2OZHA

Crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
GMPHVHVSTDNSLLDIGLIHRTLSQDTDWAKDIPLALVQRAIDHSLCFGGFVDGRQVAFARVISDYATFAYLGDVFVLPEHRGRGYSKALMDAVMAHPDLQGLRRFSLATSDAHGLYARYGFTPPLFPQSLMERYVPGLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XCC2953
publication title Crystal structure of hypothetical protein (NP_638301.1) from Xanthomonas campestris at 1.40 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 34
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ozhA01
2Z10A 2FS5A 3T90A 1I21A 2HUZA 4JD6A 3W91A 2GANA 5KTCA 3TO7A 1BOBA 4KLVA 4YGOA 3SXNA 4I49A 4KVOE 1I1DA 2AE6A 4KVXA 2PC1A 2OZUA 4L89A 1LRZA 1Y7RA 2QMLA 4KZTA 2EVNA 4RI1A 3R95A 1YREA 1BO4A 2VZYA 2C27A 1R57A 1IYLA 4R3LA 3JVNA 1YVKA 4YRHA 2ARHA 4Y49C 3DR8A 4R57A 1GHEA 1Y9KA 3SXOA 3R1KA 2CNMA 4QVTA 4QBJA 3PP9A 2H5MA 4EVYA 4E8OA 4OAEA 3S6HA 4AVBA 4R9MA 2JDDA 3F0AA 5DWNA 3R9GA 2F5IA 2HV2A 1XE4A 2B4DB 3CXSA 5ISVA 4JXRA 4JJXA 4MY0A 4XPDB 3G8WA 3EXNA 2AJ6A 2BUEA 5KTDA 2VQYA 3D2PA 1TIQA 3TCVA 2P0WA 4KOYA 4MJ8A 3CXPA 1SQHA 3GYAA 1S7LA 3IWGA 4UWJA 4KUBA 2FXFA 4AB7A 2GE3A 1MK4A 1V0CA 2EUIA 2VZZA 1YGHA 3D3SA 1Z4EA 2GIVA 5J8CA 2D4OA 2R7HA 2P6EA 3W6XA 4HNYB 4CRYB 3VWEA 1Q2DA 3S6GA 1WWZA 2Q4YA 3H4QA 1MJ9A 3PGPA 3I3GA 4UA3A 4KOTA 3DR6A 4JLYA 2VEZA 1ON0A 2B58A 2PSWA 2R1IA 4ONUA 3FRMA 4II9A 5HMNA 5EBVA 4PSXA 2Y0MA 2J8RA 1FY7A 4KUAA 3QB8A 2FT0A 3F5BA 1S60A 3TOBA 5FVJA 1NMTA 1S7FA 3LD2A 3OWCA 4B5OA 1QSNA 2G3AA 2BL1A 5IX3A 1QSRA 4HNWB 1L0CA 5H86A 4ZBGA 2OH1A 4PK2A 1QSTA 1U6MA 2PR1A 3W6SA 4F6AA 1MJAA 3CXQA 2O28A 3PZJA 3MGDA 4KLWA 1XEBA 5DWMA 2OZHA 1S7KA 3EO4A 4R3KA 2B5GA 2ZW4A 4JWPA 4U9YA 4FD5A 5H84A 3TO6A 4KORA 4M85A 4B5PA 1Q2YA 4HKFA 1IB1E 1N71A 4KOSA 1K4JA 1QSMA 4KOUA 2PQ8A 4U9ZA 2PR8A 1KZFA 3RYOA 1YK3A 4HNXB 2BEIA 4NEXA 5C82A 1IYKA 4KOXA 4E2AA 3GKRA 2VI7A 4H89A 3R9EA 3JUWA 3WR7A 4UBRA 1NSLA 1B87A 2ATRA 2FIWA 4NF1A 3FYNA 4CAWA 2KCWA 1YLEA 3TTHA 5C88A 4QB9A 2CY2A 5EC4A 4AG9A 3NE7A 3I9SA 2PRBA 4XPDC 4NCZA 2DXQA 5J8FA 3GY9A 1YX0A 2OU2A 4ORFA 2J8NA 4AVCA 1M1DA 4MHDA 3IGRA 4H6ZA 4M3SA 3ZJ0A 4CAVA 2ZPAA 1M4IA 2WPWA 4RS2A 3TOAA 4AG7A 5E96A 4CRZB 1KUYA 4NSQA 1QSOA 1S3ZA 4PV6A 5F46A 1P0HA 3DNSA 3B8GA 1Q2CA 4PK3A 1PUAA 3DDDA 4R87A 2Z11A 4LUAA 3TT2A 4LX9A 4K30A 3EFAA 1J4JA 1I12A 2VBQA 2R98A 2OZGA 2B4DA 3N7ZA 2OB0A 1B6BA 2JLMA 3BJ8A 2FSRA 2JDCA 3DSBA 4XNHB 1CM0A 4KVME 1XIXA 3LODA 5F47A 1P4NA 2B5GB 3R9FA 3D2MA 2REEA 1KUVA 2QIRA 2B3VA 1OZPA 1VHSA 3TFYA 2PDOA 4XPKA 4FD4A 1KUXA 2HQYA 3FIXA 2NMTA 5HH1A 4IUSA 2B3UA 2K5TA 3S6KA 1Z9UA 2P6GA 5KTAA 3G3SA 1S5KA 4J3GA 4F0YA 3UY5A 4OADA 4L8AA 4BMHA 4KOVA 2FE7A 4DNCA 1UFHA 1VKCA 2CNTA 2CNSA 2FIAA 3F8KA 3FB3A 1XF8A 2Q0YA 4U5YA 1YVOA 3K9UA 3SHPA 4FD6A 3P2HA 3E0KA 1RO5A 2VXKA 3BJ7A 1WK4A 2R8VA 2Z0ZA 4Y49B 3QAHA 1NE9A 2G3TA 5GCNA 1M4DA 1M44A 2RC4A 2ZXVA 3P2FA 2BSWA 1IICA 4UWIA 2ZW6A 5F48A 1Y9WA 2Q44A 1MJBA 4CS0B 4MY3A 4YFJA 3TO9A 2REFA 3FXTA 5JPHA 2P6FA 3EC4A 2QECA 1IIDA 3V8IA 3KKWA 2I79A 3EY5A 4PSWA 5I0CA 2JEVA 3TE4A 5IV0A 4MI4A 1M4GA 4AVAA 3FNCA 2Q4VA 2ZW7A 2A4NA 3VWDA 2FL4A 4H6UA 1CJWA 1YR0A 2Q04A 2I00A 4NXYA 1RXTA 4GS4A 2Q7BA 4X5KA 4XNHC 5CNPA 5IB0A 3C26A 3S6FA 3T9YA 1XMTA 3D8PA 2D4PA 4E0AA 4CAXA 1Z4RA 4B5PB 2ZW5A 4FD7A 4OLLA 4MBUA 1S7NA 4QUSA 3FBUA 3BLNA 2B4BA 4KOWA 3R96A 4IF5A 2X7BA 3ZZIA 4QC6A 5F49A 2J8MA 2FCKA 5JQ4A 4JXQA 2WPXA 2IL4A 1PU9A 4XPLA 2G0BA
chains in the Genus database with same CATH superfamily
2Z10A 2FS5A 1QMUA 3T90A 4A37A 3B3CA 1F2OA 2AFZA 4MCQA 4Z65A 1I21A 2HUZA 4JD6A 4HPSA 4MHZA 1CPSA 3H8EA 3W91A 2GANA 5KTCA 4UFXA 1BOBA 3TO7A 1AUGA 4KLVA 2DEAA 4YGOA 3SXNA 4I49A 1Z2LA 4KVOE 1I1DA 2AE6A 4KVXA 1AYEA 3BI1A 2PC1A 2PJ3A 2WZNA 3SI1A 2OZUA 2PIZA 4KSAA 1EE3P 4L89A 1LRZA 3FH4A 2FVGA 4MHNA 3T8WA 4CAFA 1ARMA 1Y7RA 2QMLA 2EVNA 2Q43A 4KZTA 4RI1A 4WJBA 1R3NA 5ELYA 3R95A 1YREA 2PE3A 1BO4A 4CGOA 4DJLA 2VZYA 2G9DA 4MRIA 2C27A 2GLJA 1R57A 1IYLA 2QJ8A 4CYNA 4R3LA 3JVNA 4MFZA 6CPAA 1YVKA 2HC9A 4YRHA 2ARHA 4Y49C 3TX8A 4AXVA 3DR8A 1M4LA 3CZXA 4NGQA 3VARA 4R57A 4KSIA 1GHEA 2ZEDA 1ZG9A 1Y9KA 3CDXA 2PCUA 1YQEA 4UFVA 3SXOA 3R1KA 2CNMA 4C7HA 1X10A 4QVTA 1XOVA 4QBJA 3CPXA 3PP9A 2H5MA 4EVYA 4NJQA 4OKOA 5EMIA 2PJCA 4E8OA 4OAEA 1ELLP 3S6HA 3WABA 4AVBA 4R9MA 2V8DA 2JDDA 4OC1A 3F0AA 4P4DA 1IY7A 2Z3LA 5K8MA 1IOFA 4X2TA 5DWNA 5G1ZA 2F5IA 2HV2A 4R7MA 3R9GA 2F8HA 5LRJA 1XE4A 4OC5A 1LOKA 2PJ6A 3JTKA 2B4DB 3CXSA 5ISVA 5HXDA 4JXRA 1XFOA 4JJXA 4MY0A 4UCPA 4XPDB 1CP6A 3V7ZA 3G8WA 3EXNA 2AJ6A 2BUEA 3NFZA 3GLJA 5KTDA 5A28A 2VQYA 4Q38A 1PCAA 1BAVA 3D2PA 4X8IA 3VH9A 4C2XA 4RUHA 5CPAA 1TIQA 4MCSA 2P0WA 3TCVA 4KOYA 1Z8XA 3B3VA 2IMOA 4MJ8A 2VL1A 3CXPA 1SQHA 3RAMA 2AFSA 3GYAA 4IK2A 5G22A 1S7LA 2GFQA 3IWGA 4UWJA 4KUBA 2FXFA 4AB7A 2GE3A 1MK4A 1V0CA 2EUIA 2VZZA 3H5ZA 4B13A 1YGHA 3D3SA 1Z4EA 5LRGA 1H8LA 4NGRA 1Y0RA 2GIVA 5HVFA 2PJ5A 5J8CA 2D4OA 2R7HA 4P4EA 3B3TA 2P6EA 3W6XA 1Q7LA 4HNYB 4CRYB 3KQXA 4PXCA 2JEWA 1YW6A 3VWEA 4LQ6A 4UFWA 5LRKA 2PJBA 1Q2DA 3S6GA 5BWAB 1WWZA 3BXMA 3WC5A 3KR4A 4JZ0A 1VHOA 3GIUA 2Q4YA 2PJ1A 1MJ9A 2QYVA 3H4QA 1Y7EA 3I3GA 3PGPA 4P4FA 4R8FA 4UA3A 5LYFA 4KOTA 4BD9A 3DR6A 4JLYA 2VEZA 3GUXA 3IEHA 2Z3MA 3KI9A 1TXRA 1ON0A 2B58A 5IB9A 2PSWA 5HVHA 1Y0YA 2R1IA 3MN8A 4ONUA 3FRMA 3B7IA 4II9A 5JH9A 5HMNA 3A9LA 3PB8X 5EBVA 2AFWA 4PSXA 2Y0MA 4PPZA 2J8RA 1XRYA 4IHMA 1FY7A 1R43A 4BBHA 4KUAA 1Z8TA 2Q7SA 3QB8A 4Q7AA 4TWEA 1ZG8A 2FT0A 1S60A 3F5BA 4NGPA 4ZY2A 3KHXA 3TOBA 1VIXA 5FVJA 3PB4X 4ZY1A 1NMTA 1S7FA 4R76A 3LD2A 3OWCA 3FECA 4B5OA 3I1UA 1QSNA 5AG5A 7CPAA 2G3AA 2BL1A 5IX3A 2PJ2A 1QSRA 2PJ0A 3GB0A 4HNWB 5F09A 1L0CA 5H86A 4ZBGA 4OC3A 5AGEA 4ZY0A 2OH1A 3SI0A 4PK2A 3D7HA 1QSTA 3KGQA 3IWEA 1U6MA 2V77A 2PR1A 3W6SA 4A31A 2J9AA 5D29A 4F6AA 1MJAA 3CXQA 3S9MA 2O28A 3PZJA 3MGDA 4KLWA 3B3SA 1TKJA 1YMEA 5G21A 1XEBA 3PBBA 5DWMA 2OZHA 1S7KA 3D68A 5HVGA 3EO4A 5G20A 1ZG7A 2B5GA 2ZW4A 4R3KA 4JWPA 4U9YA 4FD5A 5LYLA 3FEDA 5H84A 3H8FA 3TO6A 4KORA 4M85A 3V38A 4B5PA 1DTDA 4NJRA 4X3RA 1Q2YA 4HKFA 1IB1E 1N71A 4UIBA 3K2KA 4MXUA 4KOSA 3SJXA 1K4JA 1QSMA 4KOUA 4A2ZA 2Z3KA 2PQ8A 3VATA 2WSAA 4U9ZA 2PR8A 1KZFA 3FX6A 3D4UA 3RYOA 2YNEA 1YK3A 4HNXB 4NGMA 1IGBA 5AG7A 2BEIA 4NEXA 3LWUA 4M6IA 4RN7A 3NH8A 5C82A 1IYKA 3QNVA 4DYOA 4KOXA 4CGMA 2XEIA 4E2AA 3GKRA 1TF8A 2VI7A 4H89A 2Z3NA 2ZEOA 2ZEFA 4P4BA 3R9EA 1Z8WA 3SI2A 2C6GA 3JUWA 4MFLA 3WR7A 4P44A 4A30A 4DUKA 1HDQA 1PYTB 4MMOA 4GXHA 4UBRA 3D7DA 1B87A 2CIJA 2ATRA 2FIWA 1NSLA 4YWYA 4CGNA 2V8VA 4NF1A 3PB7X 3FYNA 4CAWA 1GYTA 4MFJA 4P10A 2KCWA 1YLEA 3TTHA 5C88A 1CG2A 3WC7A 4QB9A 4UF4A 4UCNA 2CY2A 4PXEA 5EC4A 3L2NA 3NE7A 1VGYA 4GM5A 4AG9A 3NH4A 5THWA 3I9SA 1CP7A 2PRBA 4XPDC 1HEEA 4NCZA 2DXQA 5J8FA 3GY9A 1YX0A 2OU2A 4EFDA 2NYQA 4OP4A 2WYRA 2GREA 4ORFA 2J8NA 4AVCA 3NA6A 1M1DA 4C68A 3HUVA 4MHDA 1VHEA 3IGRA 3D7GA 2ZEMA 5JGFA 4H6ZA 2GU2A 4M3SA 3ZJ0A 4A95A 3PRTA 4F9VA 3PFOA 3FF3A 4CAVA 2ZPAA 1CPXA 3LMSA 1NSAA 3B35A 1M4IA 2PVVA 2WPWA 4RS2A 3TOAA 4AG7A 2AFMA 4P4IA 5E96A 4CRZB 1KUYA 3PBEA 4NGNA 4NSQA 3IFEA 1QSOA 3D7FA 4ZX8A 1LAMA 1S3ZA 4PV6A 1YLOA 2YNCA 2AFUA 5F46A 1P0HA 2Z3PA 3B8GA 3DNSA 1Q2CA 4PK3A 1PUAA 3CPAA 3DDDA 4R87A 2Z11A 2EBJA 4LUAA 3TT2A 3HLPA 1BLLE 1LANA 2XEGA 4B6ZA 4LX9A 4K30A 2IJZA 2PJAA 3EFAA 4P6YA 3FMCA 3RNZA 4UEEA 1J4JA 1I12A 2VBQA 2R98A 4UIAA 4OIDA 2OZGA 4MFQA 2B4DA 2OB0A 3BJ8A 1B6BA 2JLMA 3N7ZA 2FSRA 2PJ4A 4PXDA 2JDCA 3DSBA 1Z5RA 2C6CA 3KR5A 4XNHB 3RBUA 1CM0A 3KASA 2PJ9A 3DGVA 4KVME 4MCRA 1XIXA 3LODA 5F47A 4EWTA 2GLFA 1P4NA 2ANPA 2B5GB 2BCOA 2O4HA 2ODFA 4PXBA 4ZYQA 1ZLHA 2PJ8A 3CT9A 3NH5A 1AMPA 3D2MA 2PIYA 3R9FA 4CGLA 2REEA 4A32A 2JBJA 4F0XA 4YU9A 4OC0A 1KUVA 2QIRA 1Z8LA 1JWQA 4A94A 4ZX9A 4W9YA 3K9TA 1X12A 2B3VA 2AFXA 4MFKA 1OZPA 1VHSA 4CYQA 3TFYA 1ELMP 2PDOA 2XEJA 4XPKA 4FD4A 3IU1A 4M6HA 1KUXA 2HQYA 2YNDA 2PRQA 3FIXA 4B10A 1F2PA 1CX8A 2NMTA 3KHZA 5HH1A 2EWBA 3IU2A 4IUSA 2B3UA 4CAEA 2K5TA 5AG6A 3S6KA 1Z9UA 3PFEA 4CYOA 3MRUA 2NSMA 2P6GA 4M6GA 4FAIA 4JYWA 4OIWA 4IAVA 3TC8A 5KTAA 5K8PA 3G3SA 3IC1A 2POKA 4PQAA 1S5KA 4J3GA 4F0YA 2XEFA 4C7IA 4ZI6A 2Q4ZA 4CYPA 2C6PA 3S9NA 3BI0A 2C1CA 2V8HA 1TKHA 3UY5A 4OADA 2BO9A 2ZELA 4L8AA 4OC4A 4BMHA 5K8NA 3IWWA 3WC6A 3FJUA 4KOVA 2FE7A 2ZOGA 4DNCA 2IQ6A 1UFHA 1UWYA 4FWUA 2F7VA 1VKCA 4FUUA 2CNTA 3KQZA 2CNSA 2FIAA 3F8KA 3SJFA 3FB3A 1XF8A 2Q0YA 2V8GA 4NGSA 5J1QA 3NE8A 2CTBA 4U5YA 1YVOA 1F57A 1FT7A 3K9UA 4CGPA 3SHPA 4FD6A 1LFWA 3P2HA 3BHXA 4TNUA 3E0KA 3KL9A 1RO5A 2VXKA 4R6TA 2OR4A 2YNCC 3BJ7A 1WK4A 2HB6A 4P4JA 2R8VA 2Z0ZA 2O53A 4Y49B 4F9UA 4B14A 3QAHA 1NE9A 3FVLA 4LQGA 2G3TA 3LACA 4MFPA 3H8GA 5GCNA 1M4DA 3RO0A 1M44A 2RFHA 5I4MA 4NFRA 3SJEA 2RC4A 2ZXVA 1HDUA 3P2FA 3SJGA 2BSWA 4F8ZA 1IICA 1BPNA 5A27A 1KWMA 1TKFA 3DLJA 4UWIA 2ZW6A 4MHYA 4P45A 5F48A 1Y9WA 1XBUA 1YW4A 2Q44A 1MJBA 3B3WA 2ABZA 4UEFA 4A38A 4CS0B 1LCPA 1FNOA 1TF9A 3WT4A 4MY3A 4YFJA 2YGWA 3TO9A 2EK8A 2REFA 3FXTA 5JM6A 2OOTA 1JQGA 4FBEA 2CF4A 1BPMA 1XJOA 5JPHA 4MCPA 1QQ9A 2P6FA 3EC4A 2QECA 1IIDA 5DS0A 3N5FA 3V8IA 3KKWA 2I79A 1YSJA 2JBKA 3EY5A 2Q51A 4PSWA 5I0CA 2JEVA 3PEIA 5LYIA 3TE4A 3PB9X 3IIBA 4C2ZA 1DE4C 2CTCA 2EK9A 1ARLA 2PJ7A 5LYDA 5IV0A 4MI4A 1M4GA 4AVAA 3FNCA 2EO8A 2Q4VA 2RB7A 4BINA 4MHPA 2AFOA 2ZW7A 1IOIA 2ZOFA 2CXAA 4B12A 2A4NA 3RZAA 3VWDA 3D66A 2DPSA 2BOAA 1LAPA 3D67A 4CPAA 2ZEEA 2FL4A 2QVPA 4G1PA 2ZEPA 4ONWA 4H6UA 1ZO0A 1IU8A 4UCMA 3ISXA 1CJWA 1YR0A 5CBMA 2Q04A 2I00A 3JRUA 2DF5A 4NXYA 1RXTA 3IJ3A 4GS4A 2Q7BA 4X5KA 4KSFA 4XNHC 4OMEA 4UEZA 3QAYA 2ZEGA 5AG4A 1CBXA 5CNPA 5IB0A 4A39A 3C26A 5K8OA 3S6FA 3T9YA 4A33A 1XMTA 3D8PA 4EMEA 3S9LA 2ZENA 2WUUA 2D4PA 3FEEA 4E0AA 4CAXA 1Z4RA 3ISZA 4B5PB 4K3NA 2ZW5A 3B2YA 4FD7A 4OLLA 1A2ZA 4B11A 1RTQA 3IO1A 4MBUA 1S7NA 2DPTA 3FBUA 3BLNA 1OBRA 2B4BA 4H2KA 4OC2A 4KOWA 4QUSA 1ZLIA 2I3CA 4IF5A 4WWVA 3R96A 2X7BA 3ZZIA 4QC6A 3KZWA 2ZEHA 1XMBA 5F49A 4ZGYB 2J8MA 2FCKA 4O23A 2Z3OA 4Q36A 5JQ4A 4KS9A 8CPAA 4JXQA 2WPXA 2PVWA 2IL4A 4NGTA 1PU9A 4XPLA 2G0BA 4C2YA 5D8NA 3PB6X
chains in the Genus database with same CATH topology
2Z10A 2FS5A 3T90A 1I21A 2HUZA 4JD6A 3W91A 2GANA 5KTCA 4UFXA 1BOBA 3TO7A 4KLVA 4YGOA 3SXNA 4I49A 4KVOE 1I1DA 2AE6A 4KVXA 2PC1A 2OZUA 4KSAA 4L89A 1LRZA 4CAFA 1Y7RA 2QMLA 4KZTA 2EVNA 4RI1A 3R95A 1YREA 1BO4A 4CGOA 2VZYA 2C27A 1R57A 1IYLA 4CYNA 4R3LA 3JVNA 4MFZA 1YVKA 4YRHA 2ARHA 4Y49C 3DR8A 4R57A 1GHEA 1Y9KA 4UFVA 3SXOA 3R1KA 2CNMA 4C7HA 4QVTA 4QBJA 3PP9A 2H5MA 4EVYA 4E8OA 4OAEA 3S6HA 4AVBA 4R9MA 2JDDA 3F0AA 2Z3LA 5DWNA 5G1ZA 3R9GA 2F5IA 2HV2A 1XE4A 3JTKA 2B4DB 3CXSA 5ISVA 4JXRA 4JJXA 4MY0A 4UCPA 4XPDB 3G8WA 3EXNA 2AJ6A 2BUEA 5KTDA 5A28A 2VQYA 4Q38A 3D2PA 4C2XA 1TIQA 3TCVA 2P0WA 4KOYA 4MJ8A 3CXPA 1SQHA 3GYAA 5G22A 1S7LA 3IWGA 4UWJA 4KUBA 2FXFA 4AB7A 2GE3A 1MK4A 1V0CA 2EUIA 2VZZA 3H5ZA 4B13A 1YGHA 3D3SA 1Z4EA 2GIVA 5J8CA 2D4OA 2R7HA 2P6EA 3W6XA 4HNYB 4CRYB 3VWEA 4UFWA 5BWAB 1Q2DA 3S6GA 1WWZA 2Q4YA 3H4QA 1MJ9A 3PGPA 3I3GA 4UA3A 4KOTA 3DR6A 4JLYA 2VEZA 2Z3MA 1ON0A 2B58A 2PSWA 2R1IA 4ONUA 3FRMA 4II9A 5HMNA 3A9LA 5EBVA 4PSXA 2Y0MA 2J8RA 1FY7A 4BBHA 4KUAA 3QB8A 2FT0A 3F5BA 1S60A 3TOBA 5FVJA 1NMTA 1S7FA 3LD2A 3OWCA 4B5OA 1QSNA 5AG5A 2G3AA 2BL1A 5IX3A 1QSRA 4HNWB 1L0CA 5H86A 4ZBGA 5AGEA 2OH1A 4PK2A 1QSTA 3IWEA 1U6MA 2PR1A 3W6SA 4A31A 4F6AA 1MJAA 3CXQA 2O28A 3PZJA 3MGDA 4KLWA 5G21A 1XEBA 5DWMA 2OZHA 1S7KA 3EO4A 5G20A 4R3KA 2B5GA 2ZW4A 4JWPA 4U9YA 4FD5A 5H84A 3TO6A 4KORA 4M85A 4B5PA 1Q2YA 4HKFA 1IB1E 1N71A 4KOSA 1K4JA 1QSMA 4KOUA 4A2ZA 2Z3KA 2PQ8A 2WSAA 4U9ZA 2PR8A 1KZFA 3RYOA 2YNEA 1YK3A 4HNXB 5AG7A 2BEIA 4NEXA 5C82A 1IYKA 4KOXA 4CGMA 4E2AA 3GKRA 2VI7A 4H89A 2Z3NA 3R9EA 3JUWA 4MFLA 3WR7A 4A30A 4UBRA 1NSLA 1B87A 4CGNA 2ATRA 2FIWA 4NF1A 3FYNA 4CAWA 4MFJA 2KCWA 1YLEA 3TTHA 5C88A 4QB9A 4UCNA 2CY2A 5EC4A 4AG9A 3NE7A 3I9SA 2PRBA 4XPDC 4NCZA 2DXQA 5J8FA 3GY9A 1YX0A 2OU2A 4ORFA 2J8NA 4AVCA 1M1DA 4C68A 4MHDA 3IGRA 4H6ZA 4M3SA 3ZJ0A 4A95A 4CAVA 2ZPAA 1M4IA 2WPWA 4RS2A 3TOAA 4AG7A 5E96A 4CRZB 1KUYA 4NSQA 1QSOA 1S3ZA 4PV6A 2YNCA 5F46A 1P0HA 2Z3PA 3B8GA 3DNSA 1Q2CA 4PK3A 1PUAA 3DDDA 4R87A 2Z11A 4LUAA 3TT2A 4LX9A 4K30A 3EFAA 1J4JA 1I12A 2VBQA 2R98A 2OZGA 4MFQA 2B4DA 3N7ZA 2OB0A 1B6BA 2JLMA 3BJ8A 2FSRA 2JDCA 3DSBA 4XNHB 1CM0A 4KVME 1XIXA 3LODA 5F47A 1P4NA 2B5GB 3R9FA 3D2MA 4CGLA 2REEA 4F0XA 1KUVA 2QIRA 2B3VA 4MFKA 1OZPA 1VHSA 4CYQA 3TFYA 2PDOA 4XPKA 4FD4A 3IU1A 1KUXA 2HQYA 2YNDA 3FIXA 4B10A 2NMTA 5HH1A 3IU2A 4IUSA 2B3UA 4CAEA 2K5TA 5AG6A 3S6KA 1Z9UA 4CYOA 2P6GA 5KTAA 3G3SA 1S5KA 4J3GA 4F0YA 4C7IA 4CYPA 3UY5A 4OADA 4L8AA 4BMHA 4KOVA 2FE7A 4DNCA 1UFHA 1VKCA 2CNTA 2CNSA 2FIAA 3F8KA 3FB3A 1XF8A 2Q0YA 4U5YA 4CGPA 1YVOA 3K9UA 3SHPA 4FD6A 3P2HA 3E0KA 1RO5A 2VXKA 2YNCC 3BJ7A 1WK4A 2R8VA 2Z0ZA 4Y49B 4B14A 3QAHA 1NE9A 2G3TA 4MFPA 5GCNA 1M4DA 1M44A 2RC4A 2ZXVA 3P2FA 2BSWA 1IICA 5A27A 4UWIA 2ZW6A 5F48A 1Y9WA 2Q44A 1MJBA 4CS0B 4MY3A 4YFJA 2YGWA 3TO9A 2REFA 3FXTA 5JPHA 2P6FA 3EC4A 2QECA 1IIDA 3V8IA 3KKWA 2I79A 3EY5A 4PSWA 5I0CA 2JEVA 3TE4A 4C2ZA 5IV0A 4MI4A 1M4GA 4AVAA 3FNCA 2Q4VA 2ZW7A 2CXAA 4B12A 2A4NA 3VWDA 2DPSA 2FL4A 4H6UA 1ZO0A 4UCMA 1CJWA 1YR0A 2Q04A 2I00A 4NXYA 1RXTA 4GS4A 2Q7BA 4X5KA 4KSFA 4XNHC 5AG4A 5CNPA 5IB0A 3C26A 3S6FA 3T9YA 4A33A 1XMTA 3D8PA 2WUUA 2D4PA 4E0AA 4CAXA 1Z4RA 4B5PB 2ZW5A 4FD7A 4OLLA 4B11A 4MBUA 1S7NA 2DPTA 3FBUA 3BLNA 2B4BA 4QUSA 4KOWA 3R96A 4IF5A 2X7BA 3ZZIA 4QC6A 5F49A 4ZGYB 2J8MA 2FCKA 2Z3OA 4Q36A 5JQ4A 4KS9A 4JXQA 2WPXA 2IL4A 1PU9A 4XPLA 2G0BA 4C2YA 4A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z10 A;  2FS5 A;  3T90 A;  1I21 A;  2HUZ A;  4JD6 A;  3W91 A;  2GAN A;  5KTC A;  3TO7 A;  1BOB A;  4KLV A;  4YGO A;  3SXN A;  4I49 A;  4KVO E;  1I1D A;  2AE6 A;  4KVX A;  2PC1 A;  2OZU A;  4L89 A;  1LRZ A;  1Y7R A;  2QML A;  4KZT A;  2EVN A;  4RI1 A;  3R95 A;  1YRE A;  1BO4 A;  2VZY A;  2C27 A;  1R57 A;  1IYL A;  4R3L A;  3JVN A;  1YVK A;  4YRH A;  2ARH A;  4Y49 C;  3DR8 A;  4R57 A;  1GHE A;  1Y9K A;  3SXO A;  3R1K A;  2CNM A;  4QVT A;  4QBJ A;  3PP9 A;  2H5M A;  4EVY A;  4E8O A;  4OAE A;  3S6H A;  4AVB A;  4R9M A;  2JDD A;  3F0A A;  5DWN A;  3R9G A;  2F5I A;  2HV2 A;  1XE4 A;  2B4D B;  3CXS A;  5ISV A;  4JXR A;  4JJX A;  4MY0 A;  4XPD B;  3G8W A;  3EXN A;  2AJ6 A;  2BUE A;  5KTD A;  2VQY A;  3D2P A;  1TIQ A;  3TCV A;  2P0W A;  4KOY A;  4MJ8 A;  3CXP A;  1SQH A;  3GYA A;  1S7L A;  3IWG A;  4UWJ A;  4KUB A;  2FXF A;  4AB7 A;  2GE3 A;  1MK4 A;  1V0C A;  2EUI A;  2VZZ A;  1YGH A;  3D3S A;  1Z4E A;  2GIV A;  5J8C A;  2D4O A;  2R7H A;  2P6E A;  3W6X A;  4HNY B;  4CRY B;  3VWE A;  1Q2D A;  3S6G A;  1WWZ A;  2Q4Y A;  3H4Q A;  1MJ9 A;  3PGP A;  3I3G A;  4UA3 A;  4KOT A;  3DR6 A;  4JLY A;  2VEZ A;  1ON0 A;  2B58 A;  2PSW A;  2R1I A;  4ONU A;  3FRM A;  4II9 A;  5HMN A;  5EBV A;  4PSX A;  2Y0M A;  2J8R A;  1FY7 A;  4KUA A;  3QB8 A;  2FT0 A;  3F5B A;  1S60 A;  3TOB A;  5FVJ A;  1NMT A;  1S7F A;  3LD2 A;  3OWC A;  4B5O A;  1QSN A;  2G3A A;  2BL1 A;  5IX3 A;  1QSR A;  4HNW B;  1L0C A;  5H86 A;  4ZBG A;  2OH1 A;  4PK2 A;  1QST A;  1U6M A;  2PR1 A;  3W6S A;  4F6A A;  1MJA A;  3CXQ A;  2O28 A;  3PZJ A;  3MGD A;  4KLW A;  1XEB A;  5DWM A;  2OZH A;  1S7K A;  3EO4 A;  4R3K A;  2B5G A;  2ZW4 A;  4JWP A;  4U9Y A;  4FD5 A;  5H84 A;  3TO6 A;  4KOR A;  4M85 A;  4B5P A;  1Q2Y A;  4HKF A;  1IB1 E;  1N71 A;  4KOS A;  1K4J A;  1QSM A;  4KOU A;  2PQ8 A;  4U9Z A;  2PR8 A;  1KZF A;  3RYO A;  1YK3 A;  4HNX B;  2BEI A;  4NEX A;  5C82 A;  1IYK A;  4KOX A;  4E2A A;  3GKR A;  2VI7 A;  4H89 A;  3R9E A;  3JUW A;  3WR7 A;  4UBR A;  1NSL A;  1B87 A;  2ATR A;  2FIW A;  4NF1 A;  3FYN A;  4CAW A;  2KCW A;  1YLE A;  3TTH A;  5C88 A;  4QB9 A;  2CY2 A;  5EC4 A;  4AG9 A;  3NE7 A;  3I9S A;  2PRB A;  4XPD C;  4NCZ A;  2DXQ A;  5J8F A;  3GY9 A;  1YX0 A;  2OU2 A;  4ORF A;  2J8N A;  4AVC A;  1M1D A;  4MHD A;  3IGR A;  4H6Z A;  4M3S A;  3ZJ0 A;  4CAV A;  2ZPA A;  1M4I A;  2WPW A;  4RS2 A;  3TOA A;  4AG7 A;  5E96 A;  4CRZ B;  1KUY A;  4NSQ A;  1QSO A;  1S3Z A;  4PV6 A;  5F46 A;  1P0H A;  3DNS A;  3B8G A;  1Q2C A;  4PK3 A;  1PUA A;  3DDD A;  4R87 A;  2Z11 A;  4LUA A;  3TT2 A;  4LX9 A;  4K30 A;  3EFA A;  1J4J A;  1I12 A;  2VBQ A;  2R98 A;  2OZG A;  2B4D A;  3N7Z A;  2OB0 A;  1B6B A;  2JLM A;  3BJ8 A;  2FSR A;  2JDC A;  3DSB A;  4XNH B;  1CM0 A;  4KVM E;  1XIX A;  3LOD A;  5F47 A;  1P4N A;  2B5G B;  3R9F A;  3D2M A;  2REE A;  1KUV A;  2QIR A;  2B3V A;  1OZP A;  1VHS A;  3TFY A;  2PDO A;  4XPK A;  4FD4 A;  1KUX A;  2HQY A;  3FIX A;  2NMT A;  5HH1 A;  4IUS A;  2B3U A;  2K5T A;  3S6K A;  1Z9U A;  2P6G A;  5KTA A;  3G3S A;  1S5K A;  4J3G A;  4F0Y A;  3UY5 A;  4OAD A;  4L8A A;  4BMH A;  4KOV A;  2FE7 A;  4DNC A;  1UFH A;  1VKC A;  2CNT A;  2CNS A;  2FIA A;  3F8K A;  3FB3 A;  1XF8 A;  2Q0Y A;  4U5Y A;  1YVO A;  3K9U A;  3SHP A;  4FD6 A;  3P2H A;  3E0K A;  1RO5 A;  2VXK A;  3BJ7 A;  1WK4 A;  2R8V A;  2Z0Z A;  4Y49 B;  3QAH A;  1NE9 A;  2G3T A;  5GCN A;  1M4D A;  1M44 A;  2RC4 A;  2ZXV A;  3P2F A;  2BSW A;  1IIC A;  4UWI A;  2ZW6 A;  5F48 A;  1Y9W A;  2Q44 A;  1MJB A;  4CS0 B;  4MY3 A;  4YFJ A;  3TO9 A;  2REF A;  3FXT A;  5JPH A;  2P6F A;  3EC4 A;  2QEC A;  1IID A;  3V8I A;  3KKW A;  2I79 A;  3EY5 A;  4PSW A;  5I0C A;  2JEV A;  3TE4 A;  5IV0 A;  4MI4 A;  1M4G A;  4AVA A;  3FNC A;  2Q4V A;  2ZW7 A;  2A4N A;  3VWD A;  2FL4 A;  4H6U A;  1CJW A;  1YR0 A;  2Q04 A;  2I00 A;  4NXY A;  1RXT A;  4GS4 A;  2Q7B A;  4X5K A;  4XNH C;  5CNP A;  5IB0 A;  3C26 A;  3S6F A;  3T9Y A;  1XMT A;  3D8P A;  2D4P A;  4E0A A;  4CAX A;  1Z4R A;  4B5P B;  2ZW5 A;  4FD7 A;  4OLL A;  4MBU A;  1S7N A;  4QUS A;  3FBU A;  3BLN A;  2B4B A;  4KOW A;  3R96 A;  4IF5 A;  2X7B A;  3ZZI A;  4QC6 A;  5F49 A;  2J8M A;  2FCK A;  5JQ4 A;  4JXQ A;  2WPX A;  2IL4 A;  1PU9 A;  4XPL A;  2G0B A; 
#chains in the Genus database with same CATH topology
 2Z10 A;  2FS5 A;  1QMU A;  3T90 A;  4A37 A;  3B3C A;  1F2O A;  2AFZ A;  4MCQ A;  4Z65 A;  1I21 A;  2HUZ A;  4JD6 A;  4HPS A;  4MHZ A;  1CPS A;  3H8E A;  3W91 A;  2GAN A;  5KTC A;  4UFX A;  1BOB A;  3TO7 A;  1AUG A;  4KLV A;  2DEA A;  4YGO A;  3SXN A;  4I49 A;  1Z2L A;  4KVO E;  1I1D A;  2AE6 A;  4KVX A;  1AYE A;  3BI1 A;  2PC1 A;  2PJ3 A;  2WZN A;  3SI1 A;  2OZU A;  2PIZ A;  4KSA A;  1EE3 P;  4L89 A;  1LRZ A;  3FH4 A;  2FVG A;  4MHN A;  3T8W A;  4CAF A;  1ARM A;  1Y7R A;  2QML A;  2EVN A;  2Q43 A;  4KZT A;  4RI1 A;  4WJB A;  1R3N A;  5ELY A;  3R95 A;  1YRE A;  2PE3 A;  1BO4 A;  4CGO A;  4DJL A;  2VZY A;  2G9D A;  4MRI A;  2C27 A;  2GLJ A;  1R57 A;  1IYL A;  2QJ8 A;  4CYN A;  4R3L A;  3JVN A;  4MFZ A;  6CPA A;  1YVK A;  2HC9 A;  4YRH A;  2ARH A;  4Y49 C;  3TX8 A;  4AXV A;  3DR8 A;  1M4L A;  3CZX A;  4NGQ A;  3VAR A;  4R57 A;  4KSI A;  1GHE A;  2ZED A;  1ZG9 A;  1Y9K A;  3CDX A;  2PCU A;  1YQE A;  4UFV A;  3SXO A;  3R1K A;  2CNM A;  4C7H A;  1X10 A;  4QVT A;  1XOV A;  4QBJ A;  3CPX A;  3PP9 A;  2H5M A;  4EVY A;  4NJQ A;  4OKO A;  5EMI A;  2PJC A;  4E8O A;  4OAE A;  1ELL P;  3S6H A;  3WAB A;  4AVB A;  4R9M A;  2V8D A;  2JDD A;  4OC1 A;  3F0A A;  4P4D A;  1IY7 A;  2Z3L A;  5K8M A;  1IOF A;  4X2T A;  5DWN A;  5G1Z A;  2F5I A;  2HV2 A;  4R7M A;  3R9G A;  2F8H A;  5LRJ A;  1XE4 A;  4OC5 A;  1LOK A;  2PJ6 A;  3JTK A;  2B4D B;  3CXS A;  5ISV A;  5HXD A;  4JXR A;  1XFO A;  4JJX A;  4MY0 A;  4UCP A;  4XPD B;  1CP6 A;  3V7Z A;  3G8W A;  3EXN A;  2AJ6 A;  2BUE A;  3NFZ A;  3GLJ A;  5KTD A;  5A28 A;  2VQY A;  4Q38 A;  1PCA A;  1BAV A;  3D2P A;  4X8I A;  3VH9 A;  4C2X A;  4RUH A;  5CPA A;  1TIQ A;  4MCS A;  2P0W A;  3TCV A;  4KOY A;  1Z8X A;  3B3V A;  2IMO A;  4MJ8 A;  2VL1 A;  3CXP A;  1SQH A;  3RAM A;  2AFS A;  3GYA A;  4IK2 A;  5G22 A;  1S7L A;  2GFQ A;  3IWG A;  4UWJ A;  4KUB A;  2FXF A;  4AB7 A;  2GE3 A;  1MK4 A;  1V0C A;  2EUI A;  2VZZ A;  3H5Z A;  4B13 A;  1YGH A;  3D3S A;  1Z4E A;  5LRG A;  1H8L A;  4NGR A;  1Y0R A;  2GIV A;  5HVF A;  2PJ5 A;  5J8C A;  2D4O A;  2R7H A;  4P4E A;  3B3T A;  2P6E A;  3W6X A;  1Q7L A;  4HNY B;  4CRY B;  3KQX A;  4PXC A;  2JEW A;  1YW6 A;  3VWE A;  4LQ6 A;  4UFW A;  5LRK A;  2PJB A;  1Q2D A;  3S6G A;  5BWA B;  1WWZ A;  3BXM A;  3WC5 A;  3KR4 A;  4JZ0 A;  1VHO A;  3GIU A;  2Q4Y A;  2PJ1 A;  1MJ9 A;  2QYV A;  3H4Q A;  1Y7E A;  3I3G A;  3PGP A;  4P4F A;  4R8F A;  4UA3 A;  5LYF A;  4KOT A;  4BD9 A;  3DR6 A;  4JLY A;  2VEZ A;  3GUX A;  3IEH A;  2Z3M A;  3KI9 A;  1TXR A;  1ON0 A;  2B58 A;  5IB9 A;  2PSW A;  5HVH A;  1Y0Y A;  2R1I A;  3MN8 A;  4ONU A;  3FRM A;  3B7I A;  4II9 A;  5JH9 A;  5HMN A;  3A9L A;  3PB8 X;  5EBV A;  2AFW A;  4PSX A;  2Y0M A;  4PPZ A;  2J8R A;  1XRY A;  4IHM A;  1FY7 A;  1R43 A;  4BBH A;  4KUA A;  1Z8T A;  2Q7S A;  3QB8 A;  4Q7A A;  4TWE A;  1ZG8 A;  2FT0 A;  1S60 A;  3F5B A;  4NGP A;  4ZY2 A;  3KHX A;  3TOB A;  1VIX A;  5FVJ A;  3PB4 X;  4ZY1 A;  1NMT A;  1S7F A;  4R76 A;  3LD2 A;  3OWC A;  3FEC A;  4B5O A;  3I1U A;  1QSN A;  5AG5 A;  7CPA A;  2G3A A;  2BL1 A;  5IX3 A;  2PJ2 A;  1QSR A;  2PJ0 A;  3GB0 A;  4HNW B;  5F09 A;  1L0C A;  5H86 A;  4ZBG A;  4OC3 A;  5AGE A;  4ZY0 A;  2OH1 A;  3SI0 A;  4PK2 A;  3D7H A;  1QST A;  3KGQ A;  3IWE A;  1U6M A;  2V77 A;  2PR1 A;  3W6S A;  4A31 A;  2J9A A;  5D29 A;  4F6A A;  1MJA A;  3CXQ A;  3S9M A;  2O28 A;  3PZJ A;  3MGD A;  4KLW A;  3B3S A;  1TKJ A;  1YME A;  5G21 A;  1XEB A;  3PBB A;  5DWM A;  2OZH A;  1S7K A;  3D68 A;  5HVG A;  3EO4 A;  5G20 A;  1ZG7 A;  2B5G A;  2ZW4 A;  4R3K A;  4JWP A;  4U9Y A;  4FD5 A;  5LYL A;  3FED A;  5H84 A;  3H8F A;  3TO6 A;  4KOR A;  4M85 A;  3V38 A;  4B5P A;  1DTD A;  4NJR A;  4X3R A;  1Q2Y A;  4HKF A;  1IB1 E;  1N71 A;  4UIB A;  3K2K A;  4MXU A;  4KOS A;  3SJX A;  1K4J A;  1QSM A;  4KOU A;  4A2Z A;  2Z3K A;  2PQ8 A;  3VAT A;  2WSA A;  4U9Z A;  2PR8 A;  1KZF A;  3FX6 A;  3D4U A;  3RYO A;  2YNE A;  1YK3 A;  4HNX B;  4NGM A;  1IGB A;  5AG7 A;  2BEI A;  4NEX A;  3LWU A;  4M6I A;  4RN7 A;  3NH8 A;  5C82 A;  1IYK A;  3QNV A;  4DYO A;  4KOX A;  4CGM A;  2XEI A;  4E2A A;  3GKR A;  1TF8 A;  2VI7 A;  4H89 A;  2Z3N A;  2ZEO A;  2ZEF A;  4P4B A;  3R9E A;  1Z8W A;  3SI2 A;  2C6G A;  3JUW A;  4MFL A;  3WR7 A;  4P44 A;  4A30 A;  4DUK A;  1HDQ A;  1PYT B;  4MMO A;  4GXH A;  4UBR A;  3D7D A;  1B87 A;  2CIJ A;  2ATR A;  2FIW A;  1NSL A;  4YWY A;  4CGN A;  2V8V A;  4NF1 A;  3PB7 X;  3FYN A;  4CAW A;  1GYT A;  4MFJ A;  4P10 A;  2KCW A;  1YLE A;  3TTH A;  5C88 A;  1CG2 A;  3WC7 A;  4QB9 A;  4UF4 A;  4UCN A;  2CY2 A;  4PXE A;  5EC4 A;  3L2N A;  3NE7 A;  1VGY A;  4GM5 A;  4AG9 A;  3NH4 A;  5THW A;  3I9S A;  1CP7 A;  2PRB A;  4XPD C;  1HEE A;  4NCZ A;  2DXQ A;  5J8F A;  3GY9 A;  1YX0 A;  2OU2 A;  4EFD A;  2NYQ A;  4OP4 A;  2WYR A;  2GRE A;  4ORF A;  2J8N A;  4AVC A;  3NA6 A;  1M1D A;  4C68 A;  3HUV A;  4MHD A;  1VHE A;  3IGR A;  3D7G A;  2ZEM A;  5JGF A;  4H6Z A;  2GU2 A;  4M3S A;  3ZJ0 A;  4A95 A;  3PRT A;  4F9V A;  3PFO A;  3FF3 A;  4CAV A;  2ZPA A;  1CPX A;  3LMS A;  1NSA A;  3B35 A;  1M4I A;  2PVV A;  2WPW A;  4RS2 A;  3TOA A;  4AG7 A;  2AFM A;  4P4I A;  5E96 A;  4CRZ B;  1KUY A;  3PBE A;  4NGN A;  4NSQ A;  3IFE A;  1QSO A;  3D7F A;  4ZX8 A;  1LAM A;  1S3Z A;  4PV6 A;  1YLO A;  2YNC A;  2AFU A;  5F46 A;  1P0H A;  2Z3P A;  3B8G A;  3DNS A;  1Q2C A;  4PK3 A;  1PUA A;  3CPA A;  3DDD A;  4R87 A;  2Z11 A;  2EBJ A;  4LUA A;  3TT2 A;  3HLP A;  1BLL E;  1LAN A;  2XEG A;  4B6Z A;  4LX9 A;  4K30 A;  2IJZ A;  2PJA A;  3EFA A;  4P6Y A;  3FMC A;  3RNZ A;  4UEE A;  1J4J A;  1I12 A;  2VBQ A;  2R98 A;  4UIA A;  4OID A;  2OZG A;  4MFQ A;  2B4D A;  2OB0 A;  3BJ8 A;  1B6B A;  2JLM A;  3N7Z A;  2FSR A;  2PJ4 A;  4PXD A;  2JDC A;  3DSB A;  1Z5R A;  2C6C A;  3KR5 A;  4XNH B;  3RBU A;  1CM0 A;  3KAS A;  2PJ9 A;  3DGV A;  4KVM E;  4MCR A;  1XIX A;  3LOD A;  5F47 A;  4EWT A;  2GLF A;  1P4N A;  2ANP A;  2B5G B;  2BCO A;  2O4H A;  2ODF A;  4PXB A;  4ZYQ A;  1ZLH A;  2PJ8 A;  3CT9 A;  3NH5 A;  1AMP A;  3D2M A;  2PIY A;  3R9F A;  4CGL A;  2REE A;  4A32 A;  2JBJ A;  4F0X A;  4YU9 A;  4OC0 A;  1KUV A;  2QIR A;  1Z8L A;  1JWQ A;  4A94 A;  4ZX9 A;  4W9Y A;  3K9T A;  1X12 A;  2B3V A;  2AFX A;  4MFK A;  1OZP A;  1VHS A;  4CYQ A;  3TFY A;  1ELM P;  2PDO A;  2XEJ A;  4XPK A;  4FD4 A;  3IU1 A;  4M6H A;  1KUX A;  2HQY A;  2YND A;  2PRQ A;  3FIX A;  4B10 A;  1F2P A;  1CX8 A;  2NMT A;  3KHZ A;  5HH1 A;  2EWB A;  3IU2 A;  4IUS A;  2B3U A;  4CAE A;  2K5T A;  5AG6 A;  3S6K A;  1Z9U A;  3PFE A;  4CYO A;  3MRU A;  2NSM A;  2P6G A;  4M6G A;  4FAI A;  4JYW A;  4OIW A;  4IAV A;  3TC8 A;  5KTA A;  5K8P A;  3G3S A;  3IC1 A;  2POK A;  4PQA A;  1S5K A;  4J3G A;  4F0Y A;  2XEF A;  4C7I A;  4ZI6 A;  2Q4Z A;  4CYP A;  2C6P A;  3S9N A;  3BI0 A;  2C1C A;  2V8H A;  1TKH A;  3UY5 A;  4OAD A;  2BO9 A;  2ZEL A;  4L8A A;  4OC4 A;  4BMH A;  5K8N A;  3IWW A;  3WC6 A;  3FJU A;  4KOV A;  2FE7 A;  2ZOG A;  4DNC A;  2IQ6 A;  1UFH A;  1UWY A;  4FWU A;  2F7V A;  1VKC A;  4FUU A;  2CNT A;  3KQZ A;  2CNS A;  2FIA A;  3F8K A;  3SJF A;  3FB3 A;  1XF8 A;  2Q0Y A;  2V8G A;  4NGS A;  5J1Q A;  3NE8 A;  2CTB A;  4U5Y A;  1YVO A;  1F57 A;  1FT7 A;  3K9U A;  4CGP A;  3SHP A;  4FD6 A;  1LFW A;  3P2H A;  3BHX A;  4TNU A;  3E0K A;  3KL9 A;  1RO5 A;  2VXK A;  4R6T A;  2OR4 A;  2YNC C;  3BJ7 A;  1WK4 A;  2HB6 A;  4P4J A;  2R8V A;  2Z0Z A;  2O53 A;  4Y49 B;  4F9U A;  4B14 A;  3QAH A;  1NE9 A;  3FVL A;  4LQG A;  2G3T A;  3LAC A;  4MFP A;  3H8G A;  5GCN A;  1M4D A;  3RO0 A;  1M44 A;  2RFH A;  5I4M A;  4NFR A;  3SJE A;  2RC4 A;  2ZXV A;  1HDU A;  3P2F A;  3SJG A;  2BSW A;  4F8Z A;  1IIC A;  1BPN A;  5A27 A;  1KWM A;  1TKF A;  3DLJ A;  4UWI A;  2ZW6 A;  4MHY A;  4P45 A;  5F48 A;  1Y9W A;  1XBU A;  1YW4 A;  2Q44 A;  1MJB A;  3B3W A;  2ABZ A;  4UEF A;  4A38 A;  4CS0 B;  1LCP A;  1FNO A;  1TF9 A;  3WT4 A;  4MY3 A;  4YFJ A;  2YGW A;  3TO9 A;  2EK8 A;  2REF A;  3FXT A;  5JM6 A;  2OOT A;  1JQG A;  4FBE A;  2CF4 A;  1BPM A;  1XJO A;  5JPH A;  4MCP A;  1QQ9 A;  2P6F A;  3EC4 A;  2QEC A;  1IID A;  5DS0 A;  3N5F A;  3V8I A;  3KKW A;  2I79 A;  1YSJ A;  2JBK A;  3EY5 A;  2Q51 A;  4PSW A;  5I0C A;  2JEV A;  3PEI A;  5LYI A;  3TE4 A;  3PB9 X;  3IIB A;  4C2Z A;  1DE4 C;  2CTC A;  2EK9 A;  1ARL A;  2PJ7 A;  5LYD A;  5IV0 A;  4MI4 A;  1M4G A;  4AVA A;  3FNC A;  2EO8 A;  2Q4V A;  2RB7 A;  4BIN A;  4MHP A;  2AFO A;  2ZW7 A;  1IOI A;  2ZOF A;  2CXA A;  4B12 A;  2A4N A;  3RZA A;  3VWD A;  3D66 A;  2DPS A;  2BOA A;  1LAP A;  3D67 A;  4CPA A;  2ZEE A;  2FL4 A;  2QVP A;  4G1P A;  2ZEP A;  4ONW A;  4H6U A;  1ZO0 A;  1IU8 A;  4UCM A;  3ISX A;  1CJW A;  1YR0 A;  5CBM A;  2Q04 A;  2I00 A;  3JRU A;  2DF5 A;  4NXY A;  1RXT A;  3IJ3 A;  4GS4 A;  2Q7B A;  4X5K A;  4KSF A;  4XNH C;  4OME A;  4UEZ A;  3QAY A;  2ZEG A;  5AG4 A;  1CBX A;  5CNP A;  5IB0 A;  4A39 A;  3C26 A;  5K8O A;  3S6F A;  3T9Y A;  4A33 A;  1XMT A;  3D8P A;  4EME A;  3S9L A;  2ZEN A;  2WUU A;  2D4P A;  3FEE A;  4E0A A;  4CAX A;  1Z4R A;  3ISZ A;  4B5P B;  4K3N A;  2ZW5 A;  3B2Y A;  4FD7 A;  4OLL A;  1A2Z A;  4B11 A;  1RTQ A;  3IO1 A;  4MBU A;  1S7N A;  2DPT A;  3FBU A;  3BLN A;  1OBR A;  2B4B A;  4H2K A;  4OC2 A;  4KOW A;  4QUS A;  1ZLI A;  2I3C A;  4IF5 A;  4WWV A;  3R96 A;  2X7B A;  3ZZI A;  4QC6 A;  3KZW A;  2ZEH A;  1XMB A;  5F49 A;  4ZGY B;  2J8M A;  2FCK A;  4O23 A;  2Z3O A;  4Q36 A;  5JQ4 A;  4KS9 A;  8CPA A;  4JXQ A;  2WPX A;  2PVW A;  2IL4 A;  4NGT A;  1PU9 A;  4XPL A;  2G0B A;  4C2Y A;  5D8N A;  3PB6 X; 
#chains in the Genus database with same CATH homology
 2Z10 A;  2FS5 A;  3T90 A;  1I21 A;  2HUZ A;  4JD6 A;  3W91 A;  2GAN A;  5KTC A;  4UFX A;  1BOB A;  3TO7 A;  4KLV A;  4YGO A;  3SXN A;  4I49 A;  4KVO E;  1I1D A;  2AE6 A;  4KVX A;  2PC1 A;  2OZU A;  4KSA A;  4L89 A;  1LRZ A;  4CAF A;  1Y7R A;  2QML A;  4KZT A;  2EVN A;  4RI1 A;  3R95 A;  1YRE A;  1BO4 A;  4CGO A;  2VZY A;  2C27 A;  1R57 A;  1IYL A;  4CYN A;  4R3L A;  3JVN A;  4MFZ A;  1YVK A;  4YRH A;  2ARH A;  4Y49 C;  3DR8 A;  4R57 A;  1GHE A;  1Y9K A;  4UFV A;  3SXO A;  3R1K A;  2CNM A;  4C7H A;  4QVT A;  4QBJ A;  3PP9 A;  2H5M A;  4EVY A;  4E8O A;  4OAE A;  3S6H A;  4AVB A;  4R9M A;  2JDD A;  3F0A A;  2Z3L A;  5DWN A;  5G1Z A;  3R9G A;  2F5I A;  2HV2 A;  1XE4 A;  3JTK A;  2B4D B;  3CXS A;  5ISV A;  4JXR A;  4JJX A;  4MY0 A;  4UCP A;  4XPD B;  3G8W A;  3EXN A;  2AJ6 A;  2BUE A;  5KTD A;  5A28 A;  2VQY A;  4Q38 A;  3D2P A;  4C2X A;  1TIQ A;  3TCV A;  2P0W A;  4KOY A;  4MJ8 A;  3CXP A;  1SQH A;  3GYA A;  5G22 A;  1S7L A;  3IWG A;  4UWJ A;  4KUB A;  2FXF A;  4AB7 A;  2GE3 A;  1MK4 A;  1V0C A;  2EUI A;  2VZZ A;  3H5Z A;  4B13 A;  1YGH A;  3D3S A;  1Z4E A;  2GIV A;  5J8C A;  2D4O A;  2R7H A;  2P6E A;  3W6X A;  4HNY B;  4CRY B;  3VWE A;  4UFW A;  5BWA B;  1Q2D A;  3S6G A;  1WWZ A;  2Q4Y A;  3H4Q A;  1MJ9 A;  3PGP A;  3I3G A;  4UA3 A;  4KOT A;  3DR6 A;  4JLY A;  2VEZ A;  2Z3M A;  1ON0 A;  2B58 A;  2PSW A;  2R1I A;  4ONU A;  3FRM A;  4II9 A;  5HMN A;  3A9L A;  5EBV A;  4PSX A;  2Y0M A;  2J8R A;  1FY7 A;  4BBH A;  4KUA A;  3QB8 A;  2FT0 A;  3F5B A;  1S60 A;  3TOB A;  5FVJ A;  1NMT A;  1S7F A;  3LD2 A;  3OWC A;  4B5O A;  1QSN A;  5AG5 A;  2G3A A;  2BL1 A;  5IX3 A;  1QSR A;  4HNW B;  1L0C A;  5H86 A;  4ZBG A;  5AGE A;  2OH1 A;  4PK2 A;  1QST A;  3IWE A;  1U6M A;  2PR1 A;  3W6S A;  4A31 A;  4F6A A;  1MJA A;  3CXQ A;  2O28 A;  3PZJ A;  3MGD A;  4KLW A;  5G21 A;  1XEB A;  5DWM A;  2OZH A;  1S7K A;  3EO4 A;  5G20 A;  4R3K A;  2B5G A;  2ZW4 A;  4JWP A;  4U9Y A;  4FD5 A;  5H84 A;  3TO6 A;  4KOR A;  4M85 A;  4B5P A;  1Q2Y A;  4HKF A;  1IB1 E;  1N71 A;  4KOS A;  1K4J A;  1QSM A;  4KOU A;  4A2Z A;  2Z3K A;  2PQ8 A;  2WSA A;  4U9Z A;  2PR8 A;  1KZF A;  3RYO A;  2YNE A;  1YK3 A;  4HNX B;  5AG7 A;  2BEI A;  4NEX A;  5C82 A;  1IYK A;  4KOX A;  4CGM A;  4E2A A;  3GKR A;  2VI7 A;  4H89 A;  2Z3N A;  3R9E A;  3JUW A;  4MFL A;  3WR7 A;  4A30 A;  4UBR A;  1NSL A;  1B87 A;  4CGN A;  2ATR A;  2FIW A;  4NF1 A;  3FYN A;  4CAW A;  4MFJ A;  2KCW A;  1YLE A;  3TTH A;  5C88 A;  4QB9 A;  4UCN A;  2CY2 A;  5EC4 A;  4AG9 A;  3NE7 A;  3I9S A;  2PRB A;  4XPD C;  4NCZ A;  2DXQ A;  5J8F A;  3GY9 A;  1YX0 A;  2OU2 A;  4ORF A;  2J8N A;  4AVC A;  1M1D A;  4C68 A;  4MHD A;  3IGR A;  4H6Z A;  4M3S A;  3ZJ0 A;  4A95 A;  4CAV A;  2ZPA A;  1M4I A;  2WPW A;  4RS2 A;  3TOA A;  4AG7 A;  5E96 A;  4CRZ B;  1KUY A;  4NSQ A;  1QSO A;  1S3Z A;  4PV6 A;  2YNC A;  5F46 A;  1P0H A;  2Z3P A;  3B8G A;  3DNS A;  1Q2C A;  4PK3 A;  1PUA A;  3DDD A;  4R87 A;  2Z11 A;  4LUA A;  3TT2 A;  4LX9 A;  4K30 A;  3EFA A;  1J4J A;  1I12 A;  2VBQ A;  2R98 A;  2OZG A;  4MFQ A;  2B4D A;  3N7Z A;  2OB0 A;  1B6B A;  2JLM A;  3BJ8 A;  2FSR A;  2JDC A;  3DSB A;  4XNH B;  1CM0 A;  4KVM E;  1XIX A;  3LOD A;  5F47 A;  1P4N A;  2B5G B;  3R9F A;  3D2M A;  4CGL A;  2REE A;  4F0X A;  1KUV A;  2QIR A;  2B3V A;  4MFK A;  1OZP A;  1VHS A;  4CYQ A;  3TFY A;  2PDO A;  4XPK A;  4FD4 A;  3IU1 A;  1KUX A;  2HQY A;  2YND A;  3FIX A;  4B10 A;  2NMT A;  5HH1 A;  3IU2 A;  4IUS A;  2B3U A;  4CAE A;  2K5T A;  5AG6 A;  3S6K A;  1Z9U A;  4CYO A;  2P6G A;  5KTA A;  3G3S A;  1S5K A;  4J3G A;  4F0Y A;  4C7I A;  4CYP A;  3UY5 A;  4OAD A;  4L8A A;  4BMH A;  4KOV A;  2FE7 A;  4DNC A;  1UFH A;  1VKC A;  2CNT A;  2CNS A;  2FIA A;  3F8K A;  3FB3 A;  1XF8 A;  2Q0Y A;  4U5Y A;  4CGP A;  1YVO A;  3K9U A;  3SHP A;  4FD6 A;  3P2H A;  3E0K A;  1RO5 A;  2VXK A;  2YNC C;  3BJ7 A;  1WK4 A;  2R8V A;  2Z0Z A;  4Y49 B;  4B14 A;  3QAH A;  1NE9 A;  2G3T A;  4MFP A;  5GCN A;  1M4D A;  1M44 A;  2RC4 A;  2ZXV A;  3P2F A;  2BSW A;  1IIC A;  5A27 A;  4UWI A;  2ZW6 A;  5F48 A;  1Y9W A;  2Q44 A;  1MJB A;  4CS0 B;  4MY3 A;  4YFJ A;  2YGW A;  3TO9 A;  2REF A;  3FXT A;  5JPH A;  2P6F A;  3EC4 A;  2QEC A;  1IID A;  3V8I A;  3KKW A;  2I79 A;  3EY5 A;  4PSW A;  5I0C A;  2JEV A;  3TE4 A;  4C2Z A;  5IV0 A;  4MI4 A;  1M4G A;  4AVA A;  3FNC A;  2Q4V A;  2ZW7 A;  2CXA A;  4B12 A;  2A4N A;  3VWD A;  2DPS A;  2FL4 A;  4H6U A;  1ZO0 A;  4UCM A;  1CJW A;  1YR0 A;  2Q04 A;  2I00 A;  4NXY A;  1RXT A;  4GS4 A;  2Q7B A;  4X5K A;  4KSF A;  4XNH C;  5AG4 A;  5CNP A;  5IB0 A;  3C26 A;  3S6F A;  3T9Y A;  4A33 A;  1XMT A;  3D8P A;  2WUU A;  2D4P A;  4E0A A;  4CAX A;  1Z4R A;  4B5P B;  2ZW5 A;  4FD7 A;  4OLL A;  4B11 A;  4MBU A;  1S7N A;  2DPT A;  3FBU A;  3BLN A;  2B4B A;  4QUS A;  4KOW A;  3R96 A;  4IF5 A;  2X7B A;  3ZZI A;  4QC6 A;  5F49 A;  4ZGY B;  2J8M A;  2FCK A;  2Z3O A;  4Q36 A;  5JQ4 A;  4KS9 A;  4JXQ A;  2WPX A;  2IL4 A;  1PU9 A;  4XPL A;  2G0B A;  4C2Y A;  4A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...