2OZHA

Crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
GMPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFARVISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYGFTPPLFPQSLMERYVPGLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypothetical protein XCC2953
publication title Crystal structure of hypothetical protein (NP_638301.1) from Xanthomonas campestris at 1.40 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
total genus 34
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozhA01
1Y9WA 3W6SA 3EXNA 4HNWB 2GIVA 4MHDA 3W6XA 1L0CA 2ZW5A 2J8RA 3W91A 2VBQA 1I21A 4KUBA 3VWDA 3LD2A 4CAVA 1YR0A 2EUIA 3PGPA 1YGHA 2B5GB 1U6MA 3D3SA 4M85A 4R3LA 2CNMA 2CNTA 2REEA 4JLYA 5F48A 1M4GA 1QSRA 1M4DA 4KOUA 2B5GA 1XE4A 4XNHC 2FCKA 2JDCA 1PUAA 1S7LA 3P2HA 5FVJA 3T9YA 3TFYA 5CNPA 3R9EA 1XIXA 4JJXA 3IWGA 1WWZA 1KUYA 3R96A 3S6GA 1S3ZA 4JWPA 3SXNA 5KTDA 1VHSA 4PSXA 4KOYA 3PZJA 4UWIA 1MJBA 3H4QA 2VZYA 2B4DB 4KUAA 2NMTA 3JUWA 4KLVA 2CNSA 1IB1E 2G3AA 5C82A 4H6ZA 4IUSA 3TO9A 3F8KA 5E96A 1XMTA 1Q2CA 2D4OA 1NE9A 4RS2A 4Y49C 2O28A 2H5MA 3C26A 3FIXA 5F47A 5I0CA 1QSNA 4MI4A 2FT0A 4U9YA 4R57A 4HNYB 1UFHA 3UY5A 4OAEA 1S7KA 2I00A 4CS0B 4ORFA 1S7NA 4CRYB 3EFAA 4RI1A 5JQ4A 4PSWA 4R87A 2VQYA 3ZJ0A 2Z10A 2J8NA 4NXYA 4NF1A 3I9SA 2Q04A 4KVOE 4PK3A 2FE7A 1QSOA 1RO5A 1GHEA 1Q2YA 2C27A 4DNCA 2ZW6A 4L8AA 2ZW7A 4QVTA 4L89A 1B87A 5KTCA 5DWMA 1IIDA 4J3GA 2ATRA 4U5YA 3EY5A 1OZPA 2D4PA 4CAXA 4JXQA 4QC6A 1YVOA 3D8PA 1Y9KA 5ISVA 1V0CA 2QMLA 4KLWA 1S7FA 4HNXB 3QAHA 4XPKA 4KOXA 2ZXVA 4R3KA 3OWCA 2PQ8A 4X5KA 1S5KA 2REFA 2VZZA 2CY2A 2B58A 3FNCA 1YX0A 2OZGA 2FIAA 1SQHA 3K9UA 2JLMA 5J8CA 1MK4A 2R7HA 4AVCA 2RC4A 2Y0MA 1YVKA 3P2FA 1R57A 2ZW4A 3I3GA 2B4BA 2JEVA 4KORA 4AVBA 2FS5A 3S6HA 3QB8A 2DXQA 5F49A 4I49A 3GY9A 4HKFA 3FXTA 1QSTA 5KTAA 2X7BA 4U9ZA 5IB0A 2B4DA 3TCVA 1Z4RA 3DR8A 4R9MA 2Z11A 2IL4A 3EO4A 2G3TA 4KOSA 1B6BA 4AB7A 4LX9A 4PV6A 3GKRA 1YK3A 4LUAA 1IYLA 4K30A 2OZUA 3D2PA 5HH1A 1YREA 4H6UA 4XPDC 2PC1A 4XNHB 1CJWA 3S6FA 2VI7A 3WR7A 5DWNA 4EVYA 5EC4A 3TO6A 1NSLA 1VKCA 2Z0ZA 4ZBGA 4II9A 4E2AA 1J4JA 4JD6A 4F0YA 4GS4A 3BJ7A 4FD4A 4KZTA 3E0KA 2OZHA 5IX3A 1MJAA 3TO7A 2PR1A 4NEXA 3JVNA 5C88A 1M44A 1ON0A 2EVNA 2WPWA 3RYOA 4E0AA 2P6EA 2J8MA 2R8VA 3FYNA 1I1DA 2F5IA 3FB3A 5HMNA 3CXQA 3N7ZA 1M4IA 1RXTA 2QECA 1WK4A 3BLNA 4OADA 1PU9A 3B8GA 1TIQA 3SXOA 4YFJA 3DNSA 4B5PB 2P0WA 4AG7A 2HUZA 1YLEA 2FSRA 1KUVA 3FRMA 1NMTA 2AE6A 2ZPAA 4B5PA 1BOBA 4KOWA 4PK2A 3G3SA 2OB0A 2R1IA 2VXKA 4MY0A 3R95A 2PDOA 4Y49B 4CRZB 2R98A 4BMHA 4JXRA 1Q2DA 2HQYA 2FL4A 3PP9A 4E8OA 3S6KA 2Q0YA 3TE4A 1QSMA 4H89A 5IV0A 3MGDA 4KVXA 4MBUA 3DR6A 4MJ8A 4KOTA 1CM0A 3T90A 4QBJA 1M1DA 1S60A 2QIRA 1IICA 1XEBA 4XPLA 5J8FA 3D2MA 3GYAA 4YRHA 3V8IA 1Z9UA 3F0AA 4KVME 3G8WA 5H86A 3R9GA 2OU2A 5F46A 3CXPA 4B5OA 2BSWA 3ZZIA 4OLLA 3EC4A 4UA3A 1KUXA 4NSQA 4QUSA 2BUEA 3TOBA 2KCWA 1P0HA 3DSBA 1Z4EA 3TOAA 1I12A 5EBVA 1IYKA 3SHPA 3TT2A 5H84A 2PRBA 2Q44A 1K4JA 4AG9A 4NCZA 4AVAA 1Y7RA 2P6FA 5GCNA 3TTHA 3R1KA 2BL1A 4MY3A 4UBRA 2FXFA 4IF5A 3NE7A 2G0BA 3FBUA 4UWJA 4M3SA 1MJ9A 2I79A 3DDDA 2PR8A 4FD6A 2FIWA 2WPXA 2VEZA 4CAWA 2Q4VA 2OH1A 3VWEA 2Q4YA 2P6GA 3F5BA 3KKWA 2JDDA 3IGRA 4QB9A 2B3UA 2AJ6A 3R9FA 1FY7A 5JPHA 2B3VA 2A4NA 2PSWA 4YGOA 1KZFA 2GANA 4FD7A 2K5TA 2ARHA 4F6AA 2HV2A 3LODA 2GE3A 4KOVA 2Q7BA 1N71A 2BEIA 1LRZA 4XPDB 1BO4A 3BJ8A 4FD5A 3CXSA 4ONUA 1P4NA 1XF8A
chains in the Genus database with same CATH superfamily
4OIDA 1Y9WA 3VARA 3W6SA 4A37A 4DJLA 3EXNA 4EWTA 3B3CA 3B3WA 4HNWB 1IY7A 3H8FA 5AG5A 5F09A 5J1QA 2WZNA 4A38A 2GIVA 4KSFA 4MHDA 3W6XA 3RO0A 1L0CA 2ZW5A 2PIYA 2J8RA 3A9LA 3W91A 2VBQA 2ZEMA 1I21A 4KUBA 3VWDA 3CT9A 2ABZA 4C2ZA 1Q7LA 1UWYA 2C1CA 3LD2A 2POKA 4UEEA 4FUUA 4CAVA 1YR0A 2EUIA 3MRUA 3PGPA 5I4MA 3HLPA 1YGHA 3PB7X 2B5GB 2CXAA 2PVVA 1U6MA 2Z3KA 2CTBA 2XEGA 2YGWA 3D3SA 4UFVA 1IU8A 3GB0A 4M85A 4R3LA 1QMUA 2CNMA 2BCOA 2CNTA 2REEA 4O23A 5LYIA 2IJZA 4CAFA 1QQ9A 2JBKA 2ZELA 4MHZA 4NGNA 4JLYA 5F48A 1M4GA 3NE8A 1QSRA 1M4DA 4HPSA 4KOUA 3NH5A 1X10A 2B5GA 1HDUA 5AG6A 1XE4A 4XNHC 1VIXA 2FCKA 3VATA 2ZOFA 3RBUA 2JDCA 1PUAA 1S7LA 3P2HA 5FVJA 3T9YA 3TFYA 4UFXA 5CNPA 2IQ6A 4TWEA 5ELYA 4A39A 2PJCA 4C2YA 4FBEA 3R9EA 1TKFA 1Y7EA 2AFZA 1Z8TA 2VL1A 7CPAA 1F57A 3PBBA 2GLFA 1XIXA 4KS9A 1TXRA 4JJXA 4KSIA 3FEEA 3IWGA 1F2OA 1WWZA 2AFSA 4B13A 1KUYA 3N5FA 2Z3MA 3R96A 3WC5A 3S6GA 3TC8A 1JWQA 1S3ZA 4JWPA 4NJRA 4C7IA 3B3SA 3SXNA 3B3VA 4NGSA 5K8OA 3T8WA 5KTDA 1VHSA 4PSXA 4KOYA 3PZJA 4UWIA 3HUVA 4CAEA 1MJBA 5HVHA 3H4QA 1ARMA 2VZYA 5EMIA 3SJGA 1YSJA 6CPAA 2B4DB 4B14A 4KUAA 4OIWA 1PYTB 2NMTA 3JUWA 1CPXA 4IHMA 4KLVA 2ODFA 3FX6A 4G1PA 3I1UA 2F7VA 4GM5A 2CNSA 1IB1E 2G3AA 5K8NA 3H8GA 4GXHA 4P4JA 5C82A 3IIBA 4OC5A 5HXDA 4H6ZA 4IUSA 3TO9A 4NJQA 4CGMA 3F8KA 5E96A 3H5ZA 1XMTA 2HC9A 1Q2CA 2D4OA 4B6ZA 1NE9A 2PJ3A 3PB4X 2OR4A 1BPNA 4RS2A 2WUUA 5G20A 2J9AA 3SJEA 4Y49C 2O28A 2H5MA 3C26A 3RNZA 3FIXA 2BO9A 4UFWA 5F47A 1XJOA 1QSNA 4MI4A 2FT0A 4U9YA 3WC7A 5I0CA 4YU9A 4R57A 2AFWA 3BI1A 4A33A 3QNVA 5K8PA 4ONWA 4HNYB 2CF4A 3K2KA 1UFHA 4LQGA 2CTCA 2PJ5A 4OAEA 1S7KA 2I00A 2V8DA 3TX8A 3UY5A 4ORFA 4CS0B 1S7NA 4CRYB 3EFAA 1KWMA 1TF9A 3DLJA 4RI1A 5JQ4A 2ZEFA 4P45A 4PSWA 4Q38A 4R87A 2VQYA 3ZJ0A 3WC6A 4C2XA 5D29A 2Z10A 2J8NA 2GLJA 4NXYA 2PJ9A 2G9DA 4NF1A 4Q7AA 4UIBA 1TKJA 3PB6X 2XEIA 3FEDA 4P44A 3I9SA 2Q04A 4KVOE 5JH9A 2JBJA 4PK3A 2FE7A 1XMBA 2QVPA 1QSOA 1ZLIA 1ARLA 1RO5A 1A2ZA 1TF8A 4MFLA 1GHEA 1Q2YA 2C27A 4CPAA 4MCPA 4DNCA 5HVGA 2ZW6A 4L8AA 4LQ6A 4UCNA 2ZW7A 3IJ3A 4QVTA 5IB9A 2QJ8A 2GREA 3KASA 3PFEA 4L89A 2YNCA 4MCQA 4P10A 4NGMA 2C6PA 3SI0A 2DEAA 1B87A 4MHNA 5KTCA 3D66A 5DWMA 1IIDA 4J3GA 2PJ8A 2ATRA 4U5YA 3EY5A 2XEJA 4CYPA 1OZPA 3PB8X 4CGPA 4ZY1A 2EWBA 1OBRA 2D4PA 3BHXA 3PEIA 2NYQA 4B12A 4CAXA 4JXQA 3KHXA 4QC6A 4PXDA 5JM6A 3CDXA 1YVOA 3D8PA 3S9LA 4OKOA 1Y9KA 5ISVA 1V0CA 2QMLA 4KLWA 3QAYA 1S7FA 2Q4ZA 2V77A 3QAHA 4HNXB 4XPKA 1EE3P 3BXMA 2I3CA 2ZXVA 3KHZA 4KOXA 4F8ZA 3GUXA 4EMEA 4WJBA 4R3KA 2Z3NA 3OWCA 2PQ8A 4X5KA 1S5KA 2REFA 2VZZA 2DPTA 5A28A 2Z3PA 2CY2A 2O4HA 2B58A 2Q51A 3FNCA 4MXUA 1YX0A 1Z8WA 2OZGA 4M6GA 2FIAA 1AMPA 1SQHA 1LFWA 1YMEA 4MHPA 3VH9A 2Q7SA 3K9UA 5LYLA 2JLMA 5J8CA 4ZI6A 1MK4A 2R7HA 4JYWA 4CYNA 3IWEA 4AVCA 2RC4A 4OC4A 1DTDA 4P4BA 4MHYA 2GFQA 2PRQA 2Y0MA 3PBEA 4K3NA 1YVKA 3P2FA 5AG7A 2WYRA 1CP7A 1R57A 2ZW4A 3I3GA 5LYFA 2ZEGA 2B4BA 3LMSA 2JEVA 4KORA 1H8LA 3SI1A 4CGLA 1ELMP 4M6IA 2FS5A 4X2TA 3QB8A 3S6HA 4AVBA 2JEWA 2DXQA 4ZYQA 2ZOGA 4BINA 4F9UA 5CBMA 2PVWA 4UIAA 5F49A 3B7IA 4YWYA 4ZX8A 5G1ZA 1CBXA 1YLOA 3GY9A 1VGYA 4HKFA 4I49A 4NGRA 2FVGA 1VHOA 1QSTA 2EO8A 3FXTA 2X7BA 4U9ZA 3SJFA 5KTAA 2PJ4A 3D68A 2AFUA 3RZAA 5G22A 1NSAA 2B4DA 5IB0A 2C6CA 4OC1A 3TCVA 4A31A 1Z4RA 2Z3OA 1IOFA 3DR8A 4R9MA 2Z11A 2IL4A 5DS0A 1IOIA 3EO4A 4OC0A 4OP4A 2G3TA 3IFEA 1B6BA 4KOSA 4AB7A 4C68A 1VHEA 4LX9A 4F0XA 4AXVA 4Z65A 4PV6A 4DYOA 3FVLA 3SI2A 3GKRA 1YK3A 4LUAA 1IYLA 1Y0RA 1HEEA 4K30A 4OC3A 2DPSA 2OZUA 3D2PA 5HH1A 1CG2A 1YREA 3KR5A 4H6UA 4XPDC 2PC1A 3B3TA 4DUKA 1ZG7A 3FJUA 4XNHB 1CJWA 3S6FA 1ZO0A 2VI7A 2ZEHA 4PXCA 2OOTA 3WR7A 4CYQA 5DWNA 4EVYA 3FMCA 1YW4A 5EC4A 3TO6A 4RN7A 1NSLA 1FT7A 1LANA 1VKCA 2Z0ZA 4ZBGA 4II9A 2PJ2A 1HDQA 2ZEDA 4E2AA 1J4JA 4JD6A 4F0YA 4GS4A 1BAVA 2EK8A 3BJ7A 3KQZA 1AUGA 3E0KA 4FD4A 4KZTA 4R6TA 4CYOA 2PJ0A 2OZHA 5LRKA 5IX3A 3GIUA 1MJAA 3TO7A 3V7ZA 2PR1A 3BI0A 2ZEPA 4NEXA 3JVNA 4A32A 5C88A 3DGVA 3D7GA 1M44A 3ISZA 3JTKA 1ON0A 4MFQA 1JQGA 2EVNA 2WPWA 4F9VA 3RYOA 2EK9A 4E0AA 2P6EA 2J8MA 4MCSA 4X8IA 3IU2A 2R8VA 3NH4A 5CPAA 3FYNA 1I1DA 2F5IA 3FB3A 5HMNA 3CXQA 4FWUA 3N7ZA 1M4IA 1RXTA 1ZLHA 4A30A 4NGQA 3PB9X 1XOVA 1WK4A 2QECA 2O53A 2QYVA 5D8NA 3BLNA 4PPZA 4CGOA 3IO1A 4OADA 1PU9A 3B8GA 1TIQA 4P6YA 4P4FA 4W9YA 1PCAA 3SXOA 3JRUA 2V8GA 4YFJA 2PJ6A 3DNSA 4B5PB 4OC2A 1XFOA 2P0WA 1Z5RA 5HVFA 4PQAA 2PJ7A 4NGPA 2HUZA 4AG7A 1YLEA 4X3RA 2FSRA 1KUVA 1IGBA 2YNEA 3FRMA 1NMTA 3IC1A 3NH8A 2AE6A 2ZPAA 4B5PA 1BOBA 4KOWA 4PK2A 3G3SA 2OB0A 2R1IA 2PCUA 2VXKA 3NFZA 4MY0A 3R95A 2PDOA 4Y49B 4CRZB 2R98A 4EFDA 5AG4A 4BMHA 4JXRA 1Q2DA 4UF4A 1XBUA 4MCRA 2HQYA 2FL4A 4A2ZA 1ZG8A 4ZGYB 2Z3LA 3PP9A 4E8OA 3D7HA 4JZ0A 3S6KA 4R76A 2Q0YA 4MRIA 3TE4A 1QSMA 3PRTA 4H89A 5IV0A 3MGDA 3WABA 3FECA 3MN8A 4KVXA 2ZENA 3KQXA 4UEFA 4MBUA 4IAVA 3DR6A 4MJ8A 3RAMA 3NA6A 4KOTA 1CM0A 3LWUA 4RUHA 3T90A 4QBJA 1Z8LA 2AFXA 1M1DA 1S60A 2IMOA 1IICA 2QIRA 1XEBA 4KSAA 4XPLA 5J8FA 3D2MA 3GYAA 3KR4A 4YRHA 2XEFA 4B10A 4CGNA 4OMEA 1ZG9A 3V8IA 1Z9UA 2GU2A 3CPXA 3K9TA 3CPAA 4UCMA 4R7MA 5LYDA 3F0AA 4KVME 4FAIA 4MFZA 3G8WA 2ZEEA 5H86A 3R9GA 2HB6A 2PJBA 3PFOA 2ZEOA 4IK2A 2OU2A 5F46A 2V8HA 3CXPA 1FNOA 4B5OA 1YQEA 1M4LA 3IEHA 2BSWA 3IU1A 3ZZIA 4NGTA 4OLLA 2NSMA 3EC4A 4UA3A 2PJAA 4TNUA 1KUXA 1LAMA 4NSQA 1F2PA 4QUSA 1LOKA 3KGQA 2BUEA 4R8FA 4BD9A 5BWAB 4H2KA 3D67A 1BLLE 3TOBA 2PIZA 2KCWA 1P0HA 3DSBA 2BOAA 1Z4EA 4MFPA 3TOAA 3FF3A 1I12A 5EBVA 1IYKA 2WSAA 3SHPA 3GLJA 3TT2A 5H84A 1XRYA 1Z2LA 2AFOA 2PRBA 2Q44A 1K4JA 4AG9A 4NCZA 1GYTA 4A95A 4AVAA 5LRJA 1Y7RA 2DF5A 4MMOA 2P6FA 2YNCC 4MFJA 1Z8XA 3WT4A 5GCNA 1CPSA 4UCPA 3TTHA 1R3NA 3D7DA 3R1KA 2BL1A 4MFKA 4MY3A 4UBRA 3B2YA 2FXFA 2F8HA 4IF5A 2ANPA 3IWWA 4Q36A 3S9NA 2PE3A 3H8EA 4P4EA 1CX8A 2EBJA 3NE7A 3ISXA 2G0BA 3FBUA 4UWJA 4M3SA 1MJ9A 2I79A 4NFRA 5AGEA 1TKHA 4P4IA 3DDDA 3LACA 1LAPA 2PR8A 3KL9A 5JGFA 4FD6A 2FIWA 1CP6A 2Q43A 4WWVA 4ZX9A 2WPXA 2VEZA 5A27A 5G21A 4CAWA 1AYEA 2Q4VA 2OH1A 3VWEA 8CPAA 2CIJA 2Q4YA 2P6GA 2RB7A 4ZY0A 3FH4A 3F5BA 3KKWA 2JDDA 2AFMA 3KI9A 4UEZA 5LRGA 3IGRA 4QB9A 2B3UA 3L2NA 4B11A 2RFHA 3CZXA 2AJ6A 3D7FA 1Y0YA 1R43A 3R9FA 1BPMA 1DE4C 2C6GA 4M6HA 1FY7A 1RTQA 2V8VA 5JPHA 3B35A 3S9MA 2B3VA 4P4DA 2A4NA 2PSWA 4YGOA 1KZFA 4A94A 1YW6A 4PXEA 4BBHA 3SJXA 3D4UA 2GANA 1LCPA 4C7HA 4FD7A 2PJ1A 2K5TA 3V38A 5K8MA 2ARHA 4ZY2A 4F6AA 2HV2A 3LODA 2GE3A 4KOVA 2Q7BA 1N71A 2BEIA 1X12A 1LRZA 4XPDB 4PXBA 1BO4A 5THWA 3BJ8A 4FD5A 3CXSA 4ONUA 3KZWA 1P4NA 1ELLP 1XF8A 2YNDA
chains in the Genus database with same CATH topology
1Y9WA 3W6SA 3EXNA 4HNWB 5AG5A 2GIVA 4KSFA 4MHDA 3W6XA 1L0CA 2ZW5A 2J8RA 3A9LA 3W91A 2VBQA 1I21A 4KUBA 3VWDA 4C2ZA 3LD2A 4CAVA 1YR0A 2EUIA 3PGPA 1YGHA 2B5GB 2CXAA 2Z3KA 1U6MA 4UFVA 2YGWA 3D3SA 4M85A 4R3LA 2CNMA 2CNTA 2REEA 4CAFA 4JLYA 5F48A 1M4GA 1QSRA 1M4DA 4KOUA 2B5GA 5AG6A 1XE4A 4XNHC 2FCKA 2JDCA 1PUAA 1S7LA 3P2HA 5FVJA 3T9YA 3TFYA 4UFXA 5CNPA 4C2YA 3R9EA 1XIXA 4KS9A 4JJXA 3IWGA 1WWZA 4B13A 1KUYA 2Z3MA 3R96A 3S6GA 1S3ZA 4JWPA 4C7IA 3SXNA 5KTDA 1VHSA 4PSXA 4KOYA 3PZJA 4UWIA 4CAEA 1MJBA 3H4QA 2VZYA 2B4DB 4B14A 4KUAA 2NMTA 3JUWA 4KLVA 2CNSA 1IB1E 2G3AA 5C82A 4H6ZA 4IUSA 3TO9A 4CGMA 3F8KA 5E96A 3H5ZA 1XMTA 1Q2CA 2D4OA 1NE9A 4RS2A 2WUUA 5G20A 4Y49C 2O28A 2H5MA 3C26A 3FIXA 4UFWA 5F47A 5I0CA 1QSNA 4MI4A 2FT0A 4U9YA 4R57A 4A33A 4HNYB 1UFHA 3UY5A 4OAEA 1S7KA 2I00A 4CS0B 4ORFA 1S7NA 4CRYB 3EFAA 4RI1A 5JQ4A 4Q38A 4PSWA 4R87A 2VQYA 3ZJ0A 4C2XA 2Z10A 2J8NA 4NXYA 4NF1A 3I9SA 2Q04A 4KVOE 4PK3A 2FE7A 1QSOA 1RO5A 4MFLA 1GHEA 1Q2YA 2C27A 4DNCA 2ZW6A 4L8AA 4UCNA 2ZW7A 4QVTA 4L89A 2YNCA 1B87A 5KTCA 5DWMA 1IIDA 4J3GA 2ATRA 4U5YA 3EY5A 4CYPA 1OZPA 4CGPA 2D4PA 4B12A 4CAXA 4JXQA 4QC6A 1YVOA 3D8PA 1Y9KA 5ISVA 1V0CA 2QMLA 4KLWA 1S7FA 4HNXB 3QAHA 4XPKA 4KOXA 2ZXVA 4R3KA 2Z3NA 3OWCA 2PQ8A 4X5KA 1S5KA 2REFA 2VZZA 2DPTA 5A28A 2Z3PA 2CY2A 2B58A 3FNCA 1YX0A 2OZGA 2FIAA 1SQHA 3K9UA 2JLMA 5J8CA 1MK4A 2R7HA 4CYNA 3IWEA 4AVCA 2RC4A 2Y0MA 5AG7A 1YVKA 3P2FA 1R57A 2ZW4A 3I3GA 2B4BA 2JEVA 4KORA 4CGLA 4AVBA 2FS5A 3S6HA 3QB8A 2DXQA 5F49A 5G1ZA 4I49A 3GY9A 4HKFA 3FXTA 1QSTA 5KTAA 2X7BA 4U9ZA 5IB0A 5G22A 2B4DA 3TCVA 4A31A 1Z4RA 2Z3OA 3DR8A 4R9MA 2Z11A 2IL4A 3EO4A 2G3TA 4KOSA 1B6BA 4AB7A 4C68A 4F0XA 4LX9A 4PV6A 3GKRA 1YK3A 4LUAA 1IYLA 4K30A 2DPSA 2OZUA 3D2PA 5HH1A 1YREA 4H6UA 4XPDC 2PC1A 4XNHB 1CJWA 3S6FA 1ZO0A 2VI7A 3WR7A 4CYQA 5DWNA 4EVYA 5EC4A 3TO6A 1NSLA 1VKCA 2Z0ZA 4ZBGA 4II9A 4E2AA 1J4JA 4JD6A 4F0YA 4GS4A 3BJ7A 4FD4A 4KZTA 3E0KA 4CYOA 2OZHA 5IX3A 1MJAA 3TO7A 2PR1A 4NEXA 3JVNA 4A32A 5C88A 1M44A 3JTKA 1ON0A 4MFQA 2EVNA 2WPWA 3RYOA 4E0AA 2P6EA 2J8MA 3IU2A 2R8VA 3FYNA 1I1DA 2F5IA 3FB3A 5HMNA 3CXQA 3N7ZA 1M4IA 1RXTA 4A30A 2QECA 1WK4A 4CGOA 3BLNA 4OADA 1PU9A 3B8GA 1TIQA 3SXOA 4YFJA 3DNSA 4B5PB 2P0WA 4AG7A 2HUZA 1YLEA 2FSRA 1KUVA 2YNEA 3FRMA 1NMTA 2AE6A 2ZPAA 4B5PA 1BOBA 4KOWA 4PK2A 3G3SA 2OB0A 2R1IA 2VXKA 4MY0A 3R95A 2PDOA 4Y49B 4CRZB 2R98A 5AG4A 4BMHA 4JXRA 1Q2DA 2HQYA 2FL4A 4A2ZA 4ZGYB 2Z3LA 3PP9A 4E8OA 3S6KA 2Q0YA 3TE4A 1QSMA 4H89A 5IV0A 3MGDA 4KVXA 4MBUA 3DR6A 4MJ8A 4KOTA 1CM0A 3T90A 4QBJA 1M1DA 1S60A 2QIRA 1IICA 1XEBA 4KSAA 4XPLA 5J8FA 3D2MA 3GYAA 4YRHA 4B10A 4CGNA 3V8IA 1Z9UA 4UCMA 3F0AA 4KVME 4MFZA 3G8WA 5H86A 3R9GA 2OU2A 5F46A 3CXPA 4B5OA 2BSWA 3IU1A 3ZZIA 4OLLA 3EC4A 4UA3A 1KUXA 4NSQA 4QUSA 5BWAB 2BUEA 3TOBA 2KCWA 1P0HA 3DSBA 1Z4EA 4MFPA 3TOAA 1I12A 5EBVA 1IYKA 2WSAA 3SHPA 3TT2A 5H84A 2PRBA 2Q44A 1K4JA 4AG9A 4NCZA 4A95A 4AVAA 1Y7RA 2P6FA 2YNCC 4MFJA 5GCNA 4UCPA 3TTHA 3R1KA 2BL1A 4MFKA 4MY3A 4UBRA 2FXFA 4IF5A 4Q36A 3NE7A 2G0BA 3FBUA 4UWJA 4M3SA 1MJ9A 2I79A 5AGEA 3DDDA 2PR8A 4FD6A 2FIWA 2WPXA 2VEZA 5A27A 5G21A 4CAWA 2Q4VA 2OH1A 3VWEA 2Q4YA 2P6GA 3F5BA 3KKWA 2JDDA 3IGRA 4QB9A 2B3UA 4B11A 2AJ6A 3R9FA 1FY7A 5JPHA 2B3VA 2A4NA 2PSWA 4YGOA 1KZFA 4BBHA 2GANA 4C7HA 4FD7A 2K5TA 2ARHA 4F6AA 2HV2A 3LODA 2GE3A 4KOVA 2Q7BA 1N71A 2BEIA 1LRZA 4XPDB 1BO4A 3BJ8A 4FD5A 3CXSA 4ONUA 1P4NA 1XF8A 2YNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9W A;  3W6S A;  3EXN A;  4HNW B;  2GIV A;  4MHD A;  3W6X A;  1L0C A;  2ZW5 A;  2J8R A;  3W91 A;  2VBQ A;  1I21 A;  4KUB A;  3VWD A;  3LD2 A;  4CAV A;  1YR0 A;  2EUI A;  3PGP A;  1YGH A;  2B5G B;  1U6M A;  3D3S A;  4M85 A;  4R3L A;  2CNM A;  2CNT A;  2REE A;  4JLY A;  5F48 A;  1M4G A;  1QSR A;  1M4D A;  4KOU A;  2B5G A;  1XE4 A;  4XNH C;  2FCK A;  2JDC A;  1PUA A;  1S7L A;  3P2H A;  5FVJ A;  3T9Y A;  3TFY A;  5CNP A;  3R9E A;  1XIX A;  4JJX A;  3IWG A;  1WWZ A;  1KUY A;  3R96 A;  3S6G A;  1S3Z A;  4JWP A;  3SXN A;  5KTD A;  1VHS A;  4PSX A;  4KOY A;  3PZJ A;  4UWI A;  1MJB A;  3H4Q A;  2VZY A;  2B4D B;  4KUA A;  2NMT A;  3JUW A;  4KLV A;  2CNS A;  1IB1 E;  2G3A A;  5C82 A;  4H6Z A;  4IUS A;  3TO9 A;  3F8K A;  5E96 A;  1XMT A;  1Q2C A;  2D4O A;  1NE9 A;  4RS2 A;  4Y49 C;  2O28 A;  2H5M A;  3C26 A;  3FIX A;  5F47 A;  5I0C A;  1QSN A;  4MI4 A;  2FT0 A;  4U9Y A;  4R57 A;  4HNY B;  1UFH A;  3UY5 A;  4OAE A;  1S7K A;  2I00 A;  4CS0 B;  4ORF A;  1S7N A;  4CRY B;  3EFA A;  4RI1 A;  5JQ4 A;  4PSW A;  4R87 A;  2VQY A;  3ZJ0 A;  2Z10 A;  2J8N A;  4NXY A;  4NF1 A;  3I9S A;  2Q04 A;  4KVO E;  4PK3 A;  2FE7 A;  1QSO A;  1RO5 A;  1GHE A;  1Q2Y A;  2C27 A;  4DNC A;  2ZW6 A;  4L8A A;  2ZW7 A;  4QVT A;  4L89 A;  1B87 A;  5KTC A;  5DWM A;  1IID A;  4J3G A;  2ATR A;  4U5Y A;  3EY5 A;  1OZP A;  2D4P A;  4CAX A;  4JXQ A;  4QC6 A;  1YVO A;  3D8P A;  1Y9K A;  5ISV A;  1V0C A;  2QML A;  4KLW A;  1S7F A;  4HNX B;  3QAH A;  4XPK A;  4KOX A;  2ZXV A;  4R3K A;  3OWC A;  2PQ8 A;  4X5K A;  1S5K A;  2REF A;  2VZZ A;  2CY2 A;  2B58 A;  3FNC A;  1YX0 A;  2OZG A;  2FIA A;  1SQH A;  3K9U A;  2JLM A;  5J8C A;  1MK4 A;  2R7H A;  4AVC A;  2RC4 A;  2Y0M A;  1YVK A;  3P2F A;  1R57 A;  2ZW4 A;  3I3G A;  2B4B A;  2JEV A;  4KOR A;  4AVB A;  2FS5 A;  3S6H A;  3QB8 A;  2DXQ A;  5F49 A;  4I49 A;  3GY9 A;  4HKF A;  3FXT A;  1QST A;  5KTA A;  2X7B A;  4U9Z A;  5IB0 A;  2B4D A;  3TCV A;  1Z4R A;  3DR8 A;  4R9M A;  2Z11 A;  2IL4 A;  3EO4 A;  2G3T A;  4KOS A;  1B6B A;  4AB7 A;  4LX9 A;  4PV6 A;  3GKR A;  1YK3 A;  4LUA A;  1IYL A;  4K30 A;  2OZU A;  3D2P A;  5HH1 A;  1YRE A;  4H6U A;  4XPD C;  2PC1 A;  4XNH B;  1CJW A;  3S6F A;  2VI7 A;  3WR7 A;  5DWN A;  4EVY A;  5EC4 A;  3TO6 A;  1NSL A;  1VKC A;  2Z0Z A;  4ZBG A;  4II9 A;  4E2A A;  1J4J A;  4JD6 A;  4F0Y A;  4GS4 A;  3BJ7 A;  4FD4 A;  4KZT A;  3E0K A;  2OZH A;  5IX3 A;  1MJA A;  3TO7 A;  2PR1 A;  4NEX A;  3JVN A;  5C88 A;  1M44 A;  1ON0 A;  2EVN A;  2WPW A;  3RYO A;  4E0A A;  2P6E A;  2J8M A;  2R8V A;  3FYN A;  1I1D A;  2F5I A;  3FB3 A;  5HMN A;  3CXQ A;  3N7Z A;  1M4I A;  1RXT A;  2QEC A;  1WK4 A;  3BLN A;  4OAD A;  1PU9 A;  3B8G A;  1TIQ A;  3SXO A;  4YFJ A;  3DNS A;  4B5P B;  2P0W A;  4AG7 A;  2HUZ A;  1YLE A;  2FSR A;  1KUV A;  3FRM A;  1NMT A;  2AE6 A;  2ZPA A;  4B5P A;  1BOB A;  4KOW A;  4PK2 A;  3G3S A;  2OB0 A;  2R1I A;  2VXK A;  4MY0 A;  3R95 A;  2PDO A;  4Y49 B;  4CRZ B;  2R98 A;  4BMH A;  4JXR A;  1Q2D A;  2HQY A;  2FL4 A;  3PP9 A;  4E8O A;  3S6K A;  2Q0Y A;  3TE4 A;  1QSM A;  4H89 A;  5IV0 A;  3MGD A;  4KVX A;  4MBU A;  3DR6 A;  4MJ8 A;  4KOT A;  1CM0 A;  3T90 A;  4QBJ A;  1M1D A;  1S60 A;  2QIR A;  1IIC A;  1XEB A;  4XPL A;  5J8F A;  3D2M A;  3GYA A;  4YRH A;  3V8I A;  1Z9U A;  3F0A A;  4KVM E;  3G8W A;  5H86 A;  3R9G A;  2OU2 A;  5F46 A;  3CXP A;  4B5O A;  2BSW A;  3ZZI A;  4OLL A;  3EC4 A;  4UA3 A;  1KUX A;  4NSQ A;  4QUS A;  2BUE A;  3TOB A;  2KCW A;  1P0H A;  3DSB A;  1Z4E A;  3TOA A;  1I12 A;  5EBV A;  1IYK A;  3SHP A;  3TT2 A;  5H84 A;  2PRB A;  2Q44 A;  1K4J A;  4AG9 A;  4NCZ A;  4AVA A;  1Y7R A;  2P6F A;  5GCN A;  3TTH A;  3R1K A;  2BL1 A;  4MY3 A;  4UBR A;  2FXF A;  4IF5 A;  3NE7 A;  2G0B A;  3FBU A;  4UWJ A;  4M3S A;  1MJ9 A;  2I79 A;  3DDD A;  2PR8 A;  4FD6 A;  2FIW A;  2WPX A;  2VEZ A;  4CAW A;  2Q4V A;  2OH1 A;  3VWE A;  2Q4Y A;  2P6G A;  3F5B A;  3KKW A;  2JDD A;  3IGR A;  4QB9 A;  2B3U A;  2AJ6 A;  3R9F A;  1FY7 A;  5JPH A;  2B3V A;  2A4N A;  2PSW A;  4YGO A;  1KZF A;  2GAN A;  4FD7 A;  2K5T A;  2ARH A;  4F6A A;  2HV2 A;  3LOD A;  2GE3 A;  4KOV A;  2Q7B A;  1N71 A;  2BEI A;  1LRZ A;  4XPD B;  1BO4 A;  3BJ8 A;  4FD5 A;  3CXS A;  4ONU A;  1P4N A;  1XF8 A; 
#chains in the Genus database with same CATH topology
 4OID A;  1Y9W A;  3VAR A;  3W6S A;  4A37 A;  4DJL A;  3EXN A;  4EWT A;  3B3C A;  3B3W A;  4HNW B;  1IY7 A;  3H8F A;  5AG5 A;  5F09 A;  5J1Q A;  2WZN A;  4A38 A;  2GIV A;  4KSF A;  4MHD A;  3W6X A;  3RO0 A;  1L0C A;  2ZW5 A;  2PIY A;  2J8R A;  3A9L A;  3W91 A;  2VBQ A;  2ZEM A;  1I21 A;  4KUB A;  3VWD A;  3CT9 A;  2ABZ A;  4C2Z A;  1Q7L A;  1UWY A;  2C1C A;  3LD2 A;  2POK A;  4UEE A;  4FUU A;  4CAV A;  1YR0 A;  2EUI A;  3MRU A;  3PGP A;  5I4M A;  3HLP A;  1YGH A;  3PB7 X;  2B5G B;  2CXA A;  2PVV A;  1U6M A;  2Z3K A;  2CTB A;  2XEG A;  2YGW A;  3D3S A;  4UFV A;  1IU8 A;  3GB0 A;  4M85 A;  4R3L A;  1QMU A;  2CNM A;  2BCO A;  2CNT A;  2REE A;  4O23 A;  5LYI A;  2IJZ A;  4CAF A;  1QQ9 A;  2JBK A;  2ZEL A;  4MHZ A;  4NGN A;  4JLY A;  5F48 A;  1M4G A;  3NE8 A;  1QSR A;  1M4D A;  4HPS A;  4KOU A;  3NH5 A;  1X10 A;  2B5G A;  1HDU A;  5AG6 A;  1XE4 A;  4XNH C;  1VIX A;  2FCK A;  3VAT A;  2ZOF A;  3RBU A;  2JDC A;  1PUA A;  1S7L A;  3P2H A;  5FVJ A;  3T9Y A;  3TFY A;  4UFX A;  5CNP A;  2IQ6 A;  4TWE A;  5ELY A;  4A39 A;  2PJC A;  4C2Y A;  4FBE A;  3R9E A;  1TKF A;  1Y7E A;  2AFZ A;  1Z8T A;  2VL1 A;  7CPA A;  1F57 A;  3PBB A;  2GLF A;  1XIX A;  4KS9 A;  1TXR A;  4JJX A;  4KSI A;  3FEE A;  3IWG A;  1F2O A;  1WWZ A;  2AFS A;  4B13 A;  1KUY A;  3N5F A;  2Z3M A;  3R96 A;  3WC5 A;  3S6G A;  3TC8 A;  1JWQ A;  1S3Z A;  4JWP A;  4NJR A;  4C7I A;  3B3S A;  3SXN A;  3B3V A;  4NGS A;  5K8O A;  3T8W A;  5KTD A;  1VHS A;  4PSX A;  4KOY A;  3PZJ A;  4UWI A;  3HUV A;  4CAE A;  1MJB A;  5HVH A;  3H4Q A;  1ARM A;  2VZY A;  5EMI A;  3SJG A;  1YSJ A;  6CPA A;  2B4D B;  4B14 A;  4KUA A;  4OIW A;  1PYT B;  2NMT A;  3JUW A;  1CPX A;  4IHM A;  4KLV A;  2ODF A;  3FX6 A;  4G1P A;  3I1U A;  2F7V A;  4GM5 A;  2CNS A;  1IB1 E;  2G3A A;  5K8N A;  3H8G A;  4GXH A;  4P4J A;  5C82 A;  3IIB A;  4OC5 A;  5HXD A;  4H6Z A;  4IUS A;  3TO9 A;  4NJQ A;  4CGM A;  3F8K A;  5E96 A;  3H5Z A;  1XMT A;  2HC9 A;  1Q2C A;  2D4O A;  4B6Z A;  1NE9 A;  2PJ3 A;  3PB4 X;  2OR4 A;  1BPN A;  4RS2 A;  2WUU A;  5G20 A;  2J9A A;  3SJE A;  4Y49 C;  2O28 A;  2H5M A;  3C26 A;  3RNZ A;  3FIX A;  2BO9 A;  4UFW A;  5F47 A;  1XJO A;  1QSN A;  4MI4 A;  2FT0 A;  4U9Y A;  3WC7 A;  5I0C A;  4YU9 A;  4R57 A;  2AFW A;  3BI1 A;  4A33 A;  3QNV A;  5K8P A;  4ONW A;  4HNY B;  2CF4 A;  3K2K A;  1UFH A;  4LQG A;  2CTC A;  2PJ5 A;  4OAE A;  1S7K A;  2I00 A;  2V8D A;  3TX8 A;  3UY5 A;  4ORF A;  4CS0 B;  1S7N A;  4CRY B;  3EFA A;  1KWM A;  1TF9 A;  3DLJ A;  4RI1 A;  5JQ4 A;  2ZEF A;  4P45 A;  4PSW A;  4Q38 A;  4R87 A;  2VQY A;  3ZJ0 A;  3WC6 A;  4C2X A;  5D29 A;  2Z10 A;  2J8N A;  2GLJ A;  4NXY A;  2PJ9 A;  2G9D A;  4NF1 A;  4Q7A A;  4UIB A;  1TKJ A;  3PB6 X;  2XEI A;  3FED A;  4P44 A;  3I9S A;  2Q04 A;  4KVO E;  5JH9 A;  2JBJ A;  4PK3 A;  2FE7 A;  1XMB A;  2QVP A;  1QSO A;  1ZLI A;  1ARL A;  1RO5 A;  1A2Z A;  1TF8 A;  4MFL A;  1GHE A;  1Q2Y A;  2C27 A;  4CPA A;  4MCP A;  4DNC A;  5HVG A;  2ZW6 A;  4L8A A;  4LQ6 A;  4UCN A;  2ZW7 A;  3IJ3 A;  4QVT A;  5IB9 A;  2QJ8 A;  2GRE A;  3KAS A;  3PFE A;  4L89 A;  2YNC A;  4MCQ A;  4P10 A;  4NGM A;  2C6P A;  3SI0 A;  2DEA A;  1B87 A;  4MHN A;  5KTC A;  3D66 A;  5DWM A;  1IID A;  4J3G A;  2PJ8 A;  2ATR A;  4U5Y A;  3EY5 A;  2XEJ A;  4CYP A;  1OZP A;  3PB8 X;  4CGP A;  4ZY1 A;  2EWB A;  1OBR A;  2D4P A;  3BHX A;  3PEI A;  2NYQ A;  4B12 A;  4CAX A;  4JXQ A;  3KHX A;  4QC6 A;  4PXD A;  5JM6 A;  3CDX A;  1YVO A;  3D8P A;  3S9L A;  4OKO A;  1Y9K A;  5ISV A;  1V0C A;  2QML A;  4KLW A;  3QAY A;  1S7F A;  2Q4Z A;  2V77 A;  3QAH A;  4HNX B;  4XPK A;  1EE3 P;  3BXM A;  2I3C A;  2ZXV A;  3KHZ A;  4KOX A;  4F8Z A;  3GUX A;  4EME A;  4WJB A;  4R3K A;  2Z3N A;  3OWC A;  2PQ8 A;  4X5K A;  1S5K A;  2REF A;  2VZZ A;  2DPT A;  5A28 A;  2Z3P A;  2CY2 A;  2O4H A;  2B58 A;  2Q51 A;  3FNC A;  4MXU A;  1YX0 A;  1Z8W A;  2OZG A;  4M6G A;  2FIA A;  1AMP A;  1SQH A;  1LFW A;  1YME A;  4MHP A;  3VH9 A;  2Q7S A;  3K9U A;  5LYL A;  2JLM A;  5J8C A;  4ZI6 A;  1MK4 A;  2R7H A;  4JYW A;  4CYN A;  3IWE A;  4AVC A;  2RC4 A;  4OC4 A;  1DTD A;  4P4B A;  4MHY A;  2GFQ A;  2PRQ A;  2Y0M A;  3PBE A;  4K3N A;  1YVK A;  3P2F A;  5AG7 A;  2WYR A;  1CP7 A;  1R57 A;  2ZW4 A;  3I3G A;  5LYF A;  2ZEG A;  2B4B A;  3LMS A;  2JEV A;  4KOR A;  1H8L A;  3SI1 A;  4CGL A;  1ELM P;  4M6I A;  2FS5 A;  4X2T A;  3QB8 A;  3S6H A;  4AVB A;  2JEW A;  2DXQ A;  4ZYQ A;  2ZOG A;  4BIN A;  4F9U A;  5CBM A;  2PVW A;  4UIA A;  5F49 A;  3B7I A;  4YWY A;  4ZX8 A;  5G1Z A;  1CBX A;  1YLO A;  3GY9 A;  1VGY A;  4HKF A;  4I49 A;  4NGR A;  2FVG A;  1VHO A;  1QST A;  2EO8 A;  3FXT A;  2X7B A;  4U9Z A;  3SJF A;  5KTA A;  2PJ4 A;  3D68 A;  2AFU A;  3RZA A;  5G22 A;  1NSA A;  2B4D A;  5IB0 A;  2C6C A;  4OC1 A;  3TCV A;  4A31 A;  1Z4R A;  2Z3O A;  1IOF A;  3DR8 A;  4R9M A;  2Z11 A;  2IL4 A;  5DS0 A;  1IOI A;  3EO4 A;  4OC0 A;  4OP4 A;  2G3T A;  3IFE A;  1B6B A;  4KOS A;  4AB7 A;  4C68 A;  1VHE A;  4LX9 A;  4F0X A;  4AXV A;  4Z65 A;  4PV6 A;  4DYO A;  3FVL A;  3SI2 A;  3GKR A;  1YK3 A;  4LUA A;  1IYL A;  1Y0R A;  1HEE A;  4K30 A;  4OC3 A;  2DPS A;  2OZU A;  3D2P A;  5HH1 A;  1CG2 A;  1YRE A;  3KR5 A;  4H6U A;  4XPD C;  2PC1 A;  3B3T A;  4DUK A;  1ZG7 A;  3FJU A;  4XNH B;  1CJW A;  3S6F A;  1ZO0 A;  2VI7 A;  2ZEH A;  4PXC A;  2OOT A;  3WR7 A;  4CYQ A;  5DWN A;  4EVY A;  3FMC A;  1YW4 A;  5EC4 A;  3TO6 A;  4RN7 A;  1NSL A;  1FT7 A;  1LAN A;  1VKC A;  2Z0Z A;  4ZBG A;  4II9 A;  2PJ2 A;  1HDQ A;  2ZED A;  4E2A A;  1J4J A;  4JD6 A;  4F0Y A;  4GS4 A;  1BAV A;  2EK8 A;  3BJ7 A;  3KQZ A;  1AUG A;  3E0K A;  4FD4 A;  4KZT A;  4R6T A;  4CYO A;  2PJ0 A;  2OZH A;  5LRK A;  5IX3 A;  3GIU A;  1MJA A;  3TO7 A;  3V7Z A;  2PR1 A;  3BI0 A;  2ZEP A;  4NEX A;  3JVN A;  4A32 A;  5C88 A;  3DGV A;  3D7G A;  1M44 A;  3ISZ A;  3JTK A;  1ON0 A;  4MFQ A;  1JQG A;  2EVN A;  2WPW A;  4F9V A;  3RYO A;  2EK9 A;  4E0A A;  2P6E A;  2J8M A;  4MCS A;  4X8I A;  3IU2 A;  2R8V A;  3NH4 A;  5CPA A;  3FYN A;  1I1D A;  2F5I A;  3FB3 A;  5HMN A;  3CXQ A;  4FWU A;  3N7Z A;  1M4I A;  1RXT A;  1ZLH A;  4A30 A;  4NGQ A;  3PB9 X;  1XOV A;  1WK4 A;  2QEC A;  2O53 A;  2QYV A;  5D8N A;  3BLN A;  4PPZ A;  4CGO A;  3IO1 A;  4OAD A;  1PU9 A;  3B8G A;  1TIQ A;  4P6Y A;  4P4F A;  4W9Y A;  1PCA A;  3SXO A;  3JRU A;  2V8G A;  4YFJ A;  2PJ6 A;  3DNS A;  4B5P B;  4OC2 A;  1XFO A;  2P0W A;  1Z5R A;  5HVF A;  4PQA A;  2PJ7 A;  4NGP A;  2HUZ A;  4AG7 A;  1YLE A;  4X3R A;  2FSR A;  1KUV A;  1IGB A;  2YNE A;  3FRM A;  1NMT A;  3IC1 A;  3NH8 A;  2AE6 A;  2ZPA A;  4B5P A;  1BOB A;  4KOW A;  4PK2 A;  3G3S A;  2OB0 A;  2R1I A;  2PCU A;  2VXK A;  3NFZ A;  4MY0 A;  3R95 A;  2PDO A;  4Y49 B;  4CRZ B;  2R98 A;  4EFD A;  5AG4 A;  4BMH A;  4JXR A;  1Q2D A;  4UF4 A;  1XBU A;  4MCR A;  2HQY A;  2FL4 A;  4A2Z A;  1ZG8 A;  4ZGY B;  2Z3L A;  3PP9 A;  4E8O A;  3D7H A;  4JZ0 A;  3S6K A;  4R76 A;  2Q0Y A;  4MRI A;  3TE4 A;  1QSM A;  3PRT A;  4H89 A;  5IV0 A;  3MGD A;  3WAB A;  3FEC A;  3MN8 A;  4KVX A;  2ZEN A;  3KQX A;  4UEF A;  4MBU A;  4IAV A;  3DR6 A;  4MJ8 A;  3RAM A;  3NA6 A;  4KOT A;  1CM0 A;  3LWU A;  4RUH A;  3T90 A;  4QBJ A;  1Z8L A;  2AFX A;  1M1D A;  1S60 A;  2IMO A;  1IIC A;  2QIR A;  1XEB A;  4KSA A;  4XPL A;  5J8F A;  3D2M A;  3GYA A;  3KR4 A;  4YRH A;  2XEF A;  4B10 A;  4CGN A;  4OME A;  1ZG9 A;  3V8I A;  1Z9U A;  2GU2 A;  3CPX A;  3K9T A;  3CPA A;  4UCM A;  4R7M A;  5LYD A;  3F0A A;  4KVM E;  4FAI A;  4MFZ A;  3G8W A;  2ZEE A;  5H86 A;  3R9G A;  2HB6 A;  2PJB A;  3PFO A;  2ZEO A;  4IK2 A;  2OU2 A;  5F46 A;  2V8H A;  3CXP A;  1FNO A;  4B5O A;  1YQE A;  1M4L A;  3IEH A;  2BSW A;  3IU1 A;  3ZZI A;  4NGT A;  4OLL A;  2NSM A;  3EC4 A;  4UA3 A;  2PJA A;  4TNU A;  1KUX A;  1LAM A;  4NSQ A;  1F2P A;  4QUS A;  1LOK A;  3KGQ A;  2BUE A;  4R8F A;  4BD9 A;  5BWA B;  4H2K A;  3D67 A;  1BLL E;  3TOB A;  2PIZ A;  2KCW A;  1P0H A;  3DSB A;  2BOA A;  1Z4E A;  4MFP A;  3TOA A;  3FF3 A;  1I12 A;  5EBV A;  1IYK A;  2WSA A;  3SHP A;  3GLJ A;  3TT2 A;  5H84 A;  1XRY A;  1Z2L A;  2AFO A;  2PRB A;  2Q44 A;  1K4J A;  4AG9 A;  4NCZ A;  1GYT A;  4A95 A;  4AVA A;  5LRJ A;  1Y7R A;  2DF5 A;  4MMO A;  2P6F A;  2YNC C;  4MFJ A;  1Z8X A;  3WT4 A;  5GCN A;  1CPS A;  4UCP A;  3TTH A;  1R3N A;  3D7D A;  3R1K A;  2BL1 A;  4MFK A;  4MY3 A;  4UBR A;  3B2Y A;  2FXF A;  2F8H A;  4IF5 A;  2ANP A;  3IWW A;  4Q36 A;  3S9N A;  2PE3 A;  3H8E A;  4P4E A;  1CX8 A;  2EBJ A;  3NE7 A;  3ISX A;  2G0B A;  3FBU A;  4UWJ A;  4M3S A;  1MJ9 A;  2I79 A;  4NFR A;  5AGE A;  1TKH A;  4P4I A;  3DDD A;  3LAC A;  1LAP A;  2PR8 A;  3KL9 A;  5JGF A;  4FD6 A;  2FIW A;  1CP6 A;  2Q43 A;  4WWV A;  4ZX9 A;  2WPX A;  2VEZ A;  5A27 A;  5G21 A;  4CAW A;  1AYE A;  2Q4V A;  2OH1 A;  3VWE A;  8CPA A;  2CIJ A;  2Q4Y A;  2P6G A;  2RB7 A;  4ZY0 A;  3FH4 A;  3F5B A;  3KKW A;  2JDD A;  2AFM A;  3KI9 A;  4UEZ A;  5LRG A;  3IGR A;  4QB9 A;  2B3U A;  3L2N A;  4B11 A;  2RFH A;  3CZX A;  2AJ6 A;  3D7F A;  1Y0Y A;  1R43 A;  3R9F A;  1BPM A;  1DE4 C;  2C6G A;  4M6H A;  1FY7 A;  1RTQ A;  2V8V A;  5JPH A;  3B35 A;  3S9M A;  2B3V A;  4P4D A;  2A4N A;  2PSW A;  4YGO A;  1KZF A;  4A94 A;  1YW6 A;  4PXE A;  4BBH A;  3SJX A;  3D4U A;  2GAN A;  1LCP A;  4C7H A;  4FD7 A;  2PJ1 A;  2K5T A;  3V38 A;  5K8M A;  2ARH A;  4ZY2 A;  4F6A A;  2HV2 A;  3LOD A;  2GE3 A;  4KOV A;  2Q7B A;  1N71 A;  2BEI A;  1X12 A;  1LRZ A;  4XPD B;  4PXB A;  1BO4 A;  5THW A;  3BJ8 A;  4FD5 A;  3CXS A;  4ONU A;  3KZW A;  1P4N A;  1ELL P;  1XF8 A;  2YND A; 
#chains in the Genus database with same CATH homology
 1Y9W A;  3W6S A;  3EXN A;  4HNW B;  5AG5 A;  2GIV A;  4KSF A;  4MHD A;  3W6X A;  1L0C A;  2ZW5 A;  2J8R A;  3A9L A;  3W91 A;  2VBQ A;  1I21 A;  4KUB A;  3VWD A;  4C2Z A;  3LD2 A;  4CAV A;  1YR0 A;  2EUI A;  3PGP A;  1YGH A;  2B5G B;  2CXA A;  2Z3K A;  1U6M A;  4UFV A;  2YGW A;  3D3S A;  4M85 A;  4R3L A;  2CNM A;  2CNT A;  2REE A;  4CAF A;  4JLY A;  5F48 A;  1M4G A;  1QSR A;  1M4D A;  4KOU A;  2B5G A;  5AG6 A;  1XE4 A;  4XNH C;  2FCK A;  2JDC A;  1PUA A;  1S7L A;  3P2H A;  5FVJ A;  3T9Y A;  3TFY A;  4UFX A;  5CNP A;  4C2Y A;  3R9E A;  1XIX A;  4KS9 A;  4JJX A;  3IWG A;  1WWZ A;  4B13 A;  1KUY A;  2Z3M A;  3R96 A;  3S6G A;  1S3Z A;  4JWP A;  4C7I A;  3SXN A;  5KTD A;  1VHS A;  4PSX A;  4KOY A;  3PZJ A;  4UWI A;  4CAE A;  1MJB A;  3H4Q A;  2VZY A;  2B4D B;  4B14 A;  4KUA A;  2NMT A;  3JUW A;  4KLV A;  2CNS A;  1IB1 E;  2G3A A;  5C82 A;  4H6Z A;  4IUS A;  3TO9 A;  4CGM A;  3F8K A;  5E96 A;  3H5Z A;  1XMT A;  1Q2C A;  2D4O A;  1NE9 A;  4RS2 A;  2WUU A;  5G20 A;  4Y49 C;  2O28 A;  2H5M A;  3C26 A;  3FIX A;  4UFW A;  5F47 A;  5I0C A;  1QSN A;  4MI4 A;  2FT0 A;  4U9Y A;  4R57 A;  4A33 A;  4HNY B;  1UFH A;  3UY5 A;  4OAE A;  1S7K A;  2I00 A;  4CS0 B;  4ORF A;  1S7N A;  4CRY B;  3EFA A;  4RI1 A;  5JQ4 A;  4Q38 A;  4PSW A;  4R87 A;  2VQY A;  3ZJ0 A;  4C2X A;  2Z10 A;  2J8N A;  4NXY A;  4NF1 A;  3I9S A;  2Q04 A;  4KVO E;  4PK3 A;  2FE7 A;  1QSO A;  1RO5 A;  4MFL A;  1GHE A;  1Q2Y A;  2C27 A;  4DNC A;  2ZW6 A;  4L8A A;  4UCN A;  2ZW7 A;  4QVT A;  4L89 A;  2YNC A;  1B87 A;  5KTC A;  5DWM A;  1IID A;  4J3G A;  2ATR A;  4U5Y A;  3EY5 A;  4CYP A;  1OZP A;  4CGP A;  2D4P A;  4B12 A;  4CAX A;  4JXQ A;  4QC6 A;  1YVO A;  3D8P A;  1Y9K A;  5ISV A;  1V0C A;  2QML A;  4KLW A;  1S7F A;  4HNX B;  3QAH A;  4XPK A;  4KOX A;  2ZXV A;  4R3K A;  2Z3N A;  3OWC A;  2PQ8 A;  4X5K A;  1S5K A;  2REF A;  2VZZ A;  2DPT A;  5A28 A;  2Z3P A;  2CY2 A;  2B58 A;  3FNC A;  1YX0 A;  2OZG A;  2FIA A;  1SQH A;  3K9U A;  2JLM A;  5J8C A;  1MK4 A;  2R7H A;  4CYN A;  3IWE A;  4AVC A;  2RC4 A;  2Y0M A;  5AG7 A;  1YVK A;  3P2F A;  1R57 A;  2ZW4 A;  3I3G A;  2B4B A;  2JEV A;  4KOR A;  4CGL A;  4AVB A;  2FS5 A;  3S6H A;  3QB8 A;  2DXQ A;  5F49 A;  5G1Z A;  4I49 A;  3GY9 A;  4HKF A;  3FXT A;  1QST A;  5KTA A;  2X7B A;  4U9Z A;  5IB0 A;  5G22 A;  2B4D A;  3TCV A;  4A31 A;  1Z4R A;  2Z3O A;  3DR8 A;  4R9M A;  2Z11 A;  2IL4 A;  3EO4 A;  2G3T A;  4KOS A;  1B6B A;  4AB7 A;  4C68 A;  4F0X A;  4LX9 A;  4PV6 A;  3GKR A;  1YK3 A;  4LUA A;  1IYL A;  4K30 A;  2DPS A;  2OZU A;  3D2P A;  5HH1 A;  1YRE A;  4H6U A;  4XPD C;  2PC1 A;  4XNH B;  1CJW A;  3S6F A;  1ZO0 A;  2VI7 A;  3WR7 A;  4CYQ A;  5DWN A;  4EVY A;  5EC4 A;  3TO6 A;  1NSL A;  1VKC A;  2Z0Z A;  4ZBG A;  4II9 A;  4E2A A;  1J4J A;  4JD6 A;  4F0Y A;  4GS4 A;  3BJ7 A;  4FD4 A;  4KZT A;  3E0K A;  4CYO A;  2OZH A;  5IX3 A;  1MJA A;  3TO7 A;  2PR1 A;  4NEX A;  3JVN A;  4A32 A;  5C88 A;  1M44 A;  3JTK A;  1ON0 A;  4MFQ A;  2EVN A;  2WPW A;  3RYO A;  4E0A A;  2P6E A;  2J8M A;  3IU2 A;  2R8V A;  3FYN A;  1I1D A;  2F5I A;  3FB3 A;  5HMN A;  3CXQ A;  3N7Z A;  1M4I A;  1RXT A;  4A30 A;  2QEC A;  1WK4 A;  4CGO A;  3BLN A;  4OAD A;  1PU9 A;  3B8G A;  1TIQ A;  3SXO A;  4YFJ A;  3DNS A;  4B5P B;  2P0W A;  4AG7 A;  2HUZ A;  1YLE A;  2FSR A;  1KUV A;  2YNE A;  3FRM A;  1NMT A;  2AE6 A;  2ZPA A;  4B5P A;  1BOB A;  4KOW A;  4PK2 A;  3G3S A;  2OB0 A;  2R1I A;  2VXK A;  4MY0 A;  3R95 A;  2PDO A;  4Y49 B;  4CRZ B;  2R98 A;  5AG4 A;  4BMH A;  4JXR A;  1Q2D A;  2HQY A;  2FL4 A;  4A2Z A;  4ZGY B;  2Z3L A;  3PP9 A;  4E8O A;  3S6K A;  2Q0Y A;  3TE4 A;  1QSM A;  4H89 A;  5IV0 A;  3MGD A;  4KVX A;  4MBU A;  3DR6 A;  4MJ8 A;  4KOT A;  1CM0 A;  3T90 A;  4QBJ A;  1M1D A;  1S60 A;  2QIR A;  1IIC A;  1XEB A;  4KSA A;  4XPL A;  5J8F A;  3D2M A;  3GYA A;  4YRH A;  4B10 A;  4CGN A;  3V8I A;  1Z9U A;  4UCM A;  3F0A A;  4KVM E;  4MFZ A;  3G8W A;  5H86 A;  3R9G A;  2OU2 A;  5F46 A;  3CXP A;  4B5O A;  2BSW A;  3IU1 A;  3ZZI A;  4OLL A;  3EC4 A;  4UA3 A;  1KUX A;  4NSQ A;  4QUS A;  5BWA B;  2BUE A;  3TOB A;  2KCW A;  1P0H A;  3DSB A;  1Z4E A;  4MFP A;  3TOA A;  1I12 A;  5EBV A;  1IYK A;  2WSA A;  3SHP A;  3TT2 A;  5H84 A;  2PRB A;  2Q44 A;  1K4J A;  4AG9 A;  4NCZ A;  4A95 A;  4AVA A;  1Y7R A;  2P6F A;  2YNC C;  4MFJ A;  5GCN A;  4UCP A;  3TTH A;  3R1K A;  2BL1 A;  4MFK A;  4MY3 A;  4UBR A;  2FXF A;  4IF5 A;  4Q36 A;  3NE7 A;  2G0B A;  3FBU A;  4UWJ A;  4M3S A;  1MJ9 A;  2I79 A;  5AGE A;  3DDD A;  2PR8 A;  4FD6 A;  2FIW A;  2WPX A;  2VEZ A;  5A27 A;  5G21 A;  4CAW A;  2Q4V A;  2OH1 A;  3VWE A;  2Q4Y A;  2P6G A;  3F5B A;  3KKW A;  2JDD A;  3IGR A;  4QB9 A;  2B3U A;  4B11 A;  2AJ6 A;  3R9F A;  1FY7 A;  5JPH A;  2B3V A;  2A4N A;  2PSW A;  4YGO A;  1KZF A;  4BBH A;  2GAN A;  4C7H A;  4FD7 A;  2K5T A;  2ARH A;  4F6A A;  2HV2 A;  3LOD A;  2GE3 A;  4KOV A;  2Q7B A;  1N71 A;  2BEI A;  1LRZ A;  4XPD B;  1BO4 A;  3BJ8 A;  4FD5 A;  3CXS A;  4ONU A;  1P4N A;  1XF8 A;  2YND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...