2G3TA

Crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
169
structure length
169
Chain Sequence
b'KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3tA00
1QSOA 5KTDA 4AVBA 3EC4A 4JJXA 4AVCA 2FT0A 4QC6A 4AG9A 1MK4A 2C27A 5CNPA 3EO4A 4KVME 1UFHA 3TOBA 4KOYA 2OZGA 2G3TA 2D4OA 2FCKA 4U5YA 2Z10A 1M4DA 3D2MA 1PUAA 1YR0A 1L0CA 1S60A 4OADA 3F8KA 4XNHC 1VHSA 2FE7A 4R3LA 2EVNA 3BJ8A 4U9YA 4DNCA 3WR7A 4E0AA 3SHPA 2R1IA 3T90A 4JWPA 5J8FA 1SQHA 2GIVA 3E0KA 2J8RA 3EY5A 2PQ8A 4R57A 2OH1A 3D8PA 2VZYA 2REFA 4H6UA 5F48A 4J3GA 5JQ4A 3P2HA 3SXNA 2Q4YA 1YK3A 2ZW5A 4KOTA 1YVKA 1KZFA 5H84A 2NMTA 3VWEA 4L8AA 2B5GB 5FVJA 2O28A 5IB0A 4E8OA 3W6SA 3DR8A 3ZJ0A 1XIXA 3TCVA 4RI1A 2ZXVA 2BL1A 2VEZA 2FSRA 2H5MA 1IICA 1KUYA 4KLVA 2CNTA 2PSWA 1CM0A 1N71A 5GCNA 3QB8A 2QMLA 1PU9A 3D2PA 4KVOE 3BLNA 5E96A 3VWDA 3R9GA 4NCZA 3TT2A 2KCWA 2AJ6A 4QB9A 4M3SA 1BO4A 1Z9UA 4UA3A 4IUSA 3W6XA 3FRMA 4CRYB 1GHEA 1S7NA 4FD4A 4EVYA 3F0AA 3C26A 3GY9A 1M4GA 2F5IA 3LD2A 1B6BA 5IX3A 2I00A 2Z11A 4MY0A 1Q2YA 3FXTA 3MGDA 1Y7RA 4LX9A 4CS0B 1BOBA 1YX0A 3PGPA 1IYKA 2VXKA 2ATRA 3FBUA 3LODA 3TO6A 5F46A 4PK2A 2BSWA 4B5PA 3T9YA 3CXQA 4XPKA 2Q04A 1P0HA 5HH1A 5DWMA 5ISVA 1NE9A 1B87A 2VI7A 2ARHA 4KOSA 2P6GA 1ON0A 2VBQA 4KVXA 2RC4A 3JUWA 2J8MA 1S7KA 4XPDC 1KUVA 3ZZIA 2P6FA 1WWZA 1YVOA 3V8IA 4KOWA 4NXYA 3TE4A 4H6ZA 2WPWA 3DDDA 2B4DA 1S7LA 4KOXA 1XEBA 1OZPA 4KUAA 3CXPA 2PRBA 3G8WA 1U6MA 3EXNA 1Z4RA 2WPXA 2OB0A 3S6HA 3CXSA 3EFAA 5IV0A 3R96A 1V0CA 3W91A 2CY2A 4R9MA 4NEXA 1NMTA 2EUIA 2B3UA 3R9FA 4JLYA 2HV2A 4KOUA 5C88A 1S3ZA 3R9EA 3R95A 4BMHA 2G3AA 3TO9A 1Y9KA 4PK3A 5KTCA 4MHDA 5F47A 3FIXA 3UY5A 3QAHA 2P0WA 4B5OA 3IWGA 3TO7A 4Y49C 2ZW4A 2OZHA 2PDOA 3FYNA 1QSNA 2JLMA 4HNWB 5F49A 4GS4A 1WK4A 4KUBA 4QUSA 2JDDA 4NSQA 5C82A 3R1KA 2I79A 2DXQA 1TIQA 2CNMA 2Q4VA 3I3GA 2R8VA 4XNHB 3BJ7A 4F0YA 2Q0YA 2B58A 2FIWA 3GKRA 3KKWA 2GE3A 3I9SA 2FIAA 4KORA 4OAEA 3SXOA 2R98A 4AG7A 3S6GA 5HMNA 4KZTA 3DNSA 4X5KA 2Z0ZA 4IF5A 2JDCA 4JXQA 1K4JA 2BUEA 3DSBA 1XE4A 3TOAA 1P4NA 3TFYA 3OWCA 3GYAA 4PSWA 1YREA 1LRZA 4LUAA 2REEA 4K30A 2GANA 2OU2A 5J8CA 4U9ZA 3TTHA 2J8NA 4ORFA 1I21A 4H89A 2CNSA 1QSRA 3H4QA 4MY3A 4CAVA 3DR6A 1YLEA 4KLWA 2P6EA 1I1DA 4CRZB 2A4NA 2B4BA 2ZPAA 3K9UA 4B5PB 2OZUA 4HNYB 4I49A 1Y9WA 2BEIA 1CJWA 5H86A 4NF1A 4UWIA 1I12A 2Q44A 4FD6A 3F5BA 5EBVA 4HNXB 2G0BA 4YGOA 1MJBA 1XF8A 3P2FA 4M85A 4PSXA 1MJ9A 3JVNA 1IYLA 4QBJA 1QSTA 3FB3A 1RO5A 2B4DB 4MJ8A 2AE6A 1VKCA 4F6AA 1KUXA 4UWJA 3FNCA 2ZW7A 2B5GA 1QSMA 3N7ZA 4II9A 1MJAA 1S5KA 1NSLA 1M1DA 2PC1A 1IIDA 3IGRA 4R3KA 2IL4A 4KOVA 2HUZA 1IB1E 4FD7A 1XMTA 2FS5A 3PZJA 2HQYA 4MBUA 4XPDB 2QECA 4FD5A 4E2AA 4RS2A 4JXRA 4CAXA 4JD6A 4ONUA 2FL4A 1R57A 1Q2CA 3G3SA 4AVAA 1YGHA 5DWNA 2K5TA 1FY7A 2D4PA 4ZBGA 4OLLA 4L89A 2PR8A 4QVTA 1Q2DA 3S6FA 4MI4A 4XPLA 4AB7A 2X7BA 4HKFA 4R87A 5KTAA 3D3SA 3B8GA 4CAWA 2JEVA 1Z4EA 4UBRA 5JPHA 4YRHA 1M44A 2VZZA 1M4IA 2FXFA 3PP9A 2PR1A 4PV6A 5EC4A 3S6KA 2B3VA 1S7FA 3NE7A 2ZW6A 3RYOA 1RXTA 2Q7BA 5I0CA 1J4JA 2VQYA 2R7HA 4YFJA 4Y49B 2Y0MA 2QIRA
chains in the Genus database with same CATH superfamily
2CTBA 1QSOA 5KTDA 4AVBA 4A32A 1LANA 3EC4A 4UEFA 1Z5RA 4JJXA 3B3SA 4OMEA 4AVCA 2FT0A 4CYQA 4PQAA 3DGVA 4QC6A 2XEIA 4AG9A 5LYFA 1MK4A 2C27A 2Z3OA 5CNPA 3S9LA 4X3RA 5HVFA 3EO4A 4RN7A 4KVME 4FUUA 1Y7EA 1UFHA 3B3CA 3TOBA 3PFOA 2PE3A 3B7IA 4KOYA 2OZGA 3NFZA 1XOVA 3RAMA 2G3TA 3MN8A 4PXDA 1IY7A 2D4OA 4P44A 2FCKA 2YGWA 2JEWA 1EE3P 4U5YA 2Z10A 2ZEPA 2Z3NA 4LQGA 1M4DA 1XFOA 2V77A 3D2MA 4JZ0A 1PUAA 1YR0A 5CBMA 3K2KA 1L0CA 2AFMA 1S60A 4MFLA 3F8KA 2QVPA 3I1UA 4OADA 4UEEA 4XNHC 5LRKA 1VHSA 4R7MA 2FE7A 4R3LA 2PJ9A 2EVNA 1Q7LA 3B3WA 2PJ2A 4P45A 4EFDA 3BJ8A 3V7ZA 4U9YA 4DNCA 3WR7A 1IGBA 2C6PA 4E0AA 5I4MA 2ZEFA 3SHPA 1UWYA 3B3TA 1Z2LA 1TF8A 2R1IA 7CPAA 3T90A 4JWPA 4UEZA 5J8FA 1SQHA 2GIVA 1LCPA 3E0KA 5D29A 2J8RA 2PJCA 3EY5A 2PJ1A 2PQ8A 4R57A 2OH1A 3D8PA 3KASA 2VZYA 3BI1A 3KL9A 3N5FA 4F9UA 2REFA 4H6UA 5F48A 4J3GA 2WUUA 5JQ4A 3P2HA 4NFRA 2GFQA 3SXNA 4JYWA 2G9DA 5JGFA 2Q4YA 3H5ZA 5JH9A 3PB9X 4P6YA 1ZLIA 5HVHA 1YK3A 2ZW5A 4KOTA 1YVKA 3GLJA 4CYNA 1KZFA 5H84A 1GYTA 4OC1A 2NMTA 2Z3KA 2PJAA 4ZYQA 3IO1A 5LYDA 3ISZA 3S9MA 2GREA 2ABZA 3VWEA 1ZG7A 2GLJA 2B5GB 2ZEEA 4L8AA 4P4DA 3GUXA 4TNUA 4X8IA 2PRQA 1QMUA 2O28A 5FVJA 4C2XA 4E8OA 5IB0A 5LYLA 3W6SA 4FWUA 5LYIA 5AG4A 3DR8A 2DPSA 3PRTA 5THWA 3ZJ0A 1XIXA 5AG7A 3TCVA 3H8EA 4RI1A 2ZXVA 4CGPA 1LFWA 2BL1A 2AFSA 2FVGA 2VEZA 4P4FA 1TKJA 3SI0A 2FSRA 2H5MA 2IMOA 3IU2A 1IICA 1ARLA 1KUYA 4KLVA 2CNTA 4ZX9A 4NJRA 2PSWA 2XEFA 2ZENA 1AYEA 1CM0A 1N71A 2V8DA 4K3NA 5GCNA 3QB8A 4A94A 2PVVA 4O23A 1DE4C 2QMLA 1PU9A 3IIBA 4NGTA 4CAEA 3D2PA 4MFKA 1TF9A 1Z8LA 4KVOE 3KZWA 2ZEHA 3BLNA 5E96A 3VWDA 3R9GA 4NCZA 3KGQA 5G20A 3TT2A 1TXRA 2ZOGA 3RNZA 2KCWA 2AJ6A 4QB9A 1HDQA 4M3SA 5K8MA 1IOFA 1BO4A 4F0XA 1Z9UA 4UA3A 2QJ8A 4IUSA 3W6XA 2WSAA 3CZXA 8CPAA 3FRMA 4CRYB 4IAVA 1GHEA 1H8LA 1BPNA 4BINA 1S7NA 2ZEGA 3B35A 4KSIA 4IHMA 3BXMA 4MFJA 4UCNA 4FD4A 3KR5A 4LQ6A 4C7IA 4EVYA 3F0AA 3C26A 3GY9A 3HUVA 5A28A 1CBXA 1TKHA 1M4GA 2WYRA 2HB6A 2F5IA 3SJGA 3LD2A 1B6BA 3LACA 5K8NA 2GU2A 4NGSA 2EBJA 3B2YA 5IX3A 2I00A 2Z11A 3IWEA 4MY0A 3KHZA 3TC8A 1Q2YA 2CF4A 3FXTA 1Y7RA 3MGDA 4LX9A 4B11A 1KWMA 2PJ7A 1VHOA 1BOBA 1YX0A 4CS0B 1AUGA 3PGPA 1IYKA 2VXKA 2ATRA 3FBUA 3LODA 4UIAA 3TO6A 5F46A 4PK2A 2BSWA 2GLFA 4B5PA 3T9YA 3CXQA 4BBHA 2AFXA 2Q7SA 2POKA 2J9AA 2C1CA 4R76A 2Q04A 1P0HA 4OIWA 4XPKA 5HH1A 4H2KA 2F7VA 1LOKA 3T8WA 5DWMA 2VL1A 1NE9A 1B87A 2VI7A 5ISVA 5K8PA 1XMBA 2JBKA 2ARHA 4KOSA 2P6GA 5F09A 1ON0A 2VBQA 2CIJA 4KVXA 1CP6A 3NE8A 5BWAB 2RC4A 2CTCA 2RB7A 3FECA 3JUWA 4A95A 2J8MA 1S7KA 2IQ6A 4XPDC 3NH5A 4UIBA 1KUVA 3ZZIA 2P6FA 1WWZA 1YVOA 1ZO0A 3FEDA 4P4IA 3V8IA 4KOWA 4NXYA 3TE4A 4W9YA 4H6ZA 2WPWA 3GIUA 6CPAA 3DDDA 5LRGA 2B4DA 4KS9A 1PYTB 1XRYA 3D4UA 1S7LA 3FX6A 3L2NA 4KOXA 2IJZA 1XEBA 1OZPA 3RO0A 4KUAA 3CXPA 1BPMA 3RZAA 4C68A 3LWUA 2PRBA 3FJUA 2BO9A 3CPAA 3G8WA 1NSAA 1U6MA 3EXNA 3A9LA 3KHXA 4MXUA 5CPAA 1Z4RA 3TX8A 2WPXA 4UCPA 4WJBA 3WT4A 3D67A 3SJEA 1YW4A 2OB0A 3S6HA 2PJ3A 4FAIA 4F9VA 3CXSA 3EFAA 5IV0A 3R96A 1V0CA 3KI9A 3KQZA 3W91A 2CY2A 4R9MA 4NEXA 2PVWA 1NMTA 2EUIA 2B3UA 1Z8WA 3R9FA 4JLYA 3FMCA 4PXCA 4NGPA 3PB6X 4ZGYB 2HV2A 4KOUA 2XEJA 5C88A 1S3ZA 3R9EA 4OC2A 3PEIA 3DLJA 3R95A 3D7HA 4BMHA 2G3AA 4HPSA 4NGQA 3TO9A 5D8NA 1Y9KA 1XJOA 4PK3A 4R6TA 2PIZA 5KTCA 4MHDA 1VIXA 5F47A 3FIXA 1YW6A 4P4EA 3UY5A 3RBUA 4KSAA 3QAHA 2ZOFA 1PCAA 2P0WA 3IWGA 4B5OA 1JQGA 2PJ8A 3TO7A 1ZLHA 4Y49C 4YWYA 2ZW4A 2OZHA 2PDOA 3CPXA 3FYNA 4G1PA 4C7HA 4CGNA 4A30A 1QSNA 2JLMA 4ZY0A 4ZY1A 2EWBA 3LMSA 2Z3LA 4HNWB 5F49A 4GS4A 1WK4A 4KUBA 4QUSA 2JDDA 3VARA 3NA6A 4NSQA 5C82A 5AG5A 3R1KA 4NGRA 2I79A 4WWVA 5AG6A 1BAVA 1Z8XA 2DXQA 1ZG9A 4X2TA 1TIQA 2CNMA 2Q4VA 3I3GA 2R8VA 4XNHB 4CGOA 3BJ7A 4F0YA 2Q0YA 3K9TA 2HC9A 1HDUA 2B58A 3PB7X 3PFEA 4PPZA 3WC6A 2FIWA 4OC4A 1YLOA 2Z3PA 1CX8A 3GKRA 4GXHA 5LRJA 4EWTA 2PJ5A 2NYQA 2DF5A 2XEGA 1LAPA 2RFHA 3KKWA 1OBRA 4P4BA 2GE3A 3CT9A 3I9SA 2FIAA 4KORA 4MHPA 2PJBA 4OAEA 3SXOA 2DEAA 2R98A 4AG7A 3S6GA 4Z65A 5HMNA 4M6IA 4OP4A 1LAMA 4KZTA 2V8VA 4B14A 2YNEA 1X12A 2EK8A 3IEHA 3DNSA 4A38A 4X5KA 3IC1A 2Z0ZA 4Q36A 5IB9A 4IF5A 2JDCA 4JXQA 2BCOA 2ANPA 2PCUA 4CYOA 1K4JA 5AGEA 2BUEA 3DSBA 4NJQA 5HXDA 3BI0A 1XE4A 3H8FA 3S9NA 1F2OA 1ZG8A 3PB4X 3GB0A 3TOAA 2O4HA 4MRIA 1P4NA 3SI1A 3TFYA 3OWCA 3D66A 3GYAA 4CGLA 4PSWA 1YREA 1LRZA 1YSJA 4NGMA 3QNVA 3D7FA 4LUAA 1F57A 2REEA 4BD9A 1FT7A 1VGYA 4F8ZA 4A31A 4DJLA 4K30A 3SJXA 3WC7A 1R3NA 2GANA 3PBBA 2OU2A 5J8CA 4U9ZA 3CDXA 3TTHA 2J8NA 4ORFA 1I21A 3FEEA 4Q7AA 2PJ4A 1CPXA 3PB8X 4H89A 4MCRA 2F8HA 2CNSA 1QSRA 3H4QA 4MY3A 4CAVA 4UFXA 3D7DA 3DR6A 2YNCC 1RTQA 1YLEA 4A39A 4KLWA 3MRUA 1FNOA 2P6EA 2WZNA 1I1DA 3V38A 3FH4A 4CRZB 2A4NA 2B4BA 2ZPAA 3FF3A 3IWWA 3K9UA 2OZUA 4B5PB 4P10A 4HNYB 1Y0YA 1BLLE 4C2ZA 4I49A 2CXAA 1Y9WA 4ZX8A 2BEIA 1CJWA 4OC0A 5H86A 4NF1A 4UWIA 2AFWA 1I12A 1IOIA 2QYVA 2Q44A 4UFWA 3WC5A 4FD6A 2AFOA 3KR4A 4A2ZA 4MFPA 3F5BA 5EBVA 4HNXB 2G0BA 3SJFA 4YGOA 1MJBA 3KQXA 1AMPA 1XF8A 3NH4A 2O53A 3P2FA 4M85A 4PSXA 1MJ9A 3D7GA 3JVNA 1IYLA 4QBJA 1QSTA 2ODFA 3IU1A 3IJ3A 4UFVA 3FB3A 2PJ6A 4CPAA 4C2YA 1YMEA 1RO5A 2B4DB 4MJ8A 2OR4A 2EO8A 3H8GA 2AE6A 1VKCA 4F6AA 2C6GA 1KUXA 4UWJA 5ELYA 1JWQA 1XBUA 4DYOA 2YNCA 3FNCA 2ZW7A 5JM6A 2B5GA 4R8FA 4MCPA 1QSMA 2ZELA 5EMIA 3N7ZA 4ZI6A 4II9A 1MJAA 1R43A 3VATA 1CPSA 4IK2A 4TWEA 3FVLA 1S5KA 4M6GA 2NSMA 2JBJA 4MHYA 5DS0A 1NSLA 1M1DA 1ARMA 2PC1A 1IIDA 4MFQA 4P4JA 2Q4ZA 4NGNA 3IGRA 2V8GA 4CYPA 4ONWA 1ELMP 4EMEA 5A27A 1YQEA 4R3KA 2IL4A 4KOVA 2HUZA 1IB1E 3BHXA 3D68A 2YNDA 4FD7A 3WABA 1XMTA 2FS5A 1TKFA 3PZJA 2HQYA 4MBUA 1CP7A 4XPDB 5HVGA 2QECA 4FD5A 4E2AA 4PXBA 1Z8TA 4RS2A 4JXRA 4OKOA 4CAXA 4UCMA 5K8OA 4JD6A 4MMOA 5G21A 3HLPA 1Y0RA 4A37A 2PIYA 2FL4A 4ONUA 3NH8A 1R57A 1Q2CA 1HEEA 1VHEA 2PJ0A 3G3SA 4AVAA 1YGHA 3VH9A 4OIDA 5DWNA 2DPTA 2K5TA 1CG2A 4DUKA 1FY7A 2D4PA 4AXVA 4ZBGA 4B13A 4MCSA 4OLLA 4OC3A 4FBEA 1F2PA 3JTKA 2PR8A 4L89A 4CAFA 4QVTA 2ZEMA 1Q2DA 3S6FA 4B10A 2AFZA 4MI4A 4XPLA 4AB7A 2X7BA 1X10A 4CGMA 4HKFA 1M4LA 3ISXA 4R87A 4M6HA 5KTAA 5J1QA 2Z3MA 3D3SA 3B8GA 4CAWA 1QQ9A 2JEVA 2Q51A 4MHZA 1ELLP 1Z4EA 3SI2A 2ZEOA 2AFUA 4UBRA 5JPHA 2ZEDA 2BOAA 4YRHA 3PBEA 1M44A 2VZZA 1M4IA 4B6ZA 2FXFA 4ZY2A 4B12A 3PP9A 5G1ZA 4Q38A 2PR1A 4MFZA 4PV6A 4OC5A 5EC4A 2EK9A 4UF4A 3S6KA 2B3VA 3JRUA 1S7FA 2C6CA 2ZW6A 3IFEA 3NE7A 4GM5A 4A33A 5G22A 3RYOA 1RXTA 2Q7BA 2OOTA 5I0CA 1J4JA 2VQYA 1IU8A 2Q43A 2V8HA 2R7HA 4YFJA 1DTDA 4PXEA 4KSFA 4MHNA 4Y49B 4YU9A 2Y0MA 2QIRA 3QAYA 3B3VA 2I3CA 4MCQA 4RUHA 1A2ZA
chains in the Genus database with same CATH topology
1QSOA 5KTDA 4AVBA 4A32A 3EC4A 4JJXA 4AVCA 2FT0A 4CYQA 4QC6A 4AG9A 1MK4A 2C27A 2Z3OA 5CNPA 3EO4A 4KVME 1UFHA 3TOBA 4KOYA 2OZGA 2G3TA 2D4OA 2FCKA 2YGWA 4U5YA 2Z10A 2Z3NA 1M4DA 3D2MA 1PUAA 1YR0A 1L0CA 1S60A 4MFLA 3F8KA 4OADA 4XNHC 1VHSA 2FE7A 4R3LA 2EVNA 3BJ8A 4U9YA 4DNCA 3WR7A 4E0AA 3SHPA 2R1IA 3T90A 4JWPA 5J8FA 1SQHA 2GIVA 3E0KA 2J8RA 3EY5A 2PQ8A 4R57A 2OH1A 3D8PA 2VZYA 2REFA 4H6UA 5F48A 4J3GA 2WUUA 5JQ4A 3P2HA 3SXNA 2Q4YA 3H5ZA 1YK3A 2ZW5A 4KOTA 1YVKA 4CYNA 1KZFA 5H84A 2NMTA 2Z3KA 3VWEA 4L8AA 2B5GB 5FVJA 2O28A 4C2XA 5IB0A 4E8OA 3W6SA 5AG4A 3DR8A 2DPSA 3ZJ0A 1XIXA 5AG7A 3TCVA 4RI1A 4CGPA 2ZXVA 2BL1A 2VEZA 2FSRA 2H5MA 3IU2A 1IICA 1KUYA 4KLVA 2CNTA 2PSWA 1CM0A 1N71A 5GCNA 3QB8A 2QMLA 1PU9A 4CAEA 3D2PA 4MFKA 4KVOE 3BLNA 5E96A 3VWDA 3R9GA 4NCZA 5G20A 3TT2A 2KCWA 2AJ6A 4QB9A 4M3SA 1BO4A 4F0XA 1Z9UA 4UA3A 4IUSA 3W6XA 2WSAA 3FRMA 4CRYB 1GHEA 1S7NA 4MFJA 4UCNA 4FD4A 4C7IA 4EVYA 3F0AA 3C26A 3GY9A 5A28A 1M4GA 2F5IA 3LD2A 1B6BA 5IX3A 2I00A 2Z11A 3IWEA 4MY0A 1Q2YA 3FXTA 3MGDA 1Y7RA 4LX9A 4B11A 4CS0B 1BOBA 1YX0A 3PGPA 1IYKA 2VXKA 2ATRA 3FBUA 3LODA 3TO6A 5F46A 4PK2A 2BSWA 4B5PA 3T9YA 3CXQA 4BBHA 4XPKA 2Q04A 1P0HA 5HH1A 5DWMA 5ISVA 1NE9A 1B87A 2VI7A 2ARHA 4KOSA 2P6GA 1ON0A 2VBQA 4KVXA 5BWAB 2RC4A 3JUWA 4A95A 2J8MA 1S7KA 4XPDC 1KUVA 3ZZIA 2P6FA 1WWZA 1YVOA 1ZO0A 3V8IA 4KOWA 4NXYA 3TE4A 4H6ZA 2WPWA 3DDDA 2B4DA 4KS9A 1S7LA 4KOXA 1XEBA 1OZPA 4KUAA 3CXPA 4C68A 2PRBA 3G8WA 1U6MA 3EXNA 3A9LA 1Z4RA 2WPXA 4UCPA 2OB0A 3S6HA 3CXSA 3EFAA 5IV0A 3R96A 1V0CA 3W91A 2CY2A 4R9MA 4NEXA 1NMTA 2EUIA 2B3UA 3R9FA 4JLYA 4ZGYB 2HV2A 4KOUA 5C88A 1S3ZA 3R9EA 3R95A 4BMHA 2G3AA 3TO9A 1Y9KA 4PK3A 5KTCA 4MHDA 5F47A 3FIXA 3UY5A 4KSAA 3QAHA 2P0WA 4B5OA 3IWGA 3TO7A 4Y49C 2ZW4A 2OZHA 2PDOA 3FYNA 4C7HA 4CGNA 4A30A 1QSNA 2JLMA 2Z3LA 4HNWB 5F49A 4GS4A 1WK4A 4KUBA 4QUSA 2JDDA 4NSQA 5C82A 5AG5A 3R1KA 2I79A 5AG6A 2DXQA 1TIQA 2CNMA 2Q4VA 3I3GA 2R8VA 4XNHB 4CGOA 3BJ7A 4F0YA 2Q0YA 2B58A 2FIWA 2Z3PA 3GKRA 3KKWA 2GE3A 3I9SA 2FIAA 4KORA 4OAEA 3SXOA 2R98A 4AG7A 3S6GA 5HMNA 4KZTA 4B14A 2YNEA 3DNSA 4X5KA 2Z0ZA 4Q36A 4IF5A 2JDCA 4JXQA 4CYOA 1K4JA 5AGEA 2BUEA 3DSBA 1XE4A 3TOAA 1P4NA 3TFYA 3OWCA 3GYAA 4CGLA 4PSWA 1YREA 1LRZA 4LUAA 2REEA 4A31A 4K30A 2GANA 2OU2A 5J8CA 4U9ZA 3TTHA 2J8NA 4ORFA 1I21A 4H89A 2CNSA 1QSRA 3H4QA 4MY3A 4CAVA 4UFXA 3DR6A 2YNCC 1YLEA 4KLWA 2P6EA 1I1DA 4CRZB 2A4NA 2B4BA 2ZPAA 3K9UA 4B5PB 2OZUA 4HNYB 4C2ZA 4I49A 2CXAA 1Y9WA 2BEIA 1CJWA 5H86A 4NF1A 4UWIA 1I12A 4UFWA 2Q44A 4FD6A 4A2ZA 4MFPA 3F5BA 5EBVA 4HNXB 2G0BA 4YGOA 1MJBA 1XF8A 3P2FA 4M85A 4PSXA 1MJ9A 3JVNA 1IYLA 4QBJA 1QSTA 3IU1A 4UFVA 3FB3A 4C2YA 1RO5A 2B4DB 4MJ8A 2AE6A 1VKCA 4F6AA 1KUXA 4UWJA 2YNCA 3FNCA 2ZW7A 2B5GA 1QSMA 3N7ZA 4II9A 1MJAA 1S5KA 1NSLA 1M1DA 2PC1A 1IIDA 4MFQA 3IGRA 4CYPA 5A27A 4R3KA 2IL4A 4KOVA 2HUZA 1IB1E 4FD7A 1XMTA 2FS5A 3PZJA 2HQYA 4MBUA 4XPDB 2QECA 4FD5A 4E2AA 4RS2A 4JXRA 4CAXA 4UCMA 4JD6A 5G21A 4ONUA 2FL4A 1R57A 1Q2CA 3G3SA 4AVAA 1YGHA 5DWNA 2DPTA 2K5TA 1FY7A 2D4PA 4ZBGA 4B13A 4OLLA 3JTKA 4L89A 2PR8A 4CAFA 4QVTA 1Q2DA 3S6FA 4B10A 4MI4A 4XPLA 4AB7A 2X7BA 4CGMA 4HKFA 4R87A 5KTAA 2Z3MA 3D3SA 3B8GA 4CAWA 2JEVA 1Z4EA 4UBRA 5JPHA 4YRHA 1M44A 2VZZA 1M4IA 2FXFA 4B12A 3PP9A 5G1ZA 4Q38A 2PR1A 4MFZA 4PV6A 5EC4A 3S6KA 2B3VA 1S7FA 3NE7A 2ZW6A 4A33A 5G22A 3RYOA 1RXTA 2Q7BA 5I0CA 1J4JA 2VQYA 2R7HA 4YFJA 4KSFA 4Y49B 2Y0MA 2QIRA 2YNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSO A;  5KTD A;  4AVB A;  3EC4 A;  4JJX A;  4AVC A;  2FT0 A;  4QC6 A;  4AG9 A;  1MK4 A;  2C27 A;  5CNP A;  3EO4 A;  4KVM E;  1UFH A;  3TOB A;  4KOY A;  2OZG A;  2G3T A;  2D4O A;  2FCK A;  4U5Y A;  2Z10 A;  1M4D A;  3D2M A;  1PUA A;  1YR0 A;  1L0C A;  1S60 A;  4OAD A;  3F8K A;  4XNH C;  1VHS A;  2FE7 A;  4R3L A;  2EVN A;  3BJ8 A;  4U9Y A;  4DNC A;  3WR7 A;  4E0A A;  3SHP A;  2R1I A;  3T90 A;  4JWP A;  5J8F A;  1SQH A;  2GIV A;  3E0K A;  2J8R A;  3EY5 A;  2PQ8 A;  4R57 A;  2OH1 A;  3D8P A;  2VZY A;  2REF A;  4H6U A;  5F48 A;  4J3G A;  5JQ4 A;  3P2H A;  3SXN A;  2Q4Y A;  1YK3 A;  2ZW5 A;  4KOT A;  1YVK A;  1KZF A;  5H84 A;  2NMT A;  3VWE A;  4L8A A;  2B5G B;  5FVJ A;  2O28 A;  5IB0 A;  4E8O A;  3W6S A;  3DR8 A;  3ZJ0 A;  1XIX A;  3TCV A;  4RI1 A;  2ZXV A;  2BL1 A;  2VEZ A;  2FSR A;  2H5M A;  1IIC A;  1KUY A;  4KLV A;  2CNT A;  2PSW A;  1CM0 A;  1N71 A;  5GCN A;  3QB8 A;  2QML A;  1PU9 A;  3D2P A;  4KVO E;  3BLN A;  5E96 A;  3VWD A;  3R9G A;  4NCZ A;  3TT2 A;  2KCW A;  2AJ6 A;  4QB9 A;  4M3S A;  1BO4 A;  1Z9U A;  4UA3 A;  4IUS A;  3W6X A;  3FRM A;  4CRY B;  1GHE A;  1S7N A;  4FD4 A;  4EVY A;  3F0A A;  3C26 A;  3GY9 A;  1M4G A;  2F5I A;  3LD2 A;  1B6B A;  5IX3 A;  2I00 A;  2Z11 A;  4MY0 A;  1Q2Y A;  3FXT A;  3MGD A;  1Y7R A;  4LX9 A;  4CS0 B;  1BOB A;  1YX0 A;  3PGP A;  1IYK A;  2VXK A;  2ATR A;  3FBU A;  3LOD A;  3TO6 A;  5F46 A;  4PK2 A;  2BSW A;  4B5P A;  3T9Y A;  3CXQ A;  4XPK A;  2Q04 A;  1P0H A;  5HH1 A;  5DWM A;  5ISV A;  1NE9 A;  1B87 A;  2VI7 A;  2ARH A;  4KOS A;  2P6G A;  1ON0 A;  2VBQ A;  4KVX A;  2RC4 A;  3JUW A;  2J8M A;  1S7K A;  4XPD C;  1KUV A;  3ZZI A;  2P6F A;  1WWZ A;  1YVO A;  3V8I A;  4KOW A;  4NXY A;  3TE4 A;  4H6Z A;  2WPW A;  3DDD A;  2B4D A;  1S7L A;  4KOX A;  1XEB A;  1OZP A;  4KUA A;  3CXP A;  2PRB A;  3G8W A;  1U6M A;  3EXN A;  1Z4R A;  2WPX A;  2OB0 A;  3S6H A;  3CXS A;  3EFA A;  5IV0 A;  3R96 A;  1V0C A;  3W91 A;  2CY2 A;  4R9M A;  4NEX A;  1NMT A;  2EUI A;  2B3U A;  3R9F A;  4JLY A;  2HV2 A;  4KOU A;  5C88 A;  1S3Z A;  3R9E A;  3R95 A;  4BMH A;  2G3A A;  3TO9 A;  1Y9K A;  4PK3 A;  5KTC A;  4MHD A;  5F47 A;  3FIX A;  3UY5 A;  3QAH A;  2P0W A;  4B5O A;  3IWG A;  3TO7 A;  4Y49 C;  2ZW4 A;  2OZH A;  2PDO A;  3FYN A;  1QSN A;  2JLM A;  4HNW B;  5F49 A;  4GS4 A;  1WK4 A;  4KUB A;  4QUS A;  2JDD A;  4NSQ A;  5C82 A;  3R1K A;  2I79 A;  2DXQ A;  1TIQ A;  2CNM A;  2Q4V A;  3I3G A;  2R8V A;  4XNH B;  3BJ7 A;  4F0Y A;  2Q0Y A;  2B58 A;  2FIW A;  3GKR A;  3KKW A;  2GE3 A;  3I9S A;  2FIA A;  4KOR A;  4OAE A;  3SXO A;  2R98 A;  4AG7 A;  3S6G A;  5HMN A;  4KZT A;  3DNS A;  4X5K A;  2Z0Z A;  4IF5 A;  2JDC A;  4JXQ A;  1K4J A;  2BUE A;  3DSB A;  1XE4 A;  3TOA A;  1P4N A;  3TFY A;  3OWC A;  3GYA A;  4PSW A;  1YRE A;  1LRZ A;  4LUA A;  2REE A;  4K30 A;  2GAN A;  2OU2 A;  5J8C A;  4U9Z A;  3TTH A;  2J8N A;  4ORF A;  1I21 A;  4H89 A;  2CNS A;  1QSR A;  3H4Q A;  4MY3 A;  4CAV A;  3DR6 A;  1YLE A;  4KLW A;  2P6E A;  1I1D A;  4CRZ B;  2A4N A;  2B4B A;  2ZPA A;  3K9U A;  4B5P B;  2OZU A;  4HNY B;  4I49 A;  1Y9W A;  2BEI A;  1CJW A;  5H86 A;  4NF1 A;  4UWI A;  1I12 A;  2Q44 A;  4FD6 A;  3F5B A;  5EBV A;  4HNX B;  2G0B A;  4YGO A;  1MJB A;  1XF8 A;  3P2F A;  4M85 A;  4PSX A;  1MJ9 A;  3JVN A;  1IYL A;  4QBJ A;  1QST A;  3FB3 A;  1RO5 A;  2B4D B;  4MJ8 A;  2AE6 A;  1VKC A;  4F6A A;  1KUX A;  4UWJ A;  3FNC A;  2ZW7 A;  2B5G A;  1QSM A;  3N7Z A;  4II9 A;  1MJA A;  1S5K A;  1NSL A;  1M1D A;  2PC1 A;  1IID A;  3IGR A;  4R3K A;  2IL4 A;  4KOV A;  2HUZ A;  1IB1 E;  4FD7 A;  1XMT A;  2FS5 A;  3PZJ A;  2HQY A;  4MBU A;  4XPD B;  2QEC A;  4FD5 A;  4E2A A;  4RS2 A;  4JXR A;  4CAX A;  4JD6 A;  4ONU A;  2FL4 A;  1R57 A;  1Q2C A;  3G3S A;  4AVA A;  1YGH A;  5DWN A;  2K5T A;  1FY7 A;  2D4P A;  4ZBG A;  4OLL A;  4L89 A;  2PR8 A;  4QVT A;  1Q2D A;  3S6F A;  4MI4 A;  4XPL A;  4AB7 A;  2X7B A;  4HKF A;  4R87 A;  5KTA A;  3D3S A;  3B8G A;  4CAW A;  2JEV A;  1Z4E A;  4UBR A;  5JPH A;  4YRH A;  1M44 A;  2VZZ A;  1M4I A;  2FXF A;  3PP9 A;  2PR1 A;  4PV6 A;  5EC4 A;  3S6K A;  2B3V A;  1S7F A;  3NE7 A;  2ZW6 A;  3RYO A;  1RXT A;  2Q7B A;  5I0C A;  1J4J A;  2VQY A;  2R7H A;  4YFJ A;  4Y49 B;  2Y0M A;  2QIR A; 
#chains in the Genus database with same CATH topology
 2CTB A;  1QSO A;  5KTD A;  4AVB A;  4A32 A;  1LAN A;  3EC4 A;  4UEF A;  1Z5R A;  4JJX A;  3B3S A;  4OME A;  4AVC A;  2FT0 A;  4CYQ A;  4PQA A;  3DGV A;  4QC6 A;  2XEI A;  4AG9 A;  5LYF A;  1MK4 A;  2C27 A;  2Z3O A;  5CNP A;  3S9L A;  4X3R A;  5HVF A;  3EO4 A;  4RN7 A;  4KVM E;  4FUU A;  1Y7E A;  1UFH A;  3B3C A;  3TOB A;  3PFO A;  2PE3 A;  3B7I A;  4KOY A;  2OZG A;  3NFZ A;  1XOV A;  3RAM A;  2G3T A;  3MN8 A;  4PXD A;  1IY7 A;  2D4O A;  4P44 A;  2FCK A;  2YGW A;  2JEW A;  1EE3 P;  4U5Y A;  2Z10 A;  2ZEP A;  2Z3N A;  4LQG A;  1M4D A;  1XFO A;  2V77 A;  3D2M A;  4JZ0 A;  1PUA A;  1YR0 A;  5CBM A;  3K2K A;  1L0C A;  2AFM A;  1S60 A;  4MFL A;  3F8K A;  2QVP A;  3I1U A;  4OAD A;  4UEE A;  4XNH C;  5LRK A;  1VHS A;  4R7M A;  2FE7 A;  4R3L A;  2PJ9 A;  2EVN A;  1Q7L A;  3B3W A;  2PJ2 A;  4P45 A;  4EFD A;  3BJ8 A;  3V7Z A;  4U9Y A;  4DNC A;  3WR7 A;  1IGB A;  2C6P A;  4E0A A;  5I4M A;  2ZEF A;  3SHP A;  1UWY A;  3B3T A;  1Z2L A;  1TF8 A;  2R1I A;  7CPA A;  3T90 A;  4JWP A;  4UEZ A;  5J8F A;  1SQH A;  2GIV A;  1LCP A;  3E0K A;  5D29 A;  2J8R A;  2PJC A;  3EY5 A;  2PJ1 A;  2PQ8 A;  4R57 A;  2OH1 A;  3D8P A;  3KAS A;  2VZY A;  3BI1 A;  3KL9 A;  3N5F A;  4F9U A;  2REF A;  4H6U A;  5F48 A;  4J3G A;  2WUU A;  5JQ4 A;  3P2H A;  4NFR A;  2GFQ A;  3SXN A;  4JYW A;  2G9D A;  5JGF A;  2Q4Y A;  3H5Z A;  5JH9 A;  3PB9 X;  4P6Y A;  1ZLI A;  5HVH A;  1YK3 A;  2ZW5 A;  4KOT A;  1YVK A;  3GLJ A;  4CYN A;  1KZF A;  5H84 A;  1GYT A;  4OC1 A;  2NMT A;  2Z3K A;  2PJA A;  4ZYQ A;  3IO1 A;  5LYD A;  3ISZ A;  3S9M A;  2GRE A;  2ABZ A;  3VWE A;  1ZG7 A;  2GLJ A;  2B5G B;  2ZEE A;  4L8A A;  4P4D A;  3GUX A;  4TNU A;  4X8I A;  2PRQ A;  1QMU A;  2O28 A;  5FVJ A;  4C2X A;  4E8O A;  5IB0 A;  5LYL A;  3W6S A;  4FWU A;  5LYI A;  5AG4 A;  3DR8 A;  2DPS A;  3PRT A;  5THW A;  3ZJ0 A;  1XIX A;  5AG7 A;  3TCV A;  3H8E A;  4RI1 A;  2ZXV A;  4CGP A;  1LFW A;  2BL1 A;  2AFS A;  2FVG A;  2VEZ A;  4P4F A;  1TKJ A;  3SI0 A;  2FSR A;  2H5M A;  2IMO A;  3IU2 A;  1IIC A;  1ARL A;  1KUY A;  4KLV A;  2CNT A;  4ZX9 A;  4NJR A;  2PSW A;  2XEF A;  2ZEN A;  1AYE A;  1CM0 A;  1N71 A;  2V8D A;  4K3N A;  5GCN A;  3QB8 A;  4A94 A;  2PVV A;  4O23 A;  1DE4 C;  2QML A;  1PU9 A;  3IIB A;  4NGT A;  4CAE A;  3D2P A;  4MFK A;  1TF9 A;  1Z8L A;  4KVO E;  3KZW A;  2ZEH A;  3BLN A;  5E96 A;  3VWD A;  3R9G A;  4NCZ A;  3KGQ A;  5G20 A;  3TT2 A;  1TXR A;  2ZOG A;  3RNZ A;  2KCW A;  2AJ6 A;  4QB9 A;  1HDQ A;  4M3S A;  5K8M A;  1IOF A;  1BO4 A;  4F0X A;  1Z9U A;  4UA3 A;  2QJ8 A;  4IUS A;  3W6X A;  2WSA A;  3CZX A;  8CPA A;  3FRM A;  4CRY B;  4IAV A;  1GHE A;  1H8L A;  1BPN A;  4BIN A;  1S7N A;  2ZEG A;  3B35 A;  4KSI A;  4IHM A;  3BXM A;  4MFJ A;  4UCN A;  4FD4 A;  3KR5 A;  4LQ6 A;  4C7I A;  4EVY A;  3F0A A;  3C26 A;  3GY9 A;  3HUV A;  5A28 A;  1CBX A;  1TKH A;  1M4G A;  2WYR A;  2HB6 A;  2F5I A;  3SJG A;  3LD2 A;  1B6B A;  3LAC A;  5K8N A;  2GU2 A;  4NGS A;  2EBJ A;  3B2Y A;  5IX3 A;  2I00 A;  2Z11 A;  3IWE A;  4MY0 A;  3KHZ A;  3TC8 A;  1Q2Y A;  2CF4 A;  3FXT A;  1Y7R A;  3MGD A;  4LX9 A;  4B11 A;  1KWM A;  2PJ7 A;  1VHO A;  1BOB A;  1YX0 A;  4CS0 B;  1AUG A;  3PGP A;  1IYK A;  2VXK A;  2ATR A;  3FBU A;  3LOD A;  4UIA A;  3TO6 A;  5F46 A;  4PK2 A;  2BSW A;  2GLF A;  4B5P A;  3T9Y A;  3CXQ A;  4BBH A;  2AFX A;  2Q7S A;  2POK A;  2J9A A;  2C1C A;  4R76 A;  2Q04 A;  1P0H A;  4OIW A;  4XPK A;  5HH1 A;  4H2K A;  2F7V A;  1LOK A;  3T8W A;  5DWM A;  2VL1 A;  1NE9 A;  1B87 A;  2VI7 A;  5ISV A;  5K8P A;  1XMB A;  2JBK A;  2ARH A;  4KOS A;  2P6G A;  5F09 A;  1ON0 A;  2VBQ A;  2CIJ A;  4KVX A;  1CP6 A;  3NE8 A;  5BWA B;  2RC4 A;  2CTC A;  2RB7 A;  3FEC A;  3JUW A;  4A95 A;  2J8M A;  1S7K A;  2IQ6 A;  4XPD C;  3NH5 A;  4UIB A;  1KUV A;  3ZZI A;  2P6F A;  1WWZ A;  1YVO A;  1ZO0 A;  3FED A;  4P4I A;  3V8I A;  4KOW A;  4NXY A;  3TE4 A;  4W9Y A;  4H6Z A;  2WPW A;  3GIU A;  6CPA A;  3DDD A;  5LRG A;  2B4D A;  4KS9 A;  1PYT B;  1XRY A;  3D4U A;  1S7L A;  3FX6 A;  3L2N A;  4KOX A;  2IJZ A;  1XEB A;  1OZP A;  3RO0 A;  4KUA A;  3CXP A;  1BPM A;  3RZA A;  4C68 A;  3LWU A;  2PRB A;  3FJU A;  2BO9 A;  3CPA A;  3G8W A;  1NSA A;  1U6M A;  3EXN A;  3A9L A;  3KHX A;  4MXU A;  5CPA A;  1Z4R A;  3TX8 A;  2WPX A;  4UCP A;  4WJB A;  3WT4 A;  3D67 A;  3SJE A;  1YW4 A;  2OB0 A;  3S6H A;  2PJ3 A;  4FAI A;  4F9V A;  3CXS A;  3EFA A;  5IV0 A;  3R96 A;  1V0C A;  3KI9 A;  3KQZ A;  3W91 A;  2CY2 A;  4R9M A;  4NEX A;  2PVW A;  1NMT A;  2EUI A;  2B3U A;  1Z8W A;  3R9F A;  4JLY A;  3FMC A;  4PXC A;  4NGP A;  3PB6 X;  4ZGY B;  2HV2 A;  4KOU A;  2XEJ A;  5C88 A;  1S3Z A;  3R9E A;  4OC2 A;  3PEI A;  3DLJ A;  3R95 A;  3D7H A;  4BMH A;  2G3A A;  4HPS A;  4NGQ A;  3TO9 A;  5D8N A;  1Y9K A;  1XJO A;  4PK3 A;  4R6T A;  2PIZ A;  5KTC A;  4MHD A;  1VIX A;  5F47 A;  3FIX A;  1YW6 A;  4P4E A;  3UY5 A;  3RBU A;  4KSA A;  3QAH A;  2ZOF A;  1PCA A;  2P0W A;  3IWG A;  4B5O A;  1JQG A;  2PJ8 A;  3TO7 A;  1ZLH A;  4Y49 C;  4YWY A;  2ZW4 A;  2OZH A;  2PDO A;  3CPX A;  3FYN A;  4G1P A;  4C7H A;  4CGN A;  4A30 A;  1QSN A;  2JLM A;  4ZY0 A;  4ZY1 A;  2EWB A;  3LMS A;  2Z3L A;  4HNW B;  5F49 A;  4GS4 A;  1WK4 A;  4KUB A;  4QUS A;  2JDD A;  3VAR A;  3NA6 A;  4NSQ A;  5C82 A;  5AG5 A;  3R1K A;  4NGR A;  2I79 A;  4WWV A;  5AG6 A;  1BAV A;  1Z8X A;  2DXQ A;  1ZG9 A;  4X2T A;  1TIQ A;  2CNM A;  2Q4V A;  3I3G A;  2R8V A;  4XNH B;  4CGO A;  3BJ7 A;  4F0Y A;  2Q0Y A;  3K9T A;  2HC9 A;  1HDU A;  2B58 A;  3PB7 X;  3PFE A;  4PPZ A;  3WC6 A;  2FIW A;  4OC4 A;  1YLO A;  2Z3P A;  1CX8 A;  3GKR A;  4GXH A;  5LRJ A;  4EWT A;  2PJ5 A;  2NYQ A;  2DF5 A;  2XEG A;  1LAP A;  2RFH A;  3KKW A;  1OBR A;  4P4B A;  2GE3 A;  3CT9 A;  3I9S A;  2FIA A;  4KOR A;  4MHP A;  2PJB A;  4OAE A;  3SXO A;  2DEA A;  2R98 A;  4AG7 A;  3S6G A;  4Z65 A;  5HMN A;  4M6I A;  4OP4 A;  1LAM A;  4KZT A;  2V8V A;  4B14 A;  2YNE A;  1X12 A;  2EK8 A;  3IEH A;  3DNS A;  4A38 A;  4X5K A;  3IC1 A;  2Z0Z A;  4Q36 A;  5IB9 A;  4IF5 A;  2JDC A;  4JXQ A;  2BCO A;  2ANP A;  2PCU A;  4CYO A;  1K4J A;  5AGE A;  2BUE A;  3DSB A;  4NJQ A;  5HXD A;  3BI0 A;  1XE4 A;  3H8F A;  3S9N A;  1F2O A;  1ZG8 A;  3PB4 X;  3GB0 A;  3TOA A;  2O4H A;  4MRI A;  1P4N A;  3SI1 A;  3TFY A;  3OWC A;  3D66 A;  3GYA A;  4CGL A;  4PSW A;  1YRE A;  1LRZ A;  1YSJ A;  4NGM A;  3QNV A;  3D7F A;  4LUA A;  1F57 A;  2REE A;  4BD9 A;  1FT7 A;  1VGY A;  4F8Z A;  4A31 A;  4DJL A;  4K30 A;  3SJX A;  3WC7 A;  1R3N A;  2GAN A;  3PBB A;  2OU2 A;  5J8C A;  4U9Z A;  3CDX A;  3TTH A;  2J8N A;  4ORF A;  1I21 A;  3FEE A;  4Q7A A;  2PJ4 A;  1CPX A;  3PB8 X;  4H89 A;  4MCR A;  2F8H A;  2CNS A;  1QSR A;  3H4Q A;  4MY3 A;  4CAV A;  4UFX A;  3D7D A;  3DR6 A;  2YNC C;  1RTQ A;  1YLE A;  4A39 A;  4KLW A;  3MRU A;  1FNO A;  2P6E A;  2WZN A;  1I1D A;  3V38 A;  3FH4 A;  4CRZ B;  2A4N A;  2B4B A;  2ZPA A;  3FF3 A;  3IWW A;  3K9U A;  2OZU A;  4B5P B;  4P10 A;  4HNY B;  1Y0Y A;  1BLL E;  4C2Z A;  4I49 A;  2CXA A;  1Y9W A;  4ZX8 A;  2BEI A;  1CJW A;  4OC0 A;  5H86 A;  4NF1 A;  4UWI A;  2AFW A;  1I12 A;  1IOI A;  2QYV A;  2Q44 A;  4UFW A;  3WC5 A;  4FD6 A;  2AFO A;  3KR4 A;  4A2Z A;  4MFP A;  3F5B A;  5EBV A;  4HNX B;  2G0B A;  3SJF A;  4YGO A;  1MJB A;  3KQX A;  1AMP A;  1XF8 A;  3NH4 A;  2O53 A;  3P2F A;  4M85 A;  4PSX A;  1MJ9 A;  3D7G A;  3JVN A;  1IYL A;  4QBJ A;  1QST A;  2ODF A;  3IU1 A;  3IJ3 A;  4UFV A;  3FB3 A;  2PJ6 A;  4CPA A;  4C2Y A;  1YME A;  1RO5 A;  2B4D B;  4MJ8 A;  2OR4 A;  2EO8 A;  3H8G A;  2AE6 A;  1VKC A;  4F6A A;  2C6G A;  1KUX A;  4UWJ A;  5ELY A;  1JWQ A;  1XBU A;  4DYO A;  2YNC A;  3FNC A;  2ZW7 A;  5JM6 A;  2B5G A;  4R8F A;  4MCP A;  1QSM A;  2ZEL A;  5EMI A;  3N7Z A;  4ZI6 A;  4II9 A;  1MJA A;  1R43 A;  3VAT A;  1CPS A;  4IK2 A;  4TWE A;  3FVL A;  1S5K A;  4M6G A;  2NSM A;  2JBJ A;  4MHY A;  5DS0 A;  1NSL A;  1M1D A;  1ARM A;  2PC1 A;  1IID A;  4MFQ A;  4P4J A;  2Q4Z A;  4NGN A;  3IGR A;  2V8G A;  4CYP A;  4ONW A;  1ELM P;  4EME A;  5A27 A;  1YQE A;  4R3K A;  2IL4 A;  4KOV A;  2HUZ A;  1IB1 E;  3BHX A;  3D68 A;  2YND A;  4FD7 A;  3WAB A;  1XMT A;  2FS5 A;  1TKF A;  3PZJ A;  2HQY A;  4MBU A;  1CP7 A;  4XPD B;  5HVG A;  2QEC A;  4FD5 A;  4E2A A;  4PXB A;  1Z8T A;  4RS2 A;  4JXR A;  4OKO A;  4CAX A;  4UCM A;  5K8O A;  4JD6 A;  4MMO A;  5G21 A;  3HLP A;  1Y0R A;  4A37 A;  2PIY A;  2FL4 A;  4ONU A;  3NH8 A;  1R57 A;  1Q2C A;  1HEE A;  1VHE A;  2PJ0 A;  3G3S A;  4AVA A;  1YGH A;  3VH9 A;  4OID A;  5DWN A;  2DPT A;  2K5T A;  1CG2 A;  4DUK A;  1FY7 A;  2D4P A;  4AXV A;  4ZBG A;  4B13 A;  4MCS A;  4OLL A;  4OC3 A;  4FBE A;  1F2P A;  3JTK A;  2PR8 A;  4L89 A;  4CAF A;  4QVT A;  2ZEM A;  1Q2D A;  3S6F A;  4B10 A;  2AFZ A;  4MI4 A;  4XPL A;  4AB7 A;  2X7B A;  1X10 A;  4CGM A;  4HKF A;  1M4L A;  3ISX A;  4R87 A;  4M6H A;  5KTA A;  5J1Q A;  2Z3M A;  3D3S A;  3B8G A;  4CAW A;  1QQ9 A;  2JEV A;  2Q51 A;  4MHZ A;  1ELL P;  1Z4E A;  3SI2 A;  2ZEO A;  2AFU A;  4UBR A;  5JPH A;  2ZED A;  2BOA A;  4YRH A;  3PBE A;  1M44 A;  2VZZ A;  1M4I A;  4B6Z A;  2FXF A;  4ZY2 A;  4B12 A;  3PP9 A;  5G1Z A;  4Q38 A;  2PR1 A;  4MFZ A;  4PV6 A;  4OC5 A;  5EC4 A;  2EK9 A;  4UF4 A;  3S6K A;  2B3V A;  3JRU A;  1S7F A;  2C6C A;  2ZW6 A;  3IFE A;  3NE7 A;  4GM5 A;  4A33 A;  5G22 A;  3RYO A;  1RXT A;  2Q7B A;  2OOT A;  5I0C A;  1J4J A;  2VQY A;  1IU8 A;  2Q43 A;  2V8H A;  2R7H A;  4YFJ A;  1DTD A;  4PXE A;  4KSF A;  4MHN A;  4Y49 B;  4YU9 A;  2Y0M A;  2QIR A;  3QAY A;  3B3V A;  2I3C A;  4MCQ A;  4RUH A;  1A2Z A; 
#chains in the Genus database with same CATH homology
 1QSO A;  5KTD A;  4AVB A;  4A32 A;  3EC4 A;  4JJX A;  4AVC A;  2FT0 A;  4CYQ A;  4QC6 A;  4AG9 A;  1MK4 A;  2C27 A;  2Z3O A;  5CNP A;  3EO4 A;  4KVM E;  1UFH A;  3TOB A;  4KOY A;  2OZG A;  2G3T A;  2D4O A;  2FCK A;  2YGW A;  4U5Y A;  2Z10 A;  2Z3N A;  1M4D A;  3D2M A;  1PUA A;  1YR0 A;  1L0C A;  1S60 A;  4MFL A;  3F8K A;  4OAD A;  4XNH C;  1VHS A;  2FE7 A;  4R3L A;  2EVN A;  3BJ8 A;  4U9Y A;  4DNC A;  3WR7 A;  4E0A A;  3SHP A;  2R1I A;  3T90 A;  4JWP A;  5J8F A;  1SQH A;  2GIV A;  3E0K A;  2J8R A;  3EY5 A;  2PQ8 A;  4R57 A;  2OH1 A;  3D8P A;  2VZY A;  2REF A;  4H6U A;  5F48 A;  4J3G A;  2WUU A;  5JQ4 A;  3P2H A;  3SXN A;  2Q4Y A;  3H5Z A;  1YK3 A;  2ZW5 A;  4KOT A;  1YVK A;  4CYN A;  1KZF A;  5H84 A;  2NMT A;  2Z3K A;  3VWE A;  4L8A A;  2B5G B;  5FVJ A;  2O28 A;  4C2X A;  5IB0 A;  4E8O A;  3W6S A;  5AG4 A;  3DR8 A;  2DPS A;  3ZJ0 A;  1XIX A;  5AG7 A;  3TCV A;  4RI1 A;  4CGP A;  2ZXV A;  2BL1 A;  2VEZ A;  2FSR A;  2H5M A;  3IU2 A;  1IIC A;  1KUY A;  4KLV A;  2CNT A;  2PSW A;  1CM0 A;  1N71 A;  5GCN A;  3QB8 A;  2QML A;  1PU9 A;  4CAE A;  3D2P A;  4MFK A;  4KVO E;  3BLN A;  5E96 A;  3VWD A;  3R9G A;  4NCZ A;  5G20 A;  3TT2 A;  2KCW A;  2AJ6 A;  4QB9 A;  4M3S A;  1BO4 A;  4F0X A;  1Z9U A;  4UA3 A;  4IUS A;  3W6X A;  2WSA A;  3FRM A;  4CRY B;  1GHE A;  1S7N A;  4MFJ A;  4UCN A;  4FD4 A;  4C7I A;  4EVY A;  3F0A A;  3C26 A;  3GY9 A;  5A28 A;  1M4G A;  2F5I A;  3LD2 A;  1B6B A;  5IX3 A;  2I00 A;  2Z11 A;  3IWE A;  4MY0 A;  1Q2Y A;  3FXT A;  3MGD A;  1Y7R A;  4LX9 A;  4B11 A;  4CS0 B;  1BOB A;  1YX0 A;  3PGP A;  1IYK A;  2VXK A;  2ATR A;  3FBU A;  3LOD A;  3TO6 A;  5F46 A;  4PK2 A;  2BSW A;  4B5P A;  3T9Y A;  3CXQ A;  4BBH A;  4XPK A;  2Q04 A;  1P0H A;  5HH1 A;  5DWM A;  5ISV A;  1NE9 A;  1B87 A;  2VI7 A;  2ARH A;  4KOS A;  2P6G A;  1ON0 A;  2VBQ A;  4KVX A;  5BWA B;  2RC4 A;  3JUW A;  4A95 A;  2J8M A;  1S7K A;  4XPD C;  1KUV A;  3ZZI A;  2P6F A;  1WWZ A;  1YVO A;  1ZO0 A;  3V8I A;  4KOW A;  4NXY A;  3TE4 A;  4H6Z A;  2WPW A;  3DDD A;  2B4D A;  4KS9 A;  1S7L A;  4KOX A;  1XEB A;  1OZP A;  4KUA A;  3CXP A;  4C68 A;  2PRB A;  3G8W A;  1U6M A;  3EXN A;  3A9L A;  1Z4R A;  2WPX A;  4UCP A;  2OB0 A;  3S6H A;  3CXS A;  3EFA A;  5IV0 A;  3R96 A;  1V0C A;  3W91 A;  2CY2 A;  4R9M A;  4NEX A;  1NMT A;  2EUI A;  2B3U A;  3R9F A;  4JLY A;  4ZGY B;  2HV2 A;  4KOU A;  5C88 A;  1S3Z A;  3R9E A;  3R95 A;  4BMH A;  2G3A A;  3TO9 A;  1Y9K A;  4PK3 A;  5KTC A;  4MHD A;  5F47 A;  3FIX A;  3UY5 A;  4KSA A;  3QAH A;  2P0W A;  4B5O A;  3IWG A;  3TO7 A;  4Y49 C;  2ZW4 A;  2OZH A;  2PDO A;  3FYN A;  4C7H A;  4CGN A;  4A30 A;  1QSN A;  2JLM A;  2Z3L A;  4HNW B;  5F49 A;  4GS4 A;  1WK4 A;  4KUB A;  4QUS A;  2JDD A;  4NSQ A;  5C82 A;  5AG5 A;  3R1K A;  2I79 A;  5AG6 A;  2DXQ A;  1TIQ A;  2CNM A;  2Q4V A;  3I3G A;  2R8V A;  4XNH B;  4CGO A;  3BJ7 A;  4F0Y A;  2Q0Y A;  2B58 A;  2FIW A;  2Z3P A;  3GKR A;  3KKW A;  2GE3 A;  3I9S A;  2FIA A;  4KOR A;  4OAE A;  3SXO A;  2R98 A;  4AG7 A;  3S6G A;  5HMN A;  4KZT A;  4B14 A;  2YNE A;  3DNS A;  4X5K A;  2Z0Z A;  4Q36 A;  4IF5 A;  2JDC A;  4JXQ A;  4CYO A;  1K4J A;  5AGE A;  2BUE A;  3DSB A;  1XE4 A;  3TOA A;  1P4N A;  3TFY A;  3OWC A;  3GYA A;  4CGL A;  4PSW A;  1YRE A;  1LRZ A;  4LUA A;  2REE A;  4A31 A;  4K30 A;  2GAN A;  2OU2 A;  5J8C A;  4U9Z A;  3TTH A;  2J8N A;  4ORF A;  1I21 A;  4H89 A;  2CNS A;  1QSR A;  3H4Q A;  4MY3 A;  4CAV A;  4UFX A;  3DR6 A;  2YNC C;  1YLE A;  4KLW A;  2P6E A;  1I1D A;  4CRZ B;  2A4N A;  2B4B A;  2ZPA A;  3K9U A;  4B5P B;  2OZU A;  4HNY B;  4C2Z A;  4I49 A;  2CXA A;  1Y9W A;  2BEI A;  1CJW A;  5H86 A;  4NF1 A;  4UWI A;  1I12 A;  4UFW A;  2Q44 A;  4FD6 A;  4A2Z A;  4MFP A;  3F5B A;  5EBV A;  4HNX B;  2G0B A;  4YGO A;  1MJB A;  1XF8 A;  3P2F A;  4M85 A;  4PSX A;  1MJ9 A;  3JVN A;  1IYL A;  4QBJ A;  1QST A;  3IU1 A;  4UFV A;  3FB3 A;  4C2Y A;  1RO5 A;  2B4D B;  4MJ8 A;  2AE6 A;  1VKC A;  4F6A A;  1KUX A;  4UWJ A;  2YNC A;  3FNC A;  2ZW7 A;  2B5G A;  1QSM A;  3N7Z A;  4II9 A;  1MJA A;  1S5K A;  1NSL A;  1M1D A;  2PC1 A;  1IID A;  4MFQ A;  3IGR A;  4CYP A;  5A27 A;  4R3K A;  2IL4 A;  4KOV A;  2HUZ A;  1IB1 E;  4FD7 A;  1XMT A;  2FS5 A;  3PZJ A;  2HQY A;  4MBU A;  4XPD B;  2QEC A;  4FD5 A;  4E2A A;  4RS2 A;  4JXR A;  4CAX A;  4UCM A;  4JD6 A;  5G21 A;  4ONU A;  2FL4 A;  1R57 A;  1Q2C A;  3G3S A;  4AVA A;  1YGH A;  5DWN A;  2DPT A;  2K5T A;  1FY7 A;  2D4P A;  4ZBG A;  4B13 A;  4OLL A;  3JTK A;  4L89 A;  2PR8 A;  4CAF A;  4QVT A;  1Q2D A;  3S6F A;  4B10 A;  4MI4 A;  4XPL A;  4AB7 A;  2X7B A;  4CGM A;  4HKF A;  4R87 A;  5KTA A;  2Z3M A;  3D3S A;  3B8G A;  4CAW A;  2JEV A;  1Z4E A;  4UBR A;  5JPH A;  4YRH A;  1M44 A;  2VZZ A;  1M4I A;  2FXF A;  4B12 A;  3PP9 A;  5G1Z A;  4Q38 A;  2PR1 A;  4MFZ A;  4PV6 A;  5EC4 A;  3S6K A;  2B3V A;  1S7F A;  3NE7 A;  2ZW6 A;  4A33 A;  5G22 A;  3RYO A;  1RXT A;  2Q7B A;  5I0C A;  1J4J A;  2VQY A;  2R7H A;  4YFJ A;  4KSF A;  4Y49 B;  2Y0M A;  2QIR A;  2YND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...