB 5JPHA 1AUGA 2GE3A 2PJ7A 2J9AA 1RTQA 2AJ6A 3T9YA 1MK4A 4MFLA 3S6HA 4OC5A 3LODA 2GREA 3T90A 4YU9A 2JDDA 2B3VA 3WABA 4CGLA 3VATA 2O53A 3D7HA 3A9LA 4JJXA 3R96A 4FD6A 2QJ8A 3H8EA 4MHNA 4BBHA 5C88A 4E0AA 2EBJA 4MCSA 2K5TA 1IYKA 3EXNA 1JQGA 1Y0YA 3IO1A 3NH8A 4YGOA 2PJ4A 2FVGA 4B5PB 4IHMA 2PR1A 4IK2A 3WR7A 2CNMA 1XOVA 3HUVA 3V8IA 4B13A 2Z3MA 2B5GB 2GFQA 2G3TA
chains in the Genus database with same CATH topology
4KS9A 2Z3LA 3F0AA 5AG5A 2J8MA 4U5YA 4HNXB 4UFVA 1Q2CA 3D3SA 4KLVA 3TE4A 4KSFA 1PUAA 4EVYA 5A28A 1KUYA 3QB8A 2RC4A 2FT0A 4Q36A 4B12A 4KOTA 2WPXA 5BWAB 2Q4VA 5CNPA 1WWZA 3ZZIA 1XE4A 1YVOA 3VWDA 4AG9A 4JWPA 2CXAA 1WK4A 4C2XA 5AGEA 2D4OA 4Y49C 2EUIA 2FL4A 1ON0A 1IICA 1S7LA 1BO4A 4A2ZA 3D2PA 3IWEA 2Z3KA 3BJ7A 3CXQA 1XF8A 3FRMA 4CYQA 2A4NA 4KORA 1IIDA 4OADA 4AB7A 4IUSA 4ZGYB 2FS5A 5F46A 3S6KA 2P6GA 4XPKA 4I49A 4RI1A 1IB1E 4J3GA 4UCNA 4X5KA 4FD5A 2ATRA 3D8PA 5JQ4A 2Y0MA 3JVNA 2CNSA 4C68A 3DR8A 2B4BA 4KUAA 3W6SA 4C7IA 2PQ8A 5F48A 3TOAA 1U6MA 4KZTA 4IF5A 2R1IA 3CXSA 3QAHA 2REEA 3TT2A 3B8GA 1L0CA 3LD2A 4UFXA 5GCNA 4E8OA 3H4QA 2C27A 3C26A 3EO4A 3FB3A 3K9UA 2GANA 1YVKA 5A27A 4BMHA 5F49A 2B4DA 2YNDA 1V0CA 3IWGA 4ZBGA 4UBRA 4C7HA 2BL1A 3DR6A 3G8WA 3W91A 4CYOA 4R87A 2Q04A 4NXYA 5J8CA 3S6FA 4XNHC 1KUXA 1LRZA 4H6UA 2WUUA 2NMTA 4R3LA 1Y7RA 4R9MA 2OH1A 3GKRA 1M1DA 5EC4A 2VQYA 4AVCA 4KVXA 4JD6A 2OZGA 3I3GA 4UWJA 5DWNA 4ORFA 1I21A 4A30A 3R9GA 4CS0B 3G3SA 4KVOE 4GS4A 5DWMA 2G0BA 2ZW4A 1YX0A 3TFYA 4L89A 3W6XA 4MFZA 1IYLA 4JXQA 2P0WA 4FD4A 4XPDB 5I0CA 1SQHA 1Y9WA 4CYPA 4PK2A 3DSBA 4MFQA 3R9EA 1NMTA 5C82A 1VHSA 4CYNA 1YREA 3BLNA 2OB0A 2REFA 4XNHB 3S6GA 2ZPAA 4CAFA 5ISVA 1KUVA 4KVME 4C2YA 2FIWA 1NSLA 2VBQA 4CAXA 4UCPA 5HH1A 2KCWA 2VZYA 1M44A 1XIXA 5AG4A 4KOXA 1M4IA 2J8RA 4QUSA 5F47A 4AVAA 4CRZB 4C2ZA 1M4DA 4U9YA 5AG7A 3PGPA 5E96A 4KOWA 3EY5A 4L8AA 1QSNA 2WSAA 2Z0ZA 1BOBA 1RXTA 3EFAA 5HMNA 3I9SA 1P4NA 4NEXA 2ZW7A 1QSTA 3R1KA 4LX9A 2OU2A 4AVBA 2Q7BA 4B14A 1N71A 2VI7A 2YNEA 4QB9A 4MFJA 2JDCA 2ZW5A 3F5BA 4MI4A 2Q44A 3R9FA 1K4JA 4F0YA 1CM0A 5AG6A 2FCKA 2HV2A 3FXTA 2QIRA 2X7BA 1MJBA 2VZZA 4MY3A 4U9ZA 1KZFA 4F0XA 1XEBA 2DPTA 4YFJA 5H86A 5IX3A 3SXNA 2ZXVA 2OZHA 4CAWA 4KOVA 2Q0YA 2Z11A 1I1DA 1S7NA 3MGDA 4FD7A 2AE6A 4B5PA 2P6EA 1Z4RA 4XPDC 4A31A 4DNCA 5IV0A 2B5GA 2FXFA 1S3ZA 1S60A 2HUZA 1YK3A 3NE7A 4JXRA 1YGHA 2R98A 4M85A 5IB0A 1S5KA 3BJ8A 2B3UA 3FIXA 4OAEA 3ZJ0A 2DPSA 1QSOA 1M4GA 4UA3A 3N7ZA 2BUEA 2QECA 5EBVA 4NF1A 5KTAA 5H84A 1RO5A 4KOYA 2YNCA 4LUAA 1P0HA 2B58A 4H6ZA 1Q2YA 5G20A 5G21A 2J8NA 4Q38A 4PSWA 3SXOA 3TCVA 4MBUA 1GHEA 4R57A 4KLWA 2Z3OA 2BEIA 1S7KA 2Z3NA 1NE9A 1Q2DA 4H89A 5J8FA 2B4DB 4MJ8A 1TIQA 3OWCA 2IL4A 2WPWA 4A95A 2Z10A 3RYOA 2CY2A 5KTCA 3CXPA 4II9A 2G3AA 4CAVA 1QSMA 2VEZA 4E2AA 3KKWA 3FNCA 1B6BA 4KUBA 2H5MA 3DNSA 1Z9UA 4F6AA 4QBJA 4PK3A 4HNYB 2R7HA 3TO7A 2P6FA 5FVJA 2PR8A 2O28A 4MHDA 2QMLA 4OLLA 3PZJA 4RS2A 4B10A 1VKCA 1I12A 4KOSA 3IU2A 1QSRA 2Q4YA 1Z4EA 3F8KA 4HKFA 1B87A 4K30A 4QC6A 1XMTA 2FSRA 4CAEA 3IU1A 2PSWA 2I00A 2YGWA 4MFPA 4YRHA 4CGNA 1YLEA 4CGOA 4NCZA 3IGRA 5G22A 2ARHA 3TO9A 1ZO0A 4CGMA 4AG7A 3FBUA 4JLYA 4MY0A 4M3SA 2JLMA 3E0KA 1OZPA 4KSAA 4ONUA 4B5OA 2JEVA 3GY9A 1CJWA 4PSXA 3D2MA 3PP9A 1Y9KA 2D4PA 2OZUA 2FIAA 3FYNA 2HQYA 2F5IA 1J4JA 5KTDA 2PRBA 3TO6A 3EC4A 3TOBA 1UFHA 4QVTA 1YR0A 2VXKA 4KOUA 4PV6A 4CRYB 4NSQA 5G1ZA 2DXQA 4MFKA 2PDOA 4Y49B 3H5ZA 3P2HA 2GIVA 3GYAA 3VWEA 3P2FA 2EVNA 2CNTA 2Z3PA 4A33A 4UWIA 1MJAA 2FE7A 3TTHA 1PU9A 4UFWA 1FY7A 2R8VA 3R95A 2ZW6A 2PC1A 2I79A 1R57A 2YNCC 4XPLA 4CGPA 4B11A 3JTKA 4UCMA 4R3KA 2BSWA 4A32A 3DDDA 3SHPA 3JUWA 3UY5A 1MJ9A 4HNWB 5JPHA 2GE3A 2AJ6A 3T9YA 1MK4A 4MFLA 3S6HA 3LODA 3T90A 2JDDA 2B3VA 4CGLA 3A9LA 4JJXA 3R96A 4FD6A 5C88A 4BBHA 4E0AA 2K5TA 1IYKA 3EXNA 4YGOA 4B5PB 2PR1A 3WR7A 2CNMA 3V8IA 4B13A 2Z3MA 2B5GB 1S7FA 2G3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0A A;  2J8M A;  4U5Y A;  4HNX B;  1Q2C A;  3D3S A;  4KLV A;  3TE4 A;  1PUA A;  4EVY A;  1KUY A;  3QB8 A;  2RC4 A;  2FT0 A;  4KOT A;  2WPX A;  2Q4V A;  5CNP A;  1WWZ A;  3ZZI A;  1XE4 A;  1YVO A;  3VWD A;  4AG9 A;  4JWP A;  1WK4 A;  2D4O A;  4Y49 C;  2EUI A;  2FL4 A;  1ON0 A;  1IIC A;  1S7L A;  1BO4 A;  3D2P A;  3BJ7 A;  3CXQ A;  1XF8 A;  3FRM A;  2A4N A;  4KOR A;  1IID A;  4OAD A;  4AB7 A;  4IUS A;  2FS5 A;  5F46 A;  3S6K A;  2P6G A;  4XPK A;  4I49 A;  4RI1 A;  1IB1 E;  4J3G A;  4X5K A;  4FD5 A;  2ATR A;  3D8P A;  5JQ4 A;  2Y0M A;  3JVN A;  2CNS A;  3DR8 A;  2B4B A;  4KUA A;  3W6S A;  2PQ8 A;  5F48 A;  3TOA A;  1U6M A;  4KZT A;  4IF5 A;  2R1I A;  3CXS A;  3QAH A;  2REE A;  3TT2 A;  3B8G A;  1L0C A;  3LD2 A;  5GCN A;  4E8O A;  3H4Q A;  2C27 A;  3C26 A;  3EO4 A;  3FB3 A;  3K9U A;  2GAN A;  1YVK A;  4BMH A;  5F49 A;  2B4D A;  1V0C A;  3IWG A;  4ZBG A;  4UBR A;  2BL1 A;  3DR6 A;  3G8W A;  3W91 A;  4R87 A;  2Q04 A;  4NXY A;  5J8C A;  3S6F A;  4XNH C;  1KUX A;  1LRZ A;  4H6U A;  2NMT A;  4R3L A;  1Y7R A;  4R9M A;  2OH1 A;  3GKR A;  1M1D A;  5EC4 A;  2VQY A;  4AVC A;  4KVX A;  4JD6 A;  2OZG A;  3I3G A;  4UWJ A;  5DWN A;  4ORF A;  1I21 A;  3R9G A;  4CS0 B;  3G3S A;  4KVO E;  4GS4 A;  5DWM A;  2G0B A;  2ZW4 A;  1YX0 A;  3TFY A;  4L89 A;  3W6X A;  1IYL A;  4JXQ A;  2P0W A;  4FD4 A;  4XPD B;  5I0C A;  1SQH A;  1Y9W A;  4PK2 A;  3DSB A;  3R9E A;  1NMT A;  5C82 A;  1VHS A;  1YRE A;  3BLN A;  2OB0 A;  2REF A;  4XNH B;  3S6G A;  2ZPA A;  5ISV A;  1KUV A;  4KVM E;  2FIW A;  1NSL A;  2VBQ A;  4CAX A;  5HH1 A;  2KCW A;  2VZY A;  1M44 A;  1XIX A;  4KOX A;  1M4I A;  2J8R A;  4QUS A;  5F47 A;  4AVA A;  4CRZ B;  1M4D A;  4U9Y A;  3PGP A;  5E96 A;  4KOW A;  3EY5 A;  4L8A A;  1QSN A;  2Z0Z A;  1BOB A;  1RXT A;  3EFA A;  5HMN A;  3I9S A;  1P4N A;  4NEX A;  2ZW7 A;  1QST A;  3R1K A;  4LX9 A;  2OU2 A;  4AVB A;  2Q7B A;  1N71 A;  2VI7 A;  4QB9 A;  2JDC A;  2ZW5 A;  3F5B A;  4MI4 A;  2Q44 A;  3R9F A;  1K4J A;  4F0Y A;  1CM0 A;  2FCK A;  2HV2 A;  3FXT A;  2QIR A;  2X7B A;  1MJB A;  2VZZ A;  4MY3 A;  4U9Z A;  1KZF A;  1XEB A;  4YFJ A;  5H86 A;  5IX3 A;  3SXN A;  2ZXV A;  2OZH A;  4CAW A;  4KOV A;  2Q0Y A;  2Z11 A;  1I1D A;  1S7N A;  3MGD A;  4FD7 A;  2AE6 A;  4B5P A;  2P6E A;  1Z4R A;  4XPD C;  4DNC A;  5IV0 A;  2B5G A;  2FXF A;  1S3Z A;  1S60 A;  2HUZ A;  1YK3 A;  3NE7 A;  4JXR A;  1YGH A;  2R98 A;  4M85 A;  5IB0 A;  1S5K A;  3BJ8 A;  2B3U A;  3FIX A;  4OAE A;  3ZJ0 A;  1QSO A;  1M4G A;  4UA3 A;  3N7Z A;  2BUE A;  2QEC A;  5EBV A;  4NF1 A;  5KTA A;  5H84 A;  1RO5 A;  4KOY A;  4LUA A;  1P0H A;  2B58 A;  4H6Z A;  1Q2Y A;  2J8N A;  4PSW A;  3SXO A;  3TCV A;  4MBU A;  1GHE A;  4R57 A;  4KLW A;  2BEI A;  1S7K A;  1NE9 A;  1Q2D A;  4H89 A;  5J8F A;  2B4D B;  4MJ8 A;  1TIQ A;  3OWC A;  2IL4 A;  2WPW A;  2Z10 A;  3RYO A;  2CY2 A;  5KTC A;  3CXP A;  4II9 A;  2G3A A;  4CAV A;  1QSM A;  2VEZ A;  4E2A A;  3KKW A;  3FNC A;  1B6B A;  4KUB A;  2H5M A;  3DNS A;  1Z9U A;  4F6A A;  4QBJ A;  4PK3 A;  4HNY B;  2R7H A;  3TO7 A;  2P6F A;  5FVJ A;  2PR8 A;  2O28 A;  4MHD A;  2QML A;  4OLL A;  3PZJ A;  4RS2 A;  1VKC A;  1I12 A;  4KOS A;  1QSR A;  2Q4Y A;  1Z4E A;  3F8K A;  4HKF A;  1B87 A;  4K30 A;  4QC6 A;  1XMT A;  2FSR A;  2PSW A;  2I00 A;  4YRH A;  1YLE A;  4NCZ A;  3IGR A;  2ARH A;  3TO9 A;  4AG7 A;  3FBU A;  4JLY A;  4MY0 A;  4M3S A;  2JLM A;  3E0K A;  1OZP A;  4ONU A;  4B5O A;  2JEV A;  3GY9 A;  1CJW A;  4PSX A;  3D2M A;  3PP9 A;  1Y9K A;  2D4P A;  2OZU A;  2FIA A;  3FYN A;  2HQY A;  2F5I A;  1J4J A;  5KTD A;  2PRB A;  3TO6 A;  3EC4 A;  3TOB A;  1UFH A;  4QVT A;  1YR0 A;  2VXK A;  4KOU A;  4PV6 A;  4CRY B;  4NSQ A;  2DXQ A;  2PDO A;  4Y49 B;  3P2H A;  2GIV A;  3GYA A;  3VWE A;  3P2F A;  2EVN A;  2CNT A;  4UWI A;  1MJA A;  2FE7 A;  3TTH A;  1PU9 A;  1FY7 A;  2R8V A;  3R95 A;  2ZW6 A;  2PC1 A;  2I79 A;  1R57 A;  4XPL A;  4R3K A;  2BSW A;  3DDD A;  3SHP A;  3JUW A;  3UY5 A;  1MJ9 A;  4HNW B;  5JPH A;  2GE3 A;  2AJ6 A;  3T9Y A;  1MK4 A;  3S6H A;  3LOD A;  3T90 A;  2JDD A;  2B3V A;  4JJX A;  3R96 A;  4FD6 A;  5C88 A;  4E0A A;  2K5T A;  1IYK A;  3EXN A;  4YGO A;  4B5P B;  2PR1 A;  3WR7 A;  2CNM A;  3V8I A;  2B5G B;  1S7F A;  2G3T A; 
#chains in the Genus database with same CATH topology
 4IAV A;  4KS9 A;  2Z3L A;  3F0A A;  3NA6 A;  2ZEN A;  3B7I A;  5AG5 A;  2J8M A;  4U5Y A;  2JBJ A;  4HNX B;  3CT9 A;  4UFV A;  1Q2C A;  4P4I A;  2PRQ A;  3B3V A;  3D3S A;  1CBX A;  4F9U A;  2CIJ A;  4KLV A;  3DLJ A;  2V8V A;  3IJ3 A;  2ZEF A;  4M6I A;  4KSF A;  5HXD A;  1PUA A;  3TE4 A;  4EVY A;  5A28 A;  1QQ9 A;  2GLF A;  1KUY A;  2PJ9 A;  3QB8 A;  1YW6 A;  2RC4 A;  3PB8 X;  4NGN A;  3T8W A;  1UWY A;  2FT0 A;  4Q36 A;  4B12 A;  3S9N A;  4KOT A;  2WPX A;  5BWA B;  2Q4V A;  5CNP A;  3SJG A;  1WWZ A;  3ZZI A;  3FVL A;  1XE4 A;  1YVO A;  3VWD A;  4AG9 A;  1ZG9 A;  4JWP A;  3PB6 X;  2AFW A;  2CXA A;  1WK4 A;  4C2X A;  5AGE A;  2D4O A;  2RB7 A;  3TX8 A;  1YSJ A;  3NH4 A;  2EO8 A;  2CTC A;  4Y49 C;  4OC2 A;  2EUI A;  2FL4 A;  5IB9 A;  5JH9 A;  3RNZ A;  3PB7 X;  3KL9 A;  1ON0 A;  1IIC A;  1S7L A;  3PFO A;  1BO4 A;  2PIZ A;  4A2Z A;  3D2P A;  3IWE A;  5HVH A;  1ARM A;  4Z65 A;  4ZY2 A;  2Z3K A;  5D29 A;  3VH9 A;  4WJB A;  2POK A;  3BJ7 A;  3CXQ A;  1XF8 A;  4LQG A;  3FRM A;  4CYQ A;  2A4N A;  4KOR A;  4BIN A;  1IID A;  2XEF A;  2ABZ A;  4OAD A;  4AB7 A;  2HB6 A;  4IUS A;  4ZGY B;  2FS5 A;  3FF3 A;  5F46 A;  5D8N A;  3S6K A;  2P6G A;  4XPK A;  3NH5 A;  4I49 A;  3FEE A;  4RI1 A;  4OC0 A;  5K8O A;  4FAI A;  1IB1 E;  2PE3 A;  1CP6 A;  3KHZ A;  1PYT B;  4J3G A;  4UCN A;  4TWE A;  4LQ6 A;  4X5K A;  3D7D A;  4FD5 A;  2ATR A;  3IFE A;  3KHX A;  3D8P A;  5JQ4 A;  2OR4 A;  1X10 A;  2Y0M A;  3JVN A;  2CNS A;  4C68 A;  3DR8 A;  2B4B A;  4KUA A;  3W6S A;  4C7I A;  2PQ8 A;  3BI0 A;  5F48 A;  3TC8 A;  1A2Z A;  3KQZ A;  3TOA A;  5K8M A;  2BOA A;  3FMC A;  4UF4 A;  3FH4 A;  1TKH A;  1U6M A;  1LAP A;  4IF5 A;  4KZT A;  2JEW A;  1IU8 A;  2R1I A;  3DGV A;  3CXS A;  3QAH A;  2REE A;  3TT2 A;  3B8G A;  1L0C A;  3LD2 A;  4UFX A;  5LYL A;  4M6H A;  5GCN A;  3SI1 A;  3PBB A;  4UIB A;  3CDX A;  3R9F A;  3L2N A;  4E8O A;  3H4Q A;  3D66 A;  3PFE A;  2C27 A;  3C26 A;  4P45 A;  3EO4 A;  4NGQ A;  5I4M A;  3FB3 A;  4OC4 A;  2HC9 A;  3K9U A;  2GAN A;  4JZ0 A;  3KAS A;  2PJ3 A;  1YVK A;  5A27 A;  4BMH A;  5F49 A;  2B4D A;  2YND A;  2BO9 A;  1V0C A;  1AYE A;  2ZEH A;  3PBE A;  3IWG A;  4ZBG A;  5HVG A;  5JM6 A;  2OOT A;  4UBR A;  5LYD A;  4C7H A;  2AFS A;  4X8I A;  2BL1 A;  2AFZ A;  2GLJ A;  1JWQ A;  3DR6 A;  3G8W A;  3W91 A;  4CYO A;  4R87 A;  2Q04 A;  4NXY A;  5J8C A;  3RBU A;  4MCQ A;  3RO0 A;  1S7F A;  3SJX A;  4WWV A;  4ZY0 A;  4F9V A;  1F2O A;  3ISX A;  4MHZ A;  3S6F A;  4XNH C;  1KUX A;  1LRZ A;  4P4B A;  5LYF A;  4H6U A;  2F7V A;  4Q7A A;  2WUU A;  2NMT A;  4R3L A;  3QAY A;  4UEF A;  1Y7R A;  4GXH A;  4P4E A;  4R9M A;  2OH1 A;  3GKR A;  1M1D A;  5EC4 A;  1CPX A;  3GLJ A;  2VQY A;  4RN7 A;  3IWW A;  3H8G A;  4AVC A;  4KVX A;  1F2P A;  3V7Z A;  4JD6 A;  2OZG A;  3I3G A;  4UWJ A;  5DWN A;  3LMS A;  4ORF A;  1I21 A;  4A30 A;  1XBU A;  1ZG7 A;  3R9G A;  4CS0 B;  3G3S A;  2JBK A;  4MCR A;  4KVO E;  3BI1 A;  4GS4 A;  3FX6 A;  5DWM A;  2G0B A;  1TF9 A;  2ZW4 A;  6CPA A;  7CPA A;  1YX0 A;  3TFY A;  4L89 A;  3W6X A;  4MFZ A;  1CP7 A;  1IYL A;  4JXQ A;  2C6G A;  4DJL A;  1BAV A;  2P0W A;  2PCU A;  4FD4 A;  4XPD B;  5I0C A;  1SQH A;  1TKF A;  1Y9W A;  4CYP A;  4PK2 A;  3DSB A;  4ZI6 A;  2XEG A;  4MFQ A;  3R9E A;  1NMT A;  2ZEM A;  5C82 A;  1FNO A;  4EFD A;  1VHS A;  1R43 A;  1GYT A;  1VHE A;  3D68 A;  5LRG A;  4CYN A;  4MRI A;  5CBM A;  5JGF A;  1YRE A;  3BLN A;  2OB0 A;  2REF A;  2ZED A;  2ZEE A;  4XNH B;  1IOF A;  3S9M A;  3S6G A;  2ZPA A;  4CAF A;  5ISV A;  3VAR A;  1BPN A;  4OME A;  4EME A;  1KUV A;  5LRK A;  4KVM E;  4C2Y A;  4ZX9 A;  2ZOG A;  1H8L A;  2FIW A;  1NSL A;  3BXM A;  2WZN A;  2XEI A;  3IC1 A;  2VBQ A;  1CG2 A;  1XJO A;  4OP4 A;  3FJU A;  4UCP A;  4CAX A;  5HH1 A;  2KCW A;  2VZY A;  1ZG8 A;  1YQE A;  1M44 A;  1XIX A;  5AG4 A;  2Q7S A;  3KQX A;  3SI0 A;  4NGM A;  3SJE A;  4KOX A;  5DS0 A;  1M4I A;  2PJ6 A;  2J8R A;  2VL1 A;  4QUS A;  5F47 A;  4AVA A;  3D7F A;  4OC1 A;  4CRZ B;  4C2Z A;  1ELM P;  1M4D A;  1Z5R A;  4U9Y A;  5AG7 A;  3PGP A;  5E96 A;  4DUK A;  4YWY A;  2V8D A;  4OIW A;  2I3C A;  4KOW A;  3EY5 A;  4L8A A;  4A37 A;  1YLO A;  1QSN A;  1VGY A;  2WSA A;  2Z0Z A;  4GM5 A;  3FED A;  1BOB A;  1RXT A;  3EFA A;  1LOK A;  5HMN A;  2C6C A;  3I9S A;  1P4N A;  4NEX A;  3PB4 X;  2ZW7 A;  1QST A;  4P6Y A;  2Q43 A;  3R1K A;  4LX9 A;  2OU2 A;  1IGB A;  1LAN A;  4AVB A;  2DEA A;  3K9T A;  4A94 A;  2Q7B A;  1TKJ A;  1M4L A;  1N71 A;  4B14 A;  1XFO A;  2AFO A;  2VI7 A;  2YNE A;  4QB9 A;  4MFJ A;  2JDC A;  2ZW5 A;  3F5B A;  5ELY A;  4MI4 A;  4NFR A;  2PJC A;  2Q44 A;  4UEZ A;  1K4J A;  2CF4 A;  1CM0 A;  3GIU A;  2FCK A;  4G1P A;  2HV2 A;  5AG6 A;  3FXT A;  4F0Y A;  2QIR A;  3KR4 A;  2X7B A;  1MJB A;  2VZZ A;  2PJ1 A;  3D4U A;  4MY3 A;  4BD9 A;  1EE3 P;  1HEE A;  4U9Z A;  1KZF A;  4F0X A;  1LCP A;  1XEB A;  1NSA A;  1FT7 A;  2DPT A;  4PXC A;  4YFJ A;  5H86 A;  5IX3 A;  3SXN A;  2ZXV A;  2OZH A;  4X3R A;  4CAW A;  2C6P A;  1ZLH A;  2Q0Y A;  4KOV A;  4K3N A;  3K2K A;  2Z11 A;  1I1D A;  2Q4Z A;  1S7N A;  2PIY A;  3MGD A;  4FD7 A;  2XEJ A;  4ONW A;  5EMI A;  2AE6 A;  1HDQ A;  1ELL P;  4B5P A;  2P6E A;  1Z4R A;  4M6G A;  4XPD C;  4A31 A;  4B6Z A;  1DTD A;  4DNC A;  2AFX A;  5IV0 A;  2B5G A;  2FXF A;  1S3Z A;  2C1C A;  1S60 A;  2HUZ A;  2V8G A;  8CPA A;  1YK3 A;  4KSI A;  4PXD A;  3NE7 A;  4JXR A;  1YGH A;  4P4D A;  1X12 A;  2R98 A;  5HVF A;  3WC5 A;  4M85 A;  5J1Q A;  5IB0 A;  3B3C A;  1S5K A;  3BJ8 A;  2B3U A;  3FIX A;  1CPS A;  4OAE A;  4A39 A;  3ZJ0 A;  2DPS A;  1QSO A;  1M4G A;  3PEI A;  3N7Z A;  2PVW A;  4UA3 A;  2BCO A;  2BUE A;  4A38 A;  1TXR A;  2QEC A;  4R8F A;  1Z8W A;  4NF1 A;  3H8F A;  5EBV A;  1AMP A;  4ZYQ A;  5KTA A;  4NGR A;  5H84 A;  1RO5 A;  2ZEG A;  2YNC A;  3PRT A;  4KOY A;  3SJF A;  4LUA A;  1P0H A;  2ZOF A;  2B58 A;  4H6Z A;  4PXB A;  1YME A;  3IIB A;  2IJZ A;  1Q2Y A;  4NGT A;  1Z8L A;  4OID A;  5G20 A;  5G21 A;  3HLP A;  2J8N A;  4Q38 A;  2PJB A;  3SI2 A;  4PSW A;  1XMB A;  3SXO A;  3TCV A;  3NFZ A;  4MBU A;  1GHE A;  2V8H A;  4R57 A;  5K8P A;  1LFW A;  4KLW A;  2Z3O A;  2BEI A;  1S7K A;  2Z3N A;  1NE9 A;  1Q2D A;  4X2T A;  4H89 A;  3PB9 X;  5J8F A;  2B4D B;  4MJ8 A;  1TIQ A;  3OWC A;  1KWM A;  1Q7L A;  2NSM A;  2CTB A;  2IMO A;  3B2Y A;  2IL4 A;  2WPW A;  4TNU A;  4A95 A;  2Z10 A;  3RYO A;  2CY2 A;  1LAM A;  1OBR A;  1VHO A;  1ZLI A;  2WYR A;  5KTC A;  2EK9 A;  2AFM A;  3CXP A;  4II9 A;  4MHP A;  5THW A;  4ZX8 A;  2PVV A;  2G3A A;  4CAV A;  3NE8 A;  1QSM A;  2VEZ A;  3JRU A;  4NGS A;  4E2A A;  3KKW A;  4MHY A;  4NJR A;  2EWB A;  3FNC A;  4MMO A;  1QMU A;  3RAM A;  4OC3 A;  1B6B A;  4P4J A;  3ISZ A;  2DF5 A;  4KUB A;  2H5M A;  3DNS A;  4P44 A;  1Z9U A;  4F6A A;  1CX8 A;  3FEC A;  1ARL A;  3B3W A;  4PPZ A;  4QBJ A;  4PK3 A;  4HNY B;  1Z2L A;  2GU2 A;  2R7H A;  3TO7 A;  1VIX A;  2P6F A;  5FVJ A;  2PR8 A;  2NYQ A;  2O28 A;  4MHD A;  2QML A;  4OLL A;  3PZJ A;  1PCA A;  3I1U A;  4RS2 A;  4B10 A;  3B3T A;  1VKC A;  1I12 A;  4KOS A;  3B3S A;  3WC6 A;  3KZW A;  2ODF A;  3IU2 A;  5LYI A;  1QSR A;  2Q4Y A;  3KGQ A;  4OKO A;  1Z4E A;  3F8K A;  2V77 A;  1B87 A;  4FWU A;  4HKF A;  4K30 A;  4QC6 A;  1XMT A;  2FSR A;  2QYV A;  2EK8 A;  4NGP A;  2G9D A;  2PSW A;  3IU1 A;  4CAE A;  4CPA A;  1Y7E A;  2I00 A;  2RFH A;  2YGW A;  4MFP A;  4YRH A;  4CGN A;  3GB0 A;  1YLE A;  3LAC A;  2ZEO A;  3GUX A;  2O4H A;  3MRU A;  2PJ0 A;  4NCZ A;  4CGO A;  3IGR A;  4R7M A;  5G22 A;  2ARH A;  3TO9 A;  4UEE A;  2PJ5 A;  1ZO0 A;  3KR5 A;  4CGM A;  4AG7 A;  3FBU A;  4JLY A;  5K8N A;  4PQA A;  4MY0 A;  1R3N A;  4M3S A;  4MCP A;  4R6T A;  2Q51 A;  3WC7 A;  2JLM A;  3E0K A;  3MN8 A;  1OZP A;  1XRY A;  1DE4 C;  1BLL E;  2QVP A;  4KSA A;  4ONU A;  3N5F A;  1Y0R A;  4B5O A;  4EWT A;  2JEV A;  3GY9 A;  2PJA A;  1CJW A;  2PJ8 A;  4H2K A;  4PSX A;  3D2M A;  3PP9 A;  1Y9K A;  2D4P A;  2OZU A;  1Z8X A;  2FIA A;  3FYN A;  3KI9 A;  2HQY A;  3QNV A;  2F5I A;  1J4J A;  5KTD A;  2PRB A;  3TO6 A;  2ZEL A;  1HDU A;  3EC4 A;  2ANP A;  3TOB A;  1UFH A;  3D7G A;  1YR0 A;  1F57 A;  4QVT A;  5F09 A;  2VXK A;  4KOU A;  1YW4 A;  3LWU A;  3RZA A;  5CPA A;  4AXV A;  4ZY1 A;  4UIA A;  4PV6 A;  4PXE A;  4RUH A;  3S9L A;  4CRY B;  3CZX A;  4NSQ A;  5G1Z A;  4FBE A;  2DXQ A;  3BHX A;  4MFK A;  2PDO A;  4F8Z A;  4Y49 B;  4JYW A;  2F8H A;  3H5Z A;  1Z8T A;  2GIV A;  3P2H A;  3GYA A;  3VWE A;  3P2F A;  3CPA A;  2EVN A;  4O23 A;  4R76 A;  5LRJ A;  3WT4 A;  1IOI A;  4DYO A;  2CNT A;  2Z3P A;  2ZEP A;  3D67 A;  1BPM A;  4FUU A;  4A33 A;  4UWI A;  2IQ6 A;  1MJA A;  2FE7 A;  3TTH A;  2PJ2 A;  1PU9 A;  4W9Y A;  4UFW A;  1FY7 A;  4MXU A;  2R8V A;  1IY7 A;  4P10 A;  3R95 A;  2ZW6 A;  2PC1 A;  1TF8 A;  2I79 A;  4HPS A;  1R57 A;  2YNC C;  3IEH A;  4XPL A;  4CGP A;  3V38 A;  4B11 A;  2AFU A;  3JTK A;  4UCM A;  4R3K A;  2BSW A;  4A32 A;  3CPX A;  3B35 A;  3DDD A;  4P4F A;  3SHP A;  3JUW A;  4NJQ A;  3UY5 A;  1MJ9 A;  4HNW B;  5JPH A;  1AUG A;  2GE3 A;  2PJ7 A;  2J9A A;  1RTQ A;  2AJ6 A;  3T9Y A;  1MK4 A;  4MFL A;  3S6H A;  4OC5 A;  3LOD A;  2GRE A;  3T90 A;  4YU9 A;  2JDD A;  2B3V A;  3WAB A;  4CGL A;  3VAT A;  2O53 A;  3D7H A;  3A9L A;  4JJX A;  3R96 A;  4FD6 A;  2QJ8 A;  3H8E A;  4MHN A;  4BBH A;  5C88 A;  4E0A A;  2EBJ A;  4MCS A;  2K5T A;  1IYK A;  3EXN A;  1JQG A;  1Y0Y A;  3IO1 A;  3NH8 A;  4YGO A;  2PJ4 A;  2FVG A;  4B5P B;  4IHM A;  2PR1 A;  4IK2 A;  3WR7 A;  2CNM A;  1XOV A;  3HUV A;  3V8I A;  4B13 A;  2Z3M A;  2B5G B;  2GFQ A;  2G3T A; 
#chains in the Genus database with same CATH homology
 4KS9 A;  2Z3L A;  3F0A A;  5AG5 A;  2J8M A;  4U5Y A;  4HNX B;  4UFV A;  1Q2C A;  3D3S A;  4KLV A;  3TE4 A;  4KSF A;  1PUA A;  4EVY A;  5A28 A;  1KUY A;  3QB8 A;  2RC4 A;  2FT0 A;  4Q36 A;  4B12 A;  4KOT A;  2WPX A;  5BWA B;  2Q4V A;  5CNP A;  1WWZ A;  3ZZI A;  1XE4 A;  1YVO A;  3VWD A;  4AG9 A;  4JWP A;  2CXA A;  1WK4 A;  4C2X A;  5AGE A;  2D4O A;  4Y49 C;  2EUI A;  2FL4 A;  1ON0 A;  1IIC A;  1S7L A;  1BO4 A;  4A2Z A;  3D2P A;  3IWE A;  2Z3K A;  3BJ7 A;  3CXQ A;  1XF8 A;  3FRM A;  4CYQ A;  2A4N A;  4KOR A;  1IID A;  4OAD A;  4AB7 A;  4IUS A;  4ZGY B;  2FS5 A;  5F46 A;  3S6K A;  2P6G A;  4XPK A;  4I49 A;  4RI1 A;  1IB1 E;  4J3G A;  4UCN A;  4X5K A;  4FD5 A;  2ATR A;  3D8P A;  5JQ4 A;  2Y0M A;  3JVN A;  2CNS A;  4C68 A;  3DR8 A;  2B4B A;  4KUA A;  3W6S A;  4C7I A;  2PQ8 A;  5F48 A;  3TOA A;  1U6M A;  4KZT A;  4IF5 A;  2R1I A;  3CXS A;  3QAH A;  2REE A;  3TT2 A;  3B8G A;  1L0C A;  3LD2 A;  4UFX A;  5GCN A;  4E8O A;  3H4Q A;  2C27 A;  3C26 A;  3EO4 A;  3FB3 A;  3K9U A;  2GAN A;  1YVK A;  5A27 A;  4BMH A;  5F49 A;  2B4D A;  2YND A;  1V0C A;  3IWG A;  4ZBG A;  4UBR A;  4C7H A;  2BL1 A;  3DR6 A;  3G8W A;  3W91 A;  4CYO A;  4R87 A;  2Q04 A;  4NXY A;  5J8C A;  3S6F A;  4XNH C;  1KUX A;  1LRZ A;  4H6U A;  2WUU A;  2NMT A;  4R3L A;  1Y7R A;  4R9M A;  2OH1 A;  3GKR A;  1M1D A;  5EC4 A;  2VQY A;  4AVC A;  4KVX A;  4JD6 A;  2OZG A;  3I3G A;  4UWJ A;  5DWN A;  4ORF A;  1I21 A;  4A30 A;  3R9G A;  4CS0 B;  3G3S A;  4KVO E;  4GS4 A;  5DWM A;  2G0B A;  2ZW4 A;  1YX0 A;  3TFY A;  4L89 A;  3W6X A;  4MFZ A;  1IYL A;  4JXQ A;  2P0W A;  4FD4 A;  4XPD B;  5I0C A;  1SQH A;  1Y9W A;  4CYP A;  4PK2 A;  3DSB A;  4MFQ A;  3R9E A;  1NMT A;  5C82 A;  1VHS A;  4CYN A;  1YRE A;  3BLN A;  2OB0 A;  2REF A;  4XNH B;  3S6G A;  2ZPA A;  4CAF A;  5ISV A;  1KUV A;  4KVM E;  4C2Y A;  2FIW A;  1NSL A;  2VBQ A;  4CAX A;  4UCP A;  5HH1 A;  2KCW A;  2VZY A;  1M44 A;  1XIX A;  5AG4 A;  4KOX A;  1M4I A;  2J8R A;  4QUS A;  5F47 A;  4AVA A;  4CRZ B;  4C2Z A;  1M4D A;  4U9Y A;  5AG7 A;  3PGP A;  5E96 A;  4KOW A;  3EY5 A;  4L8A A;  1QSN A;  2WSA A;  2Z0Z A;  1BOB A;  1RXT A;  3EFA A;  5HMN A;  3I9S A;  1P4N A;  4NEX A;  2ZW7 A;  1QST A;  3R1K A;  4LX9 A;  2OU2 A;  4AVB A;  2Q7B A;  4B14 A;  1N71 A;  2VI7 A;  2YNE A;  4QB9 A;  4MFJ A;  2JDC A;  2ZW5 A;  3F5B A;  4MI4 A;  2Q44 A;  3R9F A;  1K4J A;  4F0Y A;  1CM0 A;  5AG6 A;  2FCK A;  2HV2 A;  3FXT A;  2QIR A;  2X7B A;  1MJB A;  2VZZ A;  4MY3 A;  4U9Z A;  1KZF A;  4F0X A;  1XEB A;  2DPT A;  4YFJ A;  5H86 A;  5IX3 A;  3SXN A;  2ZXV A;  2OZH A;  4CAW A;  4KOV A;  2Q0Y A;  2Z11 A;  1I1D A;  1S7N A;  3MGD A;  4FD7 A;  2AE6 A;  4B5P A;  2P6E A;  1Z4R A;  4XPD C;  4A31 A;  4DNC A;  5IV0 A;  2B5G A;  2FXF A;  1S3Z A;  1S60 A;  2HUZ A;  1YK3 A;  3NE7 A;  4JXR A;  1YGH A;  2R98 A;  4M85 A;  5IB0 A;  1S5K A;  3BJ8 A;  2B3U A;  3FIX A;  4OAE A;  3ZJ0 A;  2DPS A;  1QSO A;  1M4G A;  4UA3 A;  3N7Z A;  2BUE A;  2QEC A;  5EBV A;  4NF1 A;  5KTA A;  5H84 A;  1RO5 A;  4KOY A;  2YNC A;  4LUA A;  1P0H A;  2B58 A;  4H6Z A;  1Q2Y A;  5G20 A;  5G21 A;  2J8N A;  4Q38 A;  4PSW A;  3SXO A;  3TCV A;  4MBU A;  1GHE A;  4R57 A;  4KLW A;  2Z3O A;  2BEI A;  1S7K A;  2Z3N A;  1NE9 A;  1Q2D A;  4H89 A;  5J8F A;  2B4D B;  4MJ8 A;  1TIQ A;  3OWC A;  2IL4 A;  2WPW A;  4A95 A;  2Z10 A;  3RYO A;  2CY2 A;  5KTC A;  3CXP A;  4II9 A;  2G3A A;  4CAV A;  1QSM A;  2VEZ A;  4E2A A;  3KKW A;  3FNC A;  1B6B A;  4KUB A;  2H5M A;  3DNS A;  1Z9U A;  4F6A A;  4QBJ A;  4PK3 A;  4HNY B;  2R7H A;  3TO7 A;  2P6F A;  5FVJ A;  2PR8 A;  2O28 A;  4MHD A;  2QML A;  4OLL A;  3PZJ A;  4RS2 A;  4B10 A;  1VKC A;  1I12 A;  4KOS A;  3IU2 A;  1QSR A;  2Q4Y A;  1Z4E A;  3F8K A;  4HKF A;  1B87 A;  4K30 A;  4QC6 A;  1XMT A;  2FSR A;  4CAE A;  3IU1 A;  2PSW A;  2I00 A;  2YGW A;  4MFP A;  4YRH A;  4CGN A;  1YLE A;  4CGO A;  4NCZ A;  3IGR A;  5G22 A;  2ARH A;  3TO9 A;  1ZO0 A;  4CGM A;  4AG7 A;  3FBU A;  4JLY A;  4MY0 A;  4M3S A;  2JLM A;  3E0K A;  1OZP A;  4KSA A;  4ONU A;  4B5O A;  2JEV A;  3GY9 A;  1CJW A;  4PSX A;  3D2M A;  3PP9 A;  1Y9K A;  2D4P A;  2OZU A;  2FIA A;  3FYN A;  2HQY A;  2F5I A;  1J4J A;  5KTD A;  2PRB A;  3TO6 A;  3EC4 A;  3TOB A;  1UFH A;  4QVT A;  1YR0 A;  2VXK A;  4KOU A;  4PV6 A;  4CRY B;  4NSQ A;  5G1Z A;  2DXQ A;  4MFK A;  2PDO A;  4Y49 B;  3H5Z A;  3P2H A;  2GIV A;  3GYA A;  3VWE A;  3P2F A;  2EVN A;  2CNT A;  2Z3P A;  4A33 A;  4UWI A;  1MJA A;  2FE7 A;  3TTH A;  1PU9 A;  4UFW A;  1FY7 A;  2R8V A;  3R95 A;  2ZW6 A;  2PC1 A;  2I79 A;  1R57 A;  2YNC C;  4XPL A;  4CGP A;  4B11 A;  3JTK A;  4UCM A;  4R3K A;  2BSW A;  4A32 A;  3DDD A;  3SHP A;  3JUW A;  3UY5 A;  1MJ9 A;  4HNW B;  5JPH A;  2GE3 A;  2AJ6 A;  3T9Y A;  1MK4 A;  4MFL A;  3S6H A;  3LOD A;  3T90 A;  2JDD A;  2B3V A;  4CGL A;  3A9L A;  4JJX A;  3R96 A;  4FD6 A;  5C88 A;  4BBH A;  4E0A A;  2K5T A;  1IYK A;  3EXN A;  4YGO A;  4B5P B;  2PR1 A;  3WR7 A;  2CNM A;  3V8I A;  4B13 A;  2Z3M A;  2B5G B;  1S7F A;  2G3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...