4AG7A

C. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): coenzyme a adduct
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
MSHIFDASVLAPHIPSNLPDNFKVRPLAKDDFSKGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDDCNFMTQRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSAMINE-6-PHOSPHATE N-ACETYLTRANSFERASE
publication title Structural and Biochemical Characterization of a Trapped Coenzyme a Adduct of Caenorhabditis Elegans Glucosamine-6-Phosphate N-Acetyltransferase 1.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 43
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ag7A01
3D2PA 3WR7A 5KTDA 5DWNA 2G3TA 3R9GA 3DSBA 3TTHA 4YGOA 4AB7A 2D4PA 2GANA 4CS0B 2FT0A 2R1IA 4CAWA 5CNPA 2P6EA 2Z10A 4OLLA 2RC4A 4HKFA 2FXFA 4OAEA 1S5KA 1NSLA 3FRMA 3UY5A 1L0CA 2REFA 4MI4A 2K5TA 2FE7A 2PC1A 1MJ9A 4KVXA 2G0BA 3NE7A 4UA3A 2J8MA 3B8GA 3G3SA 4NF1A 4MY3A 1M4GA 4XNHC 4ORFA 4HNYB 5E96A 4BMHA 1QSOA 1YX0A 2B3UA 2X7BA 3QAHA 1MJAA 2FSRA 3PZJA 3W91A 4I49A 1KUXA 4H89A 4GS4A 1NMTA 1Q2YA 3JVNA 4QUSA 1OZPA 3QB8A 3TOBA 4E2AA 3PGPA 2B5GB 5KTAA 4PSXA 3FIXA 4XPKA 3EY5A 3V8IA 2Q7BA 2Q04A 2VZZA 2ARHA 3CXPA 4FD7A 1TIQA 5J8CA 2EVNA 2J8NA 1Q2CA 3ZZIA 2B4DB 1WWZA 1P4NA 2CY2A 1CJWA 2R8VA 2ATRA 2B5GA 3DR8A 2IL4A 2AE6A 4PV6A 3K9UA 3F8KA 4PK2A 1WK4A 2Q4YA 3IGRA 2B4DA 5H84A 4KZTA 4IUSA 4KVOE 2JLMA 4B5PB 3S6HA 1XIXA 4R87A 1BO4A 4YFJA 1XF8A 4RS2A 3S6GA 2R7HA 2B58A 2G3AA 4II9A 2HV2A 1FY7A 3N7ZA 4U9YA 4AVBA 3I9SA 5KTCA 1KZFA 1M1DA 2ZW5A 3R96A 3R1KA 4H6ZA 4JD6A 1QSTA 1N71A 4PSWA 4HNXB 2VI7A 1YGHA 4MY0A 1XEBA 2BSWA 4DNCA 3H4QA 3TT2A 4F0YA 1KUYA 3TFYA 5HH1A 5FVJA 1I21A 5C82A 3D8PA 1YR0A 3R9EA 2KCWA 4LX9A 4M85A 1Y9KA 3TOAA 2I79A 4NEXA 4NXYA 4L8AA 2VXKA 4KOTA 4AG9A 3FXTA 2Q4VA 2BUEA 2PSWA 1VKCA 1M4DA 1U6MA 2WPWA 1Y9WA 2P6GA 3RYOA 1S7FA 3OWCA 2PR1A 2JEVA 3W6SA 2REEA 5EBVA 4KORA 4F6AA 1YK3A 2ZXVA 4FD6A 3EC4A 4JWPA 1I12A 1S60A 4LUAA 4NSQA 3EFAA 4ZBGA 1KUVA 1Z4EA 3W6XA 4UBRA 3CXSA 4MJ8A 5IX3A 2Z0ZA 1J4JA 1QSNA 2QMLA 2R98A 5F49A 1MK4A 4R9MA 3MGDA 4XNHB 4QVTA 1CM0A 2OB0A 1M44A 2Q44A 2HQYA 2AJ6A 1IIDA 4AG7A 4UWIA 3R9FA 2Y0MA 1Z4RA 4UWJA 4KOVA 5H86A 4AVCA 2QECA 3EO4A 2OZGA 2CNTA 4MHDA 4R57A 1MJBA 4JLYA 3PP9A 3S6KA 2Q0YA 4U9ZA 1M4IA 1ON0A 4FD4A 4Y49B 2VZYA 3VWDA 2VEZA 3F0AA 4RI1A 5IB0A 1RXTA 1R57A 3G8WA 1GHEA 2CNSA 5J8FA 1PUAA 2FIAA 1I1DA 3TO6A 2VBQA 4CRZB 2ZW7A 1B6BA 2OZHA 3FNCA 3EXNA 2GE3A 4R3KA 4ONUA 1YVKA 3DDDA 3GYAA 2BEIA 4NCZA 2B3VA 4XPDB 1NE9A 2FL4A 4KUAA 2PR8A 1IB1E 2D4OA 2FCKA 4E0AA 4AVAA 5JQ4A 4QC6A 1V0CA 4E8OA 4EVYA 4B5OA 1PU9A 5F46A 3T9YA 1IICA 4MBUA 4CAXA 2J8RA 1YLEA 2VQYA 1Q2DA 1IYLA 3BLNA 2PRBA 4JJXA 2ZW6A 1QSRA 4X5KA 1XMTA 4QB9A 3FB3A 3BJ7A 2PDOA 1S3ZA 2PQ8A 2Z11A 4FD5A 2P6FA 4KOYA 2ZW4A 3R95A 1UFHA 3IWGA 3KKWA 3SXOA 1YREA 3F5BA 3TO7A 2WPXA 1BOBA 2H5MA 2BL1A 1S7LA 4KVME 3ZJ0A 2EUIA 3LODA 3TE4A 4KLWA 3DNSA 4YRHA 3VWEA 2OU2A 1XE4A 2F5IA 1K4JA 5ISVA 1YVOA 5HMNA 2B4BA 4K30A 1LRZA 2HUZA 5F47A 4IF5A 2I00A 4U5YA 3TO9A 4QBJA 5IV0A 2JDCA 3I3GA 5EC4A 5C88A 4H6UA 4KOSA 3D2MA 4M3SA 3DR6A 2OH1A 4HNWB 2FS5A 1Z9UA 4JXRA 5F48A 5DWMA 3C26A 4OADA 4CAVA 2JDDA 1S7KA 3TCVA 4Y49C 1P0HA 4KLVA 3SHPA 2NMTA 2A4NA 4KOWA 4KUBA 2P0WA 1QSMA 4KOUA 3FBUA 2GIVA 2FIWA 4XPLA 4KOXA 3P2HA 4JXQA 3S6FA 3SXNA 1SQHA 5JPHA 1VHSA 3D3SA 2C27A 1RO5A 1S7NA 3CXQA 1Y7RA 3LD2A 3BJ8A 1B87A 3T90A 4R3LA 2OZUA 2ZPAA 3FYNA 5I0CA 3JUWA 4J3GA 2O28A 3GKRA 4CRYB 4XPDC 5GCNA 2CNMA 4B5PA 4L89A 2DXQA 4PK3A 1IYKA 2QIRA 3E0KA 3GY9A 3P2FA
chains in the Genus database with same CATH superfamily
3D2PA 3WR7A 1CP7A 3B35A 4O23A 4UEEA 1Z8WA 5KTDA 5DWNA 5I4MA 2C6PA 1VGYA 2G3TA 3R9GA 3FECA 4PXBA 2C6CA 3DSBA 3TTHA 4YGOA 1BAVA 4AB7A 2D4PA 1CG2A 2ZEPA 1Z8XA 2GANA 4CS0B 5G20A 2FT0A 2R1IA 2V8GA 5LYIA 4CAWA 5CNPA 4F8ZA 2AFMA 2GFQA 2ZOFA 2P6EA 2Z10A 4OLLA 2RC4A 4HKFA 2FXFA 4M6GA 4OAEA 5K8NA 3IU2A 2PJCA 1S5KA 2PCUA 1NSLA 4F9UA 1DTDA 4OC0A 2GLJA 4P4BA 3FRMA 3UY5A 1L0CA 4ZYQA 2REFA 4TNUA 2XEIA 4MI4A 3B3TA 1R43A 2BO9A 2K5TA 2FE7A 2PC1A 1MJ9A 4FAIA 1YLOA 1DE4C 3N5FA 1UWYA 3NFZA 2J9AA 4KVXA 2G0BA 3NE7A 1VIXA 4MCQA 5A27A 3BXMA 1TF9A 4UA3A 2J8MA 3B8GA 3G3SA 4A37A 5AG4A 4JZ0A 4NF1A 5G21A 4MY3A 1M4GA 1FNOA 4XNHC 4ORFA 1BPMA 4HNYB 4IK2A 2CIJA 5E96A 4BMHA 1CBXA 4IAVA 2ABZA 4DJLA 4MFPA 1QSOA 1YX0A 2AFZA 2B3UA 2X7BA 4UIAA 3QAHA 2Z3OA 1MJAA 1YMEA 3MRUA 2FSRA 1NSAA 3PZJA 1QMUA 4C2YA 5A28A 3W91A 4I49A 1KUXA 3H8GA 4H89A 3SJEA 4OC5A 4R76A 4GS4A 1NMTA 3H5ZA 5JGFA 1Q2YA 3JVNA 4QUSA 1OZPA 3QB8A 3KASA 5CBMA 3PB9X 3TOBA 4E2AA 2PJ3A 3PGPA 2B5GB 4MCPA 1EE3P 5KTAA 4PSXA 3FIXA 4XPKA 2G9DA 3EY5A 3V8IA 4A31A 2Q7BA 4ZGYB 2Q04A 4MCRA 2VZZA 3P2FA 3IWEA 4ZY0A 2PJBA 2ARHA 3CXPA 4FD7A 1TIQA 5J8CA 4NGRA 2EVNA 5HXDA 1TKJA 4YU9A 1AMPA 2J8NA 3FX6A 4MRIA 1QQ9A 1Q2CA 3IWWA 4UCPA 3ZZIA 2B4DB 1WWZA 2I3CA 3A9LA 1P4NA 2CY2A 4W9YA 1CJWA 8CPAA 3FF3A 3PB6X 2R8VA 2BOAA 2ATRA 2B5GA 3DR8A 2IL4A 4EMEA 1LAMA 2AE6A 3QAYA 3B3VA 4NGNA 4PV6A 1X10A 5LYDA 1FT7A 3K9UA 3F8KA 3D67A 1XRYA 4PK2A 1ZG7A 3PB7X 1CP6A 1AUGA 1WK4A 1JWQA 4OC2A 2Q4YA 3IGRA 3IC1A 3BHXA 3CPXA 3GB0A 4UFWA 4WJBA 2CXAA 2B4DA 4OP4A 4P10A 3GLJA 4KZTA 5H84A 4B13A 4IUSA 4KVOE 2JLMA 4B5PB 2Q7SA 3S6HA 1XIXA 2XEFA 5THWA 4R87A 3DGVA 5K8OA 1BO4A 2V8VA 4YFJA 1XF8A 4RS2A 3S6GA 1ARLA 3RNZA 2R7HA 2B58A 2G3AA 4II9A 2HV2A 1FY7A 4GXHA 4AXVA 3N7ZA 1YSJA 1KWMA 4U9YA 4EWTA 4AVBA 3I9SA 3IEHA 5KTCA 1KZFA 1M1DA 2ZW5A 3R96A 2HC9A 3JTKA 3R1KA 4H6ZA 4JD6A 5AG6A 4F9VA 5JH9A 1QSTA 1N71A 2YNCC 4PSWA 3LWUA 3S9NA 4HNXB 2VI7A 1YGHA 3HUVA 1CPSA 3BI0A 4MY0A 1YQEA 4OMEA 4C7IA 1XEBA 2BSWA 4DNCA 3H4QA 3TT2A 4F0YA 2GREA 1KUYA 2VL1A 3LACA 5HH1A 3TFYA 5FVJA 2Z3LA 1I21A 5DS0A 5C82A 5F09A 3D8PA 3MN8A 1TKFA 4ZI6A 1YR0A 4LQGA 3V7ZA 4UFVA 3R9EA 7CPAA 1Y0RA 1IU8A 2KCWA 4KS9A 4P4EA 4LX9A 2Z3PA 4NGQA 3PB8X 4M85A 1Y9KA 4UCMA 4CPAA 3RO0A 2I79A 3TOAA 4RN7A 4BINA 4NEXA 5G22A 4NXYA 4CGNA 4L8AA 4C7HA 4P4JA 3WABA 2PVWA 2VXKA 4KOTA 4AG9A 3KHXA 2PJ6A 3FXTA 4UFXA 2Q4VA 2BUEA 2PSWA 2PIYA 3T8WA 1VKCA 1M4DA 2PJ9A 4Q36A 4FBEA 3CT9A 1U6MA 4DUKA 2V8DA 2F8HA 2WPWA 1Y9WA 4UEZA 2P6GA 2ANPA 4R8FA 3NE8A 3RYOA 1S7FA 2CTBA 5LRKA 3OWCA 2PJ4A 2PR1A 2JEVA 3W6SA 2REEA 5EBVA 4KORA 1IOIA 4F6AA 1YK3A 2ZXVA 4FD6A 3EC4A 4JWPA 3SI1A 1I12A 1S60A 4LUAA 4NSQA 4YWYA 1HEEA 3EFAA 5AG5A 4ZBGA 1KUVA 1Z4EA 1XFOA 3PBBA 4UBRA 3TC8A 3W6XA 3CXSA 4MJ8A 5IX3A 2Z0ZA 1H8LA 4B10A 2JBJA 4CAFA 1J4JA 1ELLP 2QVPA 2GU2A 3RBUA 1QSNA 1ARMA 2QMLA 2R98A 5F49A 1MK4A 4R9MA 2Q51A 1R3NA 4ZX8A 2PJ1A 4P45A 3MGDA 4XNHB 4QVTA 2EWBA 1CM0A 2OB0A 1M44A 2EK8A 2Z3NA 5G1ZA 2Z3MA 1CPXA 3H8EA 4DYOA 2Q44A 3TX8A 5HVFA 1F2PA 2HQYA 2AJ6A 2ZEDA 3LMSA 4NGTA 1IIDA 3HLPA 5K8MA 4AG7A 4CYNA 3S9LA 4UWIA 3ISXA 4WWVA 4M6HA 3R9FA 2DEAA 2IMOA 1ZO0A 2PVVA 1X12A 2Y0MA 1Z4RA 4IHMA 4UWJA 4KOVA 5H86A 4AVCA 2QECA 4BBHA 3VARA 3EO4A 4CGMA 1A2ZA 3SI0A 4C2ZA 2OZGA 2WUUA 2CNTA 4MHDA 2Q43A 4R57A 1MJBA 3KHZA 2RFHA 2JEWA 3FH4A 4JLYA 3PP9A 3S6KA 3VATA 2EK9A 2Q0YA 2WYRA 4NFRA 4U9ZA 2ZEHA 1M4IA 3D7GA 3NA6A 1ON0A 4FD4A 3SJFA 4Y49B 3KL9A 1Z8LA 2VZYA 3VWDA 4NGMA 2VEZA 1F2OA 3F0AA 4CAEA 4RI1A 5IB0A 1YW6A 3GUXA 1RXTA 3IO1A 1LAPA 1R57A 3ISZA 1IGBA 2CF4A 4G1PA 3G8WA 1RTQA 1ZG8A 3D4UA 4CYOA 1GHEA 1Z5RA 2CNSA 3CPAA 5J8FA 1PUAA 4KSFA 4MHPA 3K2KA 2FIAA 4MCSA 1BLLE 4A2ZA 3PFEA 1I1DA 3TO6A 3KQZA 2VBQA 5CPAA 2ZW7A 4CRZB 1B6BA 2OZHA 3RAMA 2ZELA 5LRJA 3V38A 4ZY1A 3FNCA 5ELYA 3EXNA 2V77A 1IOFA 1Y0YA 5LYFA 2GE3A 3PEIA 3KGQA 4R3KA 4ONUA 3SJGA 1YVKA 5LYLA 1LOKA 3CDXA 4KSIA 4KSAA 4MFZA 2C1CA 3DDDA 3GYAA 2BEIA 4NCZA 4C2XA 1VHEA 2NYQA 2ZEFA 5J1QA 3NH8A 4ZX9A 2PJ0A 2B3VA 4B14A 4XPDB 1NE9A 2FL4A 4KUAA 1LCPA 2PR8A 4FWUA 3QNVA 4UEFA 1IB1E 2PRQA 2D4OA 4P4IA 4OC3A 2IJZA 4HPSA 4MHYA 2PIZA 2AFWA 4P6YA 1OBRA 2GLFA 3PRTA 4B6ZA 3IU1A 3SI2A 1IY7A 4MXUA 2FCKA 4E0AA 4AVAA 5AG7A 5JQ4A 2ZEGA 4QC6A 1V0CA 1VHOA 4PXEA 4E8OA 2YNEA 2ZEMA 1YW4A 4EVYA 1BPNA 4K3NA 4B5OA 1PU9A 4LQ6A 5F46A 3WT4A 3T9YA 3PFOA 4NGPA 2CTCA 1IICA 4MBUA 4CAXA 3IJ3A 3CZXA 1Z8TA 4NGSA 4CGOA 2J8RA 2PJ8A 2Q4ZA 3H8FA 1YLEA 2Z3KA 2VQYA 1Q2DA 1IYLA 4P44A 2WSAA 4P4DA 4PXDA 2HB6A 4X2TA 3BLNA 4BD9A 2PRBA 4MFQA 5HVHA 2AFXA 4JJXA 4TWEA 4B12A 2ZW6A 1QSRA 4NJQA 4Q7AA 4X5KA 1XMTA 4QB9A 4UCNA 3I1UA 4MMOA 3FB3A 1HDQA 3BJ7A 2PDOA 1S3ZA 4CYPA 2PQ8A 3VH9A 4NJRA 2Z11A 4FD5A 3BI1A 5D8NA 2P6FA 4KOYA 2ZW4A 3FJUA 3R95A 1UFHA 3IWGA 2ZOGA 3K9TA 3KKWA 1YREA 3KI9A 3SXOA 1ZLHA 3F5BA 4A30A 3KZWA 3TO7A 3B2YA 2WPXA 4A94A 1ZG9A 3WC6A 1BOBA 2H5MA 2BL1A 1HDUA 2YGWA 4CGLA 4MFJA 1S7LA 4KVME 5HVGA 3ZJ0A 2EUIA 5K8PA 3LODA 3TE4A 2PJ7A 4KLWA 4OIDA 1PCAA 1PYTB 4OIWA 5D29A 3DNSA 4OC4A 4PXCA 4YRHA 3VWEA 2OU2A 1JQGA 3B7IA 1XE4A 2PJ5A 3KR5A 3KR4A 2F5IA 4MHNA 3RZAA 2EO8A 1XMBA 1K4JA 5ISVA 3D7FA 2IQ6A 4OC1A 3D7HA 4A32A 5AGEA 1YVOA 2QYVA 5HMNA 2B4BA 2XEGA 4K30A 2O53A 1LRZA 4ONWA 4A33A 2HUZA 4CYQA 5F47A 6CPAA 4IF5A 2I00A 4PQAA 4U5YA 1Y7EA 4PPZA 2PE3A 3TO9A 4QBJA 5IV0A 2JDCA 3I3GA 1ZLIA 5EC4A 2O4HA 4M6IA 4FUUA 4F0XA 5C88A 3B3SA 1TKHA 4H6UA 1AYEA 4KOSA 2NSMA 3PBEA 4X3RA 4C68A 3D2MA 4M3SA 3L2NA 3KQXA 3DR6A 3FVLA 2OH1A 2ZENA 4MFKA 4HNWB 1TXRA 2FS5A 1Z9UA 1LFWA 2XEJA 4JXRA 4MHZA 3NH5A 5F48A 4CGPA 5DWMA 3C26A 3PB4X 4OADA 4CAVA 1CX8A 2JDDA 2QJ8A 1S7KA 3NH4A 4UF4A 5JM6A 4GM5A 1Q7LA 3S9MA 1XOVA 3TCVA 4A38A 1XJOA 4A95A 2AFUA 4Y49C 4X8IA 1P0HA 3IIBA 4KLVA 2EBJA 3SHPA 4UIBA 2RB7A 5IB9A 2WZNA 1GYTA 2NMTA 2A4NA 2ODFA 4KOWA 4KUBA 2P0WA 1QSMA 3WC5A 4KOUA 3FBUA 3FEDA 2GIVA 2ZEEA 2FIWA 2POKA 4R7MA 4RUHA 4XPLA 4KOXA 3P2HA 2V8HA 2YNDA 3D7DA 4JXQA 2DF5A 4JYWA 3FEEA 3S6FA 4B11A 2DPSA 4Q38A 3SXNA 4ZY2A 1SQHA 5JPHA 1VHSA 2DPTA 5LRGA 2C6GA 1Z2LA 1TF8A 3DLJA 2PJ2A 1M4LA 2C27A 3D3SA 1RO5A 3JRUA 1S7NA 3CXQA 4MFLA 2F7VA 3IFEA 5EMIA 1Y7RA 4Z65A 3LD2A 3BJ8A 2ZEOA 2OOTA 1B87A 2OR4A 3T90A 2AFSA 3SJXA 4R3LA 2OZUA 3GIUA 3B3WA 4OKOA 2ZPAA 3WC7A 3B3CA 3FYNA 1LANA 2JBKA 1XBUA 5I0CA 2AFOA 3JUWA 4J3GA 2O28A 3GKRA 4CRYB 4P4FA 4XPDC 5GCNA 2CNMA 4B5PA 2PJAA 2FVGA 4L89A 2YNCA 2DXQA 2BCOA 1ELMP 4EFDA 4PK3A 1IYKA 2QIRA 4A39A 3E0KA 3D66A 4R6TA 1F57A 5BWAB 4H2KA 3GY9A 3FMCA 3D68A
chains in the Genus database with same CATH topology
3D2PA 3WR7A 5KTDA 5DWNA 2G3TA 3R9GA 3DSBA 3TTHA 4YGOA 4AB7A 2D4PA 2GANA 4CS0B 5G20A 2FT0A 2R1IA 4CAWA 5CNPA 2P6EA 2Z10A 4OLLA 2RC4A 4HKFA 2FXFA 4OAEA 3IU2A 1S5KA 1NSLA 3FRMA 3UY5A 1L0CA 2REFA 4MI4A 2K5TA 2FE7A 2PC1A 1MJ9A 4KVXA 2G0BA 3NE7A 5A27A 4UA3A 2J8MA 3B8GA 3G3SA 5AG4A 4NF1A 5G21A 4MY3A 1M4GA 4XNHC 4ORFA 4HNYB 5E96A 4BMHA 4MFPA 1QSOA 1YX0A 2B3UA 2X7BA 3QAHA 2Z3OA 1MJAA 2FSRA 3PZJA 4C2YA 5A28A 3W91A 4I49A 1KUXA 4H89A 4GS4A 1NMTA 3H5ZA 1Q2YA 3JVNA 4QUSA 1OZPA 3QB8A 3TOBA 4E2AA 3PGPA 2B5GB 5KTAA 4PSXA 3FIXA 4XPKA 3EY5A 3V8IA 4A31A 2Q7BA 4ZGYB 2Q04A 2VZZA 3IWEA 2ARHA 3CXPA 4FD7A 1TIQA 5J8CA 2EVNA 2J8NA 1Q2CA 3ZZIA 4UCPA 2B4DB 1WWZA 3A9LA 1P4NA 2CY2A 1CJWA 2R8VA 2ATRA 2B5GA 3DR8A 2IL4A 2AE6A 4PV6A 3K9UA 3F8KA 4PK2A 1WK4A 4UFWA 2Q4YA 3IGRA 2CXAA 2B4DA 5H84A 4B13A 4KZTA 4IUSA 4KVOE 2JLMA 4B5PB 3S6HA 1XIXA 4R87A 1BO4A 4YFJA 1XF8A 4RS2A 3S6GA 2R7HA 2B58A 2G3AA 4II9A 2HV2A 1FY7A 3N7ZA 4U9YA 4AVBA 3I9SA 5KTCA 1KZFA 1M1DA 2ZW5A 3R96A 3JTKA 3R1KA 4H6ZA 4JD6A 5AG6A 1QSTA 1N71A 2YNCC 4PSWA 4HNXB 2VI7A 1YGHA 4MY0A 4C7IA 1XEBA 2BSWA 4DNCA 3H4QA 3TT2A 4F0YA 1KUYA 3TFYA 5HH1A 5FVJA 2Z3LA 1I21A 5C82A 3D8PA 1YR0A 4UFVA 3R9EA 2KCWA 4KS9A 4LX9A 2Z3PA 4M85A 1Y9KA 4UCMA 3TOAA 2I79A 4NEXA 5G22A 4NXYA 4CGNA 4L8AA 4C7HA 2VXKA 4KOTA 4AG9A 3FXTA 4UFXA 2Q4VA 2BUEA 2PSWA 1VKCA 1M4DA 4Q36A 1U6MA 2WPWA 1Y9WA 2P6GA 3RYOA 1S7FA 3OWCA 2PR1A 2JEVA 3W6SA 2REEA 5EBVA 4KORA 4F6AA 1YK3A 2ZXVA 4FD6A 3EC4A 4JWPA 1I12A 1S60A 4LUAA 4NSQA 3EFAA 5AG5A 4ZBGA 1KUVA 1Z4EA 3W6XA 4UBRA 3CXSA 4MJ8A 5IX3A 2Z0ZA 4B10A 4CAFA 1J4JA 1QSNA 2QMLA 2R98A 5F49A 1MK4A 4R9MA 3MGDA 4XNHB 4QVTA 1CM0A 2OB0A 1M44A 2Z3NA 5G1ZA 2Z3MA 2Q44A 2HQYA 2AJ6A 1IIDA 4AG7A 4CYNA 4UWIA 3R9FA 1ZO0A 2Y0MA 1Z4RA 4BBHA 4UWJA 4KOVA 5H86A 4AVCA 2QECA 3EO4A 4CGMA 4C2ZA 2OZGA 2WUUA 2CNTA 4MHDA 4R57A 1MJBA 4JLYA 3PP9A 3S6KA 2Q0YA 4U9ZA 1M4IA 1ON0A 4FD4A 4Y49B 2VZYA 3VWDA 4CAEA 2VEZA 3F0AA 4RI1A 5IB0A 1RXTA 1R57A 3G8WA 4CYOA 1GHEA 2CNSA 5J8FA 1PUAA 4KSFA 2FIAA 4A2ZA 1I1DA 3TO6A 2VBQA 4CRZB 2ZW7A 1B6BA 2OZHA 3FNCA 3EXNA 2GE3A 4R3KA 4ONUA 1YVKA 4KSAA 4MFZA 3DDDA 3GYAA 2BEIA 4NCZA 4C2XA 2B3VA 4B14A 4XPDB 1NE9A 2FL4A 4KUAA 2PR8A 1IB1E 2D4OA 3IU1A 2FCKA 4E0AA 4AVAA 5AG7A 5JQ4A 4QC6A 1V0CA 4E8OA 2YNEA 4EVYA 4B5OA 1PU9A 5F46A 3T9YA 1IICA 4MBUA 4CAXA 4CGOA 2J8RA 1YLEA 2Z3KA 2VQYA 1Q2DA 1IYLA 2WSAA 3BLNA 2PRBA 4MFQA 4JJXA 4B12A 2ZW6A 1QSRA 4X5KA 1XMTA 4QB9A 4UCNA 3FB3A 3BJ7A 2PDOA 1S3ZA 4CYPA 2PQ8A 2Z11A 4FD5A 2P6FA 4KOYA 2ZW4A 3R95A 1UFHA 3IWGA 3KKWA 3SXOA 1YREA 4A30A 3F5BA 3TO7A 2WPXA 1BOBA 2H5MA 2BL1A 2YGWA 4CGLA 4MFJA 1S7LA 4KVME 3ZJ0A 2EUIA 3LODA 3TE4A 4KLWA 3DNSA 4YRHA 3VWEA 2OU2A 1XE4A 2F5IA 1K4JA 5ISVA 4A32A 5AGEA 1YVOA 5HMNA 2B4BA 4K30A 1LRZA 4A33A 2HUZA 4CYQA 5F47A 4IF5A 2I00A 4U5YA 3TO9A 4QBJA 5IV0A 2JDCA 3I3GA 5EC4A 4F0XA 5C88A 4H6UA 4KOSA 4C68A 3D2MA 4M3SA 3DR6A 4MFKA 2OH1A 4HNWB 4CGPA 2FS5A 1Z9UA 4JXRA 5F48A 5DWMA 3C26A 4OADA 4CAVA 2JDDA 1S7KA 3TCVA 4A95A 4Y49C 1P0HA 4KLVA 3SHPA 2NMTA 2A4NA 4KOWA 4KUBA 2P0WA 1QSMA 4KOUA 3FBUA 2GIVA 2FIWA 4XPLA 4KOXA 3P2HA 2YNDA 4JXQA 4B11A 3S6FA 2DPSA 4Q38A 3SXNA 1SQHA 5JPHA 1VHSA 2DPTA 3D3SA 2C27A 1RO5A 1S7NA 3CXQA 4MFLA 1Y7RA 3LD2A 3BJ8A 1B87A 3T90A 4R3LA 2OZUA 2ZPAA 3FYNA 5I0CA 3JUWA 4J3GA 2O28A 3GKRA 4CRYB 4XPDC 5GCNA 2CNMA 4B5PA 4L89A 2YNCA 2DXQA 4PK3A 1IYKA 2QIRA 3E0KA 5BWAB 3GY9A 3P2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2P A;  3WR7 A;  5KTD A;  5DWN A;  2G3T A;  3R9G A;  3DSB A;  3TTH A;  4YGO A;  4AB7 A;  2D4P A;  2GAN A;  4CS0 B;  2FT0 A;  2R1I A;  4CAW A;  5CNP A;  2P6E A;  2Z10 A;  4OLL A;  2RC4 A;  4HKF A;  2FXF A;  4OAE A;  1S5K A;  1NSL A;  3FRM A;  3UY5 A;  1L0C A;  2REF A;  4MI4 A;  2K5T A;  2FE7 A;  2PC1 A;  1MJ9 A;  4KVX A;  2G0B A;  3NE7 A;  4UA3 A;  2J8M A;  3B8G A;  3G3S A;  4NF1 A;  4MY3 A;  1M4G A;  4XNH C;  4ORF A;  4HNY B;  5E96 A;  4BMH A;  1QSO A;  1YX0 A;  2B3U A;  2X7B A;  3QAH A;  1MJA A;  2FSR A;  3PZJ A;  3W91 A;  4I49 A;  1KUX A;  4H89 A;  4GS4 A;  1NMT A;  1Q2Y A;  3JVN A;  4QUS A;  1OZP A;  3QB8 A;  3TOB A;  4E2A A;  3PGP A;  2B5G B;  5KTA A;  4PSX A;  3FIX A;  4XPK A;  3EY5 A;  3V8I A;  2Q7B A;  2Q04 A;  2VZZ A;  2ARH A;  3CXP A;  4FD7 A;  1TIQ A;  5J8C A;  2EVN A;  2J8N A;  1Q2C A;  3ZZI A;  2B4D B;  1WWZ A;  1P4N A;  2CY2 A;  1CJW A;  2R8V A;  2ATR A;  2B5G A;  3DR8 A;  2IL4 A;  2AE6 A;  4PV6 A;  3K9U A;  3F8K A;  4PK2 A;  1WK4 A;  2Q4Y A;  3IGR A;  2B4D A;  5H84 A;  4KZT A;  4IUS A;  4KVO E;  2JLM A;  4B5P B;  3S6H A;  1XIX A;  4R87 A;  1BO4 A;  4YFJ A;  1XF8 A;  4RS2 A;  3S6G A;  2R7H A;  2B58 A;  2G3A A;  4II9 A;  2HV2 A;  1FY7 A;  3N7Z A;  4U9Y A;  4AVB A;  3I9S A;  5KTC A;  1KZF A;  1M1D A;  2ZW5 A;  3R96 A;  3R1K A;  4H6Z A;  4JD6 A;  1QST A;  1N71 A;  4PSW A;  4HNX B;  2VI7 A;  1YGH A;  4MY0 A;  1XEB A;  2BSW A;  4DNC A;  3H4Q A;  3TT2 A;  4F0Y A;  1KUY A;  3TFY A;  5HH1 A;  5FVJ A;  1I21 A;  5C82 A;  3D8P A;  1YR0 A;  3R9E A;  2KCW A;  4LX9 A;  4M85 A;  1Y9K A;  3TOA A;  2I79 A;  4NEX A;  4NXY A;  4L8A A;  2VXK A;  4KOT A;  4AG9 A;  3FXT A;  2Q4V A;  2BUE A;  2PSW A;  1VKC A;  1M4D A;  1U6M A;  2WPW A;  1Y9W A;  2P6G A;  3RYO A;  1S7F A;  3OWC A;  2PR1 A;  2JEV A;  3W6S A;  2REE A;  5EBV A;  4KOR A;  4F6A A;  1YK3 A;  2ZXV A;  4FD6 A;  3EC4 A;  4JWP A;  1I12 A;  1S60 A;  4LUA A;  4NSQ A;  3EFA A;  4ZBG A;  1KUV A;  1Z4E A;  3W6X A;  4UBR A;  3CXS A;  4MJ8 A;  5IX3 A;  2Z0Z A;  1J4J A;  1QSN A;  2QML A;  2R98 A;  5F49 A;  1MK4 A;  4R9M A;  3MGD A;  4XNH B;  4QVT A;  1CM0 A;  2OB0 A;  1M44 A;  2Q44 A;  2HQY A;  2AJ6 A;  1IID A;  4AG7 A;  4UWI A;  3R9F A;  2Y0M A;  1Z4R A;  4UWJ A;  4KOV A;  5H86 A;  4AVC A;  2QEC A;  3EO4 A;  2OZG A;  2CNT A;  4MHD A;  4R57 A;  1MJB A;  4JLY A;  3PP9 A;  3S6K A;  2Q0Y A;  4U9Z A;  1M4I A;  1ON0 A;  4FD4 A;  4Y49 B;  2VZY A;  3VWD A;  2VEZ A;  3F0A A;  4RI1 A;  5IB0 A;  1RXT A;  1R57 A;  3G8W A;  1GHE A;  2CNS A;  5J8F A;  1PUA A;  2FIA A;  1I1D A;  3TO6 A;  2VBQ A;  4CRZ B;  2ZW7 A;  1B6B A;  2OZH A;  3FNC A;  3EXN A;  2GE3 A;  4R3K A;  4ONU A;  1YVK A;  3DDD A;  3GYA A;  2BEI A;  4NCZ A;  2B3V A;  4XPD B;  1NE9 A;  2FL4 A;  4KUA A;  2PR8 A;  1IB1 E;  2D4O A;  2FCK A;  4E0A A;  4AVA A;  5JQ4 A;  4QC6 A;  1V0C A;  4E8O A;  4EVY A;  4B5O A;  1PU9 A;  5F46 A;  3T9Y A;  1IIC A;  4MBU A;  4CAX A;  2J8R A;  1YLE A;  2VQY A;  1Q2D A;  1IYL A;  3BLN A;  2PRB A;  4JJX A;  2ZW6 A;  1QSR A;  4X5K A;  1XMT A;  4QB9 A;  3FB3 A;  3BJ7 A;  2PDO A;  1S3Z A;  2PQ8 A;  2Z11 A;  4FD5 A;  2P6F A;  4KOY A;  2ZW4 A;  3R95 A;  1UFH A;  3IWG A;  3KKW A;  3SXO A;  1YRE A;  3F5B A;  3TO7 A;  2WPX A;  1BOB A;  2H5M A;  2BL1 A;  1S7L A;  4KVM E;  3ZJ0 A;  2EUI A;  3LOD A;  3TE4 A;  4KLW A;  3DNS A;  4YRH A;  3VWE A;  2OU2 A;  1XE4 A;  2F5I A;  1K4J A;  5ISV A;  1YVO A;  5HMN A;  2B4B A;  4K30 A;  1LRZ A;  2HUZ A;  5F47 A;  4IF5 A;  2I00 A;  4U5Y A;  3TO9 A;  4QBJ A;  5IV0 A;  2JDC A;  3I3G A;  5EC4 A;  5C88 A;  4H6U A;  4KOS A;  3D2M A;  4M3S A;  3DR6 A;  2OH1 A;  4HNW B;  2FS5 A;  1Z9U A;  4JXR A;  5F48 A;  5DWM A;  3C26 A;  4OAD A;  4CAV A;  2JDD A;  1S7K A;  3TCV A;  4Y49 C;  1P0H A;  4KLV A;  3SHP A;  2NMT A;  2A4N A;  4KOW A;  4KUB A;  2P0W A;  1QSM A;  4KOU A;  3FBU A;  2GIV A;  2FIW A;  4XPL A;  4KOX A;  3P2H A;  4JXQ A;  3S6F A;  3SXN A;  1SQH A;  5JPH A;  1VHS A;  3D3S A;  2C27 A;  1RO5 A;  1S7N A;  3CXQ A;  1Y7R A;  3LD2 A;  3BJ8 A;  1B87 A;  3T90 A;  4R3L A;  2OZU A;  2ZPA A;  3FYN A;  5I0C A;  3JUW A;  4J3G A;  2O28 A;  3GKR A;  4CRY B;  4XPD C;  5GCN A;  2CNM A;  4B5P A;  4L89 A;  2DXQ A;  4PK3 A;  1IYK A;  2QIR A;  3E0K A;  3GY9 A;  3P2F A; 
#chains in the Genus database with same CATH topology
 3D2P A;  3WR7 A;  1CP7 A;  3B35 A;  4O23 A;  4UEE A;  1Z8W A;  5KTD A;  5DWN A;  5I4M A;  2C6P A;  1VGY A;  2G3T A;  3R9G A;  3FEC A;  4PXB A;  2C6C A;  3DSB A;  3TTH A;  4YGO A;  1BAV A;  4AB7 A;  2D4P A;  1CG2 A;  2ZEP A;  1Z8X A;  2GAN A;  4CS0 B;  5G20 A;  2FT0 A;  2R1I A;  2V8G A;  5LYI A;  4CAW A;  5CNP A;  4F8Z A;  2AFM A;  2GFQ A;  2ZOF A;  2P6E A;  2Z10 A;  4OLL A;  2RC4 A;  4HKF A;  2FXF A;  4M6G A;  4OAE A;  5K8N A;  3IU2 A;  2PJC A;  1S5K A;  2PCU A;  1NSL A;  4F9U A;  1DTD A;  4OC0 A;  2GLJ A;  4P4B A;  3FRM A;  3UY5 A;  1L0C A;  4ZYQ A;  2REF A;  4TNU A;  2XEI A;  4MI4 A;  3B3T A;  1R43 A;  2BO9 A;  2K5T A;  2FE7 A;  2PC1 A;  1MJ9 A;  4FAI A;  1YLO A;  1DE4 C;  3N5F A;  1UWY A;  3NFZ A;  2J9A A;  4KVX A;  2G0B A;  3NE7 A;  1VIX A;  4MCQ A;  5A27 A;  3BXM A;  1TF9 A;  4UA3 A;  2J8M A;  3B8G A;  3G3S A;  4A37 A;  5AG4 A;  4JZ0 A;  4NF1 A;  5G21 A;  4MY3 A;  1M4G A;  1FNO A;  4XNH C;  4ORF A;  1BPM A;  4HNY B;  4IK2 A;  2CIJ A;  5E96 A;  4BMH A;  1CBX A;  4IAV A;  2ABZ A;  4DJL A;  4MFP A;  1QSO A;  1YX0 A;  2AFZ A;  2B3U A;  2X7B A;  4UIA A;  3QAH A;  2Z3O A;  1MJA A;  1YME A;  3MRU A;  2FSR A;  1NSA A;  3PZJ A;  1QMU A;  4C2Y A;  5A28 A;  3W91 A;  4I49 A;  1KUX A;  3H8G A;  4H89 A;  3SJE A;  4OC5 A;  4R76 A;  4GS4 A;  1NMT A;  3H5Z A;  5JGF A;  1Q2Y A;  3JVN A;  4QUS A;  1OZP A;  3QB8 A;  3KAS A;  5CBM A;  3PB9 X;  3TOB A;  4E2A A;  2PJ3 A;  3PGP A;  2B5G B;  4MCP A;  1EE3 P;  5KTA A;  4PSX A;  3FIX A;  4XPK A;  2G9D A;  3EY5 A;  3V8I A;  4A31 A;  2Q7B A;  4ZGY B;  2Q04 A;  4MCR A;  2VZZ A;  3P2F A;  3IWE A;  4ZY0 A;  2PJB A;  2ARH A;  3CXP A;  4FD7 A;  1TIQ A;  5J8C A;  4NGR A;  2EVN A;  5HXD A;  1TKJ A;  4YU9 A;  1AMP A;  2J8N A;  3FX6 A;  4MRI A;  1QQ9 A;  1Q2C A;  3IWW A;  4UCP A;  3ZZI A;  2B4D B;  1WWZ A;  2I3C A;  3A9L A;  1P4N A;  2CY2 A;  4W9Y A;  1CJW A;  8CPA A;  3FF3 A;  3PB6 X;  2R8V A;  2BOA A;  2ATR A;  2B5G A;  3DR8 A;  2IL4 A;  4EME A;  1LAM A;  2AE6 A;  3QAY A;  3B3V A;  4NGN A;  4PV6 A;  1X10 A;  5LYD A;  1FT7 A;  3K9U A;  3F8K A;  3D67 A;  1XRY A;  4PK2 A;  1ZG7 A;  3PB7 X;  1CP6 A;  1AUG A;  1WK4 A;  1JWQ A;  4OC2 A;  2Q4Y A;  3IGR A;  3IC1 A;  3BHX A;  3CPX A;  3GB0 A;  4UFW A;  4WJB A;  2CXA A;  2B4D A;  4OP4 A;  4P10 A;  3GLJ A;  4KZT A;  5H84 A;  4B13 A;  4IUS A;  4KVO E;  2JLM A;  4B5P B;  2Q7S A;  3S6H A;  1XIX A;  2XEF A;  5THW A;  4R87 A;  3DGV A;  5K8O A;  1BO4 A;  2V8V A;  4YFJ A;  1XF8 A;  4RS2 A;  3S6G A;  1ARL A;  3RNZ A;  2R7H A;  2B58 A;  2G3A A;  4II9 A;  2HV2 A;  1FY7 A;  4GXH A;  4AXV A;  3N7Z A;  1YSJ A;  1KWM A;  4U9Y A;  4EWT A;  4AVB A;  3I9S A;  3IEH A;  5KTC A;  1KZF A;  1M1D A;  2ZW5 A;  3R96 A;  2HC9 A;  3JTK A;  3R1K A;  4H6Z A;  4JD6 A;  5AG6 A;  4F9V A;  5JH9 A;  1QST A;  1N71 A;  2YNC C;  4PSW A;  3LWU A;  3S9N A;  4HNX B;  2VI7 A;  1YGH A;  3HUV A;  1CPS A;  3BI0 A;  4MY0 A;  1YQE A;  4OME A;  4C7I A;  1XEB A;  2BSW A;  4DNC A;  3H4Q A;  3TT2 A;  4F0Y A;  2GRE A;  1KUY A;  2VL1 A;  3LAC A;  5HH1 A;  3TFY A;  5FVJ A;  2Z3L A;  1I21 A;  5DS0 A;  5C82 A;  5F09 A;  3D8P A;  3MN8 A;  1TKF A;  4ZI6 A;  1YR0 A;  4LQG A;  3V7Z A;  4UFV A;  3R9E A;  7CPA A;  1Y0R A;  1IU8 A;  2KCW A;  4KS9 A;  4P4E A;  4LX9 A;  2Z3P A;  4NGQ A;  3PB8 X;  4M85 A;  1Y9K A;  4UCM A;  4CPA A;  3RO0 A;  2I79 A;  3TOA A;  4RN7 A;  4BIN A;  4NEX A;  5G22 A;  4NXY A;  4CGN A;  4L8A A;  4C7H A;  4P4J A;  3WAB A;  2PVW A;  2VXK A;  4KOT A;  4AG9 A;  3KHX A;  2PJ6 A;  3FXT A;  4UFX A;  2Q4V A;  2BUE A;  2PSW A;  2PIY A;  3T8W A;  1VKC A;  1M4D A;  2PJ9 A;  4Q36 A;  4FBE A;  3CT9 A;  1U6M A;  4DUK A;  2V8D A;  2F8H A;  2WPW A;  1Y9W A;  4UEZ A;  2P6G A;  2ANP A;  4R8F A;  3NE8 A;  3RYO A;  1S7F A;  2CTB A;  5LRK A;  3OWC A;  2PJ4 A;  2PR1 A;  2JEV A;  3W6S A;  2REE A;  5EBV A;  4KOR A;  1IOI A;  4F6A A;  1YK3 A;  2ZXV A;  4FD6 A;  3EC4 A;  4JWP A;  3SI1 A;  1I12 A;  1S60 A;  4LUA A;  4NSQ A;  4YWY A;  1HEE A;  3EFA A;  5AG5 A;  4ZBG A;  1KUV A;  1Z4E A;  1XFO A;  3PBB A;  4UBR A;  3TC8 A;  3W6X A;  3CXS A;  4MJ8 A;  5IX3 A;  2Z0Z A;  1H8L A;  4B10 A;  2JBJ A;  4CAF A;  1J4J A;  1ELL P;  2QVP A;  2GU2 A;  3RBU A;  1QSN A;  1ARM A;  2QML A;  2R98 A;  5F49 A;  1MK4 A;  4R9M A;  2Q51 A;  1R3N A;  4ZX8 A;  2PJ1 A;  4P45 A;  3MGD A;  4XNH B;  4QVT A;  2EWB A;  1CM0 A;  2OB0 A;  1M44 A;  2EK8 A;  2Z3N A;  5G1Z A;  2Z3M A;  1CPX A;  3H8E A;  4DYO A;  2Q44 A;  3TX8 A;  5HVF A;  1F2P A;  2HQY A;  2AJ6 A;  2ZED A;  3LMS A;  4NGT A;  1IID A;  3HLP A;  5K8M A;  4AG7 A;  4CYN A;  3S9L A;  4UWI A;  3ISX A;  4WWV A;  4M6H A;  3R9F A;  2DEA A;  2IMO A;  1ZO0 A;  2PVV A;  1X12 A;  2Y0M A;  1Z4R A;  4IHM A;  4UWJ A;  4KOV A;  5H86 A;  4AVC A;  2QEC A;  4BBH A;  3VAR A;  3EO4 A;  4CGM A;  1A2Z A;  3SI0 A;  4C2Z A;  2OZG A;  2WUU A;  2CNT A;  4MHD A;  2Q43 A;  4R57 A;  1MJB A;  3KHZ A;  2RFH A;  2JEW A;  3FH4 A;  4JLY A;  3PP9 A;  3S6K A;  3VAT A;  2EK9 A;  2Q0Y A;  2WYR A;  4NFR A;  4U9Z A;  2ZEH A;  1M4I A;  3D7G A;  3NA6 A;  1ON0 A;  4FD4 A;  3SJF A;  4Y49 B;  3KL9 A;  1Z8L A;  2VZY A;  3VWD A;  4NGM A;  2VEZ A;  1F2O A;  3F0A A;  4CAE A;  4RI1 A;  5IB0 A;  1YW6 A;  3GUX A;  1RXT A;  3IO1 A;  1LAP A;  1R57 A;  3ISZ A;  1IGB A;  2CF4 A;  4G1P A;  3G8W A;  1RTQ A;  1ZG8 A;  3D4U A;  4CYO A;  1GHE A;  1Z5R A;  2CNS A;  3CPA A;  5J8F A;  1PUA A;  4KSF A;  4MHP A;  3K2K A;  2FIA A;  4MCS A;  1BLL E;  4A2Z A;  3PFE A;  1I1D A;  3TO6 A;  3KQZ A;  2VBQ A;  5CPA A;  2ZW7 A;  4CRZ B;  1B6B A;  2OZH A;  3RAM A;  2ZEL A;  5LRJ A;  3V38 A;  4ZY1 A;  3FNC A;  5ELY A;  3EXN A;  2V77 A;  1IOF A;  1Y0Y A;  5LYF A;  2GE3 A;  3PEI A;  3KGQ A;  4R3K A;  4ONU A;  3SJG A;  1YVK A;  5LYL A;  1LOK A;  3CDX A;  4KSI A;  4KSA A;  4MFZ A;  2C1C A;  3DDD A;  3GYA A;  2BEI A;  4NCZ A;  4C2X A;  1VHE A;  2NYQ A;  2ZEF A;  5J1Q A;  3NH8 A;  4ZX9 A;  2PJ0 A;  2B3V A;  4B14 A;  4XPD B;  1NE9 A;  2FL4 A;  4KUA A;  1LCP A;  2PR8 A;  4FWU A;  3QNV A;  4UEF A;  1IB1 E;  2PRQ A;  2D4O A;  4P4I A;  4OC3 A;  2IJZ A;  4HPS A;  4MHY A;  2PIZ A;  2AFW A;  4P6Y A;  1OBR A;  2GLF A;  3PRT A;  4B6Z A;  3IU1 A;  3SI2 A;  1IY7 A;  4MXU A;  2FCK A;  4E0A A;  4AVA A;  5AG7 A;  5JQ4 A;  2ZEG A;  4QC6 A;  1V0C A;  1VHO A;  4PXE A;  4E8O A;  2YNE A;  2ZEM A;  1YW4 A;  4EVY A;  1BPN A;  4K3N A;  4B5O A;  1PU9 A;  4LQ6 A;  5F46 A;  3WT4 A;  3T9Y A;  3PFO A;  4NGP A;  2CTC A;  1IIC A;  4MBU A;  4CAX A;  3IJ3 A;  3CZX A;  1Z8T A;  4NGS A;  4CGO A;  2J8R A;  2PJ8 A;  2Q4Z A;  3H8F A;  1YLE A;  2Z3K A;  2VQY A;  1Q2D A;  1IYL A;  4P44 A;  2WSA A;  4P4D A;  4PXD A;  2HB6 A;  4X2T A;  3BLN A;  4BD9 A;  2PRB A;  4MFQ A;  5HVH A;  2AFX A;  4JJX A;  4TWE A;  4B12 A;  2ZW6 A;  1QSR A;  4NJQ A;  4Q7A A;  4X5K A;  1XMT A;  4QB9 A;  4UCN A;  3I1U A;  4MMO A;  3FB3 A;  1HDQ A;  3BJ7 A;  2PDO A;  1S3Z A;  4CYP A;  2PQ8 A;  3VH9 A;  4NJR A;  2Z11 A;  4FD5 A;  3BI1 A;  5D8N A;  2P6F A;  4KOY A;  2ZW4 A;  3FJU A;  3R95 A;  1UFH A;  3IWG A;  2ZOG A;  3K9T A;  3KKW A;  1YRE A;  3KI9 A;  3SXO A;  1ZLH A;  3F5B A;  4A30 A;  3KZW A;  3TO7 A;  3B2Y A;  2WPX A;  4A94 A;  1ZG9 A;  3WC6 A;  1BOB A;  2H5M A;  2BL1 A;  1HDU A;  2YGW A;  4CGL A;  4MFJ A;  1S7L A;  4KVM E;  5HVG A;  3ZJ0 A;  2EUI A;  5K8P A;  3LOD A;  3TE4 A;  2PJ7 A;  4KLW A;  4OID A;  1PCA A;  1PYT B;  4OIW A;  5D29 A;  3DNS A;  4OC4 A;  4PXC A;  4YRH A;  3VWE A;  2OU2 A;  1JQG A;  3B7I A;  1XE4 A;  2PJ5 A;  3KR5 A;  3KR4 A;  2F5I A;  4MHN A;  3RZA A;  2EO8 A;  1XMB A;  1K4J A;  5ISV A;  3D7F A;  2IQ6 A;  4OC1 A;  3D7H A;  4A32 A;  5AGE A;  1YVO A;  2QYV A;  5HMN A;  2B4B A;  2XEG A;  4K30 A;  2O53 A;  1LRZ A;  4ONW A;  4A33 A;  2HUZ A;  4CYQ A;  5F47 A;  6CPA A;  4IF5 A;  2I00 A;  4PQA A;  4U5Y A;  1Y7E A;  4PPZ A;  2PE3 A;  3TO9 A;  4QBJ A;  5IV0 A;  2JDC A;  3I3G A;  1ZLI A;  5EC4 A;  2O4H A;  4M6I A;  4FUU A;  4F0X A;  5C88 A;  3B3S A;  1TKH A;  4H6U A;  1AYE A;  4KOS A;  2NSM A;  3PBE A;  4X3R A;  4C68 A;  3D2M A;  4M3S A;  3L2N A;  3KQX A;  3DR6 A;  3FVL A;  2OH1 A;  2ZEN A;  4MFK A;  4HNW B;  1TXR A;  2FS5 A;  1Z9U A;  1LFW A;  2XEJ A;  4JXR A;  4MHZ A;  3NH5 A;  5F48 A;  4CGP A;  5DWM A;  3C26 A;  3PB4 X;  4OAD A;  4CAV A;  1CX8 A;  2JDD A;  2QJ8 A;  1S7K A;  3NH4 A;  4UF4 A;  5JM6 A;  4GM5 A;  1Q7L A;  3S9M A;  1XOV A;  3TCV A;  4A38 A;  1XJO A;  4A95 A;  2AFU A;  4Y49 C;  4X8I A;  1P0H A;  3IIB A;  4KLV A;  2EBJ A;  3SHP A;  4UIB A;  2RB7 A;  5IB9 A;  2WZN A;  1GYT A;  2NMT A;  2A4N A;  2ODF A;  4KOW A;  4KUB A;  2P0W A;  1QSM A;  3WC5 A;  4KOU A;  3FBU A;  3FED A;  2GIV A;  2ZEE A;  2FIW A;  2POK A;  4R7M A;  4RUH A;  4XPL A;  4KOX A;  3P2H A;  2V8H A;  2YND A;  3D7D A;  4JXQ A;  2DF5 A;  4JYW A;  3FEE A;  3S6F A;  4B11 A;  2DPS A;  4Q38 A;  3SXN A;  4ZY2 A;  1SQH A;  5JPH A;  1VHS A;  2DPT A;  5LRG A;  2C6G A;  1Z2L A;  1TF8 A;  3DLJ A;  2PJ2 A;  1M4L A;  2C27 A;  3D3S A;  1RO5 A;  3JRU A;  1S7N A;  3CXQ A;  4MFL A;  2F7V A;  3IFE A;  5EMI A;  1Y7R A;  4Z65 A;  3LD2 A;  3BJ8 A;  2ZEO A;  2OOT A;  1B87 A;  2OR4 A;  3T90 A;  2AFS A;  3SJX A;  4R3L A;  2OZU A;  3GIU A;  3B3W A;  4OKO A;  2ZPA A;  3WC7 A;  3B3C A;  3FYN A;  1LAN A;  2JBK A;  1XBU A;  5I0C A;  2AFO A;  3JUW A;  4J3G A;  2O28 A;  3GKR A;  4CRY B;  4P4F A;  4XPD C;  5GCN A;  2CNM A;  4B5P A;  2PJA A;  2FVG A;  4L89 A;  2YNC A;  2DXQ A;  2BCO A;  1ELM P;  4EFD A;  4PK3 A;  1IYK A;  2QIR A;  4A39 A;  3E0K A;  3D66 A;  4R6T A;  1F57 A;  5BWA B;  4H2K A;  3GY9 A;  3FMC A;  3D68 A; 
#chains in the Genus database with same CATH homology
 3D2P A;  3WR7 A;  5KTD A;  5DWN A;  2G3T A;  3R9G A;  3DSB A;  3TTH A;  4YGO A;  4AB7 A;  2D4P A;  2GAN A;  4CS0 B;  5G20 A;  2FT0 A;  2R1I A;  4CAW A;  5CNP A;  2P6E A;  2Z10 A;  4OLL A;  2RC4 A;  4HKF A;  2FXF A;  4OAE A;  3IU2 A;  1S5K A;  1NSL A;  3FRM A;  3UY5 A;  1L0C A;  2REF A;  4MI4 A;  2K5T A;  2FE7 A;  2PC1 A;  1MJ9 A;  4KVX A;  2G0B A;  3NE7 A;  5A27 A;  4UA3 A;  2J8M A;  3B8G A;  3G3S A;  5AG4 A;  4NF1 A;  5G21 A;  4MY3 A;  1M4G A;  4XNH C;  4ORF A;  4HNY B;  5E96 A;  4BMH A;  4MFP A;  1QSO A;  1YX0 A;  2B3U A;  2X7B A;  3QAH A;  2Z3O A;  1MJA A;  2FSR A;  3PZJ A;  4C2Y A;  5A28 A;  3W91 A;  4I49 A;  1KUX A;  4H89 A;  4GS4 A;  1NMT A;  3H5Z A;  1Q2Y A;  3JVN A;  4QUS A;  1OZP A;  3QB8 A;  3TOB A;  4E2A A;  3PGP A;  2B5G B;  5KTA A;  4PSX A;  3FIX A;  4XPK A;  3EY5 A;  3V8I A;  4A31 A;  2Q7B A;  4ZGY B;  2Q04 A;  2VZZ A;  3IWE A;  2ARH A;  3CXP A;  4FD7 A;  1TIQ A;  5J8C A;  2EVN A;  2J8N A;  1Q2C A;  3ZZI A;  4UCP A;  2B4D B;  1WWZ A;  3A9L A;  1P4N A;  2CY2 A;  1CJW A;  2R8V A;  2ATR A;  2B5G A;  3DR8 A;  2IL4 A;  2AE6 A;  4PV6 A;  3K9U A;  3F8K A;  4PK2 A;  1WK4 A;  4UFW A;  2Q4Y A;  3IGR A;  2CXA A;  2B4D A;  5H84 A;  4B13 A;  4KZT A;  4IUS A;  4KVO E;  2JLM A;  4B5P B;  3S6H A;  1XIX A;  4R87 A;  1BO4 A;  4YFJ A;  1XF8 A;  4RS2 A;  3S6G A;  2R7H A;  2B58 A;  2G3A A;  4II9 A;  2HV2 A;  1FY7 A;  3N7Z A;  4U9Y A;  4AVB A;  3I9S A;  5KTC A;  1KZF A;  1M1D A;  2ZW5 A;  3R96 A;  3JTK A;  3R1K A;  4H6Z A;  4JD6 A;  5AG6 A;  1QST A;  1N71 A;  2YNC C;  4PSW A;  4HNX B;  2VI7 A;  1YGH A;  4MY0 A;  4C7I A;  1XEB A;  2BSW A;  4DNC A;  3H4Q A;  3TT2 A;  4F0Y A;  1KUY A;  3TFY A;  5HH1 A;  5FVJ A;  2Z3L A;  1I21 A;  5C82 A;  3D8P A;  1YR0 A;  4UFV A;  3R9E A;  2KCW A;  4KS9 A;  4LX9 A;  2Z3P A;  4M85 A;  1Y9K A;  4UCM A;  3TOA A;  2I79 A;  4NEX A;  5G22 A;  4NXY A;  4CGN A;  4L8A A;  4C7H A;  2VXK A;  4KOT A;  4AG9 A;  3FXT A;  4UFX A;  2Q4V A;  2BUE A;  2PSW A;  1VKC A;  1M4D A;  4Q36 A;  1U6M A;  2WPW A;  1Y9W A;  2P6G A;  3RYO A;  1S7F A;  3OWC A;  2PR1 A;  2JEV A;  3W6S A;  2REE A;  5EBV A;  4KOR A;  4F6A A;  1YK3 A;  2ZXV A;  4FD6 A;  3EC4 A;  4JWP A;  1I12 A;  1S60 A;  4LUA A;  4NSQ A;  3EFA A;  5AG5 A;  4ZBG A;  1KUV A;  1Z4E A;  3W6X A;  4UBR A;  3CXS A;  4MJ8 A;  5IX3 A;  2Z0Z A;  4B10 A;  4CAF A;  1J4J A;  1QSN A;  2QML A;  2R98 A;  5F49 A;  1MK4 A;  4R9M A;  3MGD A;  4XNH B;  4QVT A;  1CM0 A;  2OB0 A;  1M44 A;  2Z3N A;  5G1Z A;  2Z3M A;  2Q44 A;  2HQY A;  2AJ6 A;  1IID A;  4AG7 A;  4CYN A;  4UWI A;  3R9F A;  1ZO0 A;  2Y0M A;  1Z4R A;  4BBH A;  4UWJ A;  4KOV A;  5H86 A;  4AVC A;  2QEC A;  3EO4 A;  4CGM A;  4C2Z A;  2OZG A;  2WUU A;  2CNT A;  4MHD A;  4R57 A;  1MJB A;  4JLY A;  3PP9 A;  3S6K A;  2Q0Y A;  4U9Z A;  1M4I A;  1ON0 A;  4FD4 A;  4Y49 B;  2VZY A;  3VWD A;  4CAE A;  2VEZ A;  3F0A A;  4RI1 A;  5IB0 A;  1RXT A;  1R57 A;  3G8W A;  4CYO A;  1GHE A;  2CNS A;  5J8F A;  1PUA A;  4KSF A;  2FIA A;  4A2Z A;  1I1D A;  3TO6 A;  2VBQ A;  4CRZ B;  2ZW7 A;  1B6B A;  2OZH A;  3FNC A;  3EXN A;  2GE3 A;  4R3K A;  4ONU A;  1YVK A;  4KSA A;  4MFZ A;  3DDD A;  3GYA A;  2BEI A;  4NCZ A;  4C2X A;  2B3V A;  4B14 A;  4XPD B;  1NE9 A;  2FL4 A;  4KUA A;  2PR8 A;  1IB1 E;  2D4O A;  3IU1 A;  2FCK A;  4E0A A;  4AVA A;  5AG7 A;  5JQ4 A;  4QC6 A;  1V0C A;  4E8O A;  2YNE A;  4EVY A;  4B5O A;  1PU9 A;  5F46 A;  3T9Y A;  1IIC A;  4MBU A;  4CAX A;  4CGO A;  2J8R A;  1YLE A;  2Z3K A;  2VQY A;  1Q2D A;  1IYL A;  2WSA A;  3BLN A;  2PRB A;  4MFQ A;  4JJX A;  4B12 A;  2ZW6 A;  1QSR A;  4X5K A;  1XMT A;  4QB9 A;  4UCN A;  3FB3 A;  3BJ7 A;  2PDO A;  1S3Z A;  4CYP A;  2PQ8 A;  2Z11 A;  4FD5 A;  2P6F A;  4KOY A;  2ZW4 A;  3R95 A;  1UFH A;  3IWG A;  3KKW A;  3SXO A;  1YRE A;  4A30 A;  3F5B A;  3TO7 A;  2WPX A;  1BOB A;  2H5M A;  2BL1 A;  2YGW A;  4CGL A;  4MFJ A;  1S7L A;  4KVM E;  3ZJ0 A;  2EUI A;  3LOD A;  3TE4 A;  4KLW A;  3DNS A;  4YRH A;  3VWE A;  2OU2 A;  1XE4 A;  2F5I A;  1K4J A;  5ISV A;  4A32 A;  5AGE A;  1YVO A;  5HMN A;  2B4B A;  4K30 A;  1LRZ A;  4A33 A;  2HUZ A;  4CYQ A;  5F47 A;  4IF5 A;  2I00 A;  4U5Y A;  3TO9 A;  4QBJ A;  5IV0 A;  2JDC A;  3I3G A;  5EC4 A;  4F0X A;  5C88 A;  4H6U A;  4KOS A;  4C68 A;  3D2M A;  4M3S A;  3DR6 A;  4MFK A;  2OH1 A;  4HNW B;  4CGP A;  2FS5 A;  1Z9U A;  4JXR A;  5F48 A;  5DWM A;  3C26 A;  4OAD A;  4CAV A;  2JDD A;  1S7K A;  3TCV A;  4A95 A;  4Y49 C;  1P0H A;  4KLV A;  3SHP A;  2NMT A;  2A4N A;  4KOW A;  4KUB A;  2P0W A;  1QSM A;  4KOU A;  3FBU A;  2GIV A;  2FIW A;  4XPL A;  4KOX A;  3P2H A;  2YND A;  4JXQ A;  4B11 A;  3S6F A;  2DPS A;  4Q38 A;  3SXN A;  1SQH A;  5JPH A;  1VHS A;  2DPT A;  3D3S A;  2C27 A;  1RO5 A;  1S7N A;  3CXQ A;  4MFL A;  1Y7R A;  3LD2 A;  3BJ8 A;  1B87 A;  3T90 A;  4R3L A;  2OZU A;  2ZPA A;  3FYN A;  5I0C A;  3JUW A;  4J3G A;  2O28 A;  3GKR A;  4CRY B;  4XPD C;  5GCN A;  2CNM A;  4B5P A;  4L89 A;  2YNC A;  2DXQ A;  4PK3 A;  1IYK A;  2QIR A;  3E0K A;  5BWA B;  3GY9 A;  3P2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...