1KUVA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
b'HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serotonin N-acetyltransferase
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuvA00
5KTCA 2FL4A 4MBUA 2VQYA 3D3SA 3FIXA 1Z4RA 2PRBA 4E0AA 2Q4YA 4QUSA 2Z11A 4H6ZA 2VI7A 2J8RA 3I3GA 1M4IA 3S6HA 4LUAA 4XNHB 3EC4A 1RXTA 3BJ7A 5H84A 4JJXA 3GKRA 4KOWA 3TO7A 5C88A 4FD7A 4KUBA 5F47A 3PP9A 4B5OA 3WR7A 1YREA 5E96A 4QB9A 3SHPA 2D4OA 2OB0A 3F8KA 2VBQA 3D8PA 1IB1E 2PC1A 4JD6A 1MJBA 4ONUA 2FSRA 2P6FA 4CRZB 1N71A 4L8AA 3R9EA 1Q2YA 4MY3A 1XEBA 4JLYA 2PSWA 2FIWA 4MHDA 3EFAA 3R9FA 3FNCA 1S3ZA 4PSXA 2DXQA 4R3KA 5J8FA 5IX3A 2B4DA 2B3VA 3GY9A 2GE3A 4BMHA 4II9A 5F48A 3T90A 4AG7A 1PUAA 4HNYB 3TOBA 4QBJA 5F49A 3R1KA 2Z10A 4HNXB 3IWGA 4MJ8A 2HQYA 1B6BA 4FD5A 4AB7A 4AG9A 2WPXA 3B8GA 4E8OA 4UWIA 4KVXA 2AE6A 3DDDA 2R1IA 4M85A 3G3SA 3TOAA 1R57A 4YRHA 1MJ9A 2B4BA 4I49A 5JQ4A 4KORA 3BLNA 1IYLA 2B4DB 2CNTA 1KUXA 1KUYA 2FT0A 1IYKA 3CXQA 4AVBA 2H5MA 1U6MA 4E2AA 3OWCA 2Q44A 3T9YA 3QAHA 3TE4A 3MGDA 1YLEA 1I21A 1J4JA 5KTAA 4R57A 3SXNA 1P0HA 4MI4A 4MY0A 1WWZA 3D2MA 1FY7A 5I0CA 2PQ8A 1Y9WA 1L0CA 4NSQA 2ZW7A 2REFA 2CNSA 3R95A 4NXYA 2WPWA 1V0CA 3S6KA 2GIVA 1QSMA 2FS5A 5FVJA 2BSWA 2O28A 2BEIA 1WK4A 1YVOA 4PV6A 3FXTA 3JUWA 4XPLA 5JPHA 3TFYA 2ATRA 1CJWA 3DR6A 4IF5A 2R8VA 4H89A 4RI1A 4PK2A 4NF1A 2PR1A 3QB8A 4YGOA 4M3SA 2IL4A 2R98A 4X5KA 4XPKA 1XMTA 1YGHA 4KOXA 3W6SA 4Y49C 2OU2A 4KLWA 3S6GA 3EXNA 4OADA 3DSBA 1SQHA 1Z4EA 2ZW4A 1Q2CA 1M1DA 3I9SA 2VZYA 2QMLA 5DWMA 1TIQA 3D2PA 5CNPA 2J8MA 3NE7A 3PGPA 1VKCA 4PK3A 4UBRA 2FE7A 3SXOA 4UA3A 3EO4A 3FB3A 4NCZA 4K30A 5DWNA 3P2FA 2KCWA 4HNWB 1XF8A 5EBVA 4UWJA 1B87A 5J8CA 5F46A 1PU9A 4FD4A 4F0YA 2I00A 4F6AA 1YX0A 3CXPA 4FD6A 4XNHC 3W91A 4JXRA 4KUAA 1I12A 2I79A 2FCKA 1IIDA 2RC4A 2EVNA 5H86A 5HH1A 1NE9A 2Z0ZA 2D4PA 3W6XA 2A4NA 2ZPAA 4ORFA 2ZW6A 4U9ZA 3TTHA 5EC4A 3F5BA 2Q04A 1ON0A 2ZW5A 3LODA 3C26A 4PSWA 1UFHA 3VWDA 2GANA 2CNMA 1MJAA 3GYAA 1OZPA 3PZJA 4OLLA 1QSRA 3TO6A 3R96A 4KVME 3JVNA 3R9GA 5IV0A 2F5IA 3CXSA 2P6EA 4B5PA 2FXFA 2AJ6A 1K4JA 3P2HA 4CAXA 2VZZA 1S5KA 2OZGA 1KZFA 2FIAA 2G3AA 4GS4A 2P6GA 2Q0YA 2J8NA 4U5YA 2OZUA 2X7BA 4KOUA 3LD2A 2HV2A 3TCVA 4LX9A 2R7HA 1LRZA 4RS2A 1S7NA 5KTDA 1M4DA 2VXKA 4KOTA 1VHSA 2BL1A 2JLMA 2JDDA 4KVOE 4KZTA 2QIRA 1XE4A 3IGRA 3FYNA 4R9MA 3G8WA 4OAEA 1NSLA 4H6UA 2BUEA 2HUZA 1NMTA 1YVKA 4AVCA 1BO4A 1M4GA 3E0KA 1I1DA 2REEA 4XPDB 3ZJ0A 4B5PB 2QECA 2C27A 2B58A 4CRYB 2B3UA 4J3GA 4KOYA 2G3TA 1Z9UA 3UY5A 2OZHA 3VWEA 3S6FA 2B5GA 2Q4VA 4EVYA 1GHEA 4HKFA 4JWPA 3RYOA 4IUSA 2K5TA 2JEVA 4YFJA 2PDOA 1IICA 4L89A 3TO9A 1QSTA 1P4NA 5IB0A 1YR0A 2VEZA 2PR8A 1S7FA 3KKWA 4KLVA 5ISVA 4QC6A 1Q2DA 1QSNA 1S7LA 1Y7RA 3FBUA 2JDCA 1CM0A 3BJ8A 3N7ZA 3H4QA 1QSOA 2Y0MA 3TT2A 1XIXA 4CAWA 1KUVA 3ZZIA 3DNSA 2Q7BA 3EY5A 4CS0B 3K9UA 4U9YA 1MK4A 2ARHA 3F0AA 2B5GB 2OH1A 4CAVA 1YK3A 2CY2A 4NEXA 5GCNA 2EUIA 3FRMA 4Y49B 4JXQA 5HMNA 4R87A 1S7KA 5C82A 4XPDC 1BOBA 4DNCA 3V8IA 4QVTA 1S60A 2NMTA 4R3LA 1RO5A 1Y9KA 2P0WA 4KOSA 1M44A 4KOVA 2ZXVA 3DR8A 4ZBGA 4AVAA 2G0BA
chains in the Genus database with same CATH superfamily
1TKHA 4LQGA 5KTCA 2FL4A 4R7MA 2G9DA 2YNEA 1XOVA 1TKJA 1AUGA 3B3SA 4M6IA 4Q36A 4MBUA 3SJXA 2VQYA 5HVGA 2ZEMA 1BLLE 4MHZA 3RNZA 3D3SA 3FIXA 3D7GA 2PRQA 4BBHA 1PYTB 1Y0RA 1Z4RA 2PRBA 4X3RA 4E0AA 2PJ5A 2Q4YA 3IJ3A 4QUSA 3PRTA 2PIZA 2Z11A 4H6ZA 2VI7A 5LRKA 2ZEDA 2J8RA 3I3GA 4EWTA 4A39A 1IY7A 1M4IA 3WABA 3S6HA 4LUAA 4Q38A 4XNHB 2GU2A 3QNVA 5K8OA 3EC4A 1EE3P 3KR4A 1RXTA 3BJ7A 1ZLIA 5H84A 4JJXA 5HVFA 4BINA 4CYOA 3GKRA 4KOWA 4MCPA 3TO7A 2YNDA 5C88A 2QYVA 4FD7A 4KUBA 5F47A 1QMUA 3B7IA 3PP9A 2PJ2A 4B5OA 3WR7A 1YREA 2PJ8A 4Q7AA 1YMEA 3PB6X 3TX8A 5E96A 3SI2A 4QB9A 1YQEA 2D4OA 2OB0A 3PB4X 5LRJA 3KHXA 3SHPA 3L2NA 3F8KA 7CPAA 2VBQA 1CPXA 3D8PA 1IB1E 4MFLA 4YWYA 2PC1A 4R8FA 3TC8A 4JD6A 2V8DA 4FBEA 2GFQA 2ZEOA 1MJBA 4HPSA 2FSRA 2P6FA 3D4UA 4ONUA 4CRZB 1JWQA 1N71A 3FX6A 4L8AA 3R9EA 1Q2YA 4MY3A 5LYIA 2ZELA 1XEBA 4F6AA 1LOKA 4UEZA 3I1UA 3NH5A 4X2TA 6CPAA 4C7IA 4NGQA 4JLYA 2PSWA 2JBKA 4MFQA 3IWEA 3QAYA 1OBRA 2FIWA 4MHDA 3EFAA 3R9FA 3FNCA 4OC2A 2JBJA 5HXDA 1S3ZA 4PSXA 4JYWA 2DXQA 5K8MA 4R3KA 3GIUA 2PJ9A 4W9YA 4EMEA 4UCNA 4DJLA 2O53A 3KGQA 5HVHA 2AFXA 1VHOA 4KSAA 2CIJA 5J8FA 5IX3A 1F2OA 2B4DA 2YGWA 4CGOA 3BXMA 1QQ9A 1YW4A 1PCAA 2B3VA 2ZOGA 3FECA 5LRGA 3GY9A 3SJFA 5JM6A 1NSAA 1X12A 2GE3A 4NGSA 4BMHA 4II9A 2PJ4A 5F48A 3T90A 2Z3NA 1LAMA 3KQZA 3IWWA 4AG7A 1PUAA 5A28A 4HNYB 3TOBA 4CYQA 4QBJA 4MCSA 4RN7A 2C1CA 5F49A 3R1KA 2Z10A 4HNXB 4P45A 2ZOFA 3IWGA 4NGMA 5JH9A 1DTDA 4MJ8A 4ZYQA 2HQYA 1B6BA 4FD5A 4G1PA 3RBUA 4AB7A 2WPXA 3K9TA 2ZENA 4AG9A 3SJGA 2IMOA 2IJZA 3NE8A 2RB7A 5BWAB 3GB0A 2IQ6A 1Z8XA 3B8GA 3V7ZA 4E8OA 5AG6A 4UWIA 4GXHA 4PXCA 4ONWA 4ZY2A 4PXBA 4A33A 2WZNA 3BI0A 2AE6A 4KVXA 3KZWA 3BHXA 4ZX9A 2XEGA 3B3WA 3DDDA 4UF4A 2AFZA 2NSMA 2R1IA 4M85A 1IOFA 3G3SA 4OC1A 3TOAA 1R57A 1ELMP 1GYTA 1MJ9A 2B4BA 4I49A 4YRHA 5JQ4A 4KORA 3VH9A 3BLNA 1IYLA 4OC5A 2EWBA 4R6TA 3JTKA 4DYOA 3FF3A 2B4DB 2CNTA 2HB6A 1KUXA 1KUYA 2FT0A 4NGNA 1IYKA 3CXQA 4UEEA 2H5MA 4AVBA 1U6MA 2AFWA 4B12A 5CPAA 3RO0A 3WC6A 2DPTA 4E2AA 3H8FA 1ZO0A 2RFHA 2BO9A 2Q44A 2YNCA 3OWCA 4KSFA 3T9YA 5LYFA 3QAHA 3TE4A 1Z8LA 3MGDA 1ELLP 2GLJA 1YLEA 1I21A 4MHNA 1J4JA 4MHPA 5KTAA 4NGPA 4CGMA 4R57A 1CP6A 3D7HA 3SXNA 1P0HA 4MI4A 4M6HA 2QJ8A 4MY0A 4B11A 3PB9X 3WC5A 3IFEA 1WWZA 4MCRA 3D2MA 1FY7A 5I0CA 2PQ8A 1Y9WA 2Z3OA 1L0CA 1BAVA 4F9UA 4NSQA 2ZW7A 2REFA 1TF8A 1AMPA 2CNSA 3R95A 4F9VA 4NXYA 1YSJA 1V0CA 1R3NA 1ZG9A 2WPWA 2ZEHA 3S6KA 5A27A 2GIVA 2AFOA 5JGFA 1QSMA 2FS5A 1RTQA 1XMBA 5FVJA 2BSWA 2O28A 1VHEA 2BEIA 3MN8A 3KHZA 4WWVA 1WK4A 1YVOA 4PV6A 2V77A 1IGBA 3FXTA 2OOTA 3JUWA 4NGRA 4XPLA 4CYNA 5JPHA 3TFYA 4K3NA 2ATRA 3IU1A 3D68A 1CJWA 3DR6A 4NFRA 4IF5A 2R8VA 2PJ1A 4H89A 1ZG7A 4RI1A 4PK2A 8CPAA 4OP4A 3B2YA 4NF1A 4MFZA 1LCPA 2PJ0A 2PR1A 3FH4A 3QB8A 4YGOA 1XBUA 4M3SA 2IL4A 2R98A 4X5KA 1ZLHA 3LACA 4A95A 2PJBA 3HLPA 1Z8TA 4MHYA 4XPKA 1XMTA 3MRUA 1TKFA 1YGHA 2V8GA 3KL9A 4KOXA 4PXEA 3W6SA 1H8LA 2Q51A 3FMCA 4Y49C 2POKA 2OU2A 3FVLA 3K2KA 4AXVA 3PBEA 4A30A 4KLWA 3FJUA 3S6GA 4OC0A 3EXNA 5D29A 4OADA 2ZEFA 1SQHA 3CT9A 3DSBA 1Z4EA 1HEEA 2DF5A 1Q2CA 2ZW4A 3S9MA 2ABZA 5AG7A 1M1DA 3HUVA 3I9SA 2VZYA 2QMLA 1ARMA 5DWMA 4A2ZA 3PB8X 3VATA 4TNUA 1TIQA 3D2PA 3H8EA 5CNPA 2J8MA 3NE7A 3NH4A 1VKCA 3PGPA 4PK3A 4UBRA 2FE7A 4CPAA 1ARLA 1VIXA 3SXOA 2EK8A 4ZGYB 3PFEA 2PIYA 2DEAA 3NA6A 3EO4A 3FB3A 4NCZA 2PJ3A 4K30A 4UA3A 4EFDA 5DWNA 3P2FA 2KCWA 4HNWB 1XF8A 5EBVA 4UWJA 4OMEA 1B87A 4MXUA 3SI1A 5F46A 5J8CA 4CAFA 4B13A 1PU9A 2XEIA 4OC4A 3LMSA 3CPAA 1DE4C 2XEFA 4FD4A 3FEDA 4F0YA 1UWYA 1VGYA 2I00A 4ZY0A 2Z3KA 1LANA 2AFSA 1FNOA 1YX0A 3CXPA 4FD6A 4MFJA 3IO1A 3JRUA 4P4JA 4PQAA 4JXRA 4XNHC 3W91A 4C7HA 5IB9A 4KUAA 1I12A 3RZAA 2I79A 4BD9A 2FCKA 2ZEEA 4JZ0A 3D67A 1IIDA 1KWMA 4A31A 4ZI6A 3LWUA 4C2YA 1CX8A 5EMIA 2EO8A 2RC4A 2EVNA 4CGPA 3ISXA 2Z3LA 2PCUA 5H86A 3BI1A 5HH1A 1NE9A 2Z0ZA 2D4PA 4TWEA 3IU2A 1TF9A 2O4HA 4P44A 3W6XA 2A4NA 2ZPAA 5G21A 3D66A 4MRIA 4ORFA 3SI0A 1YLOA 2YNCC 1F2PA 4PPZA 2ZW6A 2FVGA 5AG5A 3FEEA 4U9ZA 4MMOA 2CTBA 3PBBA 4KS9A 4CYPA 3TTHA 5EC4A 3F5BA 2Q43A 2Q04A 1ON0A 4NJRA 1JQGA 2ZW5A 4P4EA 3LODA 3C26A 4UIBA 5ELYA 4PSWA 3DGVA 5LYLA 1UFHA 3VWDA 2GANA 2CNMA 1MJAA 3GYAA 4X8IA 4FWUA 1OZPA 3PZJA 5LYDA 4F8ZA 1Z8WA 4OLLA 2Q4ZA 4M6GA 4P4BA 4R76A 4A94A 1QSRA 3TO6A 3R96A 4KVME 3JVNA 4CGLA 4B10A 3B3CA 3R9GA 1CP7A 1X10A 5IV0A 4P4FA 2F5IA 3CXSA 1Z2LA 2C6PA 2P6EA 4P4DA 1HDQA 4IHMA 3KR5A 4B5PA 5AG4A 2FXFA 2AJ6A 1K4JA 3P2HA 4CAXA 2VZZA 3D7FA 2CXAA 3PFOA 1S5KA 2OZGA 1KZFA 4MFPA 4P6YA 2FIAA 2C6CA 3DLJA 2G3AA 4GS4A 2P6GA 2Q0YA 2J8NA 3PEIA 4U5YA 2AFMA 3N5FA 4A32A 2OZUA 3NH8A 4Z65A 2X7BA 1A2ZA 2GREA 4KOUA 3LD2A 3PB7X 5J1QA 2HV2A 3TCVA 4LX9A 2R7HA 2WYRA 1LRZA 4RS2A 1S7NA 5KTDA 1M4DA 2VXKA 4KOTA 1VHSA 2BL1A 2JLMA 2JDDA 4KVOE 2CTCA 4KZTA 5THWA 2AFUA 4F0XA 1AYEA 2ZEPA 3IIBA 4CGNA 3B3TA 4UFXA 3KASA 2QIRA 1XE4A 3IGRA 3FYNA 4FAIA 4R9MA 3G8WA 2OR4A 4OAEA 1NSLA 3H8GA 5K8NA 4H6UA 4LQ6A 4PXDA 3WT4A 2BUEA 2HUZA 2ANPA 4P10A 1NMTA 4C68A 1YVKA 4AVCA 1BO4A 1M4GA 1ZG8A 4C2XA 4C2ZA 2CF4A 3E0KA 2J9AA 1I1DA 2Q7SA 2GLFA 2PJ7A 2REEA 1CPSA 3H5ZA 4NJQA 4XPDB 5G20A 3VARA 3ZJ0A 4B5PB 2QECA 4O23A 1HDUA 2JEWA 2C27A 2BCOA 1M4LA 2XEJA 3D7DA 2B58A 2Z3MA 3B35A 2B3UA 4J3GA 4KOYA 4UEFA 4ZX8A 4CRYB 2G3TA 1Z9UA 1Q7LA 5IB0A 5I4MA 4UIAA 4UCPA 3GUXA 3NFZA 3UY5A 2OZHA 2WUUA 3VWEA 4ZY1A 3S6FA 1Z5RA 2B5GA 2Q4VA 4EVYA 1GHEA 4HKFA 1XRYA 2ODFA 2WSAA 2ZEGA 4JWPA 3RYOA 2C6GA 4IUSA 1IOIA 2K5TA 3S9LA 2DPSA 1Y0YA 2JEVA 1XFOA 3SJEA 4YFJA 2PDOA 1IICA 2V8VA 4FUUA 4L89A 4OIWA 2BOAA 1QSTA 1XJOA 4YU9A 1P4NA 3TO9A 4CAEA 2PE3A 4IAVA 5G22A 4B14A 2V8HA 2PJAA 1YR0A 2VEZA 2PR8A 4H2KA 1S7FA 3ISZA 3KKWA 2NYQA 1Y7EA 4KLVA 5ISVA 4IK2A 5D8NA 4QC6A 4A38A 1Q2DA 4OIDA 5K8PA 1QSNA 1S7LA 3IEHA 2QVPA 3IC1A 3V38A 1CG2A 3CZXA 1Y7RA 3FBUA 2JDCA 1CM0A 3BJ8A 1LAPA 3GLJA 3N7ZA 1BPMA 3H4QA 1QSOA 2Y0MA 4GM5A 3TT2A 1F57A 4UFWA 2EK9A 2PJ6A 3RAMA 3A9LA 2I3CA 1XIXA 5DS0A 4DUKA 4NGTA 4CAWA 3T8WA 1KUVA 1R43A 1CBXA 3DNSA 3ZZIA 2Q7BA 2PVVA 3EY5A 4CS0B 2VL1A 5CBMA 3K9UA 4U9YA 1BPNA 4MFKA 1MK4A 2F7VA 3KQXA 2ARHA 5F09A 3F0AA 2EBJA 2B5GB 2OH1A 4UCMA 4CAVA 1YK3A 2Z3PA 2CY2A 4NEXA 2PVWA 5GCNA 1YW6A 1FT7A 2EUIA 3FRMA 3S9NA 4OC3A 4B6ZA 2F8HA 1IU8A 4MCQA 2PJCA 4Y49B 3KI9A 4JXQA 5HMNA 4WJBA 4R87A 3CPXA 1S7KA 4A37A 5C82A 4XPDC 1LFWA 4OKOA 1BOBA 1TXRA 4DNCA 3V8IA 5G1ZA 3CDXA 5AGEA 4UFVA 3B3VA 4QVTA 1S60A 2NMTA 4KSIA 4R3LA 1RO5A 1Y9KA 2HC9A 4RUHA 2P0WA 4KOSA 1M44A 4P4IA 4KOVA 2ZXVA 3DR8A 4ZBGA 3WC7A 4AVAA 2G0BA
chains in the Genus database with same CATH topology
5KTCA 2FL4A 2YNEA 4Q36A 4MBUA 2VQYA 3D3SA 3FIXA 4BBHA 1Z4RA 2PRBA 4E0AA 2Q4YA 4QUSA 2Z11A 4H6ZA 2VI7A 2J8RA 3I3GA 1M4IA 3S6HA 4LUAA 4Q38A 4XNHB 3EC4A 1RXTA 3BJ7A 5H84A 4JJXA 4CYOA 3GKRA 4KOWA 3TO7A 5C88A 2YNDA 4FD7A 4KUBA 5F47A 3PP9A 4B5OA 3WR7A 1YREA 5E96A 4QB9A 3SHPA 2D4OA 2OB0A 3F8KA 2VBQA 3D8PA 4MFLA 1IB1E 2PC1A 4JD6A 1MJBA 4ONUA 2FSRA 2P6FA 4CRZB 1N71A 4L8AA 3R9EA 1Q2YA 4MY3A 1XEBA 4C7IA 4JLYA 2PSWA 4MFQA 3IWEA 2FIWA 4MHDA 3EFAA 3R9FA 3FNCA 1S3ZA 4PSXA 2DXQA 4R3KA 4UCNA 4KSAA 5J8FA 5IX3A 2B4DA 2YGWA 4CGOA 2B3VA 3GY9A 2GE3A 4BMHA 4II9A 5F48A 3T90A 2Z3NA 4AG7A 1PUAA 5A28A 4HNYB 3TOBA 4CYQA 4QBJA 5F49A 3R1KA 2Z10A 4HNXB 3IWGA 4MJ8A 2HQYA 1B6BA 4FD5A 4AB7A 4AG9A 2WPXA 5BWAB 3B8GA 4E8OA 5AG6A 4UWIA 4A33A 4KVXA 2AE6A 3DDDA 2R1IA 4M85A 3G3SA 3TOAA 1R57A 4YRHA 1MJ9A 2B4BA 4I49A 5JQ4A 4KORA 3BLNA 1IYLA 3JTKA 2B4DB 2CNTA 1KUXA 1KUYA 2FT0A 1IYKA 3CXQA 4AVBA 2H5MA 1U6MA 4B12A 4E2AA 2DPTA 1ZO0A 2YNCA 2Q44A 3OWCA 4KSFA 3T9YA 3QAHA 3TE4A 3MGDA 1YLEA 1I21A 1J4JA 5KTAA 4CGMA 4R57A 3SXNA 1P0HA 4MI4A 4MY0A 4B11A 1WWZA 3D2MA 1FY7A 5I0CA 2PQ8A 1Y9WA 2Z3OA 1L0CA 4NSQA 2ZW7A 2REFA 2CNSA 3R95A 4NXYA 2WPWA 1V0CA 3S6KA 5A27A 2GIVA 1QSMA 2FS5A 5FVJA 2BSWA 2O28A 2BEIA 1WK4A 1YVOA 4PV6A 3FXTA 3JUWA 4XPLA 4CYNA 5JPHA 3TFYA 2ATRA 3IU1A 1CJWA 3DR6A 4IF5A 2R8VA 4H89A 4RI1A 4PK2A 4NF1A 4MFZA 2PR1A 3QB8A 4YGOA 4M3SA 2IL4A 2R98A 4X5KA 4A95A 4XPKA 1XMTA 1YGHA 4KOXA 3W6SA 4Y49C 2OU2A 4A30A 4KLWA 3S6GA 3EXNA 4OADA 3DSBA 1SQHA 1Z4EA 2ZW4A 1Q2CA 5AG7A 1M1DA 3I9SA 2VZYA 2QMLA 5DWMA 4A2ZA 1TIQA 3D2PA 5CNPA 2J8MA 3NE7A 3PGPA 1VKCA 4PK3A 4UBRA 2FE7A 4ZGYB 3SXOA 4UA3A 3EO4A 3FB3A 4NCZA 4K30A 5DWNA 3P2FA 2KCWA 4HNWB 1XF8A 5EBVA 4UWJA 1B87A 5J8CA 5F46A 4CAFA 4B13A 1PU9A 4FD4A 4F0YA 2I00A 2Z3KA 4F6AA 1YX0A 3CXPA 4FD6A 4MFJA 4XNHC 3W91A 4JXRA 4C7HA 4KUAA 1I12A 2I79A 2FCKA 1IIDA 4A31A 4C2YA 2RC4A 2EVNA 4CGPA 2Z3LA 5H86A 5HH1A 1NE9A 2Z0ZA 2D4PA 3IU2A 3W6XA 2A4NA 2ZPAA 5G21A 4ORFA 2YNCC 5AG5A 2ZW6A 4U9ZA 4KS9A 4CYPA 3TTHA 5EC4A 3F5BA 2Q04A 1ON0A 2ZW5A 3LODA 3C26A 4PSWA 1UFHA 3VWDA 2GANA 2CNMA 1MJAA 3GYAA 1OZPA 3PZJA 4OLLA 1QSRA 3TO6A 3R96A 4KVME 3JVNA 4CGLA 4B10A 3R9GA 5IV0A 2F5IA 3CXSA 2P6EA 5AG4A 4B5PA 2FXFA 2AJ6A 1K4JA 3P2HA 4CAXA 2VZZA 2CXAA 1S5KA 2OZGA 1KZFA 4MFPA 2FIAA 2G3AA 4GS4A 2P6GA 2Q0YA 2J8NA 4U5YA 4A32A 2OZUA 2X7BA 4KOUA 3LD2A 2HV2A 3TCVA 4LX9A 2R7HA 1LRZA 4RS2A 1S7NA 5KTDA 1M4DA 2VXKA 4KOTA 1VHSA 2BL1A 2JLMA 2JDDA 4KVOE 4F0XA 4KZTA 4CGNA 4UFXA 2QIRA 1XE4A 3IGRA 3FYNA 4R9MA 3G8WA 4OAEA 1NSLA 4H6UA 2BUEA 2HUZA 1NMTA 4C68A 1YVKA 4AVCA 1BO4A 1M4GA 4C2XA 4C2ZA 3E0KA 1I1DA 2REEA 3H5ZA 4XPDB 5G20A 3ZJ0A 4B5PB 2QECA 2C27A 2B58A 2Z3MA 4CRYB 2B3UA 4J3GA 4KOYA 2G3TA 1Z9UA 4UCPA 3UY5A 2OZHA 2WUUA 3VWEA 3S6FA 2B5GA 2Q4VA 4EVYA 1GHEA 4HKFA 2WSAA 4JWPA 3RYOA 4IUSA 2K5TA 2DPSA 2JEVA 4YFJA 2PDOA 1IICA 4L89A 3TO9A 1QSTA 1P4NA 4CAEA 5G22A 4B14A 5IB0A 1YR0A 2VEZA 2PR8A 1S7FA 3KKWA 4KLVA 5ISVA 4QC6A 1Q2DA 1QSNA 1S7LA 1Y7RA 3FBUA 2JDCA 1CM0A 3BJ8A 3N7ZA 3H4QA 1QSOA 2Y0MA 3TT2A 4UFWA 3A9LA 1XIXA 4CAWA 1KUVA 3ZZIA 3DNSA 2Q7BA 3EY5A 4CS0B 3K9UA 4U9YA 4MFKA 1MK4A 2ARHA 3F0AA 2B5GB 2OH1A 4UCMA 4CAVA 1YK3A 2Z3PA 2CY2A 4NEXA 5GCNA 2EUIA 3FRMA 4Y49B 4JXQA 5HMNA 4R87A 1S7KA 5C82A 4XPDC 1BOBA 4DNCA 3V8IA 5G1ZA 5AGEA 4UFVA 4QVTA 1S60A 2NMTA 4R3LA 1RO5A 1Y9KA 2P0WA 4KOSA 1M44A 4KOVA 2ZXVA 3DR8A 4ZBGA 4AVAA 2G0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTC A;  2FL4 A;  4MBU A;  2VQY A;  3D3S A;  3FIX A;  1Z4R A;  2PRB A;  4E0A A;  2Q4Y A;  4QUS A;  2Z11 A;  4H6Z A;  2VI7 A;  2J8R A;  3I3G A;  1M4I A;  3S6H A;  4LUA A;  4XNH B;  3EC4 A;  1RXT A;  3BJ7 A;  5H84 A;  4JJX A;  3GKR A;  4KOW A;  3TO7 A;  5C88 A;  4FD7 A;  4KUB A;  5F47 A;  3PP9 A;  4B5O A;  3WR7 A;  1YRE A;  5E96 A;  4QB9 A;  3SHP A;  2D4O A;  2OB0 A;  3F8K A;  2VBQ A;  3D8P A;  1IB1 E;  2PC1 A;  4JD6 A;  1MJB A;  4ONU A;  2FSR A;  2P6F A;  4CRZ B;  1N71 A;  4L8A A;  3R9E A;  1Q2Y A;  4MY3 A;  1XEB A;  4JLY A;  2PSW A;  2FIW A;  4MHD A;  3EFA A;  3R9F A;  3FNC A;  1S3Z A;  4PSX A;  2DXQ A;  4R3K A;  5J8F A;  5IX3 A;  2B4D A;  2B3V A;  3GY9 A;  2GE3 A;  4BMH A;  4II9 A;  5F48 A;  3T90 A;  4AG7 A;  1PUA A;  4HNY B;  3TOB A;  4QBJ A;  5F49 A;  3R1K A;  2Z10 A;  4HNX B;  3IWG A;  4MJ8 A;  2HQY A;  1B6B A;  4FD5 A;  4AB7 A;  4AG9 A;  2WPX A;  3B8G A;  4E8O A;  4UWI A;  4KVX A;  2AE6 A;  3DDD A;  2R1I A;  4M85 A;  3G3S A;  3TOA A;  1R57 A;  4YRH A;  1MJ9 A;  2B4B A;  4I49 A;  5JQ4 A;  4KOR A;  3BLN A;  1IYL A;  2B4D B;  2CNT A;  1KUX A;  1KUY A;  2FT0 A;  1IYK A;  3CXQ A;  4AVB A;  2H5M A;  1U6M A;  4E2A A;  3OWC A;  2Q44 A;  3T9Y A;  3QAH A;  3TE4 A;  3MGD A;  1YLE A;  1I21 A;  1J4J A;  5KTA A;  4R57 A;  3SXN A;  1P0H A;  4MI4 A;  4MY0 A;  1WWZ A;  3D2M A;  1FY7 A;  5I0C A;  2PQ8 A;  1Y9W A;  1L0C A;  4NSQ A;  2ZW7 A;  2REF A;  2CNS A;  3R95 A;  4NXY A;  2WPW A;  1V0C A;  3S6K A;  2GIV A;  1QSM A;  2FS5 A;  5FVJ A;  2BSW A;  2O28 A;  2BEI A;  1WK4 A;  1YVO A;  4PV6 A;  3FXT A;  3JUW A;  4XPL A;  5JPH A;  3TFY A;  2ATR A;  1CJW A;  3DR6 A;  4IF5 A;  2R8V A;  4H89 A;  4RI1 A;  4PK2 A;  4NF1 A;  2PR1 A;  3QB8 A;  4YGO A;  4M3S A;  2IL4 A;  2R98 A;  4X5K A;  4XPK A;  1XMT A;  1YGH A;  4KOX A;  3W6S A;  4Y49 C;  2OU2 A;  4KLW A;  3S6G A;  3EXN A;  4OAD A;  3DSB A;  1SQH A;  1Z4E A;  2ZW4 A;  1Q2C A;  1M1D A;  3I9S A;  2VZY A;  2QML A;  5DWM A;  1TIQ A;  3D2P A;  5CNP A;  2J8M A;  3NE7 A;  3PGP A;  1VKC A;  4PK3 A;  4UBR A;  2FE7 A;  3SXO A;  4UA3 A;  3EO4 A;  3FB3 A;  4NCZ A;  4K30 A;  5DWN A;  3P2F A;  2KCW A;  4HNW B;  1XF8 A;  5EBV A;  4UWJ A;  1B87 A;  5J8C A;  5F46 A;  1PU9 A;  4FD4 A;  4F0Y A;  2I00 A;  4F6A A;  1YX0 A;  3CXP A;  4FD6 A;  4XNH C;  3W91 A;  4JXR A;  4KUA A;  1I12 A;  2I79 A;  2FCK A;  1IID A;  2RC4 A;  2EVN A;  5H86 A;  5HH1 A;  1NE9 A;  2Z0Z A;  2D4P A;  3W6X A;  2A4N A;  2ZPA A;  4ORF A;  2ZW6 A;  4U9Z A;  3TTH A;  5EC4 A;  3F5B A;  2Q04 A;  1ON0 A;  2ZW5 A;  3LOD A;  3C26 A;  4PSW A;  1UFH A;  3VWD A;  2GAN A;  2CNM A;  1MJA A;  3GYA A;  1OZP A;  3PZJ A;  4OLL A;  1QSR A;  3TO6 A;  3R96 A;  4KVM E;  3JVN A;  3R9G A;  5IV0 A;  2F5I A;  3CXS A;  2P6E A;  4B5P A;  2FXF A;  2AJ6 A;  1K4J A;  3P2H A;  4CAX A;  2VZZ A;  1S5K A;  2OZG A;  1KZF A;  2FIA A;  2G3A A;  4GS4 A;  2P6G A;  2Q0Y A;  2J8N A;  4U5Y A;  2OZU A;  2X7B A;  4KOU A;  3LD2 A;  2HV2 A;  3TCV A;  4LX9 A;  2R7H A;  1LRZ A;  4RS2 A;  1S7N A;  5KTD A;  1M4D A;  2VXK A;  4KOT A;  1VHS A;  2BL1 A;  2JLM A;  2JDD A;  4KVO E;  4KZT A;  2QIR A;  1XE4 A;  3IGR A;  3FYN A;  4R9M A;  3G8W A;  4OAE A;  1NSL A;  4H6U A;  2BUE A;  2HUZ A;  1NMT A;  1YVK A;  4AVC A;  1BO4 A;  1M4G A;  3E0K A;  1I1D A;  2REE A;  4XPD B;  3ZJ0 A;  4B5P B;  2QEC A;  2C27 A;  2B58 A;  4CRY B;  2B3U A;  4J3G A;  4KOY A;  2G3T A;  1Z9U A;  3UY5 A;  2OZH A;  3VWE A;  3S6F A;  2B5G A;  2Q4V A;  4EVY A;  1GHE A;  4HKF A;  4JWP A;  3RYO A;  4IUS A;  2K5T A;  2JEV A;  4YFJ A;  2PDO A;  1IIC A;  4L89 A;  3TO9 A;  1QST A;  1P4N A;  5IB0 A;  1YR0 A;  2VEZ A;  2PR8 A;  1S7F A;  3KKW A;  4KLV A;  5ISV A;  4QC6 A;  1Q2D A;  1QSN A;  1S7L A;  1Y7R A;  3FBU A;  2JDC A;  1CM0 A;  3BJ8 A;  3N7Z A;  3H4Q A;  1QSO A;  2Y0M A;  3TT2 A;  1XIX A;  4CAW A;  1KUV A;  3ZZI A;  3DNS A;  2Q7B A;  3EY5 A;  4CS0 B;  3K9U A;  4U9Y A;  1MK4 A;  2ARH A;  3F0A A;  2B5G B;  2OH1 A;  4CAV A;  1YK3 A;  2CY2 A;  4NEX A;  5GCN A;  2EUI A;  3FRM A;  4Y49 B;  4JXQ A;  5HMN A;  4R87 A;  1S7K A;  5C82 A;  4XPD C;  1BOB A;  4DNC A;  3V8I A;  4QVT A;  1S60 A;  2NMT A;  4R3L A;  1RO5 A;  1Y9K A;  2P0W A;  4KOS A;  1M44 A;  4KOV A;  2ZXV A;  3DR8 A;  4ZBG A;  4AVA A;  2G0B A; 
#chains in the Genus database with same CATH topology
 1TKH A;  4LQG A;  5KTC A;  2FL4 A;  4R7M A;  2G9D A;  2YNE A;  1XOV A;  1TKJ A;  1AUG A;  3B3S A;  4M6I A;  4Q36 A;  4MBU A;  3SJX A;  2VQY A;  5HVG A;  2ZEM A;  1BLL E;  4MHZ A;  3RNZ A;  3D3S A;  3FIX A;  3D7G A;  2PRQ A;  4BBH A;  1PYT B;  1Y0R A;  1Z4R A;  2PRB A;  4X3R A;  4E0A A;  2PJ5 A;  2Q4Y A;  3IJ3 A;  4QUS A;  3PRT A;  2PIZ A;  2Z11 A;  4H6Z A;  2VI7 A;  5LRK A;  2ZED A;  2J8R A;  3I3G A;  4EWT A;  4A39 A;  1IY7 A;  1M4I A;  3WAB A;  3S6H A;  4LUA A;  4Q38 A;  4XNH B;  2GU2 A;  3QNV A;  5K8O A;  3EC4 A;  1EE3 P;  3KR4 A;  1RXT A;  3BJ7 A;  1ZLI A;  5H84 A;  4JJX A;  5HVF A;  4BIN A;  4CYO A;  3GKR A;  4KOW A;  4MCP A;  3TO7 A;  2YND A;  5C88 A;  2QYV A;  4FD7 A;  4KUB A;  5F47 A;  1QMU A;  3B7I A;  3PP9 A;  2PJ2 A;  4B5O A;  3WR7 A;  1YRE A;  2PJ8 A;  4Q7A A;  1YME A;  3PB6 X;  3TX8 A;  5E96 A;  3SI2 A;  4QB9 A;  1YQE A;  2D4O A;  2OB0 A;  3PB4 X;  5LRJ A;  3KHX A;  3SHP A;  3L2N A;  3F8K A;  7CPA A;  2VBQ A;  1CPX A;  3D8P A;  1IB1 E;  4MFL A;  4YWY A;  2PC1 A;  4R8F A;  3TC8 A;  4JD6 A;  2V8D A;  4FBE A;  2GFQ A;  2ZEO A;  1MJB A;  4HPS A;  2FSR A;  2P6F A;  3D4U A;  4ONU A;  4CRZ B;  1JWQ A;  1N71 A;  3FX6 A;  4L8A A;  3R9E A;  1Q2Y A;  4MY3 A;  5LYI A;  2ZEL A;  1XEB A;  4F6A A;  1LOK A;  4UEZ A;  3I1U A;  3NH5 A;  4X2T A;  6CPA A;  4C7I A;  4NGQ A;  4JLY A;  2PSW A;  2JBK A;  4MFQ A;  3IWE A;  3QAY A;  1OBR A;  2FIW A;  4MHD A;  3EFA A;  3R9F A;  3FNC A;  4OC2 A;  2JBJ A;  5HXD A;  1S3Z A;  4PSX A;  4JYW A;  2DXQ A;  5K8M A;  4R3K A;  3GIU A;  2PJ9 A;  4W9Y A;  4EME A;  4UCN A;  4DJL A;  2O53 A;  3KGQ A;  5HVH A;  2AFX A;  1VHO A;  4KSA A;  2CIJ A;  5J8F A;  5IX3 A;  1F2O A;  2B4D A;  2YGW A;  4CGO A;  3BXM A;  1QQ9 A;  1YW4 A;  1PCA A;  2B3V A;  2ZOG A;  3FEC A;  5LRG A;  3GY9 A;  3SJF A;  5JM6 A;  1NSA A;  1X12 A;  2GE3 A;  4NGS A;  4BMH A;  4II9 A;  2PJ4 A;  5F48 A;  3T90 A;  2Z3N A;  1LAM A;  3KQZ A;  3IWW A;  4AG7 A;  1PUA A;  5A28 A;  4HNY B;  3TOB A;  4CYQ A;  4QBJ A;  4MCS A;  4RN7 A;  2C1C A;  5F49 A;  3R1K A;  2Z10 A;  4HNX B;  4P45 A;  2ZOF A;  3IWG A;  4NGM A;  5JH9 A;  1DTD A;  4MJ8 A;  4ZYQ A;  2HQY A;  1B6B A;  4FD5 A;  4G1P A;  3RBU A;  4AB7 A;  2WPX A;  3K9T A;  2ZEN A;  4AG9 A;  3SJG A;  2IMO A;  2IJZ A;  3NE8 A;  2RB7 A;  5BWA B;  3GB0 A;  2IQ6 A;  1Z8X A;  3B8G A;  3V7Z A;  4E8O A;  5AG6 A;  4UWI A;  4GXH A;  4PXC A;  4ONW A;  4ZY2 A;  4PXB A;  4A33 A;  2WZN A;  3BI0 A;  2AE6 A;  4KVX A;  3KZW A;  3BHX A;  4ZX9 A;  2XEG A;  3B3W A;  3DDD A;  4UF4 A;  2AFZ A;  2NSM A;  2R1I A;  4M85 A;  1IOF A;  3G3S A;  4OC1 A;  3TOA A;  1R57 A;  1ELM P;  1GYT A;  1MJ9 A;  2B4B A;  4I49 A;  4YRH A;  5JQ4 A;  4KOR A;  3VH9 A;  3BLN A;  1IYL A;  4OC5 A;  2EWB A;  4R6T A;  3JTK A;  4DYO A;  3FF3 A;  2B4D B;  2CNT A;  2HB6 A;  1KUX A;  1KUY A;  2FT0 A;  4NGN A;  1IYK A;  3CXQ A;  4UEE A;  2H5M A;  4AVB A;  1U6M A;  2AFW A;  4B12 A;  5CPA A;  3RO0 A;  3WC6 A;  2DPT A;  4E2A A;  3H8F A;  1ZO0 A;  2RFH A;  2BO9 A;  2Q44 A;  2YNC A;  3OWC A;  4KSF A;  3T9Y A;  5LYF A;  3QAH A;  3TE4 A;  1Z8L A;  3MGD A;  1ELL P;  2GLJ A;  1YLE A;  1I21 A;  4MHN A;  1J4J A;  4MHP A;  5KTA A;  4NGP A;  4CGM A;  4R57 A;  1CP6 A;  3D7H A;  3SXN A;  1P0H A;  4MI4 A;  4M6H A;  2QJ8 A;  4MY0 A;  4B11 A;  3PB9 X;  3WC5 A;  3IFE A;  1WWZ A;  4MCR A;  3D2M A;  1FY7 A;  5I0C A;  2PQ8 A;  1Y9W A;  2Z3O A;  1L0C A;  1BAV A;  4F9U A;  4NSQ A;  2ZW7 A;  2REF A;  1TF8 A;  1AMP A;  2CNS A;  3R95 A;  4F9V A;  4NXY A;  1YSJ A;  1V0C A;  1R3N A;  1ZG9 A;  2WPW A;  2ZEH A;  3S6K A;  5A27 A;  2GIV A;  2AFO A;  5JGF A;  1QSM A;  2FS5 A;  1RTQ A;  1XMB A;  5FVJ A;  2BSW A;  2O28 A;  1VHE A;  2BEI A;  3MN8 A;  3KHZ A;  4WWV A;  1WK4 A;  1YVO A;  4PV6 A;  2V77 A;  1IGB A;  3FXT A;  2OOT A;  3JUW A;  4NGR A;  4XPL A;  4CYN A;  5JPH A;  3TFY A;  4K3N A;  2ATR A;  3IU1 A;  3D68 A;  1CJW A;  3DR6 A;  4NFR A;  4IF5 A;  2R8V A;  2PJ1 A;  4H89 A;  1ZG7 A;  4RI1 A;  4PK2 A;  8CPA A;  4OP4 A;  3B2Y A;  4NF1 A;  4MFZ A;  1LCP A;  2PJ0 A;  2PR1 A;  3FH4 A;  3QB8 A;  4YGO A;  1XBU A;  4M3S A;  2IL4 A;  2R98 A;  4X5K A;  1ZLH A;  3LAC A;  4A95 A;  2PJB A;  3HLP A;  1Z8T A;  4MHY A;  4XPK A;  1XMT A;  3MRU A;  1TKF A;  1YGH A;  2V8G A;  3KL9 A;  4KOX A;  4PXE A;  3W6S A;  1H8L A;  2Q51 A;  3FMC A;  4Y49 C;  2POK A;  2OU2 A;  3FVL A;  3K2K A;  4AXV A;  3PBE A;  4A30 A;  4KLW A;  3FJU A;  3S6G A;  4OC0 A;  3EXN A;  5D29 A;  4OAD A;  2ZEF A;  1SQH A;  3CT9 A;  3DSB A;  1Z4E A;  1HEE A;  2DF5 A;  1Q2C A;  2ZW4 A;  3S9M A;  2ABZ A;  5AG7 A;  1M1D A;  3HUV A;  3I9S A;  2VZY A;  2QML A;  1ARM A;  5DWM A;  4A2Z A;  3PB8 X;  3VAT A;  4TNU A;  1TIQ A;  3D2P A;  3H8E A;  5CNP A;  2J8M A;  3NE7 A;  3NH4 A;  1VKC A;  3PGP A;  4PK3 A;  4UBR A;  2FE7 A;  4CPA A;  1ARL A;  1VIX A;  3SXO A;  2EK8 A;  4ZGY B;  3PFE A;  2PIY A;  2DEA A;  3NA6 A;  3EO4 A;  3FB3 A;  4NCZ A;  2PJ3 A;  4K30 A;  4UA3 A;  4EFD A;  5DWN A;  3P2F A;  2KCW A;  4HNW B;  1XF8 A;  5EBV A;  4UWJ A;  4OME A;  1B87 A;  4MXU A;  3SI1 A;  5F46 A;  5J8C A;  4CAF A;  4B13 A;  1PU9 A;  2XEI A;  4OC4 A;  3LMS A;  3CPA A;  1DE4 C;  2XEF A;  4FD4 A;  3FED A;  4F0Y A;  1UWY A;  1VGY A;  2I00 A;  4ZY0 A;  2Z3K A;  1LAN A;  2AFS A;  1FNO A;  1YX0 A;  3CXP A;  4FD6 A;  4MFJ A;  3IO1 A;  3JRU A;  4P4J A;  4PQA A;  4JXR A;  4XNH C;  3W91 A;  4C7H A;  5IB9 A;  4KUA A;  1I12 A;  3RZA A;  2I79 A;  4BD9 A;  2FCK A;  2ZEE A;  4JZ0 A;  3D67 A;  1IID A;  1KWM A;  4A31 A;  4ZI6 A;  3LWU A;  4C2Y A;  1CX8 A;  5EMI A;  2EO8 A;  2RC4 A;  2EVN A;  4CGP A;  3ISX A;  2Z3L A;  2PCU A;  5H86 A;  3BI1 A;  5HH1 A;  1NE9 A;  2Z0Z A;  2D4P A;  4TWE A;  3IU2 A;  1TF9 A;  2O4H A;  4P44 A;  3W6X A;  2A4N A;  2ZPA A;  5G21 A;  3D66 A;  4MRI A;  4ORF A;  3SI0 A;  1YLO A;  2YNC C;  1F2P A;  4PPZ A;  2ZW6 A;  2FVG A;  5AG5 A;  3FEE A;  4U9Z A;  4MMO A;  2CTB A;  3PBB A;  4KS9 A;  4CYP A;  3TTH A;  5EC4 A;  3F5B A;  2Q43 A;  2Q04 A;  1ON0 A;  4NJR A;  1JQG A;  2ZW5 A;  4P4E A;  3LOD A;  3C26 A;  4UIB A;  5ELY A;  4PSW A;  3DGV A;  5LYL A;  1UFH A;  3VWD A;  2GAN A;  2CNM A;  1MJA A;  3GYA A;  4X8I A;  4FWU A;  1OZP A;  3PZJ A;  5LYD A;  4F8Z A;  1Z8W A;  4OLL A;  2Q4Z A;  4M6G A;  4P4B A;  4R76 A;  4A94 A;  1QSR A;  3TO6 A;  3R96 A;  4KVM E;  3JVN A;  4CGL A;  4B10 A;  3B3C A;  3R9G A;  1CP7 A;  1X10 A;  5IV0 A;  4P4F A;  2F5I A;  3CXS A;  1Z2L A;  2C6P A;  2P6E A;  4P4D A;  1HDQ A;  4IHM A;  3KR5 A;  4B5P A;  5AG4 A;  2FXF A;  2AJ6 A;  1K4J A;  3P2H A;  4CAX A;  2VZZ A;  3D7F A;  2CXA A;  3PFO A;  1S5K A;  2OZG A;  1KZF A;  4MFP A;  4P6Y A;  2FIA A;  2C6C A;  3DLJ A;  2G3A A;  4GS4 A;  2P6G A;  2Q0Y A;  2J8N A;  3PEI A;  4U5Y A;  2AFM A;  3N5F A;  4A32 A;  2OZU A;  3NH8 A;  4Z65 A;  2X7B A;  1A2Z A;  2GRE A;  4KOU A;  3LD2 A;  3PB7 X;  5J1Q A;  2HV2 A;  3TCV A;  4LX9 A;  2R7H A;  2WYR A;  1LRZ A;  4RS2 A;  1S7N A;  5KTD A;  1M4D A;  2VXK A;  4KOT A;  1VHS A;  2BL1 A;  2JLM A;  2JDD A;  4KVO E;  2CTC A;  4KZT A;  5THW A;  2AFU A;  4F0X A;  1AYE A;  2ZEP A;  3IIB A;  4CGN A;  3B3T A;  4UFX A;  3KAS A;  2QIR A;  1XE4 A;  3IGR A;  3FYN A;  4FAI A;  4R9M A;  3G8W A;  2OR4 A;  4OAE A;  1NSL A;  3H8G A;  5K8N A;  4H6U A;  4LQ6 A;  4PXD A;  3WT4 A;  2BUE A;  2HUZ A;  2ANP A;  4P10 A;  1NMT A;  4C68 A;  1YVK A;  4AVC A;  1BO4 A;  1M4G A;  1ZG8 A;  4C2X A;  4C2Z A;  2CF4 A;  3E0K A;  2J9A A;  1I1D A;  2Q7S A;  2GLF A;  2PJ7 A;  2REE A;  1CPS A;  3H5Z A;  4NJQ A;  4XPD B;  5G20 A;  3VAR A;  3ZJ0 A;  4B5P B;  2QEC A;  4O23 A;  1HDU A;  2JEW A;  2C27 A;  2BCO A;  1M4L A;  2XEJ A;  3D7D A;  2B58 A;  2Z3M A;  3B35 A;  2B3U A;  4J3G A;  4KOY A;  4UEF A;  4ZX8 A;  4CRY B;  2G3T A;  1Z9U A;  1Q7L A;  5IB0 A;  5I4M A;  4UIA A;  4UCP A;  3GUX A;  3NFZ A;  3UY5 A;  2OZH A;  2WUU A;  3VWE A;  4ZY1 A;  3S6F A;  1Z5R A;  2B5G A;  2Q4V A;  4EVY A;  1GHE A;  4HKF A;  1XRY A;  2ODF A;  2WSA A;  2ZEG A;  4JWP A;  3RYO A;  2C6G A;  4IUS A;  1IOI A;  2K5T A;  3S9L A;  2DPS A;  1Y0Y A;  2JEV A;  1XFO A;  3SJE A;  4YFJ A;  2PDO A;  1IIC A;  2V8V A;  4FUU A;  4L89 A;  4OIW A;  2BOA A;  1QST A;  1XJO A;  4YU9 A;  1P4N A;  3TO9 A;  4CAE A;  2PE3 A;  4IAV A;  5G22 A;  4B14 A;  2V8H A;  2PJA A;  1YR0 A;  2VEZ A;  2PR8 A;  4H2K A;  1S7F A;  3ISZ A;  3KKW A;  2NYQ A;  1Y7E A;  4KLV A;  5ISV A;  4IK2 A;  5D8N A;  4QC6 A;  4A38 A;  1Q2D A;  4OID A;  5K8P A;  1QSN A;  1S7L A;  3IEH A;  2QVP A;  3IC1 A;  3V38 A;  1CG2 A;  3CZX A;  1Y7R A;  3FBU A;  2JDC A;  1CM0 A;  3BJ8 A;  1LAP A;  3GLJ A;  3N7Z A;  1BPM A;  3H4Q A;  1QSO A;  2Y0M A;  4GM5 A;  3TT2 A;  1F57 A;  4UFW A;  2EK9 A;  2PJ6 A;  3RAM A;  3A9L A;  2I3C A;  1XIX A;  5DS0 A;  4DUK A;  4NGT A;  4CAW A;  3T8W A;  1KUV A;  1R43 A;  1CBX A;  3DNS A;  3ZZI A;  2Q7B A;  2PVV A;  3EY5 A;  4CS0 B;  2VL1 A;  5CBM A;  3K9U A;  4U9Y A;  1BPN A;  4MFK A;  1MK4 A;  2F7V A;  3KQX A;  2ARH A;  5F09 A;  3F0A A;  2EBJ A;  2B5G B;  2OH1 A;  4UCM A;  4CAV A;  1YK3 A;  2Z3P A;  2CY2 A;  4NEX A;  2PVW A;  5GCN A;  1YW6 A;  1FT7 A;  2EUI A;  3FRM A;  3S9N A;  4OC3 A;  4B6Z A;  2F8H A;  1IU8 A;  4MCQ A;  2PJC A;  4Y49 B;  3KI9 A;  4JXQ A;  5HMN A;  4WJB A;  4R87 A;  3CPX A;  1S7K A;  4A37 A;  5C82 A;  4XPD C;  1LFW A;  4OKO A;  1BOB A;  1TXR A;  4DNC A;  3V8I A;  5G1Z A;  3CDX A;  5AGE A;  4UFV A;  3B3V A;  4QVT A;  1S60 A;  2NMT A;  4KSI A;  4R3L A;  1RO5 A;  1Y9K A;  2HC9 A;  4RUH A;  2P0W A;  4KOS A;  1M44 A;  4P4I A;  4KOV A;  2ZXV A;  3DR8 A;  4ZBG A;  3WC7 A;  4AVA A;  2G0B A; 
#chains in the Genus database with same CATH homology
 5KTC A;  2FL4 A;  2YNE A;  4Q36 A;  4MBU A;  2VQY A;  3D3S A;  3FIX A;  4BBH A;  1Z4R A;  2PRB A;  4E0A A;  2Q4Y A;  4QUS A;  2Z11 A;  4H6Z A;  2VI7 A;  2J8R A;  3I3G A;  1M4I A;  3S6H A;  4LUA A;  4Q38 A;  4XNH B;  3EC4 A;  1RXT A;  3BJ7 A;  5H84 A;  4JJX A;  4CYO A;  3GKR A;  4KOW A;  3TO7 A;  5C88 A;  2YND A;  4FD7 A;  4KUB A;  5F47 A;  3PP9 A;  4B5O A;  3WR7 A;  1YRE A;  5E96 A;  4QB9 A;  3SHP A;  2D4O A;  2OB0 A;  3F8K A;  2VBQ A;  3D8P A;  4MFL A;  1IB1 E;  2PC1 A;  4JD6 A;  1MJB A;  4ONU A;  2FSR A;  2P6F A;  4CRZ B;  1N71 A;  4L8A A;  3R9E A;  1Q2Y A;  4MY3 A;  1XEB A;  4C7I A;  4JLY A;  2PSW A;  4MFQ A;  3IWE A;  2FIW A;  4MHD A;  3EFA A;  3R9F A;  3FNC A;  1S3Z A;  4PSX A;  2DXQ A;  4R3K A;  4UCN A;  4KSA A;  5J8F A;  5IX3 A;  2B4D A;  2YGW A;  4CGO A;  2B3V A;  3GY9 A;  2GE3 A;  4BMH A;  4II9 A;  5F48 A;  3T90 A;  2Z3N A;  4AG7 A;  1PUA A;  5A28 A;  4HNY B;  3TOB A;  4CYQ A;  4QBJ A;  5F49 A;  3R1K A;  2Z10 A;  4HNX B;  3IWG A;  4MJ8 A;  2HQY A;  1B6B A;  4FD5 A;  4AB7 A;  4AG9 A;  2WPX A;  5BWA B;  3B8G A;  4E8O A;  5AG6 A;  4UWI A;  4A33 A;  4KVX A;  2AE6 A;  3DDD A;  2R1I A;  4M85 A;  3G3S A;  3TOA A;  1R57 A;  4YRH A;  1MJ9 A;  2B4B A;  4I49 A;  5JQ4 A;  4KOR A;  3BLN A;  1IYL A;  3JTK A;  2B4D B;  2CNT A;  1KUX A;  1KUY A;  2FT0 A;  1IYK A;  3CXQ A;  4AVB A;  2H5M A;  1U6M A;  4B12 A;  4E2A A;  2DPT A;  1ZO0 A;  2YNC A;  2Q44 A;  3OWC A;  4KSF A;  3T9Y A;  3QAH A;  3TE4 A;  3MGD A;  1YLE A;  1I21 A;  1J4J A;  5KTA A;  4CGM A;  4R57 A;  3SXN A;  1P0H A;  4MI4 A;  4MY0 A;  4B11 A;  1WWZ A;  3D2M A;  1FY7 A;  5I0C A;  2PQ8 A;  1Y9W A;  2Z3O A;  1L0C A;  4NSQ A;  2ZW7 A;  2REF A;  2CNS A;  3R95 A;  4NXY A;  2WPW A;  1V0C A;  3S6K A;  5A27 A;  2GIV A;  1QSM A;  2FS5 A;  5FVJ A;  2BSW A;  2O28 A;  2BEI A;  1WK4 A;  1YVO A;  4PV6 A;  3FXT A;  3JUW A;  4XPL A;  4CYN A;  5JPH A;  3TFY A;  2ATR A;  3IU1 A;  1CJW A;  3DR6 A;  4IF5 A;  2R8V A;  4H89 A;  4RI1 A;  4PK2 A;  4NF1 A;  4MFZ A;  2PR1 A;  3QB8 A;  4YGO A;  4M3S A;  2IL4 A;  2R98 A;  4X5K A;  4A95 A;  4XPK A;  1XMT A;  1YGH A;  4KOX A;  3W6S A;  4Y49 C;  2OU2 A;  4A30 A;  4KLW A;  3S6G A;  3EXN A;  4OAD A;  3DSB A;  1SQH A;  1Z4E A;  2ZW4 A;  1Q2C A;  5AG7 A;  1M1D A;  3I9S A;  2VZY A;  2QML A;  5DWM A;  4A2Z A;  1TIQ A;  3D2P A;  5CNP A;  2J8M A;  3NE7 A;  3PGP A;  1VKC A;  4PK3 A;  4UBR A;  2FE7 A;  4ZGY B;  3SXO A;  4UA3 A;  3EO4 A;  3FB3 A;  4NCZ A;  4K30 A;  5DWN A;  3P2F A;  2KCW A;  4HNW B;  1XF8 A;  5EBV A;  4UWJ A;  1B87 A;  5J8C A;  5F46 A;  4CAF A;  4B13 A;  1PU9 A;  4FD4 A;  4F0Y A;  2I00 A;  2Z3K A;  4F6A A;  1YX0 A;  3CXP A;  4FD6 A;  4MFJ A;  4XNH C;  3W91 A;  4JXR A;  4C7H A;  4KUA A;  1I12 A;  2I79 A;  2FCK A;  1IID A;  4A31 A;  4C2Y A;  2RC4 A;  2EVN A;  4CGP A;  2Z3L A;  5H86 A;  5HH1 A;  1NE9 A;  2Z0Z A;  2D4P A;  3IU2 A;  3W6X A;  2A4N A;  2ZPA A;  5G21 A;  4ORF A;  2YNC C;  5AG5 A;  2ZW6 A;  4U9Z A;  4KS9 A;  4CYP A;  3TTH A;  5EC4 A;  3F5B A;  2Q04 A;  1ON0 A;  2ZW5 A;  3LOD A;  3C26 A;  4PSW A;  1UFH A;  3VWD A;  2GAN A;  2CNM A;  1MJA A;  3GYA A;  1OZP A;  3PZJ A;  4OLL A;  1QSR A;  3TO6 A;  3R96 A;  4KVM E;  3JVN A;  4CGL A;  4B10 A;  3R9G A;  5IV0 A;  2F5I A;  3CXS A;  2P6E A;  5AG4 A;  4B5P A;  2FXF A;  2AJ6 A;  1K4J A;  3P2H A;  4CAX A;  2VZZ A;  2CXA A;  1S5K A;  2OZG A;  1KZF A;  4MFP A;  2FIA A;  2G3A A;  4GS4 A;  2P6G A;  2Q0Y A;  2J8N A;  4U5Y A;  4A32 A;  2OZU A;  2X7B A;  4KOU A;  3LD2 A;  2HV2 A;  3TCV A;  4LX9 A;  2R7H A;  1LRZ A;  4RS2 A;  1S7N A;  5KTD A;  1M4D A;  2VXK A;  4KOT A;  1VHS A;  2BL1 A;  2JLM A;  2JDD A;  4KVO E;  4F0X A;  4KZT A;  4CGN A;  4UFX A;  2QIR A;  1XE4 A;  3IGR A;  3FYN A;  4R9M A;  3G8W A;  4OAE A;  1NSL A;  4H6U A;  2BUE A;  2HUZ A;  1NMT A;  4C68 A;  1YVK A;  4AVC A;  1BO4 A;  1M4G A;  4C2X A;  4C2Z A;  3E0K A;  1I1D A;  2REE A;  3H5Z A;  4XPD B;  5G20 A;  3ZJ0 A;  4B5P B;  2QEC A;  2C27 A;  2B58 A;  2Z3M A;  4CRY B;  2B3U A;  4J3G A;  4KOY A;  2G3T A;  1Z9U A;  4UCP A;  3UY5 A;  2OZH A;  2WUU A;  3VWE A;  3S6F A;  2B5G A;  2Q4V A;  4EVY A;  1GHE A;  4HKF A;  2WSA A;  4JWP A;  3RYO A;  4IUS A;  2K5T A;  2DPS A;  2JEV A;  4YFJ A;  2PDO A;  1IIC A;  4L89 A;  3TO9 A;  1QST A;  1P4N A;  4CAE A;  5G22 A;  4B14 A;  5IB0 A;  1YR0 A;  2VEZ A;  2PR8 A;  1S7F A;  3KKW A;  4KLV A;  5ISV A;  4QC6 A;  1Q2D A;  1QSN A;  1S7L A;  1Y7R A;  3FBU A;  2JDC A;  1CM0 A;  3BJ8 A;  3N7Z A;  3H4Q A;  1QSO A;  2Y0M A;  3TT2 A;  4UFW A;  3A9L A;  1XIX A;  4CAW A;  1KUV A;  3ZZI A;  3DNS A;  2Q7B A;  3EY5 A;  4CS0 B;  3K9U A;  4U9Y A;  4MFK A;  1MK4 A;  2ARH A;  3F0A A;  2B5G B;  2OH1 A;  4UCM A;  4CAV A;  1YK3 A;  2Z3P A;  2CY2 A;  4NEX A;  5GCN A;  2EUI A;  3FRM A;  4Y49 B;  4JXQ A;  5HMN A;  4R87 A;  1S7K A;  5C82 A;  4XPD C;  1BOB A;  4DNC A;  3V8I A;  5G1Z A;  5AGE A;  4UFV A;  4QVT A;  1S60 A;  2NMT A;  4R3L A;  1RO5 A;  1Y9K A;  2P0W A;  4KOS A;  1M44 A;  4KOV A;  2ZXV A;  3DR8 A;  4ZBG A;  4AVA A;  2G0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...