2G3TA

Crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
169
structure length
169
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 42
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3tA00
4FD7A 5C88A 2FE7A 4KOXA 1WK4A 2BUEA 2OZHA 4XNHB 3I9SA 2O28A 3T9YA 2BL1A 4IUSA 2EUIA 2CNMA 2B3VA 3ZZIA 2KCWA 2J8RA 5EC4A 4K30A 4JXRA 3RYOA 1I1DA 4AG7A 4MY0A 5J8CA 2C27A 4KUBA 3FBUA 2A4NA 2PDOA 2JEVA 2R8VA 4E0AA 4MHDA 4CAXA 2BEIA 2FIAA 5J8FA 5F49A 1IICA 3EFAA 3SXOA 1CJWA 5F48A 3FNCA 4F6AA 1LRZA 1P4NA 4OAEA 4UBRA 2VXKA 3S6KA 1YGHA 3LD2A 3PZJA 4PV6A 4KZTA 1MJAA 2CNTA 2FT0A 4JLYA 4QB9A 3I3GA 5E96A 2DXQA 4CAVA 4OADA 3P2HA 5JPHA 2OZGA 3F0AA 5IX3A 2ZW5A 3G8WA 5H84A 2VQYA 2OB0A 2R1IA 4RI1A 4UA3A 4U5YA 4HNXB 1S7FA 4YFJA 3T90A 1QSTA 1J4JA 2PRBA 2PR1A 2PR8A 3SXNA 3MGDA 1N71A 4R3KA 4ORFA 1PU9A 3D2MA 2R7HA 1QSRA 3QAHA 4NSQA 4CAWA 2K5TA 3P2FA 4MI4A 3S6HA 2Q4YA 3BJ8A 2VZYA 3C26A 3E0KA 3D3SA 1YLEA 4KOTA 5H86A 1Q2YA 4M3SA 2QIRA 2EVNA 3GKRA 5DWNA 1Z9UA 2JDCA 2Y0MA 5ISVA 2JDDA 4H6ZA 1NMTA 2H5MA 1TIQA 2HQYA 1XMTA 4HNYB 2G3TA 4Y49C 1Q2CA 4KOSA 4EVYA 1I21A 4QBJA 2D4OA 2ZW7A 4AVCA 2Z10A 4XPKA 4YRHA 4MY3A 3BLNA 2REEA 1QSOA 2R98A 3W6XA 1I12A 1YREA 3TO7A 2CNSA 1MJ9A 3FYNA 3N7ZA 3V8IA 2QMLA 1KUVA 2IL4A 2ARHA 3CXPA 3TOAA 4JWPA 4PK3A 2VI7A 2GIVA 4LUAA 3TO6A 4JD6A 4PSWA 3K9UA 3W91A 5C82A 4AVBA 4JXQA 2B58A 3QB8A 2GANA 3UY5A 3ZJ0A 3WR7A 1YR0A 2I79A 3FXTA 3R9EA 1Y9WA 4NCZA 1S7LA 3FB3A 1PUAA 2AE6A 3DR6A 4KVME 4PSXA 1SQHA 4J3GA 4L8AA 4CRZB 1XEBA 2P6GA 4E2AA 2X7BA 3TT2A 3TE4A 1Z4RA 3EC4A 4MBUA 2Q7BA 1XE4A 2HUZA 1Z4EA 2Z0ZA 4R9MA 2Q4VA 4M85A 3R9FA 2REFA 3BJ7A 3PP9A 5HH1A 1NE9A 2ZXVA 2AJ6A 3PGPA 3S6GA 2OU2A 4I49A 4UWIA 4FD6A 2J8MA 2P0WA 4U9ZA 4L89A 4ZBGA 1MJBA 1K4JA 2HV2A 3F8KA 4X5KA 3NE7A 2Z11A 5F46A 4H6UA 2FCKA 2WPXA 2FIWA 1IIDA 4KLVA 4PK2A 3R95A 1IYKA 3LODA 4AB7A 1R57A 2Q04A 5IB0A 1MK4A 2PC1A 4B5PB 1XIXA 3IWGA 1RXTA 3FRMA 1YVKA 4HKFA 1Y7RA 5IV0A 4R3LA 5GCNA 3DR8A 3S6FA 4B5PA 4KORA 1M1DA 4QUSA 1YVOA 1V0CA 1M4DA 2B4BA 2I00A 2PSWA 2B4DB 1QSMA 1UFHA 3R1KA 4KOUA 3EY5A 4R57A 2CY2A 4B5OA 3H4QA 5F47A 1YK3A 1FY7A 4RS2A 3CXQA 4ONUA 3F5BA 1VHSA 2FS5A 4KVXA 4XNHC 2VBQA 1S60A 3JUWA 3TO9A 4QC6A 3EXNA 4KVOE 2PQ8A 3IGRA 3TFYA 4GS4A 1VKCA 1IYLA 2G3AA 5KTCA 3JVNA 2RC4A 5CNPA 4YGOA 2ZPAA 4NF1A 4KOYA 5KTDA 1S5KA 2VEZA 3VWEA 3DSBA 4BMHA 2Q44A 2ZW4A 3R96A 1M4GA 4MJ8A 3FIXA 4AG9A 2B3UA 4LX9A 3EO4A 4FD4A 2G0BA 4IF5A 3SHPA 4AVAA 2QECA 3KKWA 4OLLA 4H89A 3DNSA 1BO4A 1Y9KA 4F0YA 4R87A 1OZPA 4NEXA 4XPDC 2FSRA 2ATRA 2OH1A 3OWCA 3B8GA 5JQ4A 1QSNA 4KOWA 2B5GB 4NXYA 1RO5A 4KOVA 4Y49B 3VWDA 5DWMA 1L0CA 1WWZA 2VZZA 3D2PA 1M4IA 1CM0A 2F5IA 3D8PA 2D4PA 1XF8A 4XPDB 4II9A 4HNWB 2FL4A 4CRYB 2FXFA 4DNCA 1B87A 2P6EA 2P6FA 2GE3A 2J8NA 4JJXA 4KLWA 4KUAA 1U6MA 1KUYA 1P0HA 3TOBA 1BOBA 1S3ZA 4FD5A 5FVJA 2Q0YA 3TCVA 4QVTA 3CXSA 1NSLA 3TTHA 1YX0A 4XPLA 2OZUA 5KTAA 2NMTA 5HMNA 2B5GA 1ON0A 1S7KA 1B6BA 4E8OA 4CS0B 2WPWA 3DDDA 2BSWA 1KUXA 2B4DA 4UWJA 3GY9A 1Q2DA 1S7NA 3GYAA 3W6SA 1GHEA 1KZFA 1IB1E 4U9YA 3G3SA 5EBVA 5I0CA 1M44A 2JLMA 2ZW6A 3R9GA
chains in the Genus database with same CATH superfamily
1HEEA 4PXEA 4FD7A 5C88A 2FE7A 4KOXA 4B12A 1WK4A 2BUEA 2OZHA 2V8VA 4MHZA 4UFVA 3D7GA 4JZ0A 4CYOA 5G1ZA 4XNHB 3V38A 4C7HA 2V77A 3I9SA 2O28A 2PJ5A 2BL1A 4IUSA 3T9YA 2EUIA 2ZELA 2CNMA 3NH4A 4MHYA 4ZY1A 2GLFA 2B3VA 3ZZIA 4HPSA 2KCWA 2J8RA 5EC4A 1DTDA 4P4BA 2J9AA 3NFZA 3PB7X 4JXRA 4K30A 3RYOA 1I1DA 2ANPA 3CPXA 4AG7A 3BHXA 4MY0A 5AG6A 2PVWA 5J8CA 1Z8TA 2QYVA 2C27A 4UCMA 2YNEA 4KUBA 4ZX9A 4C7IA 3FBUA 2PJ6A 3FEDA 4M6IA 2A4NA 3QNVA 2PDOA 2JEVA 3IJ3A 4A38A 2R8VA 2WUUA 1PCAA 4MHDA 4E0AA 3H8EA 4CAXA 2BEIA 2FIAA 2ZEMA 5J8FA 1IY7A 1YQEA 5F49A 3SJXA 4FAIA 1ARMA 1IICA 3EFAA 3KQZA 3SXOA 3CZXA 1CJWA 4MFKA 5F48A 3FNCA 4F6AA 3PB6X 4R76A 1LRZA 4BINA 4A32A 1P4NA 4PXDA 4OAEA 4UBRA 3S9NA 2CTCA 2VXKA 3S6KA 1YGHA 4MFZA 1Y0YA 2ZOFA 3DLJA 3LD2A 3PZJA 4PV6A 4KZTA 1QMUA 1MJAA 2CNTA 2FT0A 3JRUA 1IOIA 2AFZA 4JLYA 4QB9A 3I3GA 4UEZA 5E96A 2DPSA 1VIXA 1CPXA 2WSAA 3RZAA 2CTBA 2DXQA 4CAVA 1KWMA 4PXBA 4OADA 1ZG8A 3P2HA 3KR5A 5JPHA 2OZGA 3F0AA 5IX3A 3IU1A 4MMOA 2ZW5A 4CGOA 3G8WA 2JEWA 3FX6A 5H84A 5HVGA 2VQYA 4P4IA 2OB0A 2R1IA 4GXHA 4RI1A 4UA3A 5G21A 4AXVA 4U5YA 2NSMA 3S9LA 4HNXB 1S7FA 4P4JA 4YFJA 1YLOA 4NGQA 3T90A 1QSTA 3FVLA 2Q7SA 1J4JA 1YW4A 2PRBA 2PR1A 2PR8A 4B10A 3SXNA 4CYNA 3MGDA 3WC6A 1N71A 4R3KA 4ORFA 1PU9A 3D2MA 4WWVA 1TXRA 2R7HA 1QSRA 3QAHA 3PB4X 3B3CA 4NSQA 4R8FA 2K5TA 4CAWA 2GREA 3P2FA 4MI4A 3S6HA 5IB9A 2Q4YA 3BJ8A 5K8NA 2VZYA 3C26A 2ZEEA 3E0KA 4W9YA 3D3SA 4B13A 4CAFA 1YLEA 4KOTA 4MFLA 5H86A 1Q2YA 4M3SA 2QIRA 2EVNA 1AUGA 2OR4A 3D7DA 2IJZA 2PIYA 2Z3PA 3GKRA 3TX8A 2Z3MA 2IQ6A 4B14A 5DWNA 1Q7LA 2C6GA 1Z9UA 4C2YA 2DEAA 1VHEA 2JDCA 3A9LA 5LYIA 2Y0MA 2RB7A 4UF4A 5AG7A 5ISVA 2JDDA 4OKOA 4H6ZA 4MFPA 1NMTA 4PXCA 1ARLA 3QAYA 2H5MA 2PJ0A 2AFWA 4KSIA 4UCPA 3S9MA 1TIQA 3IEHA 4DUKA 2HQYA 3GLJA 4M6HA 3H8FA 1XMTA 1LCPA 2G3TA 2PJCA 4HNYB 3SI1A 5K8MA 3LWUA 4Y49C 2IMOA 4NGNA 1Q2CA 4KOSA 4KS9A 2PRQA 4EVYA 1I21A 4QBJA 2D4OA 2F8HA 2ZW7A 2OOTA 2CXAA 4AVCA 2Z10A 4XPKA 3B2YA 4YRHA 2V8HA 4YU9A 2HC9A 4A94A 3CPAA 2FVGA 3WC5A 3SI0A 4MY3A 1Z8XA 3VH9A 3BLNA 4KSAA 2BCOA 1TKJA 5JH9A 4PPZA 2REEA 1QSOA 4MHNA 2R98A 1HDUA 3W6XA 1R3NA 1I12A 1YREA 1CPSA 1XOVA 2CNSA 3TO7A 1MJ9A 4GM5A 4P44A 1ZO0A 3SJEA 2PIZA 3FYNA 4B6ZA 4NJQA 3N7ZA 4P4EA 3V8IA 4X8IA 2QMLA 1IU8A 1TF9A 1KUVA 4CGMA 2O4HA 4CYQA 2IL4A 2ARHA 1XRYA 3FF3A 3CXPA 3TOAA 1CG2A 4JWPA 2Q43A 4PK3A 2VI7A 2GIVA 4TWEA 4LUAA 2EK8A 3PBBA 3TO6A 4JD6A 4PSWA 4B11A 4ZGYB 2DF5A 1Z2LA 4P45A 2PJ1A 2PJ2A 1YW6A 3K9UA 3SJFA 3W91A 5C82A 4AVBA 3SJGA 3MN8A 1AMPA 2B58A 3QB8A 2ABZA 2GANA 4JXQA 4X2TA 3UY5A 4JYWA 3WABA 3ZJ0A 3WR7A 1YR0A 2EO8A 2I79A 3WC7A 2Z3OA 3FXTA 2XEJA 6CPAA 3R9EA 1Y9WA 4ZI6A 1TKFA 4OIWA 4OC3A 5G22A 3RBUA 4NCZA 4Z65A 4P6YA 4MXUA 1BPMA 1S7LA 2AFMA 5LYLA 1IGBA 4F8ZA 2PJ9A 3FB3A 1PUAA 2WYRA 2AE6A 4MCPA 3DR6A 5LYDA 2JBKA 4KVME 4NGMA 4PSXA 1YMEA 4FBEA 1SQHA 1LFWA 4PQAA 3IU2A 5AG5A 4J3GA 1ELLP 4L8AA 4CRZB 1XEBA 2P6GA 2AFUA 2ZEPA 3K2KA 3D7HA 3B3TA 2I3CA 1XJOA 1Y7EA 3N5FA 4E2AA 2X7BA 3TT2A 3TE4A 4MCQA 1LANA 4G1PA 3ISZA 1Z4RA 4MCSA 3L2NA 3KHXA 3EC4A 4MBUA 4OC1A 1XE4A 4P4DA 2Q7BA 4R7MA 2HUZA 2NYQA 3I1UA 2F7VA 4CAEA 2EBJA 1Z4EA 2Z0ZA 2G9DA 2PJ4A 4EFDA 1BAVA 4R9MA 4Q36A 5DS0A 1XFOA 3IWEA 4IHMA 1F2OA 4UFXA 2Q4VA 4OC0A 1ZG7A 4M85A 4MFQA 3R9FA 2REFA 3BJ7A 3PP9A 5HH1A 1XMBA 3KZWA 1NE9A 2ZXVA 2AJ6A 2PVVA 3HUVA 3IO1A 3PGPA 3S6GA 2OU2A 4KSFA 5A27A 4I49A 1Y0RA 2O53A 4CPAA 4UWIA 4FD6A 2J8MA 5F09A 2P0WA 3D66A 4RN7A 4CGNA 4U9ZA 5CBMA 4L89A 4ZBGA 2YNCA 1VGYA 1MJBA 1EE3P 1K4JA 2HV2A 3WT4A 1Z8WA 3F8KA 4X5KA 3NE7A 5LYFA 2Z11A 5F46A 3KL9A 4H6UA 1PYTB 2FCKA 2EWBA 2WPXA 2FIWA 4MRIA 1IIDA 4KLVA 4IAVA 4PK2A 4CYPA 3GIUA 5LRJA 1VHOA 3R95A 4LQGA 1IYKA 5CPAA 2WZNA 3LODA 4AB7A 2Q04A 1R57A 4A37A 5IB0A 1MK4A 2PC1A 3PRTA 4B5PB 1XIXA 3IWGA 3D67A 1RXTA 3FRMA 1CX8A 5JGFA 1YVKA 1AYEA 2ZOGA 4HKFA 2CIJA 1Y7RA 2ZEOA 2ZENA 4NGTA 4DJLA 4OP4A 4NJRA 3PB9X 5IV0A 1LAPA 2AFOA 2QVPA 3PBEA 4K3NA 4MHPA 4R3LA 5GCNA 4NGRA 3DR8A 2PJAA 3S6FA 3VATA 1YSJA 4F9VA 4B5PA 2XEIA 4H2KA 4A30A 4KORA 3B7IA 1M1DA 4RUHA 4QUSA 3V7ZA 1YVOA 1V0CA 1M4DA 1R43A 2PE3A 2B4BA 3KQXA 4MFJA 2I00A 1NSAA 2B4DB 2PSWA 1QSMA 2XEFA 4IK2A 1UFHA 3NH5A 3D68A 2ZEGA 3R1KA 5G20A 1F2PA 4KOUA 3EY5A 4F0XA 4R57A 2CY2A 4B5OA 3H4QA 5F47A 4O23A 1FNOA 4ZY0A 1YK3A 1FY7A 4RS2A 3PFOA 4NFRA 3CXQA 4UEEA 4ONUA 1BPNA 3F5BA 2ODFA 3KI9A 1HDQA 1VHSA 2FS5A 4KVXA 4XNHC 2PJBA 2VBQA 1S60A 1Z8LA 4C2ZA 1QQ9A 3RO0A 3JUWA 1OBRA 4X3RA 2ZEHA 3TO9A 5J1QA 1BLLE 3CDXA 3EXNA 4QC6A 5I4MA 4KVOE 2PQ8A 3IGRA 3TFYA 4GS4A 3FECA 1VKCA 1IYLA 2G3AA 5KTCA 3SI2A 3JVNA 2RC4A 5CNPA 4YGOA 2AFXA 2ZPAA 1X10A 4NF1A 4KOYA 5KTDA 1S5KA 2Q51A 2PJ7A 2VEZA 3VWEA 3DSBA 3KHZA 2C1CA 1TF8A 4BMHA 2Q44A 2ZW4A 3R96A 8CPAA 1ZG9A 1M4GA 1ZLIA 3FJUA 4MJ8A 2GFQA 3FIXA 4AG9A 2B3UA 3FMCA 5ELYA 5HXDA 2BO9A 4LX9A 2RFHA 3B35A 1UWYA 2G0BA 3EO4A 4FD4A 4M6GA 4IF5A 3SHPA 4UCNA 4FWUA 3GB0A 2ZEFA 4AVAA 4OC4A 2QECA 3B3WA 3KKWA 4OLLA 4ZX8A 2GLJA 4H89A 2JBJA 4UFWA 3DNSA 1BO4A 5LRKA 1Y9KA 3NE8A 4DYOA 4F0YA 2YNCC 4UIAA 4Q7AA 3BI0A 4R87A 2Z3KA 3PEIA 3B3VA 2PCUA 2Z3LA 1OZPA 3NA6A 4NEXA 2QJ8A 1XBUA 3D4UA 4XPDC 4ZYQA 3IIBA 4A31A 1X12A 2FSRA 2ATRA 1Z5RA 2OH1A 3VARA 3NH8A 2Z3NA 5AGEA 3T8WA 4C2XA 3OWCA 5HVFA 5D29A 2DPTA 3B8GA 5LRGA 2PJ8A 5JQ4A 2YNDA 1QSNA 2AFSA 3MRUA 2POKA 4KOWA 2B5GB 1LAMA 4NXYA 1RO5A 5EMIA 4ZY2A 4KOVA 4Y49B 1CP7A 3IFEA 3VWDA 5DWMA 1L0CA 1WWZA 2C6CA 3KGQA 3KR4A 4BBHA 2VZZA 2ZEDA 3D2PA 1M4IA 1JWQA 3RNZA 1CM0A 2F5IA 3D8PA 2D4PA 1XF8A 4F9UA 4P10A 5A28A 5BWAB 5HVHA 4XPDB 4YWYA 4II9A 4HNWB 4UEFA 2FL4A 2YGWA 4FUUA 4CRYB 1GYTA 2FXFA 3CT9A 1DE4C 4DNCA 3PB8X 1B87A 3FH4A 4NGPA 3D7FA 5D8NA 4CGPA 3JTKA 2P6EA 2P6FA 3BXMA 4ONWA 2GE3A 1FT7A 1M4LA 4WJBA 2J8NA 3FEEA 2V8GA 3HLPA 3PFEA 4Q38A 4JJXA 5JM6A 1TKHA 3B3SA 4P4FA 3IC1A 5AG4A 3BI1A 4KLWA 1RTQA 4KUAA 4OMEA 4EWTA 3ISXA 1U6MA 7CPAA 4A2ZA 4UIBA 2Q4ZA 1KUYA 3GUXA 2CF4A 1P0HA 2VL1A 3TOBA 2EK9A 5K8OA 4OC2A 1BOBA 1S3ZA 4FD5A 5FVJA 1IOFA 2Q0YA 5K8PA 3TCVA 4OC5A 4QVTA 1H8LA 1JQGA 3CXSA 3RAMA 1ELMP 1LOKA 2HB6A 4LQ6A 1CP6A 1ZLHA 3IWWA 1NSLA 2V8DA 3KASA 3H8GA 1A2ZA 1YX0A 4XPLA 2OZUA 1F57A 3TTHA 2NMTA 3LACA 5HMNA 5KTAA 2B5GA 1ON0A 1S7KA 1B6BA 3DGVA 4CS0B 4E8OA 4A39A 2PJ3A 3H5ZA 4A95A 2WPWA 3TC8A 4R6TA 3DDDA 2BSWA 1KUXA 2B4DA 4TNUA 4UWJA 1CBXA 3GY9A 4BD9A 1Q2DA 3LMSA 2C6PA 1S7NA 2GU2A 4CGLA 3GYAA 2XEGA 3W6SA 1GHEA 2BOAA 4OIDA 4MCRA 3K9TA 4EMEA 4C68A 1KZFA 1IB1E 5THWA 4U9YA 3G3SA 4NGSA 5EBVA 1M44A 4A33A 5I0CA 2JLMA 2ZW6A 3R9GA
chains in the Genus database with same CATH topology
4FD7A 5C88A 2FE7A 4KOXA 4B12A 1WK4A 2BUEA 2OZHA 4UFVA 4CYOA 5G1ZA 4XNHB 4C7HA 3I9SA 2O28A 3T9YA 2BL1A 4IUSA 2EUIA 2CNMA 2B3VA 3ZZIA 2KCWA 2J8RA 5EC4A 4K30A 4JXRA 3RYOA 1I1DA 4AG7A 4MY0A 5AG6A 5J8CA 2C27A 4UCMA 2YNEA 4KUBA 4C7IA 3FBUA 2A4NA 2PDOA 2JEVA 2R8VA 2WUUA 4E0AA 4MHDA 4CAXA 2BEIA 2FIAA 5J8FA 5F49A 1IICA 3EFAA 3SXOA 1CJWA 4MFKA 5F48A 3FNCA 4F6AA 1LRZA 4A32A 1P4NA 4OAEA 4UBRA 2VXKA 3S6KA 1YGHA 4MFZA 3LD2A 3PZJA 4PV6A 4KZTA 1MJAA 2CNTA 2FT0A 4JLYA 4QB9A 3I3GA 5E96A 2DPSA 2WSAA 2DXQA 4CAVA 4OADA 3P2HA 5JPHA 2OZGA 3F0AA 5IX3A 3IU1A 2ZW5A 4CGOA 3G8WA 5H84A 2VQYA 2OB0A 2R1IA 4RI1A 4UA3A 5G21A 4U5YA 4HNXB 1S7FA 4YFJA 3T90A 1QSTA 1J4JA 2PRBA 2PR1A 2PR8A 4B10A 3SXNA 4CYNA 3MGDA 1N71A 4R3KA 4ORFA 1PU9A 3D2MA 2R7HA 1QSRA 3QAHA 4NSQA 4CAWA 2K5TA 3P2FA 4MI4A 3S6HA 2Q4YA 3BJ8A 2VZYA 3C26A 3E0KA 3D3SA 4B13A 4CAFA 1YLEA 4KOTA 4MFLA 5H86A 1Q2YA 4M3SA 2QIRA 2EVNA 2Z3PA 4B14A 3GKRA 2Z3MA 5DWNA 1Z9UA 4C2YA 2JDCA 3A9LA 2Y0MA 5AG7A 5ISVA 2JDDA 4H6ZA 4MFPA 1NMTA 4UCPA 2H5MA 1TIQA 2HQYA 1XMTA 4HNYB 2G3TA 4Y49C 1Q2CA 4KOSA 4KS9A 4EVYA 1I21A 4QBJA 2D4OA 2ZW7A 4AVCA 2CXAA 2Z10A 4XPKA 4YRHA 4MY3A 3BLNA 4KSAA 2REEA 1QSOA 2R98A 3W6XA 1I12A 1YREA 3TO7A 2CNSA 1MJ9A 1ZO0A 3FYNA 3N7ZA 3V8IA 2QMLA 1KUVA 4CGMA 4CYQA 2IL4A 2ARHA 3CXPA 3TOAA 4JWPA 4PK3A 2VI7A 2GIVA 4LUAA 3TO6A 4JD6A 4PSWA 4B11A 4ZGYB 3K9UA 3W91A 5C82A 4AVBA 4JXQA 2B58A 3QB8A 2GANA 3UY5A 3ZJ0A 3WR7A 1YR0A 2I79A 2Z3OA 3FXTA 3R9EA 1Y9WA 5G22A 4NCZA 1S7LA 3FB3A 1PUAA 2AE6A 3DR6A 4KVME 4PSXA 1SQHA 3IU2A 5AG5A 4J3GA 4L8AA 4CRZB 1XEBA 2P6GA 4E2AA 2X7BA 3TT2A 3TE4A 1Z4RA 3EC4A 4MBUA 2Q7BA 1XE4A 2HUZA 4CAEA 1Z4EA 2Z0ZA 4R9MA 4Q36A 3IWEA 4UFXA 2Q4VA 4MFQA 4M85A 3R9FA 2REFA 3BJ7A 3PP9A 5HH1A 1NE9A 2ZXVA 2AJ6A 3PGPA 3S6GA 2OU2A 4KSFA 5A27A 4I49A 4UWIA 4FD6A 2J8MA 2P0WA 4CGNA 4U9ZA 4L89A 4ZBGA 2YNCA 1MJBA 1K4JA 2HV2A 3F8KA 4X5KA 3NE7A 2Z11A 5F46A 4H6UA 2FCKA 2WPXA 2FIWA 1IIDA 4KLVA 4PK2A 4CYPA 3R95A 1IYKA 3LODA 4AB7A 1R57A 2Q04A 5IB0A 1MK4A 2PC1A 4B5PB 1XIXA 3IWGA 1RXTA 3FRMA 1YVKA 4HKFA 1Y7RA 5IV0A 4R3LA 5GCNA 3DR8A 3S6FA 4B5PA 4A30A 4KORA 1M1DA 4QUSA 1YVOA 1V0CA 1M4DA 2B4BA 4MFJA 2I00A 2PSWA 2B4DB 1QSMA 1UFHA 5G20A 3R1KA 4KOUA 3EY5A 4F0XA 4R57A 2CY2A 4B5OA 3H4QA 5F47A 1YK3A 1FY7A 4RS2A 3CXQA 4ONUA 3F5BA 1VHSA 2FS5A 4KVXA 4XNHC 2VBQA 1S60A 4C2ZA 3JUWA 3TO9A 3EXNA 4QC6A 4KVOE 2PQ8A 3IGRA 3TFYA 4GS4A 1VKCA 1IYLA 2G3AA 5KTCA 3JVNA 2RC4A 5CNPA 4YGOA 2ZPAA 4NF1A 4KOYA 5KTDA 1S5KA 2VEZA 3VWEA 3DSBA 4BMHA 2Q44A 2ZW4A 3R96A 1M4GA 4MJ8A 3FIXA 4AG9A 2B3UA 4LX9A 4A31A 3EO4A 4FD4A 2G0BA 4IF5A 3SHPA 4UCNA 4AVAA 2QECA 3KKWA 4OLLA 4H89A 4UFWA 3DNSA 1BO4A 1Y9KA 4F0YA 2YNCC 4R87A 2Z3KA 2Z3LA 1OZPA 4NEXA 4XPDC 2FSRA 2ATRA 2OH1A 2Z3NA 5AGEA 4C2XA 3OWCA 2DPTA 3B8GA 5JQ4A 2YNDA 1QSNA 4KOWA 2B5GB 4NXYA 1RO5A 4KOVA 4Y49B 3VWDA 5DWMA 1L0CA 1WWZA 4BBHA 2VZZA 3D2PA 1M4IA 1CM0A 2F5IA 3D8PA 2D4PA 1XF8A 5A28A 5BWAB 4XPDB 4II9A 4HNWB 2FL4A 2YGWA 4CRYB 2FXFA 4DNCA 1B87A 4CGPA 3JTKA 2P6EA 2P6FA 2GE3A 2J8NA 4Q38A 4JJXA 5AG4A 4KLWA 4KUAA 1U6MA 4A2ZA 1KUYA 1P0HA 3TOBA 1BOBA 1S3ZA 4FD5A 5FVJA 2Q0YA 3TCVA 4QVTA 3CXSA 1NSLA 3TTHA 1YX0A 4XPLA 2OZUA 5KTAA 2NMTA 5HMNA 2B5GA 1ON0A 1S7KA 1B6BA 4E8OA 4CS0B 4A95A 3H5ZA 2WPWA 3DDDA 2BSWA 1KUXA 2B4DA 4UWJA 3GY9A 1Q2DA 1S7NA 4CGLA 3GYAA 3W6SA 1GHEA 4C68A 1KZFA 1IB1E 4U9YA 3G3SA 5EBVA 5I0CA 1M44A 4A33A 2JLMA 2ZW6A 3R9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FD7 A;  5C88 A;  2FE7 A;  4KOX A;  1WK4 A;  2BUE A;  2OZH A;  4XNH B;  3I9S A;  2O28 A;  3T9Y A;  2BL1 A;  4IUS A;  2EUI A;  2CNM A;  2B3V A;  3ZZI A;  2KCW A;  2J8R A;  5EC4 A;  4K30 A;  4JXR A;  3RYO A;  1I1D A;  4AG7 A;  4MY0 A;  5J8C A;  2C27 A;  4KUB A;  3FBU A;  2A4N A;  2PDO A;  2JEV A;  2R8V A;  4E0A A;  4MHD A;  4CAX A;  2BEI A;  2FIA A;  5J8F A;  5F49 A;  1IIC A;  3EFA A;  3SXO A;  1CJW A;  5F48 A;  3FNC A;  4F6A A;  1LRZ A;  1P4N A;  4OAE A;  4UBR A;  2VXK A;  3S6K A;  1YGH A;  3LD2 A;  3PZJ A;  4PV6 A;  4KZT A;  1MJA A;  2CNT A;  2FT0 A;  4JLY A;  4QB9 A;  3I3G A;  5E96 A;  2DXQ A;  4CAV A;  4OAD A;  3P2H A;  5JPH A;  2OZG A;  3F0A A;  5IX3 A;  2ZW5 A;  3G8W A;  5H84 A;  2VQY A;  2OB0 A;  2R1I A;  4RI1 A;  4UA3 A;  4U5Y A;  4HNX B;  1S7F A;  4YFJ A;  3T90 A;  1QST A;  1J4J A;  2PRB A;  2PR1 A;  2PR8 A;  3SXN A;  3MGD A;  1N71 A;  4R3K A;  4ORF A;  1PU9 A;  3D2M A;  2R7H A;  1QSR A;  3QAH A;  4NSQ A;  4CAW A;  2K5T A;  3P2F A;  4MI4 A;  3S6H A;  2Q4Y A;  3BJ8 A;  2VZY A;  3C26 A;  3E0K A;  3D3S A;  1YLE A;  4KOT A;  5H86 A;  1Q2Y A;  4M3S A;  2QIR A;  2EVN A;  3GKR A;  5DWN A;  1Z9U A;  2JDC A;  2Y0M A;  5ISV A;  2JDD A;  4H6Z A;  1NMT A;  2H5M A;  1TIQ A;  2HQY A;  1XMT A;  4HNY B;  2G3T A;  4Y49 C;  1Q2C A;  4KOS A;  4EVY A;  1I21 A;  4QBJ A;  2D4O A;  2ZW7 A;  4AVC A;  2Z10 A;  4XPK A;  4YRH A;  4MY3 A;  3BLN A;  2REE A;  1QSO A;  2R98 A;  3W6X A;  1I12 A;  1YRE A;  3TO7 A;  2CNS A;  1MJ9 A;  3FYN A;  3N7Z A;  3V8I A;  2QML A;  1KUV A;  2IL4 A;  2ARH A;  3CXP A;  3TOA A;  4JWP A;  4PK3 A;  2VI7 A;  2GIV A;  4LUA A;  3TO6 A;  4JD6 A;  4PSW A;  3K9U A;  3W91 A;  5C82 A;  4AVB A;  4JXQ A;  2B58 A;  3QB8 A;  2GAN A;  3UY5 A;  3ZJ0 A;  3WR7 A;  1YR0 A;  2I79 A;  3FXT A;  3R9E A;  1Y9W A;  4NCZ A;  1S7L A;  3FB3 A;  1PUA A;  2AE6 A;  3DR6 A;  4KVM E;  4PSX A;  1SQH A;  4J3G A;  4L8A A;  4CRZ B;  1XEB A;  2P6G A;  4E2A A;  2X7B A;  3TT2 A;  3TE4 A;  1Z4R A;  3EC4 A;  4MBU A;  2Q7B A;  1XE4 A;  2HUZ A;  1Z4E A;  2Z0Z A;  4R9M A;  2Q4V A;  4M85 A;  3R9F A;  2REF A;  3BJ7 A;  3PP9 A;  5HH1 A;  1NE9 A;  2ZXV A;  2AJ6 A;  3PGP A;  3S6G A;  2OU2 A;  4I49 A;  4UWI A;  4FD6 A;  2J8M A;  2P0W A;  4U9Z A;  4L89 A;  4ZBG A;  1MJB A;  1K4J A;  2HV2 A;  3F8K A;  4X5K A;  3NE7 A;  2Z11 A;  5F46 A;  4H6U A;  2FCK A;  2WPX A;  2FIW A;  1IID A;  4KLV A;  4PK2 A;  3R95 A;  1IYK A;  3LOD A;  4AB7 A;  1R57 A;  2Q04 A;  5IB0 A;  1MK4 A;  2PC1 A;  4B5P B;  1XIX A;  3IWG A;  1RXT A;  3FRM A;  1YVK A;  4HKF A;  1Y7R A;  5IV0 A;  4R3L A;  5GCN A;  3DR8 A;  3S6F A;  4B5P A;  4KOR A;  1M1D A;  4QUS A;  1YVO A;  1V0C A;  1M4D A;  2B4B A;  2I00 A;  2PSW A;  2B4D B;  1QSM A;  1UFH A;  3R1K A;  4KOU A;  3EY5 A;  4R57 A;  2CY2 A;  4B5O A;  3H4Q A;  5F47 A;  1YK3 A;  1FY7 A;  4RS2 A;  3CXQ A;  4ONU A;  3F5B A;  1VHS A;  2FS5 A;  4KVX A;  4XNH C;  2VBQ A;  1S60 A;  3JUW A;  3TO9 A;  4QC6 A;  3EXN A;  4KVO E;  2PQ8 A;  3IGR A;  3TFY A;  4GS4 A;  1VKC A;  1IYL A;  2G3A A;  5KTC A;  3JVN A;  2RC4 A;  5CNP A;  4YGO A;  2ZPA A;  4NF1 A;  4KOY A;  5KTD A;  1S5K A;  2VEZ A;  3VWE A;  3DSB A;  4BMH A;  2Q44 A;  2ZW4 A;  3R96 A;  1M4G A;  4MJ8 A;  3FIX A;  4AG9 A;  2B3U A;  4LX9 A;  3EO4 A;  4FD4 A;  2G0B A;  4IF5 A;  3SHP A;  4AVA A;  2QEC A;  3KKW A;  4OLL A;  4H89 A;  3DNS A;  1BO4 A;  1Y9K A;  4F0Y A;  4R87 A;  1OZP A;  4NEX A;  4XPD C;  2FSR A;  2ATR A;  2OH1 A;  3OWC A;  3B8G A;  5JQ4 A;  1QSN A;  4KOW A;  2B5G B;  4NXY A;  1RO5 A;  4KOV A;  4Y49 B;  3VWD A;  5DWM A;  1L0C A;  1WWZ A;  2VZZ A;  3D2P A;  1M4I A;  1CM0 A;  2F5I A;  3D8P A;  2D4P A;  1XF8 A;  4XPD B;  4II9 A;  4HNW B;  2FL4 A;  4CRY B;  2FXF A;  4DNC A;  1B87 A;  2P6E A;  2P6F A;  2GE3 A;  2J8N A;  4JJX A;  4KLW A;  4KUA A;  1U6M A;  1KUY A;  1P0H A;  3TOB A;  1BOB A;  1S3Z A;  4FD5 A;  5FVJ A;  2Q0Y A;  3TCV A;  4QVT A;  3CXS A;  1NSL A;  3TTH A;  1YX0 A;  4XPL A;  2OZU A;  5KTA A;  2NMT A;  5HMN A;  2B5G A;  1ON0 A;  1S7K A;  1B6B A;  4E8O A;  4CS0 B;  2WPW A;  3DDD A;  2BSW A;  1KUX A;  2B4D A;  4UWJ A;  3GY9 A;  1Q2D A;  1S7N A;  3GYA A;  3W6S A;  1GHE A;  1KZF A;  1IB1 E;  4U9Y A;  3G3S A;  5EBV A;  5I0C A;  1M44 A;  2JLM A;  2ZW6 A;  3R9G A; 
#chains in the Genus database with same CATH topology
 1HEE A;  4PXE A;  4FD7 A;  5C88 A;  2FE7 A;  4KOX A;  4B12 A;  1WK4 A;  2BUE A;  2OZH A;  2V8V A;  4MHZ A;  4UFV A;  3D7G A;  4JZ0 A;  4CYO A;  5G1Z A;  4XNH B;  3V38 A;  4C7H A;  2V77 A;  3I9S A;  2O28 A;  2PJ5 A;  2BL1 A;  4IUS A;  3T9Y A;  2EUI A;  2ZEL A;  2CNM A;  3NH4 A;  4MHY A;  4ZY1 A;  2GLF A;  2B3V A;  3ZZI A;  4HPS A;  2KCW A;  2J8R A;  5EC4 A;  1DTD A;  4P4B A;  2J9A A;  3NFZ A;  3PB7 X;  4JXR A;  4K30 A;  3RYO A;  1I1D A;  2ANP A;  3CPX A;  4AG7 A;  3BHX A;  4MY0 A;  5AG6 A;  2PVW A;  5J8C A;  1Z8T A;  2QYV A;  2C27 A;  4UCM A;  2YNE A;  4KUB A;  4ZX9 A;  4C7I A;  3FBU A;  2PJ6 A;  3FED A;  4M6I A;  2A4N A;  3QNV A;  2PDO A;  2JEV A;  3IJ3 A;  4A38 A;  2R8V A;  2WUU A;  1PCA A;  4MHD A;  4E0A A;  3H8E A;  4CAX A;  2BEI A;  2FIA A;  2ZEM A;  5J8F A;  1IY7 A;  1YQE A;  5F49 A;  3SJX A;  4FAI A;  1ARM A;  1IIC A;  3EFA A;  3KQZ A;  3SXO A;  3CZX A;  1CJW A;  4MFK A;  5F48 A;  3FNC A;  4F6A A;  3PB6 X;  4R76 A;  1LRZ A;  4BIN A;  4A32 A;  1P4N A;  4PXD A;  4OAE A;  4UBR A;  3S9N A;  2CTC A;  2VXK A;  3S6K A;  1YGH A;  4MFZ A;  1Y0Y A;  2ZOF A;  3DLJ A;  3LD2 A;  3PZJ A;  4PV6 A;  4KZT A;  1QMU A;  1MJA A;  2CNT A;  2FT0 A;  3JRU A;  1IOI A;  2AFZ A;  4JLY A;  4QB9 A;  3I3G A;  4UEZ A;  5E96 A;  2DPS A;  1VIX A;  1CPX A;  2WSA A;  3RZA A;  2CTB A;  2DXQ A;  4CAV A;  1KWM A;  4PXB A;  4OAD A;  1ZG8 A;  3P2H A;  3KR5 A;  5JPH A;  2OZG A;  3F0A A;  5IX3 A;  3IU1 A;  4MMO A;  2ZW5 A;  4CGO A;  3G8W A;  2JEW A;  3FX6 A;  5H84 A;  5HVG A;  2VQY A;  4P4I A;  2OB0 A;  2R1I A;  4GXH A;  4RI1 A;  4UA3 A;  5G21 A;  4AXV A;  4U5Y A;  2NSM A;  3S9L A;  4HNX B;  1S7F A;  4P4J A;  4YFJ A;  1YLO A;  4NGQ A;  3T90 A;  1QST A;  3FVL A;  2Q7S A;  1J4J A;  1YW4 A;  2PRB A;  2PR1 A;  2PR8 A;  4B10 A;  3SXN A;  4CYN A;  3MGD A;  3WC6 A;  1N71 A;  4R3K A;  4ORF A;  1PU9 A;  3D2M A;  4WWV A;  1TXR A;  2R7H A;  1QSR A;  3QAH A;  3PB4 X;  3B3C A;  4NSQ A;  4R8F A;  2K5T A;  4CAW A;  2GRE A;  3P2F A;  4MI4 A;  3S6H A;  5IB9 A;  2Q4Y A;  3BJ8 A;  5K8N A;  2VZY A;  3C26 A;  2ZEE A;  3E0K A;  4W9Y A;  3D3S A;  4B13 A;  4CAF A;  1YLE A;  4KOT A;  4MFL A;  5H86 A;  1Q2Y A;  4M3S A;  2QIR A;  2EVN A;  1AUG A;  2OR4 A;  3D7D A;  2IJZ A;  2PIY A;  2Z3P A;  3GKR A;  3TX8 A;  2Z3M A;  2IQ6 A;  4B14 A;  5DWN A;  1Q7L A;  2C6G A;  1Z9U A;  4C2Y A;  2DEA A;  1VHE A;  2JDC A;  3A9L A;  5LYI A;  2Y0M A;  2RB7 A;  4UF4 A;  5AG7 A;  5ISV A;  2JDD A;  4OKO A;  4H6Z A;  4MFP A;  1NMT A;  4PXC A;  1ARL A;  3QAY A;  2H5M A;  2PJ0 A;  2AFW A;  4KSI A;  4UCP A;  3S9M A;  1TIQ A;  3IEH A;  4DUK A;  2HQY A;  3GLJ A;  4M6H A;  3H8F A;  1XMT A;  1LCP A;  2G3T A;  2PJC A;  4HNY B;  3SI1 A;  5K8M A;  3LWU A;  4Y49 C;  2IMO A;  4NGN A;  1Q2C A;  4KOS A;  4KS9 A;  2PRQ A;  4EVY A;  1I21 A;  4QBJ A;  2D4O A;  2F8H A;  2ZW7 A;  2OOT A;  2CXA A;  4AVC A;  2Z10 A;  4XPK A;  3B2Y A;  4YRH A;  2V8H A;  4YU9 A;  2HC9 A;  4A94 A;  3CPA A;  2FVG A;  3WC5 A;  3SI0 A;  4MY3 A;  1Z8X A;  3VH9 A;  3BLN A;  4KSA A;  2BCO A;  1TKJ A;  5JH9 A;  4PPZ A;  2REE A;  1QSO A;  4MHN A;  2R98 A;  1HDU A;  3W6X A;  1R3N A;  1I12 A;  1YRE A;  1CPS A;  1XOV A;  2CNS A;  3TO7 A;  1MJ9 A;  4GM5 A;  4P44 A;  1ZO0 A;  3SJE A;  2PIZ A;  3FYN A;  4B6Z A;  4NJQ A;  3N7Z A;  4P4E A;  3V8I A;  4X8I A;  2QML A;  1IU8 A;  1TF9 A;  1KUV A;  4CGM A;  2O4H A;  4CYQ A;  2IL4 A;  2ARH A;  1XRY A;  3FF3 A;  3CXP A;  3TOA A;  1CG2 A;  4JWP A;  2Q43 A;  4PK3 A;  2VI7 A;  2GIV A;  4TWE A;  4LUA A;  2EK8 A;  3PBB A;  3TO6 A;  4JD6 A;  4PSW A;  4B11 A;  4ZGY B;  2DF5 A;  1Z2L A;  4P45 A;  2PJ1 A;  2PJ2 A;  1YW6 A;  3K9U A;  3SJF A;  3W91 A;  5C82 A;  4AVB A;  3SJG A;  3MN8 A;  1AMP A;  2B58 A;  3QB8 A;  2ABZ A;  2GAN A;  4JXQ A;  4X2T A;  3UY5 A;  4JYW A;  3WAB A;  3ZJ0 A;  3WR7 A;  1YR0 A;  2EO8 A;  2I79 A;  3WC7 A;  2Z3O A;  3FXT A;  2XEJ A;  6CPA A;  3R9E A;  1Y9W A;  4ZI6 A;  1TKF A;  4OIW A;  4OC3 A;  5G22 A;  3RBU A;  4NCZ A;  4Z65 A;  4P6Y A;  4MXU A;  1BPM A;  1S7L A;  2AFM A;  5LYL A;  1IGB A;  4F8Z A;  2PJ9 A;  3FB3 A;  1PUA A;  2WYR A;  2AE6 A;  4MCP A;  3DR6 A;  5LYD A;  2JBK A;  4KVM E;  4NGM A;  4PSX A;  1YME A;  4FBE A;  1SQH A;  1LFW A;  4PQA A;  3IU2 A;  5AG5 A;  4J3G A;  1ELL P;  4L8A A;  4CRZ B;  1XEB A;  2P6G A;  2AFU A;  2ZEP A;  3K2K A;  3D7H A;  3B3T A;  2I3C A;  1XJO A;  1Y7E A;  3N5F A;  4E2A A;  2X7B A;  3TT2 A;  3TE4 A;  4MCQ A;  1LAN A;  4G1P A;  3ISZ A;  1Z4R A;  4MCS A;  3L2N A;  3KHX A;  3EC4 A;  4MBU A;  4OC1 A;  1XE4 A;  4P4D A;  2Q7B A;  4R7M A;  2HUZ A;  2NYQ A;  3I1U A;  2F7V A;  4CAE A;  2EBJ A;  1Z4E A;  2Z0Z A;  2G9D A;  2PJ4 A;  4EFD A;  1BAV A;  4R9M A;  4Q36 A;  5DS0 A;  1XFO A;  3IWE A;  4IHM A;  1F2O A;  4UFX A;  2Q4V A;  4OC0 A;  1ZG7 A;  4M85 A;  4MFQ A;  3R9F A;  2REF A;  3BJ7 A;  3PP9 A;  5HH1 A;  1XMB A;  3KZW A;  1NE9 A;  2ZXV A;  2AJ6 A;  2PVV A;  3HUV A;  3IO1 A;  3PGP A;  3S6G A;  2OU2 A;  4KSF A;  5A27 A;  4I49 A;  1Y0R A;  2O53 A;  4CPA A;  4UWI A;  4FD6 A;  2J8M A;  5F09 A;  2P0W A;  3D66 A;  4RN7 A;  4CGN A;  4U9Z A;  5CBM A;  4L89 A;  4ZBG A;  2YNC A;  1VGY A;  1MJB A;  1EE3 P;  1K4J A;  2HV2 A;  3WT4 A;  1Z8W A;  3F8K A;  4X5K A;  3NE7 A;  5LYF A;  2Z11 A;  5F46 A;  3KL9 A;  4H6U A;  1PYT B;  2FCK A;  2EWB A;  2WPX A;  2FIW A;  4MRI A;  1IID A;  4KLV A;  4IAV A;  4PK2 A;  4CYP A;  3GIU A;  5LRJ A;  1VHO A;  3R95 A;  4LQG A;  1IYK A;  5CPA A;  2WZN A;  3LOD A;  4AB7 A;  2Q04 A;  1R57 A;  4A37 A;  5IB0 A;  1MK4 A;  2PC1 A;  3PRT A;  4B5P B;  1XIX A;  3IWG A;  3D67 A;  1RXT A;  3FRM A;  1CX8 A;  5JGF A;  1YVK A;  1AYE A;  2ZOG A;  4HKF A;  2CIJ A;  1Y7R A;  2ZEO A;  2ZEN A;  4NGT A;  4DJL A;  4OP4 A;  4NJR A;  3PB9 X;  5IV0 A;  1LAP A;  2AFO A;  2QVP A;  3PBE A;  4K3N A;  4MHP A;  4R3L A;  5GCN A;  4NGR A;  3DR8 A;  2PJA A;  3S6F A;  3VAT A;  1YSJ A;  4F9V A;  4B5P A;  2XEI A;  4H2K A;  4A30 A;  4KOR A;  3B7I A;  1M1D A;  4RUH A;  4QUS A;  3V7Z A;  1YVO A;  1V0C A;  1M4D A;  1R43 A;  2PE3 A;  2B4B A;  3KQX A;  4MFJ A;  2I00 A;  1NSA A;  2B4D B;  2PSW A;  1QSM A;  2XEF A;  4IK2 A;  1UFH A;  3NH5 A;  3D68 A;  2ZEG A;  3R1K A;  5G20 A;  1F2P A;  4KOU A;  3EY5 A;  4F0X A;  4R57 A;  2CY2 A;  4B5O A;  3H4Q A;  5F47 A;  4O23 A;  1FNO A;  4ZY0 A;  1YK3 A;  1FY7 A;  4RS2 A;  3PFO A;  4NFR A;  3CXQ A;  4UEE A;  4ONU A;  1BPN A;  3F5B A;  2ODF A;  3KI9 A;  1HDQ A;  1VHS A;  2FS5 A;  4KVX A;  4XNH C;  2PJB A;  2VBQ A;  1S60 A;  1Z8L A;  4C2Z A;  1QQ9 A;  3RO0 A;  3JUW A;  1OBR A;  4X3R A;  2ZEH A;  3TO9 A;  5J1Q A;  1BLL E;  3CDX A;  3EXN A;  4QC6 A;  5I4M A;  4KVO E;  2PQ8 A;  3IGR A;  3TFY A;  4GS4 A;  3FEC A;  1VKC A;  1IYL A;  2G3A A;  5KTC A;  3SI2 A;  3JVN A;  2RC4 A;  5CNP A;  4YGO A;  2AFX A;  2ZPA A;  1X10 A;  4NF1 A;  4KOY A;  5KTD A;  1S5K A;  2Q51 A;  2PJ7 A;  2VEZ A;  3VWE A;  3DSB A;  3KHZ A;  2C1C A;  1TF8 A;  4BMH A;  2Q44 A;  2ZW4 A;  3R96 A;  8CPA A;  1ZG9 A;  1M4G A;  1ZLI A;  3FJU A;  4MJ8 A;  2GFQ A;  3FIX A;  4AG9 A;  2B3U A;  3FMC A;  5ELY A;  5HXD A;  2BO9 A;  4LX9 A;  2RFH A;  3B35 A;  1UWY A;  2G0B A;  3EO4 A;  4FD4 A;  4M6G A;  4IF5 A;  3SHP A;  4UCN A;  4FWU A;  3GB0 A;  2ZEF A;  4AVA A;  4OC4 A;  2QEC A;  3B3W A;  3KKW A;  4OLL A;  4ZX8 A;  2GLJ A;  4H89 A;  2JBJ A;  4UFW A;  3DNS A;  1BO4 A;  5LRK A;  1Y9K A;  3NE8 A;  4DYO A;  4F0Y A;  2YNC C;  4UIA A;  4Q7A A;  3BI0 A;  4R87 A;  2Z3K A;  3PEI A;  3B3V A;  2PCU A;  2Z3L A;  1OZP A;  3NA6 A;  4NEX A;  2QJ8 A;  1XBU A;  3D4U A;  4XPD C;  4ZYQ A;  3IIB A;  4A31 A;  1X12 A;  2FSR A;  2ATR A;  1Z5R A;  2OH1 A;  3VAR A;  3NH8 A;  2Z3N A;  5AGE A;  3T8W A;  4C2X A;  3OWC A;  5HVF A;  5D29 A;  2DPT A;  3B8G A;  5LRG A;  2PJ8 A;  5JQ4 A;  2YND A;  1QSN A;  2AFS A;  3MRU A;  2POK A;  4KOW A;  2B5G B;  1LAM A;  4NXY A;  1RO5 A;  5EMI A;  4ZY2 A;  4KOV A;  4Y49 B;  1CP7 A;  3IFE A;  3VWD A;  5DWM A;  1L0C A;  1WWZ A;  2C6C A;  3KGQ A;  3KR4 A;  4BBH A;  2VZZ A;  2ZED A;  3D2P A;  1M4I A;  1JWQ A;  3RNZ A;  1CM0 A;  2F5I A;  3D8P A;  2D4P A;  1XF8 A;  4F9U A;  4P10 A;  5A28 A;  5BWA B;  5HVH A;  4XPD B;  4YWY A;  4II9 A;  4HNW B;  4UEF A;  2FL4 A;  2YGW A;  4FUU A;  4CRY B;  1GYT A;  2FXF A;  3CT9 A;  1DE4 C;  4DNC A;  3PB8 X;  1B87 A;  3FH4 A;  4NGP A;  3D7F A;  5D8N A;  4CGP A;  3JTK A;  2P6E A;  2P6F A;  3BXM A;  4ONW A;  2GE3 A;  1FT7 A;  1M4L A;  4WJB A;  2J8N A;  3FEE A;  2V8G A;  3HLP A;  3PFE A;  4Q38 A;  4JJX A;  5JM6 A;  1TKH A;  3B3S A;  4P4F A;  3IC1 A;  5AG4 A;  3BI1 A;  4KLW A;  1RTQ A;  4KUA A;  4OME A;  4EWT A;  3ISX A;  1U6M A;  7CPA A;  4A2Z A;  4UIB A;  2Q4Z A;  1KUY A;  3GUX A;  2CF4 A;  1P0H A;  2VL1 A;  3TOB A;  2EK9 A;  5K8O A;  4OC2 A;  1BOB A;  1S3Z A;  4FD5 A;  5FVJ A;  1IOF A;  2Q0Y A;  5K8P A;  3TCV A;  4OC5 A;  4QVT A;  1H8L A;  1JQG A;  3CXS A;  3RAM A;  1ELM P;  1LOK A;  2HB6 A;  4LQ6 A;  1CP6 A;  1ZLH A;  3IWW A;  1NSL A;  2V8D A;  3KAS A;  3H8G A;  1A2Z A;  1YX0 A;  4XPL A;  2OZU A;  1F57 A;  3TTH A;  2NMT A;  3LAC A;  5HMN A;  5KTA A;  2B5G A;  1ON0 A;  1S7K A;  1B6B A;  3DGV A;  4CS0 B;  4E8O A;  4A39 A;  2PJ3 A;  3H5Z A;  4A95 A;  2WPW A;  3TC8 A;  4R6T A;  3DDD A;  2BSW A;  1KUX A;  2B4D A;  4TNU A;  4UWJ A;  1CBX A;  3GY9 A;  4BD9 A;  1Q2D A;  3LMS A;  2C6P A;  1S7N A;  2GU2 A;  4CGL A;  3GYA A;  2XEG A;  3W6S A;  1GHE A;  2BOA A;  4OID A;  4MCR A;  3K9T A;  4EME A;  4C68 A;  1KZF A;  1IB1 E;  5THW A;  4U9Y A;  3G3S A;  4NGS A;  5EBV A;  1M44 A;  4A33 A;  5I0C A;  2JLM A;  2ZW6 A;  3R9G A; 
#chains in the Genus database with same CATH homology
 4FD7 A;  5C88 A;  2FE7 A;  4KOX A;  4B12 A;  1WK4 A;  2BUE A;  2OZH A;  4UFV A;  4CYO A;  5G1Z A;  4XNH B;  4C7H A;  3I9S A;  2O28 A;  3T9Y A;  2BL1 A;  4IUS A;  2EUI A;  2CNM A;  2B3V A;  3ZZI A;  2KCW A;  2J8R A;  5EC4 A;  4K30 A;  4JXR A;  3RYO A;  1I1D A;  4AG7 A;  4MY0 A;  5AG6 A;  5J8C A;  2C27 A;  4UCM A;  2YNE A;  4KUB A;  4C7I A;  3FBU A;  2A4N A;  2PDO A;  2JEV A;  2R8V A;  2WUU A;  4E0A A;  4MHD A;  4CAX A;  2BEI A;  2FIA A;  5J8F A;  5F49 A;  1IIC A;  3EFA A;  3SXO A;  1CJW A;  4MFK A;  5F48 A;  3FNC A;  4F6A A;  1LRZ A;  4A32 A;  1P4N A;  4OAE A;  4UBR A;  2VXK A;  3S6K A;  1YGH A;  4MFZ A;  3LD2 A;  3PZJ A;  4PV6 A;  4KZT A;  1MJA A;  2CNT A;  2FT0 A;  4JLY A;  4QB9 A;  3I3G A;  5E96 A;  2DPS A;  2WSA A;  2DXQ A;  4CAV A;  4OAD A;  3P2H A;  5JPH A;  2OZG A;  3F0A A;  5IX3 A;  3IU1 A;  2ZW5 A;  4CGO A;  3G8W A;  5H84 A;  2VQY A;  2OB0 A;  2R1I A;  4RI1 A;  4UA3 A;  5G21 A;  4U5Y A;  4HNX B;  1S7F A;  4YFJ A;  3T90 A;  1QST A;  1J4J A;  2PRB A;  2PR1 A;  2PR8 A;  4B10 A;  3SXN A;  4CYN A;  3MGD A;  1N71 A;  4R3K A;  4ORF A;  1PU9 A;  3D2M A;  2R7H A;  1QSR A;  3QAH A;  4NSQ A;  4CAW A;  2K5T A;  3P2F A;  4MI4 A;  3S6H A;  2Q4Y A;  3BJ8 A;  2VZY A;  3C26 A;  3E0K A;  3D3S A;  4B13 A;  4CAF A;  1YLE A;  4KOT A;  4MFL A;  5H86 A;  1Q2Y A;  4M3S A;  2QIR A;  2EVN A;  2Z3P A;  4B14 A;  3GKR A;  2Z3M A;  5DWN A;  1Z9U A;  4C2Y A;  2JDC A;  3A9L A;  2Y0M A;  5AG7 A;  5ISV A;  2JDD A;  4H6Z A;  4MFP A;  1NMT A;  4UCP A;  2H5M A;  1TIQ A;  2HQY A;  1XMT A;  4HNY B;  2G3T A;  4Y49 C;  1Q2C A;  4KOS A;  4KS9 A;  4EVY A;  1I21 A;  4QBJ A;  2D4O A;  2ZW7 A;  4AVC A;  2CXA A;  2Z10 A;  4XPK A;  4YRH A;  4MY3 A;  3BLN A;  4KSA A;  2REE A;  1QSO A;  2R98 A;  3W6X A;  1I12 A;  1YRE A;  3TO7 A;  2CNS A;  1MJ9 A;  1ZO0 A;  3FYN A;  3N7Z A;  3V8I A;  2QML A;  1KUV A;  4CGM A;  4CYQ A;  2IL4 A;  2ARH A;  3CXP A;  3TOA A;  4JWP A;  4PK3 A;  2VI7 A;  2GIV A;  4LUA A;  3TO6 A;  4JD6 A;  4PSW A;  4B11 A;  4ZGY B;  3K9U A;  3W91 A;  5C82 A;  4AVB A;  4JXQ A;  2B58 A;  3QB8 A;  2GAN A;  3UY5 A;  3ZJ0 A;  3WR7 A;  1YR0 A;  2I79 A;  2Z3O A;  3FXT A;  3R9E A;  1Y9W A;  5G22 A;  4NCZ A;  1S7L A;  3FB3 A;  1PUA A;  2AE6 A;  3DR6 A;  4KVM E;  4PSX A;  1SQH A;  3IU2 A;  5AG5 A;  4J3G A;  4L8A A;  4CRZ B;  1XEB A;  2P6G A;  4E2A A;  2X7B A;  3TT2 A;  3TE4 A;  1Z4R A;  3EC4 A;  4MBU A;  2Q7B A;  1XE4 A;  2HUZ A;  4CAE A;  1Z4E A;  2Z0Z A;  4R9M A;  4Q36 A;  3IWE A;  4UFX A;  2Q4V A;  4MFQ A;  4M85 A;  3R9F A;  2REF A;  3BJ7 A;  3PP9 A;  5HH1 A;  1NE9 A;  2ZXV A;  2AJ6 A;  3PGP A;  3S6G A;  2OU2 A;  4KSF A;  5A27 A;  4I49 A;  4UWI A;  4FD6 A;  2J8M A;  2P0W A;  4CGN A;  4U9Z A;  4L89 A;  4ZBG A;  2YNC A;  1MJB A;  1K4J A;  2HV2 A;  3F8K A;  4X5K A;  3NE7 A;  2Z11 A;  5F46 A;  4H6U A;  2FCK A;  2WPX A;  2FIW A;  1IID A;  4KLV A;  4PK2 A;  4CYP A;  3R95 A;  1IYK A;  3LOD A;  4AB7 A;  1R57 A;  2Q04 A;  5IB0 A;  1MK4 A;  2PC1 A;  4B5P B;  1XIX A;  3IWG A;  1RXT A;  3FRM A;  1YVK A;  4HKF A;  1Y7R A;  5IV0 A;  4R3L A;  5GCN A;  3DR8 A;  3S6F A;  4B5P A;  4A30 A;  4KOR A;  1M1D A;  4QUS A;  1YVO A;  1V0C A;  1M4D A;  2B4B A;  4MFJ A;  2I00 A;  2PSW A;  2B4D B;  1QSM A;  1UFH A;  5G20 A;  3R1K A;  4KOU A;  3EY5 A;  4F0X A;  4R57 A;  2CY2 A;  4B5O A;  3H4Q A;  5F47 A;  1YK3 A;  1FY7 A;  4RS2 A;  3CXQ A;  4ONU A;  3F5B A;  1VHS A;  2FS5 A;  4KVX A;  4XNH C;  2VBQ A;  1S60 A;  4C2Z A;  3JUW A;  3TO9 A;  3EXN A;  4QC6 A;  4KVO E;  2PQ8 A;  3IGR A;  3TFY A;  4GS4 A;  1VKC A;  1IYL A;  2G3A A;  5KTC A;  3JVN A;  2RC4 A;  5CNP A;  4YGO A;  2ZPA A;  4NF1 A;  4KOY A;  5KTD A;  1S5K A;  2VEZ A;  3VWE A;  3DSB A;  4BMH A;  2Q44 A;  2ZW4 A;  3R96 A;  1M4G A;  4MJ8 A;  3FIX A;  4AG9 A;  2B3U A;  4LX9 A;  4A31 A;  3EO4 A;  4FD4 A;  2G0B A;  4IF5 A;  3SHP A;  4UCN A;  4AVA A;  2QEC A;  3KKW A;  4OLL A;  4H89 A;  4UFW A;  3DNS A;  1BO4 A;  1Y9K A;  4F0Y A;  2YNC C;  4R87 A;  2Z3K A;  2Z3L A;  1OZP A;  4NEX A;  4XPD C;  2FSR A;  2ATR A;  2OH1 A;  2Z3N A;  5AGE A;  4C2X A;  3OWC A;  2DPT A;  3B8G A;  5JQ4 A;  2YND A;  1QSN A;  4KOW A;  2B5G B;  4NXY A;  1RO5 A;  4KOV A;  4Y49 B;  3VWD A;  5DWM A;  1L0C A;  1WWZ A;  4BBH A;  2VZZ A;  3D2P A;  1M4I A;  1CM0 A;  2F5I A;  3D8P A;  2D4P A;  1XF8 A;  5A28 A;  5BWA B;  4XPD B;  4II9 A;  4HNW B;  2FL4 A;  2YGW A;  4CRY B;  2FXF A;  4DNC A;  1B87 A;  4CGP A;  3JTK A;  2P6E A;  2P6F A;  2GE3 A;  2J8N A;  4Q38 A;  4JJX A;  5AG4 A;  4KLW A;  4KUA A;  1U6M A;  4A2Z A;  1KUY A;  1P0H A;  3TOB A;  1BOB A;  1S3Z A;  4FD5 A;  5FVJ A;  2Q0Y A;  3TCV A;  4QVT A;  3CXS A;  1NSL A;  3TTH A;  1YX0 A;  4XPL A;  2OZU A;  5KTA A;  2NMT A;  5HMN A;  2B5G A;  1ON0 A;  1S7K A;  1B6B A;  4E8O A;  4CS0 B;  4A95 A;  3H5Z A;  2WPW A;  3DDD A;  2BSW A;  1KUX A;  2B4D A;  4UWJ A;  3GY9 A;  1Q2D A;  1S7N A;  4CGL A;  3GYA A;  3W6S A;  1GHE A;  4C68 A;  1KZF A;  1IB1 E;  4U9Y A;  3G3S A;  5EBV A;  5I0C A;  1M44 A;  4A33 A;  2JLM A;  2ZW6 A;  3R9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...