2G3TA

Crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
169
structure length
169
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3tA00
2NMTA 3F8KA 4II9A 3FIXA 2AE6A 3SHPA 1QSRA 4JWPA 3DR8A 3V8IA 1N71A 5DWNA 3BJ8A 2WPXA 4AB7A 1S7LA 2WPWA 3D3SA 4XPLA 2OB0A 1IYKA 4JD6A 5I0CA 4R3LA 1S5KA 3EFAA 2PC1A 1S7KA 3PGPA 3UY5A 3TO7A 2P0WA 1M44A 5F47A 2Q04A 4KUBA 4B5OA 4OAEA 2PR8A 3TFYA 4JLYA 2P6GA 2Q4YA 3EC4A 2JDDA 2B4DB 2D4OA 2QECA 2BUEA 3LD2A 4NEXA 4DNCA 1PUAA 1S7NA 3TCVA 4BMHA 3DNSA 4UWJA 1MJBA 4HNXB 4L8AA 2HQYA 2BEIA 1TIQA 3T9YA 5IB0A 1YVKA 4R3KA 2CNMA 4E2AA 3R96A 2RC4A 5J8FA 5C88A 4AVCA 3S6GA 2G3AA 1NSLA 3JVNA 3TE4A 4KVME 4E0AA 1KUYA 2KCWA 1Y9WA 5H84A 3BJ7A 4KOYA 1Q2CA 1YX0A 3FYNA 3F5BA 1NMTA 1BOBA 4L89A 1B87A 4CAWA 4NXYA 2ATRA 2P6FA 3I9SA 1BO4A 2I79A 4CAVA 4GS4A 2PQ8A 1QSOA 2R1IA 2BL1A 2FT0A 2VEZA 5KTAA 4KOUA 4CAXA 4FD6A 4PSWA 4PK3A 4QC6A 4QUSA 3PP9A 1B6BA 2A4NA 3RYOA 3CXPA 4QVTA 3W6SA 3PZJA 3CXQA 5HH1A 3GYAA 4AG9A 4U9ZA 3ZZIA 4XPDB 3D2MA 3FNCA 2PDOA 4HNWB 4UWIA 3GY9A 4J3GA 3EY5A 1XE4A 1I1DA 1S3ZA 2ZW6A 2EVNA 1KUXA 2OZHA 4KOVA 1Z4EA 2HV2A 4PV6A 5JPHA 4AVAA 2Q44A 1Q2DA 3TOBA 1S7FA 1YLEA 1XF8A 4CS0B 3MGDA 3WR7A 2J8NA 1KZFA 1P4NA 3TOAA 4M3SA 4HKFA 4XNHB 4AG7A 1I21A 2Y0MA 2FCKA 1VHSA 3EO4A 3FB3A 2R8VA 2G3TA 2VZYA 3I3GA 4JJXA 4NCZA 3TT2A 1FY7A 4F6AA 1M4IA 3T90A 1M4DA 1Y9KA 2IL4A 3TTHA 2JDCA 3N7ZA 4YGOA 4Y49B 1SQHA 4KLVA 5F49A 2FIAA 3FRMA 2O28A 2VZZA 2P6EA 3ZJ0A 2QIRA 2FL4A 2CNTA 2F5IA 3SXOA 3DSBA 2Q4VA 4MHDA 4MY3A 1XEBA 5HMNA 3DDDA 3S6HA 4U5YA 4F0YA 2VI7A 1MK4A 1IIDA 4YFJA 1RXTA 1UFHA 1YK3A 5KTDA 4EVYA 2REEA 1V0CA 1S60A 3C26A 2GANA 3E0KA 3G8WA 2B5GA 4CRZB 4KORA 1IYLA 2K5TA 3QAHA 2OU2A 4ZBGA 4H6UA 4KOSA 2H5MA 2AJ6A 4KLWA 2JEVA 2ZXVA 2FS5A 4AVBA 4FD4A 4R87A 4K30A 3S6FA 3R9EA 2FSRA 4HNYB 5EBVA 3BLNA 3JUWA 1QSTA 2D4PA 3KKWA 3SXNA 2GE3A 4M85A 2FE7A 2VQYA 3CXSA 3R9GA 3R95A 3H4QA 1ON0A 2ZW4A 5F48A 4QB9A 1LRZA 2X7BA 3DR6A 4MY0A 3R9FA 1I12A 1YGHA 3TO9A 2B4DA 5F46A 3IWGA 1WWZA 1KUVA 2PSWA 2GIVA 4X5KA 4H89A 2PR1A 4PSXA 1GHEA 2Q7BA 1M4GA 2Z0ZA 3LODA 2Z11A 4FD7A 2Z10A 2B4BA 2Q0YA 4KVXA 1OZPA 1YVOA 2B5GB 1M1DA 3S6KA 3D8PA 5KTCA 3R1KA 2EUIA 2R98A 1QSNA 4H6ZA 2ZW7A 3EXNA 2BSWA 5GCNA 4NF1A 3OWCA 2J8MA 4XPDC 3W91A 4E8OA 3VWDA 2B3VA 4R9MA 4U9YA 5DWMA 5JQ4A 2PRBA 4B5PA 5IV0A 1Y7RA 2B3UA 3FBUA 4KOTA 4IF5A 4XPKA 5ISVA 3GKRA 2VXKA 4KVOE 1YR0A 5C82A 4MJ8A 1Z9UA 3P2HA 2CNSA 5IX3A 4FD5A 4UA3A 4ONUA 2I00A 4IUSA 4XNHC 1PU9A 1CJWA 1XMTA 5E96A 3VWEA 4UBRA 3F0AA 3K9UA 4OADA 3NE7A 5J8CA 2FXFA 2OZUA 3IGRA 1U6MA 3D2PA 2J8RA 1R57A 1MJAA 4JXRA 1J4JA 4OLLA 2HUZA 4ORFA 5H86A 3B8GA 1YREA 2C27A 3W6XA 3P2FA 3FXTA 4CRYB 4KUAA 1Q2YA 2OZGA 4QBJA 4Y49C 4RS2A 2R7HA 1MJ9A 2ARHA 4KOWA 2FIWA 4I49A 2JLMA 1XIXA 1QSMA 2VBQA 1K4JA 2CY2A 2REFA 1P0HA 4MBUA 2G0BA 2DXQA 4B5PB 4PK2A 4MI4A 4LX9A 4RI1A 4LUAA 1L0CA 4NSQA 4YRHA 1IICA 2B58A 3TO6A 3G3SA 1RO5A 4R57A 5CNPA 1VKCA 4KOXA 2QMLA 1IB1E 1WK4A 1CM0A 5FVJA 3QB8A 2ZPAA 4KZTA 4JXQA 2OH1A 2ZW5A 1NE9A 1Z4RA 5EC4A
chains in the Genus database with same CATH superfamily
4FUUA 1ARLA 2NMTA 3F8KA 4H2KA 4II9A 1PYTB 3FECA 1CP6A 1R3NA 3FIXA 1IGBA 2AE6A 2CIJA 4M6HA 3SJEA 3H8EA 3NE8A 3SHPA 2WSAA 2EBJA 1YMEA 1Y0RA 1QSRA 5JGFA 2DPSA 2BOAA 1TXRA 4IHMA 3DR8A 4JWPA 1N71A 3LWUA 3V8IA 1M4LA 3VATA 1GYTA 5DWNA 3CPXA 5LRKA 2V8HA 3BJ8A 2AFXA 2YNCA 1QMUA 2WPXA 4AB7A 1S7LA 2WPWA 3D3SA 3IU2A 2PJ8A 4XPLA 1CPXA 2OB0A 2WUUA 1IYKA 1XJOA 4JD6A 5I0CA 4R3LA 1S5KA 4F0XA 3EFAA 5I4MA 2PC1A 4K3NA 4R8FA 4UEFA 2PJ2A 1S7KA 3TC8A 4MFLA 3D4UA 5AG6A 3PGPA 3PBBA 4FBEA 3NH4A 3UY5A 3TO7A 2P0WA 1M44A 3IC1A 4MHYA 1YW6A 5K8NA 4DUKA 2NYQA 2Q04A 3KZWA 1LAMA 2C6GA 4KUBA 5F47A 4OAEA 4B5OA 2PR8A 5EMIA 2OOTA 1YW4A 3TFYA 4NGRA 4JLYA 2P6GA 3CT9A 3NA6A 3WC5A 2Q4YA 4UCPA 3EC4A 2JEWA 2JDDA 2B4DB 2D4OA 2AFMA 3H5ZA 1LFWA 2QECA 2BUEA 3LD2A 4NEXA 1TKJA 4DNCA 8CPAA 1PUAA 4KSFA 1S7NA 3NH8A 2F8HA 3VARA 3TCVA 2ZEFA 1JWQA 3IEHA 3MRUA 4MMOA 5LYFA 4BMHA 3DNSA 4Q7AA 1HEEA 4UWJA 1MJBA 4HNXB 4L8AA 5LYDA 2HQYA 2BEIA 2BCOA 4JYWA 4MFZA 4UEZA 1TIQA 3T9YA 3FEDA 3FX6A 4W9YA 1CX8A 1YVKA 2F7VA 5IB0A 4R3KA 4NGTA 2CNMA 5AGEA 4E2AA 3R96A 2RC4A 5J8FA 2ZOFA 4AVCA 3S6GA 5C88A 2ZELA 3B2YA 3LACA 4A38A 5THWA 4RN7A 2PJCA 3K2KA 2G3AA 3B7IA 2XEFA 4TWEA 1NSLA 4UFXA 3JVNA 5HXDA 4OP4A 3TE4A 4KVME 4E0AA 2Z3OA 1KUYA 2KCWA 4F8ZA 2V8VA 4PQAA 4CGNA 1Y9WA 4F9UA 5H84A 3BJ7A 4KOYA 4JZ0A 2YNDA 1Q2CA 1YX0A 2PJ5A 2Z3MA 1ELLP 1Y7EA 3FYNA 3F5BA 4ZGYB 1NMTA 1BOBA 3B3TA 5D29A 5K8MA 3HUVA 4L89A 1B87A 3D67A 1H8LA 4OC2A 4CAWA 4ZY1A 3BHXA 4NXYA 3K9TA 3WABA 2ATRA 2BO9A 3IJ3A 2P6FA 3ISZA 3I9SA 1BO4A 2PVWA 2ZEDA 2I79A 4NJRA 4CAVA 4GS4A 5J1QA 2PQ8A 4WWVA 1QSOA 2R1IA 3PFEA 3S9MA 4CPAA 2BL1A 2FT0A 2VEZA 5KTAA 1FT7A 4KOUA 4CAXA 4FD6A 4PSWA 2Q43A 2ZEGA 4PK3A 4QC6A 2WZNA 3PP9A 4QUSA 4WJBA 1B6BA 5LYLA 2A4NA 3RYOA 3CXPA 4CGLA 4QVTA 3W6SA 3PZJA 1TF8A 3CXQA 5HH1A 3GYAA 4YU9A 2WYRA 4C68A 4LQGA 1Z8LA 4AG9A 4U9ZA 3ZZIA 1CP7A 4XPDB 4OC1A 2ZEHA 3D2MA 3FNCA 2PDOA 4HNWB 2Z3LA 4UWIA 3PFOA 3GY9A 4J3GA 3B3CA 3EY5A 1OBRA 1VGYA 3FMCA 4NGSA 1XE4A 1I1DA 3S9LA 1S3ZA 2ZW6A 2EVNA 1KUXA 1PCAA 5A28A 2OZHA 4KOVA 1Z4EA 2HV2A 4PV6A 5JPHA 2PIYA 4AVAA 2Q44A 1FNOA 2G9DA 3BXMA 1Q2DA 3TOBA 1S7FA 4DYOA 1YLEA 4OC5A 1TF9A 3D7DA 4X2TA 1XF8A 3RAMA 4CS0B 3MGDA 4YWYA 3IFEA 3WR7A 2J8NA 4KSIA 1KZFA 4B10A 1P4NA 1CG2A 3TOAA 2AFSA 4NGQA 2CF4A 2PJ6A 4M3SA 2O4HA 4HKFA 2ODFA 4OC0A 4XNHB 4AG7A 2JBKA 5HVFA 1I21A 3PRTA 4UCNA 3H8GA 4ZY2A 1XOVA 2Y0MA 3DLJA 1AYEA 5G1ZA 4MCSA 2FCKA 1VHSA 3EO4A 3FB3A 2R8VA 4P45A 3B3SA 2OR4A 2G3TA 2VZYA 4A39A 7CPAA 1LANA 3I3GA 4CYQA 1A2ZA 3CPAA 4JJXA 4NCZA 4A94A 3TT2A 3FVLA 1FY7A 4B12A 3V7ZA 4B13A 1VHEA 3KHZA 1M4IA 4F6AA 3TX8A 4CYNA 1BPMA 3T90A 1M4DA 1Y9KA 2IL4A 3TTHA 2JDCA 4X8IA 3N7ZA 4YGOA 4Y49B 1ARMA 1SQHA 3LMSA 1TKHA 4KLVA 1IU8A 1ZG9A 5F49A 2FIAA 4Q36A 3FRMA 4MFJA 4NGMA 2O28A 2VZZA 4M6GA 5F09A 2P6EA 1IOFA 4KSAA 3H8FA 3ZJ0A 1VHOA 3SJFA 2QIRA 2AFWA 2FL4A 2CNTA 2F5IA 2PJ0A 3SXOA 3DSBA 3BI1A 2Q4VA 3PB7X 3RZAA 1BLLE 4MHDA 4MY3A 4P4BA 4B11A 4PXCA 2DPTA 5G21A 4C2YA 1XEBA 2I3CA 5HMNA 3DDDA 3RO0A 3S6HA 2ZEEA 1LCPA 4U5YA 4F0YA 3RBUA 4CGPA 3SJXA 2VI7A 5CBMA 1MK4A 4UIBA 3GB0A 1IIDA 4YFJA 1RXTA 1UFHA 4F9VA 3KGQA 4R76A 1YK3A 4P4DA 4A33A 4MCRA 5G22A 4B14A 5KTDA 3BI0A 4EVYA 4OIDA 2REEA 4ZI6A 1V0CA 4EWTA 2EWBA 1S60A 3C26A 3QNVA 3VH9A 1AMPA 2GANA 2J9AA 3E0KA 3G8WA 2B5GA 3GUXA 2EK9A 3PB8X 4CRZB 4KORA 1IYLA 1ELMP 4A37A 2K5TA 3QAHA 2OU2A 4UFWA 4ZBGA 1Z2LA 3PB9X 4OKOA 4H6UA 4KOSA 2H5MA 4FAIA 4UF4A 2AJ6A 4KLWA 2JEVA 2ZXVA 2RFHA 1ZO0A 2FS5A 4A2ZA 2ABZA 2Q51A 4AVBA 1YSJA 4FD4A 4R87A 4A32A 2V77A 3R95A 4K30A 3S6FA 4C7HA 3R9EA 2FSRA 2XEJA 3NH5A 4HNYB 5EBVA 1F57A 3BLNA 3JUWA 4A95A 4OC3A 4PXBA 5D8NA 2PJBA 1QSTA 2D4PA 3KL9A 1R43A 3KKWA 3SXNA 2GE3A 4M85A 2FE7A 2RB7A 2VQYA 4P10A 3CXSA 3R9GA 2Z3NA 2C6PA 4OC4A 3H4QA 1ON0A 4NGNA 4R6TA 2ZW4A 3PB6X 4P4IA 5F48A 4QB9A 2PJ1A 1LRZA 4CYOA 2X7BA 3DR6A 3KQZA 4MY0A 1YLOA 2DEAA 5JH9A 3KHXA 3R9FA 3GIUA 1I12A 5AG4A 1YGHA 4MRIA 2PIZA 2ZEPA 2ZOGA 3KQXA 5ELYA 2B4DA 2PJ7A 5LRJA 3TO9A 3S9NA 4ZY0A 5F46A 5LRGA 1XMBA 1KWMA 1IY7A 2CTCA 3IWGA 1WWZA 2EO8A 4P4EA 1KUVA 3IWWA 3L2NA 2Z3KA 4CGOA 2GU2A 4UCMA 4NFRA 2PSWA 4NGPA 2GIVA 2PCUA 4X5KA 4P44A 3WC6A 3I1UA 4H89A 2PR1A 3WT4A 4PSXA 1GHEA 3FEEA 2Q7BA 3SI0A 1M4GA 1UWYA 2Z0ZA 4BD9A 3LODA 4EFDA 3SI1A 2Z11A 4FD7A 2Z10A 4MCQA 2B4BA 4P6YA 2Z3PA 1X12A 2Q0YA 2NSMA 1OZPA 4KVXA 1YVOA 2B5GB 4C7IA 3FH4A 1M1DA 2GFQA 2YNCC 3S6KA 4ZX8A 3D7HA 3D8PA 1JQGA 4FWUA 4TNUA 5KTCA 1BAVA 3D68A 4HPSA 5A27A 4P4JA 1BPNA 3R1KA 2XEGA 2EUIA 3B3VA 2R98A 1QSNA 2IQ6A 3JRUA 4A30A 1LAPA 4H6ZA 2ZW7A 2V8GA 3EXNA 1RTQA 4O23A 2BSWA 2O53A 3GLJA 3HLPA 5GCNA 4NF1A 2POKA 2QYVA 4Z65A 5JM6A 2ZEOA 5LYIA 4IAVA 2PJ4A 3OWCA 1F2OA 2J8MA 4XPDC 2IJZA 3W91A 4E8OA 1IOIA 1ZG7A 4KS9A 3QAYA 3RNZA 1ZLHA 2C1CA 2VL1A 3FJUA 3VWDA 2B3VA 1Z8XA 4MCPA 4R9MA 4U9YA 2GLJA 5DWMA 2CTBA 1XRYA 6CPAA 4BINA 5JQ4A 3JTKA 2PRBA 4B5PA 5IV0A 3IO1A 5AG5A 1Y7RA 2B3UA 3FBUA 4KOTA 4IF5A 3PEIA 2JBJA 4XPKA 4CAEA 3GKRA 2VXKA 5ISVA 4KVOE 1NSAA 1YR0A 4BBHA 5C82A 4MJ8A 1HDQA 3FF3A 1Z9UA 3P2HA 5CPAA 2CNSA 5IX3A 5AG7A 4R7MA 4UIAA 4FD5A 4EMEA 4UA3A 2C6CA 4LQ6A 4GXHA 3IU1A 4MFPA 1XBUA 4ONUA 2EK8A 2I00A 4IUSA 4XNHC 5G20A 2QVPA 1CBXA 2IMOA 4MHPA 1PU9A 1F2PA 2XEIA 1CJWA 1XMTA 5DS0A 5E96A 3VWEA 3DGVA 4Q38A 4UBRA 3F0AA 3K9UA 3N5FA 4OADA 3NE7A 4NJQA 5J8CA 2CXAA 4RUHA 1Y0YA 2FXFA 2OZUA 3IGRA 4MFKA 4P4FA 4CGMA 3NFZA 1U6MA 1Z5RA 3D2PA 2GLFA 3IIBA 2J8RA 3PB4X 1R57A 3D66A 4CAFA 2DF5A 1DE4C 2QJ8A 1MJAA 2AFUA 4JXRA 4ONWA 1J4JA 4A31A 4UEEA 4OLLA 2HC9A 3T8WA 2HUZA 3KASA 3WC7A 4ORFA 5H86A 4AXVA 3B8GA 1QQ9A 1YREA 2C27A 3B35A 4CYPA 2PVVA 4OIWA 2PJ3A 3W6XA 2ZENA 3P2FA 1Z8WA 2Q4ZA 3FXTA 4CRYB 1EE3P 1LOKA 4KUAA 1Q2YA 2OZGA 3CDXA 4QBJA 5HVHA 4IK2A 3MN8A 4Y49C 4C2ZA 4RS2A 4PXEA 2R7HA 1MJ9A 2PRQA 2Q7SA 2ARHA 3KR4A 4KOWA 2FIWA 1HDUA 1YQEA 2JLMA 4I49A 4OMEA 1CPSA 1X10A 1QSMA 1XIXA 2VBQA 1K4JA 5K8OA 4PXDA 2CY2A 4B6ZA 2REFA 1Z8TA 2YGWA 1P0HA 4MXUA 4MBUA 2G0BA 4PPZA 5K8PA 2DXQA 3V38A 4C2XA 4B5PB 4PK2A 4MHZA 4UFVA 1ZLIA 2YNEA 4MI4A 4MFQA 3KI9A 1TKFA 4LX9A 2HB6A 4RI1A 3SI2A 3SJGA 4LUAA 1L0CA 5BWAB 1DTDA 4NSQA 2GREA 4YRHA 1IICA 4DJLA 2ANPA 2B58A 4X3RA 3G3SA 3TO6A 2PJ9A 4ZYQA 1RO5A 3CZXA 2AFZA 4R57A 5CNPA 5IB9A 1VKCA 2AFOA 4KOXA 3KR5A 2QMLA 1IB1E 1WK4A 1CM0A 3D7FA 4GM5A 5FVJA 3QB8A 1ZG8A 1VIXA 2ZEMA 2ZPAA 3ISXA 4MHNA 4ZX9A 3D7GA 3PBEA 1Q7LA 3IWEA 2PJAA 1XFOA 3B3WA 3A9LA 4KZTA 4JXQA 2OH1A 2ZW5A 1NE9A 1Z4RA 2PE3A 1AUGA 4G1PA 4M6IA 5HVGA 2V8DA 2FVGA 5EC4A
chains in the Genus database with same CATH topology
2NMTA 3F8KA 4II9A 3FIXA 2AE6A 3SHPA 2WSAA 1QSRA 2DPSA 4JWPA 3DR8A 3V8IA 1N71A 5DWNA 3BJ8A 2YNCA 2WPXA 4AB7A 1S7LA 2WPWA 3D3SA 3IU2A 4XPLA 2OB0A 2WUUA 1IYKA 4JD6A 5I0CA 4R3LA 1S5KA 4F0XA 3EFAA 2PC1A 1S7KA 4MFLA 5AG6A 3PGPA 3UY5A 3TO7A 2P0WA 1M44A 5F47A 2Q04A 4KUBA 4B5OA 4OAEA 2PR8A 3TFYA 4JLYA 2P6GA 2Q4YA 4UCPA 3EC4A 2JDDA 2B4DB 2D4OA 3H5ZA 2QECA 2BUEA 3LD2A 4NEXA 4DNCA 1PUAA 4KSFA 1S7NA 3TCVA 4BMHA 3DNSA 4UWJA 1MJBA 4HNXB 4L8AA 2HQYA 2BEIA 4MFZA 1TIQA 3T9YA 5IB0A 1YVKA 4R3KA 5AGEA 2CNMA 4E2AA 3R96A 2RC4A 5J8FA 5C88A 4AVCA 3S6GA 2G3AA 1NSLA 4UFXA 3JVNA 3TE4A 4KVME 4E0AA 2Z3OA 1KUYA 2KCWA 4CGNA 1Y9WA 5H84A 3BJ7A 4KOYA 2YNDA 1Q2CA 1YX0A 2Z3MA 3FYNA 3F5BA 4ZGYB 1NMTA 1BOBA 4L89A 1B87A 4CAWA 4NXYA 2ATRA 2P6FA 3I9SA 1BO4A 2I79A 4CAVA 4GS4A 2PQ8A 1QSOA 2R1IA 2BL1A 2FT0A 2VEZA 5KTAA 4KOUA 4CAXA 4FD6A 4PSWA 4PK3A 4QC6A 4QUSA 3PP9A 1B6BA 2A4NA 3RYOA 3CXPA 4CGLA 4QVTA 3W6SA 3PZJA 3CXQA 5HH1A 3GYAA 4C68A 4AG9A 4U9ZA 3ZZIA 4XPDB 3D2MA 3FNCA 2PDOA 4HNWB 2Z3LA 4UWIA 3GY9A 4J3GA 3EY5A 1XE4A 1I1DA 1S3ZA 2ZW6A 2EVNA 1KUXA 5A28A 2OZHA 4KOVA 1Z4EA 2HV2A 4PV6A 5JPHA 4AVAA 2Q44A 1Q2DA 3TOBA 1S7FA 1YLEA 1XF8A 4CS0B 3MGDA 3WR7A 2J8NA 1KZFA 4B10A 1P4NA 3TOAA 4M3SA 4HKFA 4XNHB 4AG7A 1I21A 4UCNA 2Y0MA 5G1ZA 2FCKA 1VHSA 3EO4A 3FB3A 2R8VA 2G3TA 2VZYA 3I3GA 4CYQA 4JJXA 4NCZA 3TT2A 1FY7A 4B12A 4B13A 4F6AA 1M4IA 4CYNA 3T90A 1M4DA 1Y9KA 2IL4A 3TTHA 2JDCA 3N7ZA 4YGOA 4Y49B 1SQHA 4KLVA 5F49A 2FIAA 4Q36A 3FRMA 4MFJA 2O28A 2VZZA 2P6EA 4KSAA 3ZJ0A 2QIRA 2FL4A 2CNTA 2F5IA 3SXOA 3DSBA 2Q4VA 4MHDA 4MY3A 4B11A 2DPTA 5G21A 4C2YA 1XEBA 5HMNA 3DDDA 3S6HA 4U5YA 4F0YA 4CGPA 2VI7A 1MK4A 1IIDA 4YFJA 1RXTA 1UFHA 1YK3A 4A33A 4B14A 5G22A 5KTDA 4EVYA 2REEA 1V0CA 1S60A 3C26A 2GANA 3E0KA 3G8WA 2B5GA 4CRZB 4KORA 1IYLA 2K5TA 3QAHA 2OU2A 4UFWA 4ZBGA 4H6UA 4KOSA 2H5MA 2AJ6A 4KLWA 2JEVA 2ZXVA 1ZO0A 2FS5A 4A2ZA 4AVBA 4FD4A 4R87A 4A32A 4K30A 3S6FA 4C7HA 3R9EA 2FSRA 4HNYB 5EBVA 3BLNA 3JUWA 4A95A 1QSTA 2D4PA 3KKWA 3SXNA 2GE3A 4M85A 2FE7A 2VQYA 3CXSA 3R9GA 2Z3NA 3R95A 3H4QA 1ON0A 2ZW4A 5F48A 4QB9A 1LRZA 4CYOA 2X7BA 3DR6A 4MY0A 3R9FA 1I12A 5AG4A 1YGHA 3TO9A 2B4DA 5F46A 3IWGA 1WWZA 4CGOA 1KUVA 2Z3KA 4UCMA 2PSWA 2GIVA 4X5KA 4H89A 2PR1A 4PSXA 1GHEA 2Q7BA 1M4GA 2Z0ZA 3LODA 2Z11A 4FD7A 2Z10A 2B4BA 2Z3PA 2Q0YA 4KVXA 1OZPA 1YVOA 2B5GB 4C7IA 1M1DA 2YNCC 3S6KA 3D8PA 5KTCA 5A27A 3R1KA 2EUIA 2R98A 1QSNA 4A30A 4H6ZA 2ZW7A 3EXNA 2BSWA 5GCNA 4NF1A 3OWCA 2J8MA 4XPDC 3W91A 4E8OA 4KS9A 3VWDA 2B3VA 4R9MA 4U9YA 5DWMA 5JQ4A 3JTKA 2PRBA 4B5PA 5IV0A 5AG5A 1Y7RA 2B3UA 3FBUA 4KOTA 4IF5A 4XPKA 5ISVA 4CAEA 3GKRA 2VXKA 4KVOE 1YR0A 4BBHA 5C82A 4MJ8A 1Z9UA 3P2HA 2CNSA 5IX3A 5AG7A 4FD5A 4UA3A 3IU1A 4MFPA 4ONUA 2I00A 4IUSA 4XNHC 5G20A 1PU9A 1CJWA 1XMTA 5E96A 3VWEA 4Q38A 4UBRA 3F0AA 3K9UA 4OADA 3NE7A 5J8CA 2CXAA 2FXFA 2OZUA 3IGRA 4MFKA 4CGMA 1U6MA 3D2PA 2J8RA 1R57A 4CAFA 1MJAA 4JXRA 1J4JA 4A31A 4OLLA 2HUZA 4ORFA 5H86A 3B8GA 1YREA 2C27A 4CYPA 3W6XA 3P2FA 3FXTA 4CRYB 4KUAA 1Q2YA 2OZGA 4QBJA 4Y49C 4C2ZA 4RS2A 2R7HA 1MJ9A 2ARHA 4KOWA 2FIWA 4I49A 2JLMA 1XIXA 1QSMA 2VBQA 1K4JA 2CY2A 2REFA 2YGWA 1P0HA 4MBUA 2G0BA 2DXQA 4C2XA 4B5PB 4PK2A 4UFVA 2YNEA 4MI4A 4MFQA 4LX9A 4RI1A 4LUAA 1L0CA 5BWAB 4NSQA 4YRHA 1IICA 2B58A 3TO6A 3G3SA 1RO5A 4R57A 5CNPA 1VKCA 4KOXA 2QMLA 1IB1E 1WK4A 1CM0A 5FVJA 3QB8A 2ZPAA 3IWEA 3A9LA 4KZTA 4JXQA 2OH1A 2ZW5A 1NE9A 1Z4RA 5EC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NMT A;  3F8K A;  4II9 A;  3FIX A;  2AE6 A;  3SHP A;  1QSR A;  4JWP A;  3DR8 A;  3V8I A;  1N71 A;  5DWN A;  3BJ8 A;  2WPX A;  4AB7 A;  1S7L A;  2WPW A;  3D3S A;  4XPL A;  2OB0 A;  1IYK A;  4JD6 A;  5I0C A;  4R3L A;  1S5K A;  3EFA A;  2PC1 A;  1S7K A;  3PGP A;  3UY5 A;  3TO7 A;  2P0W A;  1M44 A;  5F47 A;  2Q04 A;  4KUB A;  4B5O A;  4OAE A;  2PR8 A;  3TFY A;  4JLY A;  2P6G A;  2Q4Y A;  3EC4 A;  2JDD A;  2B4D B;  2D4O A;  2QEC A;  2BUE A;  3LD2 A;  4NEX A;  4DNC A;  1PUA A;  1S7N A;  3TCV A;  4BMH A;  3DNS A;  4UWJ A;  1MJB A;  4HNX B;  4L8A A;  2HQY A;  2BEI A;  1TIQ A;  3T9Y A;  5IB0 A;  1YVK A;  4R3K A;  2CNM A;  4E2A A;  3R96 A;  2RC4 A;  5J8F A;  5C88 A;  4AVC A;  3S6G A;  2G3A A;  1NSL A;  3JVN A;  3TE4 A;  4KVM E;  4E0A A;  1KUY A;  2KCW A;  1Y9W A;  5H84 A;  3BJ7 A;  4KOY A;  1Q2C A;  1YX0 A;  3FYN A;  3F5B A;  1NMT A;  1BOB A;  4L89 A;  1B87 A;  4CAW A;  4NXY A;  2ATR A;  2P6F A;  3I9S A;  1BO4 A;  2I79 A;  4CAV A;  4GS4 A;  2PQ8 A;  1QSO A;  2R1I A;  2BL1 A;  2FT0 A;  2VEZ A;  5KTA A;  4KOU A;  4CAX A;  4FD6 A;  4PSW A;  4PK3 A;  4QC6 A;  4QUS A;  3PP9 A;  1B6B A;  2A4N A;  3RYO A;  3CXP A;  4QVT A;  3W6S A;  3PZJ A;  3CXQ A;  5HH1 A;  3GYA A;  4AG9 A;  4U9Z A;  3ZZI A;  4XPD B;  3D2M A;  3FNC A;  2PDO A;  4HNW B;  4UWI A;  3GY9 A;  4J3G A;  3EY5 A;  1XE4 A;  1I1D A;  1S3Z A;  2ZW6 A;  2EVN A;  1KUX A;  2OZH A;  4KOV A;  1Z4E A;  2HV2 A;  4PV6 A;  5JPH A;  4AVA A;  2Q44 A;  1Q2D A;  3TOB A;  1S7F A;  1YLE A;  1XF8 A;  4CS0 B;  3MGD A;  3WR7 A;  2J8N A;  1KZF A;  1P4N A;  3TOA A;  4M3S A;  4HKF A;  4XNH B;  4AG7 A;  1I21 A;  2Y0M A;  2FCK A;  1VHS A;  3EO4 A;  3FB3 A;  2R8V A;  2G3T A;  2VZY A;  3I3G A;  4JJX A;  4NCZ A;  3TT2 A;  1FY7 A;  4F6A A;  1M4I A;  3T90 A;  1M4D A;  1Y9K A;  2IL4 A;  3TTH A;  2JDC A;  3N7Z A;  4YGO A;  4Y49 B;  1SQH A;  4KLV A;  5F49 A;  2FIA A;  3FRM A;  2O28 A;  2VZZ A;  2P6E A;  3ZJ0 A;  2QIR A;  2FL4 A;  2CNT A;  2F5I A;  3SXO A;  3DSB A;  2Q4V A;  4MHD A;  4MY3 A;  1XEB A;  5HMN A;  3DDD A;  3S6H A;  4U5Y A;  4F0Y A;  2VI7 A;  1MK4 A;  1IID A;  4YFJ A;  1RXT A;  1UFH A;  1YK3 A;  5KTD A;  4EVY A;  2REE A;  1V0C A;  1S60 A;  3C26 A;  2GAN A;  3E0K A;  3G8W A;  2B5G A;  4CRZ B;  4KOR A;  1IYL A;  2K5T A;  3QAH A;  2OU2 A;  4ZBG A;  4H6U A;  4KOS A;  2H5M A;  2AJ6 A;  4KLW A;  2JEV A;  2ZXV A;  2FS5 A;  4AVB A;  4FD4 A;  4R87 A;  4K30 A;  3S6F A;  3R9E A;  2FSR A;  4HNY B;  5EBV A;  3BLN A;  3JUW A;  1QST A;  2D4P A;  3KKW A;  3SXN A;  2GE3 A;  4M85 A;  2FE7 A;  2VQY A;  3CXS A;  3R9G A;  3R95 A;  3H4Q A;  1ON0 A;  2ZW4 A;  5F48 A;  4QB9 A;  1LRZ A;  2X7B A;  3DR6 A;  4MY0 A;  3R9F A;  1I12 A;  1YGH A;  3TO9 A;  2B4D A;  5F46 A;  3IWG A;  1WWZ A;  1KUV A;  2PSW A;  2GIV A;  4X5K A;  4H89 A;  2PR1 A;  4PSX A;  1GHE A;  2Q7B A;  1M4G A;  2Z0Z A;  3LOD A;  2Z11 A;  4FD7 A;  2Z10 A;  2B4B A;  2Q0Y A;  4KVX A;  1OZP A;  1YVO A;  2B5G B;  1M1D A;  3S6K A;  3D8P A;  5KTC A;  3R1K A;  2EUI A;  2R98 A;  1QSN A;  4H6Z A;  2ZW7 A;  3EXN A;  2BSW A;  5GCN A;  4NF1 A;  3OWC A;  2J8M A;  4XPD C;  3W91 A;  4E8O A;  3VWD A;  2B3V A;  4R9M A;  4U9Y A;  5DWM A;  5JQ4 A;  2PRB A;  4B5P A;  5IV0 A;  1Y7R A;  2B3U A;  3FBU A;  4KOT A;  4IF5 A;  4XPK A;  5ISV A;  3GKR A;  2VXK A;  4KVO E;  1YR0 A;  5C82 A;  4MJ8 A;  1Z9U A;  3P2H A;  2CNS A;  5IX3 A;  4FD5 A;  4UA3 A;  4ONU A;  2I00 A;  4IUS A;  4XNH C;  1PU9 A;  1CJW A;  1XMT A;  5E96 A;  3VWE A;  4UBR A;  3F0A A;  3K9U A;  4OAD A;  3NE7 A;  5J8C A;  2FXF A;  2OZU A;  3IGR A;  1U6M A;  3D2P A;  2J8R A;  1R57 A;  1MJA A;  4JXR A;  1J4J A;  4OLL A;  2HUZ A;  4ORF A;  5H86 A;  3B8G A;  1YRE A;  2C27 A;  3W6X A;  3P2F A;  3FXT A;  4CRY B;  4KUA A;  1Q2Y A;  2OZG A;  4QBJ A;  4Y49 C;  4RS2 A;  2R7H A;  1MJ9 A;  2ARH A;  4KOW A;  2FIW A;  4I49 A;  2JLM A;  1XIX A;  1QSM A;  2VBQ A;  1K4J A;  2CY2 A;  2REF A;  1P0H A;  4MBU A;  2G0B A;  2DXQ A;  4B5P B;  4PK2 A;  4MI4 A;  4LX9 A;  4RI1 A;  4LUA A;  1L0C A;  4NSQ A;  4YRH A;  1IIC A;  2B58 A;  3TO6 A;  3G3S A;  1RO5 A;  4R57 A;  5CNP A;  1VKC A;  4KOX A;  2QML A;  1IB1 E;  1WK4 A;  1CM0 A;  5FVJ A;  3QB8 A;  2ZPA A;  4KZT A;  4JXQ A;  2OH1 A;  2ZW5 A;  1NE9 A;  1Z4R A;  5EC4 A; 
#chains in the Genus database with same CATH topology
 4FUU A;  1ARL A;  2NMT A;  3F8K A;  4H2K A;  4II9 A;  1PYT B;  3FEC A;  1CP6 A;  1R3N A;  3FIX A;  1IGB A;  2AE6 A;  2CIJ A;  4M6H A;  3SJE A;  3H8E A;  3NE8 A;  3SHP A;  2WSA A;  2EBJ A;  1YME A;  1Y0R A;  1QSR A;  5JGF A;  2DPS A;  2BOA A;  1TXR A;  4IHM A;  3DR8 A;  4JWP A;  1N71 A;  3LWU A;  3V8I A;  1M4L A;  3VAT A;  1GYT A;  5DWN A;  3CPX A;  5LRK A;  2V8H A;  3BJ8 A;  2AFX A;  2YNC A;  1QMU A;  2WPX A;  4AB7 A;  1S7L A;  2WPW A;  3D3S A;  3IU2 A;  2PJ8 A;  4XPL A;  1CPX A;  2OB0 A;  2WUU A;  1IYK A;  1XJO A;  4JD6 A;  5I0C A;  4R3L A;  1S5K A;  4F0X A;  3EFA A;  5I4M A;  2PC1 A;  4K3N A;  4R8F A;  4UEF A;  2PJ2 A;  1S7K A;  3TC8 A;  4MFL A;  3D4U A;  5AG6 A;  3PGP A;  3PBB A;  4FBE A;  3NH4 A;  3UY5 A;  3TO7 A;  2P0W A;  1M44 A;  3IC1 A;  4MHY A;  1YW6 A;  5K8N A;  4DUK A;  2NYQ A;  2Q04 A;  3KZW A;  1LAM A;  2C6G A;  4KUB A;  5F47 A;  4OAE A;  4B5O A;  2PR8 A;  5EMI A;  2OOT A;  1YW4 A;  3TFY A;  4NGR A;  4JLY A;  2P6G A;  3CT9 A;  3NA6 A;  3WC5 A;  2Q4Y A;  4UCP A;  3EC4 A;  2JEW A;  2JDD A;  2B4D B;  2D4O A;  2AFM A;  3H5Z A;  1LFW A;  2QEC A;  2BUE A;  3LD2 A;  4NEX A;  1TKJ A;  4DNC A;  8CPA A;  1PUA A;  4KSF A;  1S7N A;  3NH8 A;  2F8H A;  3VAR A;  3TCV A;  2ZEF A;  1JWQ A;  3IEH A;  3MRU A;  4MMO A;  5LYF A;  4BMH A;  3DNS A;  4Q7A A;  1HEE A;  4UWJ A;  1MJB A;  4HNX B;  4L8A A;  5LYD A;  2HQY A;  2BEI A;  2BCO A;  4JYW A;  4MFZ A;  4UEZ A;  1TIQ A;  3T9Y A;  3FED A;  3FX6 A;  4W9Y A;  1CX8 A;  1YVK A;  2F7V A;  5IB0 A;  4R3K A;  4NGT A;  2CNM A;  5AGE A;  4E2A A;  3R96 A;  2RC4 A;  5J8F A;  2ZOF A;  4AVC A;  3S6G A;  5C88 A;  2ZEL A;  3B2Y A;  3LAC A;  4A38 A;  5THW A;  4RN7 A;  2PJC A;  3K2K A;  2G3A A;  3B7I A;  2XEF A;  4TWE A;  1NSL A;  4UFX A;  3JVN A;  5HXD A;  4OP4 A;  3TE4 A;  4KVM E;  4E0A A;  2Z3O A;  1KUY A;  2KCW A;  4F8Z A;  2V8V A;  4PQA A;  4CGN A;  1Y9W A;  4F9U A;  5H84 A;  3BJ7 A;  4KOY A;  4JZ0 A;  2YND A;  1Q2C A;  1YX0 A;  2PJ5 A;  2Z3M A;  1ELL P;  1Y7E A;  3FYN A;  3F5B A;  4ZGY B;  1NMT A;  1BOB A;  3B3T A;  5D29 A;  5K8M A;  3HUV A;  4L89 A;  1B87 A;  3D67 A;  1H8L A;  4OC2 A;  4CAW A;  4ZY1 A;  3BHX A;  4NXY A;  3K9T A;  3WAB A;  2ATR A;  2BO9 A;  3IJ3 A;  2P6F A;  3ISZ A;  3I9S A;  1BO4 A;  2PVW A;  2ZED A;  2I79 A;  4NJR A;  4CAV A;  4GS4 A;  5J1Q A;  2PQ8 A;  4WWV A;  1QSO A;  2R1I A;  3PFE A;  3S9M A;  4CPA A;  2BL1 A;  2FT0 A;  2VEZ A;  5KTA A;  1FT7 A;  4KOU A;  4CAX A;  4FD6 A;  4PSW A;  2Q43 A;  2ZEG A;  4PK3 A;  4QC6 A;  2WZN A;  3PP9 A;  4QUS A;  4WJB A;  1B6B A;  5LYL A;  2A4N A;  3RYO A;  3CXP A;  4CGL A;  4QVT A;  3W6S A;  3PZJ A;  1TF8 A;  3CXQ A;  5HH1 A;  3GYA A;  4YU9 A;  2WYR A;  4C68 A;  4LQG A;  1Z8L A;  4AG9 A;  4U9Z A;  3ZZI A;  1CP7 A;  4XPD B;  4OC1 A;  2ZEH A;  3D2M A;  3FNC A;  2PDO A;  4HNW B;  2Z3L A;  4UWI A;  3PFO A;  3GY9 A;  4J3G A;  3B3C A;  3EY5 A;  1OBR A;  1VGY A;  3FMC A;  4NGS A;  1XE4 A;  1I1D A;  3S9L A;  1S3Z A;  2ZW6 A;  2EVN A;  1KUX A;  1PCA A;  5A28 A;  2OZH A;  4KOV A;  1Z4E A;  2HV2 A;  4PV6 A;  5JPH A;  2PIY A;  4AVA A;  2Q44 A;  1FNO A;  2G9D A;  3BXM A;  1Q2D A;  3TOB A;  1S7F A;  4DYO A;  1YLE A;  4OC5 A;  1TF9 A;  3D7D A;  4X2T A;  1XF8 A;  3RAM A;  4CS0 B;  3MGD A;  4YWY A;  3IFE A;  3WR7 A;  2J8N A;  4KSI A;  1KZF A;  4B10 A;  1P4N A;  1CG2 A;  3TOA A;  2AFS A;  4NGQ A;  2CF4 A;  2PJ6 A;  4M3S A;  2O4H A;  4HKF A;  2ODF A;  4OC0 A;  4XNH B;  4AG7 A;  2JBK A;  5HVF A;  1I21 A;  3PRT A;  4UCN A;  3H8G A;  4ZY2 A;  1XOV A;  2Y0M A;  3DLJ A;  1AYE A;  5G1Z A;  4MCS A;  2FCK A;  1VHS A;  3EO4 A;  3FB3 A;  2R8V A;  4P45 A;  3B3S A;  2OR4 A;  2G3T A;  2VZY A;  4A39 A;  7CPA A;  1LAN A;  3I3G A;  4CYQ A;  1A2Z A;  3CPA A;  4JJX A;  4NCZ A;  4A94 A;  3TT2 A;  3FVL A;  1FY7 A;  4B12 A;  3V7Z A;  4B13 A;  1VHE A;  3KHZ A;  1M4I A;  4F6A A;  3TX8 A;  4CYN A;  1BPM A;  3T90 A;  1M4D A;  1Y9K A;  2IL4 A;  3TTH A;  2JDC A;  4X8I A;  3N7Z A;  4YGO A;  4Y49 B;  1ARM A;  1SQH A;  3LMS A;  1TKH A;  4KLV A;  1IU8 A;  1ZG9 A;  5F49 A;  2FIA A;  4Q36 A;  3FRM A;  4MFJ A;  4NGM A;  2O28 A;  2VZZ A;  4M6G A;  5F09 A;  2P6E A;  1IOF A;  4KSA A;  3H8F A;  3ZJ0 A;  1VHO A;  3SJF A;  2QIR A;  2AFW A;  2FL4 A;  2CNT A;  2F5I A;  2PJ0 A;  3SXO A;  3DSB A;  3BI1 A;  2Q4V A;  3PB7 X;  3RZA A;  1BLL E;  4MHD A;  4MY3 A;  4P4B A;  4B11 A;  4PXC A;  2DPT A;  5G21 A;  4C2Y A;  1XEB A;  2I3C A;  5HMN A;  3DDD A;  3RO0 A;  3S6H A;  2ZEE A;  1LCP A;  4U5Y A;  4F0Y A;  3RBU A;  4CGP A;  3SJX A;  2VI7 A;  5CBM A;  1MK4 A;  4UIB A;  3GB0 A;  1IID A;  4YFJ A;  1RXT A;  1UFH A;  4F9V A;  3KGQ A;  4R76 A;  1YK3 A;  4P4D A;  4A33 A;  4MCR A;  5G22 A;  4B14 A;  5KTD A;  3BI0 A;  4EVY A;  4OID A;  2REE A;  4ZI6 A;  1V0C A;  4EWT A;  2EWB A;  1S60 A;  3C26 A;  3QNV A;  3VH9 A;  1AMP A;  2GAN A;  2J9A A;  3E0K A;  3G8W A;  2B5G A;  3GUX A;  2EK9 A;  3PB8 X;  4CRZ B;  4KOR A;  1IYL A;  1ELM P;  4A37 A;  2K5T A;  3QAH A;  2OU2 A;  4UFW A;  4ZBG A;  1Z2L A;  3PB9 X;  4OKO A;  4H6U A;  4KOS A;  2H5M A;  4FAI A;  4UF4 A;  2AJ6 A;  4KLW A;  2JEV A;  2ZXV A;  2RFH A;  1ZO0 A;  2FS5 A;  4A2Z A;  2ABZ A;  2Q51 A;  4AVB A;  1YSJ A;  4FD4 A;  4R87 A;  4A32 A;  2V77 A;  3R95 A;  4K30 A;  3S6F A;  4C7H A;  3R9E A;  2FSR A;  2XEJ A;  3NH5 A;  4HNY B;  5EBV A;  1F57 A;  3BLN A;  3JUW A;  4A95 A;  4OC3 A;  4PXB A;  5D8N A;  2PJB A;  1QST A;  2D4P A;  3KL9 A;  1R43 A;  3KKW A;  3SXN A;  2GE3 A;  4M85 A;  2FE7 A;  2RB7 A;  2VQY A;  4P10 A;  3CXS A;  3R9G A;  2Z3N A;  2C6P A;  4OC4 A;  3H4Q A;  1ON0 A;  4NGN A;  4R6T A;  2ZW4 A;  3PB6 X;  4P4I A;  5F48 A;  4QB9 A;  2PJ1 A;  1LRZ A;  4CYO A;  2X7B A;  3DR6 A;  3KQZ A;  4MY0 A;  1YLO A;  2DEA A;  5JH9 A;  3KHX A;  3R9F A;  3GIU A;  1I12 A;  5AG4 A;  1YGH A;  4MRI A;  2PIZ A;  2ZEP A;  2ZOG A;  3KQX A;  5ELY A;  2B4D A;  2PJ7 A;  5LRJ A;  3TO9 A;  3S9N A;  4ZY0 A;  5F46 A;  5LRG A;  1XMB A;  1KWM A;  1IY7 A;  2CTC A;  3IWG A;  1WWZ A;  2EO8 A;  4P4E A;  1KUV A;  3IWW A;  3L2N A;  2Z3K A;  4CGO A;  2GU2 A;  4UCM A;  4NFR A;  2PSW A;  4NGP A;  2GIV A;  2PCU A;  4X5K A;  4P44 A;  3WC6 A;  3I1U A;  4H89 A;  2PR1 A;  3WT4 A;  4PSX A;  1GHE A;  3FEE A;  2Q7B A;  3SI0 A;  1M4G A;  1UWY A;  2Z0Z A;  4BD9 A;  3LOD A;  4EFD A;  3SI1 A;  2Z11 A;  4FD7 A;  2Z10 A;  4MCQ A;  2B4B A;  4P6Y A;  2Z3P A;  1X12 A;  2Q0Y A;  2NSM A;  1OZP A;  4KVX A;  1YVO A;  2B5G B;  4C7I A;  3FH4 A;  1M1D A;  2GFQ A;  2YNC C;  3S6K A;  4ZX8 A;  3D7H A;  3D8P A;  1JQG A;  4FWU A;  4TNU A;  5KTC A;  1BAV A;  3D68 A;  4HPS A;  5A27 A;  4P4J A;  1BPN A;  3R1K A;  2XEG A;  2EUI A;  3B3V A;  2R98 A;  1QSN A;  2IQ6 A;  3JRU A;  4A30 A;  1LAP A;  4H6Z A;  2ZW7 A;  2V8G A;  3EXN A;  1RTQ A;  4O23 A;  2BSW A;  2O53 A;  3GLJ A;  3HLP A;  5GCN A;  4NF1 A;  2POK A;  2QYV A;  4Z65 A;  5JM6 A;  2ZEO A;  5LYI A;  4IAV A;  2PJ4 A;  3OWC A;  1F2O A;  2J8M A;  4XPD C;  2IJZ A;  3W91 A;  4E8O A;  1IOI A;  1ZG7 A;  4KS9 A;  3QAY A;  3RNZ A;  1ZLH A;  2C1C A;  2VL1 A;  3FJU A;  3VWD A;  2B3V A;  1Z8X A;  4MCP A;  4R9M A;  4U9Y A;  2GLJ A;  5DWM A;  2CTB A;  1XRY A;  6CPA A;  4BIN A;  5JQ4 A;  3JTK A;  2PRB A;  4B5P A;  5IV0 A;  3IO1 A;  5AG5 A;  1Y7R A;  2B3U A;  3FBU A;  4KOT A;  4IF5 A;  3PEI A;  2JBJ A;  4XPK A;  4CAE A;  3GKR A;  2VXK A;  5ISV A;  4KVO E;  1NSA A;  1YR0 A;  4BBH A;  5C82 A;  4MJ8 A;  1HDQ A;  3FF3 A;  1Z9U A;  3P2H A;  5CPA A;  2CNS A;  5IX3 A;  5AG7 A;  4R7M A;  4UIA A;  4FD5 A;  4EME A;  4UA3 A;  2C6C A;  4LQ6 A;  4GXH A;  3IU1 A;  4MFP A;  1XBU A;  4ONU A;  2EK8 A;  2I00 A;  4IUS A;  4XNH C;  5G20 A;  2QVP A;  1CBX A;  2IMO A;  4MHP A;  1PU9 A;  1F2P A;  2XEI A;  1CJW A;  1XMT A;  5DS0 A;  5E96 A;  3VWE A;  3DGV A;  4Q38 A;  4UBR A;  3F0A A;  3K9U A;  3N5F A;  4OAD A;  3NE7 A;  4NJQ A;  5J8C A;  2CXA A;  4RUH A;  1Y0Y A;  2FXF A;  2OZU A;  3IGR A;  4MFK A;  4P4F A;  4CGM A;  3NFZ A;  1U6M A;  1Z5R A;  3D2P A;  2GLF A;  3IIB A;  2J8R A;  3PB4 X;  1R57 A;  3D66 A;  4CAF A;  2DF5 A;  1DE4 C;  2QJ8 A;  1MJA A;  2AFU A;  4JXR A;  4ONW A;  1J4J A;  4A31 A;  4UEE A;  4OLL A;  2HC9 A;  3T8W A;  2HUZ A;  3KAS A;  3WC7 A;  4ORF A;  5H86 A;  4AXV A;  3B8G A;  1QQ9 A;  1YRE A;  2C27 A;  3B35 A;  4CYP A;  2PVV A;  4OIW A;  2PJ3 A;  3W6X A;  2ZEN A;  3P2F A;  1Z8W A;  2Q4Z A;  3FXT A;  4CRY B;  1EE3 P;  1LOK A;  4KUA A;  1Q2Y A;  2OZG A;  3CDX A;  4QBJ A;  5HVH A;  4IK2 A;  3MN8 A;  4Y49 C;  4C2Z A;  4RS2 A;  4PXE A;  2R7H A;  1MJ9 A;  2PRQ A;  2Q7S A;  2ARH A;  3KR4 A;  4KOW A;  2FIW A;  1HDU A;  1YQE A;  2JLM A;  4I49 A;  4OME A;  1CPS A;  1X10 A;  1QSM A;  1XIX A;  2VBQ A;  1K4J A;  5K8O A;  4PXD A;  2CY2 A;  4B6Z A;  2REF A;  1Z8T A;  2YGW A;  1P0H A;  4MXU A;  4MBU A;  2G0B A;  4PPZ A;  5K8P A;  2DXQ A;  3V38 A;  4C2X A;  4B5P B;  4PK2 A;  4MHZ A;  4UFV A;  1ZLI A;  2YNE A;  4MI4 A;  4MFQ A;  3KI9 A;  1TKF A;  4LX9 A;  2HB6 A;  4RI1 A;  3SI2 A;  3SJG A;  4LUA A;  1L0C A;  5BWA B;  1DTD A;  4NSQ A;  2GRE A;  4YRH A;  1IIC A;  4DJL A;  2ANP A;  2B58 A;  4X3R A;  3G3S A;  3TO6 A;  2PJ9 A;  4ZYQ A;  1RO5 A;  3CZX A;  2AFZ A;  4R57 A;  5CNP A;  5IB9 A;  1VKC A;  2AFO A;  4KOX A;  3KR5 A;  2QML A;  1IB1 E;  1WK4 A;  1CM0 A;  3D7F A;  4GM5 A;  5FVJ A;  3QB8 A;  1ZG8 A;  1VIX A;  2ZEM A;  2ZPA A;  3ISX A;  4MHN A;  4ZX9 A;  3D7G A;  3PBE A;  1Q7L A;  3IWE A;  2PJA A;  1XFO A;  3B3W A;  3A9L A;  4KZT A;  4JXQ A;  2OH1 A;  2ZW5 A;  1NE9 A;  1Z4R A;  2PE3 A;  1AUG A;  4G1P A;  4M6I A;  5HVG A;  2V8D A;  2FVG A;  5EC4 A; 
#chains in the Genus database with same CATH homology
 2NMT A;  3F8K A;  4II9 A;  3FIX A;  2AE6 A;  3SHP A;  2WSA A;  1QSR A;  2DPS A;  4JWP A;  3DR8 A;  3V8I A;  1N71 A;  5DWN A;  3BJ8 A;  2YNC A;  2WPX A;  4AB7 A;  1S7L A;  2WPW A;  3D3S A;  3IU2 A;  4XPL A;  2OB0 A;  2WUU A;  1IYK A;  4JD6 A;  5I0C A;  4R3L A;  1S5K A;  4F0X A;  3EFA A;  2PC1 A;  1S7K A;  4MFL A;  5AG6 A;  3PGP A;  3UY5 A;  3TO7 A;  2P0W A;  1M44 A;  5F47 A;  2Q04 A;  4KUB A;  4B5O A;  4OAE A;  2PR8 A;  3TFY A;  4JLY A;  2P6G A;  2Q4Y A;  4UCP A;  3EC4 A;  2JDD A;  2B4D B;  2D4O A;  3H5Z A;  2QEC A;  2BUE A;  3LD2 A;  4NEX A;  4DNC A;  1PUA A;  4KSF A;  1S7N A;  3TCV A;  4BMH A;  3DNS A;  4UWJ A;  1MJB A;  4HNX B;  4L8A A;  2HQY A;  2BEI A;  4MFZ A;  1TIQ A;  3T9Y A;  5IB0 A;  1YVK A;  4R3K A;  5AGE A;  2CNM A;  4E2A A;  3R96 A;  2RC4 A;  5J8F A;  5C88 A;  4AVC A;  3S6G A;  2G3A A;  1NSL A;  4UFX A;  3JVN A;  3TE4 A;  4KVM E;  4E0A A;  2Z3O A;  1KUY A;  2KCW A;  4CGN A;  1Y9W A;  5H84 A;  3BJ7 A;  4KOY A;  2YND A;  1Q2C A;  1YX0 A;  2Z3M A;  3FYN A;  3F5B A;  4ZGY B;  1NMT A;  1BOB A;  4L89 A;  1B87 A;  4CAW A;  4NXY A;  2ATR A;  2P6F A;  3I9S A;  1BO4 A;  2I79 A;  4CAV A;  4GS4 A;  2PQ8 A;  1QSO A;  2R1I A;  2BL1 A;  2FT0 A;  2VEZ A;  5KTA A;  4KOU A;  4CAX A;  4FD6 A;  4PSW A;  4PK3 A;  4QC6 A;  4QUS A;  3PP9 A;  1B6B A;  2A4N A;  3RYO A;  3CXP A;  4CGL A;  4QVT A;  3W6S A;  3PZJ A;  3CXQ A;  5HH1 A;  3GYA A;  4C68 A;  4AG9 A;  4U9Z A;  3ZZI A;  4XPD B;  3D2M A;  3FNC A;  2PDO A;  4HNW B;  2Z3L A;  4UWI A;  3GY9 A;  4J3G A;  3EY5 A;  1XE4 A;  1I1D A;  1S3Z A;  2ZW6 A;  2EVN A;  1KUX A;  5A28 A;  2OZH A;  4KOV A;  1Z4E A;  2HV2 A;  4PV6 A;  5JPH A;  4AVA A;  2Q44 A;  1Q2D A;  3TOB A;  1S7F A;  1YLE A;  1XF8 A;  4CS0 B;  3MGD A;  3WR7 A;  2J8N A;  1KZF A;  4B10 A;  1P4N A;  3TOA A;  4M3S A;  4HKF A;  4XNH B;  4AG7 A;  1I21 A;  4UCN A;  2Y0M A;  5G1Z A;  2FCK A;  1VHS A;  3EO4 A;  3FB3 A;  2R8V A;  2G3T A;  2VZY A;  3I3G A;  4CYQ A;  4JJX A;  4NCZ A;  3TT2 A;  1FY7 A;  4B12 A;  4B13 A;  4F6A A;  1M4I A;  4CYN A;  3T90 A;  1M4D A;  1Y9K A;  2IL4 A;  3TTH A;  2JDC A;  3N7Z A;  4YGO A;  4Y49 B;  1SQH A;  4KLV A;  5F49 A;  2FIA A;  4Q36 A;  3FRM A;  4MFJ A;  2O28 A;  2VZZ A;  2P6E A;  4KSA A;  3ZJ0 A;  2QIR A;  2FL4 A;  2CNT A;  2F5I A;  3SXO A;  3DSB A;  2Q4V A;  4MHD A;  4MY3 A;  4B11 A;  2DPT A;  5G21 A;  4C2Y A;  1XEB A;  5HMN A;  3DDD A;  3S6H A;  4U5Y A;  4F0Y A;  4CGP A;  2VI7 A;  1MK4 A;  1IID A;  4YFJ A;  1RXT A;  1UFH A;  1YK3 A;  4A33 A;  4B14 A;  5G22 A;  5KTD A;  4EVY A;  2REE A;  1V0C A;  1S60 A;  3C26 A;  2GAN A;  3E0K A;  3G8W A;  2B5G A;  4CRZ B;  4KOR A;  1IYL A;  2K5T A;  3QAH A;  2OU2 A;  4UFW A;  4ZBG A;  4H6U A;  4KOS A;  2H5M A;  2AJ6 A;  4KLW A;  2JEV A;  2ZXV A;  1ZO0 A;  2FS5 A;  4A2Z A;  4AVB A;  4FD4 A;  4R87 A;  4A32 A;  4K30 A;  3S6F A;  4C7H A;  3R9E A;  2FSR A;  4HNY B;  5EBV A;  3BLN A;  3JUW A;  4A95 A;  1QST A;  2D4P A;  3KKW A;  3SXN A;  2GE3 A;  4M85 A;  2FE7 A;  2VQY A;  3CXS A;  3R9G A;  2Z3N A;  3R95 A;  3H4Q A;  1ON0 A;  2ZW4 A;  5F48 A;  4QB9 A;  1LRZ A;  4CYO A;  2X7B A;  3DR6 A;  4MY0 A;  3R9F A;  1I12 A;  5AG4 A;  1YGH A;  3TO9 A;  2B4D A;  5F46 A;  3IWG A;  1WWZ A;  4CGO A;  1KUV A;  2Z3K A;  4UCM A;  2PSW A;  2GIV A;  4X5K A;  4H89 A;  2PR1 A;  4PSX A;  1GHE A;  2Q7B A;  1M4G A;  2Z0Z A;  3LOD A;  2Z11 A;  4FD7 A;  2Z10 A;  2B4B A;  2Z3P A;  2Q0Y A;  4KVX A;  1OZP A;  1YVO A;  2B5G B;  4C7I A;  1M1D A;  2YNC C;  3S6K A;  3D8P A;  5KTC A;  5A27 A;  3R1K A;  2EUI A;  2R98 A;  1QSN A;  4A30 A;  4H6Z A;  2ZW7 A;  3EXN A;  2BSW A;  5GCN A;  4NF1 A;  3OWC A;  2J8M A;  4XPD C;  3W91 A;  4E8O A;  4KS9 A;  3VWD A;  2B3V A;  4R9M A;  4U9Y A;  5DWM A;  5JQ4 A;  3JTK A;  2PRB A;  4B5P A;  5IV0 A;  5AG5 A;  1Y7R A;  2B3U A;  3FBU A;  4KOT A;  4IF5 A;  4XPK A;  5ISV A;  4CAE A;  3GKR A;  2VXK A;  4KVO E;  1YR0 A;  4BBH A;  5C82 A;  4MJ8 A;  1Z9U A;  3P2H A;  2CNS A;  5IX3 A;  5AG7 A;  4FD5 A;  4UA3 A;  3IU1 A;  4MFP A;  4ONU A;  2I00 A;  4IUS A;  4XNH C;  5G20 A;  1PU9 A;  1CJW A;  1XMT A;  5E96 A;  3VWE A;  4Q38 A;  4UBR A;  3F0A A;  3K9U A;  4OAD A;  3NE7 A;  5J8C A;  2CXA A;  2FXF A;  2OZU A;  3IGR A;  4MFK A;  4CGM A;  1U6M A;  3D2P A;  2J8R A;  1R57 A;  4CAF A;  1MJA A;  4JXR A;  1J4J A;  4A31 A;  4OLL A;  2HUZ A;  4ORF A;  5H86 A;  3B8G A;  1YRE A;  2C27 A;  4CYP A;  3W6X A;  3P2F A;  3FXT A;  4CRY B;  4KUA A;  1Q2Y A;  2OZG A;  4QBJ A;  4Y49 C;  4C2Z A;  4RS2 A;  2R7H A;  1MJ9 A;  2ARH A;  4KOW A;  2FIW A;  4I49 A;  2JLM A;  1XIX A;  1QSM A;  2VBQ A;  1K4J A;  2CY2 A;  2REF A;  2YGW A;  1P0H A;  4MBU A;  2G0B A;  2DXQ A;  4C2X A;  4B5P B;  4PK2 A;  4UFV A;  2YNE A;  4MI4 A;  4MFQ A;  4LX9 A;  4RI1 A;  4LUA A;  1L0C A;  5BWA B;  4NSQ A;  4YRH A;  1IIC A;  2B58 A;  3TO6 A;  3G3S A;  1RO5 A;  4R57 A;  5CNP A;  1VKC A;  4KOX A;  2QML A;  1IB1 E;  1WK4 A;  1CM0 A;  5FVJ A;  3QB8 A;  2ZPA A;  3IWE A;  3A9L A;  4KZT A;  4JXQ A;  2OH1 A;  2ZW5 A;  1NE9 A;  1Z4R A;  5EC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...