2G3TA

Crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
169
structure length
169
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 42
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3tA00
3R9EA 2Y0MA 5FVJA 4B5PB 4NSQA 5E96A 4R3LA 2R8VA 3TT2A 1P0HA 1XE4A 1Z4EA 4IUSA 4KOUA 2R7HA 5F47A 2OZUA 1CM0A 2J8RA 4QB9A 1Q2YA 2B5GA 3F8KA 2WPWA 4FD4A 4R9MA 2D4PA 1S7FA 2Z0ZA 5I0CA 3FIXA 2Q04A 1YK3A 4I49A 4OLLA 1RO5A 1LRZA 2REEA 3LODA 3T9YA 1Z4RA 3UY5A 4CRZB 1WWZA 2Z10A 1BO4A 1KZFA 1L0CA 1QSNA 1NE9A 2C27A 4LX9A 4E0AA 4KORA 3TE4A 4JWPA 2GIVA 3GKRA 2B4DA 1I1DA 3D2MA 4HNYB 3CXQA 2OB0A 2CNMA 3P2FA 1BOBA 2B5GB 5JQ4A 2CY2A 2QMLA 2ZW6A 3S6HA 4KVXA 5HH1A 4KOYA 2D4OA 3CXSA 4M85A 4UWJA 4R3KA 2Q4VA 4HNWB 4UWIA 4PSWA 1RXTA 3TFYA 2GE3A 2P6EA 5EBVA 3T90A 1B87A 4E2AA 3FB3A 4JLYA 3JVNA 4MHDA 1GHEA 1S7LA 4PK3A 2ZW5A 1IB1E 2PQ8A 1XEBA 5H84A 2JDDA 3G3SA 2FS5A 3W6XA 4LUAA 4NEXA 3FXTA 4B5PA 2EVNA 3G8WA 2IL4A 2PDOA 2PR8A 4QC6A 4B5OA 2VI7A 4NXYA 4KUAA 1QSOA 3D8PA 2DXQA 1IICA 1K4JA 2FE7A 5KTCA 4AVAA 1R57A 3EXNA 2I79A 1Q2CA 2ZW4A 1CJWA 1SQHA 2VBQA 4XNHC 3ZJ0A 3QAHA 3QB8A 5IX3A 1PUAA 2QECA 1S60A 3EC4A 1U6MA 1YGHA 4JD6A 1YVKA 2FIWA 1XMTA 2B3VA 3LD2A 3CXPA 1VHSA 2CNTA 1B6BA 2HQYA 2VXKA 2RC4A 4AG7A 3W6SA 2BUEA 5J8FA 4QBJA 3E0KA 2OU2A 4MY3A 3C26A 4R87A 4CS0B 5H86A 4KLVA 3GY9A 4KOTA 4H6UA 5CNPA 1M4DA 4FD7A 4MJ8A 3F5BA 3PP9A 1Z9UA 3I9SA 4XNHB 1QSTA 2R98A 4CAWA 4KVOE 2HV2A 2O28A 2F5IA 3EO4A 3TO9A 5C82A 2Q0YA 2AE6A 4BMHA 1M4GA 1MJAA 1P4NA 3R96A 3VWDA 4XPDB 2FCKA 1Q2DA 2K5TA 3N7ZA 2VQYA 5IB0A 3PGPA 1WK4A 2FSRA 3DSBA 1M4IA 3R95A 2QIRA 3H4QA 3DNSA 1Y7RA 2BEIA 1Y9KA 2OZHA 4AVCA 2J8NA 3FNCA 2Q7BA 3TOBA 4YGOA 2KCWA 3I3GA 4AB7A 4NF1A 4JJXA 4EVYA 2FL4A 4X5KA 3BLNA 2I00A 2P6FA 1S3ZA 4MY0A 2H5MA 4U9YA 4R57A 1I12A 4OAEA 4MI4A 4F6AA 2VZZA 2ZW7A 3IWGA 1OZPA 5EC4A 2Q44A 4KOSA 4U9ZA 2NMTA 3KKWA 3B8GA 3P2HA 5KTDA 2ARHA 3ZZIA 3DR8A 4ZBGA 3RYOA 2B3UA 1J4JA 2FT0A 2PSWA 2Q4YA 3GYAA 2AJ6A 5HMNA 4CAXA 4JXQA 2Z11A 1TIQA 2EUIA 1ON0A 4DNCA 2ZPAA 1Y9WA 4KZTA 5DWNA 1MJBA 4II9A 1KUXA 2GANA 2P6GA 1XIXA 4XPKA 5IV0A 2FXFA 4ONUA 1YLEA 3D2PA 4MBUA 3S6GA 3SHPA 3DDDA 3R9GA 4XPLA 4RI1A 4UA3A 5J8CA 4H6ZA 3R9FA 3BJ8A 2WPXA 4KVME 2JDCA 1NMTA 3FRMA 4YRHA 4HNXB 4KUBA 1S5KA 2J8MA 2G3AA 4FD5A 2JEVA 1I21A 3SXOA 3WR7A 3R1KA 4KOWA 4PV6A 4ORFA 5DWMA 3DR6A 2P0WA 4KLWA 5KTAA 4XPDC 3MGDA 1MJ9A 4UBRA 2PRBA 4Y49C 2HUZA 1M1DA 3EY5A 5F48A 1YX0A 2G0BA 3FYNA 5C88A 2ZXVA 2PC1A 4H89A 3NE7A 3JUWA 2G3TA 3S6FA 2B4DB 1M44A 4NCZA 5F49A 2VEZA 4YFJA 3D3SA 2FIAA 3F0AA 4OADA 1FY7A 2R1IA 4CAVA 5F46A 4GS4A 2A4NA 2BSWA 1NSLA 4CRYB 3TO6A 4JXRA 1UFHA 3W91A 3TCVA 4QVTA 2CNSA 4PSXA 3S6KA 3K9UA 1QSRA 2OZGA 1IIDA 4PK2A 2REFA 4HKFA 2ATRA 3PZJA 2B4BA 3SXNA 2JLMA 3OWCA 2B58A 2VZYA 1KUYA 3TO7A 3VWEA 4M3SA 3FBUA 4RS2A 1YR0A 4QUSA 1V0CA 4L8AA 4U5YA 4KOXA 5ISVA 1IYLA 4FD6A 3TTHA 2X7BA 2PR1A 1S7NA 4IF5A 4AG9A 3BJ7A 1VKCA 1MK4A 4K30A 2OH1A 3IGRA 1XF8A 1KUVA 4J3GA 3V8IA 1S7KA 1N71A 4L89A 1IYKA 1YVOA 1PU9A 2BL1A 5GCNA 3EFAA 3TOAA 4Y49B 4E8OA 1QSMA 4AVBA 5JPHA 1YREA 4F0YA 4KOVA
chains in the Genus database with same CATH superfamily
3R9EA 2Y0MA 3FEEA 3RBUA 4A33A 4C7HA 4NGQA 4R6TA 5FVJA 4P4EA 2CXAA 4NSQA 4B5PB 2WYRA 1YW4A 5E96A 4F0XA 4R3LA 2R8VA 3TT2A 1P0HA 3HLPA 1XE4A 4C68A 1Z4EA 4IUSA 3QAYA 3SJEA 4LQGA 3DGVA 4KOUA 4A31A 2R7HA 1CBXA 1XOVA 1QMUA 2OZUA 5F47A 1CM0A 3CPXA 3FJUA 5IB9A 4X8IA 1R43A 2AFWA 2J8RA 4QB9A 1Q2YA 1TKHA 2C6CA 2ZELA 2B5GA 3F8KA 2WPWA 4FD4A 3T8WA 4R9MA 4P44A 5AG7A 2D4PA 4EWTA 1S7FA 1UWYA 2Z0ZA 3GB0A 4ZY2A 4ZX9A 3TC8A 5I0CA 3FIXA 3PRTA 2Q04A 4B12A 3KASA 1YK3A 2IMOA 4I49A 4OLLA 4CGOA 1RO5A 1LRZA 2REEA 1CX8A 2EK8A 3LODA 4UEZA 3SJGA 3T9YA 1Z2LA 1Z4RA 2QYVA 3UY5A 4CRZB 3NFZA 4A95A 1WWZA 1JWQA 2Z10A 4JYWA 2PJ4A 2AFMA 5I4MA 1BO4A 1KZFA 1L0CA 2C27A 1QSNA 1NE9A 4LX9A 1FNOA 4KSAA 4UCPA 4E0AA 2PIYA 4KORA 2AFZA 1Q7LA 3TE4A 2AFXA 1CP7A 4JWPA 2GIVA 3GKRA 3H8EA 4NGPA 2B4DA 1I1DA 3KL9A 4FBEA 3D2MA 4HNYB 4CYNA 3IEHA 4PQAA 5LRGA 5LYLA 3CXQA 2F8HA 4OKOA 4TWEA 2PJ5A 1Y7EA 2OB0A 2CNMA 2ZENA 3P2FA 1BOBA 2B5GB 4M6GA 3WC7A 5JQ4A 2CY2A 4KS9A 2QMLA 2ZW6A 3JTKA 4KVXA 5HH1A 3S6HA 4KOYA 4R7MA 2D4OA 3CXSA 3FECA 4M85A 2ZEPA 2YNEA 5LYDA 2RFHA 4UWJA 5BWAB 4R3KA 2Q4VA 1YLOA 4HNWB 2IQ6A 4UWIA 4PSWA 1RXTA 3I1UA 3TFYA 2GE3A 2P6EA 5EBVA 1CG2A 3PFOA 2Z3MA 3BXMA 3T90A 1B87A 4E2AA 3FB3A 4JLYA 2ZEOA 3JVNA 5DS0A 4MHDA 1GHEA 1QQ9A 2Q43A 4A38A 1DTDA 1S7LA 4PK3A 4NGMA 4YFJA 2ZW5A 1Z5RA 2GLJA 1IB1E 2PJ9A 2PQ8A 4UCMA 5LYIA 4DUKA 3PEIA 1XBUA 1XEBA 1TKJA 1DE4C 5H84A 2JDDA 4M6IA 5LRJA 3G3SA 4MFJA 1ZG9A 2FS5A 4A30A 3KR4A 3W6XA 2DPTA 1F57A 1VGYA 4EMEA 4LUAA 4NEXA 3FXTA 1PCAA 3B35A 4B5PA 2EVNA 3G8WA 1M4LA 2IL4A 2PDOA 2PR8A 3NH5A 4OC3A 4QC6A 4MHNA 3RO0A 4A94A 4C2ZA 2G9DA 1X10A 4B5OA 2POKA 2VI7A 4NXYA 4BBHA 2ANPA 4KUAA 1QSOA 3D8PA 2DXQA 4B6ZA 1IICA 1K4JA 2FE7A 5KTCA 4AVAA 4MXUA 1R57A 3V7ZA 3EXNA 2I79A 1Q2CA 2ZOFA 2ZW4A 3MRUA 1GYTA 4F8ZA 3SI1A 1CJWA 2I3CA 3A9LA 2GREA 5F49A 1KWMA 1SQHA 2VBQA 4XNHC 1YSJA 3ZJ0A 3KGQA 3QAHA 3PB7X 1HEEA 2YGWA 3QB8A 5CPAA 5IX3A 1PUAA 3VARA 3IWWA 2QECA 1S60A 1EE3P 1CP6A 3EC4A 4CGLA 4P6YA 3WC6A 3ISXA 1U6MA 1YGHA 2V8HA 1Y0YA 3LMSA 4JD6A 1YVKA 4PXEA 2PJ1A 3NH8A 4RUHA 2FIWA 3B3VA 1XMTA 2B3VA 4W9YA 4Q7AA 3LD2A 1PYTB 2Z3PA 3CXPA 1VHSA 2CNTA 4KSIA 5AG4A 1B6BA 2PCUA 4OC2A 1VIXA 2HQYA 4CGMA 4P4DA 3RNZA 4F9VA 2VXKA 1F2PA 3PB6X 3S9NA 3D68A 4CYPA 2RC4A 3NA6A 4G1PA 4AXVA 2PJ3A 3H8FA 1XFOA 4AG7A 1LAMA 1VHEA 3D67A 3W6SA 3GLJA 2BUEA 3BHXA 5J8FA 4QBJA 3E0KA 2OU2A 4MY3A 3C26A 2PE3A 3SJFA 4UFWA 4R87A 2PIZA 4CS0B 2PJ0A 3GUXA 4F9UA 2Q4ZA 4ZX8A 4HPSA 5H86A 4KLVA 3GY9A 3PBBA 4P4FA 4KOTA 8CPAA 4H6UA 2IJZA 2PJAA 2HC9A 5CNPA 4MFPA 1M4DA 4FD7A 1Z8LA 4BINA 4MJ8A 3F5BA 3PP9A 1Z9UA 3SI2A 3I9SA 3DLJA 4XNHB 4CPAA 1QSTA 1XJOA 4YWYA 2PJBA 2R98A 4OC5A 4KVOE 4CAWA 5HXDA 2HV2A 1ELLP 2OOTA 6CPAA 2J9AA 5F09A 2O28A 2F5IA 3EO4A 3TO9A 5C82A 2Q0YA 3FX6A 2AE6A 2ZEFA 3BI1A 3PB8X 1Y0RA 5G21A 4BMHA 3GIUA 1M4GA 1MJAA 2V77A 4ZI6A 1P4NA 4MFKA 3R96A 3VWDA 2VL1A 2ABZA 4B14A 3LWUA 1FT7A 1ARLA 4OIDA 2RB7A 4XPDB 2FCKA 1Q2DA 2K5TA 3N7ZA 3S9MA 3TX8A 2CIJA 1Z8WA 2VQYA 5IB0A 4MRIA 3PGPA 1AMPA 3VH9A 4A2ZA 1WK4A 3KHZA 2FSRA 3DSBA 1M4IA 3VATA 3IU2A 3R95A 1LANA 4UCNA 2QIRA 3H4QA 2PJCA 3DNSA 1BPMA 1Y7RA 2BEIA 1Y9KA 2NSMA 2OZHA 2ZEDA 3JRUA 4AVCA 3PFEA 3WC5A 2CTCA 1X12A 2J8NA 2YNCC 3FNCA 3ISZA 4OP4A 2Q7BA 3TOBA 4YGOA 4NGSA 1IGBA 1AYEA 2NYQA 3IIBA 4IHMA 2KCWA 1TF9A 3I3GA 4AB7A 1YW6A 3D66A 3NH4A 4NF1A 4JJXA 4EVYA 2FL4A 1AUGA 3KQZA 4X5KA 4H2KA 2PRQA 2GFQA 3BLNA 2I00A 2P6FA 1S3ZA 4MY0A 1HDQA 4MHZA 2QVPA 2H5MA 1IY7A 4U9YA 4UFVA 2XEFA 4C2YA 4R57A 1I12A 4OAEA 1RTQA 4MI4A 4RN7A 5CBMA 4F6AA 2VZZA 2ZW7A 3B3TA 3B3WA 3CPAA 4ZYQA 3IWGA 4WJBA 1OZPA 2PVVA 3L2NA 5EC4A 2Q44A 4KOSA 3FMCA 4U9ZA 1ZG8A 1Z8TA 2YNCA 4CAEA 4CYQA 2NMTA 3KKWA 3B8GA 3P2HA 4KSFA 2Z3LA 5KTDA 3D4UA 2ARHA 3ZZIA 3DR8A 4UIBA 4ZBGA 5K8OA 2C6GA 4UEFA 4TNUA 2AFOA 3RYOA 2B3UA 1J4JA 4ONWA 3FEDA 2FT0A 2PSWA 2ZOGA 5J1QA 4GM5A 3HUVA 3WABA 2Q4YA 5G22A 2PJ7A 2AJ6A 3GYAA 3N5FA 4UFXA 4B13A 5HMNA 4CAXA 2BOAA 4JXQA 2HB6A 2Z11A 1TIQA 2EUIA 4M6HA 1ON0A 4PXBA 4DNCA 2ZPAA 1Y9WA 4KZTA 4R8FA 5DWNA 1MJBA 5A27A 1ZLIA 4II9A 4FUUA 3WT4A 1KUXA 2GANA 2P6GA 4ZGYB 4LQ6A 1XIXA 4XPKA 5IV0A 2FXFA 3NE8A 4ONUA 4X3RA 1YLEA 3D2PA 4MBUA 4MFLA 3S6GA 3MN8A 2ZEHA 2ZEMA 3IWEA 3SHPA 2PJ6A 5JGFA 1ARMA 3DDDA 3R9GA 3RZAA 4C2XA 5EMIA 4XPLA 4RI1A 4P45A 4UA3A 2C1CA 2PJ8A 4H6ZA 5J8CA 3BI0A 3R9FA 4YU9A 2O53A 4MMOA 2GU2A 5A28A 5JM6A 3BJ8A 4A32A 2WPXA 1ELMP 1Z8XA 4KVME 7CPAA 2JDCA 1NMTA 4P4JA 3FRMA 4YRHA 2BCOA 4HNXB 1S5KA 4KUBA 4OIWA 5D8NA 4BD9A 2J8MA 2C6PA 2AFSA 2G3AA 2YNDA 4FD5A 2JEVA 3CT9A 3PBEA 1I21A 3H5ZA 3SXOA 3WR7A 3R1KA 1BAVA 4KOWA 4PXDA 2EWBA 4PV6A 2DF5A 4OC1A 2JBJA 4ORFA 3CDXA 5DWMA 2WSAA 4MHYA 3DR6A 1ZLHA 2P0WA 4KLWA 4NJRA 2CF4A 2XEJA 2V8VA 2JBKA 5HVGA 5KTAA 4XPDC 3MGDA 4R76A 2Z3OA 1MJ9A 4UBRA 4DYOA 4FAIA 2PRBA 4Y49C 2HUZA 1M1DA 3EY5A 4MCRA 1XRYA 5F48A 3B2YA 4CYOA 1YX0A 5ELYA 2WUUA 3RAMA 2G0BA 2OR4A 3FYNA 4NFRA 5C88A 2V8DA 2ZXVA 3QNVA 3V38A 1ZG7A 2PC1A 4CGPA 4H89A 5AG5A 3NE7A 3JUWA 2G3TA 3K2KA 4B11A 3S6FA 1CPSA 1IOIA 2F7VA 4NJQA 2DPSA 2B4DB 1M44A 2PVWA 4NCZA 2VEZA 1YMEA 2Z3NA 3D3SA 4O23A 2FIAA 3F0AA 4NGRA 2WZNA 4OADA 2EK9A 1FY7A 2ZEGA 4OMEA 4MFQA 2PJ2A 4MCSA 1VHOA 2R1IA 4CAVA 5G20A 5K8MA 2GLFA 5F46A 4GS4A 2A4NA 2BSWA 1NSLA 3D7HA 4CRYB 3TO6A 3S9LA 4JXRA 1UFHA 3W91A 3TCVA 4QVTA 4ZY0A 2CNSA 4PSXA 1BLLE 3S6KA 3K9UA 5LRKA 1BPNA 1QSRA 4P10A 4MHPA 2OZGA 2CTBA 4A39A 3B7IA 1IIDA 1LCPA 3IU1A 4PK2A 2REFA 4HKFA 4Q36A 1XMBA 3SI0A 2ATRA 3PZJA 2V8GA 2EO8A 2B4BA 1H8LA 3SXNA 4X2TA 2JLMA 3IJ3A 3OWCA 5G1ZA 2ODFA 2QJ8A 3KR5A 2B58A 2VZYA 1KUYA 4JZ0A 1ZO0A 1TKFA 2JEWA 5AG6A 3IFEA 5THWA 4UEEA 3TO7A 2FVGA 1IOFA 3VWEA 2DEAA 3SJXA 4M3SA 5K8NA 5AGEA 4C7IA 4B10A 3FBUA 4GXHA 5JH9A 3KQXA 4RS2A 1HDUA 4UIAA 4K3NA 1YR0A 4F0YA 1LAPA 1LOKA 4QUSA 4IK2A 1V0CA 4L8AA 5K8PA 4U5YA 3PB4X 1F2OA 4KOXA 5ISVA 3D7FA 1IYLA 3B3CA 1A2ZA 3KHXA 4FD6A 3TTHA 2X7BA 2PR1A 4Q38A 1S7NA 4IF5A 4IAVA 4AG9A 3BJ7A 3FH4A 1VKCA 4FWUA 4MCQA 3IC1A 4OC4A 5HVHA 1MK4A 2Q7SA 4K30A 2OH1A 1OBRA 4A37A 3IGRA 4MFZA 1KUVA 1XF8A 2AFUA 1YQEA 1S7KA 4J3GA 4NGNA 3V8IA 1IU8A 1N71A 3FF3A 4EFDA 2XEIA 4L89A 4PXCA 4UF4A 5HVFA 1IYKA 4DJLA 2EBJA 5D29A 3H8GA 5LYFA 1JQGA 1YVOA 2BO9A 1PU9A 2BL1A 3LACA 5GCNA 3KI9A 3B3SA 3D7DA 3EFAA 4Y49B 2Q51A 3TOAA 2ZEEA 3D7GA 4OC0A 3IO1A 3PB9X 4E8OA 1QSMA 4AVBA 1LFWA 4NGTA 2O4HA 5JPHA 4Z65A 1TXRA 4MCPA 1YREA 2Z3KA 3FVLA 1TF8A 4CGNA 4P4BA 4P4IA 4CAFA 1R3NA 4PPZA 4WWVA 1CPXA 2XEGA 3KZWA 3CZXA 1NSAA 4ZY1A 3K9TA 4KOVA
chains in the Genus database with same CATH topology
3R9EA 2Y0MA 4A33A 4C7HA 5FVJA 2CXAA 4NSQA 4B5PB 5E96A 4F0XA 4R3LA 2R8VA 3TT2A 1P0HA 1XE4A 4C68A 1Z4EA 4IUSA 4KOUA 4A31A 2R7HA 5F47A 2OZUA 1CM0A 2J8RA 4QB9A 1Q2YA 2B5GA 3F8KA 2WPWA 4FD4A 4R9MA 5AG7A 2D4PA 1S7FA 2Z0ZA 5I0CA 3FIXA 2Q04A 4B12A 1YK3A 4I49A 4OLLA 4CGOA 1RO5A 1LRZA 2REEA 3LODA 3T9YA 1Z4RA 3UY5A 4CRZB 4A95A 1WWZA 2Z10A 1BO4A 1KZFA 1L0CA 1QSNA 1NE9A 2C27A 4LX9A 4UCPA 4KSAA 4E0AA 4KORA 3TE4A 4JWPA 2GIVA 3GKRA 2B4DA 1I1DA 3D2MA 4HNYB 4CYNA 3CXQA 2OB0A 2CNMA 3P2FA 1BOBA 2B5GB 5JQ4A 2CY2A 4KS9A 2QMLA 2ZW6A 3JTKA 4KVXA 5HH1A 3S6HA 4KOYA 2D4OA 3CXSA 4M85A 2YNEA 4UWJA 5BWAB 4R3KA 2Q4VA 4HNWB 4UWIA 4PSWA 1RXTA 3TFYA 2GE3A 2P6EA 5EBVA 2Z3MA 3T90A 1B87A 4E2AA 3FB3A 4JLYA 3JVNA 4MHDA 1GHEA 1S7LA 4PK3A 2ZW5A 1IB1E 2PQ8A 4UCMA 1XEBA 5H84A 2JDDA 3G3SA 4MFJA 2FS5A 4A30A 3W6XA 2DPTA 4LUAA 4NEXA 3FXTA 4B5PA 2EVNA 3G8WA 2IL4A 2PDOA 2PR8A 4QC6A 4C2ZA 4B5OA 2VI7A 4NXYA 4BBHA 4KUAA 1QSOA 3D8PA 2DXQA 1IICA 1K4JA 2FE7A 5KTCA 4AVAA 1R57A 3EXNA 2I79A 1Q2CA 2ZW4A 1CJWA 3A9LA 1SQHA 2VBQA 4XNHC 3ZJ0A 3QAHA 3QB8A 2YGWA 5IX3A 1PUAA 2QECA 1S60A 3EC4A 4CGLA 1U6MA 1YGHA 4JD6A 1YVKA 2FIWA 1XMTA 2B3VA 3LD2A 2Z3PA 3CXPA 1VHSA 2CNTA 5AG4A 1B6BA 2HQYA 4CGMA 2VXKA 4CYPA 2RC4A 4AG7A 3W6SA 2BUEA 5J8FA 4QBJA 3E0KA 2OU2A 4MY3A 3C26A 4UFWA 4R87A 4CS0B 5H86A 4KLVA 3GY9A 4KOTA 4H6UA 5CNPA 4MFPA 1M4DA 4FD7A 4MJ8A 3F5BA 3PP9A 1Z9UA 3I9SA 4XNHB 1QSTA 2R98A 4CAWA 4KVOE 2HV2A 2O28A 2F5IA 3EO4A 3TO9A 5C82A 2Q0YA 2AE6A 5G21A 4BMHA 1M4GA 1MJAA 1P4NA 4MFKA 3R96A 3VWDA 4B14A 4XPDB 2FCKA 1Q2DA 2K5TA 3N7ZA 2VQYA 5IB0A 3PGPA 4A2ZA 1WK4A 2FSRA 3DSBA 1M4IA 3IU2A 3R95A 4UCNA 2QIRA 3H4QA 3DNSA 1Y7RA 2BEIA 1Y9KA 2OZHA 4AVCA 2J8NA 3FNCA 2YNCC 2Q7BA 3TOBA 4YGOA 2KCWA 3I3GA 4AB7A 4NF1A 4JJXA 4EVYA 2FL4A 4X5KA 3BLNA 2I00A 2P6FA 1S3ZA 4MY0A 4UFVA 2H5MA 4U9YA 4C2YA 4R57A 1I12A 4OAEA 4MI4A 4F6AA 2VZZA 2ZW7A 3IWGA 1OZPA 5EC4A 2Q44A 4KOSA 4U9ZA 2YNCA 4CAEA 4CYQA 2NMTA 3KKWA 3B8GA 4KSFA 3P2HA 2Z3LA 5KTDA 2ARHA 3ZZIA 3DR8A 4ZBGA 3RYOA 2B3UA 1J4JA 2FT0A 2PSWA 2Q4YA 5G22A 3GYAA 2AJ6A 4UFXA 4B13A 5HMNA 4CAXA 4JXQA 2Z11A 1TIQA 2EUIA 1ON0A 4DNCA 2ZPAA 1Y9WA 4KZTA 5DWNA 5A27A 1MJBA 4II9A 1KUXA 2GANA 2P6GA 4ZGYB 1XIXA 4XPKA 5IV0A 2FXFA 4ONUA 1YLEA 3D2PA 4MBUA 4MFLA 3S6GA 3SHPA 3IWEA 3DDDA 3R9GA 4C2XA 4XPLA 4RI1A 4UA3A 5J8CA 4H6ZA 3R9FA 5A28A 3BJ8A 4A32A 2WPXA 4KVME 2JDCA 1NMTA 3FRMA 4YRHA 4HNXB 4KUBA 1S5KA 2J8MA 2G3AA 2YNDA 4FD5A 2JEVA 1I21A 3H5ZA 3SXOA 3WR7A 3R1KA 4KOWA 4PV6A 4ORFA 5DWMA 2WSAA 3DR6A 2P0WA 4KLWA 5KTAA 4XPDC 3MGDA 2Z3OA 1MJ9A 4UBRA 2PRBA 4Y49C 2HUZA 1M1DA 3EY5A 5F48A 4CYOA 1YX0A 2WUUA 2G0BA 3FYNA 5C88A 2ZXVA 4CGPA 2PC1A 4H89A 5AG5A 3NE7A 3JUWA 2G3TA 4B11A 3S6FA 2DPSA 2B4DB 1M44A 4NCZA 5F49A 2VEZA 2Z3NA 4YFJA 3D3SA 2FIAA 3F0AA 4OADA 1FY7A 4MFQA 2R1IA 4CAVA 5G20A 5F46A 4GS4A 2A4NA 2BSWA 1NSLA 4CRYB 3TO6A 4JXRA 1UFHA 3W91A 3TCVA 4QVTA 2CNSA 4PSXA 3S6KA 3K9UA 1QSRA 2OZGA 1IIDA 3IU1A 4PK2A 2REFA 4HKFA 4Q36A 2ATRA 3PZJA 2B4BA 3SXNA 2JLMA 3OWCA 5G1ZA 2B58A 2VZYA 1KUYA 1ZO0A 5AG6A 3TO7A 3VWEA 4M3SA 5AGEA 4C7IA 4B10A 3FBUA 4RS2A 1YR0A 4QUSA 1V0CA 4L8AA 4U5YA 4KOXA 5ISVA 1IYLA 4FD6A 3TTHA 2X7BA 2PR1A 4Q38A 1S7NA 4IF5A 4AG9A 3BJ7A 1VKCA 1MK4A 4K30A 2OH1A 3IGRA 4MFZA 1XF8A 1KUVA 4J3GA 3V8IA 1S7KA 1N71A 4L89A 1IYKA 1YVOA 1PU9A 2BL1A 5GCNA 3EFAA 3TOAA 4Y49B 4E8OA 1QSMA 4AVBA 5JPHA 1YREA 2Z3KA 4CGNA 4CAFA 4F0YA 4KOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9E A;  2Y0M A;  5FVJ A;  4B5P B;  4NSQ A;  5E96 A;  4R3L A;  2R8V A;  3TT2 A;  1P0H A;  1XE4 A;  1Z4E A;  4IUS A;  4KOU A;  2R7H A;  5F47 A;  2OZU A;  1CM0 A;  2J8R A;  4QB9 A;  1Q2Y A;  2B5G A;  3F8K A;  2WPW A;  4FD4 A;  4R9M A;  2D4P A;  1S7F A;  2Z0Z A;  5I0C A;  3FIX A;  2Q04 A;  1YK3 A;  4I49 A;  4OLL A;  1RO5 A;  1LRZ A;  2REE A;  3LOD A;  3T9Y A;  1Z4R A;  3UY5 A;  4CRZ B;  1WWZ A;  2Z10 A;  1BO4 A;  1KZF A;  1L0C A;  1QSN A;  1NE9 A;  2C27 A;  4LX9 A;  4E0A A;  4KOR A;  3TE4 A;  4JWP A;  2GIV A;  3GKR A;  2B4D A;  1I1D A;  3D2M A;  4HNY B;  3CXQ A;  2OB0 A;  2CNM A;  3P2F A;  1BOB A;  2B5G B;  5JQ4 A;  2CY2 A;  2QML A;  2ZW6 A;  3S6H A;  4KVX A;  5HH1 A;  4KOY A;  2D4O A;  3CXS A;  4M85 A;  4UWJ A;  4R3K A;  2Q4V A;  4HNW B;  4UWI A;  4PSW A;  1RXT A;  3TFY A;  2GE3 A;  2P6E A;  5EBV A;  3T90 A;  1B87 A;  4E2A A;  3FB3 A;  4JLY A;  3JVN A;  4MHD A;  1GHE A;  1S7L A;  4PK3 A;  2ZW5 A;  1IB1 E;  2PQ8 A;  1XEB A;  5H84 A;  2JDD A;  3G3S A;  2FS5 A;  3W6X A;  4LUA A;  4NEX A;  3FXT A;  4B5P A;  2EVN A;  3G8W A;  2IL4 A;  2PDO A;  2PR8 A;  4QC6 A;  4B5O A;  2VI7 A;  4NXY A;  4KUA A;  1QSO A;  3D8P A;  2DXQ A;  1IIC A;  1K4J A;  2FE7 A;  5KTC A;  4AVA A;  1R57 A;  3EXN A;  2I79 A;  1Q2C A;  2ZW4 A;  1CJW A;  1SQH A;  2VBQ A;  4XNH C;  3ZJ0 A;  3QAH A;  3QB8 A;  5IX3 A;  1PUA A;  2QEC A;  1S60 A;  3EC4 A;  1U6M A;  1YGH A;  4JD6 A;  1YVK A;  2FIW A;  1XMT A;  2B3V A;  3LD2 A;  3CXP A;  1VHS A;  2CNT A;  1B6B A;  2HQY A;  2VXK A;  2RC4 A;  4AG7 A;  3W6S A;  2BUE A;  5J8F A;  4QBJ A;  3E0K A;  2OU2 A;  4MY3 A;  3C26 A;  4R87 A;  4CS0 B;  5H86 A;  4KLV A;  3GY9 A;  4KOT A;  4H6U A;  5CNP A;  1M4D A;  4FD7 A;  4MJ8 A;  3F5B A;  3PP9 A;  1Z9U A;  3I9S A;  4XNH B;  1QST A;  2R98 A;  4CAW A;  4KVO E;  2HV2 A;  2O28 A;  2F5I A;  3EO4 A;  3TO9 A;  5C82 A;  2Q0Y A;  2AE6 A;  4BMH A;  1M4G A;  1MJA A;  1P4N A;  3R96 A;  3VWD A;  4XPD B;  2FCK A;  1Q2D A;  2K5T A;  3N7Z A;  2VQY A;  5IB0 A;  3PGP A;  1WK4 A;  2FSR A;  3DSB A;  1M4I A;  3R95 A;  2QIR A;  3H4Q A;  3DNS A;  1Y7R A;  2BEI A;  1Y9K A;  2OZH A;  4AVC A;  2J8N A;  3FNC A;  2Q7B A;  3TOB A;  4YGO A;  2KCW A;  3I3G A;  4AB7 A;  4NF1 A;  4JJX A;  4EVY A;  2FL4 A;  4X5K A;  3BLN A;  2I00 A;  2P6F A;  1S3Z A;  4MY0 A;  2H5M A;  4U9Y A;  4R57 A;  1I12 A;  4OAE A;  4MI4 A;  4F6A A;  2VZZ A;  2ZW7 A;  3IWG A;  1OZP A;  5EC4 A;  2Q44 A;  4KOS A;  4U9Z A;  2NMT A;  3KKW A;  3B8G A;  3P2H A;  5KTD A;  2ARH A;  3ZZI A;  3DR8 A;  4ZBG A;  3RYO A;  2B3U A;  1J4J A;  2FT0 A;  2PSW A;  2Q4Y A;  3GYA A;  2AJ6 A;  5HMN A;  4CAX A;  4JXQ A;  2Z11 A;  1TIQ A;  2EUI A;  1ON0 A;  4DNC A;  2ZPA A;  1Y9W A;  4KZT A;  5DWN A;  1MJB A;  4II9 A;  1KUX A;  2GAN A;  2P6G A;  1XIX A;  4XPK A;  5IV0 A;  2FXF A;  4ONU A;  1YLE A;  3D2P A;  4MBU A;  3S6G A;  3SHP A;  3DDD A;  3R9G A;  4XPL A;  4RI1 A;  4UA3 A;  5J8C A;  4H6Z A;  3R9F A;  3BJ8 A;  2WPX A;  4KVM E;  2JDC A;  1NMT A;  3FRM A;  4YRH A;  4HNX B;  4KUB A;  1S5K A;  2J8M A;  2G3A A;  4FD5 A;  2JEV A;  1I21 A;  3SXO A;  3WR7 A;  3R1K A;  4KOW A;  4PV6 A;  4ORF A;  5DWM A;  3DR6 A;  2P0W A;  4KLW A;  5KTA A;  4XPD C;  3MGD A;  1MJ9 A;  4UBR A;  2PRB A;  4Y49 C;  2HUZ A;  1M1D A;  3EY5 A;  5F48 A;  1YX0 A;  2G0B A;  3FYN A;  5C88 A;  2ZXV A;  2PC1 A;  4H89 A;  3NE7 A;  3JUW A;  2G3T A;  3S6F A;  2B4D B;  1M44 A;  4NCZ A;  5F49 A;  2VEZ A;  4YFJ A;  3D3S A;  2FIA A;  3F0A A;  4OAD A;  1FY7 A;  2R1I A;  4CAV A;  5F46 A;  4GS4 A;  2A4N A;  2BSW A;  1NSL A;  4CRY B;  3TO6 A;  4JXR A;  1UFH A;  3W91 A;  3TCV A;  4QVT A;  2CNS A;  4PSX A;  3S6K A;  3K9U A;  1QSR A;  2OZG A;  1IID A;  4PK2 A;  2REF A;  4HKF A;  2ATR A;  3PZJ A;  2B4B A;  3SXN A;  2JLM A;  3OWC A;  2B58 A;  2VZY A;  1KUY A;  3TO7 A;  3VWE A;  4M3S A;  3FBU A;  4RS2 A;  1YR0 A;  4QUS A;  1V0C A;  4L8A A;  4U5Y A;  4KOX A;  5ISV A;  1IYL A;  4FD6 A;  3TTH A;  2X7B A;  2PR1 A;  1S7N A;  4IF5 A;  4AG9 A;  3BJ7 A;  1VKC A;  1MK4 A;  4K30 A;  2OH1 A;  3IGR A;  1XF8 A;  1KUV A;  4J3G A;  3V8I A;  1S7K A;  1N71 A;  4L89 A;  1IYK A;  1YVO A;  1PU9 A;  2BL1 A;  5GCN A;  3EFA A;  3TOA A;  4Y49 B;  4E8O A;  1QSM A;  4AVB A;  5JPH A;  1YRE A;  4F0Y A;  4KOV A; 
#chains in the Genus database with same CATH topology
 3R9E A;  2Y0M A;  3FEE A;  3RBU A;  4A33 A;  4C7H A;  4NGQ A;  4R6T A;  5FVJ A;  4P4E A;  2CXA A;  4NSQ A;  4B5P B;  2WYR A;  1YW4 A;  5E96 A;  4F0X A;  4R3L A;  2R8V A;  3TT2 A;  1P0H A;  3HLP A;  1XE4 A;  4C68 A;  1Z4E A;  4IUS A;  3QAY A;  3SJE A;  4LQG A;  3DGV A;  4KOU A;  4A31 A;  2R7H A;  1CBX A;  1XOV A;  1QMU A;  2OZU A;  5F47 A;  1CM0 A;  3CPX A;  3FJU A;  5IB9 A;  4X8I A;  1R43 A;  2AFW A;  2J8R A;  4QB9 A;  1Q2Y A;  1TKH A;  2C6C A;  2ZEL A;  2B5G A;  3F8K A;  2WPW A;  4FD4 A;  3T8W A;  4R9M A;  4P44 A;  5AG7 A;  2D4P A;  4EWT A;  1S7F A;  1UWY A;  2Z0Z A;  3GB0 A;  4ZY2 A;  4ZX9 A;  3TC8 A;  5I0C A;  3FIX A;  3PRT A;  2Q04 A;  4B12 A;  3KAS A;  1YK3 A;  2IMO A;  4I49 A;  4OLL A;  4CGO A;  1RO5 A;  1LRZ A;  2REE A;  1CX8 A;  2EK8 A;  3LOD A;  4UEZ A;  3SJG A;  3T9Y A;  1Z2L A;  1Z4R A;  2QYV A;  3UY5 A;  4CRZ B;  3NFZ A;  4A95 A;  1WWZ A;  1JWQ A;  2Z10 A;  4JYW A;  2PJ4 A;  2AFM A;  5I4M A;  1BO4 A;  1KZF A;  1L0C A;  2C27 A;  1QSN A;  1NE9 A;  4LX9 A;  1FNO A;  4KSA A;  4UCP A;  4E0A A;  2PIY A;  4KOR A;  2AFZ A;  1Q7L A;  3TE4 A;  2AFX A;  1CP7 A;  4JWP A;  2GIV A;  3GKR A;  3H8E A;  4NGP A;  2B4D A;  1I1D A;  3KL9 A;  4FBE A;  3D2M A;  4HNY B;  4CYN A;  3IEH A;  4PQA A;  5LRG A;  5LYL A;  3CXQ A;  2F8H A;  4OKO A;  4TWE A;  2PJ5 A;  1Y7E A;  2OB0 A;  2CNM A;  2ZEN A;  3P2F A;  1BOB A;  2B5G B;  4M6G A;  3WC7 A;  5JQ4 A;  2CY2 A;  4KS9 A;  2QML A;  2ZW6 A;  3JTK A;  4KVX A;  5HH1 A;  3S6H A;  4KOY A;  4R7M A;  2D4O A;  3CXS A;  3FEC A;  4M85 A;  2ZEP A;  2YNE A;  5LYD A;  2RFH A;  4UWJ A;  5BWA B;  4R3K A;  2Q4V A;  1YLO A;  4HNW B;  2IQ6 A;  4UWI A;  4PSW A;  1RXT A;  3I1U A;  3TFY A;  2GE3 A;  2P6E A;  5EBV A;  1CG2 A;  3PFO A;  2Z3M A;  3BXM A;  3T90 A;  1B87 A;  4E2A A;  3FB3 A;  4JLY A;  2ZEO A;  3JVN A;  5DS0 A;  4MHD A;  1GHE A;  1QQ9 A;  2Q43 A;  4A38 A;  1DTD A;  1S7L A;  4PK3 A;  4NGM A;  4YFJ A;  2ZW5 A;  1Z5R A;  2GLJ A;  1IB1 E;  2PJ9 A;  2PQ8 A;  4UCM A;  5LYI A;  4DUK A;  3PEI A;  1XBU A;  1XEB A;  1TKJ A;  1DE4 C;  5H84 A;  2JDD A;  4M6I A;  5LRJ A;  3G3S A;  4MFJ A;  1ZG9 A;  2FS5 A;  4A30 A;  3KR4 A;  3W6X A;  2DPT A;  1F57 A;  1VGY A;  4EME A;  4LUA A;  4NEX A;  3FXT A;  1PCA A;  3B35 A;  4B5P A;  2EVN A;  3G8W A;  1M4L A;  2IL4 A;  2PDO A;  2PR8 A;  3NH5 A;  4OC3 A;  4QC6 A;  4MHN A;  3RO0 A;  4A94 A;  4C2Z A;  2G9D A;  1X10 A;  4B5O A;  2POK A;  2VI7 A;  4NXY A;  4BBH A;  2ANP A;  4KUA A;  1QSO A;  3D8P A;  2DXQ A;  4B6Z A;  1IIC A;  1K4J A;  2FE7 A;  5KTC A;  4AVA A;  4MXU A;  1R57 A;  3V7Z A;  3EXN A;  2I79 A;  1Q2C A;  2ZOF A;  2ZW4 A;  3MRU A;  1GYT A;  4F8Z A;  3SI1 A;  1CJW A;  2I3C A;  3A9L A;  2GRE A;  5F49 A;  1KWM A;  1SQH A;  2VBQ A;  4XNH C;  1YSJ A;  3ZJ0 A;  3KGQ A;  3QAH A;  3PB7 X;  1HEE A;  2YGW A;  3QB8 A;  5CPA A;  5IX3 A;  1PUA A;  3VAR A;  3IWW A;  2QEC A;  1S60 A;  1EE3 P;  1CP6 A;  3EC4 A;  4CGL A;  4P6Y A;  3WC6 A;  3ISX A;  1U6M A;  1YGH A;  2V8H A;  1Y0Y A;  3LMS A;  4JD6 A;  1YVK A;  4PXE A;  2PJ1 A;  3NH8 A;  4RUH A;  2FIW A;  3B3V A;  1XMT A;  2B3V A;  4W9Y A;  4Q7A A;  3LD2 A;  1PYT B;  2Z3P A;  3CXP A;  1VHS A;  2CNT A;  4KSI A;  5AG4 A;  1B6B A;  2PCU A;  4OC2 A;  1VIX A;  2HQY A;  4CGM A;  4P4D A;  3RNZ A;  4F9V A;  2VXK A;  1F2P A;  3PB6 X;  3S9N A;  3D68 A;  4CYP A;  2RC4 A;  3NA6 A;  4G1P A;  4AXV A;  2PJ3 A;  3H8F A;  1XFO A;  4AG7 A;  1LAM A;  1VHE A;  3D67 A;  3W6S A;  3GLJ A;  2BUE A;  3BHX A;  5J8F A;  4QBJ A;  3E0K A;  2OU2 A;  4MY3 A;  3C26 A;  2PE3 A;  3SJF A;  4UFW A;  4R87 A;  2PIZ A;  4CS0 B;  2PJ0 A;  3GUX A;  4F9U A;  2Q4Z A;  4ZX8 A;  4HPS A;  5H86 A;  4KLV A;  3GY9 A;  3PBB A;  4P4F A;  4KOT A;  8CPA A;  4H6U A;  2IJZ A;  2PJA A;  2HC9 A;  5CNP A;  4MFP A;  1M4D A;  4FD7 A;  1Z8L A;  4BIN A;  4MJ8 A;  3F5B A;  3PP9 A;  1Z9U A;  3SI2 A;  3I9S A;  3DLJ A;  4XNH B;  4CPA A;  1QST A;  1XJO A;  4YWY A;  2PJB A;  2R98 A;  4OC5 A;  4KVO E;  4CAW A;  5HXD A;  2HV2 A;  1ELL P;  2OOT A;  6CPA A;  2J9A A;  5F09 A;  2O28 A;  2F5I A;  3EO4 A;  3TO9 A;  5C82 A;  2Q0Y A;  3FX6 A;  2AE6 A;  2ZEF A;  3BI1 A;  3PB8 X;  1Y0R A;  5G21 A;  4BMH A;  3GIU A;  1M4G A;  1MJA A;  2V77 A;  4ZI6 A;  1P4N A;  4MFK A;  3R96 A;  3VWD A;  2VL1 A;  2ABZ A;  4B14 A;  3LWU A;  1FT7 A;  1ARL A;  4OID A;  2RB7 A;  4XPD B;  2FCK A;  1Q2D A;  2K5T A;  3N7Z A;  3S9M A;  3TX8 A;  2CIJ A;  1Z8W A;  2VQY A;  5IB0 A;  4MRI A;  3PGP A;  1AMP A;  3VH9 A;  4A2Z A;  1WK4 A;  3KHZ A;  2FSR A;  3DSB A;  1M4I A;  3VAT A;  3IU2 A;  3R95 A;  1LAN A;  4UCN A;  2QIR A;  3H4Q A;  2PJC A;  3DNS A;  1BPM A;  1Y7R A;  2BEI A;  1Y9K A;  2NSM A;  2OZH A;  2ZED A;  3JRU A;  4AVC A;  3PFE A;  3WC5 A;  2CTC A;  1X12 A;  2J8N A;  2YNC C;  3FNC A;  3ISZ A;  4OP4 A;  2Q7B A;  3TOB A;  4YGO A;  4NGS A;  1IGB A;  1AYE A;  2NYQ A;  3IIB A;  4IHM A;  2KCW A;  1TF9 A;  3I3G A;  4AB7 A;  1YW6 A;  3D66 A;  3NH4 A;  4NF1 A;  4JJX A;  4EVY A;  2FL4 A;  1AUG A;  3KQZ A;  4X5K A;  4H2K A;  2PRQ A;  2GFQ A;  3BLN A;  2I00 A;  2P6F A;  1S3Z A;  4MY0 A;  1HDQ A;  4MHZ A;  2QVP A;  2H5M A;  1IY7 A;  4U9Y A;  4UFV A;  2XEF A;  4C2Y A;  4R57 A;  1I12 A;  4OAE A;  1RTQ A;  4MI4 A;  4RN7 A;  5CBM A;  4F6A A;  2VZZ A;  2ZW7 A;  3B3T A;  3B3W A;  3CPA A;  4ZYQ A;  3IWG A;  4WJB A;  1OZP A;  2PVV A;  3L2N A;  5EC4 A;  2Q44 A;  4KOS A;  3FMC A;  4U9Z A;  1ZG8 A;  1Z8T A;  2YNC A;  4CAE A;  4CYQ A;  2NMT A;  3KKW A;  3B8G A;  3P2H A;  4KSF A;  2Z3L A;  5KTD A;  3D4U A;  2ARH A;  3ZZI A;  3DR8 A;  4UIB A;  4ZBG A;  5K8O A;  2C6G A;  4UEF A;  4TNU A;  2AFO A;  3RYO A;  2B3U A;  1J4J A;  4ONW A;  3FED A;  2FT0 A;  2PSW A;  2ZOG A;  5J1Q A;  4GM5 A;  3HUV A;  3WAB A;  2Q4Y A;  5G22 A;  2PJ7 A;  2AJ6 A;  3GYA A;  3N5F A;  4UFX A;  4B13 A;  5HMN A;  4CAX A;  2BOA A;  4JXQ A;  2HB6 A;  2Z11 A;  1TIQ A;  2EUI A;  4M6H A;  1ON0 A;  4PXB A;  4DNC A;  2ZPA A;  1Y9W A;  4KZT A;  4R8F A;  5DWN A;  1MJB A;  5A27 A;  1ZLI A;  4II9 A;  4FUU A;  3WT4 A;  1KUX A;  2GAN A;  2P6G A;  4ZGY B;  4LQ6 A;  1XIX A;  4XPK A;  5IV0 A;  2FXF A;  3NE8 A;  4ONU A;  4X3R A;  1YLE A;  3D2P A;  4MBU A;  4MFL A;  3S6G A;  3MN8 A;  2ZEH A;  2ZEM A;  3IWE A;  3SHP A;  2PJ6 A;  5JGF A;  1ARM A;  3DDD A;  3R9G A;  3RZA A;  4C2X A;  5EMI A;  4XPL A;  4RI1 A;  4P45 A;  4UA3 A;  2C1C A;  2PJ8 A;  4H6Z A;  5J8C A;  3BI0 A;  3R9F A;  4YU9 A;  2O53 A;  4MMO A;  2GU2 A;  5A28 A;  5JM6 A;  3BJ8 A;  4A32 A;  2WPX A;  1ELM P;  1Z8X A;  4KVM E;  7CPA A;  2JDC A;  1NMT A;  4P4J A;  3FRM A;  4YRH A;  2BCO A;  4HNX B;  1S5K A;  4KUB A;  4OIW A;  5D8N A;  4BD9 A;  2J8M A;  2C6P A;  2AFS A;  2G3A A;  2YND A;  4FD5 A;  2JEV A;  3CT9 A;  3PBE A;  1I21 A;  3H5Z A;  3SXO A;  3WR7 A;  3R1K A;  1BAV A;  4KOW A;  4PXD A;  2EWB A;  4PV6 A;  2DF5 A;  4OC1 A;  2JBJ A;  4ORF A;  3CDX A;  5DWM A;  2WSA A;  4MHY A;  3DR6 A;  1ZLH A;  2P0W A;  4KLW A;  4NJR A;  2CF4 A;  2XEJ A;  2V8V A;  2JBK A;  5HVG A;  5KTA A;  4XPD C;  3MGD A;  4R76 A;  2Z3O A;  1MJ9 A;  4UBR A;  4DYO A;  4FAI A;  2PRB A;  4Y49 C;  2HUZ A;  1M1D A;  3EY5 A;  4MCR A;  1XRY A;  5F48 A;  3B2Y A;  4CYO A;  1YX0 A;  5ELY A;  2WUU A;  3RAM A;  2G0B A;  2OR4 A;  3FYN A;  4NFR A;  5C88 A;  2V8D A;  2ZXV A;  3QNV A;  3V38 A;  1ZG7 A;  2PC1 A;  4CGP A;  4H89 A;  5AG5 A;  3NE7 A;  3JUW A;  2G3T A;  3K2K A;  4B11 A;  3S6F A;  1CPS A;  1IOI A;  2F7V A;  4NJQ A;  2DPS A;  2B4D B;  1M44 A;  2PVW A;  4NCZ A;  2VEZ A;  1YME A;  2Z3N A;  3D3S A;  4O23 A;  2FIA A;  3F0A A;  4NGR A;  2WZN A;  4OAD A;  2EK9 A;  1FY7 A;  2ZEG A;  4OME A;  4MFQ A;  2PJ2 A;  4MCS A;  1VHO A;  2R1I A;  4CAV A;  5G20 A;  5K8M A;  2GLF A;  5F46 A;  4GS4 A;  2A4N A;  2BSW A;  1NSL A;  3D7H A;  4CRY B;  3TO6 A;  3S9L A;  4JXR A;  1UFH A;  3W91 A;  3TCV A;  4QVT A;  4ZY0 A;  2CNS A;  4PSX A;  1BLL E;  3S6K A;  3K9U A;  5LRK A;  1BPN A;  1QSR A;  4P10 A;  4MHP A;  2OZG A;  2CTB A;  4A39 A;  3B7I A;  1IID A;  1LCP A;  3IU1 A;  4PK2 A;  2REF A;  4HKF A;  4Q36 A;  1XMB A;  3SI0 A;  2ATR A;  3PZJ A;  2V8G A;  2EO8 A;  2B4B A;  1H8L A;  3SXN A;  4X2T A;  2JLM A;  3IJ3 A;  3OWC A;  5G1Z A;  2ODF A;  2QJ8 A;  3KR5 A;  2B58 A;  2VZY A;  1KUY A;  4JZ0 A;  1ZO0 A;  1TKF A;  2JEW A;  5AG6 A;  3IFE A;  5THW A;  4UEE A;  3TO7 A;  2FVG A;  1IOF A;  3VWE A;  2DEA A;  3SJX A;  4M3S A;  5K8N A;  5AGE A;  4C7I A;  4B10 A;  3FBU A;  4GXH A;  5JH9 A;  3KQX A;  4RS2 A;  1HDU A;  4UIA A;  4K3N A;  1YR0 A;  4F0Y A;  1LAP A;  1LOK A;  4QUS A;  4IK2 A;  1V0C A;  4L8A A;  5K8P A;  4U5Y A;  3PB4 X;  1F2O A;  4KOX A;  5ISV A;  3D7F A;  1IYL A;  3B3C A;  1A2Z A;  3KHX A;  4FD6 A;  3TTH A;  2X7B A;  2PR1 A;  4Q38 A;  1S7N A;  4IF5 A;  4IAV A;  4AG9 A;  3BJ7 A;  3FH4 A;  1VKC A;  4FWU A;  4MCQ A;  3IC1 A;  4OC4 A;  5HVH A;  1MK4 A;  2Q7S A;  4K30 A;  2OH1 A;  1OBR A;  4A37 A;  3IGR A;  4MFZ A;  1KUV A;  1XF8 A;  2AFU A;  1YQE A;  1S7K A;  4J3G A;  4NGN A;  3V8I A;  1IU8 A;  1N71 A;  3FF3 A;  4EFD A;  2XEI A;  4L89 A;  4PXC A;  4UF4 A;  5HVF A;  1IYK A;  4DJL A;  2EBJ A;  5D29 A;  3H8G A;  5LYF A;  1JQG A;  1YVO A;  2BO9 A;  1PU9 A;  2BL1 A;  3LAC A;  5GCN A;  3KI9 A;  3B3S A;  3D7D A;  3EFA A;  4Y49 B;  2Q51 A;  3TOA A;  2ZEE A;  3D7G A;  4OC0 A;  3IO1 A;  3PB9 X;  4E8O A;  1QSM A;  4AVB A;  1LFW A;  4NGT A;  2O4H A;  5JPH A;  4Z65 A;  1TXR A;  4MCP A;  1YRE A;  2Z3K A;  3FVL A;  1TF8 A;  4CGN A;  4P4B A;  4P4I A;  4CAF A;  1R3N A;  4PPZ A;  4WWV A;  1CPX A;  2XEG A;  3KZW A;  3CZX A;  1NSA A;  4ZY1 A;  3K9T A;  4KOV A; 
#chains in the Genus database with same CATH homology
 3R9E A;  2Y0M A;  4A33 A;  4C7H A;  5FVJ A;  2CXA A;  4NSQ A;  4B5P B;  5E96 A;  4F0X A;  4R3L A;  2R8V A;  3TT2 A;  1P0H A;  1XE4 A;  4C68 A;  1Z4E A;  4IUS A;  4KOU A;  4A31 A;  2R7H A;  5F47 A;  2OZU A;  1CM0 A;  2J8R A;  4QB9 A;  1Q2Y A;  2B5G A;  3F8K A;  2WPW A;  4FD4 A;  4R9M A;  5AG7 A;  2D4P A;  1S7F A;  2Z0Z A;  5I0C A;  3FIX A;  2Q04 A;  4B12 A;  1YK3 A;  4I49 A;  4OLL A;  4CGO A;  1RO5 A;  1LRZ A;  2REE A;  3LOD A;  3T9Y A;  1Z4R A;  3UY5 A;  4CRZ B;  4A95 A;  1WWZ A;  2Z10 A;  1BO4 A;  1KZF A;  1L0C A;  1QSN A;  1NE9 A;  2C27 A;  4LX9 A;  4UCP A;  4KSA A;  4E0A A;  4KOR A;  3TE4 A;  4JWP A;  2GIV A;  3GKR A;  2B4D A;  1I1D A;  3D2M A;  4HNY B;  4CYN A;  3CXQ A;  2OB0 A;  2CNM A;  3P2F A;  1BOB A;  2B5G B;  5JQ4 A;  2CY2 A;  4KS9 A;  2QML A;  2ZW6 A;  3JTK A;  4KVX A;  5HH1 A;  3S6H A;  4KOY A;  2D4O A;  3CXS A;  4M85 A;  2YNE A;  4UWJ A;  5BWA B;  4R3K A;  2Q4V A;  4HNW B;  4UWI A;  4PSW A;  1RXT A;  3TFY A;  2GE3 A;  2P6E A;  5EBV A;  2Z3M A;  3T90 A;  1B87 A;  4E2A A;  3FB3 A;  4JLY A;  3JVN A;  4MHD A;  1GHE A;  1S7L A;  4PK3 A;  2ZW5 A;  1IB1 E;  2PQ8 A;  4UCM A;  1XEB A;  5H84 A;  2JDD A;  3G3S A;  4MFJ A;  2FS5 A;  4A30 A;  3W6X A;  2DPT A;  4LUA A;  4NEX A;  3FXT A;  4B5P A;  2EVN A;  3G8W A;  2IL4 A;  2PDO A;  2PR8 A;  4QC6 A;  4C2Z A;  4B5O A;  2VI7 A;  4NXY A;  4BBH A;  4KUA A;  1QSO A;  3D8P A;  2DXQ A;  1IIC A;  1K4J A;  2FE7 A;  5KTC A;  4AVA A;  1R57 A;  3EXN A;  2I79 A;  1Q2C A;  2ZW4 A;  1CJW A;  3A9L A;  1SQH A;  2VBQ A;  4XNH C;  3ZJ0 A;  3QAH A;  3QB8 A;  2YGW A;  5IX3 A;  1PUA A;  2QEC A;  1S60 A;  3EC4 A;  4CGL A;  1U6M A;  1YGH A;  4JD6 A;  1YVK A;  2FIW A;  1XMT A;  2B3V A;  3LD2 A;  2Z3P A;  3CXP A;  1VHS A;  2CNT A;  5AG4 A;  1B6B A;  2HQY A;  4CGM A;  2VXK A;  4CYP A;  2RC4 A;  4AG7 A;  3W6S A;  2BUE A;  5J8F A;  4QBJ A;  3E0K A;  2OU2 A;  4MY3 A;  3C26 A;  4UFW A;  4R87 A;  4CS0 B;  5H86 A;  4KLV A;  3GY9 A;  4KOT A;  4H6U A;  5CNP A;  4MFP A;  1M4D A;  4FD7 A;  4MJ8 A;  3F5B A;  3PP9 A;  1Z9U A;  3I9S A;  4XNH B;  1QST A;  2R98 A;  4CAW A;  4KVO E;  2HV2 A;  2O28 A;  2F5I A;  3EO4 A;  3TO9 A;  5C82 A;  2Q0Y A;  2AE6 A;  5G21 A;  4BMH A;  1M4G A;  1MJA A;  1P4N A;  4MFK A;  3R96 A;  3VWD A;  4B14 A;  4XPD B;  2FCK A;  1Q2D A;  2K5T A;  3N7Z A;  2VQY A;  5IB0 A;  3PGP A;  4A2Z A;  1WK4 A;  2FSR A;  3DSB A;  1M4I A;  3IU2 A;  3R95 A;  4UCN A;  2QIR A;  3H4Q A;  3DNS A;  1Y7R A;  2BEI A;  1Y9K A;  2OZH A;  4AVC A;  2J8N A;  3FNC A;  2YNC C;  2Q7B A;  3TOB A;  4YGO A;  2KCW A;  3I3G A;  4AB7 A;  4NF1 A;  4JJX A;  4EVY A;  2FL4 A;  4X5K A;  3BLN A;  2I00 A;  2P6F A;  1S3Z A;  4MY0 A;  4UFV A;  2H5M A;  4U9Y A;  4C2Y A;  4R57 A;  1I12 A;  4OAE A;  4MI4 A;  4F6A A;  2VZZ A;  2ZW7 A;  3IWG A;  1OZP A;  5EC4 A;  2Q44 A;  4KOS A;  4U9Z A;  2YNC A;  4CAE A;  4CYQ A;  2NMT A;  3KKW A;  3B8G A;  4KSF A;  3P2H A;  2Z3L A;  5KTD A;  2ARH A;  3ZZI A;  3DR8 A;  4ZBG A;  3RYO A;  2B3U A;  1J4J A;  2FT0 A;  2PSW A;  2Q4Y A;  5G22 A;  3GYA A;  2AJ6 A;  4UFX A;  4B13 A;  5HMN A;  4CAX A;  4JXQ A;  2Z11 A;  1TIQ A;  2EUI A;  1ON0 A;  4DNC A;  2ZPA A;  1Y9W A;  4KZT A;  5DWN A;  5A27 A;  1MJB A;  4II9 A;  1KUX A;  2GAN A;  2P6G A;  4ZGY B;  1XIX A;  4XPK A;  5IV0 A;  2FXF A;  4ONU A;  1YLE A;  3D2P A;  4MBU A;  4MFL A;  3S6G A;  3SHP A;  3IWE A;  3DDD A;  3R9G A;  4C2X A;  4XPL A;  4RI1 A;  4UA3 A;  5J8C A;  4H6Z A;  3R9F A;  5A28 A;  3BJ8 A;  4A32 A;  2WPX A;  4KVM E;  2JDC A;  1NMT A;  3FRM A;  4YRH A;  4HNX B;  4KUB A;  1S5K A;  2J8M A;  2G3A A;  2YND A;  4FD5 A;  2JEV A;  1I21 A;  3H5Z A;  3SXO A;  3WR7 A;  3R1K A;  4KOW A;  4PV6 A;  4ORF A;  5DWM A;  2WSA A;  3DR6 A;  2P0W A;  4KLW A;  5KTA A;  4XPD C;  3MGD A;  2Z3O A;  1MJ9 A;  4UBR A;  2PRB A;  4Y49 C;  2HUZ A;  1M1D A;  3EY5 A;  5F48 A;  4CYO A;  1YX0 A;  2WUU A;  2G0B A;  3FYN A;  5C88 A;  2ZXV A;  4CGP A;  2PC1 A;  4H89 A;  5AG5 A;  3NE7 A;  3JUW A;  2G3T A;  4B11 A;  3S6F A;  2DPS A;  2B4D B;  1M44 A;  4NCZ A;  5F49 A;  2VEZ A;  2Z3N A;  4YFJ A;  3D3S A;  2FIA A;  3F0A A;  4OAD A;  1FY7 A;  4MFQ A;  2R1I A;  4CAV A;  5G20 A;  5F46 A;  4GS4 A;  2A4N A;  2BSW A;  1NSL A;  4CRY B;  3TO6 A;  4JXR A;  1UFH A;  3W91 A;  3TCV A;  4QVT A;  2CNS A;  4PSX A;  3S6K A;  3K9U A;  1QSR A;  2OZG A;  1IID A;  3IU1 A;  4PK2 A;  2REF A;  4HKF A;  4Q36 A;  2ATR A;  3PZJ A;  2B4B A;  3SXN A;  2JLM A;  3OWC A;  5G1Z A;  2B58 A;  2VZY A;  1KUY A;  1ZO0 A;  5AG6 A;  3TO7 A;  3VWE A;  4M3S A;  5AGE A;  4C7I A;  4B10 A;  3FBU A;  4RS2 A;  1YR0 A;  4QUS A;  1V0C A;  4L8A A;  4U5Y A;  4KOX A;  5ISV A;  1IYL A;  4FD6 A;  3TTH A;  2X7B A;  2PR1 A;  4Q38 A;  1S7N A;  4IF5 A;  4AG9 A;  3BJ7 A;  1VKC A;  1MK4 A;  4K30 A;  2OH1 A;  3IGR A;  4MFZ A;  1XF8 A;  1KUV A;  4J3G A;  3V8I A;  1S7K A;  1N71 A;  4L89 A;  1IYK A;  1YVO A;  1PU9 A;  2BL1 A;  5GCN A;  3EFA A;  3TOA A;  4Y49 B;  4E8O A;  1QSM A;  4AVB A;  5JPH A;  1YRE A;  2Z3K A;  4CGN A;  4CAF A;  4F0Y A;  4KOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...