2G3TA

Crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
169
structure length
169
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3tA00
5F48A 1KUYA 1GHEA 2FSRA 1IICA 4FD6A 4KUBA 2B4BA 2ZW7A 1KZFA 3D3SA 4YFJA 2VZYA 4JJXA 4R87A 1B6BA 4NCZA 4Y49B 3DR8A 4NEXA 3JUWA 2Q7BA 4ONUA 2D4PA 4KOWA 2EVNA 3SXOA 1YX0A 4BMHA 2ZW6A 4KOTA 2Q4YA 4PV6A 4MY3A 5DWMA 1P0HA 1YR0A 1QSRA 1XMTA 4B5OA 5C88A 2FE7A 2B5GB 3CXPA 3JVNA 2Z0ZA 4L8AA 5HMNA 2Z10A 4XNHC 4KVXA 1TIQA 3N7ZA 1SQHA 3S6HA 2B58A 2PR1A 3NE7A 2NMTA 3SXNA 2VQYA 1KUXA 3P2FA 4B5PA 2WPXA 4LUAA 3EFAA 1V0CA 4K30A 4MY0A 1YVKA 2FCKA 2FT0A 4QB9A 4QBJA 5J8FA 3V8IA 1S60A 1MJBA 3VWDA 2BEIA 4ORFA 3ZZIA 4FD5A 3TOAA 3S6GA 2K5TA 4MHDA 3MGDA 4PSWA 4OAEA 4QC6A 1MK4A 4MI4A 4JLYA 1YREA 4CAWA 4HNYB 1MJ9A 2PDOA 3TOBA 4LX9A 2GANA 4R3LA 4XPDB 3TO7A 1MJAA 4HKFA 3FRMA 2Y0MA 4UWIA 2PR8A 1XIXA 2R8VA 2Q04A 3F0AA 3TTHA 4NSQA 3P2HA 2J8NA 1U6MA 2I79A 1P4NA 5E96A 3EY5A 2KCWA 1S5KA 3S6FA 5C82A 4HNXB 5I0CA 3W6SA 3CXSA 4JXRA 1IB1E 1ON0A 2CNTA 3FNCA 2DXQA 1WWZA 2VXKA 4KOVA 4AVAA 4MJ8A 2VZZA 3QB8A 3I3GA 1XE4A 1CM0A 2P6EA 5ISVA 1K4JA 1RO5A 5EBVA 2J8RA 4FD7A 2ATRA 4H89A 4CS0B 3WR7A 3G8WA 2OB0A 4H6UA 1QSOA 2WPWA 4KUAA 4E2AA 2P6GA 1QSNA 2A4NA 1Q2YA 3D2PA 4Y49C 4F0YA 1UFHA 4NF1A 4KOYA 1VKCA 4B5PB 1S7FA 3GY9A 2X7BA 4JXQA 1YK3A 3G3SA 1BO4A 1PUAA 4OLLA 2B4DA 2VEZA 1KUVA 3FXTA 5CNPA 4E8OA 5J8CA 1M4IA 3CXQA 2GIVA 4EVYA 4UA3A 2QIRA 1I12A 2PSWA 3PP9A 2B3VA 2PRBA 5DWNA 2REEA 3R9GA 5FVJA 3BJ7A 3PGPA 3D8PA 3T9YA 5JQ4A 1J4JA 4CAVA 5IV0A 2QMLA 3FB3A 4QVTA 1Z9UA 4I49A 4E0AA 4J3GA 4KOXA 3TT2A 2OZHA 2CY2A 4PK3A 3DNSA 2R7HA 1I1DA 2IL4A 5F49A 1NMTA 4M3SA 3EC4A 3R1KA 2B3UA 3S6KA 1Z4EA 4UBRA 2FS5A 3F5BA 4GS4A 5IB0A 4KLVA 2OZUA 3TE4A 1WK4A 2R1IA 3QAHA 1Z4RA 2OZGA 1BOBA 5H86A 1FY7A 2F5IA 2VI7A 3D2MA 4PK2A 3FYNA 1Y9KA 3LODA 2D4OA 2AE6A 2GE3A 3BLNA 1Y7RA 2G3AA 1OZPA 4CAXA 3KKWA 4CRZB 1PU9A 3T90A 2JDCA 4R57A 4RI1A 3H4QA 3W6XA 1M44A 2EUIA 4KZTA 2Q4VA 1M1DA 3C26A 4AVBA 1B87A 2REFA 3TO9A 1NSLA 4DNCA 2ZXVA 4R3KA 4RS2A 1QSTA 4KORA 1S7NA 3ZJ0A 1IYLA 2OU2A 5KTCA 3BJ8A 4JWPA 2FIWA 2JDDA 3UY5A 3RYOA 4KOUA 2PC1A 3IWGA 2BL1A 2P6FA 4AVCA 4M85A 3LD2A 4AG9A 4KVME 3OWCA 2HV2A 3I9SA 1QSMA 3R9EA 2ZW4A 4U5YA 2ZW5A 3TCVA 1Q2DA 3R96A 1S7KA 5JPHA 1Q2CA 1CJWA 3FIXA 3TFYA 4X5KA 1VHSA 2J8MA 1NE9A 2G0BA 2ARHA 5F47A 3DSBA 4AB7A 1IYKA 1XEBA 3DDDA 2VBQA 2FXFA 1YGHA 1YVOA 3PZJA 1IIDA 2Q44A 4KLWA 1S3ZA 3R95A 4XNHB 4U9YA 2Z11A 1N71A 3GKRA 2H5MA 2R98A 5F46A 4JD6A 5GCNA 3K9UA 3IGRA 2FIAA 2P0WA 3VWEA 5KTDA 2B5GA 4KVOE 5IX3A 5KTAA 3E0KA 3FBUA 2JLMA 4XPKA 4QUSA 4R9MA 2CNSA 2BUEA 3DR6A 2BSWA 4OADA 4XPDC 4AG7A 5EC4A 2C27A 1LRZA 1I21A 4ZBGA 2OH1A 4CRYB 2G3TA 4FD4A 3TO6A 4HNWB 4MBUA 1S7LA 4YGOA 4L89A 1M4DA 2Q0YA 2RC4A 4KOSA 1L0CA 4II9A 3R9FA 4NXYA 2HQYA 4U9ZA 1YLEA 2AJ6A 1R57A 4XPLA 3F8KA 4PSXA 1RXTA 3B8GA 3SHPA 2PQ8A 4F6AA 4H6ZA 1XF8A 3GYAA 4UWJA 3EO4A 5H84A 4YRHA 3W91A 2QECA 4IF5A 4IUSA 2JEVA 5HH1A 2B4DB 2O28A 3EXNA 1Y9WA 2I00A 2ZPAA 1M4GA 2FL4A 2CNMA 2HUZA
chains in the Genus database with same CATH superfamily
5CBMA 5F48A 4OKOA 2YNDA 1KUYA 1GHEA 3HUVA 2FSRA 1IICA 3B3SA 4FD6A 4KUBA 1F57A 2B4BA 2PJBA 2PJ3A 2PJ1A 2ZW7A 1Q7LA 4JZ0A 3S9NA 1KZFA 1XFOA 3D3SA 4YFJA 3H5ZA 2VZYA 4JJXA 4R87A 4ZX8A 1B6BA 5J1QA 5D29A 4NCZA 4Y49B 3DR8A 3IU2A 4NEXA 3JUWA 2XEGA 2Q7BA 4AXVA 1DTDA 4ONUA 2D4PA 3FECA 4KOWA 2OR4A 2EVNA 4FWUA 3SXOA 2CTCA 1YX0A 2PJCA 3FEDA 4BMHA 4DYOA 2BO9A 2C6GA 1F2PA 2ZW6A 3PEIA 4KOTA 2Q4YA 4UCNA 4PV6A 4CYQA 2RFHA 2ZEGA 4MY3A 1P0HA 1HEEA 4PXBA 5DWMA 4EFDA 4ZGYB 4CGNA 1YR0A 2DEAA 1QSRA 1XMTA 4P44A 4B5OA 4C68A 3D7DA 5C88A 2FE7A 2B5GB 3CXPA 3JVNA 3LACA 4R8FA 2Z0ZA 1ELLP 4L8AA 5HMNA 2Z10A 4XNHC 2PJ7A 3PB6X 2Q7SA 2YNEA 4KVXA 4P45A 5HVHA 4YWYA 4B11A 4OC1A 1TIQA 2QJ8A 4UEFA 3N7ZA 1SQHA 1ARMA 4UCMA 2B58A 3S6HA 2PR1A 2Q43A 3NE7A 4NJQA 2NMTA 4GXHA 4MHNA 3SXNA 2VQYA 2YNCC 1KUXA 3P2FA 4MCSA 3S9LA 4B5PA 2WPXA 4LUAA 5AG5A 4R76A 3EFAA 1V0CA 3WC6A 4K30A 4MY0A 4PXCA 1YVKA 2FCKA 2FT0A 2Q51A 4QB9A 4QBJA 2DF5A 5J8FA 2JBJA 3CPXA 2PRQA 5EMIA 3GIUA 3V8IA 5IB9A 1S60A 3BHXA 1MJBA 5HVFA 3VWDA 2BEIA 4K3NA 4DJLA 4FBEA 4ORFA 4MHPA 2BOAA 3KGQA 4FD5A 3RZAA 3S6GA 4UFVA 3TOAA 3ZZIA 4P4EA 2K5TA 2RB7A 3B2YA 4MHDA 4ZY2A 3MGDA 4PSWA 4OAEA 2Z3LA 3KR4A 4QC6A 1MK4A 4MI4A 4JLYA 1YREA 2V8VA 4CAWA 4HNYB 1MJ9A 1BAVA 1TXRA 4MHZA 2PDOA 4Q7AA 3TOBA 3V38A 5JM6A 4FAIA 4LX9A 1VGYA 1Z2LA 2GANA 4ONWA 4R3LA 4UF4A 1JQGA 4XPDB 5G21A 3TO7A 1XBUA 4M6HA 1MJAA 4HKFA 2EK9A 2WSAA 3FRMA 2Y0MA 4UWIA 2PR8A 5JH9A 4UCPA 1XIXA 2R8VA 2Q04A 2PJ8A 3F0AA 1ARLA 1IGBA 4CAEA 3TTHA 4NSQA 3P2HA 2PIYA 5LYFA 3HLPA 2J8NA 2QYVA 1U6MA 2F7VA 1P4NA 2I79A 2ZOGA 5E96A 2KCWA 3EY5A 1S5KA 1ZG8A 3A9LA 1UWYA 1YQEA 2PJ6A 3S6FA 4A30A 5C82A 3IEHA 3PB8X 4HNXB 5I0CA 3KQZA 3W6SA 3CXSA 6CPAA 3FH4A 4JXRA 3JRUA 2HB6A 4JYWA 2DPSA 2ZEOA 4F8ZA 1IB1E 1ON0A 2CNTA 3FNCA 3VATA 1TF9A 2POKA 2DXQA 1AMPA 1WWZA 4B12A 4BINA 2AFXA 2VXKA 4KOVA 3B3CA 4MJ8A 4AVAA 2VZZA 2ZEPA 2NSMA 4OC5A 3QB8A 1RTQA 2ODFA 1XOVA 1YW6A 3I3GA 2O4HA 4PXDA 1XE4A 1CM0A 4W9YA 2GLJA 1QQ9A 2P6EA 5ISVA 3SI1A 1K4JA 4GM5A 4A94A 3MRUA 1RO5A 5DS0A 4B10A 3B7IA 4CYOA 5EBVA 2J8RA 3B35A 4FD7A 3FJUA 1EE3P 1X12A 2ATRA 3KASA 2FVGA 3D7HA 4H89A 5G1ZA 4CS0B 3WR7A 2WYRA 3GB0A 3G8WA 2Q4ZA 2OB0A 4H6UA 4KSIA 5BWAB 3PBBA 3KI9A 4C2ZA 1QSOA 3RAMA 3NH4A 2WPWA 1YSJA 4RN7A 4KUAA 4UIBA 4E2AA 2P6GA 1QSNA 4F0XA 2A4NA 4P4FA 4NGTA 1Q2YA 3D2PA 3FMCA 2EO8A 4Y49C 3NH5A 4F0YA 1UFHA 5LYLA 4NJRA 4NGMA 3DGVA 3K2KA 4CPAA 4NF1A 1VHEA 4KOYA 1ELMP 5CPAA 4NGPA 2ZOFA 1VKCA 4OC4A 4B5PB 2C1CA 4R6TA 1ZO0A 4OP4A 1S7FA 3T8WA 3GY9A 2Z3MA 2JBKA 4ZYQA 2X7BA 4JXQA 4P4IA 1YK3A 2ZEEA 1BO4A 3G3SA 2IMOA 1IY7A 1PUAA 4OLLA 2B4DA 2VEZA 4WWVA 1KUVA 3FXTA 4NGQA 5CNPA 2PE3A 4E8OA 1KWMA 5J8CA 1M4IA 1A2ZA 5K8PA 4FUUA 3B3WA 2EWBA 1R43A 5LRJA 3CXQA 1LCPA 4WJBA 3SJXA 2XEJA 2GIVA 4BBHA 3CZXA 4EVYA 1CBXA 3D66A 4UA3A 1Y7EA 4ZY0A 2J9AA 1X10A 2QIRA 1I12A 2PSWA 3PP9A 4KSFA 2B3VA 3D7GA 2PRBA 4KS9A 3WC7A 2AFMA 2PJ4A 5DWNA 4OIDA 2REEA 1XJOA 3CPAA 3R9GA 5FVJA 5G20A 4P4BA 2PJ9A 3KQXA 4MRIA 1QMUA 2WZNA 3BJ7A 2GLFA 3PGPA 5HXDA 3D8PA 3FVLA 1H8LA 4F9UA 3T9YA 5K8OA 5JQ4A 4C2YA 1J4JA 1BPNA 1NSAA 4CAVA 5IV0A 2QMLA 2AFWA 2BCOA 4OC2A 3GUXA 3RBUA 3FB3A 1OBRA 2QVPA 4OC3A 1Z9UA 2AFSA 4P4JA 1LAMA 4I49A 4QVTA 4E0AA 4J3GA 2PVVA 4KOXA 3TT2A 2Z3PA 2OZHA 2Z3KA 2CY2A 4PK3A 1JWQA 2PCUA 4M6GA 3DNSA 4MFPA 2R7HA 3FF3A 1I1DA 2IL4A 5F49A 1NMTA 4A37A 4M3SA 3EC4A 3R1KA 3FEEA 3TC8A 4Q38A 1Z8LA 3B3TA 2GFQA 2B3UA 3PB9X 4EWTA 1F2OA 4R7MA 4NFRA 3RO0A 3S6KA 3KHXA 1Z4EA 3DLJA 3WC5A 4UBRA 5D8NA 2FS5A 4KSAA 3F5BA 2YNCA 4GS4A 1VHOA 3SJGA 5IB0A 2XEIA 4KLVA 2OZUA 3TE4A 1WK4A 3BXMA 2R1IA 1CX8A 4NGNA 4CGMA 3QAHA 1Z4RA 2OZGA 1BOBA 5H86A 1FY7A 2F5IA 4P6YA 3IJ3A 1HDQA 4PXEA 4C7HA 2IJZA 2VI7A 3D2MA 4PK2A 3FYNA 3PFOA 1Y9KA 3FX6A 3LODA 2D4OA 2AE6A 2GE3A 3BLNA 3JTKA 2Z3OA 1Y7RA 2G3AA 3PBEA 2ABZA 2HC9A 5K8NA 3BI1A 3KZWA 5A27A 1IU8A 1AYEA 1TKFA 1OZPA 4MFKA 3KKWA 4MFQA 4CAXA 4CRZB 4DUKA 1PU9A 5AG7A 2JDCA 3GLJA 3T90A 2F8HA 5HVGA 2EK8A 2AFZA 4R57A 4RI1A 3H4QA 3W6XA 3V7ZA 1M44A 2EUIA 4CGOA 1VIXA 4KZTA 3B3VA 5AG6A 2Q4VA 3KL9A 4UEEA 1TKJA 2G9DA 1M1DA 1Y0RA 3PB4X 4ZX9A 1M4LA 3C26A 2ZENA 4AVBA 4OIWA 1B87A 1Y0YA 2REFA 3TO9A 1NSLA 4M6IA 4CGLA 4A2ZA 1ZLIA 4DNCA 4HPSA 4MCRA 2PJ0A 2ZXVA 4YU9A 4R3KA 4RS2A 1QSTA 4KORA 1YW4A 4CYPA 1S7NA 2CXAA 3ZJ0A 1IYLA 2OU2A 1IOFA 1ZG7A 4ZI6A 5KTCA 3BJ8A 1FT7A 4JWPA 2FIWA 2JDDA 4X8IA 3UY5A 5A28A 1FNOA 1TF8A 3RYOA 4KOUA 2PC1A 1PYTB 1Z8TA 3IWGA 3LMSA 4LQ6A 2BL1A 2P6FA 5LRGA 2V8HA 4B14A 4AVCA 3IC1A 4M85A 3LD2A 3VH9A 4KVME 4AG9A 3OWCA 5ELYA 2HV2A 3I9SA 5LYIA 4CYNA 1BLLE 1QSMA 3IIBA 1IOIA 1Z5RA 2ZW4A 4MFLA 3R9EA 4U5YA 2ZW5A 4X2TA 1CP6A 3TCVA 1Q2DA 2V8DA 3D68A 3R96A 4A33A 1S7KA 3WT4A 5JPHA 1Q2CA 1CJWA 3FIXA 2XEFA 4IHMA 3QNVA 3BI0A 2WUUA 3TFYA 1LAPA 4TWEA 4X5KA 1VHSA 2J8MA 7CPAA 1NE9A 2G0BA 3LWUA 4F9VA 2ARHA 4G1PA 1LFWA 5F47A 1CPSA 2AFOA 4A95A 3KR5A 3DSBA 4AB7A 1CP7A 1IYKA 1XEBA 4MCQA 3D4UA 3IU1A 3DDDA 2Z3NA 2VBQA 4O23A 2FXFA 1YGHA 5K8MA 1YVOA 1IIDA 3PZJA 3CT9A 3PFEA 3SJEA 3ISXA 4C7IA 2Q44A 3PRTA 4KLWA 1S3ZA 3R95A 4XNHB 4U9YA 2Z11A 5THWA 4C2XA 1N71A 4OC0A 4OMEA 4EMEA 3GKRA 2H5MA 1PCAA 2R98A 3CDXA 4PPZA 4MXUA 4A38A 3IO1A 3H8EA 5F46A 4B6ZA 4JD6A 5GCNA 2ANPA 2ZELA 3K9UA 4MHYA 3MN8A 3VARA 1AUGA 1CPXA 3SJFA 4MCPA 2AFUA 3IGRA 2FIAA 5LRKA 3ISZA 2GREA 2P0WA 2PIZA 3VWEA 4B13A 1XRYA 2CF4A 2I3CA 4CAFA 3SI2A 4PQAA 5KTDA 4CGPA 4H2KA 3QAYA 3TX8A 2B5GA 4KVOE 5IX3A 3L2NA 4BD9A 4Z65A 3K9TA 5KTAA 3D7FA 2EBJA 2YGWA 3E0KA 3FBUA 1TKHA 2ZEMA 4IAVA 2JLMA 4XPKA 1LANA 2ZEFA 4QUSA 2C6CA 3NH8A 4P4DA 2CNSA 4R9MA 2CTBA 2BUEA 3DR6A 4LQGA 5AGEA 4A31A 2BSWA 4OADA 3KHZA 2DPTA 4XPDC 5LYDA 3RNZA 4AG7A 5EC4A 2C27A 1CG2A 1ZG9A 1LRZA 1I21A 4ZBGA 2OH1A 4UFXA 4CRYB 3H8GA 4P10A 2G3TA 4FD4A 1BPMA 4MFZA 2IQ6A 3TO6A 4HNWB 4MBUA 1S7LA 5AG4A 3IWWA 4YGOA 4L89A 1M4DA 3WABA 2Q0YA 2RC4A 4A32A 4KOSA 1L0CA 2C6PA 3I1UA 3PB7X 5I4MA 2VL1A 3R9FA 4NXYA 4II9A 2PJ5A 3NE8A 4NGRA 4TNUA 2O53A 1DE4C 1GYTA 8CPAA 2V8GA 2HQYA 2V77A 4U9ZA 1YLEA 3IFEA 2AJ6A 1Z8WA 5JGFA 1R57A 4UFWA 1YMEA 4UEZA 3F8KA 4PSXA 1RXTA 2PJAA 3B8GA 4XPLA 2NYQA 1HDUA 3D67A 4X3RA 3H8FA 4UIAA 1XMBA 4MMOA 1YLOA 5G22A 3SHPA 2CIJA 2PJ2A 2PQ8A 4F6AA 2OOTA 4H6ZA 1XF8A 3GYAA 4UWJA 3EO4A 5H84A 4A39A 1ZLHA 3NFZA 3NA6A 1R3NA 4YRHA 2PVWA 3W91A 2QECA 4NGSA 4ZY1A 5F09A 1LOKA 4IF5A 3S9MA 3IWEA 2JEVA 4IUSA 4RUHA 2JEWA 5HH1A 1Z8XA 2B4DB 2O28A 4Q36A 4MFJA 3SI0A 2ZEDA 2ZEHA 3EXNA 1Y9WA 2GU2A 2I00A 3N5FA 4IK2A 2ZPAA 1M4GA 2FL4A 2CNMA 2HUZA
chains in the Genus database with same CATH topology
5F48A 2YNDA 1KUYA 1GHEA 2FSRA 1IICA 4FD6A 4KUBA 2B4BA 2ZW7A 1KZFA 3D3SA 4YFJA 3H5ZA 2VZYA 4JJXA 4R87A 1B6BA 4NCZA 4Y49B 3DR8A 3IU2A 4NEXA 3JUWA 2Q7BA 4ONUA 2D4PA 4KOWA 2EVNA 3SXOA 1YX0A 4BMHA 2ZW6A 4KOTA 2Q4YA 4UCNA 4PV6A 4CYQA 4MY3A 5DWMA 1P0HA 4ZGYB 4CGNA 1YR0A 1QSRA 1XMTA 4B5OA 4C68A 5C88A 2FE7A 2B5GB 3CXPA 3JVNA 2Z0ZA 4L8AA 5HMNA 2Z10A 4XNHC 2YNEA 4KVXA 4B11A 1TIQA 3N7ZA 1SQHA 4UCMA 3S6HA 2B58A 2PR1A 3NE7A 2NMTA 3SXNA 2VQYA 2YNCC 1KUXA 3P2FA 4B5PA 2WPXA 4LUAA 5AG5A 3EFAA 1V0CA 4K30A 4MY0A 1YVKA 2FCKA 2FT0A 4QB9A 4QBJA 5J8FA 3V8IA 1S60A 1MJBA 3VWDA 2BEIA 4ORFA 3ZZIA 4FD5A 3TOAA 3S6GA 4UFVA 2K5TA 4MHDA 3MGDA 4PSWA 4OAEA 2Z3LA 4QC6A 1MK4A 4MI4A 4JLYA 1YREA 4CAWA 4HNYB 1MJ9A 2PDOA 3TOBA 4LX9A 2GANA 4R3LA 4XPDB 5G21A 3TO7A 1MJAA 4HKFA 2WSAA 3FRMA 2Y0MA 4UWIA 2PR8A 4UCPA 1XIXA 2R8VA 2Q04A 3F0AA 4CAEA 3TTHA 4NSQA 3P2HA 2J8NA 1U6MA 2I79A 1P4NA 5E96A 3EY5A 2KCWA 1S5KA 3S6FA 3A9LA 4A30A 5C82A 4HNXB 5I0CA 3W6SA 3CXSA 4JXRA 2DPSA 1IB1E 1ON0A 2CNTA 3FNCA 2DXQA 1WWZA 4B12A 2VXKA 4KOVA 4AVAA 4MJ8A 2VZZA 3QB8A 3I3GA 1XE4A 1CM0A 2P6EA 5ISVA 1K4JA 1RO5A 4B10A 4CYOA 5EBVA 2J8RA 4FD7A 2ATRA 4H89A 4CS0B 5G1ZA 3WR7A 3G8WA 2OB0A 4H6UA 5BWAB 4C2ZA 1QSOA 2WPWA 4KUAA 4E2AA 2P6GA 1QSNA 4F0XA 2A4NA 1Q2YA 3D2PA 4Y49C 4F0YA 1UFHA 4NF1A 4KOYA 1VKCA 4B5PB 1ZO0A 1S7FA 3GY9A 2Z3MA 2X7BA 4JXQA 1YK3A 3G3SA 1BO4A 1PUAA 4OLLA 2B4DA 2VEZA 1KUVA 3FXTA 5CNPA 4E8OA 5J8CA 1M4IA 3CXQA 2GIVA 4BBHA 4EVYA 4UA3A 2QIRA 1I12A 2PSWA 3PP9A 4KSFA 2B3VA 2PRBA 4KS9A 5DWNA 2REEA 3R9GA 5FVJA 5G20A 3BJ7A 3PGPA 3D8PA 3T9YA 5JQ4A 4C2YA 1J4JA 4CAVA 5IV0A 2QMLA 3FB3A 4QVTA 1Z9UA 4I49A 4E0AA 4J3GA 4KOXA 3TT2A 2Z3PA 2Z3KA 2OZHA 2CY2A 4PK3A 3DNSA 4MFPA 2R7HA 1I1DA 2IL4A 5F49A 1NMTA 4M3SA 3EC4A 3R1KA 4Q38A 2B3UA 3S6KA 1Z4EA 4UBRA 2FS5A 4KSAA 3F5BA 2YNCA 4GS4A 5IB0A 4KLVA 2OZUA 3TE4A 1WK4A 2R1IA 4CGMA 3QAHA 1Z4RA 2OZGA 1BOBA 5H86A 1FY7A 2F5IA 4C7HA 2VI7A 3D2MA 4PK2A 3FYNA 1Y9KA 3LODA 2D4OA 2AE6A 2GE3A 3BLNA 3JTKA 2Z3OA 1Y7RA 2G3AA 5A27A 4MFKA 4MFQA 1OZPA 4CAXA 3KKWA 4CRZB 1PU9A 5AG7A 2JDCA 3T90A 4R57A 4RI1A 3H4QA 3W6XA 1M44A 2EUIA 4CGOA 4KZTA 5AG6A 2Q4VA 1M1DA 3C26A 4AVBA 1B87A 2REFA 3TO9A 1NSLA 4CGLA 4A2ZA 4DNCA 2ZXVA 4R3KA 4RS2A 1QSTA 4KORA 4CYPA 1S7NA 2CXAA 3ZJ0A 1IYLA 2OU2A 5KTCA 3BJ8A 4JWPA 2FIWA 2JDDA 3UY5A 5A28A 3RYOA 4KOUA 2PC1A 3IWGA 2BL1A 2P6FA 4B14A 4AVCA 4M85A 3LD2A 4AG9A 4KVME 3OWCA 2HV2A 3I9SA 4CYNA 1QSMA 3R9EA 2ZW4A 4MFLA 4U5YA 2ZW5A 3TCVA 1Q2DA 3R96A 4A33A 1S7KA 5JPHA 1Q2CA 1CJWA 3FIXA 2WUUA 3TFYA 4X5KA 1VHSA 2J8MA 1NE9A 2G0BA 2ARHA 5F47A 4A95A 3DSBA 4AB7A 1IYKA 1XEBA 3IU1A 3DDDA 2Z3NA 2VBQA 2FXFA 1YGHA 1YVOA 3PZJA 1IIDA 4C7IA 2Q44A 4KLWA 1S3ZA 3R95A 4XNHB 4U9YA 2Z11A 4C2XA 1N71A 3GKRA 2H5MA 2R98A 5F46A 4JD6A 5GCNA 3K9UA 3IGRA 2FIAA 2P0WA 3VWEA 4B13A 4CAFA 5KTDA 4CGPA 2B5GA 4KVOE 5IX3A 5KTAA 3E0KA 2YGWA 3FBUA 2JLMA 4XPKA 4QUSA 4R9MA 2CNSA 5AGEA 2BUEA 3DR6A 4A31A 2BSWA 4OADA 2DPTA 4XPDC 4AG7A 5EC4A 2C27A 1LRZA 1I21A 4ZBGA 2OH1A 4UFXA 4CRYB 2G3TA 4FD4A 4MFZA 3TO6A 5AG4A 4HNWB 4MBUA 1S7LA 4YGOA 4L89A 1M4DA 4A32A 2Q0YA 2RC4A 4KOSA 1L0CA 4II9A 3R9FA 4NXYA 2HQYA 4U9ZA 1YLEA 2AJ6A 1R57A 4UFWA 4XPLA 3F8KA 4PSXA 1RXTA 3B8GA 5G22A 3SHPA 2PQ8A 4F6AA 4H6ZA 1XF8A 3GYAA 4UWJA 3EO4A 5H84A 4YRHA 3W91A 2QECA 4IF5A 3IWEA 2JEVA 4IUSA 5HH1A 2B4DB 2O28A 4Q36A 4MFJA 3EXNA 1Y9WA 2I00A 2ZPAA 1M4GA 2FL4A 2CNMA 2HUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F48 A;  1KUY A;  1GHE A;  2FSR A;  1IIC A;  4FD6 A;  4KUB A;  2B4B A;  2ZW7 A;  1KZF A;  3D3S A;  4YFJ A;  2VZY A;  4JJX A;  4R87 A;  1B6B A;  4NCZ A;  4Y49 B;  3DR8 A;  4NEX A;  3JUW A;  2Q7B A;  4ONU A;  2D4P A;  4KOW A;  2EVN A;  3SXO A;  1YX0 A;  4BMH A;  2ZW6 A;  4KOT A;  2Q4Y A;  4PV6 A;  4MY3 A;  5DWM A;  1P0H A;  1YR0 A;  1QSR A;  1XMT A;  4B5O A;  5C88 A;  2FE7 A;  2B5G B;  3CXP A;  3JVN A;  2Z0Z A;  4L8A A;  5HMN A;  2Z10 A;  4XNH C;  4KVX A;  1TIQ A;  3N7Z A;  1SQH A;  3S6H A;  2B58 A;  2PR1 A;  3NE7 A;  2NMT A;  3SXN A;  2VQY A;  1KUX A;  3P2F A;  4B5P A;  2WPX A;  4LUA A;  3EFA A;  1V0C A;  4K30 A;  4MY0 A;  1YVK A;  2FCK A;  2FT0 A;  4QB9 A;  4QBJ A;  5J8F A;  3V8I A;  1S60 A;  1MJB A;  3VWD A;  2BEI A;  4ORF A;  3ZZI A;  4FD5 A;  3TOA A;  3S6G A;  2K5T A;  4MHD A;  3MGD A;  4PSW A;  4OAE A;  4QC6 A;  1MK4 A;  4MI4 A;  4JLY A;  1YRE A;  4CAW A;  4HNY B;  1MJ9 A;  2PDO A;  3TOB A;  4LX9 A;  2GAN A;  4R3L A;  4XPD B;  3TO7 A;  1MJA A;  4HKF A;  3FRM A;  2Y0M A;  4UWI A;  2PR8 A;  1XIX A;  2R8V A;  2Q04 A;  3F0A A;  3TTH A;  4NSQ A;  3P2H A;  2J8N A;  1U6M A;  2I79 A;  1P4N A;  5E96 A;  3EY5 A;  2KCW A;  1S5K A;  3S6F A;  5C82 A;  4HNX B;  5I0C A;  3W6S A;  3CXS A;  4JXR A;  1IB1 E;  1ON0 A;  2CNT A;  3FNC A;  2DXQ A;  1WWZ A;  2VXK A;  4KOV A;  4AVA A;  4MJ8 A;  2VZZ A;  3QB8 A;  3I3G A;  1XE4 A;  1CM0 A;  2P6E A;  5ISV A;  1K4J A;  1RO5 A;  5EBV A;  2J8R A;  4FD7 A;  2ATR A;  4H89 A;  4CS0 B;  3WR7 A;  3G8W A;  2OB0 A;  4H6U A;  1QSO A;  2WPW A;  4KUA A;  4E2A A;  2P6G A;  1QSN A;  2A4N A;  1Q2Y A;  3D2P A;  4Y49 C;  4F0Y A;  1UFH A;  4NF1 A;  4KOY A;  1VKC A;  4B5P B;  1S7F A;  3GY9 A;  2X7B A;  4JXQ A;  1YK3 A;  3G3S A;  1BO4 A;  1PUA A;  4OLL A;  2B4D A;  2VEZ A;  1KUV A;  3FXT A;  5CNP A;  4E8O A;  5J8C A;  1M4I A;  3CXQ A;  2GIV A;  4EVY A;  4UA3 A;  2QIR A;  1I12 A;  2PSW A;  3PP9 A;  2B3V A;  2PRB A;  5DWN A;  2REE A;  3R9G A;  5FVJ A;  3BJ7 A;  3PGP A;  3D8P A;  3T9Y A;  5JQ4 A;  1J4J A;  4CAV A;  5IV0 A;  2QML A;  3FB3 A;  4QVT A;  1Z9U A;  4I49 A;  4E0A A;  4J3G A;  4KOX A;  3TT2 A;  2OZH A;  2CY2 A;  4PK3 A;  3DNS A;  2R7H A;  1I1D A;  2IL4 A;  5F49 A;  1NMT A;  4M3S A;  3EC4 A;  3R1K A;  2B3U A;  3S6K A;  1Z4E A;  4UBR A;  2FS5 A;  3F5B A;  4GS4 A;  5IB0 A;  4KLV A;  2OZU A;  3TE4 A;  1WK4 A;  2R1I A;  3QAH A;  1Z4R A;  2OZG A;  1BOB A;  5H86 A;  1FY7 A;  2F5I A;  2VI7 A;  3D2M A;  4PK2 A;  3FYN A;  1Y9K A;  3LOD A;  2D4O A;  2AE6 A;  2GE3 A;  3BLN A;  1Y7R A;  2G3A A;  1OZP A;  4CAX A;  3KKW A;  4CRZ B;  1PU9 A;  3T90 A;  2JDC A;  4R57 A;  4RI1 A;  3H4Q A;  3W6X A;  1M44 A;  2EUI A;  4KZT A;  2Q4V A;  1M1D A;  3C26 A;  4AVB A;  1B87 A;  2REF A;  3TO9 A;  1NSL A;  4DNC A;  2ZXV A;  4R3K A;  4RS2 A;  1QST A;  4KOR A;  1S7N A;  3ZJ0 A;  1IYL A;  2OU2 A;  5KTC A;  3BJ8 A;  4JWP A;  2FIW A;  2JDD A;  3UY5 A;  3RYO A;  4KOU A;  2PC1 A;  3IWG A;  2BL1 A;  2P6F A;  4AVC A;  4M85 A;  3LD2 A;  4AG9 A;  4KVM E;  3OWC A;  2HV2 A;  3I9S A;  1QSM A;  3R9E A;  2ZW4 A;  4U5Y A;  2ZW5 A;  3TCV A;  1Q2D A;  3R96 A;  1S7K A;  5JPH A;  1Q2C A;  1CJW A;  3FIX A;  3TFY A;  4X5K A;  1VHS A;  2J8M A;  1NE9 A;  2G0B A;  2ARH A;  5F47 A;  3DSB A;  4AB7 A;  1IYK A;  1XEB A;  3DDD A;  2VBQ A;  2FXF A;  1YGH A;  1YVO A;  3PZJ A;  1IID A;  2Q44 A;  4KLW A;  1S3Z A;  3R95 A;  4XNH B;  4U9Y A;  2Z11 A;  1N71 A;  3GKR A;  2H5M A;  2R98 A;  5F46 A;  4JD6 A;  5GCN A;  3K9U A;  3IGR A;  2FIA A;  2P0W A;  3VWE A;  5KTD A;  2B5G A;  4KVO E;  5IX3 A;  5KTA A;  3E0K A;  3FBU A;  2JLM A;  4XPK A;  4QUS A;  4R9M A;  2CNS A;  2BUE A;  3DR6 A;  2BSW A;  4OAD A;  4XPD C;  4AG7 A;  5EC4 A;  2C27 A;  1LRZ A;  1I21 A;  4ZBG A;  2OH1 A;  4CRY B;  2G3T A;  4FD4 A;  3TO6 A;  4HNW B;  4MBU A;  1S7L A;  4YGO A;  4L89 A;  1M4D A;  2Q0Y A;  2RC4 A;  4KOS A;  1L0C A;  4II9 A;  3R9F A;  4NXY A;  2HQY A;  4U9Z A;  1YLE A;  2AJ6 A;  1R57 A;  4XPL A;  3F8K A;  4PSX A;  1RXT A;  3B8G A;  3SHP A;  2PQ8 A;  4F6A A;  4H6Z A;  1XF8 A;  3GYA A;  4UWJ A;  3EO4 A;  5H84 A;  4YRH A;  3W91 A;  2QEC A;  4IF5 A;  4IUS A;  2JEV A;  5HH1 A;  2B4D B;  2O28 A;  3EXN A;  1Y9W A;  2I00 A;  2ZPA A;  1M4G A;  2FL4 A;  2CNM A;  2HUZ A; 
#chains in the Genus database with same CATH topology
 5CBM A;  5F48 A;  4OKO A;  2YND A;  1KUY A;  1GHE A;  3HUV A;  2FSR A;  1IIC A;  3B3S A;  4FD6 A;  4KUB A;  1F57 A;  2B4B A;  2PJB A;  2PJ3 A;  2PJ1 A;  2ZW7 A;  1Q7L A;  4JZ0 A;  3S9N A;  1KZF A;  1XFO A;  3D3S A;  4YFJ A;  3H5Z A;  2VZY A;  4JJX A;  4R87 A;  4ZX8 A;  1B6B A;  5J1Q A;  5D29 A;  4NCZ A;  4Y49 B;  3DR8 A;  3IU2 A;  4NEX A;  3JUW A;  2XEG A;  2Q7B A;  4AXV A;  1DTD A;  4ONU A;  2D4P A;  3FEC A;  4KOW A;  2OR4 A;  2EVN A;  4FWU A;  3SXO A;  2CTC A;  1YX0 A;  2PJC A;  3FED A;  4BMH A;  4DYO A;  2BO9 A;  2C6G A;  1F2P A;  2ZW6 A;  3PEI A;  4KOT A;  2Q4Y A;  4UCN A;  4PV6 A;  4CYQ A;  2RFH A;  2ZEG A;  4MY3 A;  1P0H A;  1HEE A;  4PXB A;  5DWM A;  4EFD A;  4ZGY B;  4CGN A;  1YR0 A;  2DEA A;  1QSR A;  1XMT A;  4P44 A;  4B5O A;  4C68 A;  3D7D A;  5C88 A;  2FE7 A;  2B5G B;  3CXP A;  3JVN A;  3LAC A;  4R8F A;  2Z0Z A;  1ELL P;  4L8A A;  5HMN A;  2Z10 A;  4XNH C;  2PJ7 A;  3PB6 X;  2Q7S A;  2YNE A;  4KVX A;  4P45 A;  5HVH A;  4YWY A;  4B11 A;  4OC1 A;  1TIQ A;  2QJ8 A;  4UEF A;  3N7Z A;  1SQH A;  1ARM A;  4UCM A;  2B58 A;  3S6H A;  2PR1 A;  2Q43 A;  3NE7 A;  4NJQ A;  2NMT A;  4GXH A;  4MHN A;  3SXN A;  2VQY A;  2YNC C;  1KUX A;  3P2F A;  4MCS A;  3S9L A;  4B5P A;  2WPX A;  4LUA A;  5AG5 A;  4R76 A;  3EFA A;  1V0C A;  3WC6 A;  4K30 A;  4MY0 A;  4PXC A;  1YVK A;  2FCK A;  2FT0 A;  2Q51 A;  4QB9 A;  4QBJ A;  2DF5 A;  5J8F A;  2JBJ A;  3CPX A;  2PRQ A;  5EMI A;  3GIU A;  3V8I A;  5IB9 A;  1S60 A;  3BHX A;  1MJB A;  5HVF A;  3VWD A;  2BEI A;  4K3N A;  4DJL A;  4FBE A;  4ORF A;  4MHP A;  2BOA A;  3KGQ A;  4FD5 A;  3RZA A;  3S6G A;  4UFV A;  3TOA A;  3ZZI A;  4P4E A;  2K5T A;  2RB7 A;  3B2Y A;  4MHD A;  4ZY2 A;  3MGD A;  4PSW A;  4OAE A;  2Z3L A;  3KR4 A;  4QC6 A;  1MK4 A;  4MI4 A;  4JLY A;  1YRE A;  2V8V A;  4CAW A;  4HNY B;  1MJ9 A;  1BAV A;  1TXR A;  4MHZ A;  2PDO A;  4Q7A A;  3TOB A;  3V38 A;  5JM6 A;  4FAI A;  4LX9 A;  1VGY A;  1Z2L A;  2GAN A;  4ONW A;  4R3L A;  4UF4 A;  1JQG A;  4XPD B;  5G21 A;  3TO7 A;  1XBU A;  4M6H A;  1MJA A;  4HKF A;  2EK9 A;  2WSA A;  3FRM A;  2Y0M A;  4UWI A;  2PR8 A;  5JH9 A;  4UCP A;  1XIX A;  2R8V A;  2Q04 A;  2PJ8 A;  3F0A A;  1ARL A;  1IGB A;  4CAE A;  3TTH A;  4NSQ A;  3P2H A;  2PIY A;  5LYF A;  3HLP A;  2J8N A;  2QYV A;  1U6M A;  2F7V A;  1P4N A;  2I79 A;  2ZOG A;  5E96 A;  2KCW A;  3EY5 A;  1S5K A;  1ZG8 A;  3A9L A;  1UWY A;  1YQE A;  2PJ6 A;  3S6F A;  4A30 A;  5C82 A;  3IEH A;  3PB8 X;  4HNX B;  5I0C A;  3KQZ A;  3W6S A;  3CXS A;  6CPA A;  3FH4 A;  4JXR A;  3JRU A;  2HB6 A;  4JYW A;  2DPS A;  2ZEO A;  4F8Z A;  1IB1 E;  1ON0 A;  2CNT A;  3FNC A;  3VAT A;  1TF9 A;  2POK A;  2DXQ A;  1AMP A;  1WWZ A;  4B12 A;  4BIN A;  2AFX A;  2VXK A;  4KOV A;  3B3C A;  4MJ8 A;  4AVA A;  2VZZ A;  2ZEP A;  2NSM A;  4OC5 A;  3QB8 A;  1RTQ A;  2ODF A;  1XOV A;  1YW6 A;  3I3G A;  2O4H A;  4PXD A;  1XE4 A;  1CM0 A;  4W9Y A;  2GLJ A;  1QQ9 A;  2P6E A;  5ISV A;  3SI1 A;  1K4J A;  4GM5 A;  4A94 A;  3MRU A;  1RO5 A;  5DS0 A;  4B10 A;  3B7I A;  4CYO A;  5EBV A;  2J8R A;  3B35 A;  4FD7 A;  3FJU A;  1EE3 P;  1X12 A;  2ATR A;  3KAS A;  2FVG A;  3D7H A;  4H89 A;  5G1Z A;  4CS0 B;  3WR7 A;  2WYR A;  3GB0 A;  3G8W A;  2Q4Z A;  2OB0 A;  4H6U A;  4KSI A;  5BWA B;  3PBB A;  3KI9 A;  4C2Z A;  1QSO A;  3RAM A;  3NH4 A;  2WPW A;  1YSJ A;  4RN7 A;  4KUA A;  4UIB A;  4E2A A;  2P6G A;  1QSN A;  4F0X A;  2A4N A;  4P4F A;  4NGT A;  1Q2Y A;  3D2P A;  3FMC A;  2EO8 A;  4Y49 C;  3NH5 A;  4F0Y A;  1UFH A;  5LYL A;  4NJR A;  4NGM A;  3DGV A;  3K2K A;  4CPA A;  4NF1 A;  1VHE A;  4KOY A;  1ELM P;  5CPA A;  4NGP A;  2ZOF A;  1VKC A;  4OC4 A;  4B5P B;  2C1C A;  4R6T A;  1ZO0 A;  4OP4 A;  1S7F A;  3T8W A;  3GY9 A;  2Z3M A;  2JBK A;  4ZYQ A;  2X7B A;  4JXQ A;  4P4I A;  1YK3 A;  2ZEE A;  1BO4 A;  3G3S A;  2IMO A;  1IY7 A;  1PUA A;  4OLL A;  2B4D A;  2VEZ A;  4WWV A;  1KUV A;  3FXT A;  4NGQ A;  5CNP A;  2PE3 A;  4E8O A;  1KWM A;  5J8C A;  1M4I A;  1A2Z A;  5K8P A;  4FUU A;  3B3W A;  2EWB A;  1R43 A;  5LRJ A;  3CXQ A;  1LCP A;  4WJB A;  3SJX A;  2XEJ A;  2GIV A;  4BBH A;  3CZX A;  4EVY A;  1CBX A;  3D66 A;  4UA3 A;  1Y7E A;  4ZY0 A;  2J9A A;  1X10 A;  2QIR A;  1I12 A;  2PSW A;  3PP9 A;  4KSF A;  2B3V A;  3D7G A;  2PRB A;  4KS9 A;  3WC7 A;  2AFM A;  2PJ4 A;  5DWN A;  4OID A;  2REE A;  1XJO A;  3CPA A;  3R9G A;  5FVJ A;  5G20 A;  4P4B A;  2PJ9 A;  3KQX A;  4MRI A;  1QMU A;  2WZN A;  3BJ7 A;  2GLF A;  3PGP A;  5HXD A;  3D8P A;  3FVL A;  1H8L A;  4F9U A;  3T9Y A;  5K8O A;  5JQ4 A;  4C2Y A;  1J4J A;  1BPN A;  1NSA A;  4CAV A;  5IV0 A;  2QML A;  2AFW A;  2BCO A;  4OC2 A;  3GUX A;  3RBU A;  3FB3 A;  1OBR A;  2QVP A;  4OC3 A;  1Z9U A;  2AFS A;  4P4J A;  1LAM A;  4I49 A;  4QVT A;  4E0A A;  4J3G A;  2PVV A;  4KOX A;  3TT2 A;  2Z3P A;  2OZH A;  2Z3K A;  2CY2 A;  4PK3 A;  1JWQ A;  2PCU A;  4M6G A;  3DNS A;  4MFP A;  2R7H A;  3FF3 A;  1I1D A;  2IL4 A;  5F49 A;  1NMT A;  4A37 A;  4M3S A;  3EC4 A;  3R1K A;  3FEE A;  3TC8 A;  4Q38 A;  1Z8L A;  3B3T A;  2GFQ A;  2B3U A;  3PB9 X;  4EWT A;  1F2O A;  4R7M A;  4NFR A;  3RO0 A;  3S6K A;  3KHX A;  1Z4E A;  3DLJ A;  3WC5 A;  4UBR A;  5D8N A;  2FS5 A;  4KSA A;  3F5B A;  2YNC A;  4GS4 A;  1VHO A;  3SJG A;  5IB0 A;  2XEI A;  4KLV A;  2OZU A;  3TE4 A;  1WK4 A;  3BXM A;  2R1I A;  1CX8 A;  4NGN A;  4CGM A;  3QAH A;  1Z4R A;  2OZG A;  1BOB A;  5H86 A;  1FY7 A;  2F5I A;  4P6Y A;  3IJ3 A;  1HDQ A;  4PXE A;  4C7H A;  2IJZ A;  2VI7 A;  3D2M A;  4PK2 A;  3FYN A;  3PFO A;  1Y9K A;  3FX6 A;  3LOD A;  2D4O A;  2AE6 A;  2GE3 A;  3BLN A;  3JTK A;  2Z3O A;  1Y7R A;  2G3A A;  3PBE A;  2ABZ A;  2HC9 A;  5K8N A;  3BI1 A;  3KZW A;  5A27 A;  1IU8 A;  1AYE A;  1TKF A;  1OZP A;  4MFK A;  3KKW A;  4MFQ A;  4CAX A;  4CRZ B;  4DUK A;  1PU9 A;  5AG7 A;  2JDC A;  3GLJ A;  3T90 A;  2F8H A;  5HVG A;  2EK8 A;  2AFZ A;  4R57 A;  4RI1 A;  3H4Q A;  3W6X A;  3V7Z A;  1M44 A;  2EUI A;  4CGO A;  1VIX A;  4KZT A;  3B3V A;  5AG6 A;  2Q4V A;  3KL9 A;  4UEE A;  1TKJ A;  2G9D A;  1M1D A;  1Y0R A;  3PB4 X;  4ZX9 A;  1M4L A;  3C26 A;  2ZEN A;  4AVB A;  4OIW A;  1B87 A;  1Y0Y A;  2REF A;  3TO9 A;  1NSL A;  4M6I A;  4CGL A;  4A2Z A;  1ZLI A;  4DNC A;  4HPS A;  4MCR A;  2PJ0 A;  2ZXV A;  4YU9 A;  4R3K A;  4RS2 A;  1QST A;  4KOR A;  1YW4 A;  4CYP A;  1S7N A;  2CXA A;  3ZJ0 A;  1IYL A;  2OU2 A;  1IOF A;  1ZG7 A;  4ZI6 A;  5KTC A;  3BJ8 A;  1FT7 A;  4JWP A;  2FIW A;  2JDD A;  4X8I A;  3UY5 A;  5A28 A;  1FNO A;  1TF8 A;  3RYO A;  4KOU A;  2PC1 A;  1PYT B;  1Z8T A;  3IWG A;  3LMS A;  4LQ6 A;  2BL1 A;  2P6F A;  5LRG A;  2V8H A;  4B14 A;  4AVC A;  3IC1 A;  4M85 A;  3LD2 A;  3VH9 A;  4KVM E;  4AG9 A;  3OWC A;  5ELY A;  2HV2 A;  3I9S A;  5LYI A;  4CYN A;  1BLL E;  1QSM A;  3IIB A;  1IOI A;  1Z5R A;  2ZW4 A;  4MFL A;  3R9E A;  4U5Y A;  2ZW5 A;  4X2T A;  1CP6 A;  3TCV A;  1Q2D A;  2V8D A;  3D68 A;  3R96 A;  4A33 A;  1S7K A;  3WT4 A;  5JPH A;  1Q2C A;  1CJW A;  3FIX A;  2XEF A;  4IHM A;  3QNV A;  3BI0 A;  2WUU A;  3TFY A;  1LAP A;  4TWE A;  4X5K A;  1VHS A;  2J8M A;  7CPA A;  1NE9 A;  2G0B A;  3LWU A;  4F9V A;  2ARH A;  4G1P A;  1LFW A;  5F47 A;  1CPS A;  2AFO A;  4A95 A;  3KR5 A;  3DSB A;  4AB7 A;  1CP7 A;  1IYK A;  1XEB A;  4MCQ A;  3D4U A;  3IU1 A;  3DDD A;  2Z3N A;  2VBQ A;  4O23 A;  2FXF A;  1YGH A;  5K8M A;  1YVO A;  1IID A;  3PZJ A;  3CT9 A;  3PFE A;  3SJE A;  3ISX A;  4C7I A;  2Q44 A;  3PRT A;  4KLW A;  1S3Z A;  3R95 A;  4XNH B;  4U9Y A;  2Z11 A;  5THW A;  4C2X A;  1N71 A;  4OC0 A;  4OME A;  4EME A;  3GKR A;  2H5M A;  1PCA A;  2R98 A;  3CDX A;  4PPZ A;  4MXU A;  4A38 A;  3IO1 A;  3H8E A;  5F46 A;  4B6Z A;  4JD6 A;  5GCN A;  2ANP A;  2ZEL A;  3K9U A;  4MHY A;  3MN8 A;  3VAR A;  1AUG A;  1CPX A;  3SJF A;  4MCP A;  2AFU A;  3IGR A;  2FIA A;  5LRK A;  3ISZ A;  2GRE A;  2P0W A;  2PIZ A;  3VWE A;  4B13 A;  1XRY A;  2CF4 A;  2I3C A;  4CAF A;  3SI2 A;  4PQA A;  5KTD A;  4CGP A;  4H2K A;  3QAY A;  3TX8 A;  2B5G A;  4KVO E;  5IX3 A;  3L2N A;  4BD9 A;  4Z65 A;  3K9T A;  5KTA A;  3D7F A;  2EBJ A;  2YGW A;  3E0K A;  3FBU A;  1TKH A;  2ZEM A;  4IAV A;  2JLM A;  4XPK A;  1LAN A;  2ZEF A;  4QUS A;  2C6C A;  3NH8 A;  4P4D A;  2CNS A;  4R9M A;  2CTB A;  2BUE A;  3DR6 A;  4LQG A;  5AGE A;  4A31 A;  2BSW A;  4OAD A;  3KHZ A;  2DPT A;  4XPD C;  5LYD A;  3RNZ A;  4AG7 A;  5EC4 A;  2C27 A;  1CG2 A;  1ZG9 A;  1LRZ A;  1I21 A;  4ZBG A;  2OH1 A;  4UFX A;  4CRY B;  3H8G A;  4P10 A;  2G3T A;  4FD4 A;  1BPM A;  4MFZ A;  2IQ6 A;  3TO6 A;  4HNW B;  4MBU A;  1S7L A;  5AG4 A;  3IWW A;  4YGO A;  4L89 A;  1M4D A;  3WAB A;  2Q0Y A;  2RC4 A;  4A32 A;  4KOS A;  1L0C A;  2C6P A;  3I1U A;  3PB7 X;  5I4M A;  2VL1 A;  3R9F A;  4NXY A;  4II9 A;  2PJ5 A;  3NE8 A;  4NGR A;  4TNU A;  2O53 A;  1DE4 C;  1GYT A;  8CPA A;  2V8G A;  2HQY A;  2V77 A;  4U9Z A;  1YLE A;  3IFE A;  2AJ6 A;  1Z8W A;  5JGF A;  1R57 A;  4UFW A;  1YME A;  4UEZ A;  3F8K A;  4PSX A;  1RXT A;  2PJA A;  3B8G A;  4XPL A;  2NYQ A;  1HDU A;  3D67 A;  4X3R A;  3H8F A;  4UIA A;  1XMB A;  4MMO A;  1YLO A;  5G22 A;  3SHP A;  2CIJ A;  2PJ2 A;  2PQ8 A;  4F6A A;  2OOT A;  4H6Z A;  1XF8 A;  3GYA A;  4UWJ A;  3EO4 A;  5H84 A;  4A39 A;  1ZLH A;  3NFZ A;  3NA6 A;  1R3N A;  4YRH A;  2PVW A;  3W91 A;  2QEC A;  4NGS A;  4ZY1 A;  5F09 A;  1LOK A;  4IF5 A;  3S9M A;  3IWE A;  2JEV A;  4IUS A;  4RUH A;  2JEW A;  5HH1 A;  1Z8X A;  2B4D B;  2O28 A;  4Q36 A;  4MFJ A;  3SI0 A;  2ZED A;  2ZEH A;  3EXN A;  1Y9W A;  2GU2 A;  2I00 A;  3N5F A;  4IK2 A;  2ZPA A;  1M4G A;  2FL4 A;  2CNM A;  2HUZ A; 
#chains in the Genus database with same CATH homology
 5F48 A;  2YND A;  1KUY A;  1GHE A;  2FSR A;  1IIC A;  4FD6 A;  4KUB A;  2B4B A;  2ZW7 A;  1KZF A;  3D3S A;  4YFJ A;  3H5Z A;  2VZY A;  4JJX A;  4R87 A;  1B6B A;  4NCZ A;  4Y49 B;  3DR8 A;  3IU2 A;  4NEX A;  3JUW A;  2Q7B A;  4ONU A;  2D4P A;  4KOW A;  2EVN A;  3SXO A;  1YX0 A;  4BMH A;  2ZW6 A;  4KOT A;  2Q4Y A;  4UCN A;  4PV6 A;  4CYQ A;  4MY3 A;  5DWM A;  1P0H A;  4ZGY B;  4CGN A;  1YR0 A;  1QSR A;  1XMT A;  4B5O A;  4C68 A;  5C88 A;  2FE7 A;  2B5G B;  3CXP A;  3JVN A;  2Z0Z A;  4L8A A;  5HMN A;  2Z10 A;  4XNH C;  2YNE A;  4KVX A;  4B11 A;  1TIQ A;  3N7Z A;  1SQH A;  4UCM A;  3S6H A;  2B58 A;  2PR1 A;  3NE7 A;  2NMT A;  3SXN A;  2VQY A;  2YNC C;  1KUX A;  3P2F A;  4B5P A;  2WPX A;  4LUA A;  5AG5 A;  3EFA A;  1V0C A;  4K30 A;  4MY0 A;  1YVK A;  2FCK A;  2FT0 A;  4QB9 A;  4QBJ A;  5J8F A;  3V8I A;  1S60 A;  1MJB A;  3VWD A;  2BEI A;  4ORF A;  3ZZI A;  4FD5 A;  3TOA A;  3S6G A;  4UFV A;  2K5T A;  4MHD A;  3MGD A;  4PSW A;  4OAE A;  2Z3L A;  4QC6 A;  1MK4 A;  4MI4 A;  4JLY A;  1YRE A;  4CAW A;  4HNY B;  1MJ9 A;  2PDO A;  3TOB A;  4LX9 A;  2GAN A;  4R3L A;  4XPD B;  5G21 A;  3TO7 A;  1MJA A;  4HKF A;  2WSA A;  3FRM A;  2Y0M A;  4UWI A;  2PR8 A;  4UCP A;  1XIX A;  2R8V A;  2Q04 A;  3F0A A;  4CAE A;  3TTH A;  4NSQ A;  3P2H A;  2J8N A;  1U6M A;  2I79 A;  1P4N A;  5E96 A;  3EY5 A;  2KCW A;  1S5K A;  3S6F A;  3A9L A;  4A30 A;  5C82 A;  4HNX B;  5I0C A;  3W6S A;  3CXS A;  4JXR A;  2DPS A;  1IB1 E;  1ON0 A;  2CNT A;  3FNC A;  2DXQ A;  1WWZ A;  4B12 A;  2VXK A;  4KOV A;  4AVA A;  4MJ8 A;  2VZZ A;  3QB8 A;  3I3G A;  1XE4 A;  1CM0 A;  2P6E A;  5ISV A;  1K4J A;  1RO5 A;  4B10 A;  4CYO A;  5EBV A;  2J8R A;  4FD7 A;  2ATR A;  4H89 A;  4CS0 B;  5G1Z A;  3WR7 A;  3G8W A;  2OB0 A;  4H6U A;  5BWA B;  4C2Z A;  1QSO A;  2WPW A;  4KUA A;  4E2A A;  2P6G A;  1QSN A;  4F0X A;  2A4N A;  1Q2Y A;  3D2P A;  4Y49 C;  4F0Y A;  1UFH A;  4NF1 A;  4KOY A;  1VKC A;  4B5P B;  1ZO0 A;  1S7F A;  3GY9 A;  2Z3M A;  2X7B A;  4JXQ A;  1YK3 A;  3G3S A;  1BO4 A;  1PUA A;  4OLL A;  2B4D A;  2VEZ A;  1KUV A;  3FXT A;  5CNP A;  4E8O A;  5J8C A;  1M4I A;  3CXQ A;  2GIV A;  4BBH A;  4EVY A;  4UA3 A;  2QIR A;  1I12 A;  2PSW A;  3PP9 A;  4KSF A;  2B3V A;  2PRB A;  4KS9 A;  5DWN A;  2REE A;  3R9G A;  5FVJ A;  5G20 A;  3BJ7 A;  3PGP A;  3D8P A;  3T9Y A;  5JQ4 A;  4C2Y A;  1J4J A;  4CAV A;  5IV0 A;  2QML A;  3FB3 A;  4QVT A;  1Z9U A;  4I49 A;  4E0A A;  4J3G A;  4KOX A;  3TT2 A;  2Z3P A;  2Z3K A;  2OZH A;  2CY2 A;  4PK3 A;  3DNS A;  4MFP A;  2R7H A;  1I1D A;  2IL4 A;  5F49 A;  1NMT A;  4M3S A;  3EC4 A;  3R1K A;  4Q38 A;  2B3U A;  3S6K A;  1Z4E A;  4UBR A;  2FS5 A;  4KSA A;  3F5B A;  2YNC A;  4GS4 A;  5IB0 A;  4KLV A;  2OZU A;  3TE4 A;  1WK4 A;  2R1I A;  4CGM A;  3QAH A;  1Z4R A;  2OZG A;  1BOB A;  5H86 A;  1FY7 A;  2F5I A;  4C7H A;  2VI7 A;  3D2M A;  4PK2 A;  3FYN A;  1Y9K A;  3LOD A;  2D4O A;  2AE6 A;  2GE3 A;  3BLN A;  3JTK A;  2Z3O A;  1Y7R A;  2G3A A;  5A27 A;  4MFK A;  4MFQ A;  1OZP A;  4CAX A;  3KKW A;  4CRZ B;  1PU9 A;  5AG7 A;  2JDC A;  3T90 A;  4R57 A;  4RI1 A;  3H4Q A;  3W6X A;  1M44 A;  2EUI A;  4CGO A;  4KZT A;  5AG6 A;  2Q4V A;  1M1D A;  3C26 A;  4AVB A;  1B87 A;  2REF A;  3TO9 A;  1NSL A;  4CGL A;  4A2Z A;  4DNC A;  2ZXV A;  4R3K A;  4RS2 A;  1QST A;  4KOR A;  4CYP A;  1S7N A;  2CXA A;  3ZJ0 A;  1IYL A;  2OU2 A;  5KTC A;  3BJ8 A;  4JWP A;  2FIW A;  2JDD A;  3UY5 A;  5A28 A;  3RYO A;  4KOU A;  2PC1 A;  3IWG A;  2BL1 A;  2P6F A;  4B14 A;  4AVC A;  4M85 A;  3LD2 A;  4AG9 A;  4KVM E;  3OWC A;  2HV2 A;  3I9S A;  4CYN A;  1QSM A;  3R9E A;  2ZW4 A;  4MFL A;  4U5Y A;  2ZW5 A;  3TCV A;  1Q2D A;  3R96 A;  4A33 A;  1S7K A;  5JPH A;  1Q2C A;  1CJW A;  3FIX A;  2WUU A;  3TFY A;  4X5K A;  1VHS A;  2J8M A;  1NE9 A;  2G0B A;  2ARH A;  5F47 A;  4A95 A;  3DSB A;  4AB7 A;  1IYK A;  1XEB A;  3IU1 A;  3DDD A;  2Z3N A;  2VBQ A;  2FXF A;  1YGH A;  1YVO A;  3PZJ A;  1IID A;  4C7I A;  2Q44 A;  4KLW A;  1S3Z A;  3R95 A;  4XNH B;  4U9Y A;  2Z11 A;  4C2X A;  1N71 A;  3GKR A;  2H5M A;  2R98 A;  5F46 A;  4JD6 A;  5GCN A;  3K9U A;  3IGR A;  2FIA A;  2P0W A;  3VWE A;  4B13 A;  4CAF A;  5KTD A;  4CGP A;  2B5G A;  4KVO E;  5IX3 A;  5KTA A;  3E0K A;  2YGW A;  3FBU A;  2JLM A;  4XPK A;  4QUS A;  4R9M A;  2CNS A;  5AGE A;  2BUE A;  3DR6 A;  4A31 A;  2BSW A;  4OAD A;  2DPT A;  4XPD C;  4AG7 A;  5EC4 A;  2C27 A;  1LRZ A;  1I21 A;  4ZBG A;  2OH1 A;  4UFX A;  4CRY B;  2G3T A;  4FD4 A;  4MFZ A;  3TO6 A;  5AG4 A;  4HNW B;  4MBU A;  1S7L A;  4YGO A;  4L89 A;  1M4D A;  4A32 A;  2Q0Y A;  2RC4 A;  4KOS A;  1L0C A;  4II9 A;  3R9F A;  4NXY A;  2HQY A;  4U9Z A;  1YLE A;  2AJ6 A;  1R57 A;  4UFW A;  4XPL A;  3F8K A;  4PSX A;  1RXT A;  3B8G A;  5G22 A;  3SHP A;  2PQ8 A;  4F6A A;  4H6Z A;  1XF8 A;  3GYA A;  4UWJ A;  3EO4 A;  5H84 A;  4YRH A;  3W91 A;  2QEC A;  4IF5 A;  3IWE A;  2JEV A;  4IUS A;  5HH1 A;  2B4D B;  2O28 A;  4Q36 A;  4MFJ A;  3EXN A;  1Y9W A;  2I00 A;  2ZPA A;  1M4G A;  2FL4 A;  2CNM A;  2HUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...