4AG7A

C. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): coenzyme a adduct
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
MSHIFDASVLAPHIPSNLPDNFKVRPLAKDDFSKGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDDCNFMTQRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of a Trapped Coenzyme a Adduct of Caenorhabditis Elegans Glucosamine-6-Phosphate N-Acetyltransferase 1.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
molecule keywords GLUCOSAMINE-6-PHOSPHATE N-ACETYLTRANSFERASE
total genus 43
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ag7A01
2D4OA 1YGHA 2B58A 4MHDA 3TCVA 4FD6A 5C82A 3FB3A 4XPDC 1J4JA 2KCWA 3G8WA 4XPDB 2B3UA 4MJ8A 2Z10A 4KVOE 4OADA 4B5PA 4U9ZA 2P6FA 2REEA 3FYNA 4B5PB 4QVTA 3IWGA 5J8CA 2JLMA 5F47A 3SXOA 1QSMA 4R3LA 4KOYA 3S6HA 1QSTA 5J8FA 2REFA 1WK4A 1OZPA 1XEBA 3D2MA 1NMTA 3CXPA 1M4IA 4M3SA 4HNXB 1I1DA 1FY7A 5DWMA 1B6BA 4ZBGA 1Q2CA 2B3VA 3F0AA 2VZYA 4AB7A 3DNSA 3TO6A 3P2HA 2GIVA 2JDCA 1S5KA 4KZTA 2ZW7A 4KOSA 4QC6A 3R9EA 5IX3A 2BL1A 2FIAA 3TO7A 3FRMA 1S3ZA 3F8KA 4MBUA 4KVXA 3DDDA 3SHPA 4OAEA 5IB0A 2GANA 5DWNA 1Y9KA 4MY0A 1KUVA 2C27A 5GCNA 3GKRA 2CNMA 2D4PA 4UWJA 1S7KA 2NMTA 4R87A 2Z0ZA 4H89A 4KVME 1IB1E 5H84A 2OU2A 1Q2DA 2OH1A 3FXTA 5E96A 1VHSA 4HNYB 2B4DB 3LD2A 4NCZA 3D2PA 1XIXA 4H6UA 4B5OA 2VXKA 1MJ9A 3JVNA 3EC4A 1S7NA 3WR7A 1M1DA 3GYAA 4CAWA 3TO9A 4KOXA 1YR0A 3PGPA 2R98A 4FD7A 2G3TA 2CNTA 4JXRA 2B5GB 2FS5A 3BLNA 1ON0A 3TOBA 1Z4EA 4R57A 3TE4A 2FE7A 1NE9A 5HH1A 2HV2A 3TFYA 3EO4A 2FIWA 2BUEA 2PR1A 1BOBA 4NEXA 4H6ZA 2QIRA 5H86A 3PZJA 4UWIA 1Q2YA 3VWEA 2VZZA 4GS4A 1P4NA 2PR8A 4CRZB 4LX9A 4JWPA 1PU9A 2WPWA 4KOVA 1IICA 2Q4YA 2IL4A 4U5YA 3LODA 2ZW5A 2GE3A 2FCKA 1Z9UA 2P6GA 1QSRA 3D8PA 2EVNA 4IUSA 3I9SA 4KOWA 4CAXA 4LUAA 2FSRA 4R9MA 4PV6A 4NXYA 4ORFA 4BMHA 2HUZA 5JPHA 2JEVA 1L0CA 4EVYA 4F0YA 1IYKA 4FD5A 3CXQA 4RS2A 3DSBA 1I12A 2HQYA 4F6AA 1I21A 1UFHA 3FNCA 1YREA 1IYLA 2Q04A 2Q0YA 4L8AA 1QSNA 1B87A 3TOAA 2R1IA 3N7ZA 3DR6A 2ZXVA 1MJBA 1XF8A 2OB0A 3W6XA 2ATRA 2QMLA 1MK4A 4Y49B 4PSXA 2CY2A 4X5KA 4Y49C 1YVKA 3C26A 5CNPA 5I0CA 2PC1A 1PUAA 4HKFA 3SXNA 1WWZA 2Q4VA 3KKWA 4PK3A 4JJXA 4KLVA 3BJ7A 3V8IA 3S6FA 1RO5A 1SQHA 3OWCA 2Q44A 3EFAA 4NSQA 4KOTA 2J8MA 3IGRA 4JXQA 2K5TA 1MJAA 5EC4A 2J8RA 1YX0A 2A4NA 4M85A 4YGOA 4QUSA 4KOUA 1M4DA 1TIQA 4UA3A 5F46A 4CS0B 2BEIA 4KUBA 3R9FA 1K4JA 3R9GA 3FBUA 5JQ4A 4PSWA 3TTHA 3JUWA 2FL4A 1Y7RA 2ZW6A 2FXFA 1M4GA 2AE6A 5F48A 1NSLA 4KORA 4KUAA 5KTCA 1M44A 4QB9A 4MY3A 5HMNA 1YVOA 1U6MA 4PK2A 3S6KA 5ISVA 4AVCA 2B4BA 1S7LA 2I79A 2ZW4A 4AVAA 3K9UA 5FVJA 2PQ8A 4CAVA 4J3GA 1KUXA 4AG7A 4DNCA 2EUIA 3R1KA 1S60A 1R57A 4KLWA 3W91A 4L89A 2FT0A 1Y9WA 1YLEA 1XMTA 4UBRA 3FIXA 3QAHA 1VKCA 4XNHC 1IIDA 2H5MA 2P0WA 4ONUA 4YFJA 4XNHB 1Z4RA 3B8GA 3PP9A 3MGDA 2WPXA 5EBVA 4RI1A 3VWDA 2OZUA 2OZHA 2G3AA 1QSOA 1CM0A 2JDDA 4MI4A 1N71A 3E0KA 4E2AA 2PRBA 1YK3A 1KUYA 4AVBA 5KTDA 2P6EA 2VQYA 5C88A 4JD6A 4AG9A 2ARHA 3D3SA 2VI7A 3T9YA 2R8VA 3TT2A 4I49A 2G0BA 3CXSA 3T90A 4E0AA 2O28A 4NF1A 4CRYB 1GHEA 2J8NA 2R7HA 4II9A 2OZGA 4HNWB 3R96A 3BJ8A 2Y0MA 3F5BA 1XE4A 4QBJA 2RC4A 3R95A 4K30A 4R3KA 4FD4A 4XPLA 2ZPAA 4YRHA 2BSWA 2F5IA 2QECA 2I00A 2DXQA 3RYOA 1BO4A 1V0CA 1P0HA 2Z11A 1S7FA 2AJ6A 4E8OA 3W6SA 2PDOA 3S6GA 1CJWA 2VEZA 3H4QA 3G3SA 2CNSA 5F49A 3UY5A 3QB8A 1LRZA 3EXNA 4JLYA 5KTAA 2B5GA 2X7BA 3ZZIA 2Q7BA 4IF5A 3P2FA 3EY5A 3I3GA 3DR8A 5IV0A 1RXTA 2VBQA 3ZJ0A 4XPKA 3GY9A 1KZFA 3NE7A 4OLLA 2PSWA 2B4DA 4U9YA
chains in the Genus database with same CATH superfamily
2D4OA 8CPAA 1YGHA 3S9MA 2B58A 2GFQA 4MHZA 2POKA 4CAFA 4MHDA 4C2XA 4B14A 4LQ6A 3HLPA 3TCVA 4FD6A 1Z8XA 5C82A 4DUKA 4FAIA 4NGRA 1JQGA 3FB3A 3SJEA 4KSFA 5A27A 4XPDC 1J4JA 3WT4A 2KCWA 3MRUA 5HVGA 1LCPA 3D66A 1LFWA 4X2TA 3G8WA 3I1UA 4XPDB 2PJCA 2B3UA 1LOKA 4MJ8A 4ONWA 2Z10A 2Z3KA 3LACA 1VIXA 2PJ8A 3PB8X 2P6FA 4KVOE 2REEA 4OADA 4U9ZA 1R43A 3FYNA 4QVTA 4B5PB 1AUGA 3D68A 4IHMA 3IWGA 5JH9A 2XEFA 2HB6A 5HVFA 2JLMA 3KI9A 5F47A 3SXOA 1QSMA 2EO8A 5J8CA 1A2ZA 1XMBA 4KOYA 4R3LA 4MCQA 4CGOA 3S6HA 3T8WA 4CGPA 1QSTA 3K9TA 5J1QA 3JTKA 5J8FA 2REFA 1WK4A 2PJ3A 2Q51A 4MCPA 2EWBA 1OZPA 1XEBA 3DGVA 3D2MA 1NMTA 3K2KA 3PB9X 4RUHA 3CXPA 4PXEA 2AFZA 1M4IA 4X3RA 2PJ0A 2Z3PA 4UIAA 4M3SA 4HNXB 1I1DA 4UIBA 1FY7A 3NH4A 5DWMA 1B6BA 4ZBGA 1Q2CA 4K3NA 2B3VA 4LQGA 3F0AA 2VZYA 4AB7A 3DNSA 3WC7A 3ISZA 4EFDA 4B11A 4YWYA 3TO6A 3P2HA 2GIVA 4Z65A 2RB7A 2JDCA 4MCSA 1S5KA 1Z8WA 2ZOGA 3B3VA 2ZW7A 4KZTA 4KOSA 4BBHA 4QC6A 4A94A 3R9EA 5IX3A 3B3WA 2BL1A 4PQAA 2FIAA 2C6GA 3TO7A 1IY7A 1DE4C 3FRMA 4BD9A 1S3ZA 2QYVA 1QMUA 2G9DA 3F8KA 2ZEOA 1CPSA 4MBUA 1R3NA 4KVXA 4IK2A 3DDDA 5G20A 3SHPA 4OAEA 1XJOA 1JWQA 3B7IA 3IO1A 5IB0A 1DTDA 2GANA 1F2OA 5DWNA 1Y9KA 2AFOA 4MY0A 1KUVA 5LYFA 2C27A 4NJRA 5GCNA 3GKRA 3FECA 4CAEA 2CNMA 2D4PA 4UWJA 2RFHA 1S7KA 2NMTA 4R87A 2Z0ZA 4H89A 3S9NA 4KVME 2PVWA 1IB1E 2PVVA 3IJ3A 5H84A 4A33A 2OU2A 4RN7A 1Z5RA 1Q2DA 2OH1A 3FXTA 5E96A 1VHSA 3B3TA 3VARA 1CPXA 1YLOA 4UFXA 3SI2A 4HNYB 3RAMA 2B4DB 3LD2A 3KQZA 4NCZA 4P45A 4PXDA 3D2PA 2PJBA 1XIXA 4H6UA 6CPAA 3KR4A 4B5OA 2HC9A 2V8VA 2VXKA 3HUVA 3PBBA 1MJ9A 3JVNA 2XEIA 1S7NA 3EC4A 1PYTB 4B10A 4P4FA 2DPSA 3WR7A 3QAYA 1M1DA 2ODFA 3GYAA 2GREA 4CAWA 3TO9A 4MXUA 4KOXA 4C7HA 3BI1A 3FH4A 4M6GA 2C1CA 1YR0A 3PGPA 3PB6X 2R98A 4CGLA 2JEWA 4FD7A 3WC5A 4B6ZA 3B2YA 2G3TA 2CNTA 3B3SA 4R7MA 4MFQA 1YW4A 1BAVA 3BI0A 2B5GB 4JXRA 2FS5A 3BLNA 1ON0A 1TF8A 5K8PA 3TOBA 3D4UA 1Z4EA 1YQEA 1XRYA 4R57A 3TE4A 2C6PA 2FE7A 1NE9A 3IC1A 4NGTA 5HH1A 2XEJA 2DPTA 2HV2A 3TFYA 4PXCA 3EO4A 2FIWA 4CYQA 1TKHA 2IJZA 3BHXA 4MFJA 4A39A 3KR5A 2BUEA 4WWVA 2PR1A 4KSAA 1YW6A 4MFZA 1BOBA 4BINA 4NEXA 2J9AA 2AFSA 1ARMA 4H6ZA 2QIRA 3RNZA 1YSJA 3PB7X 3DLJA 5K8MA 5H86A 4NFRA 3PZJA 3PRTA 4UWIA 1Q2YA 3VWEA 2VZZA 5AG6A 4GS4A 1P4NA 4FUUA 1Z8TA 2PR8A 4MHPA 4CRZB 4LX9A 4P4EA 5EMIA 3GUXA 3H8GA 3LMSA 4JWPA 1PU9A 1CP7A 3KZWA 2WPWA 2QJ8A 4UCMA 4NGSA 4DYOA 4KOVA 1IICA 5D8NA 2ZEFA 3PBEA 2Q4ZA 1LAPA 4Q36A 4R76A 4GM5A 2Q4YA 2IL4A 3IU1A 4U5YA 3NH5A 3LODA 5D29A 2ZW5A 2GE3A 2I3CA 2Z3LA 2PIYA 4EWTA 2FCKA 1Z9UA 3D67A 2P6GA 1QSRA 3D8PA 2EVNA 4IUSA 1LAMA 3I9SA 2XEGA 3KASA 4KOWA 4CAXA 4OC0A 2PCUA 1ARLA 2PIZA 4LUAA 5LRKA 2FSRA 4R9MA 1Z8LA 1ZG8A 4NXYA 4ORFA 4PV6A 2BCOA 2HUZA 2Q43A 4BMHA 4CYPA 5JPHA 2JEVA 1L0CA 3SJFA 4EVYA 4MCRA 3H5ZA 2CTBA 4F0YA 1IYKA 2OR4A 1HDQA 1RTQA 4FD5A 3CXQA 2NYQA 4RS2A 3DSBA 4OC1A 1I12A 2HQYA 2O53A 4CYNA 4F6AA 1I21A 1UFHA 3FNCA 4OMEA 1YREA 3SJGA 4ZY1A 1IYLA 2Q04A 2Q0YA 2PJ5A 4L8AA 1QSNA 4OKOA 2PJ6A 1B87A 2QVPA 3TOAA 4M6HA 4TNUA 1ZG9A 2R1IA 1IU8A 3N7ZA 4P10A 4A37A 4F0XA 3DR6A 2ZXVA 3FJUA 4CYOA 1MJBA 1XF8A 2OB0A 2WUUA 4C7IA 2PRQA 3CT9A 3W6XA 4WJBA 1EE3P 4B13A 2ATRA 4FWUA 3TC8A 2QMLA 4C2YA 3CDXA 1MK4A 1AYEA 4Y49B 3IFEA 4X8IA 4PSXA 1HEEA 5DS0A 2CY2A 4DJLA 4X5KA 1FNOA 4Y49C 2AFMA 1CX8A 1YVKA 3C26A 5CNPA 4MFPA 4UEEA 5LYLA 5I0CA 2PC1A 1PUAA 1QQ9A 2CF4A 4HKFA 4IAVA 4A2ZA 3SXNA 1WWZA 1TKFA 2GLFA 2F8HA 2Q4VA 3KKWA 4OC5A 4PK3A 4Q7AA 4MHNA 5HVHA 3GB0A 4JZ0A 4NGMA 2AFUA 2IMOA 4JJXA 3PFOA 2ZEPA 2EK8A 4NGNA 4A95A 3WC6A 1CBXA 4ZY2A 4KLVA 3BJ7A 3V8IA 5AG7A 3S6FA 2O4HA 4PPZA 3KQXA 4UEFA 1RO5A 2F7VA 1SQHA 3BXMA 3OWCA 1Y0RA 2Q44A 3EFAA 2PJAA 5LRGA 4NSQA 1TXRA 3KHZA 4KOTA 5LYIA 2J8MA 3IGRA 5AGEA 4UCNA 4JXQA 4B12A 2K5TA 4P4DA 3L2NA 1MJAA 3LWUA 5EC4A 3PFEA 4P6YA 4JYWA 1Y7EA 1YX0A 2A4NA 2J8RA 4M85A 5ELYA 4YGOA 4QUSA 4MMOA 4KOUA 1M4DA 1TIQA 1GYTA 3KL9A 4NJQA 2CIJA 2DF5A 4UA3A 2ANPA 2BEIA 4CS0B 5F46A 3D7GA 1OBRA 4KUBA 3R9FA 4FBEA 4OC4A 4ZX9A 1K4JA 3R9GA 1F57A 2GU2A 2BOAA 5LYDA 2ZEGA 3RBUA 2Z3MA 3D7DA 4C68A 4ZY0A 3FBUA 4MRIA 4EMEA 1M4LA 5JQ4A 4MFLA 1XOVA 3NE8A 4F9VA 1ZLHA 2ABZA 4H2KA 3JRUA 4P4JA 4PSWA 3TTHA 4ZGYB 3H8FA 3JUWA 4CPAA 2FL4A 1Y7RA 2FXFA 2ZW6A 4GXHA 3FEEA 2EK9A 4KS9A 1M4GA 2AE6A 1IOIA 5F48A 1NSLA 2ZELA 1XFOA 1ZLIA 3PEIA 5HXDA 5CBMA 4KORA 4KUAA 5KTCA 3IWEA 5IB9A 1M44A 5G21A 4QB9A 4MY3A 5HMNA 2YNCA 1YVOA 4OIDA 1U6MA 1ELLP 1VGYA 4PK2A 3S6KA 5ISVA 4ZYQA 3S9LA 3IIBA 1IOFA 2VL1A 1CP6A 2BO9A 4AVCA 5JGFA 2B4BA 1S7LA 2I79A 2ZW4A 4HPSA 4AVAA 3K9UA 4W9YA 5FVJA 5BWAB 1PCAA 2PQ8A 4R8FA 3VH9A 4CAVA 2C6CA 4J3GA 1KUXA 4AG7A 4DNCA 2EUIA 5THWA 3R1KA 1FT7A 4M6IA 1Q7LA 2Z3OA 1ZO0A 1S60A 1R57A 2PE3A 4KLWA 2V8DA 3W91A 2WZNA 4MHYA 4ZX8A 3CPAA 5F09A 4L89A 2PJ7A 2FT0A 1X12A 1Y9WA 1BPNA 3QNVA 1YLEA 1XMTA 3NA6A 4CGMA 4UBRA 2JBKA 3FIXA 2ZENA 2ZEHA 3QAHA 1VKCA 2AFXA 1XBUA 4XNHC 1IIDA 2H5MA 3VATA 2P0WA 1LANA 4ONUA 4P4IA 4YFJA 4P4BA 4XNHB 1Z4RA 3B8GA 4OIWA 3PP9A 4A30A 3MGDA 2WPXA 3IU2A 4UEZA 5EBVA 4A31A 5K8OA 2YNCC 5AG4A 4RI1A 3VWDA 3PB4X 2EBJA 1CG2A 2OZUA 4MFKA 2OZHA 2G3AA 1QSOA 1CM0A 2V77A 2JDDA 4MI4A 1N71A 4C2ZA 3E0KA 4E2AA 1TF9A 2PRBA 1YK3A 2PJ9A 3FF3A 1KUYA 4UF4A 4A38A 4OC3A 4AVBA 4NGPA 5KTDA 1UWYA 3KGQA 2PJ4A 2P6EA 2VQYA 5A28A 1AMPA 1BLLE 4F9UA 5C88A 4UFVA 4JD6A 2WSAA 3RO0A 4AG9A 4CGNA 5CPAA 1H8LA 2ARHA 3B3CA 3D3SA 4OP4A 2VI7A 4F8ZA 3T9YA 2AFWA 4G1PA 3CPXA 4P44A 2R8VA 7CPAA 3TT2A 3MN8A 4OC2A 4R6TA 1VHEA 5G22A 4I49A 2G0BA 3CXSA 1Z2LA 3T90A 4E0AA 2O28A 4NF1A 4CRYB 2Q7SA 1GHEA 2J8NA 2R7HA 2ZEEA 1HDUA 4Q38A 4II9A 3V7ZA 4NGQA 2IQ6A 2OZGA 4HNWB 3ISXA 3R96A 4UFWA 1Y0YA 3BJ8A 3FX6A 2Y0MA 3WABA 3F5BA 3D7FA 1XE4A 4O23A 1ZG7A 3B35A 2CTCA 3FMCA 2RC4A 5AG5A 3R95A 3SI1A 4K30A 3TX8A 4QBJA 4R3KA 4FD4A 2YNDA 2ZPAA 4XPLA 3A9LA 3CZXA 4KSIA 2NSMA 3GIUA 2V8HA 4YRHA 3H8EA 2BSWA 2F5IA 2QECA 2I00A 2DXQA 3RYOA 5JM6A 1IGBA 1BO4A 1ELMP 1BPMA 1V0CA 1P0HA 1VHOA 2Z11A 4TWEA 2ZOFA 1S7FA 2AJ6A 4E8OA 3W6SA 2PDOA 3S6GA 1CJWA 2VEZA 2WYRA 3H4QA 2CXAA 3G3SA 2CNSA 2GLJA 2OOTA 3V38A 4UCPA 3KHXA 5K8NA 5F49A 3UY5A 4B5PA 1NSAA 2YNEA 3QB8A 1LRZA 1X10A 3EXNA 4JLYA 4A32A 5KTAA 3FEDA 2B5GA 1TKJA 2FVGA 2X7BA 4ZI6A 3D7HA 2Z3NA 4YU9A 4PXBA 3ZZIA 2Q7BA 3FVLA 4IF5A 3SJXA 3GLJA 3EY5A 2ZEDA 3I3GA 3IEHA 2YGWA 3P2FA 5G1ZA 1KWMA 1F2PA 3DR8A 3NFZA 2V8GA 5IV0A 3RZAA 1RXTA 2VBQA 2PJ1A 2JBJA 4XPKA 3ZJ0A 5I4MA 5LRJA 4AXVA 1YMEA 3GY9A 3N5FA 3SI0A 1KZFA 2ZEMA 3NH8A 3NE7A 3IWWA 4OLLA 2PSWA 2DEAA 2PJ2A 2B4DA 4U9YA
chains in the Genus database with same CATH topology
2D4OA 1YGHA 2B58A 4CAFA 4MHDA 4C2XA 4B14A 3TCVA 4FD6A 5C82A 3FB3A 4KSFA 5A27A 4XPDC 1J4JA 2KCWA 3G8WA 4XPDB 2B3UA 4MJ8A 2Z10A 2Z3KA 4KVOE 4OADA 4U9ZA 4B5PA 2P6FA 2REEA 3FYNA 4B5PB 4QVTA 3IWGA 5J8CA 2JLMA 5F47A 3SXOA 1QSMA 4R3LA 4KOYA 4CGOA 3S6HA 4CGPA 1QSTA 3JTKA 5J8FA 2REFA 1WK4A 1OZPA 1XEBA 3D2MA 1NMTA 3CXPA 1M4IA 2Z3PA 4M3SA 4HNXB 1I1DA 1FY7A 5DWMA 1B6BA 4ZBGA 1Q2CA 2B3VA 3F0AA 2VZYA 4AB7A 3DNSA 4B11A 3TO6A 3P2HA 2GIVA 2JDCA 1S5KA 4KZTA 2ZW7A 4KOSA 4BBHA 4QC6A 3R9EA 5IX3A 2BL1A 2FIAA 3TO7A 3FRMA 1S3ZA 3F8KA 4MBUA 4KVXA 3DDDA 5G20A 3SHPA 4OAEA 5IB0A 2GANA 5DWNA 1Y9KA 4MY0A 1KUVA 2C27A 5GCNA 3GKRA 4CAEA 2CNMA 2D4PA 4UWJA 1S7KA 2NMTA 4R87A 2Z0ZA 4H89A 4KVME 1IB1E 5H84A 4A33A 2OU2A 1Q2DA 2OH1A 3FXTA 5E96A 1VHSA 4UFXA 4HNYB 2B4DB 3LD2A 4NCZA 3D2PA 1XIXA 4H6UA 4B5OA 2VXKA 1MJ9A 3JVNA 3EC4A 1S7NA 4B10A 2DPSA 3WR7A 1M1DA 3GYAA 4CAWA 3TO9A 4KOXA 4C7HA 1YR0A 3PGPA 2R98A 4CGLA 4FD7A 2G3TA 2CNTA 4MFQA 4JXRA 2B5GB 2FS5A 3BLNA 1ON0A 3TOBA 1Z4EA 4R57A 3TE4A 2FE7A 1NE9A 5HH1A 2DPTA 2HV2A 3TFYA 3EO4A 2FIWA 4CYQA 4MFJA 2BUEA 2PR1A 4KSAA 4MFZA 1BOBA 4NEXA 4H6ZA 2QIRA 5H86A 3PZJA 4UWIA 1Q2YA 3VWEA 2VZZA 5AG6A 4GS4A 1P4NA 2PR8A 4CRZB 4LX9A 4JWPA 1PU9A 2WPWA 4UCMA 4KOVA 1IICA 4Q36A 2Q4YA 2IL4A 3IU1A 4U5YA 3LODA 2ZW5A 2GE3A 2Z3LA 2FCKA 1Z9UA 2P6GA 1QSRA 3D8PA 2EVNA 4IUSA 3I9SA 4KOWA 4CAXA 4LUAA 2FSRA 4R9MA 4PV6A 4NXYA 4ORFA 4BMHA 2HUZA 5JPHA 4CYPA 2JEVA 1L0CA 4EVYA 3H5ZA 4F0YA 1IYKA 4FD5A 3CXQA 4RS2A 3DSBA 1I12A 2HQYA 4CYNA 4F6AA 1I21A 1UFHA 3FNCA 1YREA 1IYLA 2Q04A 2Q0YA 4L8AA 1QSNA 1B87A 3TOAA 2R1IA 3N7ZA 4F0XA 3DR6A 2ZXVA 4CYOA 1MJBA 1XF8A 2OB0A 2WUUA 4C7IA 3W6XA 4B13A 2ATRA 2QMLA 4C2YA 1MK4A 4Y49B 4PSXA 2CY2A 4X5KA 4Y49C 1YVKA 3C26A 5CNPA 4MFPA 5I0CA 2PC1A 1PUAA 4HKFA 4A2ZA 3SXNA 1WWZA 2Q4VA 3KKWA 4PK3A 4JJXA 4A95A 4KLVA 3BJ7A 3V8IA 5AG7A 3S6FA 1RO5A 1SQHA 3OWCA 2Q44A 3EFAA 4NSQA 4KOTA 2J8MA 3IGRA 5AGEA 4UCNA 4JXQA 4B12A 2K5TA 1MJAA 5EC4A 2J8RA 1YX0A 2A4NA 4M85A 4YGOA 4QUSA 4KOUA 1M4DA 1TIQA 4UA3A 5F46A 4CS0B 2BEIA 4KUBA 3R9FA 1K4JA 3R9GA 2Z3MA 4C68A 3FBUA 5JQ4A 4MFLA 4PSWA 3TTHA 4ZGYB 3JUWA 2FL4A 1Y7RA 2ZW6A 2FXFA 4KS9A 1M4GA 2AE6A 5F48A 1NSLA 4KORA 4KUAA 5KTCA 3IWEA 1M44A 5G21A 4QB9A 4MY3A 5HMNA 2YNCA 1YVOA 1U6MA 4PK2A 3S6KA 5ISVA 4AVCA 2B4BA 1S7LA 2I79A 2ZW4A 4AVAA 3K9UA 5FVJA 5BWAB 2PQ8A 4CAVA 4J3GA 1KUXA 4AG7A 4DNCA 2EUIA 3R1KA 2Z3OA 1ZO0A 1S60A 1R57A 4KLWA 3W91A 4L89A 2FT0A 1Y9WA 1YLEA 1XMTA 4CGMA 4UBRA 3FIXA 3QAHA 1VKCA 4XNHC 1IIDA 2H5MA 2P0WA 4ONUA 4YFJA 4XNHB 1Z4RA 3B8GA 3PP9A 3MGDA 2WPXA 3IU2A 5EBVA 4A31A 2YNCC 5AG4A 4RI1A 3VWDA 2OZUA 4MFKA 2OZHA 2G3AA 1QSOA 1CM0A 2JDDA 4MI4A 1N71A 4C2ZA 3E0KA 4E2AA 2PRBA 1YK3A 1KUYA 4AVBA 5KTDA 2P6EA 2VQYA 5A28A 5C88A 4UFVA 4JD6A 2WSAA 4CGNA 4AG9A 2ARHA 3D3SA 2VI7A 3T9YA 2R8VA 3TT2A 5G22A 4I49A 2G0BA 3CXSA 3T90A 4E0AA 2O28A 4NF1A 4CRYB 1GHEA 2J8NA 2R7HA 4II9A 4Q38A 2OZGA 4HNWB 3R96A 4UFWA 3BJ8A 2Y0MA 3F5BA 1XE4A 5AG5A 4QBJA 2RC4A 3R95A 4K30A 4R3KA 4FD4A 2YNDA 2ZPAA 4XPLA 3A9LA 4YRHA 2BSWA 2F5IA 2QECA 2I00A 2DXQA 3RYOA 1BO4A 1V0CA 1P0HA 2Z11A 1S7FA 2AJ6A 4E8OA 3W6SA 2PDOA 3S6GA 1CJWA 2VEZA 3H4QA 2CXAA 3G3SA 2CNSA 4UCPA 5F49A 3UY5A 2YNEA 3QB8A 1LRZA 3EXNA 4A32A 4JLYA 5KTAA 2B5GA 2X7BA 2Z3NA 3ZZIA 2Q7BA 4IF5A 3P2FA 3EY5A 3I3GA 2YGWA 5G1ZA 3DR8A 5IV0A 1RXTA 2VBQA 3ZJ0A 4XPKA 3GY9A 1KZFA 3NE7A 4OLLA 2PSWA 4A30A 2B4DA 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4O A;  1YGH A;  2B58 A;  4MHD A;  3TCV A;  4FD6 A;  5C82 A;  3FB3 A;  4XPD C;  1J4J A;  2KCW A;  3G8W A;  4XPD B;  2B3U A;  4MJ8 A;  2Z10 A;  4KVO E;  4OAD A;  4B5P A;  4U9Z A;  2P6F A;  2REE A;  3FYN A;  4B5P B;  4QVT A;  3IWG A;  5J8C A;  2JLM A;  5F47 A;  3SXO A;  1QSM A;  4R3L A;  4KOY A;  3S6H A;  1QST A;  5J8F A;  2REF A;  1WK4 A;  1OZP A;  1XEB A;  3D2M A;  1NMT A;  3CXP A;  1M4I A;  4M3S A;  4HNX B;  1I1D A;  1FY7 A;  5DWM A;  1B6B A;  4ZBG A;  1Q2C A;  2B3V A;  3F0A A;  2VZY A;  4AB7 A;  3DNS A;  3TO6 A;  3P2H A;  2GIV A;  2JDC A;  1S5K A;  4KZT A;  2ZW7 A;  4KOS A;  4QC6 A;  3R9E A;  5IX3 A;  2BL1 A;  2FIA A;  3TO7 A;  3FRM A;  1S3Z A;  3F8K A;  4MBU A;  4KVX A;  3DDD A;  3SHP A;  4OAE A;  5IB0 A;  2GAN A;  5DWN A;  1Y9K A;  4MY0 A;  1KUV A;  2C27 A;  5GCN A;  3GKR A;  2CNM A;  2D4P A;  4UWJ A;  1S7K A;  2NMT A;  4R87 A;  2Z0Z A;  4H89 A;  4KVM E;  1IB1 E;  5H84 A;  2OU2 A;  1Q2D A;  2OH1 A;  3FXT A;  5E96 A;  1VHS A;  4HNY B;  2B4D B;  3LD2 A;  4NCZ A;  3D2P A;  1XIX A;  4H6U A;  4B5O A;  2VXK A;  1MJ9 A;  3JVN A;  3EC4 A;  1S7N A;  3WR7 A;  1M1D A;  3GYA A;  4CAW A;  3TO9 A;  4KOX A;  1YR0 A;  3PGP A;  2R98 A;  4FD7 A;  2G3T A;  2CNT A;  4JXR A;  2B5G B;  2FS5 A;  3BLN A;  1ON0 A;  3TOB A;  1Z4E A;  4R57 A;  3TE4 A;  2FE7 A;  1NE9 A;  5HH1 A;  2HV2 A;  3TFY A;  3EO4 A;  2FIW A;  2BUE A;  2PR1 A;  1BOB A;  4NEX A;  4H6Z A;  2QIR A;  5H86 A;  3PZJ A;  4UWI A;  1Q2Y A;  3VWE A;  2VZZ A;  4GS4 A;  1P4N A;  2PR8 A;  4CRZ B;  4LX9 A;  4JWP A;  1PU9 A;  2WPW A;  4KOV A;  1IIC A;  2Q4Y A;  2IL4 A;  4U5Y A;  3LOD A;  2ZW5 A;  2GE3 A;  2FCK A;  1Z9U A;  2P6G A;  1QSR A;  3D8P A;  2EVN A;  4IUS A;  3I9S A;  4KOW A;  4CAX A;  4LUA A;  2FSR A;  4R9M A;  4PV6 A;  4NXY A;  4ORF A;  4BMH A;  2HUZ A;  5JPH A;  2JEV A;  1L0C A;  4EVY A;  4F0Y A;  1IYK A;  4FD5 A;  3CXQ A;  4RS2 A;  3DSB A;  1I12 A;  2HQY A;  4F6A A;  1I21 A;  1UFH A;  3FNC A;  1YRE A;  1IYL A;  2Q04 A;  2Q0Y A;  4L8A A;  1QSN A;  1B87 A;  3TOA A;  2R1I A;  3N7Z A;  3DR6 A;  2ZXV A;  1MJB A;  1XF8 A;  2OB0 A;  3W6X A;  2ATR A;  2QML A;  1MK4 A;  4Y49 B;  4PSX A;  2CY2 A;  4X5K A;  4Y49 C;  1YVK A;  3C26 A;  5CNP A;  5I0C A;  2PC1 A;  1PUA A;  4HKF A;  3SXN A;  1WWZ A;  2Q4V A;  3KKW A;  4PK3 A;  4JJX A;  4KLV A;  3BJ7 A;  3V8I A;  3S6F A;  1RO5 A;  1SQH A;  3OWC A;  2Q44 A;  3EFA A;  4NSQ A;  4KOT A;  2J8M A;  3IGR A;  4JXQ A;  2K5T A;  1MJA A;  5EC4 A;  2J8R A;  1YX0 A;  2A4N A;  4M85 A;  4YGO A;  4QUS A;  4KOU A;  1M4D A;  1TIQ A;  4UA3 A;  5F46 A;  4CS0 B;  2BEI A;  4KUB A;  3R9F A;  1K4J A;  3R9G A;  3FBU A;  5JQ4 A;  4PSW A;  3TTH A;  3JUW A;  2FL4 A;  1Y7R A;  2ZW6 A;  2FXF A;  1M4G A;  2AE6 A;  5F48 A;  1NSL A;  4KOR A;  4KUA A;  5KTC A;  1M44 A;  4QB9 A;  4MY3 A;  5HMN A;  1YVO A;  1U6M A;  4PK2 A;  3S6K A;  5ISV A;  4AVC A;  2B4B A;  1S7L A;  2I79 A;  2ZW4 A;  4AVA A;  3K9U A;  5FVJ A;  2PQ8 A;  4CAV A;  4J3G A;  1KUX A;  4AG7 A;  4DNC A;  2EUI A;  3R1K A;  1S60 A;  1R57 A;  4KLW A;  3W91 A;  4L89 A;  2FT0 A;  1Y9W A;  1YLE A;  1XMT A;  4UBR A;  3FIX A;  3QAH A;  1VKC A;  4XNH C;  1IID A;  2H5M A;  2P0W A;  4ONU A;  4YFJ A;  4XNH B;  1Z4R A;  3B8G A;  3PP9 A;  3MGD A;  2WPX A;  5EBV A;  4RI1 A;  3VWD A;  2OZU A;  2OZH A;  2G3A A;  1QSO A;  1CM0 A;  2JDD A;  4MI4 A;  1N71 A;  3E0K A;  4E2A A;  2PRB A;  1YK3 A;  1KUY A;  4AVB A;  5KTD A;  2P6E A;  2VQY A;  5C88 A;  4JD6 A;  4AG9 A;  2ARH A;  3D3S A;  2VI7 A;  3T9Y A;  2R8V A;  3TT2 A;  4I49 A;  2G0B A;  3CXS A;  3T90 A;  4E0A A;  2O28 A;  4NF1 A;  4CRY B;  1GHE A;  2J8N A;  2R7H A;  4II9 A;  2OZG A;  4HNW B;  3R96 A;  3BJ8 A;  2Y0M A;  3F5B A;  1XE4 A;  4QBJ A;  2RC4 A;  3R95 A;  4K30 A;  4R3K A;  4FD4 A;  4XPL A;  2ZPA A;  4YRH A;  2BSW A;  2F5I A;  2QEC A;  2I00 A;  2DXQ A;  3RYO A;  1BO4 A;  1V0C A;  1P0H A;  2Z11 A;  1S7F A;  2AJ6 A;  4E8O A;  3W6S A;  2PDO A;  3S6G A;  1CJW A;  2VEZ A;  3H4Q A;  3G3S A;  2CNS A;  5F49 A;  3UY5 A;  3QB8 A;  1LRZ A;  3EXN A;  4JLY A;  5KTA A;  2B5G A;  2X7B A;  3ZZI A;  2Q7B A;  4IF5 A;  3P2F A;  3EY5 A;  3I3G A;  3DR8 A;  5IV0 A;  1RXT A;  2VBQ A;  3ZJ0 A;  4XPK A;  3GY9 A;  1KZF A;  3NE7 A;  4OLL A;  2PSW A;  2B4D A;  4U9Y A; 
#chains in the Genus database with same CATH topology
 2D4O A;  8CPA A;  1YGH A;  3S9M A;  2B58 A;  2GFQ A;  4MHZ A;  2POK A;  4CAF A;  4MHD A;  4C2X A;  4B14 A;  4LQ6 A;  3HLP A;  3TCV A;  4FD6 A;  1Z8X A;  5C82 A;  4DUK A;  4FAI A;  4NGR A;  1JQG A;  3FB3 A;  3SJE A;  4KSF A;  5A27 A;  4XPD C;  1J4J A;  3WT4 A;  2KCW A;  3MRU A;  5HVG A;  1LCP A;  3D66 A;  1LFW A;  4X2T A;  3G8W A;  3I1U A;  4XPD B;  2PJC A;  2B3U A;  1LOK A;  4MJ8 A;  4ONW A;  2Z10 A;  2Z3K A;  3LAC A;  1VIX A;  2PJ8 A;  3PB8 X;  2P6F A;  4KVO E;  2REE A;  4OAD A;  4U9Z A;  1R43 A;  3FYN A;  4QVT A;  4B5P B;  1AUG A;  3D68 A;  4IHM A;  3IWG A;  5JH9 A;  2XEF A;  2HB6 A;  5HVF A;  2JLM A;  3KI9 A;  5F47 A;  3SXO A;  1QSM A;  2EO8 A;  5J8C A;  1A2Z A;  1XMB A;  4KOY A;  4R3L A;  4MCQ A;  4CGO A;  3S6H A;  3T8W A;  4CGP A;  1QST A;  3K9T A;  5J1Q A;  3JTK A;  5J8F A;  2REF A;  1WK4 A;  2PJ3 A;  2Q51 A;  4MCP A;  2EWB A;  1OZP A;  1XEB A;  3DGV A;  3D2M A;  1NMT A;  3K2K A;  3PB9 X;  4RUH A;  3CXP A;  4PXE A;  2AFZ A;  1M4I A;  4X3R A;  2PJ0 A;  2Z3P A;  4UIA A;  4M3S A;  4HNX B;  1I1D A;  4UIB A;  1FY7 A;  3NH4 A;  5DWM A;  1B6B A;  4ZBG A;  1Q2C A;  4K3N A;  2B3V A;  4LQG A;  3F0A A;  2VZY A;  4AB7 A;  3DNS A;  3WC7 A;  3ISZ A;  4EFD A;  4B11 A;  4YWY A;  3TO6 A;  3P2H A;  2GIV A;  4Z65 A;  2RB7 A;  2JDC A;  4MCS A;  1S5K A;  1Z8W A;  2ZOG A;  3B3V A;  2ZW7 A;  4KZT A;  4KOS A;  4BBH A;  4QC6 A;  4A94 A;  3R9E A;  5IX3 A;  3B3W A;  2BL1 A;  4PQA A;  2FIA A;  2C6G A;  3TO7 A;  1IY7 A;  1DE4 C;  3FRM A;  4BD9 A;  1S3Z A;  2QYV A;  1QMU A;  2G9D A;  3F8K A;  2ZEO A;  1CPS A;  4MBU A;  1R3N A;  4KVX A;  4IK2 A;  3DDD A;  5G20 A;  3SHP A;  4OAE A;  1XJO A;  1JWQ A;  3B7I A;  3IO1 A;  5IB0 A;  1DTD A;  2GAN A;  1F2O A;  5DWN A;  1Y9K A;  2AFO A;  4MY0 A;  1KUV A;  5LYF A;  2C27 A;  4NJR A;  5GCN A;  3GKR A;  3FEC A;  4CAE A;  2CNM A;  2D4P A;  4UWJ A;  2RFH A;  1S7K A;  2NMT A;  4R87 A;  2Z0Z A;  4H89 A;  3S9N A;  4KVM E;  2PVW A;  1IB1 E;  2PVV A;  3IJ3 A;  5H84 A;  4A33 A;  2OU2 A;  4RN7 A;  1Z5R A;  1Q2D A;  2OH1 A;  3FXT A;  5E96 A;  1VHS A;  3B3T A;  3VAR A;  1CPX A;  1YLO A;  4UFX A;  3SI2 A;  4HNY B;  3RAM A;  2B4D B;  3LD2 A;  3KQZ A;  4NCZ A;  4P45 A;  4PXD A;  3D2P A;  2PJB A;  1XIX A;  4H6U A;  6CPA A;  3KR4 A;  4B5O A;  2HC9 A;  2V8V A;  2VXK A;  3HUV A;  3PBB A;  1MJ9 A;  3JVN A;  2XEI A;  1S7N A;  3EC4 A;  1PYT B;  4B10 A;  4P4F A;  2DPS A;  3WR7 A;  3QAY A;  1M1D A;  2ODF A;  3GYA A;  2GRE A;  4CAW A;  3TO9 A;  4MXU A;  4KOX A;  4C7H A;  3BI1 A;  3FH4 A;  4M6G A;  2C1C A;  1YR0 A;  3PGP A;  3PB6 X;  2R98 A;  4CGL A;  2JEW A;  4FD7 A;  3WC5 A;  4B6Z A;  3B2Y A;  2G3T A;  2CNT A;  3B3S A;  4R7M A;  4MFQ A;  1YW4 A;  1BAV A;  3BI0 A;  2B5G B;  4JXR A;  2FS5 A;  3BLN A;  1ON0 A;  1TF8 A;  5K8P A;  3TOB A;  3D4U A;  1Z4E A;  1YQE A;  1XRY A;  4R57 A;  3TE4 A;  2C6P A;  2FE7 A;  1NE9 A;  3IC1 A;  4NGT A;  5HH1 A;  2XEJ A;  2DPT A;  2HV2 A;  3TFY A;  4PXC A;  3EO4 A;  2FIW A;  4CYQ A;  1TKH A;  2IJZ A;  3BHX A;  4MFJ A;  4A39 A;  3KR5 A;  2BUE A;  4WWV A;  2PR1 A;  4KSA A;  1YW6 A;  4MFZ A;  1BOB A;  4BIN A;  4NEX A;  2J9A A;  2AFS A;  1ARM A;  4H6Z A;  2QIR A;  3RNZ A;  1YSJ A;  3PB7 X;  3DLJ A;  5K8M A;  5H86 A;  4NFR A;  3PZJ A;  3PRT A;  4UWI A;  1Q2Y A;  3VWE A;  2VZZ A;  5AG6 A;  4GS4 A;  1P4N A;  4FUU A;  1Z8T A;  2PR8 A;  4MHP A;  4CRZ B;  4LX9 A;  4P4E A;  5EMI A;  3GUX A;  3H8G A;  3LMS A;  4JWP A;  1PU9 A;  1CP7 A;  3KZW A;  2WPW A;  2QJ8 A;  4UCM A;  4NGS A;  4DYO A;  4KOV A;  1IIC A;  5D8N A;  2ZEF A;  3PBE A;  2Q4Z A;  1LAP A;  4Q36 A;  4R76 A;  4GM5 A;  2Q4Y A;  2IL4 A;  3IU1 A;  4U5Y A;  3NH5 A;  3LOD A;  5D29 A;  2ZW5 A;  2GE3 A;  2I3C A;  2Z3L A;  2PIY A;  4EWT A;  2FCK A;  1Z9U A;  3D67 A;  2P6G A;  1QSR A;  3D8P A;  2EVN A;  4IUS A;  1LAM A;  3I9S A;  2XEG A;  3KAS A;  4KOW A;  4CAX A;  4OC0 A;  2PCU A;  1ARL A;  2PIZ A;  4LUA A;  5LRK A;  2FSR A;  4R9M A;  1Z8L A;  1ZG8 A;  4NXY A;  4ORF A;  4PV6 A;  2BCO A;  2HUZ A;  2Q43 A;  4BMH A;  4CYP A;  5JPH A;  2JEV A;  1L0C A;  3SJF A;  4EVY A;  4MCR A;  3H5Z A;  2CTB A;  4F0Y A;  1IYK A;  2OR4 A;  1HDQ A;  1RTQ A;  4FD5 A;  3CXQ A;  2NYQ A;  4RS2 A;  3DSB A;  4OC1 A;  1I12 A;  2HQY A;  2O53 A;  4CYN A;  4F6A A;  1I21 A;  1UFH A;  3FNC A;  4OME A;  1YRE A;  3SJG A;  4ZY1 A;  1IYL A;  2Q04 A;  2Q0Y A;  2PJ5 A;  4L8A A;  1QSN A;  4OKO A;  2PJ6 A;  1B87 A;  2QVP A;  3TOA A;  4M6H A;  4TNU A;  1ZG9 A;  2R1I A;  1IU8 A;  3N7Z A;  4P10 A;  4A37 A;  4F0X A;  3DR6 A;  2ZXV A;  3FJU A;  4CYO A;  1MJB A;  1XF8 A;  2OB0 A;  2WUU A;  4C7I A;  2PRQ A;  3CT9 A;  3W6X A;  4WJB A;  1EE3 P;  4B13 A;  2ATR A;  4FWU A;  3TC8 A;  2QML A;  4C2Y A;  3CDX A;  1MK4 A;  1AYE A;  4Y49 B;  3IFE A;  4X8I A;  4PSX A;  1HEE A;  5DS0 A;  2CY2 A;  4DJL A;  4X5K A;  1FNO A;  4Y49 C;  2AFM A;  1CX8 A;  1YVK A;  3C26 A;  5CNP A;  4MFP A;  4UEE A;  5LYL A;  5I0C A;  2PC1 A;  1PUA A;  1QQ9 A;  2CF4 A;  4HKF A;  4IAV A;  4A2Z A;  3SXN A;  1WWZ A;  1TKF A;  2GLF A;  2F8H A;  2Q4V A;  3KKW A;  4OC5 A;  4PK3 A;  4Q7A A;  4MHN A;  5HVH A;  3GB0 A;  4JZ0 A;  4NGM A;  2AFU A;  2IMO A;  4JJX A;  3PFO A;  2ZEP A;  2EK8 A;  4NGN A;  4A95 A;  3WC6 A;  1CBX A;  4ZY2 A;  4KLV A;  3BJ7 A;  3V8I A;  5AG7 A;  3S6F A;  2O4H A;  4PPZ A;  3KQX A;  4UEF A;  1RO5 A;  2F7V A;  1SQH A;  3BXM A;  3OWC A;  1Y0R A;  2Q44 A;  3EFA A;  2PJA A;  5LRG A;  4NSQ A;  1TXR A;  3KHZ A;  4KOT A;  5LYI A;  2J8M A;  3IGR A;  5AGE A;  4UCN A;  4JXQ A;  4B12 A;  2K5T A;  4P4D A;  3L2N A;  1MJA A;  3LWU A;  5EC4 A;  3PFE A;  4P6Y A;  4JYW A;  1Y7E A;  1YX0 A;  2A4N A;  2J8R A;  4M85 A;  5ELY A;  4YGO A;  4QUS A;  4MMO A;  4KOU A;  1M4D A;  1TIQ A;  1GYT A;  3KL9 A;  4NJQ A;  2CIJ A;  2DF5 A;  4UA3 A;  2ANP A;  2BEI A;  4CS0 B;  5F46 A;  3D7G A;  1OBR A;  4KUB A;  3R9F A;  4FBE A;  4OC4 A;  4ZX9 A;  1K4J A;  3R9G A;  1F57 A;  2GU2 A;  2BOA A;  5LYD A;  2ZEG A;  3RBU A;  2Z3M A;  3D7D A;  4C68 A;  4ZY0 A;  3FBU A;  4MRI A;  4EME A;  1M4L A;  5JQ4 A;  4MFL A;  1XOV A;  3NE8 A;  4F9V A;  1ZLH A;  2ABZ A;  4H2K A;  3JRU A;  4P4J A;  4PSW A;  3TTH A;  4ZGY B;  3H8F A;  3JUW A;  4CPA A;  2FL4 A;  1Y7R A;  2FXF A;  2ZW6 A;  4GXH A;  3FEE A;  2EK9 A;  4KS9 A;  1M4G A;  2AE6 A;  1IOI A;  5F48 A;  1NSL A;  2ZEL A;  1XFO A;  1ZLI A;  3PEI A;  5HXD A;  5CBM A;  4KOR A;  4KUA A;  5KTC A;  3IWE A;  5IB9 A;  1M44 A;  5G21 A;  4QB9 A;  4MY3 A;  5HMN A;  2YNC A;  1YVO A;  4OID A;  1U6M A;  1ELL P;  1VGY A;  4PK2 A;  3S6K A;  5ISV A;  4ZYQ A;  3S9L A;  3IIB A;  1IOF A;  2VL1 A;  1CP6 A;  2BO9 A;  4AVC A;  5JGF A;  2B4B A;  1S7L A;  2I79 A;  2ZW4 A;  4HPS A;  4AVA A;  3K9U A;  4W9Y A;  5FVJ A;  5BWA B;  1PCA A;  2PQ8 A;  4R8F A;  3VH9 A;  4CAV A;  2C6C A;  4J3G A;  1KUX A;  4AG7 A;  4DNC A;  2EUI A;  5THW A;  3R1K A;  1FT7 A;  4M6I A;  1Q7L A;  2Z3O A;  1ZO0 A;  1S60 A;  1R57 A;  2PE3 A;  4KLW A;  2V8D A;  3W91 A;  2WZN A;  4MHY A;  4ZX8 A;  3CPA A;  5F09 A;  4L89 A;  2PJ7 A;  2FT0 A;  1X12 A;  1Y9W A;  1BPN A;  3QNV A;  1YLE A;  1XMT A;  3NA6 A;  4CGM A;  4UBR A;  2JBK A;  3FIX A;  2ZEN A;  2ZEH A;  3QAH A;  1VKC A;  2AFX A;  1XBU A;  4XNH C;  1IID A;  2H5M A;  3VAT A;  2P0W A;  1LAN A;  4ONU A;  4P4I A;  4YFJ A;  4P4B A;  4XNH B;  1Z4R A;  3B8G A;  4OIW A;  3PP9 A;  4A30 A;  3MGD A;  2WPX A;  3IU2 A;  4UEZ A;  5EBV A;  4A31 A;  5K8O A;  2YNC C;  5AG4 A;  4RI1 A;  3VWD A;  3PB4 X;  2EBJ A;  1CG2 A;  2OZU A;  4MFK A;  2OZH A;  2G3A A;  1QSO A;  1CM0 A;  2V77 A;  2JDD A;  4MI4 A;  1N71 A;  4C2Z A;  3E0K A;  4E2A A;  1TF9 A;  2PRB A;  1YK3 A;  2PJ9 A;  3FF3 A;  1KUY A;  4UF4 A;  4A38 A;  4OC3 A;  4AVB A;  4NGP A;  5KTD A;  1UWY A;  3KGQ A;  2PJ4 A;  2P6E A;  2VQY A;  5A28 A;  1AMP A;  1BLL E;  4F9U A;  5C88 A;  4UFV A;  4JD6 A;  2WSA A;  3RO0 A;  4AG9 A;  4CGN A;  5CPA A;  1H8L A;  2ARH A;  3B3C A;  3D3S A;  4OP4 A;  2VI7 A;  4F8Z A;  3T9Y A;  2AFW A;  4G1P A;  3CPX A;  4P44 A;  2R8V A;  7CPA A;  3TT2 A;  3MN8 A;  4OC2 A;  4R6T A;  1VHE A;  5G22 A;  4I49 A;  2G0B A;  3CXS A;  1Z2L A;  3T90 A;  4E0A A;  2O28 A;  4NF1 A;  4CRY B;  2Q7S A;  1GHE A;  2J8N A;  2R7H A;  2ZEE A;  1HDU A;  4Q38 A;  4II9 A;  3V7Z A;  4NGQ A;  2IQ6 A;  2OZG A;  4HNW B;  3ISX A;  3R96 A;  4UFW A;  1Y0Y A;  3BJ8 A;  3FX6 A;  2Y0M A;  3WAB A;  3F5B A;  3D7F A;  1XE4 A;  4O23 A;  1ZG7 A;  3B35 A;  2CTC A;  3FMC A;  2RC4 A;  5AG5 A;  3R95 A;  3SI1 A;  4K30 A;  3TX8 A;  4QBJ A;  4R3K A;  4FD4 A;  2YND A;  2ZPA A;  4XPL A;  3A9L A;  3CZX A;  4KSI A;  2NSM A;  3GIU A;  2V8H A;  4YRH A;  3H8E A;  2BSW A;  2F5I A;  2QEC A;  2I00 A;  2DXQ A;  3RYO A;  5JM6 A;  1IGB A;  1BO4 A;  1ELM P;  1BPM A;  1V0C A;  1P0H A;  1VHO A;  2Z11 A;  4TWE A;  2ZOF A;  1S7F A;  2AJ6 A;  4E8O A;  3W6S A;  2PDO A;  3S6G A;  1CJW A;  2VEZ A;  2WYR A;  3H4Q A;  2CXA A;  3G3S A;  2CNS A;  2GLJ A;  2OOT A;  3V38 A;  4UCP A;  3KHX A;  5K8N A;  5F49 A;  3UY5 A;  4B5P A;  1NSA A;  2YNE A;  3QB8 A;  1LRZ A;  1X10 A;  3EXN A;  4JLY A;  4A32 A;  5KTA A;  3FED A;  2B5G A;  1TKJ A;  2FVG A;  2X7B A;  4ZI6 A;  3D7H A;  2Z3N A;  4YU9 A;  4PXB A;  3ZZI A;  2Q7B A;  3FVL A;  4IF5 A;  3SJX A;  3GLJ A;  3EY5 A;  2ZED A;  3I3G A;  3IEH A;  2YGW A;  3P2F A;  5G1Z A;  1KWM A;  1F2P A;  3DR8 A;  3NFZ A;  2V8G A;  5IV0 A;  3RZA A;  1RXT A;  2VBQ A;  2PJ1 A;  2JBJ A;  4XPK A;  3ZJ0 A;  5I4M A;  5LRJ A;  4AXV A;  1YME A;  3GY9 A;  3N5F A;  3SI0 A;  1KZF A;  2ZEM A;  3NH8 A;  3NE7 A;  3IWW A;  4OLL A;  2PSW A;  2DEA A;  2PJ2 A;  2B4D A;  4U9Y A; 
#chains in the Genus database with same CATH homology
 2D4O A;  1YGH A;  2B58 A;  4CAF A;  4MHD A;  4C2X A;  4B14 A;  3TCV A;  4FD6 A;  5C82 A;  3FB3 A;  4KSF A;  5A27 A;  4XPD C;  1J4J A;  2KCW A;  3G8W A;  4XPD B;  2B3U A;  4MJ8 A;  2Z10 A;  2Z3K A;  4KVO E;  4OAD A;  4U9Z A;  4B5P A;  2P6F A;  2REE A;  3FYN A;  4B5P B;  4QVT A;  3IWG A;  5J8C A;  2JLM A;  5F47 A;  3SXO A;  1QSM A;  4R3L A;  4KOY A;  4CGO A;  3S6H A;  4CGP A;  1QST A;  3JTK A;  5J8F A;  2REF A;  1WK4 A;  1OZP A;  1XEB A;  3D2M A;  1NMT A;  3CXP A;  1M4I A;  2Z3P A;  4M3S A;  4HNX B;  1I1D A;  1FY7 A;  5DWM A;  1B6B A;  4ZBG A;  1Q2C A;  2B3V A;  3F0A A;  2VZY A;  4AB7 A;  3DNS A;  4B11 A;  3TO6 A;  3P2H A;  2GIV A;  2JDC A;  1S5K A;  4KZT A;  2ZW7 A;  4KOS A;  4BBH A;  4QC6 A;  3R9E A;  5IX3 A;  2BL1 A;  2FIA A;  3TO7 A;  3FRM A;  1S3Z A;  3F8K A;  4MBU A;  4KVX A;  3DDD A;  5G20 A;  3SHP A;  4OAE A;  5IB0 A;  2GAN A;  5DWN A;  1Y9K A;  4MY0 A;  1KUV A;  2C27 A;  5GCN A;  3GKR A;  4CAE A;  2CNM A;  2D4P A;  4UWJ A;  1S7K A;  2NMT A;  4R87 A;  2Z0Z A;  4H89 A;  4KVM E;  1IB1 E;  5H84 A;  4A33 A;  2OU2 A;  1Q2D A;  2OH1 A;  3FXT A;  5E96 A;  1VHS A;  4UFX A;  4HNY B;  2B4D B;  3LD2 A;  4NCZ A;  3D2P A;  1XIX A;  4H6U A;  4B5O A;  2VXK A;  1MJ9 A;  3JVN A;  3EC4 A;  1S7N A;  4B10 A;  2DPS A;  3WR7 A;  1M1D A;  3GYA A;  4CAW A;  3TO9 A;  4KOX A;  4C7H A;  1YR0 A;  3PGP A;  2R98 A;  4CGL A;  4FD7 A;  2G3T A;  2CNT A;  4MFQ A;  4JXR A;  2B5G B;  2FS5 A;  3BLN A;  1ON0 A;  3TOB A;  1Z4E A;  4R57 A;  3TE4 A;  2FE7 A;  1NE9 A;  5HH1 A;  2DPT A;  2HV2 A;  3TFY A;  3EO4 A;  2FIW A;  4CYQ A;  4MFJ A;  2BUE A;  2PR1 A;  4KSA A;  4MFZ A;  1BOB A;  4NEX A;  4H6Z A;  2QIR A;  5H86 A;  3PZJ A;  4UWI A;  1Q2Y A;  3VWE A;  2VZZ A;  5AG6 A;  4GS4 A;  1P4N A;  2PR8 A;  4CRZ B;  4LX9 A;  4JWP A;  1PU9 A;  2WPW A;  4UCM A;  4KOV A;  1IIC A;  4Q36 A;  2Q4Y A;  2IL4 A;  3IU1 A;  4U5Y A;  3LOD A;  2ZW5 A;  2GE3 A;  2Z3L A;  2FCK A;  1Z9U A;  2P6G A;  1QSR A;  3D8P A;  2EVN A;  4IUS A;  3I9S A;  4KOW A;  4CAX A;  4LUA A;  2FSR A;  4R9M A;  4PV6 A;  4NXY A;  4ORF A;  4BMH A;  2HUZ A;  5JPH A;  4CYP A;  2JEV A;  1L0C A;  4EVY A;  3H5Z A;  4F0Y A;  1IYK A;  4FD5 A;  3CXQ A;  4RS2 A;  3DSB A;  1I12 A;  2HQY A;  4CYN A;  4F6A A;  1I21 A;  1UFH A;  3FNC A;  1YRE A;  1IYL A;  2Q04 A;  2Q0Y A;  4L8A A;  1QSN A;  1B87 A;  3TOA A;  2R1I A;  3N7Z A;  4F0X A;  3DR6 A;  2ZXV A;  4CYO A;  1MJB A;  1XF8 A;  2OB0 A;  2WUU A;  4C7I A;  3W6X A;  4B13 A;  2ATR A;  2QML A;  4C2Y A;  1MK4 A;  4Y49 B;  4PSX A;  2CY2 A;  4X5K A;  4Y49 C;  1YVK A;  3C26 A;  5CNP A;  4MFP A;  5I0C A;  2PC1 A;  1PUA A;  4HKF A;  4A2Z A;  3SXN A;  1WWZ A;  2Q4V A;  3KKW A;  4PK3 A;  4JJX A;  4A95 A;  4KLV A;  3BJ7 A;  3V8I A;  5AG7 A;  3S6F A;  1RO5 A;  1SQH A;  3OWC A;  2Q44 A;  3EFA A;  4NSQ A;  4KOT A;  2J8M A;  3IGR A;  5AGE A;  4UCN A;  4JXQ A;  4B12 A;  2K5T A;  1MJA A;  5EC4 A;  2J8R A;  1YX0 A;  2A4N A;  4M85 A;  4YGO A;  4QUS A;  4KOU A;  1M4D A;  1TIQ A;  4UA3 A;  5F46 A;  4CS0 B;  2BEI A;  4KUB A;  3R9F A;  1K4J A;  3R9G A;  2Z3M A;  4C68 A;  3FBU A;  5JQ4 A;  4MFL A;  4PSW A;  3TTH A;  4ZGY B;  3JUW A;  2FL4 A;  1Y7R A;  2ZW6 A;  2FXF A;  4KS9 A;  1M4G A;  2AE6 A;  5F48 A;  1NSL A;  4KOR A;  4KUA A;  5KTC A;  3IWE A;  1M44 A;  5G21 A;  4QB9 A;  4MY3 A;  5HMN A;  2YNC A;  1YVO A;  1U6M A;  4PK2 A;  3S6K A;  5ISV A;  4AVC A;  2B4B A;  1S7L A;  2I79 A;  2ZW4 A;  4AVA A;  3K9U A;  5FVJ A;  5BWA B;  2PQ8 A;  4CAV A;  4J3G A;  1KUX A;  4AG7 A;  4DNC A;  2EUI A;  3R1K A;  2Z3O A;  1ZO0 A;  1S60 A;  1R57 A;  4KLW A;  3W91 A;  4L89 A;  2FT0 A;  1Y9W A;  1YLE A;  1XMT A;  4CGM A;  4UBR A;  3FIX A;  3QAH A;  1VKC A;  4XNH C;  1IID A;  2H5M A;  2P0W A;  4ONU A;  4YFJ A;  4XNH B;  1Z4R A;  3B8G A;  3PP9 A;  3MGD A;  2WPX A;  3IU2 A;  5EBV A;  4A31 A;  2YNC C;  5AG4 A;  4RI1 A;  3VWD A;  2OZU A;  4MFK A;  2OZH A;  2G3A A;  1QSO A;  1CM0 A;  2JDD A;  4MI4 A;  1N71 A;  4C2Z A;  3E0K A;  4E2A A;  2PRB A;  1YK3 A;  1KUY A;  4AVB A;  5KTD A;  2P6E A;  2VQY A;  5A28 A;  5C88 A;  4UFV A;  4JD6 A;  2WSA A;  4CGN A;  4AG9 A;  2ARH A;  3D3S A;  2VI7 A;  3T9Y A;  2R8V A;  3TT2 A;  5G22 A;  4I49 A;  2G0B A;  3CXS A;  3T90 A;  4E0A A;  2O28 A;  4NF1 A;  4CRY B;  1GHE A;  2J8N A;  2R7H A;  4II9 A;  4Q38 A;  2OZG A;  4HNW B;  3R96 A;  4UFW A;  3BJ8 A;  2Y0M A;  3F5B A;  1XE4 A;  5AG5 A;  4QBJ A;  2RC4 A;  3R95 A;  4K30 A;  4R3K A;  4FD4 A;  2YND A;  2ZPA A;  4XPL A;  3A9L A;  4YRH A;  2BSW A;  2F5I A;  2QEC A;  2I00 A;  2DXQ A;  3RYO A;  1BO4 A;  1V0C A;  1P0H A;  2Z11 A;  1S7F A;  2AJ6 A;  4E8O A;  3W6S A;  2PDO A;  3S6G A;  1CJW A;  2VEZ A;  3H4Q A;  2CXA A;  3G3S A;  2CNS A;  4UCP A;  5F49 A;  3UY5 A;  2YNE A;  3QB8 A;  1LRZ A;  3EXN A;  4A32 A;  4JLY A;  5KTA A;  2B5G A;  2X7B A;  2Z3N A;  3ZZI A;  2Q7B A;  4IF5 A;  3P2F A;  3EY5 A;  3I3G A;  2YGW A;  5G1Z A;  3DR8 A;  5IV0 A;  1RXT A;  2VBQ A;  3ZJ0 A;  4XPK A;  3GY9 A;  1KZF A;  3NE7 A;  4OLL A;  2PSW A;  4A30 A;  2B4D A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...