4AG7A

C. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): coenzyme a adduct
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
MSHIFDASVLAPHIPSNLPDNFKVRPLAKDDFSKGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDDCNFMTQRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-6-PHOSPHATE N-ACETYLTRANSFERASE
publication title Structural and Biochemical Characterization of a Trapped Coenzyme a Adduct of Caenorhabditis Elegans Glucosamine-6-Phosphate N-Acetyltransferase 1.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 43
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ag7A01
5H84A 1M4IA 1S60A 1QSNA 2REEA 4CS0B 2Q44A 1FY7A 4RS2A 1SQHA 3FYNA 4YGOA 1Q2CA 2B3VA 2PQ8A 2PRBA 4HNWB 3LD2A 4E2AA 2EVNA 2DXQA 4IUSA 3W91A 1M1DA 1XF8A 2P0WA 5F49A 5C88A 1S7LA 4KLVA 2OH1A 2BL1A 3F0AA 3N7ZA 1Z4EA 3R9FA 3G3SA 3JUWA 2Q7BA 2BEIA 3DR8A 1S7FA 4AVAA 1YREA 1M44A 2G3TA 3QB8A 3SXOA 4MBUA 4XPDB 1YLEA 5GCNA 1NSLA 1M4DA 4H6UA 4B5PA 5HH1A 3I9SA 4LUAA 4R57A 4PK3A 4OADA 1YK3A 4R9MA 4B5OA 3LODA 2CNMA 4JWPA 4PK2A 3RYOA 5JPHA 3D3SA 3T90A 1BO4A 3GKRA 4KORA 2K5TA 2QMLA 4X5KA 1KUXA 2VZYA 4AG9A 3W6XA 3BJ8A 4XNHC 2NMTA 4HKFA 1MJ9A 1YGHA 1B87A 2KCWA 3TO7A 3VWDA 4CAVA 4QBJA 2FXFA 3OWCA 1S7KA 3FRMA 3TOAA 3G8WA 5E96A 2R8VA 4FD4A 4CRZB 1K4JA 4JXRA 1Q2YA 3TO9A 1S5KA 3DDDA 5H86A 1IYKA 4IF5A 4KUBA 2VBQA 3PZJA 2D4PA 2AE6A 5F46A 3EO4A 3S6FA 2REFA 2H5MA 2VI7A 3TTHA 1OZPA 1YX0A 3TE4A 1P4NA 2Q0YA 2CY2A 1S7NA 3PGPA 1NMTA 4M85A 2FS5A 4KOYA 2ARHA 2R7HA 2VQYA 4UA3A 4JXQA 3KKWA 1U6MA 4FD5A 1BOBA 1CJWA 3FIXA 2WPWA 4MY3A 5IX3A 5HMNA 1WK4A 2Q4VA 1MK4A 4KUAA 5I0CA 4R87A 4XPKA 5IV0A 1KUVA 4OLLA 3TO6A 1XMTA 3VWEA 1Y9KA 3SXNA 5ISVA 3T9YA 4F6AA 2D4OA 2ZPAA 2HUZA 1B6BA 1RO5A 2VEZA 3D2MA 1XEBA 4CAWA 3TT2A 1M4GA 2WPXA 4ONUA 2J8NA 2HV2A 3FB3A 2J8RA 4KOWA 4R3KA 1I1DA 1IIDA 2ZXVA 2I79A 4JJXA 4AVBA 3D2PA 2OB0A 4L89A 3S6KA 1CM0A 2AJ6A 4XNHB 2B5GA 1S3ZA 1Q2DA 3UY5A 3F8KA 4J3GA 2HQYA 1KUYA 2ZW7A 2FIAA 2C27A 5J8CA 4NCZA 2QIRA 3R96A 4K30A 1P0HA 2B4DB 3ZZIA 1QSOA 1VKCA 2OU2A 3CXSA 3EFAA 3CXQA 1YR0A 2CNTA 4MY0A 5DWMA 3S6HA 3PP9A 4ZBGA 1VHSA 3GYAA 2CNSA 2FE7A 2Z0ZA 4XPLA 3DSBA 2FCKA 4HNXB 2GIVA 1PU9A 4ORFA 1MJAA 4KVME 2ATRA 4BMHA 3EC4A 3ZJ0A 2JEVA 2FL4A 4H6ZA 4JLYA 2B58A 4GS4A 5F47A 1YVKA 4AG7A 2Z11A 2JDCA 5FVJA 1RXTA 3H4QA 1QSMA 1YVOA 1J4JA 2JLMA 4PV6A 1Y9WA 4FD7A 4Y49C 3R1KA 2QECA 3E0KA 2OZHA 5KTDA 2PR8A 3P2HA 2ZW4A 4UBRA 4DNCA 1L0CA 3GY9A 4PSXA 4CAXA 5F48A 2PSWA 3S6GA 3DNSA 4QUSA 1MJBA 2PC1A 4R3LA 1N71A 1I12A 1PUAA 3MGDA 4RI1A 4KOTA 2IL4A 2FSRA 2BUEA 2Q4YA 4KZTA 4M3SA 2JDDA 3EY5A 1IICA 4I49A 2O28A 3SHPA 3FXTA 5CNPA 1V0CA 4MHDA 2PDOA 4YRHA 1IYLA 4KVOE 5KTAA 2ZW5A 3TFYA 4QVTA 2J8MA 4NEXA 4KOSA 3K9UA 3IGRA 3FNCA 4EVYA 2OZGA 4OAEA 3TCVA 3BJ7A 2P6FA 2A4NA 2GE3A 1QSTA 3I3GA 3R9EA 1R57A 4KOXA 2B3UA 3P2FA 4KLWA 5C82A 5EC4A 4MJ8A 4UWIA 2VXKA 3FBUA 2B4DA 2GANA 3R95A 2BSWA 3JVNA 3C26A 3DR6A 4KOVA 4UWJA 3D8PA 4QB9A 1Z9UA 2P6EA 4KVXA 5KTCA 4B5PB 3QAHA 4KOUA 1XE4A 2Y0MA 4U5YA 2B5GB 4PSWA 4Y49B 4YFJA 2X7BA 4XPDC 2FT0A 4F0YA 1UFHA 4U9YA 4NXYA 2EUIA 2I00A 5EBVA 4H89A 2PR1A 2ZW6A 2B4BA 3WR7A 4MI4A 2F5IA 1GHEA 1WWZA 4QC6A 2R1IA 2P6GA 3B8GA 1ON0A 2G0BA 3IWGA 1TIQA 5JQ4A 2R98A 2Z10A 3CXPA 4NSQA 1IB1E 1KZFA 2Q04A 4E8OA 1Z4RA 2G3AA 3NE7A 4FD6A 4AVCA 3R9GA 4JD6A 4II9A 4LX9A 3V8IA 4L8AA 4U9ZA 4E0AA 3EXNA 2OZUA 5J8FA 1I21A 5IB0A 1QSRA 4AB7A 3BLNA 2FIWA 1XIXA 5DWNA 3W6SA 4NF1A 4CRYB 1NE9A 3F5BA 2RC4A 3TOBA 1LRZA 1Y7RA 2VZZA 4HNYB
chains in the Genus database with same CATH superfamily
2F8HA 1M4IA 5H84A 3CZXA 5HVHA 2XEJA 4MFZA 2V77A 1S60A 3WABA 2GLJA 3CDXA 4IAVA 3GB0A 1QSNA 2QJ8A 1XBUA 3BHXA 3H8GA 2REEA 4MFKA 3HUVA 4CYQA 4W9YA 3KHZA 4CS0B 1IY7A 3B3WA 3QNVA 2IJZA 2Q44A 1FY7A 3A9LA 4RS2A 1SQHA 4BD9A 3FYNA 4YGOA 1CPXA 1Q2CA 2B3VA 4R7MA 3ISZA 3IWWA 2PQ8A 2PRBA 1LAMA 2NSMA 4HNWB 3LD2A 4MCQA 4E2AA 1YLOA 2EVNA 2O4HA 2DXQA 2VL1A 4IUSA 4MXUA 4OC1A 4OC4A 1LOKA 3W91A 5BWAB 1M1DA 1XF8A 2ZEOA 2P0WA 3IFEA 5F49A 1X12A 5C88A 3H8FA 1S7LA 4KLVA 2OH1A 1RTQA 4KSAA 3KR4A 2BL1A 3F0AA 2AFZA 3N7ZA 2XEGA 4ZX8A 3PB7X 1Z4EA 3R9FA 3RNZA 3G3SA 3PB9X 3JUWA 1TKHA 2Q7BA 2BEIA 3DR8A 5G22A 3FJUA 2ZEPA 3BI1A 1S7FA 4YU9A 3B3CA 4AVAA 5LYIA 1YREA 5A27A 1IU8A 5G1ZA 1M44A 1Y0RA 2G3TA 2GREA 3QB8A 3SXOA 4GXHA 4LQ6A 4MBUA 4XPDB 4A95A 1YLEA 1TF8A 5GCNA 1NSLA 1M4DA 4H6UA 3WC7A 1X10A 2O53A 3LMSA 5HH1A 3SJEA 4B5PA 3I9SA 4LUAA 4R57A 3CPXA 4PK3A 3KASA 5LYLA 3MN8A 5LYDA 4OADA 4F9VA 4C68A 2PJ4A 4RN7A 1YK3A 4R9MA 3FH4A 4HPSA 4B5OA 3LODA 2CNMA 4X2TA 5LRGA 1R3NA 4JWPA 3SJFA 4C2YA 2EK9A 4MCSA 4PQAA 4PXBA 4PK2A 1DTDA 3RYOA 1XRYA 3D3SA 3KI9A 1BO4A 3GKRA 3IU2A 4KORA 1XMBA 4UFVA 3T90A 2K5TA 2QMLA 2V8VA 4IHMA 4X5KA 3S9NA 2Z3OA 1KUXA 2VZYA 4AG9A 3SI1A 3W6XA 4CGOA 3BJ8A 2DF5A 1YMEA 2CIJA 4XNHC 3N5FA 1AMPA 4NGMA 5DS0A 5ELYA 3V38A 2NMTA 4UEFA 4WJBA 4HKFA 4UF4A 3FMCA 1H8LA 3D67A 1MJ9A 1YGHA 1B87A 2CTCA 2KCWA 3NH8A 2Q51A 4NJQA 3TO7A 3VWDA 4BINA 4MHPA 4CAVA 4QBJA 1EE3P 2BCOA 2ZEGA 4EMEA 2FXFA 3OWCA 1S7KA 1A2ZA 2BOAA 2PE3A 2DPTA 3FRMA 4CPAA 2V8DA 3TOAA 3G8WA 2J9AA 2PJ7A 5E96A 4A32A 4A37A 2R8VA 3B3TA 2Q4ZA 4P10A 4CAEA 4PXCA 4FD4A 3WC5A 4MFJA 2V8GA 4CRZB 1K4JA 4JXRA 2PJ3A 1XFOA 5THWA 1Q2YA 3TO9A 1S5KA 2PIZA 3DDDA 4LQGA 1IYKA 4OKOA 4IF5A 5H86A 4CGLA 1ZG9A 2I3CA 1ARMA 4KUBA 4OIDA 2WZNA 2VBQA 2QYVA 3PZJA 2D4PA 2Z3MA 4WWVA 2CF4A 3KGQA 2G9DA 4ZY0A 2AE6A 2Z3KA 3BI0A 5F46A 4NJRA 3EO4A 3S6FA 2REFA 4ONWA 3D7FA 1LCPA 4ZY1A 2H5MA 2VI7A 3TTHA 4M6GA 1OZPA 2NYQA 1YX0A 2F7VA 3WT4A 3TE4A 1P4NA 4C2XA 2Q0YA 3PB8X 2CY2A 1VGYA 1S7NA 3PGPA 5JH9A 1NMTA 4M85A 2FS5A 4KOYA 2ARHA 2R7HA 2VQYA 1PYTB 4UA3A 5LRJA 4EFDA 1LANA 4MFPA 4JXQA 5K8NA 3VATA 3KKWA 1U6MA 1LFWA 4UCMA 4DYOA 4FD5A 1BOBA 2WYRA 4NGPA 1CJWA 4OC2A 3FIXA 4MMOA 3D68A 2WPWA 4MY3A 5IX3A 2PJAA 4MCPA 4Q38A 5HMNA 1AUGA 4CYPA 4G1PA 3IO1A 1WK4A 2OOTA 2Q4VA 4PXDA 2JBJA 1MK4A 3KR5A 1PCAA 3D7GA 4H2KA 4KUAA 4R87A 4XPKA 4ZYQA 5I0CA 1KUVA 5IV0A 2AFMA 1QQ9A 4OLLA 3V7ZA 3TO6A 1XMTA 3FEDA 3VWEA 1Y9KA 3SXNA 4EWTA 1IOIA 3H8EA 5ISVA 3T9YA 4F6AA 2D4OA 2ZPAA 1XOVA 4Q7AA 5D8NA 2HUZA 1B6BA 1RO5A 1CP7A 2VEZA 1XEBA 3D2MA 1CP6A 2GU2A 4CAWA 5LYFA 1YW6A 1CBXA 3TT2A 1M4GA 3SI0A 2WPXA 4B13A 4ONUA 5AG4A 1VIXA 4O23A 2J8NA 2PJ2A 5G20A 2HV2A 4ZI6A 4F0XA 3FB3A 2J8RA 2YNDA 3KQXA 2JBKA 4KOWA 1HEEA 4R3KA 4DUKA 1I1DA 1NSAA 4MHZA 1IIDA 2ZXVA 5HVGA 2I79A 4JJXA 4KS9A 4AVBA 3D2PA 2OB0A 1Z8LA 2PJ0A 4L89A 4NFRA 4FBEA 5AG5A 1Y0YA 1CM0A 4ZY2A 3S6KA 4PXEA 4ZX9A 2HC9A 1ARLA 4YWYA 4UEZA 2EWBA 4B14A 1VHEA 3KHXA 2AJ6A 2DPSA 2PJ5A 4UEEA 4XNHB 2B5GA 2PVVA 1F57A 1S3ZA 1Q2DA 3UY5A 3F8KA 1CX8A 4CYNA 1TKJA 4J3GA 2HQYA 1KUYA 1BLLE 2ZW7A 2PJBA 2FIAA 2XEFA 4OMEA 2CTBA 2ZEHA 2C27A 2AFXA 4NCZA 5J8CA 1JWQA 2QIRA 3R96A 1ZO0A 4K30A 1Q7LA 1P0HA 2B4DB 4P4JA 5D29A 3ZZIA 3LWUA 4OIWA 1QSOA 1VKCA 2OU2A 1HDUA 2C6PA 4DJLA 2FVGA 1Z2LA 3CXSA 3NFZA 1BPNA 4NGQA 3D66A 3EFAA 3K2KA 4OP4A 1YR0A 2V8HA 3CXQA 4P4EA 3S9LA 3B2YA 3FF3A 3KL9A 3T8WA 2CNTA 4MY0A 5DWMA 3S6HA 3PP9A 2ZOFA 4ZBGA 1VHSA 4M6HA 1XJOA 3MRUA 3GYAA 2BO9A 5K8MA 4A31A 4NGTA 4FAIA 2PJ8A 2PRQA 5JM6A 2CNSA 2FE7A 2Z0ZA 3PEIA 1UWYA 3L2NA 4XPLA 3DSBA 1YW4A 2FCKA 4TNUA 4OC5A 4HNXB 2GIVA 1PU9A 4ORFA 1MJAA 4KVME 3VH9A 5AGEA 2ATRA 1CG2A 4BMHA 3VARA 3JRUA 3EC4A 1AYEA 4BBHA 2ANPA 3JTKA 4JZ0A 2JEVA 2FL4A 4H6ZA 4P4BA 4JLYA 3ZJ0A 2B58A 1ZLHA 4GS4A 4PPZA 1YVKA 5F47A 2Z11A 2JDCA 2QVPA 4AG7A 3D7DA 5FVJA 1RXTA 3H4QA 1QSMA 3SI2A 2IQ6A 1YVOA 1J4JA 2JLMA 4PV6A 4UFWA 1Y9WA 2YNCA 4FD7A 1R43A 4UCPA 4NGSA 4TWEA 1DE4C 3FVLA 4Y49C 1FT7A 2C6GA 4A39A 2GLFA 3R1KA 2QECA 3E0KA 4NGRA 4A94A 1YSJA 3PBBA 1HDQA 5HXDA 1ELLP 2OZHA 2XEIA 3PFOA 5KTDA 3CT9A 4P4IA 2PR8A 3IIBA 4MHNA 2RB7A 3P2HA 2HB6A 2ZW4A 4A38A 4R8FA 2YNEA 1F2PA 4UBRA 1GYTA 3IEHA 3PB4X 2ZEDA 2DEAA 4DNCA 1L0CA 3GY9A 4PSXA 5G21A 2C1CA 2Z3NA 2ABZA 5JPHA 4CAXA 3PFEA 5F48A 3GIUA 4C7IA 4CGNA 4F8ZA 2PSWA 3FEEA 3DNSA 3S6GA 4QUSA 2ZENA 2IMOA 5K8PA 4CAFA 3KZWA 1MJBA 2JEWA 2PC1A 4R3LA 1N71A 1I12A 1PUAA 3PRTA 4CGMA 2PIYA 3ISXA 2POKA 3GUXA 1TKFA 3MGDA 4RI1A 4UIAA 5JGFA 4KOTA 2IL4A 4AXVA 2FSRA 3K9TA 3PBEA 2BUEA 2EK8A 1OBRA 4R76A 4ZGYB 1ZG7A 5AG6A 4RUHA 2Q4YA 4C2ZA 4KZTA 4M3SA 2JDDA 3EY5A 1IICA 4I49A 2O28A 2YNCC 3SHPA 4MHYA 3HLPA 3FXTA 5CNPA 4B12A 1V0CA 4MHDA 2PDOA 4YRHA 1IYLA 4CGPA 4KVOE 5KTAA 2ZW5A 8CPAA 3TFYA 4QVTA 4B6ZA 3FX6A 2J8MA 2PJ9A 4NEXA 4KOSA 3K9UA 4IK2A 3IGRA 1KWMA 7CPAA 2AFOA 3FNCA 3NE8A 4EVYA 2PCUA 2OZGA 3B35A 2WUUA 4X8IA 2EBJA 4OAEA 3TCVA 2AFWA 1CPSA 1JQGA 2Z3PA 2ZELA 3LACA 3B3VA 2P6FA 1TXRA 1YQEA 3BJ7A 2A4NA 2GE3A 1QSTA 3I1UA 3I3GA 4P44A 3R9EA 1R57A 4K3NA 4KOXA 2B3UA 3IJ3A 4KSFA 3P2FA 4KLWA 1ELMP 5C82A 2AFSA 3DLJA 2AFUA 5EC4A 3NA6A 4MJ8A 4UWIA 2Q43A 4A30A 2VXKA 2PJ1A 3FBUA 2B4DA 3NH4A 3SJGA 1F2OA 4KSIA 3RBUA 2GANA 3R95A 2BSWA 3JVNA 3C26A 3DR6A 4KOVA 3TX8A 4GM5A 4UWJA 3D8PA 5IB9A 4A2ZA 4QB9A 1VHOA 3CPAA 2ZEFA 1Z9UA 2P6EA 4A33A 4KVXA 5KTCA 4FWUA 5CPAA 4B5PB 1BAVA 2EO8A 4MRIA 5A28A 3QAHA 4KOUA 4P4DA 1BPMA 1XE4A 2Y0MA 5AG7A 4U5YA 3NH5A 3WC6A 2B5GB 4JYWA 4PSWA 5EMIA 5J1QA 4Y49B 4YFJA 3QAYA 1Z5RA 2X7BA 4XPDC 2FT0A 4F0YA 1UFHA 4U9YA 1Z8TA 4NXYA 2EUIA 2I00A 2ZOGA 5EBVA 4H89A 2PR1A 2ZW6A 2B4BA 2RFHA 2WSAA 3IWEA 5HVFA 4F9UA 3PB6X 4Q36A 1Z8XA 3D7HA 3WR7A 4UFXA 4OC0A 4MI4A 2Z3LA 2F5IA 1GHEA 1WWZA 5F09A 4QC6A 2R1IA 2PJCA 1FNOA 2CXAA 2P6GA 3IU1A 1QMUA 3B8GA 1IOFA 1ON0A 2G0BA 2ZEMA 5CBMA 3IWGA 3RO0A 3DGVA 4P4FA 4B10A 4MFLA 3IC1A 1TIQA 1ZLIA 5JQ4A 2R98A 2Z10A 3CXPA 4NSQA 4NGNA 2Q7SA 3H5ZA 4OC3A 3D4UA 4UIBA 2ODFA 1IB1E 1KZFA 2GFQA 2Q04A 4E8OA 1Z4RA 3TC8A 2G3AA 3NE7A 5I4MA 4FD6A 2OR4A 5LRKA 4AVCA 1TF9A 3B7IA 4JD6A 3R9GA 4II9A 4LX9A 4P45A 3V8IA 1LAPA 4L8AA 2C6CA 4U9ZA 2YGWA 4E0AA 3EXNA 3RZAA 4UCNA 4MFQA 4P6YA 4M6IA 4C7HA 2OZUA 2ZEEA 5J8FA 1I21A 3BXMA 3B3SA 4R6TA 5IB0A 3KQZA 3S9MA 4MCRA 1QSRA 2PVWA 6CPAA 4AB7A 4Z65A 3BLNA 1Z8WA 1XIXA 2FIWA 3GLJA 3RAMA 5DWNA 3SJXA 3W6SA 1M4LA 4CYOA 4NF1A 4X3RA 4CRYB 1Y7EA 1NE9A 3F5BA 1IGBA 2RC4A 3TOBA 1ZG8A 1LRZA 1Y7RA 2VZZA 4HNYB 4FUUA 3FECA 2PJ6A 5K8OA 4B11A
chains in the Genus database with same CATH topology
5H84A 1M4IA 4MFZA 1S60A 4MFKA 4C2ZA 1QSNA 4CYQA 2REEA 4CS0B 2Q44A 1FY7A 3A9LA 4RS2A 1SQHA 3FYNA 4YGOA 1Q2CA 2B3VA 2PQ8A 2PRBA 4HNWB 3LD2A 4E2AA 2EVNA 2DXQA 5BWAB 4IUSA 3W91A 1M1DA 1XF8A 2P0WA 5F49A 5C88A 1S7LA 4KLVA 2OH1A 4KSAA 2BL1A 3F0AA 3N7ZA 1Z4EA 3R9FA 3G3SA 3JUWA 2Q7BA 2BEIA 3DR8A 5G22A 1S7FA 4AVAA 1YREA 5A27A 5G1ZA 1M44A 2G3TA 3QB8A 3SXOA 4MBUA 4XPDB 1YLEA 5GCNA 1NSLA 1M4DA 4H6UA 4B5PA 5HH1A 3I9SA 4LUAA 4R57A 4PK3A 4OADA 4C68A 1YK3A 4R9MA 4B5OA 3LODA 2CNMA 4JWPA 4C2YA 4PK2A 3RYOA 5JPHA 3D3SA 3T90A 4UFVA 1BO4A 3GKRA 3IU2A 4KORA 2K5TA 2QMLA 4X5KA 2Z3OA 1KUXA 2VZYA 4AG9A 3W6XA 4CGOA 3BJ8A 4XNHC 2NMTA 4HKFA 1MJ9A 1YGHA 1B87A 2KCWA 3TO7A 3VWDA 4CAVA 4QBJA 2FXFA 3OWCA 1S7KA 3FRMA 2DPTA 3TOAA 3G8WA 5E96A 4A32A 2R8VA 4CAEA 4FD4A 4MFJA 4CRZB 1K4JA 4JXRA 1Q2YA 3TO9A 1S5KA 3DDDA 5H86A 1IYKA 4CGLA 4IF5A 4KUBA 2VBQA 3PZJA 2D4PA 2Z3MA 2AE6A 2Z3KA 5F46A 3EO4A 3S6FA 2REFA 2H5MA 2VI7A 3TTHA 1OZPA 1YX0A 3TE4A 1P4NA 4C2XA 2Q0YA 2CY2A 1S7NA 3PGPA 1NMTA 4M85A 2FS5A 4KOYA 2ARHA 2R7HA 2VQYA 4UA3A 4MFPA 4JXQA 3KKWA 1U6MA 4UCMA 4FD5A 1BOBA 1CJWA 3FIXA 2WPWA 4MY3A 5IX3A 5HMNA 4Q38A 4CYPA 1WK4A 2Q4VA 1MK4A 4KUAA 5I0CA 4R87A 4XPKA 5IV0A 1KUVA 4OLLA 3TO6A 1XMTA 3VWEA 1Y9KA 3SXNA 5ISVA 3T9YA 4F6AA 2D4OA 2ZPAA 2HUZA 1B6BA 1RO5A 2VEZA 3D2MA 1XEBA 4CAWA 3TT2A 1M4GA 4B13A 2WPXA 5AG4A 4ONUA 2J8NA 5G20A 2HV2A 4F0XA 3FB3A 2J8RA 2YNDA 4KOWA 4R3KA 1I1DA 1IIDA 2ZXVA 2I79A 4JJXA 4KS9A 4AVBA 3D2PA 2OB0A 4L89A 5AG5A 3S6KA 1CM0A 4B14A 2AJ6A 2DPSA 4XNHB 2B5GA 1S3ZA 1Q2DA 3UY5A 3F8KA 4CYNA 4J3GA 2HQYA 1KUYA 2ZW7A 2FIAA 2C27A 5J8CA 4NCZA 2QIRA 3R96A 1ZO0A 4K30A 1P0HA 2B4DB 3ZZIA 1QSOA 1VKCA 2OU2A 3CXSA 3EFAA 3CXQA 1YR0A 2CNTA 4MY0A 5DWMA 3S6HA 3PP9A 4ZBGA 1VHSA 3GYAA 4A31A 2CNSA 2FE7A 2Z0ZA 4XPLA 3DSBA 2FCKA 4HNXB 2GIVA 1PU9A 4ORFA 1MJAA 4KVME 5AGEA 2ATRA 4BMHA 3EC4A 4BBHA 3JTKA 3ZJ0A 2JEVA 2FL4A 4H6ZA 4A95A 4JLYA 2B58A 4GS4A 5F47A 1YVKA 4AG7A 2Z11A 2JDCA 5FVJA 1RXTA 3H4QA 1QSMA 1YVOA 1J4JA 2JLMA 4PV6A 4UFWA 1Y9WA 2YNCA 4FD7A 4UCPA 4Y49C 3R1KA 2QECA 3E0KA 2OZHA 5KTDA 2PR8A 3P2HA 2ZW4A 2YNEA 4UBRA 4DNCA 1L0CA 3GY9A 4PSXA 5G21A 2Z3NA 4CAXA 5F48A 4C7IA 4CGNA 2PSWA 3S6GA 3DNSA 4QUSA 4CAFA 1MJBA 2PC1A 4R3LA 1N71A 1I12A 1PUAA 4CGMA 3MGDA 4RI1A 4KOTA 2IL4A 2FSRA 2BUEA 4ZGYB 5AG6A 2Q4YA 4KZTA 4M3SA 2JDDA 3EY5A 1IICA 4I49A 2O28A 2YNCC 3SHPA 3FXTA 5CNPA 4B12A 1V0CA 4MHDA 2PDOA 4YRHA 1IYLA 4CGPA 4KVOE 5KTAA 2ZW5A 3TFYA 4QVTA 2J8MA 4NEXA 4KOSA 3K9UA 3IGRA 3FNCA 4EVYA 2OZGA 2WUUA 4OAEA 3TCVA 2Z3PA 3BJ7A 2P6FA 2A4NA 2GE3A 1QSTA 3I3GA 3R9EA 1R57A 4KOXA 2B3UA 4KSFA 3P2FA 4KLWA 5C82A 5EC4A 4MJ8A 4UWIA 4A30A 2VXKA 3FBUA 2B4DA 2GANA 3R95A 2BSWA 3JVNA 3C26A 3DR6A 4KOVA 4UWJA 3D8PA 4A2ZA 4QB9A 1Z9UA 2P6EA 4A33A 4KVXA 5KTCA 5A28A 4B5PB 3QAHA 4KOUA 1XE4A 2Y0MA 5AG7A 4U5YA 2B5GB 4PSWA 4Y49B 4YFJA 2X7BA 4XPDC 2FT0A 4F0YA 1UFHA 4U9YA 4NXYA 2EUIA 2I00A 5EBVA 4H89A 2PR1A 2ZW6A 2B4BA 2WSAA 3IWEA 4Q36A 3WR7A 4UFXA 4MI4A 2Z3LA 2F5IA 1GHEA 1WWZA 4QC6A 2R1IA 2CXAA 2P6GA 3IU1A 3B8GA 1ON0A 2G0BA 3IWGA 4B10A 4MFLA 1TIQA 5JQ4A 2R98A 2Z10A 3CXPA 4NSQA 3H5ZA 1IB1E 1KZFA 2Q04A 4E8OA 1Z4RA 2G3AA 3NE7A 4FD6A 4AVCA 3R9GA 4JD6A 4II9A 4LX9A 3V8IA 4L8AA 4U9ZA 2YGWA 4E0AA 3EXNA 4UCNA 4MFQA 4C7HA 2OZUA 5J8FA 1I21A 5IB0A 1QSRA 4AB7A 3BLNA 2FIWA 1XIXA 5DWNA 3W6SA 4CYOA 4NF1A 4CRYB 1NE9A 3F5BA 2RC4A 3TOBA 1LRZA 1Y7RA 2VZZA 4HNYB 4B11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H84 A;  1M4I A;  1S60 A;  1QSN A;  2REE A;  4CS0 B;  2Q44 A;  1FY7 A;  4RS2 A;  1SQH A;  3FYN A;  4YGO A;  1Q2C A;  2B3V A;  2PQ8 A;  2PRB A;  4HNW B;  3LD2 A;  4E2A A;  2EVN A;  2DXQ A;  4IUS A;  3W91 A;  1M1D A;  1XF8 A;  2P0W A;  5F49 A;  5C88 A;  1S7L A;  4KLV A;  2OH1 A;  2BL1 A;  3F0A A;  3N7Z A;  1Z4E A;  3R9F A;  3G3S A;  3JUW A;  2Q7B A;  2BEI A;  3DR8 A;  1S7F A;  4AVA A;  1YRE A;  1M44 A;  2G3T A;  3QB8 A;  3SXO A;  4MBU A;  4XPD B;  1YLE A;  5GCN A;  1NSL A;  1M4D A;  4H6U A;  4B5P A;  5HH1 A;  3I9S A;  4LUA A;  4R57 A;  4PK3 A;  4OAD A;  1YK3 A;  4R9M A;  4B5O A;  3LOD A;  2CNM A;  4JWP A;  4PK2 A;  3RYO A;  5JPH A;  3D3S A;  3T90 A;  1BO4 A;  3GKR A;  4KOR A;  2K5T A;  2QML A;  4X5K A;  1KUX A;  2VZY A;  4AG9 A;  3W6X A;  3BJ8 A;  4XNH C;  2NMT A;  4HKF A;  1MJ9 A;  1YGH A;  1B87 A;  2KCW A;  3TO7 A;  3VWD A;  4CAV A;  4QBJ A;  2FXF A;  3OWC A;  1S7K A;  3FRM A;  3TOA A;  3G8W A;  5E96 A;  2R8V A;  4FD4 A;  4CRZ B;  1K4J A;  4JXR A;  1Q2Y A;  3TO9 A;  1S5K A;  3DDD A;  5H86 A;  1IYK A;  4IF5 A;  4KUB A;  2VBQ A;  3PZJ A;  2D4P A;  2AE6 A;  5F46 A;  3EO4 A;  3S6F A;  2REF A;  2H5M A;  2VI7 A;  3TTH A;  1OZP A;  1YX0 A;  3TE4 A;  1P4N A;  2Q0Y A;  2CY2 A;  1S7N A;  3PGP A;  1NMT A;  4M85 A;  2FS5 A;  4KOY A;  2ARH A;  2R7H A;  2VQY A;  4UA3 A;  4JXQ A;  3KKW A;  1U6M A;  4FD5 A;  1BOB A;  1CJW A;  3FIX A;  2WPW A;  4MY3 A;  5IX3 A;  5HMN A;  1WK4 A;  2Q4V A;  1MK4 A;  4KUA A;  5I0C A;  4R87 A;  4XPK A;  5IV0 A;  1KUV A;  4OLL A;  3TO6 A;  1XMT A;  3VWE A;  1Y9K A;  3SXN A;  5ISV A;  3T9Y A;  4F6A A;  2D4O A;  2ZPA A;  2HUZ A;  1B6B A;  1RO5 A;  2VEZ A;  3D2M A;  1XEB A;  4CAW A;  3TT2 A;  1M4G A;  2WPX A;  4ONU A;  2J8N A;  2HV2 A;  3FB3 A;  2J8R A;  4KOW A;  4R3K A;  1I1D A;  1IID A;  2ZXV A;  2I79 A;  4JJX A;  4AVB A;  3D2P A;  2OB0 A;  4L89 A;  3S6K A;  1CM0 A;  2AJ6 A;  4XNH B;  2B5G A;  1S3Z A;  1Q2D A;  3UY5 A;  3F8K A;  4J3G A;  2HQY A;  1KUY A;  2ZW7 A;  2FIA A;  2C27 A;  5J8C A;  4NCZ A;  2QIR A;  3R96 A;  4K30 A;  1P0H A;  2B4D B;  3ZZI A;  1QSO A;  1VKC A;  2OU2 A;  3CXS A;  3EFA A;  3CXQ A;  1YR0 A;  2CNT A;  4MY0 A;  5DWM A;  3S6H A;  3PP9 A;  4ZBG A;  1VHS A;  3GYA A;  2CNS A;  2FE7 A;  2Z0Z A;  4XPL A;  3DSB A;  2FCK A;  4HNX B;  2GIV A;  1PU9 A;  4ORF A;  1MJA A;  4KVM E;  2ATR A;  4BMH A;  3EC4 A;  3ZJ0 A;  2JEV A;  2FL4 A;  4H6Z A;  4JLY A;  2B58 A;  4GS4 A;  5F47 A;  1YVK A;  4AG7 A;  2Z11 A;  2JDC A;  5FVJ A;  1RXT A;  3H4Q A;  1QSM A;  1YVO A;  1J4J A;  2JLM A;  4PV6 A;  1Y9W A;  4FD7 A;  4Y49 C;  3R1K A;  2QEC A;  3E0K A;  2OZH A;  5KTD A;  2PR8 A;  3P2H A;  2ZW4 A;  4UBR A;  4DNC A;  1L0C A;  3GY9 A;  4PSX A;  4CAX A;  5F48 A;  2PSW A;  3S6G A;  3DNS A;  4QUS A;  1MJB A;  2PC1 A;  4R3L A;  1N71 A;  1I12 A;  1PUA A;  3MGD A;  4RI1 A;  4KOT A;  2IL4 A;  2FSR A;  2BUE A;  2Q4Y A;  4KZT A;  4M3S A;  2JDD A;  3EY5 A;  1IIC A;  4I49 A;  2O28 A;  3SHP A;  3FXT A;  5CNP A;  1V0C A;  4MHD A;  2PDO A;  4YRH A;  1IYL A;  4KVO E;  5KTA A;  2ZW5 A;  3TFY A;  4QVT A;  2J8M A;  4NEX A;  4KOS A;  3K9U A;  3IGR A;  3FNC A;  4EVY A;  2OZG A;  4OAE A;  3TCV A;  3BJ7 A;  2P6F A;  2A4N A;  2GE3 A;  1QST A;  3I3G A;  3R9E A;  1R57 A;  4KOX A;  2B3U A;  3P2F A;  4KLW A;  5C82 A;  5EC4 A;  4MJ8 A;  4UWI A;  2VXK A;  3FBU A;  2B4D A;  2GAN A;  3R95 A;  2BSW A;  3JVN A;  3C26 A;  3DR6 A;  4KOV A;  4UWJ A;  3D8P A;  4QB9 A;  1Z9U A;  2P6E A;  4KVX A;  5KTC A;  4B5P B;  3QAH A;  4KOU A;  1XE4 A;  2Y0M A;  4U5Y A;  2B5G B;  4PSW A;  4Y49 B;  4YFJ A;  2X7B A;  4XPD C;  2FT0 A;  4F0Y A;  1UFH A;  4U9Y A;  4NXY A;  2EUI A;  2I00 A;  5EBV A;  4H89 A;  2PR1 A;  2ZW6 A;  2B4B A;  3WR7 A;  4MI4 A;  2F5I A;  1GHE A;  1WWZ A;  4QC6 A;  2R1I A;  2P6G A;  3B8G A;  1ON0 A;  2G0B A;  3IWG A;  1TIQ A;  5JQ4 A;  2R98 A;  2Z10 A;  3CXP A;  4NSQ A;  1IB1 E;  1KZF A;  2Q04 A;  4E8O A;  1Z4R A;  2G3A A;  3NE7 A;  4FD6 A;  4AVC A;  3R9G A;  4JD6 A;  4II9 A;  4LX9 A;  3V8I A;  4L8A A;  4U9Z A;  4E0A A;  3EXN A;  2OZU A;  5J8F A;  1I21 A;  5IB0 A;  1QSR A;  4AB7 A;  3BLN A;  2FIW A;  1XIX A;  5DWN A;  3W6S A;  4NF1 A;  4CRY B;  1NE9 A;  3F5B A;  2RC4 A;  3TOB A;  1LRZ A;  1Y7R A;  2VZZ A;  4HNY B; 
#chains in the Genus database with same CATH topology
 2F8H A;  1M4I A;  5H84 A;  3CZX A;  5HVH A;  2XEJ A;  4MFZ A;  2V77 A;  1S60 A;  3WAB A;  2GLJ A;  3CDX A;  4IAV A;  3GB0 A;  1QSN A;  2QJ8 A;  1XBU A;  3BHX A;  3H8G A;  2REE A;  4MFK A;  3HUV A;  4CYQ A;  4W9Y A;  3KHZ A;  4CS0 B;  1IY7 A;  3B3W A;  3QNV A;  2IJZ A;  2Q44 A;  1FY7 A;  3A9L A;  4RS2 A;  1SQH A;  4BD9 A;  3FYN A;  4YGO A;  1CPX A;  1Q2C A;  2B3V A;  4R7M A;  3ISZ A;  3IWW A;  2PQ8 A;  2PRB A;  1LAM A;  2NSM A;  4HNW B;  3LD2 A;  4MCQ A;  4E2A A;  1YLO A;  2EVN A;  2O4H A;  2DXQ A;  2VL1 A;  4IUS A;  4MXU A;  4OC1 A;  4OC4 A;  1LOK A;  3W91 A;  5BWA B;  1M1D A;  1XF8 A;  2ZEO A;  2P0W A;  3IFE A;  5F49 A;  1X12 A;  5C88 A;  3H8F A;  1S7L A;  4KLV A;  2OH1 A;  1RTQ A;  4KSA A;  3KR4 A;  2BL1 A;  3F0A A;  2AFZ A;  3N7Z A;  2XEG A;  4ZX8 A;  3PB7 X;  1Z4E A;  3R9F A;  3RNZ A;  3G3S A;  3PB9 X;  3JUW A;  1TKH A;  2Q7B A;  2BEI A;  3DR8 A;  5G22 A;  3FJU A;  2ZEP A;  3BI1 A;  1S7F A;  4YU9 A;  3B3C A;  4AVA A;  5LYI A;  1YRE A;  5A27 A;  1IU8 A;  5G1Z A;  1M44 A;  1Y0R A;  2G3T A;  2GRE A;  3QB8 A;  3SXO A;  4GXH A;  4LQ6 A;  4MBU A;  4XPD B;  4A95 A;  1YLE A;  1TF8 A;  5GCN A;  1NSL A;  1M4D A;  4H6U A;  3WC7 A;  1X10 A;  2O53 A;  3LMS A;  5HH1 A;  3SJE A;  4B5P A;  3I9S A;  4LUA A;  4R57 A;  3CPX A;  4PK3 A;  3KAS A;  5LYL A;  3MN8 A;  5LYD A;  4OAD A;  4F9V A;  4C68 A;  2PJ4 A;  4RN7 A;  1YK3 A;  4R9M A;  3FH4 A;  4HPS A;  4B5O A;  3LOD A;  2CNM A;  4X2T A;  5LRG A;  1R3N A;  4JWP A;  3SJF A;  4C2Y A;  2EK9 A;  4MCS A;  4PQA A;  4PXB A;  4PK2 A;  1DTD A;  3RYO A;  1XRY A;  3D3S A;  3KI9 A;  1BO4 A;  3GKR A;  3IU2 A;  4KOR A;  1XMB A;  4UFV A;  3T90 A;  2K5T A;  2QML A;  2V8V A;  4IHM A;  4X5K A;  3S9N A;  2Z3O A;  1KUX A;  2VZY A;  4AG9 A;  3SI1 A;  3W6X A;  4CGO A;  3BJ8 A;  2DF5 A;  1YME A;  2CIJ A;  4XNH C;  3N5F A;  1AMP A;  4NGM A;  5DS0 A;  5ELY A;  3V38 A;  2NMT A;  4UEF A;  4WJB A;  4HKF A;  4UF4 A;  3FMC A;  1H8L A;  3D67 A;  1MJ9 A;  1YGH A;  1B87 A;  2CTC A;  2KCW A;  3NH8 A;  2Q51 A;  4NJQ A;  3TO7 A;  3VWD A;  4BIN A;  4MHP A;  4CAV A;  4QBJ A;  1EE3 P;  2BCO A;  2ZEG A;  4EME A;  2FXF A;  3OWC A;  1S7K A;  1A2Z A;  2BOA A;  2PE3 A;  2DPT A;  3FRM A;  4CPA A;  2V8D A;  3TOA A;  3G8W A;  2J9A A;  2PJ7 A;  5E96 A;  4A32 A;  4A37 A;  2R8V A;  3B3T A;  2Q4Z A;  4P10 A;  4CAE A;  4PXC A;  4FD4 A;  3WC5 A;  4MFJ A;  2V8G A;  4CRZ B;  1K4J A;  4JXR A;  2PJ3 A;  1XFO A;  5THW A;  1Q2Y A;  3TO9 A;  1S5K A;  2PIZ A;  3DDD A;  4LQG A;  1IYK A;  4OKO A;  4IF5 A;  5H86 A;  4CGL A;  1ZG9 A;  2I3C A;  1ARM A;  4KUB A;  4OID A;  2WZN A;  2VBQ A;  2QYV A;  3PZJ A;  2D4P A;  2Z3M A;  4WWV A;  2CF4 A;  3KGQ A;  2G9D A;  4ZY0 A;  2AE6 A;  2Z3K A;  3BI0 A;  5F46 A;  4NJR A;  3EO4 A;  3S6F A;  2REF A;  4ONW A;  3D7F A;  1LCP A;  4ZY1 A;  2H5M A;  2VI7 A;  3TTH A;  4M6G A;  1OZP A;  2NYQ A;  1YX0 A;  2F7V A;  3WT4 A;  3TE4 A;  1P4N A;  4C2X A;  2Q0Y A;  3PB8 X;  2CY2 A;  1VGY A;  1S7N A;  3PGP A;  5JH9 A;  1NMT A;  4M85 A;  2FS5 A;  4KOY A;  2ARH A;  2R7H A;  2VQY A;  1PYT B;  4UA3 A;  5LRJ A;  4EFD A;  1LAN A;  4MFP A;  4JXQ A;  5K8N A;  3VAT A;  3KKW A;  1U6M A;  1LFW A;  4UCM A;  4DYO A;  4FD5 A;  1BOB A;  2WYR A;  4NGP A;  1CJW A;  4OC2 A;  3FIX A;  4MMO A;  3D68 A;  2WPW A;  4MY3 A;  5IX3 A;  2PJA A;  4MCP A;  4Q38 A;  5HMN A;  1AUG A;  4CYP A;  4G1P A;  3IO1 A;  1WK4 A;  2OOT A;  2Q4V A;  4PXD A;  2JBJ A;  1MK4 A;  3KR5 A;  1PCA A;  3D7G A;  4H2K A;  4KUA A;  4R87 A;  4XPK A;  4ZYQ A;  5I0C A;  1KUV A;  5IV0 A;  2AFM A;  1QQ9 A;  4OLL A;  3V7Z A;  3TO6 A;  1XMT A;  3FED A;  3VWE A;  1Y9K A;  3SXN A;  4EWT A;  1IOI A;  3H8E A;  5ISV A;  3T9Y A;  4F6A A;  2D4O A;  2ZPA A;  1XOV A;  4Q7A A;  5D8N A;  2HUZ A;  1B6B A;  1RO5 A;  1CP7 A;  2VEZ A;  1XEB A;  3D2M A;  1CP6 A;  2GU2 A;  4CAW A;  5LYF A;  1YW6 A;  1CBX A;  3TT2 A;  1M4G A;  3SI0 A;  2WPX A;  4B13 A;  4ONU A;  5AG4 A;  1VIX A;  4O23 A;  2J8N A;  2PJ2 A;  5G20 A;  2HV2 A;  4ZI6 A;  4F0X A;  3FB3 A;  2J8R A;  2YND A;  3KQX A;  2JBK A;  4KOW A;  1HEE A;  4R3K A;  4DUK A;  1I1D A;  1NSA A;  4MHZ A;  1IID A;  2ZXV A;  5HVG A;  2I79 A;  4JJX A;  4KS9 A;  4AVB A;  3D2P A;  2OB0 A;  1Z8L A;  2PJ0 A;  4L89 A;  4NFR A;  4FBE A;  5AG5 A;  1Y0Y A;  1CM0 A;  4ZY2 A;  3S6K A;  4PXE A;  4ZX9 A;  2HC9 A;  1ARL A;  4YWY A;  4UEZ A;  2EWB A;  4B14 A;  1VHE A;  3KHX A;  2AJ6 A;  2DPS A;  2PJ5 A;  4UEE A;  4XNH B;  2B5G A;  2PVV A;  1F57 A;  1S3Z A;  1Q2D A;  3UY5 A;  3F8K A;  1CX8 A;  4CYN A;  1TKJ A;  4J3G A;  2HQY A;  1KUY A;  1BLL E;  2ZW7 A;  2PJB A;  2FIA A;  2XEF A;  4OME A;  2CTB A;  2ZEH A;  2C27 A;  2AFX A;  4NCZ A;  5J8C A;  1JWQ A;  2QIR A;  3R96 A;  1ZO0 A;  4K30 A;  1Q7L A;  1P0H A;  2B4D B;  4P4J A;  5D29 A;  3ZZI A;  3LWU A;  4OIW A;  1QSO A;  1VKC A;  2OU2 A;  1HDU A;  2C6P A;  4DJL A;  2FVG A;  1Z2L A;  3CXS A;  3NFZ A;  1BPN A;  4NGQ A;  3D66 A;  3EFA A;  3K2K A;  4OP4 A;  1YR0 A;  2V8H A;  3CXQ A;  4P4E A;  3S9L A;  3B2Y A;  3FF3 A;  3KL9 A;  3T8W A;  2CNT A;  4MY0 A;  5DWM A;  3S6H A;  3PP9 A;  2ZOF A;  4ZBG A;  1VHS A;  4M6H A;  1XJO A;  3MRU A;  3GYA A;  2BO9 A;  5K8M A;  4A31 A;  4NGT A;  4FAI A;  2PJ8 A;  2PRQ A;  5JM6 A;  2CNS A;  2FE7 A;  2Z0Z A;  3PEI A;  1UWY A;  3L2N A;  4XPL A;  3DSB A;  1YW4 A;  2FCK A;  4TNU A;  4OC5 A;  4HNX B;  2GIV A;  1PU9 A;  4ORF A;  1MJA A;  4KVM E;  3VH9 A;  5AGE A;  2ATR A;  1CG2 A;  4BMH A;  3VAR A;  3JRU A;  3EC4 A;  1AYE A;  4BBH A;  2ANP A;  3JTK A;  4JZ0 A;  2JEV A;  2FL4 A;  4H6Z A;  4P4B A;  4JLY A;  3ZJ0 A;  2B58 A;  1ZLH A;  4GS4 A;  4PPZ A;  1YVK A;  5F47 A;  2Z11 A;  2JDC A;  2QVP A;  4AG7 A;  3D7D A;  5FVJ A;  1RXT A;  3H4Q A;  1QSM A;  3SI2 A;  2IQ6 A;  1YVO A;  1J4J A;  2JLM A;  4PV6 A;  4UFW A;  1Y9W A;  2YNC A;  4FD7 A;  1R43 A;  4UCP A;  4NGS A;  4TWE A;  1DE4 C;  3FVL A;  4Y49 C;  1FT7 A;  2C6G A;  4A39 A;  2GLF A;  3R1K A;  2QEC A;  3E0K A;  4NGR A;  4A94 A;  1YSJ A;  3PBB A;  1HDQ A;  5HXD A;  1ELL P;  2OZH A;  2XEI A;  3PFO A;  5KTD A;  3CT9 A;  4P4I A;  2PR8 A;  3IIB A;  4MHN A;  2RB7 A;  3P2H A;  2HB6 A;  2ZW4 A;  4A38 A;  4R8F A;  2YNE A;  1F2P A;  4UBR A;  1GYT A;  3IEH A;  3PB4 X;  2ZED A;  2DEA A;  4DNC A;  1L0C A;  3GY9 A;  4PSX A;  5G21 A;  2C1C A;  2Z3N A;  2ABZ A;  5JPH A;  4CAX A;  3PFE A;  5F48 A;  3GIU A;  4C7I A;  4CGN A;  4F8Z A;  2PSW A;  3FEE A;  3DNS A;  3S6G A;  4QUS A;  2ZEN A;  2IMO A;  5K8P A;  4CAF A;  3KZW A;  1MJB A;  2JEW A;  2PC1 A;  4R3L A;  1N71 A;  1I12 A;  1PUA A;  3PRT A;  4CGM A;  2PIY A;  3ISX A;  2POK A;  3GUX A;  1TKF A;  3MGD A;  4RI1 A;  4UIA A;  5JGF A;  4KOT A;  2IL4 A;  4AXV A;  2FSR A;  3K9T A;  3PBE A;  2BUE A;  2EK8 A;  1OBR A;  4R76 A;  4ZGY B;  1ZG7 A;  5AG6 A;  4RUH A;  2Q4Y A;  4C2Z A;  4KZT A;  4M3S A;  2JDD A;  3EY5 A;  1IIC A;  4I49 A;  2O28 A;  2YNC C;  3SHP A;  4MHY A;  3HLP A;  3FXT A;  5CNP A;  4B12 A;  1V0C A;  4MHD A;  2PDO A;  4YRH A;  1IYL A;  4CGP A;  4KVO E;  5KTA A;  2ZW5 A;  8CPA A;  3TFY A;  4QVT A;  4B6Z A;  3FX6 A;  2J8M A;  2PJ9 A;  4NEX A;  4KOS A;  3K9U A;  4IK2 A;  3IGR A;  1KWM A;  7CPA A;  2AFO A;  3FNC A;  3NE8 A;  4EVY A;  2PCU A;  2OZG A;  3B35 A;  2WUU A;  4X8I A;  2EBJ A;  4OAE A;  3TCV A;  2AFW A;  1CPS A;  1JQG A;  2Z3P A;  2ZEL A;  3LAC A;  3B3V A;  2P6F A;  1TXR A;  1YQE A;  3BJ7 A;  2A4N A;  2GE3 A;  1QST A;  3I1U A;  3I3G A;  4P44 A;  3R9E A;  1R57 A;  4K3N A;  4KOX A;  2B3U A;  3IJ3 A;  4KSF A;  3P2F A;  4KLW A;  1ELM P;  5C82 A;  2AFS A;  3DLJ A;  2AFU A;  5EC4 A;  3NA6 A;  4MJ8 A;  4UWI A;  2Q43 A;  4A30 A;  2VXK A;  2PJ1 A;  3FBU A;  2B4D A;  3NH4 A;  3SJG A;  1F2O A;  4KSI A;  3RBU A;  2GAN A;  3R95 A;  2BSW A;  3JVN A;  3C26 A;  3DR6 A;  4KOV A;  3TX8 A;  4GM5 A;  4UWJ A;  3D8P A;  5IB9 A;  4A2Z A;  4QB9 A;  1VHO A;  3CPA A;  2ZEF A;  1Z9U A;  2P6E A;  4A33 A;  4KVX A;  5KTC A;  4FWU A;  5CPA A;  4B5P B;  1BAV A;  2EO8 A;  4MRI A;  5A28 A;  3QAH A;  4KOU A;  4P4D A;  1BPM A;  1XE4 A;  2Y0M A;  5AG7 A;  4U5Y A;  3NH5 A;  3WC6 A;  2B5G B;  4JYW A;  4PSW A;  5EMI A;  5J1Q A;  4Y49 B;  4YFJ A;  3QAY A;  1Z5R A;  2X7B A;  4XPD C;  2FT0 A;  4F0Y A;  1UFH A;  4U9Y A;  1Z8T A;  4NXY A;  2EUI A;  2I00 A;  2ZOG A;  5EBV A;  4H89 A;  2PR1 A;  2ZW6 A;  2B4B A;  2RFH A;  2WSA A;  3IWE A;  5HVF A;  4F9U A;  3PB6 X;  4Q36 A;  1Z8X A;  3D7H A;  3WR7 A;  4UFX A;  4OC0 A;  4MI4 A;  2Z3L A;  2F5I A;  1GHE A;  1WWZ A;  5F09 A;  4QC6 A;  2R1I A;  2PJC A;  1FNO A;  2CXA A;  2P6G A;  3IU1 A;  1QMU A;  3B8G A;  1IOF A;  1ON0 A;  2G0B A;  2ZEM A;  5CBM A;  3IWG A;  3RO0 A;  3DGV A;  4P4F A;  4B10 A;  4MFL A;  3IC1 A;  1TIQ A;  1ZLI A;  5JQ4 A;  2R98 A;  2Z10 A;  3CXP A;  4NSQ A;  4NGN A;  2Q7S A;  3H5Z A;  4OC3 A;  3D4U A;  4UIB A;  2ODF A;  1IB1 E;  1KZF A;  2GFQ A;  2Q04 A;  4E8O A;  1Z4R A;  3TC8 A;  2G3A A;  3NE7 A;  5I4M A;  4FD6 A;  2OR4 A;  5LRK A;  4AVC A;  1TF9 A;  3B7I A;  4JD6 A;  3R9G A;  4II9 A;  4LX9 A;  4P45 A;  3V8I A;  1LAP A;  4L8A A;  2C6C A;  4U9Z A;  2YGW A;  4E0A A;  3EXN A;  3RZA A;  4UCN A;  4MFQ A;  4P6Y A;  4M6I A;  4C7H A;  2OZU A;  2ZEE A;  5J8F A;  1I21 A;  3BXM A;  3B3S A;  4R6T A;  5IB0 A;  3KQZ A;  3S9M A;  4MCR A;  1QSR A;  2PVW A;  6CPA A;  4AB7 A;  4Z65 A;  3BLN A;  1Z8W A;  1XIX A;  2FIW A;  3GLJ A;  3RAM A;  5DWN A;  3SJX A;  3W6S A;  1M4L A;  4CYO A;  4NF1 A;  4X3R A;  4CRY B;  1Y7E A;  1NE9 A;  3F5B A;  1IGB A;  2RC4 A;  3TOB A;  1ZG8 A;  1LRZ A;  1Y7R A;  2VZZ A;  4HNY B;  4FUU A;  3FEC A;  2PJ6 A;  5K8O A;  4B11 A; 
#chains in the Genus database with same CATH homology
 5H84 A;  1M4I A;  4MFZ A;  1S60 A;  4MFK A;  4C2Z A;  1QSN A;  4CYQ A;  2REE A;  4CS0 B;  2Q44 A;  1FY7 A;  3A9L A;  4RS2 A;  1SQH A;  3FYN A;  4YGO A;  1Q2C A;  2B3V A;  2PQ8 A;  2PRB A;  4HNW B;  3LD2 A;  4E2A A;  2EVN A;  2DXQ A;  5BWA B;  4IUS A;  3W91 A;  1M1D A;  1XF8 A;  2P0W A;  5F49 A;  5C88 A;  1S7L A;  4KLV A;  2OH1 A;  4KSA A;  2BL1 A;  3F0A A;  3N7Z A;  1Z4E A;  3R9F A;  3G3S A;  3JUW A;  2Q7B A;  2BEI A;  3DR8 A;  5G22 A;  1S7F A;  4AVA A;  1YRE A;  5A27 A;  5G1Z A;  1M44 A;  2G3T A;  3QB8 A;  3SXO A;  4MBU A;  4XPD B;  1YLE A;  5GCN A;  1NSL A;  1M4D A;  4H6U A;  4B5P A;  5HH1 A;  3I9S A;  4LUA A;  4R57 A;  4PK3 A;  4OAD A;  4C68 A;  1YK3 A;  4R9M A;  4B5O A;  3LOD A;  2CNM A;  4JWP A;  4C2Y A;  4PK2 A;  3RYO A;  5JPH A;  3D3S A;  3T90 A;  4UFV A;  1BO4 A;  3GKR A;  3IU2 A;  4KOR A;  2K5T A;  2QML A;  4X5K A;  2Z3O A;  1KUX A;  2VZY A;  4AG9 A;  3W6X A;  4CGO A;  3BJ8 A;  4XNH C;  2NMT A;  4HKF A;  1MJ9 A;  1YGH A;  1B87 A;  2KCW A;  3TO7 A;  3VWD A;  4CAV A;  4QBJ A;  2FXF A;  3OWC A;  1S7K A;  3FRM A;  2DPT A;  3TOA A;  3G8W A;  5E96 A;  4A32 A;  2R8V A;  4CAE A;  4FD4 A;  4MFJ A;  4CRZ B;  1K4J A;  4JXR A;  1Q2Y A;  3TO9 A;  1S5K A;  3DDD A;  5H86 A;  1IYK A;  4CGL A;  4IF5 A;  4KUB A;  2VBQ A;  3PZJ A;  2D4P A;  2Z3M A;  2AE6 A;  2Z3K A;  5F46 A;  3EO4 A;  3S6F A;  2REF A;  2H5M A;  2VI7 A;  3TTH A;  1OZP A;  1YX0 A;  3TE4 A;  1P4N A;  4C2X A;  2Q0Y A;  2CY2 A;  1S7N A;  3PGP A;  1NMT A;  4M85 A;  2FS5 A;  4KOY A;  2ARH A;  2R7H A;  2VQY A;  4UA3 A;  4MFP A;  4JXQ A;  3KKW A;  1U6M A;  4UCM A;  4FD5 A;  1BOB A;  1CJW A;  3FIX A;  2WPW A;  4MY3 A;  5IX3 A;  5HMN A;  4Q38 A;  4CYP A;  1WK4 A;  2Q4V A;  1MK4 A;  4KUA A;  5I0C A;  4R87 A;  4XPK A;  5IV0 A;  1KUV A;  4OLL A;  3TO6 A;  1XMT A;  3VWE A;  1Y9K A;  3SXN A;  5ISV A;  3T9Y A;  4F6A A;  2D4O A;  2ZPA A;  2HUZ A;  1B6B A;  1RO5 A;  2VEZ A;  3D2M A;  1XEB A;  4CAW A;  3TT2 A;  1M4G A;  4B13 A;  2WPX A;  5AG4 A;  4ONU A;  2J8N A;  5G20 A;  2HV2 A;  4F0X A;  3FB3 A;  2J8R A;  2YND A;  4KOW A;  4R3K A;  1I1D A;  1IID A;  2ZXV A;  2I79 A;  4JJX A;  4KS9 A;  4AVB A;  3D2P A;  2OB0 A;  4L89 A;  5AG5 A;  3S6K A;  1CM0 A;  4B14 A;  2AJ6 A;  2DPS A;  4XNH B;  2B5G A;  1S3Z A;  1Q2D A;  3UY5 A;  3F8K A;  4CYN A;  4J3G A;  2HQY A;  1KUY A;  2ZW7 A;  2FIA A;  2C27 A;  5J8C A;  4NCZ A;  2QIR A;  3R96 A;  1ZO0 A;  4K30 A;  1P0H A;  2B4D B;  3ZZI A;  1QSO A;  1VKC A;  2OU2 A;  3CXS A;  3EFA A;  3CXQ A;  1YR0 A;  2CNT A;  4MY0 A;  5DWM A;  3S6H A;  3PP9 A;  4ZBG A;  1VHS A;  3GYA A;  4A31 A;  2CNS A;  2FE7 A;  2Z0Z A;  4XPL A;  3DSB A;  2FCK A;  4HNX B;  2GIV A;  1PU9 A;  4ORF A;  1MJA A;  4KVM E;  5AGE A;  2ATR A;  4BMH A;  3EC4 A;  4BBH A;  3JTK A;  3ZJ0 A;  2JEV A;  2FL4 A;  4H6Z A;  4A95 A;  4JLY A;  2B58 A;  4GS4 A;  5F47 A;  1YVK A;  4AG7 A;  2Z11 A;  2JDC A;  5FVJ A;  1RXT A;  3H4Q A;  1QSM A;  1YVO A;  1J4J A;  2JLM A;  4PV6 A;  4UFW A;  1Y9W A;  2YNC A;  4FD7 A;  4UCP A;  4Y49 C;  3R1K A;  2QEC A;  3E0K A;  2OZH A;  5KTD A;  2PR8 A;  3P2H A;  2ZW4 A;  2YNE A;  4UBR A;  4DNC A;  1L0C A;  3GY9 A;  4PSX A;  5G21 A;  2Z3N A;  4CAX A;  5F48 A;  4C7I A;  4CGN A;  2PSW A;  3S6G A;  3DNS A;  4QUS A;  4CAF A;  1MJB A;  2PC1 A;  4R3L A;  1N71 A;  1I12 A;  1PUA A;  4CGM A;  3MGD A;  4RI1 A;  4KOT A;  2IL4 A;  2FSR A;  2BUE A;  4ZGY B;  5AG6 A;  2Q4Y A;  4KZT A;  4M3S A;  2JDD A;  3EY5 A;  1IIC A;  4I49 A;  2O28 A;  2YNC C;  3SHP A;  3FXT A;  5CNP A;  4B12 A;  1V0C A;  4MHD A;  2PDO A;  4YRH A;  1IYL A;  4CGP A;  4KVO E;  5KTA A;  2ZW5 A;  3TFY A;  4QVT A;  2J8M A;  4NEX A;  4KOS A;  3K9U A;  3IGR A;  3FNC A;  4EVY A;  2OZG A;  2WUU A;  4OAE A;  3TCV A;  2Z3P A;  3BJ7 A;  2P6F A;  2A4N A;  2GE3 A;  1QST A;  3I3G A;  3R9E A;  1R57 A;  4KOX A;  2B3U A;  4KSF A;  3P2F A;  4KLW A;  5C82 A;  5EC4 A;  4MJ8 A;  4UWI A;  4A30 A;  2VXK A;  3FBU A;  2B4D A;  2GAN A;  3R95 A;  2BSW A;  3JVN A;  3C26 A;  3DR6 A;  4KOV A;  4UWJ A;  3D8P A;  4A2Z A;  4QB9 A;  1Z9U A;  2P6E A;  4A33 A;  4KVX A;  5KTC A;  5A28 A;  4B5P B;  3QAH A;  4KOU A;  1XE4 A;  2Y0M A;  5AG7 A;  4U5Y A;  2B5G B;  4PSW A;  4Y49 B;  4YFJ A;  2X7B A;  4XPD C;  2FT0 A;  4F0Y A;  1UFH A;  4U9Y A;  4NXY A;  2EUI A;  2I00 A;  5EBV A;  4H89 A;  2PR1 A;  2ZW6 A;  2B4B A;  2WSA A;  3IWE A;  4Q36 A;  3WR7 A;  4UFX A;  4MI4 A;  2Z3L A;  2F5I A;  1GHE A;  1WWZ A;  4QC6 A;  2R1I A;  2CXA A;  2P6G A;  3IU1 A;  3B8G A;  1ON0 A;  2G0B A;  3IWG A;  4B10 A;  4MFL A;  1TIQ A;  5JQ4 A;  2R98 A;  2Z10 A;  3CXP A;  4NSQ A;  3H5Z A;  1IB1 E;  1KZF A;  2Q04 A;  4E8O A;  1Z4R A;  2G3A A;  3NE7 A;  4FD6 A;  4AVC A;  3R9G A;  4JD6 A;  4II9 A;  4LX9 A;  3V8I A;  4L8A A;  4U9Z A;  2YGW A;  4E0A A;  3EXN A;  4UCN A;  4MFQ A;  4C7H A;  2OZU A;  5J8F A;  1I21 A;  5IB0 A;  1QSR A;  4AB7 A;  3BLN A;  2FIW A;  1XIX A;  5DWN A;  3W6S A;  4CYO A;  4NF1 A;  4CRY B;  1NE9 A;  3F5B A;  2RC4 A;  3TOB A;  1LRZ A;  1Y7R A;  2VZZ A;  4HNY B;  4B11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...