2OZHA

Crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
GMPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFARVISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYGFTPPLFPQSLMERYVPGLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XCC2953
publication title Crystal structure of hypothetical protein (NP_638301.1) from Xanthomonas campestris at 1.40 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 34
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozhA01
1PU9A 2VXKA 1YX0A 2B4DB 3UY5A 1QSTA 2VBQA 3EXNA 3TOBA 3TO6A 4UWIA 3JUWA 4FD5A 3NE7A 2X7BA 4KUBA 2D4OA 2O28A 5F47A 1XIXA 5DWNA 1I12A 1Y9WA 4FD7A 2OZUA 1Q2YA 2J8NA 1ON0A 4RI1A 1QSOA 3B8GA 2JLMA 2R98A 2H5MA 3FXTA 1TIQA 5EBVA 3MGDA 4ORFA 2ZXVA 5F46A 4MJ8A 5H84A 5GCNA 3TO7A 2DXQA 3T9YA 4YFJA 1QSMA 1YK3A 4K30A 1Q2CA 3BLNA 2JEVA 3TTHA 2FXFA 2CNTA 3EFAA 1Y7RA 1S7FA 1Z4EA 3QAHA 2GANA 1YGHA 2ZW4A 3R1KA 1K4JA 3LODA 5KTAA 2BSWA 4JWPA 5H86A 1S5KA 2Z0ZA 4II9A 4KOTA 4XPKA 1QSNA 2PRBA 2FE7A 3DNSA 4QBJA 4PK3A 4M3SA 2C27A 2B58A 1XE4A 1MJ9A 4L89A 4OADA 3T90A 4KZTA 2FIAA 3FYNA 5DWMA 4PSWA 4UA3A 3D2PA 3R9FA 2FCKA 1XEBA 4R57A 4HKFA 3D3SA 3DR6A 2CY2A 2WPXA 3QB8A 2EUIA 5JPHA 4I49A 4YGOA 4JXRA 3D2MA 5J8CA 4H89A 2B5GB 1YREA 3SXOA 3IWGA 1GHEA 1KZFA 3BJ7A 2FT0A 4QC6A 4B5PA 2FIWA 1MJBA 5E96A 2Q0YA 2BUEA 3SXNA 3C26A 4XPDC 2ZW7A 4E2AA 3P2FA 4PV6A 5KTCA 3TE4A 4KVOE 4KORA 4UBRA 4HNWB 3PGPA 3FB3A 1PUAA 2G0BA 3R9GA 2HV2A 5IX3A 1YLEA 3W91A 1KUVA 3EY5A 3FBUA 3F8KA 4NF1A 4KOWA 4FD4A 5IV0A 4AG9A 2P6EA 4XPDB 4PSXA 1WWZA 1I1DA 2J8RA 5F48A 2JDDA 4KVXA 1L0CA 1S7NA 2AE6A 4M85A 2EVNA 4ONUA 2P6GA 2F5IA 3R96A 2OZGA 1LRZA 2Q4VA 1IIDA 4J3GA 1MK4A 5C82A 1M1DA 3D8PA 3EO4A 4KLVA 3VWEA 3S6HA 2J8MA 1YR0A 3R95A 2REFA 2PSWA 4OLLA 2PQ8A 1N71A 1XF8A 2Z11A 2CNMA 4CAVA 2BEIA 3I9SA 3S6FA 1IICA 4R3LA 4QB9A 2K5TA 2VI7A 1WK4A 2OU2A 4L8AA 2A4NA 4OAEA 3H4QA 2G3TA 4AG7A 4HNYB 4IUSA 3DR8A 2HUZA 2ZW6A 1MJAA 2QECA 5CNPA 4RS2A 4R3KA 2FL4A 1SQHA 3GYAA 4B5OA 2OB0A 3CXSA 4CAXA 2KCWA 2ZPAA 3S6GA 4U9ZA 1S3ZA 1B87A 4UWJA 5ISVA 2REEA 2R8VA 1M4GA 2CNSA 4MHDA 3ZZIA 2OH1A 2AJ6A 4KLWA 2P6FA 2PR8A 3CXPA 5KTDA 1NSLA 4MI4A 4AVCA 2GIVA 2Z10A 3N7ZA 5I0CA 2Q4YA 3P2HA 1P4NA 2QMLA 1YVKA 4PK2A 1KUYA 3IGRA 2PC1A 1KUXA 4AB7A 3VWDA 2JDCA 5JQ4A 3G3SA 4JLYA 4LUAA 2HQYA 5J8FA 4CS0B 1J4JA 2Q04A 1BOBA 4KVME 4ZBGA 3R9EA 2Q44A 3TO9A 3DDDA 3JVNA 4HNXB 1IYKA 1BO4A 4NXYA 4Y49C 2B4BA 4EVYA 5HH1A 5EC4A 4CAWA 3F5BA 3PZJA 2WPWA 3OWCA 1U6MA 4NEXA 4Y49B 3WR7A 4E0AA 1V0CA 1NMTA 3KKWA 4QVTA 4JD6A 5F49A 3FRMA 1S60A 1I21A 2VZZA 5FVJA 2B3VA 4XNHB 1VKCA 3LD2A 3TFYA 1S7KA 2B4DA 2IL4A 3G8WA 1NE9A 4KUAA 4JJXA 3E0KA 2OZHA 1S7LA 2ZW5A 1M4IA 2FSRA 4F6AA 2NMTA 4U5YA 2VZYA 4E8OA 3RYOA 4NCZA 1RO5A 4MBUA 4KOVA 1IB1E 1P0HA 2R7HA 1OZPA 2G3AA 1Q2DA 1R57A 5HMNA 1M44A 4KOSA 4U9YA 3ZJ0A 4AVAA 4BMHA 3FNCA 2D4PA 3CXQA 3S6KA 3PP9A 3SHPA 4AVBA 1CM0A 3FIXA 4H6ZA 3W6XA 1UFHA 4B5PB 4JXQA 3I3GA 1RXTA 3GKRA 3TOAA 3TCVA 3TT2A 2FS5A 4IF5A 1CJWA 4MY3A 2ARHA 4X5KA 2B3UA 4KOXA 2VEZA 1FY7A 1YVOA 4LX9A 3GY9A 1Y9KA 2I79A 1VHSA 4XPLA 5C88A 3F0AA 1XMTA 1Z9UA 2QIRA 4YRHA 2Q7BA 3DSBA 2PDOA 4NSQA 5IB0A 3K9UA 2I00A 2P0WA 1QSRA 4MY0A 4R9MA 3W6SA 2VQYA 4H6UA 2B5GA 1B6BA 4KOUA 3V8IA 4FD6A 2R1IA 2BL1A 2GE3A 1IYLA 1Z4RA 4XNHC 3BJ8A 4DNCA 4R87A 4F0YA 2PR1A 4QUSA 2ATRA 4CRZB 2RC4A 3EC4A 1M4DA 4CRYB 2Y0MA 4KOYA 4GS4A
chains in the Genus database with same CATH superfamily
3PFEA 1XBUA 2AFOA 1PU9A 4MHNA 2VXKA 1YX0A 2XEGA 3FMCA 1BPMA 2B4DB 3UY5A 4ZX9A 5A27A 2O4HA 4CYOA 1QSTA 2VBQA 2AFUA 3EXNA 4P44A 1Z2LA 3TOBA 3TO6A 1TF9A 1RTQA 2PJ6A 4CGMA 4B13A 2PJ8A 2CIJA 2XEIA 4UWIA 3KGQA 5F09A 3JUWA 4FD5A 3NE7A 2X7BA 3MN8A 3D7DA 3N5FA 4KUBA 2D4OA 2O28A 3CZXA 3H8EA 3FH4A 5F47A 4MFKA 1XIXA 4PXCA 1I12A 2AFZA 5DWNA 3WT4A 4A31A 4P4FA 1Y9WA 4K3NA 4FD7A 2OZUA 2PIYA 1Q2YA 2J8NA 3B7IA 5G22A 1ON0A 2ANPA 2ODFA 4RI1A 1QSOA 4OC1A 4C2ZA 3S9NA 3B8GA 2JLMA 2R98A 1TXRA 5AG4A 2H5MA 3FXTA 3BI1A 1ZG8A 3D67A 1TIQA 1IOFA 3GLJA 5EBVA 3MGDA 4ORFA 5AG7A 1XFOA 2ZEDA 2ZXVA 4M6GA 1ELLP 4GXHA 4NGNA 4ZY1A 5F46A 2PJ5A 4MJ8A 3KI9A 3KZWA 4A2ZA 5H84A 3B2YA 5GCNA 4ZYQA 3TO7A 5AG5A 1TF8A 2FVGA 4Q36A 2DXQA 2PCUA 4A32A 2WZNA 3IC1A 3T9YA 4YFJA 1QSMA 1YK3A 4K30A 4P4DA 1ARLA 4UIBA 1Q2CA 3BLNA 2JEVA 4ZX8A 3TTHA 2FXFA 2PRQA 2ZEEA 3CT9A 2CNTA 3NH8A 3EFAA 3PEIA 1M4LA 4CGLA 1Y7RA 1S7FA 1Z4EA 5AG6A 1LANA 3QAHA 5CBMA 2GANA 2Z3LA 1YGHA 2ZW4A 3R1KA 1K4JA 2PJBA 1LOKA 3LODA 5KTAA 2BSWA 4JWPA 5H86A 2V77A 1S5KA 2Z0ZA 3IU1A 3JRUA 4A37A 4II9A 4KOTA 4XPKA 1QSNA 2PRBA 1Z5RA 2FE7A 3DNSA 3IO1A 3MRUA 4QBJA 4PK3A 4M3SA 4C7IA 2CTCA 2C27A 2B58A 1XE4A 1MJ9A 4PXDA 4L89A 4OADA 3T90A 1CP7A 4KZTA 3KHZA 5CPAA 1OBRA 1JQGA 2FIAA 3FYNA 3LMSA 3IU2A 3KR4A 5DWMA 2ZEGA 3LWUA 4PSWA 4UA3A 3D2PA 4C2XA 3R9FA 2FCKA 1XEBA 4R57A 1XRYA 3D3SA 3DR6A 4HKFA 2CY2A 2WPXA 3QB8A 3IIBA 3SI0A 2EUIA 2VL1A 4EFDA 5JPHA 4I49A 2AFXA 4YGOA 4JXRA 1VHOA 2XEJA 3D2MA 3KQXA 4H89A 2B5GB 5J8CA 1YREA 5K8PA 3SXOA 3IWGA 3NH4A 4BD9A 1GHEA 1KZFA 3BJ7A 1UWYA 2FT0A 4QC6A 4MMOA 4LQGA 2FIWA 4B5PA 1MJBA 3RBUA 5K8MA 1ARMA 5E96A 3SJGA 2Q0YA 3CDXA 2BUEA 2ZOFA 3SXNA 3C26A 1ZO0A 2WUUA 1PCAA 2ZW7A 4P4EA 4XPDC 3VARA 1IU8A 3QNVA 3SI1A 4MCRA 1Y0YA 4E2AA 3P2FA 4PV6A 5KTCA 3TE4A 4KVOE 2PJ1A 4X3RA 4KORA 4UBRA 4CYPA 4HNWB 3PGPA 3FB3A 1BAVA 2HB6A 2O53A 3KQZA 1PUAA 2G0BA 3CPAA 3R9GA 2Z3PA 2HV2A 4B12A 5IX3A 3K9TA 1YLEA 3W91A 1KUVA 3EY5A 3FBUA 4HPSA 1TKHA 3IJ3A 1VGYA 4R8FA 2DEAA 3H5ZA 3F8KA 4NF1A 4OIDA 5AGEA 4KSAA 1BPNA 4KOWA 4FD4A 5IV0A 4R7MA 4AG9A 2P6EA 2V8VA 4XPDB 4A94A 4KS9A 4DYOA 1DTDA 2PJAA 4OP4A 4PSXA 1WWZA 2V8HA 4NJRA 8CPAA 1I1DA 5ELYA 1A2ZA 2J8RA 1AMPA 1BLLE 2PVWA 4X2TA 4NGMA 5LYLA 2ZEFA 5F48A 1F2OA 2GREA 3HLPA 4MCSA 1FNOA 2JDDA 1PYTB 4KVXA 1L0CA 2YGWA 1S7NA 2AE6A 2DF5A 4M85A 3DLJA 2EVNA 2F8HA 4ONUA 2P6GA 3WC6A 3SI2A 4MHPA 3B3WA 4A95A 2F5IA 2Z3KA 3R96A 3S9MA 2OZGA 2F7VA 1LRZA 2Q4VA 1F2PA 4UCPA 2ZEOA 1IIDA 4J3GA 1Z8LA 1MK4A 5G21A 2YNCA 2EBJA 3SJXA 4B11A 5HVHA 5C82A 1M1DA 3D8PA 3EO4A 3FEDA 4KLVA 3VWEA 3S6HA 2I3CA 2J8MA 1YR0A 2WYRA 3GB0A 3R95A 5IB9A 2REFA 2PSWA 4ONWA 4PPZA 4NGTA 4OLLA 2PQ8A 1N71A 1XF8A 1YMEA 2AFSA 2Z11A 2CNMA 4X8IA 2BEIA 3I9SA 4M6HA 4CAFA 4CAVA 5K8OA 5LRKA 4UEZA 4KSFA 1IICA 4P45A 3S6FA 4R3LA 5J1QA 1VIXA 4IAVA 4QB9A 3QAYA 1ZG9A 2K5TA 2ZOGA 2VI7A 4UIAA 2DPSA 3H8FA 1WK4A 2OU2A 5I4MA 4L8AA 2A4NA 3FECA 4NGSA 5LYFA 2RB7A 3H4QA 2G3TA 1AUGA 4OAEA 3TX8A 4AG7A 2DPTA 3PRTA 1LAMA 4HNYB 4IUSA 3DR8A 4Q38A 4KSIA 2HUZA 2ZW6A 3GUXA 1MJAA 2QECA 2EWBA 4EWTA 1Z8XA 2JBKA 5CNPA 3RO0A 4CAEA 4RS2A 4R3KA 4W9YA 2FL4A 1ZLIA 1SQHA 1H8LA 4RUHA 3GYAA 4B5OA 4O23A 2OB0A 3CXSA 3B3VA 2YNDA 3H8GA 2KCWA 4CAXA 4OC5A 2PJ3A 4MFJA 2GLJA 2ZPAA 4Z65A 1XJOA 3S6GA 4R6TA 2NYQA 3BI0A 2CTBA 3FVLA 1S3ZA 1LCPA 4U9ZA 3TC8A 3D7FA 1B87A 4UWJA 5ISVA 4UF4A 1Y0RA 2R8VA 2REEA 3WC5A 1M4GA 2IQ6A 1DE4C 4BINA 5LYIA 4TWEA 2CNSA 4MHDA 4CGNA 2HC9A 4PQAA 3ZZIA 2OH1A 4MRIA 2AJ6A 4KLWA 2P6FA 2PE3A 2PR8A 3PB6X 1CX8A 1TKFA 6CPAA 3CXPA 4B14A 5KTDA 5G1ZA 4CPAA 3BXMA 3PBBA 3B35A 1NSLA 3FJUA 4MI4A 1QQ9A 1YW6A 3A9LA 5G20A 4AVCA 2GIVA 2Z10A 3N7ZA 5I0CA 5JM6A 2Q4YA 4F8ZA 3P2HA 1IY7A 1IGBA 4B10A 1P4NA 2QMLA 1YVKA 3SJFA 4PK2A 3NFZA 4P4JA 4UEFA 1KUYA 3IGRA 2PC1A 1KUXA 4AB7A 3VWDA 5DS0A 1ZLHA 2JDCA 4OC3A 4H2KA 1HEEA 5JQ4A 3G3SA 4JLYA 2POKA 2V8DA 4LUAA 2HQYA 5J8FA 1CPXA 4CS0B 1J4JA 3B3CA 4MCPA 3FX6A 2Q04A 1BOBA 2JBJA 2BCOA 4KVME 3PB8X 4P4BA 4ZY2A 4ZBGA 5A28A 1YQEA 3R9EA 2AFWA 2Q44A 2YNCC 3TO9A 2C6PA 2PJ0A 2V8GA 3DDDA 3JVNA 4HNXB 4MFQA 1IYKA 1BO4A 4NXYA 4PXBA 4Y49C 2B4BA 4EVYA 4NGRA 5HH1A 4GM5A 3V38A 5EC4A 4DJLA 4CAWA 4MFPA 4B6ZA 3FEEA 3CPXA 1TKJA 3F5BA 3GIUA 3PZJA 3PFOA 4Q7AA 2Q51A 4MHYA 4YU9A 4WWVA 5D29A 4OC0A 4P6YA 1ZG7A 2WPWA 5LYDA 1YSJA 4MFZA 1KWMA 2PJ7A 4IHMA 1IOIA 4OC2A 3KHXA 3D4UA 2ZEHA 3S9LA 3OWCA 3PB4X 1CG2A 3L2NA 4A33A 1U6MA 3PB7X 4MXUA 4UCNA 4NEXA 2EO8A 4Y49B 3WR7A 4E0AA 3IEHA 2PVVA 3IFEA 1V0CA 2CF4A 2WSAA 1CP6A 1NMTA 3KKWA 4QVTA 1F57A 4IK2A 2OOTA 4JD6A 5F49A 1S60A 2J9AA 1I21A 2VZZA 3FRMA 5FVJA 2B3VA 3NA6A 4NGPA 4XNHB 1VKCA 4ZI6A 3LD2A 3WC7A 3B3SA 3TFYA 2ZEPA 4C7HA 2EK9A 3NH5A 4UCMA 2QYVA 3KR5A 1S7KA 2B4DA 5HVFA 2AFMA 1VHEA 2PJ4A 2IL4A 3G8WA 4OMEA 4NJQA 3KASA 5HVGA 1NE9A 4KUAA 4UFXA 4JJXA 3E0KA 2Z3OA 4WJBA 4C2YA 1Z8WA 3B3TA 2OZHA 3I1UA 3KL9A 4ZY0A 2ZENA 3ISXA 1S7LA 2ZW5A 1M4IA 1HDQA 2GFQA 2FSRA 5JH9A 1HDUA 2NSMA 2GLFA 4YWYA 4OKOA 4F6AA 2NMTA 3BHXA 4U5YA 2VZYA 4E8OA 3RYOA 4NGQA 3VATA 3D66A 5JGFA 4NCZA 1Q7LA 2Q4ZA 1RO5A 4MBUA 4KOVA 1IB1E 1P0HA 2R7HA 4OIWA 4UEEA 2JEWA 3LACA 1OZPA 1Y7EA 1X10A 2BOAA 2PIZA 2G3AA 2Z3NA 3RAMA 4CYNA 3JTKA 3ISZA 2C6CA 4F0XA 1Q2DA 1R57A 3WABA 1M44A 4KOSA 5HMNA 3K2KA 4U9YA 3ZJ0A 2IJZA 4MCQA 2Q43A 4FWUA 1LAPA 1JWQA 3RZAA 4AVAA 5K8NA 4C68A 3RNZA 4A38A 4BMHA 3FNCA 2D4PA 3CXQA 3S6KA 3PP9A 3SHPA 4AVBA 1CM0A 5LRGA 3FIXA 4H6ZA 3W6XA 2BO9A 1UFHA 2C6GA 4B5PB 1CBXA 4JXQA 2CXAA 5EMIA 1ELMP 3I3GA 1RXTA 1XMBA 4NFRA 4JYWA 4DUKA 3PBEA 4CGPA 3HUVA 3GKRA 3TOAA 3TCVA 1R3NA 4LQ6A 3TT2A 2FS5A 3NE8A 3D7HA 1LFWA 2IMOA 4IF5A 2PJ2A 4TNUA 1R43A 1CJWA 4MY3A 2ARHA 4X5KA 2B3UA 4FBEA 4KOXA 2VEZA 1FY7A 1X12A 1YVOA 4UFWA 4FUUA 2PJ9A 2YNEA 1NSAA 4LX9A 1YW4A 3GY9A 1Y9KA 4F9UA 4JZ0A 4OC4A 2I79A 4CYQA 1VHSA 2GU2A 4FAIA 2G9DA 3D68A 4XPLA 4G1PA 4MFLA 4AXVA 5C88A 1XOVA 3F0AA 4EMEA 1XMTA 1Z9UA 4UFVA 4ZGYB 2QIRA 5D8NA 1FT7A 3DGVA 4BBHA 1QMUA 4YRHA 3FF3A 2Q7BA 3DSBA 2QVPA 4CGOA 2Z3MA 2PDOA 4NSQA 3IWEA 5IB0A 3K9UA 2I00A 2P0WA 1QSRA 3IWWA 4MY0A 4R9MA 5HXDA 3T8WA 5THWA 4R76A 1CPSA 3W6SA 2OR4A 2VQYA 4H6UA 4MHZA 1EE3P 5LRJA 2B5GA 1B6BA 2Q7SA 4KOUA 4FD6A 4M6IA 2R1IA 3V8IA 3VH9A 2BL1A 3PB9X 3SJEA 2GE3A 1IYLA 1Z8TA 2C1CA 4P4IA 4A39A 1Z4RA 3V7ZA 2EK8A 2ZELA 4XNHC 3BJ8A 4DNCA 1GYTA 2RFHA 1AYEA 2ZEMA 3D7GA 4R87A 2PJCA 2PR1A 4PXEA 2ATRA 4QUSA 4F0YA 2QJ8A 4CRZB 2ABZA 2RC4A 3EC4A 1M4DA 4P10A 1YLOA 4CRYB 2XEFA 4A30A 7CPAA 2Y0MA 4KOYA 4GS4A 4RN7A 4F9VA 5BWAB
chains in the Genus database with same CATH topology
1PU9A 2VXKA 1YX0A 2B4DB 3UY5A 5A27A 4CYOA 1QSTA 2VBQA 3EXNA 3TOBA 3TO6A 4CGMA 4B13A 4UWIA 3JUWA 4FD5A 3NE7A 2X7BA 4KUBA 2D4OA 2O28A 5F47A 4MFKA 1XIXA 5DWNA 1I12A 4A31A 1Y9WA 4FD7A 2OZUA 1Q2YA 2J8NA 5G22A 1ON0A 4RI1A 1QSOA 4C2ZA 3B8GA 2JLMA 2R98A 5AG4A 2H5MA 3FXTA 1TIQA 5EBVA 3MGDA 4ORFA 5AG7A 2ZXVA 5F46A 4MJ8A 4A2ZA 5H84A 5GCNA 3TO7A 5AG5A 4Q36A 2DXQA 4A32A 3T9YA 4YFJA 1QSMA 1YK3A 4K30A 1Q2CA 3BLNA 2JEVA 3TTHA 2FXFA 2CNTA 3EFAA 4CGLA 1Y7RA 1S7FA 1Z4EA 5AG6A 3QAHA 2GANA 2Z3LA 1YGHA 2ZW4A 3R1KA 1K4JA 3LODA 5KTAA 2BSWA 4JWPA 5H86A 1S5KA 2Z0ZA 3IU1A 4II9A 4KOTA 4XPKA 1QSNA 2PRBA 2FE7A 3DNSA 4QBJA 4PK3A 4M3SA 4C7IA 2C27A 2B58A 1XE4A 1MJ9A 4L89A 4OADA 3T90A 4KZTA 2FIAA 3FYNA 3IU2A 5DWMA 4PSWA 4UA3A 3D2PA 4C2XA 3R9FA 2FCKA 1XEBA 4R57A 4HKFA 3D3SA 3DR6A 2CY2A 2WPXA 3QB8A 2EUIA 5JPHA 4I49A 4YGOA 4JXRA 3D2MA 5J8CA 4H89A 2B5GB 1YREA 3SXOA 3IWGA 1GHEA 1KZFA 3BJ7A 2FT0A 4QC6A 4B5PA 2FIWA 1MJBA 5E96A 2Q0YA 2BUEA 3SXNA 3C26A 1ZO0A 2WUUA 4XPDC 2ZW7A 4E2AA 3P2FA 4PV6A 5KTCA 3TE4A 4KVOE 4KORA 4UBRA 4CYPA 4HNWB 3PGPA 3FB3A 1PUAA 2G0BA 3R9GA 2Z3PA 2HV2A 4B12A 5IX3A 1YLEA 3W91A 1KUVA 3EY5A 3FBUA 3H5ZA 3F8KA 4NF1A 5AGEA 4KSAA 4KOWA 4FD4A 5IV0A 4AG9A 2P6EA 4XPDB 4KS9A 4PSXA 1WWZA 1I1DA 2J8RA 5F48A 2JDDA 4KVXA 1L0CA 2YGWA 1S7NA 2AE6A 4M85A 2EVNA 4ONUA 2P6GA 4A95A 2F5IA 2Z3KA 3R96A 2OZGA 1LRZA 2Q4VA 4UCPA 1IIDA 4J3GA 4B11A 1MK4A 5G21A 2YNCA 5C82A 1M1DA 3D8PA 3EO4A 4KLVA 3VWEA 3S6HA 2J8MA 1YR0A 3R95A 2REFA 2PSWA 4OLLA 2PQ8A 1N71A 1XF8A 2Z11A 2CNMA 4CAVA 2BEIA 3I9SA 4CAFA 3S6FA 4KSFA 1IICA 4R3LA 4QB9A 2K5TA 2VI7A 2DPSA 1WK4A 2OU2A 4L8AA 2A4NA 4OAEA 3H4QA 2G3TA 4AG7A 2DPTA 4HNYB 4IUSA 3DR8A 4Q38A 2HUZA 2ZW6A 1MJAA 2QECA 5CNPA 4CAEA 4RS2A 4R3KA 2FL4A 1SQHA 3GYAA 4B5OA 2OB0A 3CXSA 2YNDA 4CAXA 2KCWA 4MFJA 2ZPAA 3S6GA 4U9ZA 1S3ZA 1B87A 4UWJA 5ISVA 2REEA 2R8VA 1M4GA 2CNSA 4MHDA 4CGNA 3ZZIA 2OH1A 2AJ6A 4KLWA 2P6FA 2PR8A 3CXPA 4B14A 5KTDA 5G1ZA 1NSLA 4MI4A 4AVCA 3A9LA 5G20A 2GIVA 2Z10A 3N7ZA 5I0CA 2Q4YA 3P2HA 4B10A 1P4NA 2QMLA 1YVKA 4PK2A 1KUYA 3IGRA 2PC1A 1KUXA 4AB7A 3VWDA 2JDCA 5JQ4A 3G3SA 4JLYA 4LUAA 2HQYA 5J8FA 4CS0B 1J4JA 2Q04A 1BOBA 4KVME 4ZBGA 5A28A 3R9EA 2Q44A 2YNCC 3TO9A 4ZGYB 3DDDA 3JVNA 4HNXB 4MFQA 1IYKA 1BO4A 4NXYA 4Y49C 2B4BA 4EVYA 5HH1A 5EC4A 4CAWA 4MFPA 3F5BA 3PZJA 2WPWA 4MFZA 3OWCA 4A33A 1U6MA 4UCNA 4NEXA 4Y49B 3WR7A 4E0AA 1V0CA 2WSAA 1NMTA 3KKWA 4QVTA 4JD6A 5F49A 3FRMA 1S60A 1I21A 2VZZA 5FVJA 2B3VA 4XNHB 1VKCA 3LD2A 3TFYA 4C7HA 4UCMA 1S7KA 2B4DA 2IL4A 3G8WA 1NE9A 4KUAA 4UFXA 4JJXA 3E0KA 2Z3OA 4C2YA 2OZHA 1S7LA 2ZW5A 1M4IA 2FSRA 4F6AA 2NMTA 4U5YA 2VZYA 4E8OA 3RYOA 4NCZA 1RO5A 4MBUA 4KOVA 1IB1E 1P0HA 2R7HA 1OZPA 2Z3NA 2G3AA 4CYNA 3JTKA 4F0XA 1Q2DA 1R57A 5HMNA 1M44A 4KOSA 4U9YA 3ZJ0A 4AVAA 4C68A 4BMHA 3FNCA 2D4PA 3CXQA 3S6KA 3PP9A 3SHPA 4AVBA 1CM0A 3FIXA 4H6ZA 3W6XA 1UFHA 4B5PB 4JXQA 2CXAA 3I3GA 1RXTA 4CGPA 3GKRA 3TOAA 3TCVA 3TT2A 2FS5A 4IF5A 1CJWA 4MY3A 2ARHA 4X5KA 2B3UA 4KOXA 2VEZA 1FY7A 1YVOA 4UFWA 2YNEA 4LX9A 3GY9A 1Y9KA 2I79A 4CYQA 1VHSA 4XPLA 4MFLA 5C88A 3F0AA 1XMTA 1Z9UA 4UFVA 2QIRA 4BBHA 4YRHA 2Q7BA 3DSBA 4CGOA 2Z3MA 2PDOA 4NSQA 3IWEA 5IB0A 3K9UA 2I00A 2P0WA 1QSRA 4MY0A 4R9MA 3W6SA 2VQYA 4H6UA 2B5GA 1B6BA 4KOUA 3V8IA 4FD6A 2R1IA 2BL1A 2GE3A 1IYLA 1Z4RA 4XNHC 3BJ8A 4DNCA 4R87A 4F0YA 2PR1A 4QUSA 2ATRA 4CRZB 2RC4A 3EC4A 1M4DA 4CRYB 4A30A 2Y0MA 4KOYA 4GS4A 5BWAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU9 A;  2VXK A;  1YX0 A;  2B4D B;  3UY5 A;  1QST A;  2VBQ A;  3EXN A;  3TOB A;  3TO6 A;  4UWI A;  3JUW A;  4FD5 A;  3NE7 A;  2X7B A;  4KUB A;  2D4O A;  2O28 A;  5F47 A;  1XIX A;  5DWN A;  1I12 A;  1Y9W A;  4FD7 A;  2OZU A;  1Q2Y A;  2J8N A;  1ON0 A;  4RI1 A;  1QSO A;  3B8G A;  2JLM A;  2R98 A;  2H5M A;  3FXT A;  1TIQ A;  5EBV A;  3MGD A;  4ORF A;  2ZXV A;  5F46 A;  4MJ8 A;  5H84 A;  5GCN A;  3TO7 A;  2DXQ A;  3T9Y A;  4YFJ A;  1QSM A;  1YK3 A;  4K30 A;  1Q2C A;  3BLN A;  2JEV A;  3TTH A;  2FXF A;  2CNT A;  3EFA A;  1Y7R A;  1S7F A;  1Z4E A;  3QAH A;  2GAN A;  1YGH A;  2ZW4 A;  3R1K A;  1K4J A;  3LOD A;  5KTA A;  2BSW A;  4JWP A;  5H86 A;  1S5K A;  2Z0Z A;  4II9 A;  4KOT A;  4XPK A;  1QSN A;  2PRB A;  2FE7 A;  3DNS A;  4QBJ A;  4PK3 A;  4M3S A;  2C27 A;  2B58 A;  1XE4 A;  1MJ9 A;  4L89 A;  4OAD A;  3T90 A;  4KZT A;  2FIA A;  3FYN A;  5DWM A;  4PSW A;  4UA3 A;  3D2P A;  3R9F A;  2FCK A;  1XEB A;  4R57 A;  4HKF A;  3D3S A;  3DR6 A;  2CY2 A;  2WPX A;  3QB8 A;  2EUI A;  5JPH A;  4I49 A;  4YGO A;  4JXR A;  3D2M A;  5J8C A;  4H89 A;  2B5G B;  1YRE A;  3SXO A;  3IWG A;  1GHE A;  1KZF A;  3BJ7 A;  2FT0 A;  4QC6 A;  4B5P A;  2FIW A;  1MJB A;  5E96 A;  2Q0Y A;  2BUE A;  3SXN A;  3C26 A;  4XPD C;  2ZW7 A;  4E2A A;  3P2F A;  4PV6 A;  5KTC A;  3TE4 A;  4KVO E;  4KOR A;  4UBR A;  4HNW B;  3PGP A;  3FB3 A;  1PUA A;  2G0B A;  3R9G A;  2HV2 A;  5IX3 A;  1YLE A;  3W91 A;  1KUV A;  3EY5 A;  3FBU A;  3F8K A;  4NF1 A;  4KOW A;  4FD4 A;  5IV0 A;  4AG9 A;  2P6E A;  4XPD B;  4PSX A;  1WWZ A;  1I1D A;  2J8R A;  5F48 A;  2JDD A;  4KVX A;  1L0C A;  1S7N A;  2AE6 A;  4M85 A;  2EVN A;  4ONU A;  2P6G A;  2F5I A;  3R96 A;  2OZG A;  1LRZ A;  2Q4V A;  1IID A;  4J3G A;  1MK4 A;  5C82 A;  1M1D A;  3D8P A;  3EO4 A;  4KLV A;  3VWE A;  3S6H A;  2J8M A;  1YR0 A;  3R95 A;  2REF A;  2PSW A;  4OLL A;  2PQ8 A;  1N71 A;  1XF8 A;  2Z11 A;  2CNM A;  4CAV A;  2BEI A;  3I9S A;  3S6F A;  1IIC A;  4R3L A;  4QB9 A;  2K5T A;  2VI7 A;  1WK4 A;  2OU2 A;  4L8A A;  2A4N A;  4OAE A;  3H4Q A;  2G3T A;  4AG7 A;  4HNY B;  4IUS A;  3DR8 A;  2HUZ A;  2ZW6 A;  1MJA A;  2QEC A;  5CNP A;  4RS2 A;  4R3K A;  2FL4 A;  1SQH A;  3GYA A;  4B5O A;  2OB0 A;  3CXS A;  4CAX A;  2KCW A;  2ZPA A;  3S6G A;  4U9Z A;  1S3Z A;  1B87 A;  4UWJ A;  5ISV A;  2REE A;  2R8V A;  1M4G A;  2CNS A;  4MHD A;  3ZZI A;  2OH1 A;  2AJ6 A;  4KLW A;  2P6F A;  2PR8 A;  3CXP A;  5KTD A;  1NSL A;  4MI4 A;  4AVC A;  2GIV A;  2Z10 A;  3N7Z A;  5I0C A;  2Q4Y A;  3P2H A;  1P4N A;  2QML A;  1YVK A;  4PK2 A;  1KUY A;  3IGR A;  2PC1 A;  1KUX A;  4AB7 A;  3VWD A;  2JDC A;  5JQ4 A;  3G3S A;  4JLY A;  4LUA A;  2HQY A;  5J8F A;  4CS0 B;  1J4J A;  2Q04 A;  1BOB A;  4KVM E;  4ZBG A;  3R9E A;  2Q44 A;  3TO9 A;  3DDD A;  3JVN A;  4HNX B;  1IYK A;  1BO4 A;  4NXY A;  4Y49 C;  2B4B A;  4EVY A;  5HH1 A;  5EC4 A;  4CAW A;  3F5B A;  3PZJ A;  2WPW A;  3OWC A;  1U6M A;  4NEX A;  4Y49 B;  3WR7 A;  4E0A A;  1V0C A;  1NMT A;  3KKW A;  4QVT A;  4JD6 A;  5F49 A;  3FRM A;  1S60 A;  1I21 A;  2VZZ A;  5FVJ A;  2B3V A;  4XNH B;  1VKC A;  3LD2 A;  3TFY A;  1S7K A;  2B4D A;  2IL4 A;  3G8W A;  1NE9 A;  4KUA A;  4JJX A;  3E0K A;  2OZH A;  1S7L A;  2ZW5 A;  1M4I A;  2FSR A;  4F6A A;  2NMT A;  4U5Y A;  2VZY A;  4E8O A;  3RYO A;  4NCZ A;  1RO5 A;  4MBU A;  4KOV A;  1IB1 E;  1P0H A;  2R7H A;  1OZP A;  2G3A A;  1Q2D A;  1R57 A;  5HMN A;  1M44 A;  4KOS A;  4U9Y A;  3ZJ0 A;  4AVA A;  4BMH A;  3FNC A;  2D4P A;  3CXQ A;  3S6K A;  3PP9 A;  3SHP A;  4AVB A;  1CM0 A;  3FIX A;  4H6Z A;  3W6X A;  1UFH A;  4B5P B;  4JXQ A;  3I3G A;  1RXT A;  3GKR A;  3TOA A;  3TCV A;  3TT2 A;  2FS5 A;  4IF5 A;  1CJW A;  4MY3 A;  2ARH A;  4X5K A;  2B3U A;  4KOX A;  2VEZ A;  1FY7 A;  1YVO A;  4LX9 A;  3GY9 A;  1Y9K A;  2I79 A;  1VHS A;  4XPL A;  5C88 A;  3F0A A;  1XMT A;  1Z9U A;  2QIR A;  4YRH A;  2Q7B A;  3DSB A;  2PDO A;  4NSQ A;  5IB0 A;  3K9U A;  2I00 A;  2P0W A;  1QSR A;  4MY0 A;  4R9M A;  3W6S A;  2VQY A;  4H6U A;  2B5G A;  1B6B A;  4KOU A;  3V8I A;  4FD6 A;  2R1I A;  2BL1 A;  2GE3 A;  1IYL A;  1Z4R A;  4XNH C;  3BJ8 A;  4DNC A;  4R87 A;  4F0Y A;  2PR1 A;  4QUS A;  2ATR A;  4CRZ B;  2RC4 A;  3EC4 A;  1M4D A;  4CRY B;  2Y0M A;  4KOY A;  4GS4 A; 
#chains in the Genus database with same CATH topology
 3PFE A;  1XBU A;  2AFO A;  1PU9 A;  4MHN A;  2VXK A;  1YX0 A;  2XEG A;  3FMC A;  1BPM A;  2B4D B;  3UY5 A;  4ZX9 A;  5A27 A;  2O4H A;  4CYO A;  1QST A;  2VBQ A;  2AFU A;  3EXN A;  4P44 A;  1Z2L A;  3TOB A;  3TO6 A;  1TF9 A;  1RTQ A;  2PJ6 A;  4CGM A;  4B13 A;  2PJ8 A;  2CIJ A;  2XEI A;  4UWI A;  3KGQ A;  5F09 A;  3JUW A;  4FD5 A;  3NE7 A;  2X7B A;  3MN8 A;  3D7D A;  3N5F A;  4KUB A;  2D4O A;  2O28 A;  3CZX A;  3H8E A;  3FH4 A;  5F47 A;  4MFK A;  1XIX A;  4PXC A;  1I12 A;  2AFZ A;  5DWN A;  3WT4 A;  4A31 A;  4P4F A;  1Y9W A;  4K3N A;  4FD7 A;  2OZU A;  2PIY A;  1Q2Y A;  2J8N A;  3B7I A;  5G22 A;  1ON0 A;  2ANP A;  2ODF A;  4RI1 A;  1QSO A;  4OC1 A;  4C2Z A;  3S9N A;  3B8G A;  2JLM A;  2R98 A;  1TXR A;  5AG4 A;  2H5M A;  3FXT A;  3BI1 A;  1ZG8 A;  3D67 A;  1TIQ A;  1IOF A;  3GLJ A;  5EBV A;  3MGD A;  4ORF A;  5AG7 A;  1XFO A;  2ZED A;  2ZXV A;  4M6G A;  1ELL P;  4GXH A;  4NGN A;  4ZY1 A;  5F46 A;  2PJ5 A;  4MJ8 A;  3KI9 A;  3KZW A;  4A2Z A;  5H84 A;  3B2Y A;  5GCN A;  4ZYQ A;  3TO7 A;  5AG5 A;  1TF8 A;  2FVG A;  4Q36 A;  2DXQ A;  2PCU A;  4A32 A;  2WZN A;  3IC1 A;  3T9Y A;  4YFJ A;  1QSM A;  1YK3 A;  4K30 A;  4P4D A;  1ARL A;  4UIB A;  1Q2C A;  3BLN A;  2JEV A;  4ZX8 A;  3TTH A;  2FXF A;  2PRQ A;  2ZEE A;  3CT9 A;  2CNT A;  3NH8 A;  3EFA A;  3PEI A;  1M4L A;  4CGL A;  1Y7R A;  1S7F A;  1Z4E A;  5AG6 A;  1LAN A;  3QAH A;  5CBM A;  2GAN A;  2Z3L A;  1YGH A;  2ZW4 A;  3R1K A;  1K4J A;  2PJB A;  1LOK A;  3LOD A;  5KTA A;  2BSW A;  4JWP A;  5H86 A;  2V77 A;  1S5K A;  2Z0Z A;  3IU1 A;  3JRU A;  4A37 A;  4II9 A;  4KOT A;  4XPK A;  1QSN A;  2PRB A;  1Z5R A;  2FE7 A;  3DNS A;  3IO1 A;  3MRU A;  4QBJ A;  4PK3 A;  4M3S A;  4C7I A;  2CTC A;  2C27 A;  2B58 A;  1XE4 A;  1MJ9 A;  4PXD A;  4L89 A;  4OAD A;  3T90 A;  1CP7 A;  4KZT A;  3KHZ A;  5CPA A;  1OBR A;  1JQG A;  2FIA A;  3FYN A;  3LMS A;  3IU2 A;  3KR4 A;  5DWM A;  2ZEG A;  3LWU A;  4PSW A;  4UA3 A;  3D2P A;  4C2X A;  3R9F A;  2FCK A;  1XEB A;  4R57 A;  1XRY A;  3D3S A;  3DR6 A;  4HKF A;  2CY2 A;  2WPX A;  3QB8 A;  3IIB A;  3SI0 A;  2EUI A;  2VL1 A;  4EFD A;  5JPH A;  4I49 A;  2AFX A;  4YGO A;  4JXR A;  1VHO A;  2XEJ A;  3D2M A;  3KQX A;  4H89 A;  2B5G B;  5J8C A;  1YRE A;  5K8P A;  3SXO A;  3IWG A;  3NH4 A;  4BD9 A;  1GHE A;  1KZF A;  3BJ7 A;  1UWY A;  2FT0 A;  4QC6 A;  4MMO A;  4LQG A;  2FIW A;  4B5P A;  1MJB A;  3RBU A;  5K8M A;  1ARM A;  5E96 A;  3SJG A;  2Q0Y A;  3CDX A;  2BUE A;  2ZOF A;  3SXN A;  3C26 A;  1ZO0 A;  2WUU A;  1PCA A;  2ZW7 A;  4P4E A;  4XPD C;  3VAR A;  1IU8 A;  3QNV A;  3SI1 A;  4MCR A;  1Y0Y A;  4E2A A;  3P2F A;  4PV6 A;  5KTC A;  3TE4 A;  4KVO E;  2PJ1 A;  4X3R A;  4KOR A;  4UBR A;  4CYP A;  4HNW B;  3PGP A;  3FB3 A;  1BAV A;  2HB6 A;  2O53 A;  3KQZ A;  1PUA A;  2G0B A;  3CPA A;  3R9G A;  2Z3P A;  2HV2 A;  4B12 A;  5IX3 A;  3K9T A;  1YLE A;  3W91 A;  1KUV A;  3EY5 A;  3FBU A;  4HPS A;  1TKH A;  3IJ3 A;  1VGY A;  4R8F A;  2DEA A;  3H5Z A;  3F8K A;  4NF1 A;  4OID A;  5AGE A;  4KSA A;  1BPN A;  4KOW A;  4FD4 A;  5IV0 A;  4R7M A;  4AG9 A;  2P6E A;  2V8V A;  4XPD B;  4A94 A;  4KS9 A;  4DYO A;  1DTD A;  2PJA A;  4OP4 A;  4PSX A;  1WWZ A;  2V8H A;  4NJR A;  8CPA A;  1I1D A;  5ELY A;  1A2Z A;  2J8R A;  1AMP A;  1BLL E;  2PVW A;  4X2T A;  4NGM A;  5LYL A;  2ZEF A;  5F48 A;  1F2O A;  2GRE A;  3HLP A;  4MCS A;  1FNO A;  2JDD A;  1PYT B;  4KVX A;  1L0C A;  2YGW A;  1S7N A;  2AE6 A;  2DF5 A;  4M85 A;  3DLJ A;  2EVN A;  2F8H A;  4ONU A;  2P6G A;  3WC6 A;  3SI2 A;  4MHP A;  3B3W A;  4A95 A;  2F5I A;  2Z3K A;  3R96 A;  3S9M A;  2OZG A;  2F7V A;  1LRZ A;  2Q4V A;  1F2P A;  4UCP A;  2ZEO A;  1IID A;  4J3G A;  1Z8L A;  1MK4 A;  5G21 A;  2YNC A;  2EBJ A;  3SJX A;  4B11 A;  5HVH A;  5C82 A;  1M1D A;  3D8P A;  3EO4 A;  3FED A;  4KLV A;  3VWE A;  3S6H A;  2I3C A;  2J8M A;  1YR0 A;  2WYR A;  3GB0 A;  3R95 A;  5IB9 A;  2REF A;  2PSW A;  4ONW A;  4PPZ A;  4NGT A;  4OLL A;  2PQ8 A;  1N71 A;  1XF8 A;  1YME A;  2AFS A;  2Z11 A;  2CNM A;  4X8I A;  2BEI A;  3I9S A;  4M6H A;  4CAF A;  4CAV A;  5K8O A;  5LRK A;  4UEZ A;  4KSF A;  1IIC A;  4P45 A;  3S6F A;  4R3L A;  5J1Q A;  1VIX A;  4IAV A;  4QB9 A;  3QAY A;  1ZG9 A;  2K5T A;  2ZOG A;  2VI7 A;  4UIA A;  2DPS A;  3H8F A;  1WK4 A;  2OU2 A;  5I4M A;  4L8A A;  2A4N A;  3FEC A;  4NGS A;  5LYF A;  2RB7 A;  3H4Q A;  2G3T A;  1AUG A;  4OAE A;  3TX8 A;  4AG7 A;  2DPT A;  3PRT A;  1LAM A;  4HNY B;  4IUS A;  3DR8 A;  4Q38 A;  4KSI A;  2HUZ A;  2ZW6 A;  3GUX A;  1MJA A;  2QEC A;  2EWB A;  4EWT A;  1Z8X A;  2JBK A;  5CNP A;  3RO0 A;  4CAE A;  4RS2 A;  4R3K A;  4W9Y A;  2FL4 A;  1ZLI A;  1SQH A;  1H8L A;  4RUH A;  3GYA A;  4B5O A;  4O23 A;  2OB0 A;  3CXS A;  3B3V A;  2YND A;  3H8G A;  2KCW A;  4CAX A;  4OC5 A;  2PJ3 A;  4MFJ A;  2GLJ A;  2ZPA A;  4Z65 A;  1XJO A;  3S6G A;  4R6T A;  2NYQ A;  3BI0 A;  2CTB A;  3FVL A;  1S3Z A;  1LCP A;  4U9Z A;  3TC8 A;  3D7F A;  1B87 A;  4UWJ A;  5ISV A;  4UF4 A;  1Y0R A;  2R8V A;  2REE A;  3WC5 A;  1M4G A;  2IQ6 A;  1DE4 C;  4BIN A;  5LYI A;  4TWE A;  2CNS A;  4MHD A;  4CGN A;  2HC9 A;  4PQA A;  3ZZI A;  2OH1 A;  4MRI A;  2AJ6 A;  4KLW A;  2P6F A;  2PE3 A;  2PR8 A;  3PB6 X;  1CX8 A;  1TKF A;  6CPA A;  3CXP A;  4B14 A;  5KTD A;  5G1Z A;  4CPA A;  3BXM A;  3PBB A;  3B35 A;  1NSL A;  3FJU A;  4MI4 A;  1QQ9 A;  1YW6 A;  3A9L A;  5G20 A;  4AVC A;  2GIV A;  2Z10 A;  3N7Z A;  5I0C A;  5JM6 A;  2Q4Y A;  4F8Z A;  3P2H A;  1IY7 A;  1IGB A;  4B10 A;  1P4N A;  2QML A;  1YVK A;  3SJF A;  4PK2 A;  3NFZ A;  4P4J A;  4UEF A;  1KUY A;  3IGR A;  2PC1 A;  1KUX A;  4AB7 A;  3VWD A;  5DS0 A;  1ZLH A;  2JDC A;  4OC3 A;  4H2K A;  1HEE A;  5JQ4 A;  3G3S A;  4JLY A;  2POK A;  2V8D A;  4LUA A;  2HQY A;  5J8F A;  1CPX A;  4CS0 B;  1J4J A;  3B3C A;  4MCP A;  3FX6 A;  2Q04 A;  1BOB A;  2JBJ A;  2BCO A;  4KVM E;  3PB8 X;  4P4B A;  4ZY2 A;  4ZBG A;  5A28 A;  1YQE A;  3R9E A;  2AFW A;  2Q44 A;  2YNC C;  3TO9 A;  2C6P A;  2PJ0 A;  2V8G A;  3DDD A;  3JVN A;  4HNX B;  4MFQ A;  1IYK A;  1BO4 A;  4NXY A;  4PXB A;  4Y49 C;  2B4B A;  4EVY A;  4NGR A;  5HH1 A;  4GM5 A;  3V38 A;  5EC4 A;  4DJL A;  4CAW A;  4MFP A;  4B6Z A;  3FEE A;  3CPX A;  1TKJ A;  3F5B A;  3GIU A;  3PZJ A;  3PFO A;  4Q7A A;  2Q51 A;  4MHY A;  4YU9 A;  4WWV A;  5D29 A;  4OC0 A;  4P6Y A;  1ZG7 A;  2WPW A;  5LYD A;  1YSJ A;  4MFZ A;  1KWM A;  2PJ7 A;  4IHM A;  1IOI A;  4OC2 A;  3KHX A;  3D4U A;  2ZEH A;  3S9L A;  3OWC A;  3PB4 X;  1CG2 A;  3L2N A;  4A33 A;  1U6M A;  3PB7 X;  4MXU A;  4UCN A;  4NEX A;  2EO8 A;  4Y49 B;  3WR7 A;  4E0A A;  3IEH A;  2PVV A;  3IFE A;  1V0C A;  2CF4 A;  2WSA A;  1CP6 A;  1NMT A;  3KKW A;  4QVT A;  1F57 A;  4IK2 A;  2OOT A;  4JD6 A;  5F49 A;  1S60 A;  2J9A A;  1I21 A;  2VZZ A;  3FRM A;  5FVJ A;  2B3V A;  3NA6 A;  4NGP A;  4XNH B;  1VKC A;  4ZI6 A;  3LD2 A;  3WC7 A;  3B3S A;  3TFY A;  2ZEP A;  4C7H A;  2EK9 A;  3NH5 A;  4UCM A;  2QYV A;  3KR5 A;  1S7K A;  2B4D A;  5HVF A;  2AFM A;  1VHE A;  2PJ4 A;  2IL4 A;  3G8W A;  4OME A;  4NJQ A;  3KAS A;  5HVG A;  1NE9 A;  4KUA A;  4UFX A;  4JJX A;  3E0K A;  2Z3O A;  4WJB A;  4C2Y A;  1Z8W A;  3B3T A;  2OZH A;  3I1U A;  3KL9 A;  4ZY0 A;  2ZEN A;  3ISX A;  1S7L A;  2ZW5 A;  1M4I A;  1HDQ A;  2GFQ A;  2FSR A;  5JH9 A;  1HDU A;  2NSM A;  2GLF A;  4YWY A;  4OKO A;  4F6A A;  2NMT A;  3BHX A;  4U5Y A;  2VZY A;  4E8O A;  3RYO A;  4NGQ A;  3VAT A;  3D66 A;  5JGF A;  4NCZ A;  1Q7L A;  2Q4Z A;  1RO5 A;  4MBU A;  4KOV A;  1IB1 E;  1P0H A;  2R7H A;  4OIW A;  4UEE A;  2JEW A;  3LAC A;  1OZP A;  1Y7E A;  1X10 A;  2BOA A;  2PIZ A;  2G3A A;  2Z3N A;  3RAM A;  4CYN A;  3JTK A;  3ISZ A;  2C6C A;  4F0X A;  1Q2D A;  1R57 A;  3WAB A;  1M44 A;  4KOS A;  5HMN A;  3K2K A;  4U9Y A;  3ZJ0 A;  2IJZ A;  4MCQ A;  2Q43 A;  4FWU A;  1LAP A;  1JWQ A;  3RZA A;  4AVA A;  5K8N A;  4C68 A;  3RNZ A;  4A38 A;  4BMH A;  3FNC A;  2D4P A;  3CXQ A;  3S6K A;  3PP9 A;  3SHP A;  4AVB A;  1CM0 A;  5LRG A;  3FIX A;  4H6Z A;  3W6X A;  2BO9 A;  1UFH A;  2C6G A;  4B5P B;  1CBX A;  4JXQ A;  2CXA A;  5EMI A;  1ELM P;  3I3G A;  1RXT A;  1XMB A;  4NFR A;  4JYW A;  4DUK A;  3PBE A;  4CGP A;  3HUV A;  3GKR A;  3TOA A;  3TCV A;  1R3N A;  4LQ6 A;  3TT2 A;  2FS5 A;  3NE8 A;  3D7H A;  1LFW A;  2IMO A;  4IF5 A;  2PJ2 A;  4TNU A;  1R43 A;  1CJW A;  4MY3 A;  2ARH A;  4X5K A;  2B3U A;  4FBE A;  4KOX A;  2VEZ A;  1FY7 A;  1X12 A;  1YVO A;  4UFW A;  4FUU A;  2PJ9 A;  2YNE A;  1NSA A;  4LX9 A;  1YW4 A;  3GY9 A;  1Y9K A;  4F9U A;  4JZ0 A;  4OC4 A;  2I79 A;  4CYQ A;  1VHS A;  2GU2 A;  4FAI A;  2G9D A;  3D68 A;  4XPL A;  4G1P A;  4MFL A;  4AXV A;  5C88 A;  1XOV A;  3F0A A;  4EME A;  1XMT A;  1Z9U A;  4UFV A;  4ZGY B;  2QIR A;  5D8N A;  1FT7 A;  3DGV A;  4BBH A;  1QMU A;  4YRH A;  3FF3 A;  2Q7B A;  3DSB A;  2QVP A;  4CGO A;  2Z3M A;  2PDO A;  4NSQ A;  3IWE A;  5IB0 A;  3K9U A;  2I00 A;  2P0W A;  1QSR A;  3IWW A;  4MY0 A;  4R9M A;  5HXD A;  3T8W A;  5THW A;  4R76 A;  1CPS A;  3W6S A;  2OR4 A;  2VQY A;  4H6U A;  4MHZ A;  1EE3 P;  5LRJ A;  2B5G A;  1B6B A;  2Q7S A;  4KOU A;  4FD6 A;  4M6I A;  2R1I A;  3V8I A;  3VH9 A;  2BL1 A;  3PB9 X;  3SJE A;  2GE3 A;  1IYL A;  1Z8T A;  2C1C A;  4P4I A;  4A39 A;  1Z4R A;  3V7Z A;  2EK8 A;  2ZEL A;  4XNH C;  3BJ8 A;  4DNC A;  1GYT A;  2RFH A;  1AYE A;  2ZEM A;  3D7G A;  4R87 A;  2PJC A;  2PR1 A;  4PXE A;  2ATR A;  4QUS A;  4F0Y A;  2QJ8 A;  4CRZ B;  2ABZ A;  2RC4 A;  3EC4 A;  1M4D A;  4P10 A;  1YLO A;  4CRY B;  2XEF A;  4A30 A;  7CPA A;  2Y0M A;  4KOY A;  4GS4 A;  4RN7 A;  4F9V A;  5BWA B; 
#chains in the Genus database with same CATH homology
 1PU9 A;  2VXK A;  1YX0 A;  2B4D B;  3UY5 A;  5A27 A;  4CYO A;  1QST A;  2VBQ A;  3EXN A;  3TOB A;  3TO6 A;  4CGM A;  4B13 A;  4UWI A;  3JUW A;  4FD5 A;  3NE7 A;  2X7B A;  4KUB A;  2D4O A;  2O28 A;  5F47 A;  4MFK A;  1XIX A;  5DWN A;  1I12 A;  4A31 A;  1Y9W A;  4FD7 A;  2OZU A;  1Q2Y A;  2J8N A;  5G22 A;  1ON0 A;  4RI1 A;  1QSO A;  4C2Z A;  3B8G A;  2JLM A;  2R98 A;  5AG4 A;  2H5M A;  3FXT A;  1TIQ A;  5EBV A;  3MGD A;  4ORF A;  5AG7 A;  2ZXV A;  5F46 A;  4MJ8 A;  4A2Z A;  5H84 A;  5GCN A;  3TO7 A;  5AG5 A;  4Q36 A;  2DXQ A;  4A32 A;  3T9Y A;  4YFJ A;  1QSM A;  1YK3 A;  4K30 A;  1Q2C A;  3BLN A;  2JEV A;  3TTH A;  2FXF A;  2CNT A;  3EFA A;  4CGL A;  1Y7R A;  1S7F A;  1Z4E A;  5AG6 A;  3QAH A;  2GAN A;  2Z3L A;  1YGH A;  2ZW4 A;  3R1K A;  1K4J A;  3LOD A;  5KTA A;  2BSW A;  4JWP A;  5H86 A;  1S5K A;  2Z0Z A;  3IU1 A;  4II9 A;  4KOT A;  4XPK A;  1QSN A;  2PRB A;  2FE7 A;  3DNS A;  4QBJ A;  4PK3 A;  4M3S A;  4C7I A;  2C27 A;  2B58 A;  1XE4 A;  1MJ9 A;  4L89 A;  4OAD A;  3T90 A;  4KZT A;  2FIA A;  3FYN A;  3IU2 A;  5DWM A;  4PSW A;  4UA3 A;  3D2P A;  4C2X A;  3R9F A;  2FCK A;  1XEB A;  4R57 A;  4HKF A;  3D3S A;  3DR6 A;  2CY2 A;  2WPX A;  3QB8 A;  2EUI A;  5JPH A;  4I49 A;  4YGO A;  4JXR A;  3D2M A;  5J8C A;  4H89 A;  2B5G B;  1YRE A;  3SXO A;  3IWG A;  1GHE A;  1KZF A;  3BJ7 A;  2FT0 A;  4QC6 A;  4B5P A;  2FIW A;  1MJB A;  5E96 A;  2Q0Y A;  2BUE A;  3SXN A;  3C26 A;  1ZO0 A;  2WUU A;  4XPD C;  2ZW7 A;  4E2A A;  3P2F A;  4PV6 A;  5KTC A;  3TE4 A;  4KVO E;  4KOR A;  4UBR A;  4CYP A;  4HNW B;  3PGP A;  3FB3 A;  1PUA A;  2G0B A;  3R9G A;  2Z3P A;  2HV2 A;  4B12 A;  5IX3 A;  1YLE A;  3W91 A;  1KUV A;  3EY5 A;  3FBU A;  3H5Z A;  3F8K A;  4NF1 A;  5AGE A;  4KSA A;  4KOW A;  4FD4 A;  5IV0 A;  4AG9 A;  2P6E A;  4XPD B;  4KS9 A;  4PSX A;  1WWZ A;  1I1D A;  2J8R A;  5F48 A;  2JDD A;  4KVX A;  1L0C A;  2YGW A;  1S7N A;  2AE6 A;  4M85 A;  2EVN A;  4ONU A;  2P6G A;  4A95 A;  2F5I A;  2Z3K A;  3R96 A;  2OZG A;  1LRZ A;  2Q4V A;  4UCP A;  1IID A;  4J3G A;  4B11 A;  1MK4 A;  5G21 A;  2YNC A;  5C82 A;  1M1D A;  3D8P A;  3EO4 A;  4KLV A;  3VWE A;  3S6H A;  2J8M A;  1YR0 A;  3R95 A;  2REF A;  2PSW A;  4OLL A;  2PQ8 A;  1N71 A;  1XF8 A;  2Z11 A;  2CNM A;  4CAV A;  2BEI A;  3I9S A;  4CAF A;  3S6F A;  4KSF A;  1IIC A;  4R3L A;  4QB9 A;  2K5T A;  2VI7 A;  2DPS A;  1WK4 A;  2OU2 A;  4L8A A;  2A4N A;  4OAE A;  3H4Q A;  2G3T A;  4AG7 A;  2DPT A;  4HNY B;  4IUS A;  3DR8 A;  4Q38 A;  2HUZ A;  2ZW6 A;  1MJA A;  2QEC A;  5CNP A;  4CAE A;  4RS2 A;  4R3K A;  2FL4 A;  1SQH A;  3GYA A;  4B5O A;  2OB0 A;  3CXS A;  2YND A;  4CAX A;  2KCW A;  4MFJ A;  2ZPA A;  3S6G A;  4U9Z A;  1S3Z A;  1B87 A;  4UWJ A;  5ISV A;  2REE A;  2R8V A;  1M4G A;  2CNS A;  4MHD A;  4CGN A;  3ZZI A;  2OH1 A;  2AJ6 A;  4KLW A;  2P6F A;  2PR8 A;  3CXP A;  4B14 A;  5KTD A;  5G1Z A;  1NSL A;  4MI4 A;  4AVC A;  3A9L A;  5G20 A;  2GIV A;  2Z10 A;  3N7Z A;  5I0C A;  2Q4Y A;  3P2H A;  4B10 A;  1P4N A;  2QML A;  1YVK A;  4PK2 A;  1KUY A;  3IGR A;  2PC1 A;  1KUX A;  4AB7 A;  3VWD A;  2JDC A;  5JQ4 A;  3G3S A;  4JLY A;  4LUA A;  2HQY A;  5J8F A;  4CS0 B;  1J4J A;  2Q04 A;  1BOB A;  4KVM E;  4ZBG A;  5A28 A;  3R9E A;  2Q44 A;  2YNC C;  3TO9 A;  4ZGY B;  3DDD A;  3JVN A;  4HNX B;  4MFQ A;  1IYK A;  1BO4 A;  4NXY A;  4Y49 C;  2B4B A;  4EVY A;  5HH1 A;  5EC4 A;  4CAW A;  4MFP A;  3F5B A;  3PZJ A;  2WPW A;  4MFZ A;  3OWC A;  4A33 A;  1U6M A;  4UCN A;  4NEX A;  4Y49 B;  3WR7 A;  4E0A A;  1V0C A;  2WSA A;  1NMT A;  3KKW A;  4QVT A;  4JD6 A;  5F49 A;  3FRM A;  1S60 A;  1I21 A;  2VZZ A;  5FVJ A;  2B3V A;  4XNH B;  1VKC A;  3LD2 A;  3TFY A;  4C7H A;  4UCM A;  1S7K A;  2B4D A;  2IL4 A;  3G8W A;  1NE9 A;  4KUA A;  4UFX A;  4JJX A;  3E0K A;  2Z3O A;  4C2Y A;  2OZH A;  1S7L A;  2ZW5 A;  1M4I A;  2FSR A;  4F6A A;  2NMT A;  4U5Y A;  2VZY A;  4E8O A;  3RYO A;  4NCZ A;  1RO5 A;  4MBU A;  4KOV A;  1IB1 E;  1P0H A;  2R7H A;  1OZP A;  2Z3N A;  2G3A A;  4CYN A;  3JTK A;  4F0X A;  1Q2D A;  1R57 A;  5HMN A;  1M44 A;  4KOS A;  4U9Y A;  3ZJ0 A;  4AVA A;  4C68 A;  4BMH A;  3FNC A;  2D4P A;  3CXQ A;  3S6K A;  3PP9 A;  3SHP A;  4AVB A;  1CM0 A;  3FIX A;  4H6Z A;  3W6X A;  1UFH A;  4B5P B;  4JXQ A;  2CXA A;  3I3G A;  1RXT A;  4CGP A;  3GKR A;  3TOA A;  3TCV A;  3TT2 A;  2FS5 A;  4IF5 A;  1CJW A;  4MY3 A;  2ARH A;  4X5K A;  2B3U A;  4KOX A;  2VEZ A;  1FY7 A;  1YVO A;  4UFW A;  2YNE A;  4LX9 A;  3GY9 A;  1Y9K A;  2I79 A;  4CYQ A;  1VHS A;  4XPL A;  4MFL A;  5C88 A;  3F0A A;  1XMT A;  1Z9U A;  4UFV A;  2QIR A;  4BBH A;  4YRH A;  2Q7B A;  3DSB A;  4CGO A;  2Z3M A;  2PDO A;  4NSQ A;  3IWE A;  5IB0 A;  3K9U A;  2I00 A;  2P0W A;  1QSR A;  4MY0 A;  4R9M A;  3W6S A;  2VQY A;  4H6U A;  2B5G A;  1B6B A;  4KOU A;  3V8I A;  4FD6 A;  2R1I A;  2BL1 A;  2GE3 A;  1IYL A;  1Z4R A;  4XNH C;  3BJ8 A;  4DNC A;  4R87 A;  4F0Y A;  2PR1 A;  4QUS A;  2ATR A;  4CRZ B;  2RC4 A;  3EC4 A;  1M4D A;  4CRY B;  4A30 A;  2Y0M A;  4KOY A;  4GS4 A;  5BWA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...