1TKJA

Streptomyces griseus aminopeptidase complexed with d-methionine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
total genus 112
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkjA00
2PJ9A 4NJQA 1YMEA 4NGNA 4P10A 3KL9A 4P4FA 4NGPA 1IGBA 1DTDA 1YW4A 5D29A 2AFXA 4DUKA 5JGFA 3IIBA 4PPZA 4H2KA 1FNOA 2ZOFA 8CPAA 2F7VA 1EE3P 2NYQA 4MHZA 2ZENA 2V8HA 3KQXA 2EK9A 3KHXA 2BCOA 2DEAA 2NSMA 3IEHA 4YWYA 1VGYA 2BO9A 1NSAA 5LYFA 3IWWA 4ONWA 1F2OA 2QJ8A 2V8DA 3L2NA 2ZEDA 3IJ3A 1ELLP 2VL1A 2AFZA 3H8FA 2PJCA 4NGTA 1YLOA 2PJ8A 3S9NA 4WWVA 4DJLA 4PXBA 4A39A 4F8ZA 3KI9A 4K3NA 3BXMA 2ZEPA 1RTQA 3LMSA 4MCQA 3H8EA 3SJEA 1Z5RA 4JYWA 2ANPA 3MN8A 2PJ7A 1ZG8A 1YSJA 4UIBA 5CBMA 3TC8A 2JEWA 4OC1A 5HVFA 4BD9A 1HEEA 2PCUA 2PIYA 4R76A 4JZ0A 3PB9X 2QYVA 2GLFA 1TKFA 1TKJA 2EK8A 2CIJA 1OBRA 3FVLA 1XBUA 2V77A 4NGMA 1FT7A 2WZNA 3CT9A 2QVPA 2ZOGA 2PVWA 1TF9A 2ZEGA 2C6GA 1VHOA 6CPAA 4OIDA 3RBUA 1ARLA 4P4JA 4MCSA 4UIAA 4R7MA 2IQ6A 4EWTA 2ZELA 4CPAA 3KHZA 2I3CA 3K9TA 3D67A 3PFOA 3BI0A 2AFMA 3SI2A 4WJBA 4UF4A 4ZY0A 2XEIA 4OMEA 1CPSA 1ZLHA 3B3TA 2JBJA 3IFEA 3CPXA 4PXCA 3D4UA 4KSIA 3B2YA 3SJGA 2OOTA 2V8GA 3PB6X 4G1PA 4A38A 4OC2A 4YU9A 3I1UA 1Q7LA 4P4DA 1AMPA 3KQZA 2CF4A 2ZEOA 4FWUA 3DGVA 1Y0RA 1LAMA 3WC6A 3SI1A 3FX6A 1ELMP 3FJUA 2GREA 3VATA 3H8GA 3RZAA 2PIZA 4ZI6A 5J1QA 4TNUA 3VH9A 3NH4A 3WABA 4Z65A 2PJBA 3HLPA 3PBBA 7CPAA 1LAPA 4A94A 3B3VA 2XEFA 3SJFA 1TF8A 2PJ4A 1AYEA 3GLJA 3B3SA 4DYOA 5F09A 2IJZA 1R43A 3FH4A 4MHPA 3WC5A 2RFHA 4OKOA 4UEEA 3BI1A 3IC1A 4TWEA 2CTCA 4UEFA 4ZY2A 2AFOA 3GUXA 2GLJA 4IK2A 2FVGA 4OP4A 4IAVA 1LCPA 4P44A 1CP7A 3S9LA 5LYLA 1CPXA 4OIWA 3NFZA 3B35A 3FMCA 2O53A 2C6CA 5THWA 3KGQA 3MRUA 3PB7X 4NGRA 4ZYQA 1DE4C 4IHMA 5D8NA 3ISXA 4FAIA 4R8FA 2OR4A 1ARMA 1LANA 3B3WA 2PJ1A 3FECA 3SI0A 4ZY1A 1ZG7A 3FEDA 2POKA 1Y7EA 3KASA 3KR5A 4MMOA 2O4HA 1BPMA 1XJOA 3KZWA 4FUUA 1XMBA 2HC9A 4P4IA 2BOAA 2IMOA 4P4EA 3BHXA 2AFWA 4ZX8A 2Q4ZA 3ISZA 2RB7A 2Q51A 4RUHA 4X3RA 1F57A 3V7ZA 5K8PA 1KWMA 1QMUA 3V38A 3GB0A 4OC5A 3NH8A 4NGSA 1VHEA 3TX8A 3JRUA 3FF3A 3T8WA 5HVHA 2ZEEA 2PRQA 1QQ9A 5JH9A 3D68A 1JQGA 2ABZA 2PJ2A 1Z8LA 3D7GA 1BAVA 1UWYA 4OC4A 5HXDA 4P6YA 4MHYA 1BPNA 2PJ3A 1CBXA 1HDUA 5K8MA 5CPAA 5DS0A 3IO1A 4R6TA 3DLJA 3NH5A 3D7DA 4FBEA 5LRKA 2PJAA 4ZX9A 1VIXA 3HUVA 3CPAA 3D7FA 4P4BA 1HDQA 3WT4A 4EMEA 3NA6A 3QNVA 2PJ0A 1R3NA 2AFUA 4MHNA 1F2PA 5K8OA 4OC3A 2CTBA 1LFWA 4NGQA 5LRGA 1TXRA 2J9AA 4PXDA 2PVVA 1IY7A 1LOKA 4A37A 5LYIA 3K2KA 3SJXA 2EWBA 2XEJA 5JM6A 1ZG9A 4PQAA 4X8IA 3D7HA 4MXUA 5I4MA 1PYTB 4B6ZA 2V8VA 3KR4A 3B7IA 2PE3A 2AFSA 2ZEFA 3PRTA 4W9YA 4NJRA 2PJ6A 3D66A 5IB9A 2F8HA 4MCPA 3PBEA 3S9MA 1GYTA 2C1CA 4F9UA 2ZEMA 2WYRA 2PJ5A 2GU2A 1TKHA 3CDXA 4X2TA 3VARA 4GM5A 1BLLE 3PB4X 1CG2A 1ZLIA 3RAMA 2ZEHA 3B3CA 4MCRA 3PEIA 4OC0A 2XEGA 2HB6A 1M4LA 2G9DA 4UEZA 1H8LA 5LYDA 1Z2LA 3N5FA 1CP6A 5ELYA 4NFRA 3LWUA 4F9VA 4PXEA 1XFOA 1Y0YA 1XRYA 4EFDA 3FEEA 5HVGA 3WC7A 4P45A 4MRIA 2Q43A 4LQGA 5LRJA 1CX8A 4AXVA 2C6PA 3PB8X 3PFEA 1PCAA 1YW6A 4O23A 4Q7AA 2JBKA 5K8NA
chains in the Genus database with same CATH superfamily
2PJ9A 4NJQA 1YMEA 4NGNA 3TTHA 1KUXA 4P10A 1ZO0A 3KL9A 4CGNA 4CGOA 2CNSA 1X12A 1M4IA 3IWGA 4P4FA 4NGPA 3TOAA 1IGBA 2FIWA 2GFQA 1DTDA 3G3SA 1YW4A 2DXQA 5D29A 2AFXA 4DUKA 5JGFA 2PR8A 3PP9A 2GIVA 3IIBA 2FE7A 2WPXA 2KCWA 2OU2A 1QSMA 2Q4VA 4H2KA 4PPZA 4CYNA 1FNOA 2RC4A 2CNMA 2B4DB 3B8GA 2ZOFA 5IV0A 8CPAA 3LD2A 5A28A 2P6EA 1XMTA 2F7VA 1EE3P 2NYQA 4MHZA 2ZENA 2V8HA 3KQXA 2EK9A 2YNEA 3KHXA 2BCOA 1N71A 4MFPA 2DEAA 2NSMA 3IEHA 4YWYA 3RO0A 1VGYA 4R9MA 2BO9A 2VZZA 1NSAA 2VI7A 5LYFA 3IWWA 4ONWA 1F2OA 2QJ8A 3I9SA 2V8DA 3L2NA 2ZEDA 2G0BA 3IJ3A 1ELLP 2VL1A 2AFZA 3CZXA 3H8FA 4F0XA 2PJCA 4XNHB 4L89A 4NGTA 1YLOA 2PJ8A 4PSWA 3S9NA 4WWVA 3CXQA 4DJLA 1WWZA 3GIUA 5G22A 2Y0MA 4PXBA 2P0WA 1RO5A 4KOTA 2JDDA 4A39A 4F8ZA 2WPWA 3KI9A 4K3NA 5BWAB 3BXMA 2ZEPA 1XOVA 1YVKA 1RTQA 3LMSA 3ZZIA 4MCQA 4MFLA 4B5PA 5F47A 2H5MA 2B58A 3H8EA 3SJEA 1Z5RA 4MJ8A 4UWIA 2AJ6A 4JYWA 2ANPA 3MN8A 3IGRA 2P6GA 5EBVA 5JQ4A 4C2XA 2EBJA 2PJ7A 4ZBGA 1ZG8A 1YSJA 2Z3MA 4U9ZA 4UIBA 5CBMA 3TC8A 3JUWA 2JEWA 1NSLA 4OC1A 3PGPA 5A27A 5HVFA 4XPKA 4BD9A 1YLEA 4A95A 1HEEA 2J8MA 2PCUA 2VZYA 2PIYA 4IUSA 4R76A 1JWQA 3A9LA 4JZ0A 4NXYA 3PB9X 2QYVA 5C88A 2OB0A 2GLFA 3F5BA 4K30A 5ISVA 1NMTA 1TKFA 1TKJA 3CXPA 4YGOA 2EK8A 2CIJA 1OBRA 3FVLA 4GS4A 1XBUA 2V77A 4KSFA 4NGMA 4XPLA 1FT7A 2VQYA 2FXFA 1YR0A 4I49A 3UY5A 2WZNA 3CT9A 4E8OA 1M4DA 2K5TA 2QVPA 3SHPA 4E0AA 2ZOGA 4XPDB 1QSTA 2PVWA 2EUIA 5HMNA 2R8VA 1Q2CA 1TF9A 4KUBA 1Q2YA 2ZEGA 2C6GA 4KOSA 1VHOA 4AG9A 1AUGA 3R1KA 4OIDA 6CPAA 3RBUA 4CYOA 1ARLA 4LUAA 3BLNA 1CJWA 3H4QA 3GYAA 4HNWB 4P4JA 1SQHA 4KS9A 4CYPA 4C7IA 4MCSA 4UIAA 4A33A 1IIDA 4UCPA 4B11A 2BL1A 3FRMA 4R7MA 3NE8A 2DPSA 5E96A 4F0YA 2IQ6A 2Z3OA 2ZELA 4EWTA 4CPAA 3DNSA 3KHZA 2I3CA 3LODA 5G20A 4BINA 3K9TA 2Q4YA 3D67A 3PFOA 3RNZA 1Z8XA 4RN7A 4QBJA 4ORFA 3BI0A 3T9YA 2AFMA 3QB8A 2QECA 3SI2A 4WJBA 3OWCA 4C2ZA 4UF4A 4ZY0A 2XEIA 4OMEA 3D3SA 1CPSA 2NMTA 4J3GA 2CNTA 1ZLHA 3B3TA 2JBJA 3FNCA 3IFEA 3CPXA 4LQ6A 4PXCA 3D4UA 4FD7A 4KSIA 3B2YA 1I21A 3SJGA 3TT2A 2OOTA 3D2PA 4CGLA 2V8GA 3PB6X 4G1PA 2CXAA 4A38A 4EVYA 5DWNA 3TOBA 4OC2A 2GE3A 3I1UA 1Q7LA 4P4DA 4YU9A 3SXNA 1Z4RA 1AMPA 3KQZA 2CF4A 2ZEOA 4FWUA 5F46A 3DGVA 1NE9A 1Y0RA 1LAMA 3WC6A 3SI1A 3R9GA 3FX6A 1ELMP 1PU9A 1YX0A 1PUAA 3P2HA 4PK3A 4PK2A 2PQ8A 2Z11A 3FJUA 2GREA 4A32A 2FS5A 2PC1A 3BJ7A 4KVME 4Y49B 4MI4A 3I3GA 4E2AA 2B3VA 3VATA 3H8GA 3RZAA 2PIZA 2B5GB 1LRZA 4KOWA 4BMHA 2ATRA 4ZI6A 5J1QA 4TNUA 3VH9A 1Y9WA 3NH4A 2ZW6A 4IF5A 3WABA 4Z65A 2PJBA 1Y7RA 3HLPA 3D2MA 3PBBA 4Q38A 7CPAA 1LAPA 5AG4A 4A94A 4PSXA 3B3VA 4MBUA 4L8AA 2XEFA 3SJFA 1TF8A 2PJ4A 4XNHC 1AYEA 3GLJA 4UFWA 1B6BA 4JD6A 4CAVA 3B3SA 3TFYA 2FCKA 1WK4A 2Z3KA 4CAEA 4DYOA 5F09A 2IJZA 1R43A 3IU1A 2FSRA 3FH4A 4MHPA 4NSQA 4R57A 3WC5A 1IICA 2RFHA 2FL4A 3C26A 4OKOA 2R7HA 4FD4A 3BI1A 3FB3A 3IC1A 4UEEA 4TWEA 2CY2A 3JTKA 4ONUA 2CTCA 4QUSA 1S5KA 2FT0A 2ZW4A 2BEIA 1VKCA 4UEFA 3TO9A 5AG7A 1X10A 3TO6A 1YQEA 3PZJA 4KSAA 5GCNA 3R9EA 4BBHA 1MK4A 2AFOA 1Z8TA 2PRBA 3FYNA 3GUXA 4ZY2A 2GLJA 2ZXVA 4IK2A 3V8IA 5EC4A 2FVGA 2YNDA 3NE7A 3DR6A 1K4JA 4IAVA 1R57A 1LCPA 2QIRA 4OP4A 3VWEA 4P44A 1YGHA 1CP7A 3S9LA 4FD5A 5LYLA 1CPXA 4OIWA 3NFZA 4HNYB 3B35A 3FMCA 4A31A 5FVJA 2O53A 4YFJA 2C6CA 4U9YA 4B14A 5THWA 3KGQA 3MRUA 1MJ9A 4UA3A 5H86A 4NCZA 3S6KA 3PB7X 4NGRA 4ZYQA 1MJAA 4MFQA 1DE4C 1Z8WA 4IHMA 4CAFA 5D8NA 2YGWA 4CGMA 1OZPA 3ISXA 4H6ZA 4FAIA 4R8FA 2OR4A 2G3TA 1ARMA 5KTAA 2PR1A 1LANA 3B3WA 4JJXA 4MFZA 2PJ1A 3QAYA 5EMIA 3JVNA 4JXRA 4MY3A 4ZGYB 1M44A 2R1IA 3FECA 3SI0A 4ZY1A 1ZG7A 3FEDA 1IYKA 1Z9UA 2F5IA 2POKA 1BO4A 1Y7EA 4Q36A 5G1ZA 3KASA 3EY5A 3KR5A 2Q7SA 4MMOA 2PSWA 3F8KA 2O4HA 1S60A 4FD6A 4OAEA 1KUVA 1BPMA 1XJOA 3KZWA 4FUUA 1XMBA 2HC9A 4P4IA 2BOAA 2IMOA 4P4EA 3T90A 2REEA 3BHXA 4C2YA 2AFWA 4ZX8A 4MFKA 2Q4ZA 3ISZA 2RB7A 4A30A 2Q51A 4OLLA 4X3RA 4B5PB 4RUHA 3SXOA 2B4DA 1F57A 4AVCA 2JDCA 5J8CA 3V7ZA 3IWEA 3P2FA 5K8PA 5KTCA 1IYLA 1KWMA 1QMUA 5KTDA 3IU2A 2DF5A 3V38A 3GB0A 1GHEA 4OC5A 1MJBA 3NH8A 1BOBA 3N7ZA 4KOYA 4KVOE 3KKWA 4NGSA 1VHEA 2Z3PA 5I0CA 3TX8A 1YREA 2B4BA 1Z4EA 1FY7A 1B87A 3JRUA 5IB0A 4UBRA 5J8FA 3FF3A 4AVAA 3T8WA 2HUZA 4KOXA 5HVHA 4C68A 5IX3A 2OZGA 2ZEEA 3FIXA 5H84A 2PRQA 1QSRA 3FBUA 5HH1A 2IL4A 1QQ9A 2EO8A 5JH9A 2Q44A 3DR8A 3D68A 3S6HA 1JQGA 2ABZA 4M6GA 2GANA 2PJ2A 1Z8LA 2HV2A 3D7GA 1S7KA 1RXTA 3ZJ0A 1BAVA 1UWYA 4OC4A 5HXDA 4QC6A 4NF1A 4P6YA 4MHYA 1BPNA 4UCMA 2VBQA 2PJ3A 2Z3NA 1CBXA 1Q2DA 1HDUA 5K8MA 1U6MA 5CPAA 3EFAA 3CXSA 2A4NA 1P4NA 4YRHA 5DS0A 4R87A 3IO1A 4R6TA 1YK3A 3DLJA 3NH5A 2Z3LA 4CRYB 2OH1A 4R3LA 3D7DA 4FBEA 1IU8A 5LRKA 2PJAA 4ZX9A 4B5OA 1VIXA 2Z0ZA 2JEVA 3EC4A 3HUVA 2WSAA 3CPAA 3RYOA 4KZTA 1QSNA 3D7FA 3BJ8A 4P4BA 1HDQA 4UFXA 2REFA 4GXHA 3WT4A 4EMEA 3NA6A 2DPTA 3QNVA 4R3KA 2PJ0A 1R3NA 3VWDA 3S6GA 1KZFA 2AFUA 4JLYA 4H6UA 1F2PA 1QSOA 4MHNA 5K8OA 4OC3A 2CTBA 1LFWA 4NGQA 5LRGA 3W91A 4M3SA 4M6HA 4HNXB 2O28A 4RI1A 3S6FA 4CS0B 1TXRA 2J9AA 4X5KA 3F0AA 4CAXA 4OADA 4PXDA 3W6SA 2PVVA 1IY7A 1LOKA 3TE4A 1VHSA 4A37A 2X7BA 2EVNA 5LYIA 3K2KA 3SJXA 3TO7A 4CYQA 3TCVA 1XEBA 2Q04A 2EWBA 2XEJA 4UCNA 1V0CA 2BUEA 3FXTA 4MY0A 5JM6A 2AE6A 2VEZA 1ZG9A 4PQAA 4X8IA 3D7HA 4MXUA 4AVBA 4JXQA 2BSWA 2ZW5A 1L0CA 4CRZB 4H89A 1PYTB 4B6ZA 2V8VA 5I4MA 4HPSA 3KR4A 1XE4A 2PE3A 3B7IA 2Q7BA 5JPHA 4II9A 4XPDC 2AFSA 2ZEFA 3PRTA 4W9YA 4NJRA 1UFHA 2PDOA 2PJ6A 2J8RA 1S7FA 3D66A 5IB9A 4C7HA 4B12A 3G8WA 3MGDA 2J8NA 2F8HA 3QAHA 4MCPA 3PBEA 2YNCA 4MHDA 4KLWA 4U5YA 3S9MA 4AB7A 1IOIA 5C82A 3EO4A 5AG6A 1IOFA 1YVOA 5CNPA 1I1DA 1GYTA 2OZUA 2B3UA 2G3AA 2QMLA 2I79A 3D8PA 1TIQA 1IB1E 2C1CA 4CAWA 4F6AA 5F49A 4F9UA 1XF8A 3WR7A 2ZEMA 2WYRA 2ARHA 2PJ5A 2GU2A 1TKHA 3CDXA 4X2TA 3GKRA 4CGPA 2JLMA 3VARA 4GM5A 1BLLE 3DDDA 4KVXA 2VXKA 2D4OA 1M1DA 2ODFA 2P6FA 2YNCC 4RS2A 3PB4X 1S7LA 1M4GA 3R9FA 1CG2A 1ZLIA 2Z10A 4HKFA 3RAMA 2D4PA 4A2ZA 3H5ZA 2B5GA 1S3ZA 2I00A 2ZEHA 4B13A 2WUUA 3B3CA 2ZW7A 4MCRA 3PEIA 1P0HA 4OC0A 2XEGA 4KUAA 2HB6A 1M4LA 2G9DA 5AG5A 1A2ZA 4UEZA 5G21A 1H8LA 2C27A 3GY9A 4KOVA 4B10A 5LYDA 3E0KA 4QVTA 3R96A 2OZHA 5DWMA 1Z2LA 3N5FA 1CP6A 5F48A 4DNCA 3EXNA 5ELYA 4NFRA 4QB9A 4KLVA 4Y49C 3LWUA 4F9VA 2R98A 4PXEA 1XFOA 1XIXA 1J4JA 1Y0YA 2Q0YA 1XRYA 4EFDA 4AG7A 3FEEA 2FIAA 4MFJA 2ZPAA 3WC7A 5HVGA 4P45A 4MRIA 1ON0A 3DSBA 4M6IA 5AGEA 2Q43A 4LQGA 5LRJA 1CX8A 4AXVA 2C6PA 3PB8X 4PV6A 4JWPA 1KUYA 3K9UA 3PFEA 4UFVA 1S7NA 1CM0A 1Y9KA 1PCAA 4KOUA 4LX9A 4UWJA 4M85A 3R95A 3LACA 4KORA 3W6XA 2HQYA 4NEXA 1YW6A 1I12A 4O23A 4Q7AA 2JBKA 5K8NA
chains in the Genus database with same CATH topology
2PJ9A 4NJQA 1YMEA 4NGNA 4P10A 3KL9A 4P4FA 4NGPA 1IGBA 1DTDA 1YW4A 5D29A 2AFXA 4DUKA 5JGFA 3IIBA 4PPZA 4H2KA 1FNOA 2ZOFA 8CPAA 2F7VA 1EE3P 2NYQA 4MHZA 2ZENA 2V8HA 3KQXA 2EK9A 3KHXA 2BCOA 2DEAA 2NSMA 3IEHA 4YWYA 1VGYA 2BO9A 1NSAA 5LYFA 3IWWA 4ONWA 1F2OA 2QJ8A 2V8DA 3L2NA 2ZEDA 3IJ3A 1ELLP 2VL1A 2AFZA 3H8FA 2PJCA 4NGTA 1YLOA 2PJ8A 3S9NA 4WWVA 4DJLA 4PXBA 4A39A 4F8ZA 3KI9A 4K3NA 3BXMA 2ZEPA 1RTQA 3LMSA 4MCQA 3H8EA 3SJEA 1Z5RA 4JYWA 2ANPA 3MN8A 2PJ7A 1ZG8A 1YSJA 4UIBA 5CBMA 3TC8A 2JEWA 4OC1A 5HVFA 4BD9A 1HEEA 2PCUA 2PIYA 4R76A 4JZ0A 3PB9X 2QYVA 2GLFA 1TKFA 1TKJA 2EK8A 2CIJA 1OBRA 3FVLA 1XBUA 2V77A 4NGMA 1FT7A 2WZNA 3CT9A 2QVPA 2ZOGA 2PVWA 1TF9A 2ZEGA 2C6GA 1VHOA 6CPAA 4OIDA 3RBUA 1ARLA 4P4JA 4MCSA 4UIAA 4R7MA 2IQ6A 4EWTA 2ZELA 4CPAA 3KHZA 2I3CA 3K9TA 3D67A 3PFOA 3BI0A 2AFMA 3SI2A 4WJBA 4UF4A 4ZY0A 2XEIA 4OMEA 1CPSA 1ZLHA 3B3TA 2JBJA 3IFEA 3CPXA 4PXCA 3D4UA 4KSIA 3B2YA 3SJGA 2OOTA 2V8GA 3PB6X 4G1PA 4A38A 4OC2A 4YU9A 3I1UA 1Q7LA 4P4DA 1AMPA 3KQZA 2CF4A 2ZEOA 4FWUA 3DGVA 1Y0RA 1LAMA 3WC6A 3SI1A 3FX6A 1ELMP 3FJUA 2GREA 3VATA 3H8GA 3RZAA 2PIZA 4ZI6A 5J1QA 4TNUA 3VH9A 3NH4A 3WABA 4Z65A 2PJBA 3HLPA 3PBBA 7CPAA 1LAPA 4A94A 3B3VA 2XEFA 3SJFA 1TF8A 2PJ4A 1AYEA 3GLJA 3B3SA 4DYOA 5F09A 2IJZA 1R43A 3FH4A 4MHPA 3WC5A 2RFHA 4OKOA 4UEEA 3BI1A 3IC1A 4TWEA 2CTCA 4UEFA 4ZY2A 2AFOA 3GUXA 2GLJA 4IK2A 2FVGA 4OP4A 4IAVA 1LCPA 4P44A 1CP7A 3S9LA 5LYLA 1CPXA 4OIWA 3NFZA 3B35A 3FMCA 2O53A 2C6CA 5THWA 3KGQA 3MRUA 3PB7X 4NGRA 4ZYQA 1DE4C 4IHMA 5D8NA 3ISXA 4FAIA 4R8FA 2OR4A 1ARMA 1LANA 3B3WA 2PJ1A 3FECA 3SI0A 4ZY1A 1ZG7A 3FEDA 2POKA 1Y7EA 3KASA 3KR5A 4MMOA 2O4HA 1BPMA 1XJOA 3KZWA 4FUUA 1XMBA 2HC9A 4P4IA 2BOAA 2IMOA 4P4EA 3BHXA 2AFWA 4ZX8A 2Q4ZA 3ISZA 2RB7A 2Q51A 4RUHA 4X3RA 1F57A 3V7ZA 5K8PA 1KWMA 1QMUA 3V38A 3GB0A 4OC5A 3NH8A 4NGSA 1VHEA 3TX8A 3JRUA 3FF3A 3T8WA 5HVHA 2ZEEA 2PRQA 1QQ9A 5JH9A 3D68A 1JQGA 2ABZA 2PJ2A 1Z8LA 3D7GA 1BAVA 1UWYA 4OC4A 5HXDA 4P6YA 4MHYA 1BPNA 2PJ3A 1CBXA 1HDUA 5K8MA 5CPAA 5DS0A 3IO1A 4R6TA 3DLJA 3NH5A 3D7DA 4FBEA 5LRKA 2PJAA 4ZX9A 1VIXA 3HUVA 3CPAA 3D7FA 4P4BA 1HDQA 3WT4A 4EMEA 3NA6A 3QNVA 2PJ0A 1R3NA 2AFUA 4MHNA 1F2PA 5K8OA 4OC3A 2CTBA 1LFWA 4NGQA 5LRGA 1TXRA 2J9AA 4PXDA 2PVVA 1IY7A 1LOKA 4A37A 5LYIA 3K2KA 3SJXA 2EWBA 2XEJA 5JM6A 1ZG9A 4PQAA 4X8IA 3D7HA 4MXUA 5I4MA 1PYTB 4B6ZA 2V8VA 3KR4A 3B7IA 2PE3A 2AFSA 2ZEFA 3PRTA 4W9YA 4NJRA 2PJ6A 3D66A 5IB9A 2F8HA 4MCPA 3PBEA 3S9MA 1GYTA 2C1CA 4F9UA 2ZEMA 2WYRA 2PJ5A 2GU2A 1TKHA 3CDXA 4X2TA 3VARA 4GM5A 1BLLE 3PB4X 1CG2A 1ZLIA 3RAMA 2ZEHA 3B3CA 4MCRA 3PEIA 4OC0A 2XEGA 2HB6A 1M4LA 2G9DA 4UEZA 1H8LA 5LYDA 1Z2LA 3N5FA 1CP6A 5ELYA 4NFRA 3LWUA 4F9VA 4PXEA 1XFOA 1Y0YA 1XRYA 4EFDA 3FEEA 5HVGA 3WC7A 4P45A 4MRIA 2Q43A 4LQGA 5LRJA 1CX8A 4AXVA 2C6PA 3PB8X 3PFEA 1PCAA 1YW6A 4O23A 4Q7AA 2JBKA 5K8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ9 A;  4NJQ A;  1YME A;  4NGN A;  4P10 A;  3KL9 A;  4P4F A;  4NGP A;  1IGB A;  1DTD A;  1YW4 A;  5D29 A;  2AFX A;  4DUK A;  5JGF A;  3IIB A;  4PPZ A;  4H2K A;  1FNO A;  2ZOF A;  8CPA A;  2F7V A;  1EE3 P;  2NYQ A;  4MHZ A;  2ZEN A;  2V8H A;  3KQX A;  2EK9 A;  3KHX A;  2BCO A;  2DEA A;  2NSM A;  3IEH A;  4YWY A;  1VGY A;  2BO9 A;  1NSA A;  5LYF A;  3IWW A;  4ONW A;  1F2O A;  2QJ8 A;  2V8D A;  3L2N A;  2ZED A;  3IJ3 A;  1ELL P;  2VL1 A;  2AFZ A;  3H8F A;  2PJC A;  4NGT A;  1YLO A;  2PJ8 A;  3S9N A;  4WWV A;  4DJL A;  4PXB A;  4A39 A;  4F8Z A;  3KI9 A;  4K3N A;  3BXM A;  2ZEP A;  1RTQ A;  3LMS A;  4MCQ A;  3H8E A;  3SJE A;  1Z5R A;  4JYW A;  2ANP A;  3MN8 A;  2PJ7 A;  1ZG8 A;  1YSJ A;  4UIB A;  5CBM A;  3TC8 A;  2JEW A;  4OC1 A;  5HVF A;  4BD9 A;  1HEE A;  2PCU A;  2PIY A;  4R76 A;  4JZ0 A;  3PB9 X;  2QYV A;  2GLF A;  1TKF A;  1TKJ A;  2EK8 A;  2CIJ A;  1OBR A;  3FVL A;  1XBU A;  2V77 A;  4NGM A;  1FT7 A;  2WZN A;  3CT9 A;  2QVP A;  2ZOG A;  2PVW A;  1TF9 A;  2ZEG A;  2C6G A;  1VHO A;  6CPA A;  4OID A;  3RBU A;  1ARL A;  4P4J A;  4MCS A;  4UIA A;  4R7M A;  2IQ6 A;  4EWT A;  2ZEL A;  4CPA A;  3KHZ A;  2I3C A;  3K9T A;  3D67 A;  3PFO A;  3BI0 A;  2AFM A;  3SI2 A;  4WJB A;  4UF4 A;  4ZY0 A;  2XEI A;  4OME A;  1CPS A;  1ZLH A;  3B3T A;  2JBJ A;  3IFE A;  3CPX A;  4PXC A;  3D4U A;  4KSI A;  3B2Y A;  3SJG A;  2OOT A;  2V8G A;  3PB6 X;  4G1P A;  4A38 A;  4OC2 A;  4YU9 A;  3I1U A;  1Q7L A;  4P4D A;  1AMP A;  3KQZ A;  2CF4 A;  2ZEO A;  4FWU A;  3DGV A;  1Y0R A;  1LAM A;  3WC6 A;  3SI1 A;  3FX6 A;  1ELM P;  3FJU A;  2GRE A;  3VAT A;  3H8G A;  3RZA A;  2PIZ A;  4ZI6 A;  5J1Q A;  4TNU A;  3VH9 A;  3NH4 A;  3WAB A;  4Z65 A;  2PJB A;  3HLP A;  3PBB A;  7CPA A;  1LAP A;  4A94 A;  3B3V A;  2XEF A;  3SJF A;  1TF8 A;  2PJ4 A;  1AYE A;  3GLJ A;  3B3S A;  4DYO A;  5F09 A;  2IJZ A;  1R43 A;  3FH4 A;  4MHP A;  3WC5 A;  2RFH A;  4OKO A;  4UEE A;  3BI1 A;  3IC1 A;  4TWE A;  2CTC A;  4UEF A;  4ZY2 A;  2AFO A;  3GUX A;  2GLJ A;  4IK2 A;  2FVG A;  4OP4 A;  4IAV A;  1LCP A;  4P44 A;  1CP7 A;  3S9L A;  5LYL A;  1CPX A;  4OIW A;  3NFZ A;  3B35 A;  3FMC A;  2O53 A;  2C6C A;  5THW A;  3KGQ A;  3MRU A;  3PB7 X;  4NGR A;  4ZYQ A;  1DE4 C;  4IHM A;  5D8N A;  3ISX A;  4FAI A;  4R8F A;  2OR4 A;  1ARM A;  1LAN A;  3B3W A;  2PJ1 A;  3FEC A;  3SI0 A;  4ZY1 A;  1ZG7 A;  3FED A;  2POK A;  1Y7E A;  3KAS A;  3KR5 A;  4MMO A;  2O4H A;  1BPM A;  1XJO A;  3KZW A;  4FUU A;  1XMB A;  2HC9 A;  4P4I A;  2BOA A;  2IMO A;  4P4E A;  3BHX A;  2AFW A;  4ZX8 A;  2Q4Z A;  3ISZ A;  2RB7 A;  2Q51 A;  4RUH A;  4X3R A;  1F57 A;  3V7Z A;  5K8P A;  1KWM A;  1QMU A;  3V38 A;  3GB0 A;  4OC5 A;  3NH8 A;  4NGS A;  1VHE A;  3TX8 A;  3JRU A;  3FF3 A;  3T8W A;  5HVH A;  2ZEE A;  2PRQ A;  1QQ9 A;  5JH9 A;  3D68 A;  1JQG A;  2ABZ A;  2PJ2 A;  1Z8L A;  3D7G A;  1BAV A;  1UWY A;  4OC4 A;  5HXD A;  4P6Y A;  4MHY A;  1BPN A;  2PJ3 A;  1CBX A;  1HDU A;  5K8M A;  5CPA A;  5DS0 A;  3IO1 A;  4R6T A;  3DLJ A;  3NH5 A;  3D7D A;  4FBE A;  5LRK A;  2PJA A;  4ZX9 A;  1VIX A;  3HUV A;  3CPA A;  3D7F A;  4P4B A;  1HDQ A;  3WT4 A;  4EME A;  3NA6 A;  3QNV A;  2PJ0 A;  1R3N A;  2AFU A;  4MHN A;  1F2P A;  5K8O A;  4OC3 A;  2CTB A;  1LFW A;  4NGQ A;  5LRG A;  1TXR A;  2J9A A;  4PXD A;  2PVV A;  1IY7 A;  1LOK A;  4A37 A;  5LYI A;  3K2K A;  3SJX A;  2EWB A;  2XEJ A;  5JM6 A;  1ZG9 A;  4PQA A;  4X8I A;  3D7H A;  4MXU A;  5I4M A;  1PYT B;  4B6Z A;  2V8V A;  3KR4 A;  3B7I A;  2PE3 A;  2AFS A;  2ZEF A;  3PRT A;  4W9Y A;  4NJR A;  2PJ6 A;  3D66 A;  5IB9 A;  2F8H A;  4MCP A;  3PBE A;  3S9M A;  1GYT A;  2C1C A;  4F9U A;  2ZEM A;  2WYR A;  2PJ5 A;  2GU2 A;  1TKH A;  3CDX A;  4X2T A;  3VAR A;  4GM5 A;  1BLL E;  3PB4 X;  1CG2 A;  1ZLI A;  3RAM A;  2ZEH A;  3B3C A;  4MCR A;  3PEI A;  4OC0 A;  2XEG A;  2HB6 A;  1M4L A;  2G9D A;  4UEZ A;  1H8L A;  5LYD A;  1Z2L A;  3N5F A;  1CP6 A;  5ELY A;  4NFR A;  3LWU A;  4F9V A;  4PXE A;  1XFO A;  1Y0Y A;  1XRY A;  4EFD A;  3FEE A;  5HVG A;  3WC7 A;  4P45 A;  4MRI A;  2Q43 A;  4LQG A;  5LRJ A;  1CX8 A;  4AXV A;  2C6P A;  3PB8 X;  3PFE A;  1PCA A;  1YW6 A;  4O23 A;  4Q7A A;  2JBK A;  5K8N A; 
#chains in the Genus database with same CATH topology
 2PJ9 A;  4NJQ A;  1YME A;  4NGN A;  3TTH A;  1KUX A;  4P10 A;  1ZO0 A;  3KL9 A;  4CGN A;  4CGO A;  2CNS A;  1X12 A;  1M4I A;  3IWG A;  4P4F A;  4NGP A;  3TOA A;  1IGB A;  2FIW A;  2GFQ A;  1DTD A;  3G3S A;  1YW4 A;  2DXQ A;  5D29 A;  2AFX A;  4DUK A;  5JGF A;  2PR8 A;  3PP9 A;  2GIV A;  3IIB A;  2FE7 A;  2WPX A;  2KCW A;  2OU2 A;  1QSM A;  2Q4V A;  4H2K A;  4PPZ A;  4CYN A;  1FNO A;  2RC4 A;  2CNM A;  2B4D B;  3B8G A;  2ZOF A;  5IV0 A;  8CPA A;  3LD2 A;  5A28 A;  2P6E A;  1XMT A;  2F7V A;  1EE3 P;  2NYQ A;  4MHZ A;  2ZEN A;  2V8H A;  3KQX A;  2EK9 A;  2YNE A;  3KHX A;  2BCO A;  1N71 A;  4MFP A;  2DEA A;  2NSM A;  3IEH A;  4YWY A;  3RO0 A;  1VGY A;  4R9M A;  2BO9 A;  2VZZ A;  1NSA A;  2VI7 A;  5LYF A;  3IWW A;  4ONW A;  1F2O A;  2QJ8 A;  3I9S A;  2V8D A;  3L2N A;  2ZED A;  2G0B A;  3IJ3 A;  1ELL P;  2VL1 A;  2AFZ A;  3CZX A;  3H8F A;  4F0X A;  2PJC A;  4XNH B;  4L89 A;  4NGT A;  1YLO A;  2PJ8 A;  4PSW A;  3S9N A;  4WWV A;  3CXQ A;  4DJL A;  1WWZ A;  3GIU A;  5G22 A;  2Y0M A;  4PXB A;  2P0W A;  1RO5 A;  4KOT A;  2JDD A;  4A39 A;  4F8Z A;  2WPW A;  3KI9 A;  4K3N A;  5BWA B;  3BXM A;  2ZEP A;  1XOV A;  1YVK A;  1RTQ A;  3LMS A;  3ZZI A;  4MCQ A;  4MFL A;  4B5P A;  5F47 A;  2H5M A;  2B58 A;  3H8E A;  3SJE A;  1Z5R A;  4MJ8 A;  4UWI A;  2AJ6 A;  4JYW A;  2ANP A;  3MN8 A;  3IGR A;  2P6G A;  5EBV A;  5JQ4 A;  4C2X A;  2EBJ A;  2PJ7 A;  4ZBG A;  1ZG8 A;  1YSJ A;  2Z3M A;  4U9Z A;  4UIB A;  5CBM A;  3TC8 A;  3JUW A;  2JEW A;  1NSL A;  4OC1 A;  3PGP A;  5A27 A;  5HVF A;  4XPK A;  4BD9 A;  1YLE A;  4A95 A;  1HEE A;  2J8M A;  2PCU A;  2VZY A;  2PIY A;  4IUS A;  4R76 A;  1JWQ A;  3A9L A;  4JZ0 A;  4NXY A;  3PB9 X;  2QYV A;  5C88 A;  2OB0 A;  2GLF A;  3F5B A;  4K30 A;  5ISV A;  1NMT A;  1TKF A;  1TKJ A;  3CXP A;  4YGO A;  2EK8 A;  2CIJ A;  1OBR A;  3FVL A;  4GS4 A;  1XBU A;  2V77 A;  4KSF A;  4NGM A;  4XPL A;  1FT7 A;  2VQY A;  2FXF A;  1YR0 A;  4I49 A;  3UY5 A;  2WZN A;  3CT9 A;  4E8O A;  1M4D A;  2K5T A;  2QVP A;  3SHP A;  4E0A A;  2ZOG A;  4XPD B;  1QST A;  2PVW A;  2EUI A;  5HMN A;  2R8V A;  1Q2C A;  1TF9 A;  4KUB A;  1Q2Y A;  2ZEG A;  2C6G A;  4KOS A;  1VHO A;  4AG9 A;  1AUG A;  3R1K A;  4OID A;  6CPA A;  3RBU A;  4CYO A;  1ARL A;  4LUA A;  3BLN A;  1CJW A;  3H4Q A;  3GYA A;  4HNW B;  4P4J A;  1SQH A;  4KS9 A;  4CYP A;  4C7I A;  4MCS A;  4UIA A;  4A33 A;  1IID A;  4UCP A;  4B11 A;  2BL1 A;  3FRM A;  4R7M A;  3NE8 A;  2DPS A;  5E96 A;  4F0Y A;  2IQ6 A;  2Z3O A;  2ZEL A;  4EWT A;  4CPA A;  3DNS A;  3KHZ A;  2I3C A;  3LOD A;  5G20 A;  4BIN A;  3K9T A;  2Q4Y A;  3D67 A;  3PFO A;  3RNZ A;  1Z8X A;  4RN7 A;  4QBJ A;  4ORF A;  3BI0 A;  3T9Y A;  2AFM A;  3QB8 A;  2QEC A;  3SI2 A;  4WJB A;  3OWC A;  4C2Z A;  4UF4 A;  4ZY0 A;  2XEI A;  4OME A;  3D3S A;  1CPS A;  2NMT A;  4J3G A;  2CNT A;  1ZLH A;  3B3T A;  2JBJ A;  3FNC A;  3IFE A;  3CPX A;  4LQ6 A;  4PXC A;  3D4U A;  4FD7 A;  4KSI A;  3B2Y A;  1I21 A;  3SJG A;  3TT2 A;  2OOT A;  3D2P A;  4CGL A;  2V8G A;  3PB6 X;  4G1P A;  2CXA A;  4A38 A;  4EVY A;  5DWN A;  3TOB A;  4OC2 A;  2GE3 A;  3I1U A;  1Q7L A;  4P4D A;  4YU9 A;  3SXN A;  1Z4R A;  1AMP A;  3KQZ A;  2CF4 A;  2ZEO A;  4FWU A;  5F46 A;  3DGV A;  1NE9 A;  1Y0R A;  1LAM A;  3WC6 A;  3SI1 A;  3R9G A;  3FX6 A;  1ELM P;  1PU9 A;  1YX0 A;  1PUA A;  3P2H A;  4PK3 A;  4PK2 A;  2PQ8 A;  2Z11 A;  3FJU A;  2GRE A;  4A32 A;  2FS5 A;  2PC1 A;  3BJ7 A;  4KVM E;  4Y49 B;  4MI4 A;  3I3G A;  4E2A A;  2B3V A;  3VAT A;  3H8G A;  3RZA A;  2PIZ A;  2B5G B;  1LRZ A;  4KOW A;  4BMH A;  2ATR A;  4ZI6 A;  5J1Q A;  4TNU A;  3VH9 A;  1Y9W A;  3NH4 A;  2ZW6 A;  4IF5 A;  3WAB A;  4Z65 A;  2PJB A;  1Y7R A;  3HLP A;  3D2M A;  3PBB A;  4Q38 A;  7CPA A;  1LAP A;  5AG4 A;  4A94 A;  4PSX A;  3B3V A;  4MBU A;  4L8A A;  2XEF A;  3SJF A;  1TF8 A;  2PJ4 A;  4XNH C;  1AYE A;  3GLJ A;  4UFW A;  1B6B A;  4JD6 A;  4CAV A;  3B3S A;  3TFY A;  2FCK A;  1WK4 A;  2Z3K A;  4CAE A;  4DYO A;  5F09 A;  2IJZ A;  1R43 A;  3IU1 A;  2FSR A;  3FH4 A;  4MHP A;  4NSQ A;  4R57 A;  3WC5 A;  1IIC A;  2RFH A;  2FL4 A;  3C26 A;  4OKO A;  2R7H A;  4FD4 A;  3BI1 A;  3FB3 A;  3IC1 A;  4UEE A;  4TWE A;  2CY2 A;  3JTK A;  4ONU A;  2CTC A;  4QUS A;  1S5K A;  2FT0 A;  2ZW4 A;  2BEI A;  1VKC A;  4UEF A;  3TO9 A;  5AG7 A;  1X10 A;  3TO6 A;  1YQE A;  3PZJ A;  4KSA A;  5GCN A;  3R9E A;  4BBH A;  1MK4 A;  2AFO A;  1Z8T A;  2PRB A;  3FYN A;  3GUX A;  4ZY2 A;  2GLJ A;  2ZXV A;  4IK2 A;  3V8I A;  5EC4 A;  2FVG A;  2YND A;  3NE7 A;  3DR6 A;  1K4J A;  4IAV A;  1R57 A;  1LCP A;  2QIR A;  4OP4 A;  3VWE A;  4P44 A;  1YGH A;  1CP7 A;  3S9L A;  4FD5 A;  5LYL A;  1CPX A;  4OIW A;  3NFZ A;  4HNY B;  3B35 A;  3FMC A;  4A31 A;  5FVJ A;  2O53 A;  4YFJ A;  2C6C A;  4U9Y A;  4B14 A;  5THW A;  3KGQ A;  3MRU A;  1MJ9 A;  4UA3 A;  5H86 A;  4NCZ A;  3S6K A;  3PB7 X;  4NGR A;  4ZYQ A;  1MJA A;  4MFQ A;  1DE4 C;  1Z8W A;  4IHM A;  4CAF A;  5D8N A;  2YGW A;  4CGM A;  1OZP A;  3ISX A;  4H6Z A;  4FAI A;  4R8F A;  2OR4 A;  2G3T A;  1ARM A;  5KTA A;  2PR1 A;  1LAN A;  3B3W A;  4JJX A;  4MFZ A;  2PJ1 A;  3QAY A;  5EMI A;  3JVN A;  4JXR A;  4MY3 A;  4ZGY B;  1M44 A;  2R1I A;  3FEC A;  3SI0 A;  4ZY1 A;  1ZG7 A;  3FED A;  1IYK A;  1Z9U A;  2F5I A;  2POK A;  1BO4 A;  1Y7E A;  4Q36 A;  5G1Z A;  3KAS A;  3EY5 A;  3KR5 A;  2Q7S A;  4MMO A;  2PSW A;  3F8K A;  2O4H A;  1S60 A;  4FD6 A;  4OAE A;  1KUV A;  1BPM A;  1XJO A;  3KZW A;  4FUU A;  1XMB A;  2HC9 A;  4P4I A;  2BOA A;  2IMO A;  4P4E A;  3T90 A;  2REE A;  3BHX A;  4C2Y A;  2AFW A;  4ZX8 A;  4MFK A;  2Q4Z A;  3ISZ A;  2RB7 A;  4A30 A;  2Q51 A;  4OLL A;  4X3R A;  4B5P B;  4RUH A;  3SXO A;  2B4D A;  1F57 A;  4AVC A;  2JDC A;  5J8C A;  3V7Z A;  3IWE A;  3P2F A;  5K8P A;  5KTC A;  1IYL A;  1KWM A;  1QMU A;  5KTD A;  3IU2 A;  2DF5 A;  3V38 A;  3GB0 A;  1GHE A;  4OC5 A;  1MJB A;  3NH8 A;  1BOB A;  3N7Z A;  4KOY A;  4KVO E;  3KKW A;  4NGS A;  1VHE A;  2Z3P A;  5I0C A;  3TX8 A;  1YRE A;  2B4B A;  1Z4E A;  1FY7 A;  1B87 A;  3JRU A;  5IB0 A;  4UBR A;  5J8F A;  3FF3 A;  4AVA A;  3T8W A;  2HUZ A;  4KOX A;  5HVH A;  4C68 A;  5IX3 A;  2OZG A;  2ZEE A;  3FIX A;  5H84 A;  2PRQ A;  1QSR A;  3FBU A;  5HH1 A;  2IL4 A;  1QQ9 A;  2EO8 A;  5JH9 A;  2Q44 A;  3DR8 A;  3D68 A;  3S6H A;  1JQG A;  2ABZ A;  4M6G A;  2GAN A;  2PJ2 A;  1Z8L A;  2HV2 A;  3D7G A;  1S7K A;  1RXT A;  3ZJ0 A;  1BAV A;  1UWY A;  4OC4 A;  5HXD A;  4QC6 A;  4NF1 A;  4P6Y A;  4MHY A;  1BPN A;  4UCM A;  2VBQ A;  2PJ3 A;  2Z3N A;  1CBX A;  1Q2D A;  1HDU A;  5K8M A;  1U6M A;  5CPA A;  3EFA A;  3CXS A;  2A4N A;  1P4N A;  4YRH A;  5DS0 A;  4R87 A;  3IO1 A;  4R6T A;  1YK3 A;  3DLJ A;  3NH5 A;  2Z3L A;  4CRY B;  2OH1 A;  4R3L A;  3D7D A;  4FBE A;  1IU8 A;  5LRK A;  2PJA A;  4ZX9 A;  4B5O A;  1VIX A;  2Z0Z A;  2JEV A;  3EC4 A;  3HUV A;  2WSA A;  3CPA A;  3RYO A;  4KZT A;  1QSN A;  3D7F A;  3BJ8 A;  4P4B A;  1HDQ A;  4UFX A;  2REF A;  4GXH A;  3WT4 A;  4EME A;  3NA6 A;  2DPT A;  3QNV A;  4R3K A;  2PJ0 A;  1R3N A;  3VWD A;  3S6G A;  1KZF A;  2AFU A;  4JLY A;  4H6U A;  1F2P A;  1QSO A;  4MHN A;  5K8O A;  4OC3 A;  2CTB A;  1LFW A;  4NGQ A;  5LRG A;  3W91 A;  4M3S A;  4M6H A;  4HNX B;  2O28 A;  4RI1 A;  3S6F A;  4CS0 B;  1TXR A;  2J9A A;  4X5K A;  3F0A A;  4CAX A;  4OAD A;  4PXD A;  3W6S A;  2PVV A;  1IY7 A;  1LOK A;  3TE4 A;  1VHS A;  4A37 A;  2X7B A;  2EVN A;  5LYI A;  3K2K A;  3SJX A;  3TO7 A;  4CYQ A;  3TCV A;  1XEB A;  2Q04 A;  2EWB A;  2XEJ A;  4UCN A;  1V0C A;  2BUE A;  3FXT A;  4MY0 A;  5JM6 A;  2AE6 A;  2VEZ A;  1ZG9 A;  4PQA A;  4X8I A;  3D7H A;  4MXU A;  4AVB A;  4JXQ A;  2BSW A;  2ZW5 A;  1L0C A;  4CRZ B;  4H89 A;  1PYT B;  4B6Z A;  2V8V A;  5I4M A;  4HPS A;  3KR4 A;  1XE4 A;  2PE3 A;  3B7I A;  2Q7B A;  5JPH A;  4II9 A;  4XPD C;  2AFS A;  2ZEF A;  3PRT A;  4W9Y A;  4NJR A;  1UFH A;  2PDO A;  2PJ6 A;  2J8R A;  1S7F A;  3D66 A;  5IB9 A;  4C7H A;  4B12 A;  3G8W A;  3MGD A;  2J8N A;  2F8H A;  3QAH A;  4MCP A;  3PBE A;  2YNC A;  4MHD A;  4KLW A;  4U5Y A;  3S9M A;  4AB7 A;  1IOI A;  5C82 A;  3EO4 A;  5AG6 A;  1IOF A;  1YVO A;  5CNP A;  1I1D A;  1GYT A;  2OZU A;  2B3U A;  2G3A A;  2QML A;  2I79 A;  3D8P A;  1TIQ A;  1IB1 E;  2C1C A;  4CAW A;  4F6A A;  5F49 A;  4F9U A;  1XF8 A;  3WR7 A;  2ZEM A;  2WYR A;  2ARH A;  2PJ5 A;  2GU2 A;  1TKH A;  3CDX A;  4X2T A;  3GKR A;  4CGP A;  2JLM A;  3VAR A;  4GM5 A;  1BLL E;  3DDD A;  4KVX A;  2VXK A;  2D4O A;  1M1D A;  2ODF A;  2P6F A;  2YNC C;  4RS2 A;  3PB4 X;  1S7L A;  1M4G A;  3R9F A;  1CG2 A;  1ZLI A;  2Z10 A;  4HKF A;  3RAM A;  2D4P A;  4A2Z A;  3H5Z A;  2B5G A;  1S3Z A;  2I00 A;  2ZEH A;  4B13 A;  2WUU A;  3B3C A;  2ZW7 A;  4MCR A;  3PEI A;  1P0H A;  4OC0 A;  2XEG A;  4KUA A;  2HB6 A;  1M4L A;  2G9D A;  5AG5 A;  1A2Z A;  4UEZ A;  5G21 A;  1H8L A;  2C27 A;  3GY9 A;  4KOV A;  4B10 A;  5LYD A;  3E0K A;  4QVT A;  3R96 A;  2OZH A;  5DWM A;  1Z2L A;  3N5F A;  1CP6 A;  5F48 A;  4DNC A;  3EXN A;  5ELY A;  4NFR A;  4QB9 A;  4KLV A;  4Y49 C;  3LWU A;  4F9V A;  2R98 A;  4PXE A;  1XFO A;  1XIX A;  1J4J A;  1Y0Y A;  2Q0Y A;  1XRY A;  4EFD A;  4AG7 A;  3FEE A;  2FIA A;  4MFJ A;  2ZPA A;  3WC7 A;  5HVG A;  4P45 A;  4MRI A;  1ON0 A;  3DSB A;  4M6I A;  5AGE A;  2Q43 A;  4LQG A;  5LRJ A;  1CX8 A;  4AXV A;  2C6P A;  3PB8 X;  4PV6 A;  4JWP A;  1KUY A;  3K9U A;  3PFE A;  4UFV A;  1S7N A;  1CM0 A;  1Y9K A;  1PCA A;  4KOU A;  4LX9 A;  4UWJ A;  4M85 A;  3R95 A;  3LAC A;  4KOR A;  3W6X A;  2HQY A;  4NEX A;  1YW6 A;  1I12 A;  4O23 A;  4Q7A A;  2JBK A;  5K8N A; 
#chains in the Genus database with same CATH homology
 2PJ9 A;  4NJQ A;  1YME A;  4NGN A;  4P10 A;  3KL9 A;  4P4F A;  4NGP A;  1IGB A;  1DTD A;  1YW4 A;  5D29 A;  2AFX A;  4DUK A;  5JGF A;  3IIB A;  4PPZ A;  4H2K A;  1FNO A;  2ZOF A;  8CPA A;  2F7V A;  1EE3 P;  2NYQ A;  4MHZ A;  2ZEN A;  2V8H A;  3KQX A;  2EK9 A;  3KHX A;  2BCO A;  2DEA A;  2NSM A;  3IEH A;  4YWY A;  1VGY A;  2BO9 A;  1NSA A;  5LYF A;  3IWW A;  4ONW A;  1F2O A;  2QJ8 A;  2V8D A;  3L2N A;  2ZED A;  3IJ3 A;  1ELL P;  2VL1 A;  2AFZ A;  3H8F A;  2PJC A;  4NGT A;  1YLO A;  2PJ8 A;  3S9N A;  4WWV A;  4DJL A;  4PXB A;  4A39 A;  4F8Z A;  3KI9 A;  4K3N A;  3BXM A;  2ZEP A;  1RTQ A;  3LMS A;  4MCQ A;  3H8E A;  3SJE A;  1Z5R A;  4JYW A;  2ANP A;  3MN8 A;  2PJ7 A;  1ZG8 A;  1YSJ A;  4UIB A;  5CBM A;  3TC8 A;  2JEW A;  4OC1 A;  5HVF A;  4BD9 A;  1HEE A;  2PCU A;  2PIY A;  4R76 A;  4JZ0 A;  3PB9 X;  2QYV A;  2GLF A;  1TKF A;  1TKJ A;  2EK8 A;  2CIJ A;  1OBR A;  3FVL A;  1XBU A;  2V77 A;  4NGM A;  1FT7 A;  2WZN A;  3CT9 A;  2QVP A;  2ZOG A;  2PVW A;  1TF9 A;  2ZEG A;  2C6G A;  1VHO A;  6CPA A;  4OID A;  3RBU A;  1ARL A;  4P4J A;  4MCS A;  4UIA A;  4R7M A;  2IQ6 A;  4EWT A;  2ZEL A;  4CPA A;  3KHZ A;  2I3C A;  3K9T A;  3D67 A;  3PFO A;  3BI0 A;  2AFM A;  3SI2 A;  4WJB A;  4UF4 A;  4ZY0 A;  2XEI A;  4OME A;  1CPS A;  1ZLH A;  3B3T A;  2JBJ A;  3IFE A;  3CPX A;  4PXC A;  3D4U A;  4KSI A;  3B2Y A;  3SJG A;  2OOT A;  2V8G A;  3PB6 X;  4G1P A;  4A38 A;  4OC2 A;  4YU9 A;  3I1U A;  1Q7L A;  4P4D A;  1AMP A;  3KQZ A;  2CF4 A;  2ZEO A;  4FWU A;  3DGV A;  1Y0R A;  1LAM A;  3WC6 A;  3SI1 A;  3FX6 A;  1ELM P;  3FJU A;  2GRE A;  3VAT A;  3H8G A;  3RZA A;  2PIZ A;  4ZI6 A;  5J1Q A;  4TNU A;  3VH9 A;  3NH4 A;  3WAB A;  4Z65 A;  2PJB A;  3HLP A;  3PBB A;  7CPA A;  1LAP A;  4A94 A;  3B3V A;  2XEF A;  3SJF A;  1TF8 A;  2PJ4 A;  1AYE A;  3GLJ A;  3B3S A;  4DYO A;  5F09 A;  2IJZ A;  1R43 A;  3FH4 A;  4MHP A;  3WC5 A;  2RFH A;  4OKO A;  4UEE A;  3BI1 A;  3IC1 A;  4TWE A;  2CTC A;  4UEF A;  4ZY2 A;  2AFO A;  3GUX A;  2GLJ A;  4IK2 A;  2FVG A;  4OP4 A;  4IAV A;  1LCP A;  4P44 A;  1CP7 A;  3S9L A;  5LYL A;  1CPX A;  4OIW A;  3NFZ A;  3B35 A;  3FMC A;  2O53 A;  2C6C A;  5THW A;  3KGQ A;  3MRU A;  3PB7 X;  4NGR A;  4ZYQ A;  1DE4 C;  4IHM A;  5D8N A;  3ISX A;  4FAI A;  4R8F A;  2OR4 A;  1ARM A;  1LAN A;  3B3W A;  2PJ1 A;  3FEC A;  3SI0 A;  4ZY1 A;  1ZG7 A;  3FED A;  2POK A;  1Y7E A;  3KAS A;  3KR5 A;  4MMO A;  2O4H A;  1BPM A;  1XJO A;  3KZW A;  4FUU A;  1XMB A;  2HC9 A;  4P4I A;  2BOA A;  2IMO A;  4P4E A;  3BHX A;  2AFW A;  4ZX8 A;  2Q4Z A;  3ISZ A;  2RB7 A;  2Q51 A;  4RUH A;  4X3R A;  1F57 A;  3V7Z A;  5K8P A;  1KWM A;  1QMU A;  3V38 A;  3GB0 A;  4OC5 A;  3NH8 A;  4NGS A;  1VHE A;  3TX8 A;  3JRU A;  3FF3 A;  3T8W A;  5HVH A;  2ZEE A;  2PRQ A;  1QQ9 A;  5JH9 A;  3D68 A;  1JQG A;  2ABZ A;  2PJ2 A;  1Z8L A;  3D7G A;  1BAV A;  1UWY A;  4OC4 A;  5HXD A;  4P6Y A;  4MHY A;  1BPN A;  2PJ3 A;  1CBX A;  1HDU A;  5K8M A;  5CPA A;  5DS0 A;  3IO1 A;  4R6T A;  3DLJ A;  3NH5 A;  3D7D A;  4FBE A;  5LRK A;  2PJA A;  4ZX9 A;  1VIX A;  3HUV A;  3CPA A;  3D7F A;  4P4B A;  1HDQ A;  3WT4 A;  4EME A;  3NA6 A;  3QNV A;  2PJ0 A;  1R3N A;  2AFU A;  4MHN A;  1F2P A;  5K8O A;  4OC3 A;  2CTB A;  1LFW A;  4NGQ A;  5LRG A;  1TXR A;  2J9A A;  4PXD A;  2PVV A;  1IY7 A;  1LOK A;  4A37 A;  5LYI A;  3K2K A;  3SJX A;  2EWB A;  2XEJ A;  5JM6 A;  1ZG9 A;  4PQA A;  4X8I A;  3D7H A;  4MXU A;  5I4M A;  1PYT B;  4B6Z A;  2V8V A;  3KR4 A;  3B7I A;  2PE3 A;  2AFS A;  2ZEF A;  3PRT A;  4W9Y A;  4NJR A;  2PJ6 A;  3D66 A;  5IB9 A;  2F8H A;  4MCP A;  3PBE A;  3S9M A;  1GYT A;  2C1C A;  4F9U A;  2ZEM A;  2WYR A;  2PJ5 A;  2GU2 A;  1TKH A;  3CDX A;  4X2T A;  3VAR A;  4GM5 A;  1BLL E;  3PB4 X;  1CG2 A;  1ZLI A;  3RAM A;  2ZEH A;  3B3C A;  4MCR A;  3PEI A;  4OC0 A;  2XEG A;  2HB6 A;  1M4L A;  2G9D A;  4UEZ A;  1H8L A;  5LYD A;  1Z2L A;  3N5F A;  1CP6 A;  5ELY A;  4NFR A;  3LWU A;  4F9V A;  4PXE A;  1XFO A;  1Y0Y A;  1XRY A;  4EFD A;  3FEE A;  5HVG A;  3WC7 A;  4P45 A;  4MRI A;  2Q43 A;  4LQG A;  5LRJ A;  1CX8 A;  4AXV A;  2C6P A;  3PB8 X;  3PFE A;  1PCA A;  1YW6 A;  4O23 A;  4Q7A A;  2JBK A;  5K8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...