2OZHA

Crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
GMPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFARVISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYGFTPPLFPQSLMERYVPGLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_638301.1) from Xanthomonas campestris at 1.40 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords Hypothetical protein XCC2953
total genus 34
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozhA01
5EC4A 2B58A 2R7HA 1QSTA 3VWDA 4CS0B 1XIXA 3IGRA 2FCKA 4JXRA 4Y49C 4QVTA 2R98A 4KUAA 4MY3A 5H84A 2JLMA 3GYAA 1IYLA 1R57A 3I3GA 4U9ZA 2Q44A 4AG7A 2X7BA 1QSRA 2B5GA 4I49A 4E2AA 2JEVA 4H6ZA 4CRZB 2OZHA 4KUBA 1M44A 1WWZA 1ON0A 2FIWA 2PR1A 3TO9A 1NMTA 4AVBA 2J8NA 3R9EA 3S6KA 2K5TA 4CAXA 3DR8A 2B4DA 4AG9A 2OZGA 2PC1A 2P0WA 1YR0A 2Q0YA 3EFAA 1IIDA 1S3ZA 1BO4A 5CNPA 4J3GA 4PSWA 1YVKA 4NCZA 3VWEA 2G3TA 3PGPA 4F6AA 5J8FA 4OADA 3R9FA 1QSMA 2VQYA 3W91A 2FT0A 4GS4A 3FB3A 5HH1A 4OLLA 2CNTA 3D8PA 3FYNA 1RO5A 5EBVA 1I21A 4KOVA 3D3SA 3TOBA 3EO4A 5J8CA 1PU9A 3I9SA 4H89A 4KVME 4KLWA 3OWCA 2R1IA 5I0CA 4JXQA 5FVJA 2QIRA 2P6FA 1M4DA 4IF5A 3H4QA 2J8RA 1XMTA 1VHSA 4R57A 2PRBA 1KUVA 3DDDA 3SXNA 4L8AA 3TO6A 3W6SA 1GHEA 2BUEA 4AVAA 1NSLA 5JQ4A 1XF8A 4KVXA 4ONUA 2H5MA 4HNYB 5HMNA 3RYOA 3TTHA 4B5PB 2O28A 5IB0A 4X5KA 2I00A 2ZW6A 3T9YA 2AE6A 3C26A 3JUWA 4QUSA 4BMHA 2JDCA 4FD6A 4DNCA 1YLEA 3G3SA 5H86A 4FD5A 1WK4A 4RS2A 4MI4A 3PZJA 4MBUA 4U9YA 1I1DA 4KOTA 5F48A 3PP9A 3IWGA 4R9MA 4KOUA 5F47A 3NE7A 2PQ8A 2G3AA 3F0AA 3KKWA 4L89A 1Q2YA 2VXKA 2ZW5A 3WR7A 1SQHA 2B3UA 4YRHA 2GANA 4XPLA 2R8VA 2ZXVA 2QMLA 2VZZA 1Y7RA 4QB9A 2ZW4A 1XEBA 4PK3A 2D4OA 2G0BA 2CY2A 1P4NA 2P6GA 3DNSA 3CXQA 4AB7A 2Z10A 3GY9A 3S6FA 1B87A 4JD6A 3DSBA 2Z0ZA 3TCVA 4OAEA 3JVNA 3F5BA 1S7FA 2PSWA 4LUAA 2BL1A 2RC4A 2ARHA 2AJ6A 4ZBGA 4E8OA 2FXFA 4KVOE 1CM0A 3EC4A 4HNWB 1VKCA 4M3SA 2VI7A 2WPWA 5IX3A 3R95A 3SXOA 3S6HA 4CAVA 2OZUA 1J4JA 2EUIA 1M1DA 1Z4RA 1S7KA 1S7LA 3BJ7A 4XPKA 2C27A 1YREA 4JWPA 2FE7A 3QB8A 4NEXA 3R9GA 1QSNA 1CJWA 1MJBA 5KTDA 1BOBA 1Y9WA 1PUAA 3CXSA 2P6EA 2OH1A 2B4BA 2Z11A 2ZPAA 5F49A 2GE3A 1FY7A 3F8KA 1S5KA 2VBQA 4RI1A 2EVNA 3K9UA 4YFJA 2Y0MA 2Q4YA 2VEZA 3CXPA 1Y9KA 2I79A 2FSRA 2JDDA 4UWIA 2Q4VA 2NMTA 3W6XA 4UWJA 3R96A 1L0CA 5DWNA 2FL4A 2BEIA 4XNHB 3G8WA 1MJAA 3SHPA 4KOSA 1KZFA 4XPDC 2A4NA 1YX0A 1UFHA 3S6GA 2QECA 2ATRA 4R3KA 4PK2A 3EXNA 2REFA 3LODA 2J8MA 2Q04A 2F5IA 3TOAA 4EVYA 4KORA 4R87A 4JJXA 4ORFA 2Q7BA 5KTCA 5C88A 5ISVA 4FD4A 1RXTA 1OZPA 5KTAA 3ZZIA 3GKRA 5GCNA 1U6MA 1Z9UA 3LD2A 4UBRA 3N7ZA 4KOXA 5DWMA 3FNCA 4R3LA 1MJ9A 1P0HA 3BJ8A 1B6BA 3MGDA 4MY0A 2B3VA 4UA3A 1M4IA 2B4DB 2D4PA 1Z4EA 2GIVA 1YK3A 4M85A 4B5PA 1IYKA 1V0CA 2REEA 4NXYA 1I12A 3P2HA 2DXQA 2HQYA 4KOWA 4II9A 4QBJA 2B5GB 3EY5A 1IB1E 3TT2A 1YVOA 1KUYA 4PSXA 3D2MA 3TO7A 4KOYA 4B5OA 1KUXA 1LRZA 1TIQA 2PDOA 3TE4A 4MHDA 4HNXB 3D2PA 2IL4A 4XNHC 1Q2CA 4E0AA 1Q2DA 5JPHA 3DR6A 2KCWA 2HV2A 4K30A 3TFYA 4IUSA 3R1KA 3T90A 2CNSA 4PV6A 3ZJ0A 2BSWA 4CRYB 2PR8A 4JLYA 4XPDB 5E96A 4KZTA 3E0KA 1M4GA 3B8GA 4F0YA 1NE9A 3V8IA 4Y49B 2OU2A 4FD7A 2ZW7A 3FBUA 1S7NA 3FRMA 3UY5A 1MK4A 4CAWA 1QSOA 1YGHA 2FIAA 4HKFA 2HUZA 2WPXA 2OB0A 1XE4A 4U5YA 1S60A 3BLNA 3P2FA 2CNMA 4YGOA 1IICA 4MJ8A 2FS5A 3FXTA 5F46A 2VZYA 3FIXA 1K4JA 3QAHA 5C82A 4NF1A 1N71A 4NSQA 4KLVA 4AVCA 4H6UA 4LX9A 4QC6A 5IV0A
chains in the Genus database with same CATH superfamily
5D29A 2B58A 5EC4A 2HC9A 1VIXA 2QVPA 2R7HA 4R8FA 1QSTA 4CYNA 2AFXA 1X10A 3VWDA 4CS0B 1XIXA 3IGRA 2FCKA 3VH9A 4C2XA 3FECA 4JXRA 4P45A 2QJ8A 4Y49C 4QVTA 1YQEA 4OKOA 5F09A 2R98A 3NE8A 2GLFA 2XEJA 4PPZA 3NFZA 2PJ1A 2PJ7A 4KUAA 3PEIA 4MY3A 4P10A 5H84A 4OIWA 1XFOA 1M4LA 2JLMA 3BXMA 3DGVA 3GYAA 2EO8A 2Q7SA 4PXDA 5HVGA 2CTCA 1IYLA 1R57A 2Z3KA 3L2NA 3WC7A 4TNUA 4CGLA 3I3GA 4BD9A 4U9ZA 3B3CA 3B3WA 1JWQA 2PJ2A 2Q44A 2IQ6A 2XEGA 4AG7A 2X7BA 1HEEA 1CP7A 1QSRA 2WZNA 2B5GA 2NSMA 4I49A 4MHYA 4E2AA 1BAVA 2JEVA 3FVLA 1QMUA 4H6ZA 2Q43A 4C7HA 2OZHA 2ZENA 4CRZB 2RFHA 2CTBA 3D7FA 2ZEFA 1M44A 3BHXA 2PJ9A 4KUBA 3GUXA 3B35A 3D67A 4P4FA 4MFQA 1WWZA 1ON0A 2FIWA 2PR1A 3TO9A 1ZLHA 1NMTA 4AVBA 2J8NA 3R9EA 3S6KA 1YSJA 2K5TA 5IB9A 4CAXA 3GLJA 4A2ZA 3DR8A 5A28A 4GM5A 4BBHA 3IWWA 2B4DA 3SJFA 4AG9A 2RB7A 1Z2LA 2OZGA 2PC1A 4C2YA 3PB8X 3I1UA 2P0WA 4PQAA 1YR0A 5ELYA 2PJ4A 3PBEA 3SI2A 1A2ZA 2Q0YA 3EFAA 5AG4A 4R6TA 3KQZA 2EBJA 1IIDA 2BO9A 1S3ZA 1BO4A 1FT7A 4MHNA 2ZEGA 4W9YA 5CNPA 4CGMA 4J3GA 4OC5A 1IY7A 4PSWA 3JTKA 2Z3OA 4CGPA 1YVKA 1Z5RA 3IU2A 4NCZA 3VWEA 2G3TA 3PGPA 4X3RA 4F6AA 5J8FA 5I4MA 4OADA 1DTDA 3R9FA 2O4HA 3KASA 1QSMA 4MFLA 2VQYA 4LQ6A 3W91A 2FT0A 2V8GA 3B3SA 4Z65A 2OR4A 2J9AA 2EWBA 4GS4A 3FB3A 5HH1A 5CBMA 4OLLA 4A32A 2CNTA 3D8PA 1GYTA 4OC2A 1Q7LA 3FYNA 4C7IA 1RO5A 5EMIA 5EBVA 1I21A 1ZLIA 2AFOA 4KOVA 5HXDA 3IWEA 2YGWA 3D3SA 3TOBA 3EO4A 5J8CA 4EWTA 1PU9A 3I9SA 4A30A 1AMPA 2PJ3A 4H89A 2DEAA 4M6IA 4KS9A 3OWCA 2R1IA 4KLWA 4KVME 3WT4A 4JXQA 5I0CA 4B11A 5FVJA 2QIRA 2PJ8A 3JRUA 5AG7A 2P6FA 1M4DA 3H8GA 4IF5A 3H4QA 2J8RA 1YMEA 4FBEA 2YNCC 1XMTA 4UFWA 1VHSA 1PYTB 1VHOA 4R57A 5LYDA 1TKHA 2PRBA 2GFQA 2PVVA 3H8FA 3V7ZA 1KUVA 1NSAA 4Q36A 1CG2A 3DDDA 3SXNA 4L8AA 3TO6A 3W6SA 4P4DA 1KWMA 4MHZA 1GHEA 2BUEA 2C6CA 2O53A 4OMEA 4AVAA 1ARLA 1NSLA 5JQ4A 4ZX9A 2Z3PA 3PFOA 1XF8A 3DLJA 4KVXA 4ONUA 2H5MA 4HNYB 5HMNA 3RYOA 1TKJA 1XMBA 3TTHA 1ELLP 4EMEA 1XOVA 4RN7A 4C68A 4P4BA 4B6ZA 4B5PB 2O28A 3WC6A 3PFEA 1IU8A 5IB0A 4X5KA 3H5ZA 4B10A 3RBUA 4MMOA 2I00A 2ZW6A 3T9YA 3LACA 2AE6A 3C26A 4NFRA 2GLJA 3KI9A 4TWEA 1CPSA 2AFSA 4A31A 3JUWA 3PB6X 2PJBA 4QUSA 4BMHA 1XRYA 2Z3MA 5G21A 3QAYA 2JDCA 4FD6A 4DNCA 3BI0A 4X2TA 1VHEA 1YLEA 4P4EA 3MRUA 3G3SA 2WYRA 4FD5A 5H86A 1BLLE 2EK9A 1WK4A 4RS2A 2I3CA 1VGYA 4MI4A 3PZJA 1ARMA 2Z3LA 4MBUA 4U9YA 1I1DA 3D7GA 4KOTA 5F48A 2CF4A 1YLOA 3PP9A 3IWGA 1IGBA 4UEEA 4R9MA 1JQGA 4KOUA 3CZXA 3SJGA 3KR5A 4DYOA 5F47A 3NE7A 4PXBA 1CX8A 2BOAA 1ZG8A 3D7HA 2PQ8A 4R76A 2G3AA 3F0AA 5G22A 1LANA 1Y7EA 3KKWA 4L89A 4NGNA 3KL9A 4DUKA 1Q2YA 3IO1A 1LFWA 2VXKA 2ZW5A 3WR7A 4B12A 1SQHA 1LAMA 1X12A 3B2YA 5LRGA 2B3UA 3HUVA 3S9NA 4YRHA 2GANA 4XPLA 2R8VA 2ZXVA 2EK8A 3B7IA 2QMLA 2VZZA 3SI1A 1Y7RA 4QB9A 2ZW4A 1F2PA 1XEBA 4PK3A 2D4OA 4MCPA 4JZ0A 4UF4A 2G0BA 3IC1A 4GXHA 2CY2A 2ZEEA 1P4NA 2P6GA 4MFPA 3DNSA 3CXQA 4AB7A 2Z10A 2ANPA 3GY9A 3S6FA 4FWUA 1B87A 5DS0A 4JD6A 4EFDA 3DSBA 2Z0ZA 4PXEA 3BI1A 3TCVA 2JBKA 4OAEA 1H8LA 4CAFA 3JVNA 4Q38A 3F5BA 1XBUA 3T8WA 4AXVA 4CPAA 1S7FA 3B3TA 4F8ZA 3KQXA 2AFWA 2PSWA 4LUAA 1XJOA 1ZG9A 2F8HA 2VL1A 4MCQA 4KSIA 4UEZA 3D7DA 2ZELA 2BL1A 2PVWA 2RC4A 3NA6A 4ZY1A 6CPAA 2PIZA 3FX6A 4ONWA 4NGPA 1Z8TA 2ARHA 2XEFA 3SJXA 2AJ6A 3ISZA 1AUGA 4ZBGA 1TKFA 4HPSA 4E8OA 4UFXA 2FXFA 2WSAA 3IEHA 4KVOE 3HLPA 1CM0A 3EC4A 4HNWB 4P4IA 5K8OA 4P4JA 1CBXA 3QNVA 1VKCA 4M3SA 2ZEMA 2VI7A 3RZAA 5LRJA 2WPWA 5IX3A 3R95A 4CYOA 3KZWA 3SXOA 2DPSA 2JBJA 3S6HA 5LRKA 4CAVA 4UEFA 2OZUA 1EE3P 3VARA 4OIDA 1J4JA 1HDQA 2EUIA 4H2KA 1FNOA 2V77A 1M1DA 3RO0A 3CPAA 4LQGA 1Z4RA 5JM6A 1S7KA 1ZO0A 1S7LA 3BJ7A 4NGMA 2OOTA 4Q7AA 4XPKA 1IOIA 1DE4C 5A27A 4KSAA 2C27A 1YREA 4JWPA 2NYQA 2IMOA 4M6GA 2C1CA 2FE7A 3QB8A 5THWA 2YNCA 1QQ9A 1YW4A 4NEXA 3R9GA 1ELMP 1QSNA 2V8VA 1CJWA 1MJBA 2DPTA 5KTDA 3IJ3A 4MXUA 2DF5A 1Y9WA 2PJ0A 4P6YA 5HVFA 1PUAA 3CXSA 2P6EA 2OH1A 3KGQA 4UCNA 2PCUA 3TC8A 2B4BA 3MN8A 3FH4A 3GB0A 2Z11A 2ZPAA 5F49A 2GE3A 1FY7A 4ZYQA 4YU9A 3IFEA 3F8KA 3V38A 4A95A 1S5KA 2VBQA 4MCSA 4RI1A 1ZG7A 4A33A 2EVNA 3NH5A 3K9UA 3IU1A 3PB9X 4NJQA 4CYQA 4YFJA 2Y0MA 2Q4YA 2VEZA 3CXPA 4IAVA 1IOFA 2C6PA 5K8PA 1Y9KA 5K8MA 4MFJA 2ODFA 2Z3NA 1Y0YA 2I79A 3FEEA 2FSRA 2JDDA 4UWIA 4R7MA 3D4UA 2Q4VA 1RTQA 2BCOA 2NMTA 4UWJA 3W6XA 3R96A 1L0CA 1YW6A 2GREA 4C2ZA 4G1PA 4O23A 4P44A 4WJBA 2GU2A 4CGNA 5K8NA 2C6GA 5DWNA 4QC6A 2FL4A 3B3VA 4UIAA 4ZX8A 2V8HA 4UCMA 3CT9A 2BEIA 5J1QA 5AG6A 4XNHB 3G8WA 1BPNA 1CP6A 2YNEA 2AFZA 1MJAA 1LAPA 2JEWA 8CPAA 3SHPA 1TF8A 1KZFA 4KOSA 4B13A 2FVGA 4XPDC 4ZY2A 2A4NA 4FUUA 3CDXA 1YX0A 1UFHA 4KSFA 4MCRA 3S6GA 2QECA 2ATRA 3FEDA 4R3KA 3EXNA 4PK2A 2REFA 5HVHA 3LODA 3LMSA 2J8MA 2Q04A 2F5IA 3TOAA 3D68A 1F57A 4EVYA 4KORA 4NGRA 2ABZA 2PJCA 4BINA 4A94A 4PXCA 1BPMA 4R87A 4JJXA 4ORFA 4CYPA 2Q7BA 1TF9A 4OC1A 5KTCA 4ZGYB 5C88A 5ISVA 2ZEHA 2ZEPA 3K9TA 2PIYA 3N5FA 4FD4A 2WUUA 1RXTA 1OZPA 5G20A 5LYIA 3FMCA 5KTAA 3ZZIA 2ZEDA 3GIUA 3GKRA 5GCNA 1U6MA 4ZY0A 1PCAA 4CGOA 3IIBA 4NGQA 1LOKA 1Z9UA 3FF3A 4NGSA 3LD2A 3KHZA 4UBRA 3PB4X 3N7ZA 4KOXA 5DWMA 3FNCA 4IK2A 2POKA 4YWYA 4F9VA 2ZEOA 1HDUA 4R3LA 1MJ9A 1LCPA 1P0HA 3BJ8A 1B6BA 3MGDA 4MHPA 4MY0A 5D8NA 1TXRA 2B3VA 4UA3A 1M4IA 2B4DB 3PBBA 2PRQA 2D4PA 4OP4A 3K2KA 4X8IA 1Z4EA 2GIVA 1YK3A 4M85A 4NJRA 5CPAA 4OC3A 4B5PA 1Z8XA 1IYKA 1V0CA 1F2OA 1Z8LA 2REEA 4NXYA 3SJEA 5BWAB 3S9LA 3VATA 4UFVA 2CXAA 1I12A 3P2HA 5G1ZA 2DXQA 2HQYA 3KR4A 4KOWA 3RNZA 4II9A 2V8DA 2CIJA 2HB6A 2PE3A 3H8EA 3A9LA 3RAMA 3S9MA 2B5GB 3EY5A 4QBJA 5AGEA 1IB1E 3TT2A 4NGTA 5LYLA 1YVOA 1KUYA 4PSXA 2PJ6A 3D2MA 3TO7A 4KOYA 4OC0A 4B5OA 2AFUA 4F0XA 5LYFA 1KUXA 1LRZA 4RUHA 1UWYA 1TIQA 4MFKA 4A37A 2PDOA 4DJLA 3TE4A 4MHDA 2ZOGA 4HNXB 3D2PA 2IL4A 4F9UA 4XNHC 1Q2CA 4E0AA 1Q2DA 4FAIA 5JPHA 3DR6A 3ISXA 2KCWA 2HV2A 4K30A 3TFYA 4IUSA 3R1KA 4MRIA 3T90A 2CNSA 4PV6A 3TX8A 2BSWA 3ZJ0A 2ZOFA 2PR8A 4CRYB 4JLYA 2QYVA 2G9DA 4XPDB 5E96A 3PRTA 4KZTA 3NH4A 3E0KA 1M4GA 3B8GA 4M6HA 4A39A 4F0YA 1NE9A 3V8IA 4Y49B 1Z8WA 5AG5A 5JH9A 2OU2A 4FD7A 2ZW7A 3CPXA 3FBUA 1OBRA 1AYEA 1S7NA 3FRMA 3KHXA 3UY5A 3WABA 1MK4A 1R43A 4CAEA 2IJZA 4CAWA 2PJAA 1QSOA 1YGHA 4A38A 2FIAA 2AFMA 3PB7X 1CPXA 2XEIA 4HKFA 4UIBA 2HUZA 4MFZA 2WPXA 4K3NA 2OB0A 1XE4A 2PJ5A 1S60A 4U5YA 5JGFA 3NH8A 3BLNA 3P2FA 2CNMA 4YGOA 1IICA 4MJ8A 2FS5A 3D66A 3FXTA 5F46A 2VZYA 3FIXA 1Y0RA 3SI0A 1K4JA 3LWUA 7CPAA 2Q4ZA 3QAHA 5C82A 4NF1A 4UCPA 1N71A 2F7VA 4NSQA 4KLVA 2YNDA 4JYWA 2Q51A 4ZI6A 1R3NA 4AVCA 4IHMA 4B14A 3FJUA 4OC4A 4H6UA 4LX9A 1BOBA 3WC5A 4WWVA 5IV0A
chains in the Genus database with same CATH topology
5EC4A 2B58A 2R7HA 4CYNA 1QSTA 3VWDA 4CS0B 1XIXA 3IGRA 2FCKA 4C2XA 4JXRA 4Y49C 4QVTA 2R98A 4KUAA 4MY3A 5H84A 2JLMA 3GYAA 1IYLA 1R57A 2Z3KA 4CGLA 3I3GA 4U9ZA 2Q44A 4AG7A 2X7BA 1QSRA 2B5GA 4I49A 4E2AA 2JEVA 4H6ZA 4C7HA 4CRZB 2OZHA 4KUBA 1M44A 4MFQA 1WWZA 1ON0A 2FIWA 2PR1A 3TO9A 1NMTA 4AVBA 2J8NA 3R9EA 3S6KA 2K5TA 4CAXA 4A2ZA 3DR8A 5A28A 4BBHA 2B4DA 4AG9A 2OZGA 2PC1A 4C2YA 2P0WA 1YR0A 2Q0YA 5AG4A 3EFAA 1IIDA 1S3ZA 1BO4A 5CNPA 4CGMA 4J3GA 4PSWA 3JTKA 2Z3OA 4CGPA 1YVKA 3IU2A 4NCZA 3VWEA 2G3TA 3PGPA 4F6AA 5J8FA 4OADA 3R9FA 1QSMA 4MFLA 2VQYA 3W91A 2FT0A 4GS4A 3FB3A 5HH1A 4OLLA 4A32A 2CNTA 3D8PA 3FYNA 4C7IA 1RO5A 5EBVA 1I21A 4KOVA 3IWEA 2YGWA 3D3SA 3TOBA 3EO4A 5J8CA 1PU9A 3I9SA 4A30A 4H89A 4KS9A 4KVME 4KLWA 3OWCA 2R1IA 5I0CA 4JXQA 4B11A 5FVJA 2QIRA 5AG7A 2P6FA 1M4DA 4IF5A 3H4QA 2J8RA 2YNCC 1XMTA 4UFWA 1VHSA 4R57A 2PRBA 1KUVA 4Q36A 3DDDA 3SXNA 4L8AA 3TO6A 3W6SA 1GHEA 2BUEA 4AVAA 1NSLA 5JQ4A 2Z3PA 1XF8A 4KVXA 4ONUA 2H5MA 4HNYB 5HMNA 3RYOA 3TTHA 4C68A 4B5PB 2O28A 5IB0A 4X5KA 3H5ZA 4B10A 2I00A 2ZW6A 3T9YA 2AE6A 3C26A 4A31A 3JUWA 4QUSA 4BMHA 2Z3MA 5G21A 2JDCA 4FD6A 4DNCA 1YLEA 3G3SA 5H86A 4FD5A 1WK4A 4RS2A 4MI4A 3PZJA 2Z3LA 4MBUA 4U9YA 1I1DA 4KOTA 5F48A 3PP9A 3IWGA 4R9MA 4KOUA 5F47A 3NE7A 2PQ8A 2G3AA 3F0AA 5G22A 3KKWA 4L89A 1Q2YA 2VXKA 2ZW5A 3WR7A 4B12A 1SQHA 2B3UA 4YRHA 2GANA 4XPLA 2R8VA 2ZXVA 2QMLA 2VZZA 1Y7RA 4QB9A 2ZW4A 1XEBA 4PK3A 2D4OA 2G0BA 2CY2A 1P4NA 2P6GA 4MFPA 3DNSA 3CXQA 4AB7A 2Z10A 3GY9A 3S6FA 1B87A 4JD6A 3DSBA 2Z0ZA 3TCVA 4OAEA 4CAFA 3JVNA 4Q38A 3F5BA 1S7FA 2PSWA 4LUAA 2BL1A 2RC4A 2ARHA 2AJ6A 4ZBGA 4E8OA 4UFXA 2FXFA 2WSAA 4KVOE 1CM0A 3EC4A 4HNWB 1VKCA 4M3SA 2VI7A 2WPWA 5IX3A 3R95A 4CYOA 3SXOA 2DPSA 3S6HA 4CAVA 2OZUA 1J4JA 2EUIA 1M1DA 1Z4RA 1S7KA 1ZO0A 1S7LA 3BJ7A 4XPKA 5A27A 4KSAA 2C27A 1YREA 4JWPA 2FE7A 3QB8A 2YNCA 4NEXA 3R9GA 1QSNA 1CJWA 1MJBA 2DPTA 5KTDA 1Y9WA 1PUAA 3CXSA 2P6EA 2OH1A 4UCNA 2B4BA 2Z11A 2ZPAA 5F49A 2GE3A 1FY7A 3F8KA 4A95A 1S5KA 2VBQA 4RI1A 4A33A 2EVNA 3K9UA 3IU1A 4CYQA 4YFJA 2Y0MA 2Q4YA 2VEZA 3CXPA 1Y9KA 4MFJA 2Z3NA 2I79A 2FSRA 2JDDA 4UWIA 2Q4VA 2NMTA 3W6XA 4UWJA 3R96A 1L0CA 4C2ZA 4CGNA 5DWNA 4QC6A 2FL4A 4UCMA 2BEIA 5AG6A 4XNHB 3G8WA 2YNEA 1MJAA 3SHPA 4KOSA 1KZFA 4B13A 4XPDC 2A4NA 1YX0A 1UFHA 4KSFA 3S6GA 2QECA 2ATRA 4R3KA 3EXNA 4PK2A 2REFA 3LODA 2J8MA 2Q04A 2F5IA 3TOAA 4EVYA 4KORA 4R87A 4JJXA 4ORFA 4CYPA 2Q7BA 5KTCA 4ZGYB 5C88A 5ISVA 4FD4A 2WUUA 1RXTA 1OZPA 5G20A 5KTAA 3ZZIA 3GKRA 5GCNA 1U6MA 4CGOA 1Z9UA 3LD2A 4UBRA 3N7ZA 4KOXA 5DWMA 3FNCA 4R3LA 1MJ9A 1P0HA 3BJ8A 1B6BA 3MGDA 4MY0A 2B3VA 4UA3A 1M4IA 2B4DB 2D4PA 1Z4EA 2GIVA 1YK3A 4M85A 4B5PA 1IYKA 1V0CA 2REEA 4NXYA 5BWAB 4UFVA 2CXAA 1I12A 3P2HA 5G1ZA 2DXQA 2HQYA 4KOWA 4II9A 3A9LA 4QBJA 2B5GB 3EY5A 5AGEA 1IB1E 3TT2A 1YVOA 1KUYA 4PSXA 3D2MA 3TO7A 4KOYA 4B5OA 4F0XA 1KUXA 1LRZA 1TIQA 4MFKA 2PDOA 3TE4A 4MHDA 4HNXB 3D2PA 2IL4A 4XNHC 1Q2CA 4E0AA 1Q2DA 5JPHA 3DR6A 2KCWA 2HV2A 4K30A 3TFYA 4IUSA 3R1KA 3T90A 2CNSA 4PV6A 3ZJ0A 2BSWA 4CRYB 2PR8A 4JLYA 4XPDB 5E96A 4KZTA 3E0KA 1M4GA 3B8GA 4F0YA 1NE9A 3V8IA 4Y49B 5AG5A 2OU2A 4FD7A 2ZW7A 3FBUA 1S7NA 3FRMA 3UY5A 4CAEA 1MK4A 4CAWA 1QSOA 1YGHA 2FIAA 4HKFA 2HUZA 4MFZA 2WPXA 2OB0A 1XE4A 4U5YA 1S60A 3BLNA 3P2FA 2CNMA 4YGOA 1IICA 4MJ8A 2FS5A 3FXTA 5F46A 2VZYA 3FIXA 1K4JA 3QAHA 5C82A 4NF1A 4UCPA 1N71A 4NSQA 4KLVA 2YNDA 4B14A 4AVCA 4H6UA 4LX9A 1BOBA 5IV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC4 A;  2B58 A;  2R7H A;  1QST A;  3VWD A;  4CS0 B;  1XIX A;  3IGR A;  2FCK A;  4JXR A;  4Y49 C;  4QVT A;  2R98 A;  4KUA A;  4MY3 A;  5H84 A;  2JLM A;  3GYA A;  1IYL A;  1R57 A;  3I3G A;  4U9Z A;  2Q44 A;  4AG7 A;  2X7B A;  1QSR A;  2B5G A;  4I49 A;  4E2A A;  2JEV A;  4H6Z A;  4CRZ B;  2OZH A;  4KUB A;  1M44 A;  1WWZ A;  1ON0 A;  2FIW A;  2PR1 A;  3TO9 A;  1NMT A;  4AVB A;  2J8N A;  3R9E A;  3S6K A;  2K5T A;  4CAX A;  3DR8 A;  2B4D A;  4AG9 A;  2OZG A;  2PC1 A;  2P0W A;  1YR0 A;  2Q0Y A;  3EFA A;  1IID A;  1S3Z A;  1BO4 A;  5CNP A;  4J3G A;  4PSW A;  1YVK A;  4NCZ A;  3VWE A;  2G3T A;  3PGP A;  4F6A A;  5J8F A;  4OAD A;  3R9F A;  1QSM A;  2VQY A;  3W91 A;  2FT0 A;  4GS4 A;  3FB3 A;  5HH1 A;  4OLL A;  2CNT A;  3D8P A;  3FYN A;  1RO5 A;  5EBV A;  1I21 A;  4KOV A;  3D3S A;  3TOB A;  3EO4 A;  5J8C A;  1PU9 A;  3I9S A;  4H89 A;  4KVM E;  4KLW A;  3OWC A;  2R1I A;  5I0C A;  4JXQ A;  5FVJ A;  2QIR A;  2P6F A;  1M4D A;  4IF5 A;  3H4Q A;  2J8R A;  1XMT A;  1VHS A;  4R57 A;  2PRB A;  1KUV A;  3DDD A;  3SXN A;  4L8A A;  3TO6 A;  3W6S A;  1GHE A;  2BUE A;  4AVA A;  1NSL A;  5JQ4 A;  1XF8 A;  4KVX A;  4ONU A;  2H5M A;  4HNY B;  5HMN A;  3RYO A;  3TTH A;  4B5P B;  2O28 A;  5IB0 A;  4X5K A;  2I00 A;  2ZW6 A;  3T9Y A;  2AE6 A;  3C26 A;  3JUW A;  4QUS A;  4BMH A;  2JDC A;  4FD6 A;  4DNC A;  1YLE A;  3G3S A;  5H86 A;  4FD5 A;  1WK4 A;  4RS2 A;  4MI4 A;  3PZJ A;  4MBU A;  4U9Y A;  1I1D A;  4KOT A;  5F48 A;  3PP9 A;  3IWG A;  4R9M A;  4KOU A;  5F47 A;  3NE7 A;  2PQ8 A;  2G3A A;  3F0A A;  3KKW A;  4L89 A;  1Q2Y A;  2VXK A;  2ZW5 A;  3WR7 A;  1SQH A;  2B3U A;  4YRH A;  2GAN A;  4XPL A;  2R8V A;  2ZXV A;  2QML A;  2VZZ A;  1Y7R A;  4QB9 A;  2ZW4 A;  1XEB A;  4PK3 A;  2D4O A;  2G0B A;  2CY2 A;  1P4N A;  2P6G A;  3DNS A;  3CXQ A;  4AB7 A;  2Z10 A;  3GY9 A;  3S6F A;  1B87 A;  4JD6 A;  3DSB A;  2Z0Z A;  3TCV A;  4OAE A;  3JVN A;  3F5B A;  1S7F A;  2PSW A;  4LUA A;  2BL1 A;  2RC4 A;  2ARH A;  2AJ6 A;  4ZBG A;  4E8O A;  2FXF A;  4KVO E;  1CM0 A;  3EC4 A;  4HNW B;  1VKC A;  4M3S A;  2VI7 A;  2WPW A;  5IX3 A;  3R95 A;  3SXO A;  3S6H A;  4CAV A;  2OZU A;  1J4J A;  2EUI A;  1M1D A;  1Z4R A;  1S7K A;  1S7L A;  3BJ7 A;  4XPK A;  2C27 A;  1YRE A;  4JWP A;  2FE7 A;  3QB8 A;  4NEX A;  3R9G A;  1QSN A;  1CJW A;  1MJB A;  5KTD A;  1BOB A;  1Y9W A;  1PUA A;  3CXS A;  2P6E A;  2OH1 A;  2B4B A;  2Z11 A;  2ZPA A;  5F49 A;  2GE3 A;  1FY7 A;  3F8K A;  1S5K A;  2VBQ A;  4RI1 A;  2EVN A;  3K9U A;  4YFJ A;  2Y0M A;  2Q4Y A;  2VEZ A;  3CXP A;  1Y9K A;  2I79 A;  2FSR A;  2JDD A;  4UWI A;  2Q4V A;  2NMT A;  3W6X A;  4UWJ A;  3R96 A;  1L0C A;  5DWN A;  2FL4 A;  2BEI A;  4XNH B;  3G8W A;  1MJA A;  3SHP A;  4KOS A;  1KZF A;  4XPD C;  2A4N A;  1YX0 A;  1UFH A;  3S6G A;  2QEC A;  2ATR A;  4R3K A;  4PK2 A;  3EXN A;  2REF A;  3LOD A;  2J8M A;  2Q04 A;  2F5I A;  3TOA A;  4EVY A;  4KOR A;  4R87 A;  4JJX A;  4ORF A;  2Q7B A;  5KTC A;  5C88 A;  5ISV A;  4FD4 A;  1RXT A;  1OZP A;  5KTA A;  3ZZI A;  3GKR A;  5GCN A;  1U6M A;  1Z9U A;  3LD2 A;  4UBR A;  3N7Z A;  4KOX A;  5DWM A;  3FNC A;  4R3L A;  1MJ9 A;  1P0H A;  3BJ8 A;  1B6B A;  3MGD A;  4MY0 A;  2B3V A;  4UA3 A;  1M4I A;  2B4D B;  2D4P A;  1Z4E A;  2GIV A;  1YK3 A;  4M85 A;  4B5P A;  1IYK A;  1V0C A;  2REE A;  4NXY A;  1I12 A;  3P2H A;  2DXQ A;  2HQY A;  4KOW A;  4II9 A;  4QBJ A;  2B5G B;  3EY5 A;  1IB1 E;  3TT2 A;  1YVO A;  1KUY A;  4PSX A;  3D2M A;  3TO7 A;  4KOY A;  4B5O A;  1KUX A;  1LRZ A;  1TIQ A;  2PDO A;  3TE4 A;  4MHD A;  4HNX B;  3D2P A;  2IL4 A;  4XNH C;  1Q2C A;  4E0A A;  1Q2D A;  5JPH A;  3DR6 A;  2KCW A;  2HV2 A;  4K30 A;  3TFY A;  4IUS A;  3R1K A;  3T90 A;  2CNS A;  4PV6 A;  3ZJ0 A;  2BSW A;  4CRY B;  2PR8 A;  4JLY A;  4XPD B;  5E96 A;  4KZT A;  3E0K A;  1M4G A;  3B8G A;  4F0Y A;  1NE9 A;  3V8I A;  4Y49 B;  2OU2 A;  4FD7 A;  2ZW7 A;  3FBU A;  1S7N A;  3FRM A;  3UY5 A;  1MK4 A;  4CAW A;  1QSO A;  1YGH A;  2FIA A;  4HKF A;  2HUZ A;  2WPX A;  2OB0 A;  1XE4 A;  4U5Y A;  1S60 A;  3BLN A;  3P2F A;  2CNM A;  4YGO A;  1IIC A;  4MJ8 A;  2FS5 A;  3FXT A;  5F46 A;  2VZY A;  3FIX A;  1K4J A;  3QAH A;  5C82 A;  4NF1 A;  1N71 A;  4NSQ A;  4KLV A;  4AVC A;  4H6U A;  4LX9 A;  4QC6 A;  5IV0 A; 
#chains in the Genus database with same CATH topology
 5D29 A;  2B58 A;  5EC4 A;  2HC9 A;  1VIX A;  2QVP A;  2R7H A;  4R8F A;  1QST A;  4CYN A;  2AFX A;  1X10 A;  3VWD A;  4CS0 B;  1XIX A;  3IGR A;  2FCK A;  3VH9 A;  4C2X A;  3FEC A;  4JXR A;  4P45 A;  2QJ8 A;  4Y49 C;  4QVT A;  1YQE A;  4OKO A;  5F09 A;  2R98 A;  3NE8 A;  2GLF A;  2XEJ A;  4PPZ A;  3NFZ A;  2PJ1 A;  2PJ7 A;  4KUA A;  3PEI A;  4MY3 A;  4P10 A;  5H84 A;  4OIW A;  1XFO A;  1M4L A;  2JLM A;  3BXM A;  3DGV A;  3GYA A;  2EO8 A;  2Q7S A;  4PXD A;  5HVG A;  2CTC A;  1IYL A;  1R57 A;  2Z3K A;  3L2N A;  3WC7 A;  4TNU A;  4CGL A;  3I3G A;  4BD9 A;  4U9Z A;  3B3C A;  3B3W A;  1JWQ A;  2PJ2 A;  2Q44 A;  2IQ6 A;  2XEG A;  4AG7 A;  2X7B A;  1HEE A;  1CP7 A;  1QSR A;  2WZN A;  2B5G A;  2NSM A;  4I49 A;  4MHY A;  4E2A A;  1BAV A;  2JEV A;  3FVL A;  1QMU A;  4H6Z A;  2Q43 A;  4C7H A;  2OZH A;  2ZEN A;  4CRZ B;  2RFH A;  2CTB A;  3D7F A;  2ZEF A;  1M44 A;  3BHX A;  2PJ9 A;  4KUB A;  3GUX A;  3B35 A;  3D67 A;  4P4F A;  4MFQ A;  1WWZ A;  1ON0 A;  2FIW A;  2PR1 A;  3TO9 A;  1ZLH A;  1NMT A;  4AVB A;  2J8N A;  3R9E A;  3S6K A;  1YSJ A;  2K5T A;  5IB9 A;  4CAX A;  3GLJ A;  4A2Z A;  3DR8 A;  5A28 A;  4GM5 A;  4BBH A;  3IWW A;  2B4D A;  3SJF A;  4AG9 A;  2RB7 A;  1Z2L A;  2OZG A;  2PC1 A;  4C2Y A;  3PB8 X;  3I1U A;  2P0W A;  4PQA A;  1YR0 A;  5ELY A;  2PJ4 A;  3PBE A;  3SI2 A;  1A2Z A;  2Q0Y A;  3EFA A;  5AG4 A;  4R6T A;  3KQZ A;  2EBJ A;  1IID A;  2BO9 A;  1S3Z A;  1BO4 A;  1FT7 A;  4MHN A;  2ZEG A;  4W9Y A;  5CNP A;  4CGM A;  4J3G A;  4OC5 A;  1IY7 A;  4PSW A;  3JTK A;  2Z3O A;  4CGP A;  1YVK A;  1Z5R A;  3IU2 A;  4NCZ A;  3VWE A;  2G3T A;  3PGP A;  4X3R A;  4F6A A;  5J8F A;  5I4M A;  4OAD A;  1DTD A;  3R9F A;  2O4H A;  3KAS A;  1QSM A;  4MFL A;  2VQY A;  4LQ6 A;  3W91 A;  2FT0 A;  2V8G A;  3B3S A;  4Z65 A;  2OR4 A;  2J9A A;  2EWB A;  4GS4 A;  3FB3 A;  5HH1 A;  5CBM A;  4OLL A;  4A32 A;  2CNT A;  3D8P A;  1GYT A;  4OC2 A;  1Q7L A;  3FYN A;  4C7I A;  1RO5 A;  5EMI A;  5EBV A;  1I21 A;  1ZLI A;  2AFO A;  4KOV A;  5HXD A;  3IWE A;  2YGW A;  3D3S A;  3TOB A;  3EO4 A;  5J8C A;  4EWT A;  1PU9 A;  3I9S A;  4A30 A;  1AMP A;  2PJ3 A;  4H89 A;  2DEA A;  4M6I A;  4KS9 A;  3OWC A;  2R1I A;  4KLW A;  4KVM E;  3WT4 A;  4JXQ A;  5I0C A;  4B11 A;  5FVJ A;  2QIR A;  2PJ8 A;  3JRU A;  5AG7 A;  2P6F A;  1M4D A;  3H8G A;  4IF5 A;  3H4Q A;  2J8R A;  1YME A;  4FBE A;  2YNC C;  1XMT A;  4UFW A;  1VHS A;  1PYT B;  1VHO A;  4R57 A;  5LYD A;  1TKH A;  2PRB A;  2GFQ A;  2PVV A;  3H8F A;  3V7Z A;  1KUV A;  1NSA A;  4Q36 A;  1CG2 A;  3DDD A;  3SXN A;  4L8A A;  3TO6 A;  3W6S A;  4P4D A;  1KWM A;  4MHZ A;  1GHE A;  2BUE A;  2C6C A;  2O53 A;  4OME A;  4AVA A;  1ARL A;  1NSL A;  5JQ4 A;  4ZX9 A;  2Z3P A;  3PFO A;  1XF8 A;  3DLJ A;  4KVX A;  4ONU A;  2H5M A;  4HNY B;  5HMN A;  3RYO A;  1TKJ A;  1XMB A;  3TTH A;  1ELL P;  4EME A;  1XOV A;  4RN7 A;  4C68 A;  4P4B A;  4B6Z A;  4B5P B;  2O28 A;  3WC6 A;  3PFE A;  1IU8 A;  5IB0 A;  4X5K A;  3H5Z A;  4B10 A;  3RBU A;  4MMO A;  2I00 A;  2ZW6 A;  3T9Y A;  3LAC A;  2AE6 A;  3C26 A;  4NFR A;  2GLJ A;  3KI9 A;  4TWE A;  1CPS A;  2AFS A;  4A31 A;  3JUW A;  3PB6 X;  2PJB A;  4QUS A;  4BMH A;  1XRY A;  2Z3M A;  5G21 A;  3QAY A;  2JDC A;  4FD6 A;  4DNC A;  3BI0 A;  4X2T A;  1VHE A;  1YLE A;  4P4E A;  3MRU A;  3G3S A;  2WYR A;  4FD5 A;  5H86 A;  1BLL E;  2EK9 A;  1WK4 A;  4RS2 A;  2I3C A;  1VGY A;  4MI4 A;  3PZJ A;  1ARM A;  2Z3L A;  4MBU A;  4U9Y A;  1I1D A;  3D7G A;  4KOT A;  5F48 A;  2CF4 A;  1YLO A;  3PP9 A;  3IWG A;  1IGB A;  4UEE A;  4R9M A;  1JQG A;  4KOU A;  3CZX A;  3SJG A;  3KR5 A;  4DYO A;  5F47 A;  3NE7 A;  4PXB A;  1CX8 A;  2BOA A;  1ZG8 A;  3D7H A;  2PQ8 A;  4R76 A;  2G3A A;  3F0A A;  5G22 A;  1LAN A;  1Y7E A;  3KKW A;  4L89 A;  4NGN A;  3KL9 A;  4DUK A;  1Q2Y A;  3IO1 A;  1LFW A;  2VXK A;  2ZW5 A;  3WR7 A;  4B12 A;  1SQH A;  1LAM A;  1X12 A;  3B2Y A;  5LRG A;  2B3U A;  3HUV A;  3S9N A;  4YRH A;  2GAN A;  4XPL A;  2R8V A;  2ZXV A;  2EK8 A;  3B7I A;  2QML A;  2VZZ A;  3SI1 A;  1Y7R A;  4QB9 A;  2ZW4 A;  1F2P A;  1XEB A;  4PK3 A;  2D4O A;  4MCP A;  4JZ0 A;  4UF4 A;  2G0B A;  3IC1 A;  4GXH A;  2CY2 A;  2ZEE A;  1P4N A;  2P6G A;  4MFP A;  3DNS A;  3CXQ A;  4AB7 A;  2Z10 A;  2ANP A;  3GY9 A;  3S6F A;  4FWU A;  1B87 A;  5DS0 A;  4JD6 A;  4EFD A;  3DSB A;  2Z0Z A;  4PXE A;  3BI1 A;  3TCV A;  2JBK A;  4OAE A;  1H8L A;  4CAF A;  3JVN A;  4Q38 A;  3F5B A;  1XBU A;  3T8W A;  4AXV A;  4CPA A;  1S7F A;  3B3T A;  4F8Z A;  3KQX A;  2AFW A;  2PSW A;  4LUA A;  1XJO A;  1ZG9 A;  2F8H A;  2VL1 A;  4MCQ A;  4KSI A;  4UEZ A;  3D7D A;  2ZEL A;  2BL1 A;  2PVW A;  2RC4 A;  3NA6 A;  4ZY1 A;  6CPA A;  2PIZ A;  3FX6 A;  4ONW A;  4NGP A;  1Z8T A;  2ARH A;  2XEF A;  3SJX A;  2AJ6 A;  3ISZ A;  1AUG A;  4ZBG A;  1TKF A;  4HPS A;  4E8O A;  4UFX A;  2FXF A;  2WSA A;  3IEH A;  4KVO E;  3HLP A;  1CM0 A;  3EC4 A;  4HNW B;  4P4I A;  5K8O A;  4P4J A;  1CBX A;  3QNV A;  1VKC A;  4M3S A;  2ZEM A;  2VI7 A;  3RZA A;  5LRJ A;  2WPW A;  5IX3 A;  3R95 A;  4CYO A;  3KZW A;  3SXO A;  2DPS A;  2JBJ A;  3S6H A;  5LRK A;  4CAV A;  4UEF A;  2OZU A;  1EE3 P;  3VAR A;  4OID A;  1J4J A;  1HDQ A;  2EUI A;  4H2K A;  1FNO A;  2V77 A;  1M1D A;  3RO0 A;  3CPA A;  4LQG A;  1Z4R A;  5JM6 A;  1S7K A;  1ZO0 A;  1S7L A;  3BJ7 A;  4NGM A;  2OOT A;  4Q7A A;  4XPK A;  1IOI A;  1DE4 C;  5A27 A;  4KSA A;  2C27 A;  1YRE A;  4JWP A;  2NYQ A;  2IMO A;  4M6G A;  2C1C A;  2FE7 A;  3QB8 A;  5THW A;  2YNC A;  1QQ9 A;  1YW4 A;  4NEX A;  3R9G A;  1ELM P;  1QSN A;  2V8V A;  1CJW A;  1MJB A;  2DPT A;  5KTD A;  3IJ3 A;  4MXU A;  2DF5 A;  1Y9W A;  2PJ0 A;  4P6Y A;  5HVF A;  1PUA A;  3CXS A;  2P6E A;  2OH1 A;  3KGQ A;  4UCN A;  2PCU A;  3TC8 A;  2B4B A;  3MN8 A;  3FH4 A;  3GB0 A;  2Z11 A;  2ZPA A;  5F49 A;  2GE3 A;  1FY7 A;  4ZYQ A;  4YU9 A;  3IFE A;  3F8K A;  3V38 A;  4A95 A;  1S5K A;  2VBQ A;  4MCS A;  4RI1 A;  1ZG7 A;  4A33 A;  2EVN A;  3NH5 A;  3K9U A;  3IU1 A;  3PB9 X;  4NJQ A;  4CYQ A;  4YFJ A;  2Y0M A;  2Q4Y A;  2VEZ A;  3CXP A;  4IAV A;  1IOF A;  2C6P A;  5K8P A;  1Y9K A;  5K8M A;  4MFJ A;  2ODF A;  2Z3N A;  1Y0Y A;  2I79 A;  3FEE A;  2FSR A;  2JDD A;  4UWI A;  4R7M A;  3D4U A;  2Q4V A;  1RTQ A;  2BCO A;  2NMT A;  4UWJ A;  3W6X A;  3R96 A;  1L0C A;  1YW6 A;  2GRE A;  4C2Z A;  4G1P A;  4O23 A;  4P44 A;  4WJB A;  2GU2 A;  4CGN A;  5K8N A;  2C6G A;  5DWN A;  4QC6 A;  2FL4 A;  3B3V A;  4UIA A;  4ZX8 A;  2V8H A;  4UCM A;  3CT9 A;  2BEI A;  5J1Q A;  5AG6 A;  4XNH B;  3G8W A;  1BPN A;  1CP6 A;  2YNE A;  2AFZ A;  1MJA A;  1LAP A;  2JEW A;  8CPA A;  3SHP A;  1TF8 A;  1KZF A;  4KOS A;  4B13 A;  2FVG A;  4XPD C;  4ZY2 A;  2A4N A;  4FUU A;  3CDX A;  1YX0 A;  1UFH A;  4KSF A;  4MCR A;  3S6G A;  2QEC A;  2ATR A;  3FED A;  4R3K A;  3EXN A;  4PK2 A;  2REF A;  5HVH A;  3LOD A;  3LMS A;  2J8M A;  2Q04 A;  2F5I A;  3TOA A;  3D68 A;  1F57 A;  4EVY A;  4KOR A;  4NGR A;  2ABZ A;  2PJC A;  4BIN A;  4A94 A;  4PXC A;  1BPM A;  4R87 A;  4JJX A;  4ORF A;  4CYP A;  2Q7B A;  1TF9 A;  4OC1 A;  5KTC A;  4ZGY B;  5C88 A;  5ISV A;  2ZEH A;  2ZEP A;  3K9T A;  2PIY A;  3N5F A;  4FD4 A;  2WUU A;  1RXT A;  1OZP A;  5G20 A;  5LYI A;  3FMC A;  5KTA A;  3ZZI A;  2ZED A;  3GIU A;  3GKR A;  5GCN A;  1U6M A;  4ZY0 A;  1PCA A;  4CGO A;  3IIB A;  4NGQ A;  1LOK A;  1Z9U A;  3FF3 A;  4NGS A;  3LD2 A;  3KHZ A;  4UBR A;  3PB4 X;  3N7Z A;  4KOX A;  5DWM A;  3FNC A;  4IK2 A;  2POK A;  4YWY A;  4F9V A;  2ZEO A;  1HDU A;  4R3L A;  1MJ9 A;  1LCP A;  1P0H A;  3BJ8 A;  1B6B A;  3MGD A;  4MHP A;  4MY0 A;  5D8N A;  1TXR A;  2B3V A;  4UA3 A;  1M4I A;  2B4D B;  3PBB A;  2PRQ A;  2D4P A;  4OP4 A;  3K2K A;  4X8I A;  1Z4E A;  2GIV A;  1YK3 A;  4M85 A;  4NJR A;  5CPA A;  4OC3 A;  4B5P A;  1Z8X A;  1IYK A;  1V0C A;  1F2O A;  1Z8L A;  2REE A;  4NXY A;  3SJE A;  5BWA B;  3S9L A;  3VAT A;  4UFV A;  2CXA A;  1I12 A;  3P2H A;  5G1Z A;  2DXQ A;  2HQY A;  3KR4 A;  4KOW A;  3RNZ A;  4II9 A;  2V8D A;  2CIJ A;  2HB6 A;  2PE3 A;  3H8E A;  3A9L A;  3RAM A;  3S9M A;  2B5G B;  3EY5 A;  4QBJ A;  5AGE A;  1IB1 E;  3TT2 A;  4NGT A;  5LYL A;  1YVO A;  1KUY A;  4PSX A;  2PJ6 A;  3D2M A;  3TO7 A;  4KOY A;  4OC0 A;  4B5O A;  2AFU A;  4F0X A;  5LYF A;  1KUX A;  1LRZ A;  4RUH A;  1UWY A;  1TIQ A;  4MFK A;  4A37 A;  2PDO A;  4DJL A;  3TE4 A;  4MHD A;  2ZOG A;  4HNX B;  3D2P A;  2IL4 A;  4F9U A;  4XNH C;  1Q2C A;  4E0A A;  1Q2D A;  4FAI A;  5JPH A;  3DR6 A;  3ISX A;  2KCW A;  2HV2 A;  4K30 A;  3TFY A;  4IUS A;  3R1K A;  4MRI A;  3T90 A;  2CNS A;  4PV6 A;  3TX8 A;  2BSW A;  3ZJ0 A;  2ZOF A;  2PR8 A;  4CRY B;  4JLY A;  2QYV A;  2G9D A;  4XPD B;  5E96 A;  3PRT A;  4KZT A;  3NH4 A;  3E0K A;  1M4G A;  3B8G A;  4M6H A;  4A39 A;  4F0Y A;  1NE9 A;  3V8I A;  4Y49 B;  1Z8W A;  5AG5 A;  5JH9 A;  2OU2 A;  4FD7 A;  2ZW7 A;  3CPX A;  3FBU A;  1OBR A;  1AYE A;  1S7N A;  3FRM A;  3KHX A;  3UY5 A;  3WAB A;  1MK4 A;  1R43 A;  4CAE A;  2IJZ A;  4CAW A;  2PJA A;  1QSO A;  1YGH A;  4A38 A;  2FIA A;  2AFM A;  3PB7 X;  1CPX A;  2XEI A;  4HKF A;  4UIB A;  2HUZ A;  4MFZ A;  2WPX A;  4K3N A;  2OB0 A;  1XE4 A;  2PJ5 A;  1S60 A;  4U5Y A;  5JGF A;  3NH8 A;  3BLN A;  3P2F A;  2CNM A;  4YGO A;  1IIC A;  4MJ8 A;  2FS5 A;  3D66 A;  3FXT A;  5F46 A;  2VZY A;  3FIX A;  1Y0R A;  3SI0 A;  1K4J A;  3LWU A;  7CPA A;  2Q4Z A;  3QAH A;  5C82 A;  4NF1 A;  4UCP A;  1N71 A;  2F7V A;  4NSQ A;  4KLV A;  2YND A;  4JYW A;  2Q51 A;  4ZI6 A;  1R3N A;  4AVC A;  4IHM A;  4B14 A;  3FJU A;  4OC4 A;  4H6U A;  4LX9 A;  1BOB A;  3WC5 A;  4WWV A;  5IV0 A; 
#chains in the Genus database with same CATH homology
 5EC4 A;  2B58 A;  2R7H A;  4CYN A;  1QST A;  3VWD A;  4CS0 B;  1XIX A;  3IGR A;  2FCK A;  4C2X A;  4JXR A;  4Y49 C;  4QVT A;  2R98 A;  4KUA A;  4MY3 A;  5H84 A;  2JLM A;  3GYA A;  1IYL A;  1R57 A;  2Z3K A;  4CGL A;  3I3G A;  4U9Z A;  2Q44 A;  4AG7 A;  2X7B A;  1QSR A;  2B5G A;  4I49 A;  4E2A A;  2JEV A;  4H6Z A;  4C7H A;  4CRZ B;  2OZH A;  4KUB A;  1M44 A;  4MFQ A;  1WWZ A;  1ON0 A;  2FIW A;  2PR1 A;  3TO9 A;  1NMT A;  4AVB A;  2J8N A;  3R9E A;  3S6K A;  2K5T A;  4CAX A;  4A2Z A;  3DR8 A;  5A28 A;  4BBH A;  2B4D A;  4AG9 A;  2OZG A;  2PC1 A;  4C2Y A;  2P0W A;  1YR0 A;  2Q0Y A;  5AG4 A;  3EFA A;  1IID A;  1S3Z A;  1BO4 A;  5CNP A;  4CGM A;  4J3G A;  4PSW A;  3JTK A;  2Z3O A;  4CGP A;  1YVK A;  3IU2 A;  4NCZ A;  3VWE A;  2G3T A;  3PGP A;  4F6A A;  5J8F A;  4OAD A;  3R9F A;  1QSM A;  4MFL A;  2VQY A;  3W91 A;  2FT0 A;  4GS4 A;  3FB3 A;  5HH1 A;  4OLL A;  4A32 A;  2CNT A;  3D8P A;  3FYN A;  4C7I A;  1RO5 A;  5EBV A;  1I21 A;  4KOV A;  3IWE A;  2YGW A;  3D3S A;  3TOB A;  3EO4 A;  5J8C A;  1PU9 A;  3I9S A;  4A30 A;  4H89 A;  4KS9 A;  4KVM E;  4KLW A;  3OWC A;  2R1I A;  5I0C A;  4JXQ A;  4B11 A;  5FVJ A;  2QIR A;  5AG7 A;  2P6F A;  1M4D A;  4IF5 A;  3H4Q A;  2J8R A;  2YNC C;  1XMT A;  4UFW A;  1VHS A;  4R57 A;  2PRB A;  1KUV A;  4Q36 A;  3DDD A;  3SXN A;  4L8A A;  3TO6 A;  3W6S A;  1GHE A;  2BUE A;  4AVA A;  1NSL A;  5JQ4 A;  2Z3P A;  1XF8 A;  4KVX A;  4ONU A;  2H5M A;  4HNY B;  5HMN A;  3RYO A;  3TTH A;  4C68 A;  4B5P B;  2O28 A;  5IB0 A;  4X5K A;  3H5Z A;  4B10 A;  2I00 A;  2ZW6 A;  3T9Y A;  2AE6 A;  3C26 A;  4A31 A;  3JUW A;  4QUS A;  4BMH A;  2Z3M A;  5G21 A;  2JDC A;  4FD6 A;  4DNC A;  1YLE A;  3G3S A;  5H86 A;  4FD5 A;  1WK4 A;  4RS2 A;  4MI4 A;  3PZJ A;  2Z3L A;  4MBU A;  4U9Y A;  1I1D A;  4KOT A;  5F48 A;  3PP9 A;  3IWG A;  4R9M A;  4KOU A;  5F47 A;  3NE7 A;  2PQ8 A;  2G3A A;  3F0A A;  5G22 A;  3KKW A;  4L89 A;  1Q2Y A;  2VXK A;  2ZW5 A;  3WR7 A;  4B12 A;  1SQH A;  2B3U A;  4YRH A;  2GAN A;  4XPL A;  2R8V A;  2ZXV A;  2QML A;  2VZZ A;  1Y7R A;  4QB9 A;  2ZW4 A;  1XEB A;  4PK3 A;  2D4O A;  2G0B A;  2CY2 A;  1P4N A;  2P6G A;  4MFP A;  3DNS A;  3CXQ A;  4AB7 A;  2Z10 A;  3GY9 A;  3S6F A;  1B87 A;  4JD6 A;  3DSB A;  2Z0Z A;  3TCV A;  4OAE A;  4CAF A;  3JVN A;  4Q38 A;  3F5B A;  1S7F A;  2PSW A;  4LUA A;  2BL1 A;  2RC4 A;  2ARH A;  2AJ6 A;  4ZBG A;  4E8O A;  4UFX A;  2FXF A;  2WSA A;  4KVO E;  1CM0 A;  3EC4 A;  4HNW B;  1VKC A;  4M3S A;  2VI7 A;  2WPW A;  5IX3 A;  3R95 A;  4CYO A;  3SXO A;  2DPS A;  3S6H A;  4CAV A;  2OZU A;  1J4J A;  2EUI A;  1M1D A;  1Z4R A;  1S7K A;  1ZO0 A;  1S7L A;  3BJ7 A;  4XPK A;  5A27 A;  4KSA A;  2C27 A;  1YRE A;  4JWP A;  2FE7 A;  3QB8 A;  2YNC A;  4NEX A;  3R9G A;  1QSN A;  1CJW A;  1MJB A;  2DPT A;  5KTD A;  1Y9W A;  1PUA A;  3CXS A;  2P6E A;  2OH1 A;  4UCN A;  2B4B A;  2Z11 A;  2ZPA A;  5F49 A;  2GE3 A;  1FY7 A;  3F8K A;  4A95 A;  1S5K A;  2VBQ A;  4RI1 A;  4A33 A;  2EVN A;  3K9U A;  3IU1 A;  4CYQ A;  4YFJ A;  2Y0M A;  2Q4Y A;  2VEZ A;  3CXP A;  1Y9K A;  4MFJ A;  2Z3N A;  2I79 A;  2FSR A;  2JDD A;  4UWI A;  2Q4V A;  2NMT A;  3W6X A;  4UWJ A;  3R96 A;  1L0C A;  4C2Z A;  4CGN A;  5DWN A;  4QC6 A;  2FL4 A;  4UCM A;  2BEI A;  5AG6 A;  4XNH B;  3G8W A;  2YNE A;  1MJA A;  3SHP A;  4KOS A;  1KZF A;  4B13 A;  4XPD C;  2A4N A;  1YX0 A;  1UFH A;  4KSF A;  3S6G A;  2QEC A;  2ATR A;  4R3K A;  3EXN A;  4PK2 A;  2REF A;  3LOD A;  2J8M A;  2Q04 A;  2F5I A;  3TOA A;  4EVY A;  4KOR A;  4R87 A;  4JJX A;  4ORF A;  4CYP A;  2Q7B A;  5KTC A;  4ZGY B;  5C88 A;  5ISV A;  4FD4 A;  2WUU A;  1RXT A;  1OZP A;  5G20 A;  5KTA A;  3ZZI A;  3GKR A;  5GCN A;  1U6M A;  4CGO A;  1Z9U A;  3LD2 A;  4UBR A;  3N7Z A;  4KOX A;  5DWM A;  3FNC A;  4R3L A;  1MJ9 A;  1P0H A;  3BJ8 A;  1B6B A;  3MGD A;  4MY0 A;  2B3V A;  4UA3 A;  1M4I A;  2B4D B;  2D4P A;  1Z4E A;  2GIV A;  1YK3 A;  4M85 A;  4B5P A;  1IYK A;  1V0C A;  2REE A;  4NXY A;  5BWA B;  4UFV A;  2CXA A;  1I12 A;  3P2H A;  5G1Z A;  2DXQ A;  2HQY A;  4KOW A;  4II9 A;  3A9L A;  4QBJ A;  2B5G B;  3EY5 A;  5AGE A;  1IB1 E;  3TT2 A;  1YVO A;  1KUY A;  4PSX A;  3D2M A;  3TO7 A;  4KOY A;  4B5O A;  4F0X A;  1KUX A;  1LRZ A;  1TIQ A;  4MFK A;  2PDO A;  3TE4 A;  4MHD A;  4HNX B;  3D2P A;  2IL4 A;  4XNH C;  1Q2C A;  4E0A A;  1Q2D A;  5JPH A;  3DR6 A;  2KCW A;  2HV2 A;  4K30 A;  3TFY A;  4IUS A;  3R1K A;  3T90 A;  2CNS A;  4PV6 A;  3ZJ0 A;  2BSW A;  4CRY B;  2PR8 A;  4JLY A;  4XPD B;  5E96 A;  4KZT A;  3E0K A;  1M4G A;  3B8G A;  4F0Y A;  1NE9 A;  3V8I A;  4Y49 B;  5AG5 A;  2OU2 A;  4FD7 A;  2ZW7 A;  3FBU A;  1S7N A;  3FRM A;  3UY5 A;  4CAE A;  1MK4 A;  4CAW A;  1QSO A;  1YGH A;  2FIA A;  4HKF A;  2HUZ A;  4MFZ A;  2WPX A;  2OB0 A;  1XE4 A;  4U5Y A;  1S60 A;  3BLN A;  3P2F A;  2CNM A;  4YGO A;  1IIC A;  4MJ8 A;  2FS5 A;  3FXT A;  5F46 A;  2VZY A;  3FIX A;  1K4J A;  3QAH A;  5C82 A;  4NF1 A;  4UCP A;  1N71 A;  4NSQ A;  4KLV A;  2YND A;  4B14 A;  4AVC A;  4H6U A;  4LX9 A;  1BOB A;  5IV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...