1TKJA

Streptomyces griseus aminopeptidase complexed with d-methionine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
277
structure length
277
Chain Sequence
b'APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
molecule tags Hydrolase
total genus 112
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkjA00
1R3NA 1TXRA 1QQ9A 1FNOA 2PJ7A 2FVGA 5ELYA 3PBBA 3B7IA 5JGFA 1BPNA 4P4BA 4YU9A 5LRKA 2RFHA 1CX8A 3KQXA 3KHZA 3BI0A 1LOKA 2PIZA 4ZX9A 3PB8X 2ZEEA 2ANPA 5LRJA 4OC2A 4IAVA 4FUUA 5D29A 1LAMA 1TKJA 4GM5A 3GB0A 4UEEA 2C1CA 2PJBA 3PEIA 1CG2A 4NGPA 3FH4A 4Z65A 2PJ2A 2QVPA 4UIBA 1QMUA 3WC5A 3KHXA 2ZEFA 2CTBA 4X8IA 2PVVA 3BXMA 1XBUA 2JBKA 2AFZA 2PJ0A 4PXBA 4P4EA 2ZEHA 4X2TA 4OP4A 3KQZA 1VHEA 2C6PA 4A37A 2G9DA 3DGVA 2PE3A 4P10A 4IHMA 3PFOA 3DLJA 4PXCA 2PRQA 2QJ8A 2AFUA 3WT4A 3FMCA 4JYWA 3NH8A 2ZEDA 3PFEA 3QNVA 4WWVA 2F8HA 4EFDA 2DEAA 3WC7A 2Q4ZA 1IY7A 2PIYA 3IWWA 3FF3A 1PYTB 2XEFA 3I1UA 2WYRA 2OOTA 3FX6A 1ZG9A 5DS0A 3B3VA 1R43A 3FECA 3IIBA 5K8PA 4O23A 1BLLE 5K8NA 4X3RA 2V8HA 3V38A 4FBEA 4MRIA 3WC6A 4FWUA 1TKHA 2C6CA 4OC0A 2C6GA 3PB9X 1OBRA 2JBJA 2PJAA 3WABA 3S9MA 3FEDA 1HDQA 3PB7X 2AFWA 1Z5RA 2CIJA 5K8MA 1LFWA 2ZOGA 4NGSA 4NFRA 1CBXA 1ZLIA 4ZI6A 3FJUA 1M4LA 4R6TA 4R76A 4W9YA 2PJCA 3D4UA 3TX8A 1CP6A 4PQAA 1H8LA 2OR4A 3GLJA 2CF4A 2PJ4A 3K9TA 3S9LA 1HEEA 4P4IA 1UWYA 3D68A 2PJ1A 4MHPA 1VHOA 4OIDA 4UEFA 1XRYA 2AFSA 2ZEOA 1ZG8A 3SJFA 4R8FA 4MHZA 4NGMA 2NSMA 7CPAA 4OC3A 3H8GA 3H8EA 1YSJA 3NH4A 2AFOA 4JZ0A 3IO1A 2NYQA 4Q7AA 4MCRA 3RBUA 5LYLA 4F9UA 4OC1A 1CP7A 4NGTA 4F8ZA 1ARLA 2O53A 3KL9A 1Y0RA 3JRUA 3CPAA 1Y0YA 1XJOA 2IQ6A 4UIAA 3CDXA 4AXVA 3PB6X 4MCQA 1TF8A 3B2YA 5HVFA 3D7HA 4ZYQA 1Z8LA 2XEGA 5JH9A 1KWMA 4A39A 5HVHA 4B6ZA 3VH9A 2HC9A 2O4HA 1NSAA 3B3CA 2EK8A 3PB4X 1VIXA 2PJ3A 3SI0A 3HUVA 4NGQA 3B3TA 3D7GA 4PXEA 1DTDA 4ZY1A 1AYEA 2RB7A 5THWA 4EWTA 3MRUA 1Y7EA 2AFMA 4EMEA 4A38A 3BI1A 5F09A 1LANA 1BAVA 4FAIA 3PBEA 4P4JA 1DE4C 2PJ9A 3K2KA 4P44A 3RZAA 3GUXA 2ZEGA 4MHYA 1F2OA 2F7VA 3SJXA 5HXDA 2CTCA 3KZWA 5LYDA 4DYOA 3IC1A 4RUHA 2ZEMA 2QYVA 4PXDA 3B3WA 2IJZA 3KI9A 2ABZA 1F57A 1GYTA 1LCPA 3D66A 2AFXA 5I4MA 2ZEPA 3PRTA 1YLOA 3IEHA 1IGBA 4NGNA 3D7FA 4CPAA 1ARMA 4P4FA 3T8WA 2XEIA 1YW4A 5CBMA 3L2NA 5IB9A 2V8DA 2J9AA 2GU2A 4ZX8A 2PJ8A 3CT9A 3VATA 4DJLA 3KR4A 1RTQA 4MMOA 2GLFA 1VGYA 4IK2A 2WZNA 1JQGA 4NGRA 3NH5A 1PCAA 4MCSA 4OMEA 3B3SA 1ZLHA 2BCOA 2ZELA 3SI2A 3LMSA 4P6YA 4P4DA 2ZENA 4K3NA 2PVWA 1ELMP 2IMOA 4A94A 1CPXA 1EE3P 3NA6A 1HDUA 5LYFA 4KSIA 4OC5A 2V8GA 5K8OA 6CPAA 3MN8A 1TF9A 3KGQA 5LRGA 4F9VA 4TNUA 4UEZA 4LQGA 2EK9A 1FT7A 4TWEA 4H2KA 3SJGA 3VARA 4ZY2A 4NJQA 4DUKA 2JEWA 4ZY0A 4MCPA 1ZG7A 2PJ5A 2BO9A 3KASA 1AMPA 1F2PA 2PJ6A 2I3CA 4MHNA 3BHXA 1XFOA 1XMBA 4UF4A 1LAPA 2V77A 3NFZA 4MXUA 3ISXA 5CPAA 2BOAA 2Q51A 3HLPA 3IFEA 5D8NA 1TKFA 4WJBA 4NJRA 3SJEA 8CPAA 3V7ZA 4ONWA 3D7DA 3D67A 1YMEA 4PPZA 2VL1A 3S9NA 1BPMA 3H8FA 4BD9A 5LYIA 3CPXA 3FVLA 3RAMA 3KR5A 3B35A 1ELLP 2HB6A 5HVGA 2PCUA 5J1QA 3TC8A 4G1PA 1CPSA 3N5FA 1Q7LA 3FEEA 1Z2LA 2EWBA 4R7MA 3LWUA 2GREA 2V8VA 2POKA 2XEJA 2GLJA 4P45A 3IJ3A 1YW6A 3SI1A 2Q43A 5JM6A 2ZOFA 4OIWA 4OC4A 4YWYA 3ISZA 4OKOA
chains in the Genus database with same CATH superfamily
1R3NA 4UA3A 1TXRA 2Z0ZA 4RI1A 2IL4A 2B58A 2ARHA 2X7BA 1QQ9A 1FNOA 1PUAA 4B10A 2PJ7A 2B5GA 2C27A 2FVGA 5ELYA 3PBBA 3W6SA 5HH1A 3B7IA 2GANA 1BPNA 1NE9A 3NE7A 4P4BA 4YU9A 4CS0B 4PV6A 4QBJA 2G3AA 5LRKA 4CAVA 4KORA 2RFHA 1CX8A 3T90A 3A9LA 3KQXA 3KHZA 1YVOA 3BI0A 3IWEA 5AG4A 2B3UA 2P6GA 4JWPA 2KCWA 4R9MA 1I21A 2B4BA 1LOKA 3FYNA 3D2MA 3EY5A 4A95A 4KOTA 4A30A 2PIZA 4ZX9A 3PB8X 2ZEEA 3S6KA 1SQHA 2ANPA 2I79A 4MI4A 2ZXVA 1LRZA 5LRJA 4OC2A 2PR1A 1Z8XA 4IAVA 4FUUA 4X5KA 5D29A 5JQ4A 3ZJ0A 1LAMA 1TKJA 4GM5A 3GB0A 4KOWA 5H86A 4YGOA 3FB3A 4UEEA 2C1CA 2PJBA 3LACA 3P2HA 4CAWA 3PEIA 2J8MA 2QIRA 4XPKA 1CG2A 4NGPA 3SXNA 3FH4A 2ATRA 4M6HA 4Q36A 3OWCA 4Z65A 2PJ2A 2Q04A 2QVPA 5AG6A 1CM0A 1M4GA 4A33A 3I3GA 4UIBA 1QMUA 1X12A 3WC5A 2JDCA 1YGHA 2GIVA 1ZO0A 3KHXA 2PC1A 2ZEFA 1VKCA 2CTBA 4X8IA 4MFQA 2PVVA 3BXMA 2JLMA 3JVNA 1XBUA 2JBKA 2AFZA 1K4JA 5EC4A 5G1ZA 2PJ0A 4PXBA 4P4EA 2ZEHA 4CAFA 5F48A 5G21A 4LX9A 2PSWA 2QECA 4OP4A 4X2TA 2EO8A 1S7NA 3B8GA 1IB1E 3KQZA 1VHEA 5C82A 2C6PA 5E96A 4R57A 4A37A 1Z8TA 1M1DA 2VI7A 2G9DA 4E2AA 3DGVA 2PE3A 3DSBA 4LQ6A 1P4NA 4P10A 4C68A 4IHMA 3PFOA 3DLJA 4PXCA 5CNPA 2PRQA 2QJ8A 2AFUA 1WK4A 3QAYA 1IOIA 1IOFA 4RN7A 3WT4A 4CYOA 1WWZA 3FMCA 5H84A 3SXOA 3W91A 4JD6A 4JYWA 3S6FA 1A2ZA 3NH8A 4KZTA 2Z3LA 2ZEDA 5AGEA 4HPSA 3PFEA 4KSAA 3QNVA 4WWVA 5A28A 2O28A 2Q4VA 2Z3PA 2Z3OA 2F8HA 3F5BA 4EFDA 2DEAA 3WC7A 2Q4ZA 1IY7A 2PIYA 3BLNA 3TCVA 3IWWA 4MFJA 3FF3A 1PYTB 2WPXA 3FXTA 2XEFA 3KKWA 3I1UA 3TT2A 2WYRA 2OOTA 5IX3A 4A32A 1KUYA 3FX6A 1ZG9A 1YK3A 3CZXA 4GXHA 5DS0A 3B3VA 1R43A 2PRBA 4MFZA 3FECA 3IIBA 5K8PA 1S7LA 1TIQA 2HV2A 2AJ6A 1KUXA 4CYNA 4O23A 1BLLE 3F0AA 3LD2A 4ORFA 5K8NA 4X3RA 3D8PA 2V8HA 3V38A 4M3SA 4FBEA 1UFHA 4MRIA 3WC6A 4FWUA 2ZW7A 1TKHA 2C6CA 4OC0A 1GHEA 2C6GA 2G0BA 2J8RA 3TE4A 1B87A 4A31A 3PB9X 4L89A 1OBRA 2JBJA 2PJAA 1QSOA 3WABA 4KSFA 3S9MA 3FEDA 1HDQA 1M4DA 2EVNA 3EXNA 3PB7X 4KLVA 2QMLA 1OZPA 2AFWA 1Z5RA 2ZW5A 2D4PA 4FD7A 3R9EA 2CIJA 1MJ9A 5K8MA 4CRYB 2FSRA 1QSMA 1LFWA 3P2FA 3R96A 3FRMA 1PU9A 2Z3KA 2ZOGA 4NGSA 4NFRA 4IF5A 4YFJA 4CGPA 3T9YA 1CBXA 1ZLIA 2B5GB 4ZI6A 3FJUA 2OZGA 4UCNA 1Q2CA 1M4LA 4R6TA 4PSXA 4R76A 1Q2DA 3RO0A 1I12A 4W9YA 2PJCA 4FD4A 2Q0YA 3D4UA 4J3GA 1CP6A 4PQAA 3TO7A 3TX8A 1IYLA 1H8LA 4B5PA 5IB0A 5EBVA 2OR4A 3GLJA 2CF4A 2PJ4A 3K9TA 3S9LA 4CYPA 1HEEA 4P4IA 1UWYA 4U5YA 4XNHC 5KTAA 3E0KA 3D68A 4MBUA 2PJ1A 4CRZB 1V0CA 4MHPA 1VHOA 4KVOE 4OIDA 4U9YA 4AVAA 4YRHA 4UEFA 1XRYA 2Q44A 2AFSA 4R87A 5ISVA 2ZEOA 1ZG8A 3SJFA 5A27A 4R8FA 4MHZA 4NGMA 1YQEA 1S60A 2CNMA 2NSMA 4HNWB 4OC3A 1Y9KA 3H8EA 3H8GA 1YSJA 2JEVA 7CPAA 3NH4A 2AFOA 4MY0A 3MGDA 4JZ0A 4CYQA 3IO1A 4B11A 2NYQA 4Q7AA 4KLWA 4MCRA 3CXSA 3RBUA 4MFLA 1XEBA 4M6IA 5LYLA 4F9UA 2B3VA 4OC1A 1CP7A 3TFYA 4NGTA 4F8ZA 1ARLA 5F09A 2WPWA 2O53A 2DXQA 1B6BA 5F46A 1YR0A 1RXTA 1Y9WA 3KL9A 1Y0RA 3JRUA 3H4QA 3CPAA 1QSTA 1Y0YA 1XJOA 2R8VA 2IQ6A 2YNDA 4UIAA 3CDXA 4AXVA 3IU2A 3PB6X 4MCQA 1TF8A 3B2YA 5HVFA 3D7HA 4ZYQA 1Z8LA 2XEGA 5JH9A 1KWMA 1MK4A 1L0CA 4A39A 3FIXA 5HVHA 2CNTA 2DPSA 4IUSA 4KS9A 3VH9A 4B6ZA 2HC9A 2O4HA 1NSAA 3B3CA 2EK8A 3PB4X 3DNSA 2DPTA 4CGLA 1VIXA 2FT0A 2PJ3A 4JXRA 3SI0A 3HUVA 4NGQA 3B3TA 2BUEA 3D7GA 4PXEA 3IU1A 1DTDA 1S7KA 4AG7A 4ZY1A 1AYEA 4LUAA 2RB7A 1VHSA 2WUUA 5THWA 1J4JA 4EWTA 1S3ZA 2OB0A 2F5IA 3MRUA 1Y7EA 3F8KA 2AFMA 4CGOA 2R1IA 4EMEA 1R57A 4A38A 5KTCA 2AE6A 3BI1A 2FL4A 3VWEA 3H5ZA 4R3KA 1LANA 1BAVA 4H89A 4ZBGA 4FAIA 3PBEA 4P4JA 3R9FA 3CXQA 4QB9A 1DE4C 2PJ9A 3K2KA 4P44A 3RZAA 2REFA 3GUXA 2ZEGA 4MHYA 1F2OA 1JWQA 2BSWA 2RC4A 5JGFA 2F7VA 3RYOA 2OH1A 4UCPA 2B4DA 3SJXA 5HXDA 4MJ8A 1KZFA 4NSQA 2CTCA 1YX0A 3TOAA 2A4NA 3KZWA 4CGNA 5LYDA 4DYOA 3IC1A 4RUHA 2ZEMA 3GIUA 3GYAA 2QYVA 1QSRA 1IU8A 5AG5A 4E8OA 4PXDA 1IICA 4KUAA 4B5OA 3B3WA 3SHPA 4UWIA 2BEIA 2IJZA 4XNHB 3KI9A 4C2ZA 2NMTA 2ABZA 1XOVA 3DR6A 1F57A 1GYTA 1LCPA 3D66A 2AFXA 2YNCA 5I4MA 2ZEPA 4CAXA 3PRTA 3PZJA 3I9SA 1YLOA 4JXQA 3IEHA 1IGBA 2FIWA 4NGNA 3D7FA 4CPAA 1ARMA 1KUVA 4P4FA 3VWDA 2Q4YA 4MY3A 3T8WA 4B14A 2FS5A 5I0CA 2XEIA 2FCKA 4HNYB 4NEXA 3WR7A 1YW4A 1CJWA 4ZGYB 5CBMA 4CAEA 1NMTA 3L2NA 1S7FA 5IB9A 1YLEA 3N7ZA 4R3LA 1I1DA 3JTKA 2GFQA 1M44A 4DNCA 2FIAA 3G8WA 3DR8A 2ODFA 2REEA 2V8DA 2J9AA 4UBRA 3C26A 2GU2A 4ZX8A 2PJ8A 2OU2A 3CT9A 3VATA 4C2YA 4DJLA 1Y7RA 2VBQA 3KR4A 1FY7A 1RTQA 4UFWA 4MMOA 1MJBA 3R9GA 2GLFA 3W6XA 1MJAA 1VGYA 4NCZA 4IK2A 2WZNA 1JQGA 4NGRA 4B5PB 3JUWA 3NH5A 4F6AA 1PCAA 4MCSA 1Z4EA 4OMEA 2R98A 1BOBA 3B3SA 1ZLHA 3PP9A 2BCOA 2YNCC 2ZELA 4XPLA 1U6MA 4ONUA 3NE8A 4M6GA 3SI2A 2VZYA 2Z10A 5F47A 3LMSA 5DWMA 2Z3MA 3S6GA 4XPDB 2D4OA 4P6YA 4AVCA 4KOUA 4P4DA 2ZENA 3GKRA 4JJXA 4F0XA 4K3NA 4UFXA 2PVWA 1ELMP 2IMOA 1XIXA 4L8AA 4A94A 1Z9UA 4K30A 1CPXA 1EE3P 4MHDA 3NA6A 4E0AA 1HDUA 4KOYA 1BO4A 4KSIA 4Y49C 5LYFA 4GS4A 4OC5A 2G3TA 2V8GA 4I49A 5K8OA 2JDDA 6CPAA 3BJ7A 2ZPAA 3MN8A 5DWNA 3TO6A 1TF9A 3IWGA 2R7HA 4II9A 3KGQA 4OAEA 4UFVA 5LRGA 4EVYA 2FE7A 1Z4RA 4F9VA 4TNUA 4UEZA 1ON0A 4LQGA 2EK9A 1FT7A 3BJ8A 4KVME 2OZUA 4TWEA 4H2KA 4OLLA 4QC6A 2J8NA 3SJGA 3VARA 4B12A 4ZY2A 4NJQA 4DUKA 2JEWA 2Z3NA 3G3SA 4MCPA 4PK3A 4UWJA 1ZG7A 4ZY0A 2BL1A 2PJ5A 2BO9A 3KASA 4KOXA 2OZHA 3EC4A 4KUBA 4FD5A 1AMPA 4JLYA 3IGRA 3QB8A 1M4IA 1F2PA 3D2PA 3TO9A 2PJ6A 2VZZA 3CXPA 2I3CA 4MHNA 2Q7SA 3BHXA 2YGWA 4OADA 1XFOA 1Q2YA 4CGMA 4MFKA 4MFPA 1XMBA 4UF4A 3TTHA 4U9ZA 1Z8WA 1LAPA 4XPDC 4KOSA 3V8IA 2V77A 4UCMA 3NFZA 4MXUA 3ISXA 5F49A 2GE3A 2PR8A 2YNEA 5CPAA 5G20A 4PSWA 2BOAA 2Q51A 3HLPA 3IFEA 4NXYA 3GY9A 3R95A 2HQYA 3LODA 3ZZIA 4BMHA 3S6HA 5BWAB 4H6ZA 5D8NA 1TKFA 5J8CA 4WJBA 2PQ8A 3DDDA 1AUGA 4NJRA 2Q7BA 3SJEA 5J8FA 8CPAA 3V7ZA 3FBUA 4ONWA 3D7DA 3D67A 4H6UA 1YMEA 1S5KA 4PPZA 2B4DB 1QSNA 4KVXA 2PDOA 2VL1A 4F0YA 3PGPA 4AVBA 3S9NA 2H5MA 4PK2A 5FVJA 1BPMA 3H8FA 4BD9A 2EBJA 3EFAA 5LYIA 3CPXA 3FVLA 4C7IA 1X10A 3RAMA 3KR5A 4HKFA 3RNZA 4B13A 1YVKA 1ELLP 1IYKA 2HB6A 1YREA 3B35A 5HVGA 2PCUA 5J1QA 3TC8A 3UY5A 4QUSA 4G1PA 1CPSA 4RS2A 2VXKA 2Y0MA 3D3SA 1Q7LA 3N5FA 3TOBA 3FEEA 1P0HA 2P0WA 1Z2LA 2DF5A 2EWBA 1RO5A 2CNSA 3K9UA 4R7MA 2P6EA 3LWUA 2GREA 2ZW6A 2V8VA 2POKA 5HMNA 4C7HA 5IV0A 2XEJA 5EMIA 3QAHA 2EUIA 2GLJA 4Y49B 4P45A 3IJ3A 1XE4A 5G22A 2FXFA 4AB7A 1YW6A 3SI1A 1IIDA 5AG7A 4A2ZA 5KTDA 2HUZA 2I00A 2Q43A 2ZW4A 4KOVA 5GCNA 4AG9A 5JM6A 1N71A 5JPHA 2K5TA 2Z11A 2ZOFA 4HNXB 4OIWA 4C2XA 2P6FA 4M85A 4BINA 2VEZA 4FD6A 4OC4A 1NSLA 1XF8A 2VQYA 2CY2A 4QVTA 4YWYA 2WSAA 4Q38A 3FNCA 3ISZA 4BBHA 2CXAA 3EO4A 3R1KA 5C88A 1XMTA 4NF1A 4OKOA
chains in the Genus database with same CATH topology
1R3NA 1TXRA 1QQ9A 1FNOA 2PJ7A 2FVGA 5ELYA 3PBBA 3B7IA 5JGFA 1BPNA 4P4BA 4YU9A 5LRKA 2RFHA 1CX8A 3KQXA 3KHZA 3BI0A 1LOKA 2PIZA 4ZX9A 3PB8X 2ZEEA 2ANPA 5LRJA 4OC2A 4IAVA 4FUUA 5D29A 1LAMA 1TKJA 4GM5A 3GB0A 4UEEA 2C1CA 2PJBA 3PEIA 1CG2A 4NGPA 3FH4A 4Z65A 2PJ2A 2QVPA 4UIBA 1QMUA 3WC5A 3KHXA 2ZEFA 2CTBA 4X8IA 2PVVA 3BXMA 1XBUA 2JBKA 2AFZA 2PJ0A 4PXBA 4P4EA 2ZEHA 4X2TA 4OP4A 3KQZA 1VHEA 2C6PA 4A37A 2G9DA 3DGVA 2PE3A 4P10A 4IHMA 3PFOA 3DLJA 4PXCA 2PRQA 2QJ8A 2AFUA 3WT4A 3FMCA 4JYWA 3NH8A 2ZEDA 3PFEA 3QNVA 4WWVA 2F8HA 4EFDA 2DEAA 3WC7A 2Q4ZA 1IY7A 2PIYA 3IWWA 3FF3A 1PYTB 2XEFA 3I1UA 2WYRA 2OOTA 3FX6A 1ZG9A 5DS0A 3B3VA 1R43A 3FECA 3IIBA 5K8PA 4O23A 1BLLE 5K8NA 4X3RA 2V8HA 3V38A 4FBEA 4MRIA 3WC6A 4FWUA 1TKHA 2C6CA 4OC0A 2C6GA 3PB9X 1OBRA 2JBJA 2PJAA 3WABA 3S9MA 3FEDA 1HDQA 3PB7X 2AFWA 1Z5RA 2CIJA 5K8MA 1LFWA 2ZOGA 4NGSA 4NFRA 1CBXA 1ZLIA 4ZI6A 3FJUA 1M4LA 4R6TA 4R76A 4W9YA 2PJCA 3D4UA 3TX8A 1CP6A 4PQAA 1H8LA 2OR4A 3GLJA 2CF4A 2PJ4A 3K9TA 3S9LA 1HEEA 4P4IA 1UWYA 3D68A 2PJ1A 4MHPA 1VHOA 4OIDA 4UEFA 1XRYA 2AFSA 2ZEOA 1ZG8A 3SJFA 4R8FA 4MHZA 4NGMA 2NSMA 7CPAA 4OC3A 3H8GA 3H8EA 1YSJA 3NH4A 2AFOA 4JZ0A 3IO1A 2NYQA 4Q7AA 4MCRA 3RBUA 5LYLA 4F9UA 4OC1A 1CP7A 4NGTA 4F8ZA 1ARLA 2O53A 3KL9A 1Y0RA 3JRUA 3CPAA 1Y0YA 1XJOA 2IQ6A 4UIAA 3CDXA 4AXVA 3PB6X 4MCQA 1TF8A 3B2YA 5HVFA 3D7HA 4ZYQA 1Z8LA 2XEGA 5JH9A 1KWMA 4A39A 5HVHA 4B6ZA 3VH9A 2HC9A 2O4HA 1NSAA 3B3CA 2EK8A 3PB4X 1VIXA 2PJ3A 3SI0A 3HUVA 4NGQA 3B3TA 3D7GA 4PXEA 1DTDA 4ZY1A 1AYEA 2RB7A 5THWA 4EWTA 3MRUA 1Y7EA 2AFMA 4EMEA 4A38A 3BI1A 5F09A 1LANA 1BAVA 4FAIA 3PBEA 4P4JA 1DE4C 2PJ9A 3K2KA 4P44A 3RZAA 3GUXA 2ZEGA 4MHYA 1F2OA 2F7VA 3SJXA 5HXDA 2CTCA 3KZWA 5LYDA 4DYOA 3IC1A 4RUHA 2ZEMA 2QYVA 4PXDA 3B3WA 2IJZA 3KI9A 2ABZA 1F57A 1GYTA 1LCPA 3D66A 2AFXA 5I4MA 2ZEPA 3PRTA 1YLOA 3IEHA 1IGBA 4NGNA 3D7FA 4CPAA 1ARMA 4P4FA 3T8WA 2XEIA 1YW4A 5CBMA 3L2NA 5IB9A 2V8DA 2J9AA 2GU2A 4ZX8A 2PJ8A 3CT9A 3VATA 4DJLA 3KR4A 1RTQA 4MMOA 2GLFA 1VGYA 4IK2A 2WZNA 1JQGA 4NGRA 3NH5A 1PCAA 4MCSA 4OMEA 3B3SA 1ZLHA 2BCOA 2ZELA 3SI2A 3LMSA 4P6YA 4P4DA 2ZENA 4K3NA 2PVWA 1ELMP 2IMOA 4A94A 1CPXA 1EE3P 3NA6A 1HDUA 5LYFA 4KSIA 4OC5A 2V8GA 5K8OA 6CPAA 3MN8A 1TF9A 3KGQA 5LRGA 4F9VA 4TNUA 4UEZA 4LQGA 2EK9A 1FT7A 4TWEA 4H2KA 3SJGA 3VARA 4ZY2A 4NJQA 4DUKA 2JEWA 4ZY0A 4MCPA 1ZG7A 2PJ5A 2BO9A 3KASA 1AMPA 1F2PA 2PJ6A 2I3CA 4MHNA 3BHXA 1XFOA 1XMBA 4UF4A 1LAPA 2V77A 3NFZA 4MXUA 3ISXA 5CPAA 2BOAA 2Q51A 3HLPA 3IFEA 5D8NA 1TKFA 4WJBA 4NJRA 3SJEA 8CPAA 3V7ZA 4ONWA 3D7DA 3D67A 1YMEA 4PPZA 2VL1A 3S9NA 1BPMA 3H8FA 4BD9A 5LYIA 3CPXA 3FVLA 3RAMA 3KR5A 3B35A 1ELLP 2HB6A 5HVGA 2PCUA 5J1QA 3TC8A 4G1PA 1CPSA 3N5FA 1Q7LA 3FEEA 1Z2LA 2EWBA 4R7MA 3LWUA 2GREA 2V8VA 2POKA 2XEJA 2GLJA 4P45A 3IJ3A 1YW6A 3SI1A 2Q43A 5JM6A 2ZOFA 4OIWA 4OC4A 4YWYA 3ISZA 4OKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3N A;  1TXR A;  1QQ9 A;  1FNO A;  2PJ7 A;  2FVG A;  5ELY A;  3PBB A;  3B7I A;  5JGF A;  1BPN A;  4P4B A;  4YU9 A;  5LRK A;  2RFH A;  1CX8 A;  3KQX A;  3KHZ A;  3BI0 A;  1LOK A;  2PIZ A;  4ZX9 A;  3PB8 X;  2ZEE A;  2ANP A;  5LRJ A;  4OC2 A;  4IAV A;  4FUU A;  5D29 A;  1LAM A;  1TKJ A;  4GM5 A;  3GB0 A;  4UEE A;  2C1C A;  2PJB A;  3PEI A;  1CG2 A;  4NGP A;  3FH4 A;  4Z65 A;  2PJ2 A;  2QVP A;  4UIB A;  1QMU A;  3WC5 A;  3KHX A;  2ZEF A;  2CTB A;  4X8I A;  2PVV A;  3BXM A;  1XBU A;  2JBK A;  2AFZ A;  2PJ0 A;  4PXB A;  4P4E A;  2ZEH A;  4X2T A;  4OP4 A;  3KQZ A;  1VHE A;  2C6P A;  4A37 A;  2G9D A;  3DGV A;  2PE3 A;  4P10 A;  4IHM A;  3PFO A;  3DLJ A;  4PXC A;  2PRQ A;  2QJ8 A;  2AFU A;  3WT4 A;  3FMC A;  4JYW A;  3NH8 A;  2ZED A;  3PFE A;  3QNV A;  4WWV A;  2F8H A;  4EFD A;  2DEA A;  3WC7 A;  2Q4Z A;  1IY7 A;  2PIY A;  3IWW A;  3FF3 A;  1PYT B;  2XEF A;  3I1U A;  2WYR A;  2OOT A;  3FX6 A;  1ZG9 A;  5DS0 A;  3B3V A;  1R43 A;  3FEC A;  3IIB A;  5K8P A;  4O23 A;  1BLL E;  5K8N A;  4X3R A;  2V8H A;  3V38 A;  4FBE A;  4MRI A;  3WC6 A;  4FWU A;  1TKH A;  2C6C A;  4OC0 A;  2C6G A;  3PB9 X;  1OBR A;  2JBJ A;  2PJA A;  3WAB A;  3S9M A;  3FED A;  1HDQ A;  3PB7 X;  2AFW A;  1Z5R A;  2CIJ A;  5K8M A;  1LFW A;  2ZOG A;  4NGS A;  4NFR A;  1CBX A;  1ZLI A;  4ZI6 A;  3FJU A;  1M4L A;  4R6T A;  4R76 A;  4W9Y A;  2PJC A;  3D4U A;  3TX8 A;  1CP6 A;  4PQA A;  1H8L A;  2OR4 A;  3GLJ A;  2CF4 A;  2PJ4 A;  3K9T A;  3S9L A;  1HEE A;  4P4I A;  1UWY A;  3D68 A;  2PJ1 A;  4MHP A;  1VHO A;  4OID A;  4UEF A;  1XRY A;  2AFS A;  2ZEO A;  1ZG8 A;  3SJF A;  4R8F A;  4MHZ A;  4NGM A;  2NSM A;  7CPA A;  4OC3 A;  3H8G A;  3H8E A;  1YSJ A;  3NH4 A;  2AFO A;  4JZ0 A;  3IO1 A;  2NYQ A;  4Q7A A;  4MCR A;  3RBU A;  5LYL A;  4F9U A;  4OC1 A;  1CP7 A;  4NGT A;  4F8Z A;  1ARL A;  2O53 A;  3KL9 A;  1Y0R A;  3JRU A;  3CPA A;  1Y0Y A;  1XJO A;  2IQ6 A;  4UIA A;  3CDX A;  4AXV A;  3PB6 X;  4MCQ A;  1TF8 A;  3B2Y A;  5HVF A;  3D7H A;  4ZYQ A;  1Z8L A;  2XEG A;  5JH9 A;  1KWM A;  4A39 A;  5HVH A;  4B6Z A;  3VH9 A;  2HC9 A;  2O4H A;  1NSA A;  3B3C A;  2EK8 A;  3PB4 X;  1VIX A;  2PJ3 A;  3SI0 A;  3HUV A;  4NGQ A;  3B3T A;  3D7G A;  4PXE A;  1DTD A;  4ZY1 A;  1AYE A;  2RB7 A;  5THW A;  4EWT A;  3MRU A;  1Y7E A;  2AFM A;  4EME A;  4A38 A;  3BI1 A;  5F09 A;  1LAN A;  1BAV A;  4FAI A;  3PBE A;  4P4J A;  1DE4 C;  2PJ9 A;  3K2K A;  4P44 A;  3RZA A;  3GUX A;  2ZEG A;  4MHY A;  1F2O A;  2F7V A;  3SJX A;  5HXD A;  2CTC A;  3KZW A;  5LYD A;  4DYO A;  3IC1 A;  4RUH A;  2ZEM A;  2QYV A;  4PXD A;  3B3W A;  2IJZ A;  3KI9 A;  2ABZ A;  1F57 A;  1GYT A;  1LCP A;  3D66 A;  2AFX A;  5I4M A;  2ZEP A;  3PRT A;  1YLO A;  3IEH A;  1IGB A;  4NGN A;  3D7F A;  4CPA A;  1ARM A;  4P4F A;  3T8W A;  2XEI A;  1YW4 A;  5CBM A;  3L2N A;  5IB9 A;  2V8D A;  2J9A A;  2GU2 A;  4ZX8 A;  2PJ8 A;  3CT9 A;  3VAT A;  4DJL A;  3KR4 A;  1RTQ A;  4MMO A;  2GLF A;  1VGY A;  4IK2 A;  2WZN A;  1JQG A;  4NGR A;  3NH5 A;  1PCA A;  4MCS A;  4OME A;  3B3S A;  1ZLH A;  2BCO A;  2ZEL A;  3SI2 A;  3LMS A;  4P6Y A;  4P4D A;  2ZEN A;  4K3N A;  2PVW A;  1ELM P;  2IMO A;  4A94 A;  1CPX A;  1EE3 P;  3NA6 A;  1HDU A;  5LYF A;  4KSI A;  4OC5 A;  2V8G A;  5K8O A;  6CPA A;  3MN8 A;  1TF9 A;  3KGQ A;  5LRG A;  4F9V A;  4TNU A;  4UEZ A;  4LQG A;  2EK9 A;  1FT7 A;  4TWE A;  4H2K A;  3SJG A;  3VAR A;  4ZY2 A;  4NJQ A;  4DUK A;  2JEW A;  4ZY0 A;  4MCP A;  1ZG7 A;  2PJ5 A;  2BO9 A;  3KAS A;  1AMP A;  1F2P A;  2PJ6 A;  2I3C A;  4MHN A;  3BHX A;  1XFO A;  1XMB A;  4UF4 A;  1LAP A;  2V77 A;  3NFZ A;  4MXU A;  3ISX A;  5CPA A;  2BOA A;  2Q51 A;  3HLP A;  3IFE A;  5D8N A;  1TKF A;  4WJB A;  4NJR A;  3SJE A;  8CPA A;  3V7Z A;  4ONW A;  3D7D A;  3D67 A;  1YME A;  4PPZ A;  2VL1 A;  3S9N A;  1BPM A;  3H8F A;  4BD9 A;  5LYI A;  3CPX A;  3FVL A;  3RAM A;  3KR5 A;  3B35 A;  1ELL P;  2HB6 A;  5HVG A;  2PCU A;  5J1Q A;  3TC8 A;  4G1P A;  1CPS A;  3N5F A;  1Q7L A;  3FEE A;  1Z2L A;  2EWB A;  4R7M A;  3LWU A;  2GRE A;  2V8V A;  2POK A;  2XEJ A;  2GLJ A;  4P45 A;  3IJ3 A;  1YW6 A;  3SI1 A;  2Q43 A;  5JM6 A;  2ZOF A;  4OIW A;  4OC4 A;  4YWY A;  3ISZ A;  4OKO A; 
#chains in the Genus database with same CATH topology
 1R3N A;  4UA3 A;  1TXR A;  2Z0Z A;  4RI1 A;  2IL4 A;  2B58 A;  2ARH A;  2X7B A;  1QQ9 A;  1FNO A;  1PUA A;  4B10 A;  2PJ7 A;  2B5G A;  2C27 A;  2FVG A;  5ELY A;  3PBB A;  3W6S A;  5HH1 A;  3B7I A;  2GAN A;  1BPN A;  1NE9 A;  3NE7 A;  4P4B A;  4YU9 A;  4CS0 B;  4PV6 A;  4QBJ A;  2G3A A;  5LRK A;  4CAV A;  4KOR A;  2RFH A;  1CX8 A;  3T90 A;  3A9L A;  3KQX A;  3KHZ A;  1YVO A;  3BI0 A;  3IWE A;  5AG4 A;  2B3U A;  2P6G A;  4JWP A;  2KCW A;  4R9M A;  1I21 A;  2B4B A;  1LOK A;  3FYN A;  3D2M A;  3EY5 A;  4A95 A;  4KOT A;  4A30 A;  2PIZ A;  4ZX9 A;  3PB8 X;  2ZEE A;  3S6K A;  1SQH A;  2ANP A;  2I79 A;  4MI4 A;  2ZXV A;  1LRZ A;  5LRJ A;  4OC2 A;  2PR1 A;  1Z8X A;  4IAV A;  4FUU A;  4X5K A;  5D29 A;  5JQ4 A;  3ZJ0 A;  1LAM A;  1TKJ A;  4GM5 A;  3GB0 A;  4KOW A;  5H86 A;  4YGO A;  3FB3 A;  4UEE A;  2C1C A;  2PJB A;  3LAC A;  3P2H A;  4CAW A;  3PEI A;  2J8M A;  2QIR A;  4XPK A;  1CG2 A;  4NGP A;  3SXN A;  3FH4 A;  2ATR A;  4M6H A;  4Q36 A;  3OWC A;  4Z65 A;  2PJ2 A;  2Q04 A;  2QVP A;  5AG6 A;  1CM0 A;  1M4G A;  4A33 A;  3I3G A;  4UIB A;  1QMU A;  1X12 A;  3WC5 A;  2JDC A;  1YGH A;  2GIV A;  1ZO0 A;  3KHX A;  2PC1 A;  2ZEF A;  1VKC A;  2CTB A;  4X8I A;  4MFQ A;  2PVV A;  3BXM A;  2JLM A;  3JVN A;  1XBU A;  2JBK A;  2AFZ A;  1K4J A;  5EC4 A;  5G1Z A;  2PJ0 A;  4PXB A;  4P4E A;  2ZEH A;  4CAF A;  5F48 A;  5G21 A;  4LX9 A;  2PSW A;  2QEC A;  4OP4 A;  4X2T A;  2EO8 A;  1S7N A;  3B8G A;  1IB1 E;  3KQZ A;  1VHE A;  5C82 A;  2C6P A;  5E96 A;  4R57 A;  4A37 A;  1Z8T A;  1M1D A;  2VI7 A;  2G9D A;  4E2A A;  3DGV A;  2PE3 A;  3DSB A;  4LQ6 A;  1P4N A;  4P10 A;  4C68 A;  4IHM A;  3PFO A;  3DLJ A;  4PXC A;  5CNP A;  2PRQ A;  2QJ8 A;  2AFU A;  1WK4 A;  3QAY A;  1IOI A;  1IOF A;  4RN7 A;  3WT4 A;  4CYO A;  1WWZ A;  3FMC A;  5H84 A;  3SXO A;  3W91 A;  4JD6 A;  4JYW A;  3S6F A;  1A2Z A;  3NH8 A;  4KZT A;  2Z3L A;  2ZED A;  5AGE A;  4HPS A;  3PFE A;  4KSA A;  3QNV A;  4WWV A;  5A28 A;  2O28 A;  2Q4V A;  2Z3P A;  2Z3O A;  2F8H A;  3F5B A;  4EFD A;  2DEA A;  3WC7 A;  2Q4Z A;  1IY7 A;  2PIY A;  3BLN A;  3TCV A;  3IWW A;  4MFJ A;  3FF3 A;  1PYT B;  2WPX A;  3FXT A;  2XEF A;  3KKW A;  3I1U A;  3TT2 A;  2WYR A;  2OOT A;  5IX3 A;  4A32 A;  1KUY A;  3FX6 A;  1ZG9 A;  1YK3 A;  3CZX A;  4GXH A;  5DS0 A;  3B3V A;  1R43 A;  2PRB A;  4MFZ A;  3FEC A;  3IIB A;  5K8P A;  1S7L A;  1TIQ A;  2HV2 A;  2AJ6 A;  1KUX A;  4CYN A;  4O23 A;  1BLL E;  3F0A A;  3LD2 A;  4ORF A;  5K8N A;  4X3R A;  3D8P A;  2V8H A;  3V38 A;  4M3S A;  4FBE A;  1UFH A;  4MRI A;  3WC6 A;  4FWU A;  2ZW7 A;  1TKH A;  2C6C A;  4OC0 A;  1GHE A;  2C6G A;  2G0B A;  2J8R A;  3TE4 A;  1B87 A;  4A31 A;  3PB9 X;  4L89 A;  1OBR A;  2JBJ A;  2PJA A;  1QSO A;  3WAB A;  4KSF A;  3S9M A;  3FED A;  1HDQ A;  1M4D A;  2EVN A;  3EXN A;  3PB7 X;  4KLV A;  2QML A;  1OZP A;  2AFW A;  1Z5R A;  2ZW5 A;  2D4P A;  4FD7 A;  3R9E A;  2CIJ A;  1MJ9 A;  5K8M A;  4CRY B;  2FSR A;  1QSM A;  1LFW A;  3P2F A;  3R96 A;  3FRM A;  1PU9 A;  2Z3K A;  2ZOG A;  4NGS A;  4NFR A;  4IF5 A;  4YFJ A;  4CGP A;  3T9Y A;  1CBX A;  1ZLI A;  2B5G B;  4ZI6 A;  3FJU A;  2OZG A;  4UCN A;  1Q2C A;  1M4L A;  4R6T A;  4PSX A;  4R76 A;  1Q2D A;  3RO0 A;  1I12 A;  4W9Y A;  2PJC A;  4FD4 A;  2Q0Y A;  3D4U A;  4J3G A;  1CP6 A;  4PQA A;  3TO7 A;  3TX8 A;  1IYL A;  1H8L A;  4B5P A;  5IB0 A;  5EBV A;  2OR4 A;  3GLJ A;  2CF4 A;  2PJ4 A;  3K9T A;  3S9L A;  4CYP A;  1HEE A;  4P4I A;  1UWY A;  4U5Y A;  4XNH C;  5KTA A;  3E0K A;  3D68 A;  4MBU A;  2PJ1 A;  4CRZ B;  1V0C A;  4MHP A;  1VHO A;  4KVO E;  4OID A;  4U9Y A;  4AVA A;  4YRH A;  4UEF A;  1XRY A;  2Q44 A;  2AFS A;  4R87 A;  5ISV A;  2ZEO A;  1ZG8 A;  3SJF A;  5A27 A;  4R8F A;  4MHZ A;  4NGM A;  1YQE A;  1S60 A;  2CNM A;  2NSM A;  4HNW B;  4OC3 A;  1Y9K A;  3H8E A;  3H8G A;  1YSJ A;  2JEV A;  7CPA A;  3NH4 A;  2AFO A;  4MY0 A;  3MGD A;  4JZ0 A;  4CYQ A;  3IO1 A;  4B11 A;  2NYQ A;  4Q7A A;  4KLW A;  4MCR A;  3CXS A;  3RBU A;  4MFL A;  1XEB A;  4M6I A;  5LYL A;  4F9U A;  2B3V A;  4OC1 A;  1CP7 A;  3TFY A;  4NGT A;  4F8Z A;  1ARL A;  5F09 A;  2WPW A;  2O53 A;  2DXQ A;  1B6B A;  5F46 A;  1YR0 A;  1RXT A;  1Y9W A;  3KL9 A;  1Y0R A;  3JRU A;  3H4Q A;  3CPA A;  1QST A;  1Y0Y A;  1XJO A;  2R8V A;  2IQ6 A;  2YND A;  4UIA A;  3CDX A;  4AXV A;  3IU2 A;  3PB6 X;  4MCQ A;  1TF8 A;  3B2Y A;  5HVF A;  3D7H A;  4ZYQ A;  1Z8L A;  2XEG A;  5JH9 A;  1KWM A;  1MK4 A;  1L0C A;  4A39 A;  3FIX A;  5HVH A;  2CNT A;  2DPS A;  4IUS A;  4KS9 A;  3VH9 A;  4B6Z A;  2HC9 A;  2O4H A;  1NSA A;  3B3C A;  2EK8 A;  3PB4 X;  3DNS A;  2DPT A;  4CGL A;  1VIX A;  2FT0 A;  2PJ3 A;  4JXR A;  3SI0 A;  3HUV A;  4NGQ A;  3B3T A;  2BUE A;  3D7G A;  4PXE A;  3IU1 A;  1DTD A;  1S7K A;  4AG7 A;  4ZY1 A;  1AYE A;  4LUA A;  2RB7 A;  1VHS A;  2WUU A;  5THW A;  1J4J A;  4EWT A;  1S3Z A;  2OB0 A;  2F5I A;  3MRU A;  1Y7E A;  3F8K A;  2AFM A;  4CGO A;  2R1I A;  4EME A;  1R57 A;  4A38 A;  5KTC A;  2AE6 A;  3BI1 A;  2FL4 A;  3VWE A;  3H5Z A;  4R3K A;  1LAN A;  1BAV A;  4H89 A;  4ZBG A;  4FAI A;  3PBE A;  4P4J A;  3R9F A;  3CXQ A;  4QB9 A;  1DE4 C;  2PJ9 A;  3K2K A;  4P44 A;  3RZA A;  2REF A;  3GUX A;  2ZEG A;  4MHY A;  1F2O A;  1JWQ A;  2BSW A;  2RC4 A;  5JGF A;  2F7V A;  3RYO A;  2OH1 A;  4UCP A;  2B4D A;  3SJX A;  5HXD A;  4MJ8 A;  1KZF A;  4NSQ A;  2CTC A;  1YX0 A;  3TOA A;  2A4N A;  3KZW A;  4CGN A;  5LYD A;  4DYO A;  3IC1 A;  4RUH A;  2ZEM A;  3GIU A;  3GYA A;  2QYV A;  1QSR A;  1IU8 A;  5AG5 A;  4E8O A;  4PXD A;  1IIC A;  4KUA A;  4B5O A;  3B3W A;  3SHP A;  4UWI A;  2BEI A;  2IJZ A;  4XNH B;  3KI9 A;  4C2Z A;  2NMT A;  2ABZ A;  1XOV A;  3DR6 A;  1F57 A;  1GYT A;  1LCP A;  3D66 A;  2AFX A;  2YNC A;  5I4M A;  2ZEP A;  4CAX A;  3PRT A;  3PZJ A;  3I9S A;  1YLO A;  4JXQ A;  3IEH A;  1IGB A;  2FIW A;  4NGN A;  3D7F A;  4CPA A;  1ARM A;  1KUV A;  4P4F A;  3VWD A;  2Q4Y A;  4MY3 A;  3T8W A;  4B14 A;  2FS5 A;  5I0C A;  2XEI A;  2FCK A;  4HNY B;  4NEX A;  3WR7 A;  1YW4 A;  1CJW A;  4ZGY B;  5CBM A;  4CAE A;  1NMT A;  3L2N A;  1S7F A;  5IB9 A;  1YLE A;  3N7Z A;  4R3L A;  1I1D A;  3JTK A;  2GFQ A;  1M44 A;  4DNC A;  2FIA A;  3G8W A;  3DR8 A;  2ODF A;  2REE A;  2V8D A;  2J9A A;  4UBR A;  3C26 A;  2GU2 A;  4ZX8 A;  2PJ8 A;  2OU2 A;  3CT9 A;  3VAT A;  4C2Y A;  4DJL A;  1Y7R A;  2VBQ A;  3KR4 A;  1FY7 A;  1RTQ A;  4UFW A;  4MMO A;  1MJB A;  3R9G A;  2GLF A;  3W6X A;  1MJA A;  1VGY A;  4NCZ A;  4IK2 A;  2WZN A;  1JQG A;  4NGR A;  4B5P B;  3JUW A;  3NH5 A;  4F6A A;  1PCA A;  4MCS A;  1Z4E A;  4OME A;  2R98 A;  1BOB A;  3B3S A;  1ZLH A;  3PP9 A;  2BCO A;  2YNC C;  2ZEL A;  4XPL A;  1U6M A;  4ONU A;  3NE8 A;  4M6G A;  3SI2 A;  2VZY A;  2Z10 A;  5F47 A;  3LMS A;  5DWM A;  2Z3M A;  3S6G A;  4XPD B;  2D4O A;  4P6Y A;  4AVC A;  4KOU A;  4P4D A;  2ZEN A;  3GKR A;  4JJX A;  4F0X A;  4K3N A;  4UFX A;  2PVW A;  1ELM P;  2IMO A;  1XIX A;  4L8A A;  4A94 A;  1Z9U A;  4K30 A;  1CPX A;  1EE3 P;  4MHD A;  3NA6 A;  4E0A A;  1HDU A;  4KOY A;  1BO4 A;  4KSI A;  4Y49 C;  5LYF A;  4GS4 A;  4OC5 A;  2G3T A;  2V8G A;  4I49 A;  5K8O A;  2JDD A;  6CPA A;  3BJ7 A;  2ZPA A;  3MN8 A;  5DWN A;  3TO6 A;  1TF9 A;  3IWG A;  2R7H A;  4II9 A;  3KGQ A;  4OAE A;  4UFV A;  5LRG A;  4EVY A;  2FE7 A;  1Z4R A;  4F9V A;  4TNU A;  4UEZ A;  1ON0 A;  4LQG A;  2EK9 A;  1FT7 A;  3BJ8 A;  4KVM E;  2OZU A;  4TWE A;  4H2K A;  4OLL A;  4QC6 A;  2J8N A;  3SJG A;  3VAR A;  4B12 A;  4ZY2 A;  4NJQ A;  4DUK A;  2JEW A;  2Z3N A;  3G3S A;  4MCP A;  4PK3 A;  4UWJ A;  1ZG7 A;  4ZY0 A;  2BL1 A;  2PJ5 A;  2BO9 A;  3KAS A;  4KOX A;  2OZH A;  3EC4 A;  4KUB A;  4FD5 A;  1AMP A;  4JLY A;  3IGR A;  3QB8 A;  1M4I A;  1F2P A;  3D2P A;  3TO9 A;  2PJ6 A;  2VZZ A;  3CXP A;  2I3C A;  4MHN A;  2Q7S A;  3BHX A;  2YGW A;  4OAD A;  1XFO A;  1Q2Y A;  4CGM A;  4MFK A;  4MFP A;  1XMB A;  4UF4 A;  3TTH A;  4U9Z A;  1Z8W A;  1LAP A;  4XPD C;  4KOS A;  3V8I A;  2V77 A;  4UCM A;  3NFZ A;  4MXU A;  3ISX A;  5F49 A;  2GE3 A;  2PR8 A;  2YNE A;  5CPA A;  5G20 A;  4PSW A;  2BOA A;  2Q51 A;  3HLP A;  3IFE A;  4NXY A;  3GY9 A;  3R95 A;  2HQY A;  3LOD A;  3ZZI A;  4BMH A;  3S6H A;  5BWA B;  4H6Z A;  5D8N A;  1TKF A;  5J8C A;  4WJB A;  2PQ8 A;  3DDD A;  1AUG A;  4NJR A;  2Q7B A;  3SJE A;  5J8F A;  8CPA A;  3V7Z A;  3FBU A;  4ONW A;  3D7D A;  3D67 A;  4H6U A;  1YME A;  1S5K A;  4PPZ A;  2B4D B;  1QSN A;  4KVX A;  2PDO A;  2VL1 A;  4F0Y A;  3PGP A;  4AVB A;  3S9N A;  2H5M A;  4PK2 A;  5FVJ A;  1BPM A;  3H8F A;  4BD9 A;  2EBJ A;  3EFA A;  5LYI A;  3CPX A;  3FVL A;  4C7I A;  1X10 A;  3RAM A;  3KR5 A;  4HKF A;  3RNZ A;  4B13 A;  1YVK A;  1ELL P;  1IYK A;  2HB6 A;  1YRE A;  3B35 A;  5HVG A;  2PCU A;  5J1Q A;  3TC8 A;  3UY5 A;  4QUS A;  4G1P A;  1CPS A;  4RS2 A;  2VXK A;  2Y0M A;  3D3S A;  1Q7L A;  3N5F A;  3TOB A;  3FEE A;  1P0H A;  2P0W A;  1Z2L A;  2DF5 A;  2EWB A;  1RO5 A;  2CNS A;  3K9U A;  4R7M A;  2P6E A;  3LWU A;  2GRE A;  2ZW6 A;  2V8V A;  2POK A;  5HMN A;  4C7H A;  5IV0 A;  2XEJ A;  5EMI A;  3QAH A;  2EUI A;  2GLJ A;  4Y49 B;  4P45 A;  3IJ3 A;  1XE4 A;  5G22 A;  2FXF A;  4AB7 A;  1YW6 A;  3SI1 A;  1IID A;  5AG7 A;  4A2Z A;  5KTD A;  2HUZ A;  2I00 A;  2Q43 A;  2ZW4 A;  4KOV A;  5GCN A;  4AG9 A;  5JM6 A;  1N71 A;  5JPH A;  2K5T A;  2Z11 A;  2ZOF A;  4HNX B;  4OIW A;  4C2X A;  2P6F A;  4M85 A;  4BIN A;  2VEZ A;  4FD6 A;  4OC4 A;  1NSL A;  1XF8 A;  2VQY A;  2CY2 A;  4QVT A;  4YWY A;  2WSA A;  4Q38 A;  3FNC A;  3ISZ A;  4BBH A;  2CXA A;  3EO4 A;  3R1K A;  5C88 A;  1XMT A;  4NF1 A;  4OKO A; 
#chains in the Genus database with same CATH homology
 1R3N A;  1TXR A;  1QQ9 A;  1FNO A;  2PJ7 A;  2FVG A;  5ELY A;  3PBB A;  3B7I A;  5JGF A;  1BPN A;  4P4B A;  4YU9 A;  5LRK A;  2RFH A;  1CX8 A;  3KQX A;  3KHZ A;  3BI0 A;  1LOK A;  2PIZ A;  4ZX9 A;  3PB8 X;  2ZEE A;  2ANP A;  5LRJ A;  4OC2 A;  4IAV A;  4FUU A;  5D29 A;  1LAM A;  1TKJ A;  4GM5 A;  3GB0 A;  4UEE A;  2C1C A;  2PJB A;  3PEI A;  1CG2 A;  4NGP A;  3FH4 A;  4Z65 A;  2PJ2 A;  2QVP A;  4UIB A;  1QMU A;  3WC5 A;  3KHX A;  2ZEF A;  2CTB A;  4X8I A;  2PVV A;  3BXM A;  1XBU A;  2JBK A;  2AFZ A;  2PJ0 A;  4PXB A;  4P4E A;  2ZEH A;  4X2T A;  4OP4 A;  3KQZ A;  1VHE A;  2C6P A;  4A37 A;  2G9D A;  3DGV A;  2PE3 A;  4P10 A;  4IHM A;  3PFO A;  3DLJ A;  4PXC A;  2PRQ A;  2QJ8 A;  2AFU A;  3WT4 A;  3FMC A;  4JYW A;  3NH8 A;  2ZED A;  3PFE A;  3QNV A;  4WWV A;  2F8H A;  4EFD A;  2DEA A;  3WC7 A;  2Q4Z A;  1IY7 A;  2PIY A;  3IWW A;  3FF3 A;  1PYT B;  2XEF A;  3I1U A;  2WYR A;  2OOT A;  3FX6 A;  1ZG9 A;  5DS0 A;  3B3V A;  1R43 A;  3FEC A;  3IIB A;  5K8P A;  4O23 A;  1BLL E;  5K8N A;  4X3R A;  2V8H A;  3V38 A;  4FBE A;  4MRI A;  3WC6 A;  4FWU A;  1TKH A;  2C6C A;  4OC0 A;  2C6G A;  3PB9 X;  1OBR A;  2JBJ A;  2PJA A;  3WAB A;  3S9M A;  3FED A;  1HDQ A;  3PB7 X;  2AFW A;  1Z5R A;  2CIJ A;  5K8M A;  1LFW A;  2ZOG A;  4NGS A;  4NFR A;  1CBX A;  1ZLI A;  4ZI6 A;  3FJU A;  1M4L A;  4R6T A;  4R76 A;  4W9Y A;  2PJC A;  3D4U A;  3TX8 A;  1CP6 A;  4PQA A;  1H8L A;  2OR4 A;  3GLJ A;  2CF4 A;  2PJ4 A;  3K9T A;  3S9L A;  1HEE A;  4P4I A;  1UWY A;  3D68 A;  2PJ1 A;  4MHP A;  1VHO A;  4OID A;  4UEF A;  1XRY A;  2AFS A;  2ZEO A;  1ZG8 A;  3SJF A;  4R8F A;  4MHZ A;  4NGM A;  2NSM A;  7CPA A;  4OC3 A;  3H8G A;  3H8E A;  1YSJ A;  3NH4 A;  2AFO A;  4JZ0 A;  3IO1 A;  2NYQ A;  4Q7A A;  4MCR A;  3RBU A;  5LYL A;  4F9U A;  4OC1 A;  1CP7 A;  4NGT A;  4F8Z A;  1ARL A;  2O53 A;  3KL9 A;  1Y0R A;  3JRU A;  3CPA A;  1Y0Y A;  1XJO A;  2IQ6 A;  4UIA A;  3CDX A;  4AXV A;  3PB6 X;  4MCQ A;  1TF8 A;  3B2Y A;  5HVF A;  3D7H A;  4ZYQ A;  1Z8L A;  2XEG A;  5JH9 A;  1KWM A;  4A39 A;  5HVH A;  4B6Z A;  3VH9 A;  2HC9 A;  2O4H A;  1NSA A;  3B3C A;  2EK8 A;  3PB4 X;  1VIX A;  2PJ3 A;  3SI0 A;  3HUV A;  4NGQ A;  3B3T A;  3D7G A;  4PXE A;  1DTD A;  4ZY1 A;  1AYE A;  2RB7 A;  5THW A;  4EWT A;  3MRU A;  1Y7E A;  2AFM A;  4EME A;  4A38 A;  3BI1 A;  5F09 A;  1LAN A;  1BAV A;  4FAI A;  3PBE A;  4P4J A;  1DE4 C;  2PJ9 A;  3K2K A;  4P44 A;  3RZA A;  3GUX A;  2ZEG A;  4MHY A;  1F2O A;  2F7V A;  3SJX A;  5HXD A;  2CTC A;  3KZW A;  5LYD A;  4DYO A;  3IC1 A;  4RUH A;  2ZEM A;  2QYV A;  4PXD A;  3B3W A;  2IJZ A;  3KI9 A;  2ABZ A;  1F57 A;  1GYT A;  1LCP A;  3D66 A;  2AFX A;  5I4M A;  2ZEP A;  3PRT A;  1YLO A;  3IEH A;  1IGB A;  4NGN A;  3D7F A;  4CPA A;  1ARM A;  4P4F A;  3T8W A;  2XEI A;  1YW4 A;  5CBM A;  3L2N A;  5IB9 A;  2V8D A;  2J9A A;  2GU2 A;  4ZX8 A;  2PJ8 A;  3CT9 A;  3VAT A;  4DJL A;  3KR4 A;  1RTQ A;  4MMO A;  2GLF A;  1VGY A;  4IK2 A;  2WZN A;  1JQG A;  4NGR A;  3NH5 A;  1PCA A;  4MCS A;  4OME A;  3B3S A;  1ZLH A;  2BCO A;  2ZEL A;  3SI2 A;  3LMS A;  4P6Y A;  4P4D A;  2ZEN A;  4K3N A;  2PVW A;  1ELM P;  2IMO A;  4A94 A;  1CPX A;  1EE3 P;  3NA6 A;  1HDU A;  5LYF A;  4KSI A;  4OC5 A;  2V8G A;  5K8O A;  6CPA A;  3MN8 A;  1TF9 A;  3KGQ A;  5LRG A;  4F9V A;  4TNU A;  4UEZ A;  4LQG A;  2EK9 A;  1FT7 A;  4TWE A;  4H2K A;  3SJG A;  3VAR A;  4ZY2 A;  4NJQ A;  4DUK A;  2JEW A;  4ZY0 A;  4MCP A;  1ZG7 A;  2PJ5 A;  2BO9 A;  3KAS A;  1AMP A;  1F2P A;  2PJ6 A;  2I3C A;  4MHN A;  3BHX A;  1XFO A;  1XMB A;  4UF4 A;  1LAP A;  2V77 A;  3NFZ A;  4MXU A;  3ISX A;  5CPA A;  2BOA A;  2Q51 A;  3HLP A;  3IFE A;  5D8N A;  1TKF A;  4WJB A;  4NJR A;  3SJE A;  8CPA A;  3V7Z A;  4ONW A;  3D7D A;  3D67 A;  1YME A;  4PPZ A;  2VL1 A;  3S9N A;  1BPM A;  3H8F A;  4BD9 A;  5LYI A;  3CPX A;  3FVL A;  3RAM A;  3KR5 A;  3B35 A;  1ELL P;  2HB6 A;  5HVG A;  2PCU A;  5J1Q A;  3TC8 A;  4G1P A;  1CPS A;  3N5F A;  1Q7L A;  3FEE A;  1Z2L A;  2EWB A;  4R7M A;  3LWU A;  2GRE A;  2V8V A;  2POK A;  2XEJ A;  2GLJ A;  4P45 A;  3IJ3 A;  1YW6 A;  3SI1 A;  2Q43 A;  5JM6 A;  2ZOF A;  4OIW A;  4OC4 A;  4YWY A;  3ISZ A;  4OKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...