1KUVA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serotonin N-acetyltransferase
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuvA00
2P0WA 3W91A 2K5TA 1B87A 1KUXA 3PP9A 4JXQA 1MJBA 3F0AA 2B4BA 2B58A 2HV2A 2PRBA 3R9EA 4CRZB 2R1IA 2BL1A 4Y49B 1QSOA 1Q2DA 2GIVA 4R9MA 2EUIA 1FY7A 5J8CA 1XIXA 1WWZA 3ZZIA 1YREA 1M4DA 4PSXA 3PGPA 4HKFA 4XPKA 4RI1A 1XEBA 3TCVA 4KOUA 2PDOA 1M1DA 3QAHA 2IL4A 3CXPA 1Y9KA 4MJ8A 3UY5A 1CM0A 5DWMA 4NCZA 3CXQA 2KCWA 2B4DA 2J8MA 2B4DB 4NF1A 4H6UA 4Y49C 2DXQA 2D4OA 2FXFA 2I00A 1S7NA 1Z4RA 2X7BA 4MY0A 3TFYA 2OB0A 5H84A 3CXSA 3EC4A 3VWDA 5KTCA 4ZBGA 1YR0A 2PQ8A 5JQ4A 3SHPA 1QSMA 4M3SA 1M4GA 4BMHA 2QECA 1P0HA 2ZW7A 4QVTA 2CY2A 5EC4A 1MK4A 5F47A 4DNCA 2PR1A 2CNMA 1K4JA 4JJXA 4CAXA 4L8AA 4R3LA 2FE7A 2VQYA 3FYNA 2CNTA 2B5GA 2B5GB 4FD4A 5C88A 3BJ8A 5KTDA 1KUYA 4OAEA 1NSLA 4MHDA 1IYLA 2BEIA 4F0YA 3P2FA 4KUAA 3N7ZA 4JWPA 4GS4A 3DR8A 2Q4YA 1YGHA 1BOBA 1M4IA 1SQHA 4H6ZA 3SXNA 1I12A 5H86A 3R9FA 1QSNA 1GHEA 4X5KA 4KZTA 1YX0A 5C82A 5KTAA 2P6EA 3EFAA 3FNCA 4KOXA 1P4NA 4YRHA 4PK3A 4KUBA 3BJ7A 4XPDB 4NXYA 2Q04A 4E8OA 1IIDA 2PC1A 2Q0YA 2B3UA 2WPXA 2JEVA 1S7KA 4XNHB 1U6MA 1S7FA 2HUZA 3TO9A 4II9A 3S6GA 3R9GA 1NE9A 2REFA 2OZHA 4FD5A 2Q7BA 2OH1A 2I79A 5ISVA 2Q44A 1IYKA 5F49A 2Z11A 1BO4A 4LX9A 1MJ9A 4QBJA 5CNPA 4XPLA 1V0CA 4XPDC 4PSWA 3NE7A 3T90A 4IF5A 5FVJA 5I0CA 5IB0A 4U5YA 1I1DA 4KORA 1IB1E 4XNHC 1MJAA 2R98A 2ZPAA 3FBUA 1J4JA 4AVBA 4NSQA 3TOAA 3BLNA 4YFJA 1IICA 3B8GA 3GY9A 4AB7A 3GYAA 3EXNA 5EBVA 3P2HA 3DR6A 2VZZA 3TO7A 4JLYA 4KOVA 4NEXA 1S5KA 4ORFA 1M44A 4UBRA 1QSRA 1QSTA 3D2PA 4UWIA 3D2MA 3I9SA 1WK4A 4M85A 2AJ6A 3F8KA 2R8VA 3H4QA 2FCKA 4U9YA 2RC4A 3JUWA 1Y9WA 4CRYB 4E2AA 2ZW4A 1TIQA 4AG7A 2JDCA 4CAVA 2NMTA 4EVYA 3FB3A 2H5MA 2WPWA 3GKRA 2ZW5A 3G3SA 1XMTA 2CNSA 4KOSA 3RYOA 3W6SA 1Z9UA 1XE4A 4K30A 5IX3A 2ZW6A 4F6AA 4MBUA 3IWGA 4CS0B 1S60A 1CJWA 4QC6A 4HNWB 2FIWA 3EO4A 2Z10A 3TOBA 4AVAA 1RO5A 2VZYA 4KVOE 3S6KA 2BSWA 3JVNA 3F5BA 3C26A 5JPHA 2A4NA 4ONUA 2ZXVA 2PSWA 4AVCA 3DNSA 2Z0ZA 3LODA 2J8NA 4U9ZA 2G0BA 3D8PA 3DDDA 4KVME 1B6BA 3FRMA 2FS5A 4HNXB 2G3AA 3R96A 1YVOA 3R1KA 3E0KA 3EY5A 1N71A 2VBQA 4MY3A 5HH1A 3S6HA 5GCNA 1Q2YA 5IV0A 2O28A 4IUSA 4L89A 4I49A 1RXTA 2FT0A 3PZJA 4YGOA 4H89A 1KZFA 2Y0MA 3OWCA 4KOYA 4UA3A 4B5PA 2FSRA 4B5PB 1PUAA 2JDDA 1R57A 1S7LA 2GANA 3TO6A 5E96A 2EVNA 3SXOA 3VWEA 3D3SA 3K9UA 3S6FA 2JLMA 1YK3A 4PV6A 1YLEA 1YVKA 3I3GA 3TT2A 4KOWA 2VI7A 1I21A 3IGRA 2HQYA 2QMLA 1UFHA 3G8WA 2P6GA 3W6XA 4R87A 1NMTA 1PU9A 4QUSA 1OZPA 4FD7A 2B3VA 2OZGA 1L0CA 1VHSA 5F46A 4KLVA 4R57A 3FXTA 2ARHA 1ON0A 2PR8A 2REEA 4R3KA 2FL4A 1LRZA 2GE3A 4QB9A 3DSBA 1VKCA 5J8FA 2OZUA 4MI4A 2D4PA 3TTHA 5DWNA 2R7HA 4OLLA 4AG9A 3ZJ0A 4FD6A 4OADA 1Y7RA 3QB8A 3WR7A 3TE4A 2Q4VA 2J8RA 4E0AA 4JD6A 1XF8A 1Q2CA 2QIRA 2VXKA 3KKWA 4LUAA 4JXRA 2ATRA 4J3GA 3R95A 1KUVA 2AE6A 4HNYB 5HMNA 3T9YA 5F48A 4B5OA 4CAWA 2OU2A 3V8IA 1Z4EA 2G3TA 2P6FA 4UWJA 2C27A 4KVXA 2BUEA 2VEZA 4RS2A 4KLWA 2F5IA 3MGDA 2FIAA 4PK2A 3FIXA 3LD2A 1S3ZA 4KOTA
chains in the Genus database with same CATH superfamily
2P0WA 3W91A 2K5TA 1B87A 1KUXA 3PP9A 4LQ6A 4JXQA 1MJBA 2C6CA 3F0AA 2B4BA 4Q7AA 2GLJA 2B58A 4LQGA 2HV2A 2PRBA 3R9EA 4CRZB 2AFUA 2R1IA 2WUUA 1ELMP 3SI0A 2BL1A 4Y49B 1QSOA 1AUGA 4A38A 1Q2DA 1BPMA 2GIVA 2PRQA 4A94A 1YMEA 4R9MA 3N5FA 4PXCA 2XEJA 2EUIA 2NSMA 1FY7A 1KWMA 1Z8LA 5J8CA 1XIXA 1WWZA 2ZEEA 4NJRA 3KL9A 3ZZIA 3WT4A 1YREA 1M4DA 4PSXA 3D4UA 4FWUA 1HDQA 1H8LA 3PGPA 4HKFA 2Z3NA 1A2ZA 3KZWA 2XEGA 3PB8X 3CT9A 2ANPA 4RI1A 4XPKA 1XEBA 3TCVA 4JZ0A 5LRJA 1LFWA 5G20A 3B3SA 2PVVA 3FJUA 3FECA 1TF8A 4KOUA 2PDOA 1M1DA 3QAHA 1X10A 2IL4A 3CXPA 1Y9KA 4MJ8A 3UY5A 1CM0A 4R3KA 5DWMA 4NCZA 2ZEMA 2PIZA 3VATA 1F2PA 3CXQA 2V8GA 4C2XA 2KCWA 1UWYA 2C6PA 5AGEA 2B4DA 2J8MA 2B4DB 4NF1A 2VL1A 4H6UA 2DXQA 4MCPA 4PXBA 4Y49C 4ZX9A 4F9VA 2D4OA 2FXFA 2I00A 2PCUA 4MHYA 1S7NA 1TF9A 4YFJA 1VIXA 4ZI6A 1Z4RA 5JH9A 2X7BA 4MY0A 4UFWA 3TFYA 1VHOA 1FT7A 2OB0A 2QVPA 2CTBA 5H84A 5CBMA 1Z5RA 3CXSA 2F7VA 2ZOFA 3KR5A 3EC4A 1X12A 2Z3KA 3ISXA 3VWDA 5KTCA 4ZBGA 1TKHA 1TXRA 1YR0A 2AFZA 2PQ8A 2ZEFA 5JQ4A 5AG5A 3SHPA 2ZELA 1CP7A 1QSMA 3H8EA 4MFLA 3GLJA 4ZYQA 4M3SA 4A31A 1M4GA 4BMHA 1NSAA 3H8GA 4OC3A 2QECA 3KR4A 5A28A 1P0HA 2ZW7A 4QVTA 4YU9A 2CY2A 3K9TA 4FUUA 4O23A 3S9LA 5EC4A 1MK4A 1LAMA 5F47A 2BO9A 4DNCA 4K3NA 4C7HA 4C68A 2QJ8A 1XBUA 3MN8A 2PR1A 2CNMA 4EFDA 4CAEA 1K4JA 4JJXA 5LRGA 3SI2A 3H8FA 4CAXA 2Q4ZA 3HUVA 4L8AA 3JRUA 2FE7A 4NJQA 4R3LA 2JEWA 5THWA 2VQYA 2WYRA 4PQAA 5IB9A 4GM5A 3FYNA 2CNTA 2B5GA 4OC2A 4CAFA 2B5GB 4FD4A 5C88A 1QMUA 2NYQA 2PJBA 2PJ0A 3QNVA 4CGPA 3BJ8A 5KTDA 1KUYA 3SJEA 4OAEA 1NSLA 4MHDA 5LYFA 1IYLA 2BEIA 2ZEHA 3KGQA 4F0YA 3P2FA 2AFXA 3LWUA 3D7DA 4KUAA 2EWBA 3N7ZA 4MHPA 5G1ZA 3FX6A 2YNDA 2CIJA 4JWPA 1IU8A 4GS4A 3DR8A 4H2KA 2Q4YA 4Q38A 2YNEA 2JBJA 5D8NA 5AG7A 2BCOA 1YGHA 1BOBA 1M4IA 1SQHA 4UCNA 4H6ZA 2ODFA 3SXNA 1I12A 5H86A 1ZLHA 2Z3MA 3R9FA 2YGWA 3IWEA 1QSNA 3T8WA 1JWQA 4BD9A 1PYTB 1GHEA 3B3VA 1LOKA 4P4FA 4KZTA 4X5KA 1YX0A 1YQEA 5C82A 5KTAA 2P6EA 4R8FA 3EFAA 3FNCA 4RUHA 4KOXA 1P4NA 4YRHA 4PK3A 4NGSA 2AFWA 1ZG9A 4P44A 1GYTA 3IFEA 4KUBA 4TNUA 3BJ7A 4XPDB 4NXYA 2Q04A 2Q43A 4E8OA 4KS9A 1IIDA 2PC1A 2DF5A 2Q0YA 4DJLA 5CPAA 5D29A 3D67A 2B3UA 2WPXA 2ZENA 3PEIA 3TC8A 5K8PA 2JEVA 1S7KA 3WC7A 8CPAA 4XNHB 1U6MA 1S7FA 1YW6A 2HUZA 3GIUA 4MRIA 3TO9A 4II9A 3S6GA 1Y7EA 3RBUA 2JBKA 1NE9A 3R9GA 2REFA 3D66A 2OZHA 4FD5A 1BPNA 2Q7BA 2OH1A 4A32A 2I79A 4OC5A 4B10A 3S9NA 2OOTA 4NGNA 5ISVA 2Q44A 4KSIA 4M6HA 1LANA 4P10A 5BWAB 1IYKA 1IGBA 5F49A 3RNZA 2Z11A 1BO4A 2ZEDA 3PBBA 4LX9A 4ZX8A 4DUKA 4NGTA 4M6IA 4NFRA 1MJ9A 3NH8A 3D7HA 4YWYA 5CNPA 4QBJA 2IQ6A 4XPLA 2ZOGA 1V0CA 3BXMA 4PSWA 4XPDC 3NE7A 4EMEA 3IO1A 4MFPA 3T90A 3IU1A 4IF5A 5FVJA 5I0CA 5IB0A 4U5YA 2OR4A 1I1DA 3IC1A 4KORA 4CGMA 1IB1E 4XNHC 4IAVA 1MJAA 3V38A 2XEFA 5HVHA 2R98A 4P4IA 1VGYA 4UCMA 4A33A 1ELLP 5HVGA 2ZPAA 3FBUA 4R76A 1J4JA 1OBRA 3B2YA 2BOAA 4AVBA 1XOVA 4NSQA 3TOAA 2QYVA 3BLNA 3FEDA 4B13A 4CPAA 1IICA 2WZNA 3B8GA 3GY9A 4MHZA 4B6ZA 4AB7A 3GYAA 3EXNA 1VHEA 4IHMA 5EBVA 3P2HA 3DR6A 2VZZA 2PJ8A 3TO7A 2PE3A 2EK8A 3SI1A 4JLYA 4KOVA 3V7ZA 1ZO0A 2ZEPA 1R43A 4MFJA 4NEXA 4Z65A 4GXHA 5A27A 1S5KA 4IK2A 4ORFA 3VARA 1M44A 4UBRA 1QSRA 1QSTA 1YSJA 3D2PA 1AYEA 4UWIA 1XJOA 3D2MA 3I9SA 1FNOA 1WK4A 5DS0A 2O4HA 4G1PA 3KI9A 1HEEA 1QQ9A 3BHXA 2G9DA 1ARMA 3PBEA 2YNCA 5I4MA 3LACA 4M85A 3KQXA 2AJ6A 2V8VA 3F8KA 4P4JA 4OC4A 2R8VA 3H4QA 4A95A 1Y0YA 2FCKA 4U9YA 2RC4A 1M4LA 3JUWA 5HVFA 1Y9WA 4MCQA 4CRYB 4P45A 4E2AA 2C6GA 2ZW4A 5K8NA 3DLJA 1TIQA 1Q7LA 4C2ZA 3RO0A 4AG7A 2JDCA 4RN7A 2POKA 4CAVA 2NMTA 4EVYA 4AXVA 3FB3A 3I1UA 5LYDA 2PJ3A 2PVWA 3VH9A 2HB6A 2H5MA 2WSAA 3B3CA 4UEZA 4HPSA 5EMIA 2WPWA 3GKRA 4A37A 2PJ7A 4OC0A 5AG6A 5LYLA 2AFMA 1RTQA 3RAMA 4UEFA 4WWVA 1XFOA 2ZEGA 3WC5A 2ZW5A 3G3SA 4JYWA 1Z8XA 1XMTA 2CNSA 4KOSA 4P6YA 3RYOA 3W6SA 1Z9UA 1XE4A 4Q36A 4X8IA 4K30A 5IX3A 3BI0A 2YNCC 2IJZA 5G21A 4A39A 2ZW6A 2AFOA 3KHXA 3B3WA 4CGLA 4ZY0A 4OC1A 4PXDA 3WABA 4MBUA 4F6AA 3D68A 7CPAA 3IWGA 4CS0B 1S60A 1CJWA 1CP6A 4HNWB 4QC6A 1IOIA 2Q51A 2FIWA 3PB4X 2F8HA 3NH4A 3D7GA 2DPSA 3EO4A 1YLOA 2Z10A 3TOBA 4CYNA 4A2ZA 4AVAA 4M6GA 3SJGA 1YW4A 1XMBA 1TKJA 1RO5A 3NFZA 5G22A 3PFEA 3CPAA 4NGRA 2VZYA 4KVOE 3S6KA 2BSWA 2V8DA 2Z3LA 3PFOA 3JVNA 3F5BA 3C26A 5JPHA 2A4NA 3B35A 4ONUA 2ZXVA 2PSWA 4TWEA 4AVCA 1CBXA 2Z0ZA 3DNSA 3JTKA 3LODA 2J8NA 4U9ZA 2G0BA 2RB7A 4ONWA 4EWTA 2GU2A 3D7FA 3D8PA 3DDDA 3KASA 4KVME 1B6BA 2C1CA 3FRMA 2FS5A 4HNXB 2G3AA 4ZY1A 5JGFA 3R96A 3GB0A 1YVOA 3R1KA 2EBJA 3E0KA 3IEHA 4B11A 3IJ3A 1XRYA 4NGMA 3A9LA 2EK9A 3EY5A 3FF3A 3WC6A 1N71A 2CXAA 3BI1A 4MMOA 4CYOA 4MFKA 1CPSA 2VBQA 3NE8A 1LCPA 4MY3A 3B3TA 5HH1A 3S6HA 3IIBA 5GCNA 1Q2YA 5ELYA 5IV0A 2O28A 1IOFA 4IUSA 4I49A 4L89A 4R7MA 1RXTA 2FT0A 5LRKA 4PPZA 3PB7X 4P4BA 2PJ4A 3PZJA 4FBEA 1Z8WA 4YGOA 4H89A 1KZFA 4UFVA 2Y0MA 3OWCA 4KOYA 2Z3PA 4UA3A 3S9MA 4B5PA 2PIYA 2FSRA 2RFHA 4B5PB 1PUAA 4B12A 1CX8A 2JDDA 4CGNA 1R57A 1S7LA 2GANA 5LYIA 3TO6A 5E96A 4C7IA 4X2TA 2EVNA 3SXOA 3VWEA 2PJ9A 3QAYA 4A30A 3D3SA 3K9UA 3S6FA 1ZG7A 2JLMA 1YK3A 3ISZA 1AMPA 4PV6A 3RZAA 1CG2A 3IWWA 2PJ5A 1YLEA 1YVKA 5AG4A 3I3GA 3TT2A 3NA6A 4MFZA 5F09A 4KOWA 1ZG8A 4OIWA 4OKOA 4BBHA 2VI7A 1I21A 4CGOA 2DEAA 4NGQA 4MFQA 4MHNA 3IGRA 2HQYA 2QMLA 3PB9X 1UFHA 4OP4A 3G8WA 2P6GA 3W6XA 4R87A 4C2YA 1NMTA 1PU9A 3H5ZA 1OZPA 3PRTA 3CDXA 4QUSA 4FD7A 2B3VA 2OZGA 2FVGA 1L0CA 1EE3P 1VHSA 3CZXA 2PJ6A 3L2NA 4KLVA 5F46A 2EO8A 4R57A 3FXTA 1TKFA 4CYQA 2PJ2A 4CYPA 2ARHA 1Y0RA 2Q7SA 1ON0A 3LMSA 2PR8A 2REEA 1BLLE 1DE4C 1LRZA 2AFSA 2FL4A 2GE3A 1Z2LA 2V8HA 3KQZA 3NH5A 2ABZA 3DSBA 1F2OA 4QB9A 2J9AA 5K8MA 1VKCA 4PXEA 5J8FA 3IU2A 2OZUA 4MI4A 2CF4A 2D4PA 3TTHA 1R3NA 2IMOA 4W9YA 2PJAA 4OMEA 1ARLA 1JQGA 4NGPA 5DWNA 2R7HA 4OLLA 4DYOA 4AG9A 3ZJ0A 4FD6A 3KHZA 4KSFA 4OADA 1BAVA 2DPTA 3GUXA 1Y7RA 3HLPA 1Z8TA 3QB8A 3SJFA 3WR7A 3TE4A 2Q4VA 5HXDA 2J8RA 4MCRA 4E0AA 3FEEA 4UEEA 4JD6A 1XF8A 6CPAA 1Q2CA 2PJCA 1F57A 2QIRA 2VXKA 4B14A 3KKWA 2O53A 4LUAA 4KSAA 4JXRA 4OIDA 4P4EA 2ATRA 4J3GA 3K2KA 4UIBA 3R95A 2GREA 2PJ1A 2Z3OA 3SJXA 1KUVA 2AE6A 4HNYB 4P4DA 3T9YA 5F48A 4WJBA 5HMNA 2HC9A 4UF4A 4B5OA 4F0XA 1HDUA 2CTCA 4CAWA 2OU2A 3V8IA 4X3RA 1Z4EA 1DTDA 3FH4A 2G3TA 4F9UA 2GFQA 2P6FA 3FVLA 5K8OA 1LAPA 1ZLIA 4UWJA 2C27A 2XEIA 3DGVA 4KVXA 4MXUA 4F8ZA 3FMCA 1CPXA 2BUEA 4FAIA 1PCAA 2VEZA 5JM6A 3MRUA 4RS2A 2I3CA 4KLWA 4UCPA 2ZEOA 2F5IA 3TX8A 3MGDA 2FIAA 4PK2A 5J1QA 4ZGYB 2V77A 4UFXA 3B7IA 4BINA 2GLFA 3FIXA 4MCSA 4ZY2A 3CPXA 3PB6X 3LD2A 1S3ZA 1IY7A 4UIAA 4KOTA 4R6TA
chains in the Genus database with same CATH topology
2P0WA 3W91A 2K5TA 1B87A 1KUXA 3PP9A 4JXQA 1MJBA 3F0AA 2B4BA 2B58A 2HV2A 2PRBA 3R9EA 4CRZB 2R1IA 2WUUA 2BL1A 4Y49B 1QSOA 1Q2DA 2GIVA 4R9MA 2EUIA 1FY7A 5J8CA 1XIXA 1WWZA 3ZZIA 1YREA 1M4DA 4PSXA 3PGPA 4HKFA 2Z3NA 4XPKA 4RI1A 1XEBA 3TCVA 5G20A 4KOUA 2PDOA 1M1DA 3QAHA 2IL4A 3CXPA 1Y9KA 4MJ8A 3UY5A 1CM0A 5DWMA 4NCZA 3CXQA 4C2XA 2KCWA 5AGEA 2B4DA 2J8MA 2B4DB 4NF1A 4H6UA 4Y49C 2DXQA 2D4OA 2FXFA 2I00A 1S7NA 1Z4RA 2X7BA 4MY0A 4UFWA 3TFYA 2OB0A 5H84A 3CXSA 3EC4A 2Z3KA 3VWDA 5KTCA 4ZBGA 1YR0A 2PQ8A 5JQ4A 5AG5A 3SHPA 1QSMA 4MFLA 4M3SA 4A31A 1M4GA 4BMHA 2QECA 5A28A 1P0HA 2ZW7A 4QVTA 2CY2A 5EC4A 1MK4A 5F47A 4DNCA 4C7HA 4C68A 2PR1A 2CNMA 4CAEA 1K4JA 4JJXA 4CAXA 4L8AA 4R3LA 2FE7A 2VQYA 3FYNA 2CNTA 2B5GA 4CAFA 2B5GB 4FD4A 5C88A 4CGPA 3BJ8A 5KTDA 1KUYA 4OAEA 1NSLA 4MHDA 1IYLA 2BEIA 4F0YA 3P2FA 4KUAA 3N7ZA 5G1ZA 2YNDA 4JWPA 4GS4A 3DR8A 2Q4YA 4Q38A 2YNEA 5AG7A 1YGHA 1BOBA 1M4IA 1SQHA 4UCNA 4H6ZA 3SXNA 1I12A 5H86A 2Z3MA 3R9FA 2YGWA 3IWEA 1QSNA 1GHEA 4X5KA 4KZTA 1YX0A 5C82A 5KTAA 2P6EA 3EFAA 3FNCA 4KOXA 1P4NA 4YRHA 4PK3A 4KUBA 3BJ7A 4XPDB 4NXYA 2Q04A 4E8OA 4KS9A 1IIDA 2PC1A 2Q0YA 2B3UA 2WPXA 2JEVA 1S7KA 4XNHB 1U6MA 1S7FA 2HUZA 3TO9A 4II9A 3S6GA 3R9GA 1NE9A 2REFA 2OZHA 4FD5A 2Q7BA 2OH1A 4A32A 2I79A 4B10A 5ISVA 2Q44A 5BWAB 1IYKA 5F49A 2Z11A 1BO4A 4LX9A 1MJ9A 4QBJA 5CNPA 4XPLA 1V0CA 4XPDC 4PSWA 3NE7A 4MFPA 3T90A 3IU1A 4IF5A 5FVJA 5I0CA 5IB0A 4U5YA 1I1DA 4KORA 4CGMA 1IB1E 4XNHC 1MJAA 2R98A 4A33A 4UCMA 2ZPAA 3FBUA 1J4JA 4AVBA 4NSQA 3TOAA 3BLNA 4YFJA 4B13A 1IICA 3B8GA 3GY9A 4AB7A 3GYAA 3EXNA 5EBVA 3P2HA 3DR6A 2VZZA 3TO7A 4JLYA 4KOVA 1ZO0A 4MFJA 4NEXA 5A27A 1S5KA 4ORFA 1M44A 4UBRA 1QSRA 1QSTA 3D2PA 4UWIA 3D2MA 3I9SA 1WK4A 2YNCA 4M85A 2AJ6A 3F8KA 2R8VA 3H4QA 4A95A 2FCKA 4U9YA 2RC4A 3JUWA 1Y9WA 4CRYB 4E2AA 2ZW4A 1TIQA 4C2ZA 4AG7A 2JDCA 4CAVA 2NMTA 4EVYA 3FB3A 2H5MA 2WSAA 2WPWA 3GKRA 5AG6A 2ZW5A 3G3SA 1XMTA 2CNSA 4KOSA 3RYOA 3W6SA 1Z9UA 1XE4A 4Q36A 4K30A 5IX3A 2YNCC 5G21A 2ZW6A 4CGLA 4F6AA 4MBUA 3IWGA 4CS0B 1S60A 1CJWA 4QC6A 4HNWB 2FIWA 2DPSA 3EO4A 2Z10A 3TOBA 4CYNA 4A2ZA 4AVAA 1RO5A 5G22A 2VZYA 4KVOE 3S6KA 2BSWA 2Z3LA 3JVNA 3F5BA 3C26A 5JPHA 2A4NA 4ONUA 2ZXVA 2PSWA 4AVCA 3DNSA 2Z0ZA 3JTKA 3LODA 2J8NA 4U9ZA 2G0BA 3D8PA 3DDDA 4KVME 1B6BA 3FRMA 2FS5A 4HNXB 2G3AA 3R96A 1YVOA 3R1KA 3E0KA 4B11A 3A9LA 3EY5A 1N71A 2CXAA 4CYOA 4MFKA 2VBQA 4MY3A 5HH1A 3S6HA 5GCNA 1Q2YA 5IV0A 2O28A 4IUSA 4L89A 4I49A 1RXTA 2FT0A 3PZJA 4YGOA 4H89A 1KZFA 4UFVA 2Y0MA 3OWCA 4KOYA 2Z3PA 4UA3A 4B5PA 2FSRA 4B5PB 1PUAA 4B12A 2JDDA 4CGNA 1R57A 1S7LA 2GANA 3TO6A 5E96A 4C7IA 2EVNA 3SXOA 3VWEA 4A30A 3D3SA 3K9UA 3S6FA 2JLMA 1YK3A 4PV6A 1YLEA 1YVKA 5AG4A 3I3GA 3TT2A 4MFZA 4KOWA 4BBHA 2VI7A 1I21A 4CGOA 4MFQA 3IGRA 2HQYA 2QMLA 1UFHA 3G8WA 2P6GA 3W6XA 4R87A 4C2YA 1NMTA 1PU9A 3H5ZA 1OZPA 4QUSA 4FD7A 2B3VA 2OZGA 1L0CA 1VHSA 5F46A 4KLVA 4R57A 3FXTA 4CYQA 4CYPA 2ARHA 1ON0A 2PR8A 2REEA 4R3KA 2FL4A 1LRZA 2GE3A 4QB9A 3DSBA 1VKCA 5J8FA 3IU2A 2OZUA 4MI4A 2D4PA 3TTHA 5DWNA 2R7HA 4OLLA 4AG9A 3ZJ0A 4FD6A 4KSFA 4OADA 2DPTA 1Y7RA 3QB8A 3WR7A 3TE4A 2Q4VA 2J8RA 4E0AA 4JD6A 1XF8A 1Q2CA 4B14A 2QIRA 2VXKA 3KKWA 4LUAA 4KSAA 4JXRA 2ATRA 4J3GA 3R95A 2Z3OA 1KUVA 2AE6A 4HNYB 5HMNA 3T9YA 5F48A 4B5OA 4F0XA 4CAWA 2OU2A 3V8IA 1Z4EA 2G3TA 2P6FA 4UWJA 2C27A 4KVXA 2BUEA 2VEZA 4RS2A 4KLWA 4UCPA 2F5IA 3MGDA 2FIAA 4PK2A 4ZGYB 4UFXA 3FIXA 3LD2A 1S3ZA 4KOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0W A;  3W91 A;  2K5T A;  1B87 A;  1KUX A;  3PP9 A;  4JXQ A;  1MJB A;  3F0A A;  2B4B A;  2B58 A;  2HV2 A;  2PRB A;  3R9E A;  4CRZ B;  2R1I A;  2BL1 A;  4Y49 B;  1QSO A;  1Q2D A;  2GIV A;  4R9M A;  2EUI A;  1FY7 A;  5J8C A;  1XIX A;  1WWZ A;  3ZZI A;  1YRE A;  1M4D A;  4PSX A;  3PGP A;  4HKF A;  4XPK A;  4RI1 A;  1XEB A;  3TCV A;  4KOU A;  2PDO A;  1M1D A;  3QAH A;  2IL4 A;  3CXP A;  1Y9K A;  4MJ8 A;  3UY5 A;  1CM0 A;  5DWM A;  4NCZ A;  3CXQ A;  2KCW A;  2B4D A;  2J8M A;  2B4D B;  4NF1 A;  4H6U A;  4Y49 C;  2DXQ A;  2D4O A;  2FXF A;  2I00 A;  1S7N A;  1Z4R A;  2X7B A;  4MY0 A;  3TFY A;  2OB0 A;  5H84 A;  3CXS A;  3EC4 A;  3VWD A;  5KTC A;  4ZBG A;  1YR0 A;  2PQ8 A;  5JQ4 A;  3SHP A;  1QSM A;  4M3S A;  1M4G A;  4BMH A;  2QEC A;  1P0H A;  2ZW7 A;  4QVT A;  2CY2 A;  5EC4 A;  1MK4 A;  5F47 A;  4DNC A;  2PR1 A;  2CNM A;  1K4J A;  4JJX A;  4CAX A;  4L8A A;  4R3L A;  2FE7 A;  2VQY A;  3FYN A;  2CNT A;  2B5G A;  2B5G B;  4FD4 A;  5C88 A;  3BJ8 A;  5KTD A;  1KUY A;  4OAE A;  1NSL A;  4MHD A;  1IYL A;  2BEI A;  4F0Y A;  3P2F A;  4KUA A;  3N7Z A;  4JWP A;  4GS4 A;  3DR8 A;  2Q4Y A;  1YGH A;  1BOB A;  1M4I A;  1SQH A;  4H6Z A;  3SXN A;  1I12 A;  5H86 A;  3R9F A;  1QSN A;  1GHE A;  4X5K A;  4KZT A;  1YX0 A;  5C82 A;  5KTA A;  2P6E A;  3EFA A;  3FNC A;  4KOX A;  1P4N A;  4YRH A;  4PK3 A;  4KUB A;  3BJ7 A;  4XPD B;  4NXY A;  2Q04 A;  4E8O A;  1IID A;  2PC1 A;  2Q0Y A;  2B3U A;  2WPX A;  2JEV A;  1S7K A;  4XNH B;  1U6M A;  1S7F A;  2HUZ A;  3TO9 A;  4II9 A;  3S6G A;  3R9G A;  1NE9 A;  2REF A;  2OZH A;  4FD5 A;  2Q7B A;  2OH1 A;  2I79 A;  5ISV A;  2Q44 A;  1IYK A;  5F49 A;  2Z11 A;  1BO4 A;  4LX9 A;  1MJ9 A;  4QBJ A;  5CNP A;  4XPL A;  1V0C A;  4XPD C;  4PSW A;  3NE7 A;  3T90 A;  4IF5 A;  5FVJ A;  5I0C A;  5IB0 A;  4U5Y A;  1I1D A;  4KOR A;  1IB1 E;  4XNH C;  1MJA A;  2R98 A;  2ZPA A;  3FBU A;  1J4J A;  4AVB A;  4NSQ A;  3TOA A;  3BLN A;  4YFJ A;  1IIC A;  3B8G A;  3GY9 A;  4AB7 A;  3GYA A;  3EXN A;  5EBV A;  3P2H A;  3DR6 A;  2VZZ A;  3TO7 A;  4JLY A;  4KOV A;  4NEX A;  1S5K A;  4ORF A;  1M44 A;  4UBR A;  1QSR A;  1QST A;  3D2P A;  4UWI A;  3D2M A;  3I9S A;  1WK4 A;  4M85 A;  2AJ6 A;  3F8K A;  2R8V A;  3H4Q A;  2FCK A;  4U9Y A;  2RC4 A;  3JUW A;  1Y9W A;  4CRY B;  4E2A A;  2ZW4 A;  1TIQ A;  4AG7 A;  2JDC A;  4CAV A;  2NMT A;  4EVY A;  3FB3 A;  2H5M A;  2WPW A;  3GKR A;  2ZW5 A;  3G3S A;  1XMT A;  2CNS A;  4KOS A;  3RYO A;  3W6S A;  1Z9U A;  1XE4 A;  4K30 A;  5IX3 A;  2ZW6 A;  4F6A A;  4MBU A;  3IWG A;  4CS0 B;  1S60 A;  1CJW A;  4QC6 A;  4HNW B;  2FIW A;  3EO4 A;  2Z10 A;  3TOB A;  4AVA A;  1RO5 A;  2VZY A;  4KVO E;  3S6K A;  2BSW A;  3JVN A;  3F5B A;  3C26 A;  5JPH A;  2A4N A;  4ONU A;  2ZXV A;  2PSW A;  4AVC A;  3DNS A;  2Z0Z A;  3LOD A;  2J8N A;  4U9Z A;  2G0B A;  3D8P A;  3DDD A;  4KVM E;  1B6B A;  3FRM A;  2FS5 A;  4HNX B;  2G3A A;  3R96 A;  1YVO A;  3R1K A;  3E0K A;  3EY5 A;  1N71 A;  2VBQ A;  4MY3 A;  5HH1 A;  3S6H A;  5GCN A;  1Q2Y A;  5IV0 A;  2O28 A;  4IUS A;  4L89 A;  4I49 A;  1RXT A;  2FT0 A;  3PZJ A;  4YGO A;  4H89 A;  1KZF A;  2Y0M A;  3OWC A;  4KOY A;  4UA3 A;  4B5P A;  2FSR A;  4B5P B;  1PUA A;  2JDD A;  1R57 A;  1S7L A;  2GAN A;  3TO6 A;  5E96 A;  2EVN A;  3SXO A;  3VWE A;  3D3S A;  3K9U A;  3S6F A;  2JLM A;  1YK3 A;  4PV6 A;  1YLE A;  1YVK A;  3I3G A;  3TT2 A;  4KOW A;  2VI7 A;  1I21 A;  3IGR A;  2HQY A;  2QML A;  1UFH A;  3G8W A;  2P6G A;  3W6X A;  4R87 A;  1NMT A;  1PU9 A;  4QUS A;  1OZP A;  4FD7 A;  2B3V A;  2OZG A;  1L0C A;  1VHS A;  5F46 A;  4KLV A;  4R57 A;  3FXT A;  2ARH A;  1ON0 A;  2PR8 A;  2REE A;  4R3K A;  2FL4 A;  1LRZ A;  2GE3 A;  4QB9 A;  3DSB A;  1VKC A;  5J8F A;  2OZU A;  4MI4 A;  2D4P A;  3TTH A;  5DWN A;  2R7H A;  4OLL A;  4AG9 A;  3ZJ0 A;  4FD6 A;  4OAD A;  1Y7R A;  3QB8 A;  3WR7 A;  3TE4 A;  2Q4V A;  2J8R A;  4E0A A;  4JD6 A;  1XF8 A;  1Q2C A;  2QIR A;  2VXK A;  3KKW A;  4LUA A;  4JXR A;  2ATR A;  4J3G A;  3R95 A;  1KUV A;  2AE6 A;  4HNY B;  5HMN A;  3T9Y A;  5F48 A;  4B5O A;  4CAW A;  2OU2 A;  3V8I A;  1Z4E A;  2G3T A;  2P6F A;  4UWJ A;  2C27 A;  4KVX A;  2BUE A;  2VEZ A;  4RS2 A;  4KLW A;  2F5I A;  3MGD A;  2FIA A;  4PK2 A;  3FIX A;  3LD2 A;  1S3Z A;  4KOT A; 
#chains in the Genus database with same CATH topology
 2P0W A;  3W91 A;  2K5T A;  1B87 A;  1KUX A;  3PP9 A;  4LQ6 A;  4JXQ A;  1MJB A;  2C6C A;  3F0A A;  2B4B A;  4Q7A A;  2GLJ A;  2B58 A;  4LQG A;  2HV2 A;  2PRB A;  3R9E A;  4CRZ B;  2AFU A;  2R1I A;  2WUU A;  1ELM P;  3SI0 A;  2BL1 A;  4Y49 B;  1QSO A;  1AUG A;  4A38 A;  1Q2D A;  1BPM A;  2GIV A;  2PRQ A;  4A94 A;  1YME A;  4R9M A;  3N5F A;  4PXC A;  2XEJ A;  2EUI A;  2NSM A;  1FY7 A;  1KWM A;  1Z8L A;  5J8C A;  1XIX A;  1WWZ A;  2ZEE A;  4NJR A;  3KL9 A;  3ZZI A;  3WT4 A;  1YRE A;  1M4D A;  4PSX A;  3D4U A;  4FWU A;  1HDQ A;  1H8L A;  3PGP A;  4HKF A;  2Z3N A;  1A2Z A;  3KZW A;  2XEG A;  3PB8 X;  3CT9 A;  2ANP A;  4RI1 A;  4XPK A;  1XEB A;  3TCV A;  4JZ0 A;  5LRJ A;  1LFW A;  5G20 A;  3B3S A;  2PVV A;  3FJU A;  3FEC A;  1TF8 A;  4KOU A;  2PDO A;  1M1D A;  3QAH A;  1X10 A;  2IL4 A;  3CXP A;  1Y9K A;  4MJ8 A;  3UY5 A;  1CM0 A;  4R3K A;  5DWM A;  4NCZ A;  2ZEM A;  2PIZ A;  3VAT A;  1F2P A;  3CXQ A;  2V8G A;  4C2X A;  2KCW A;  1UWY A;  2C6P A;  5AGE A;  2B4D A;  2J8M A;  2B4D B;  4NF1 A;  2VL1 A;  4H6U A;  2DXQ A;  4MCP A;  4PXB A;  4Y49 C;  4ZX9 A;  4F9V A;  2D4O A;  2FXF A;  2I00 A;  2PCU A;  4MHY A;  1S7N A;  1TF9 A;  4YFJ A;  1VIX A;  4ZI6 A;  1Z4R A;  5JH9 A;  2X7B A;  4MY0 A;  4UFW A;  3TFY A;  1VHO A;  1FT7 A;  2OB0 A;  2QVP A;  2CTB A;  5H84 A;  5CBM A;  1Z5R A;  3CXS A;  2F7V A;  2ZOF A;  3KR5 A;  3EC4 A;  1X12 A;  2Z3K A;  3ISX A;  3VWD A;  5KTC A;  4ZBG A;  1TKH A;  1TXR A;  1YR0 A;  2AFZ A;  2PQ8 A;  2ZEF A;  5JQ4 A;  5AG5 A;  3SHP A;  2ZEL A;  1CP7 A;  1QSM A;  3H8E A;  4MFL A;  3GLJ A;  4ZYQ A;  4M3S A;  4A31 A;  1M4G A;  4BMH A;  1NSA A;  3H8G A;  4OC3 A;  2QEC A;  3KR4 A;  5A28 A;  1P0H A;  2ZW7 A;  4QVT A;  4YU9 A;  2CY2 A;  3K9T A;  4FUU A;  4O23 A;  3S9L A;  5EC4 A;  1MK4 A;  1LAM A;  5F47 A;  2BO9 A;  4DNC A;  4K3N A;  4C7H A;  4C68 A;  2QJ8 A;  1XBU A;  3MN8 A;  2PR1 A;  2CNM A;  4EFD A;  4CAE A;  1K4J A;  4JJX A;  5LRG A;  3SI2 A;  3H8F A;  4CAX A;  2Q4Z A;  3HUV A;  4L8A A;  3JRU A;  2FE7 A;  4NJQ A;  4R3L A;  2JEW A;  5THW A;  2VQY A;  2WYR A;  4PQA A;  5IB9 A;  4GM5 A;  3FYN A;  2CNT A;  2B5G A;  4OC2 A;  4CAF A;  2B5G B;  4FD4 A;  5C88 A;  1QMU A;  2NYQ A;  2PJB A;  2PJ0 A;  3QNV A;  4CGP A;  3BJ8 A;  5KTD A;  1KUY A;  3SJE A;  4OAE A;  1NSL A;  4MHD A;  5LYF A;  1IYL A;  2BEI A;  2ZEH A;  3KGQ A;  4F0Y A;  3P2F A;  2AFX A;  3LWU A;  3D7D A;  4KUA A;  2EWB A;  3N7Z A;  4MHP A;  5G1Z A;  3FX6 A;  2YND A;  2CIJ A;  4JWP A;  1IU8 A;  4GS4 A;  3DR8 A;  4H2K A;  2Q4Y A;  4Q38 A;  2YNE A;  2JBJ A;  5D8N A;  5AG7 A;  2BCO A;  1YGH A;  1BOB A;  1M4I A;  1SQH A;  4UCN A;  4H6Z A;  2ODF A;  3SXN A;  1I12 A;  5H86 A;  1ZLH A;  2Z3M A;  3R9F A;  2YGW A;  3IWE A;  1QSN A;  3T8W A;  1JWQ A;  4BD9 A;  1PYT B;  1GHE A;  3B3V A;  1LOK A;  4P4F A;  4KZT A;  4X5K A;  1YX0 A;  1YQE A;  5C82 A;  5KTA A;  2P6E A;  4R8F A;  3EFA A;  3FNC A;  4RUH A;  4KOX A;  1P4N A;  4YRH A;  4PK3 A;  4NGS A;  2AFW A;  1ZG9 A;  4P44 A;  1GYT A;  3IFE A;  4KUB A;  4TNU A;  3BJ7 A;  4XPD B;  4NXY A;  2Q04 A;  2Q43 A;  4E8O A;  4KS9 A;  1IID A;  2PC1 A;  2DF5 A;  2Q0Y A;  4DJL A;  5CPA A;  5D29 A;  3D67 A;  2B3U A;  2WPX A;  2ZEN A;  3PEI A;  3TC8 A;  5K8P A;  2JEV A;  1S7K A;  3WC7 A;  8CPA A;  4XNH B;  1U6M A;  1S7F A;  1YW6 A;  2HUZ A;  3GIU A;  4MRI A;  3TO9 A;  4II9 A;  3S6G A;  1Y7E A;  3RBU A;  2JBK A;  1NE9 A;  3R9G A;  2REF A;  3D66 A;  2OZH A;  4FD5 A;  1BPN A;  2Q7B A;  2OH1 A;  4A32 A;  2I79 A;  4OC5 A;  4B10 A;  3S9N A;  2OOT A;  4NGN A;  5ISV A;  2Q44 A;  4KSI A;  4M6H A;  1LAN A;  4P10 A;  5BWA B;  1IYK A;  1IGB A;  5F49 A;  3RNZ A;  2Z11 A;  1BO4 A;  2ZED A;  3PBB A;  4LX9 A;  4ZX8 A;  4DUK A;  4NGT A;  4M6I A;  4NFR A;  1MJ9 A;  3NH8 A;  3D7H A;  4YWY A;  5CNP A;  4QBJ A;  2IQ6 A;  4XPL A;  2ZOG A;  1V0C A;  3BXM A;  4PSW A;  4XPD C;  3NE7 A;  4EME A;  3IO1 A;  4MFP A;  3T90 A;  3IU1 A;  4IF5 A;  5FVJ A;  5I0C A;  5IB0 A;  4U5Y A;  2OR4 A;  1I1D A;  3IC1 A;  4KOR A;  4CGM A;  1IB1 E;  4XNH C;  4IAV A;  1MJA A;  3V38 A;  2XEF A;  5HVH A;  2R98 A;  4P4I A;  1VGY A;  4UCM A;  4A33 A;  1ELL P;  5HVG A;  2ZPA A;  3FBU A;  4R76 A;  1J4J A;  1OBR A;  3B2Y A;  2BOA A;  4AVB A;  1XOV A;  4NSQ A;  3TOA A;  2QYV A;  3BLN A;  3FED A;  4B13 A;  4CPA A;  1IIC A;  2WZN A;  3B8G A;  3GY9 A;  4MHZ A;  4B6Z A;  4AB7 A;  3GYA A;  3EXN A;  1VHE A;  4IHM A;  5EBV A;  3P2H A;  3DR6 A;  2VZZ A;  2PJ8 A;  3TO7 A;  2PE3 A;  2EK8 A;  3SI1 A;  4JLY A;  4KOV A;  3V7Z A;  1ZO0 A;  2ZEP A;  1R43 A;  4MFJ A;  4NEX A;  4Z65 A;  4GXH A;  5A27 A;  1S5K A;  4IK2 A;  4ORF A;  3VAR A;  1M44 A;  4UBR A;  1QSR A;  1QST A;  1YSJ A;  3D2P A;  1AYE A;  4UWI A;  1XJO A;  3D2M A;  3I9S A;  1FNO A;  1WK4 A;  5DS0 A;  2O4H A;  4G1P A;  3KI9 A;  1HEE A;  1QQ9 A;  3BHX A;  2G9D A;  1ARM A;  3PBE A;  2YNC A;  5I4M A;  3LAC A;  4M85 A;  3KQX A;  2AJ6 A;  2V8V A;  3F8K A;  4P4J A;  4OC4 A;  2R8V A;  3H4Q A;  4A95 A;  1Y0Y A;  2FCK A;  4U9Y A;  2RC4 A;  1M4L A;  3JUW A;  5HVF A;  1Y9W A;  4MCQ A;  4CRY B;  4P45 A;  4E2A A;  2C6G A;  2ZW4 A;  5K8N A;  3DLJ A;  1TIQ A;  1Q7L A;  4C2Z A;  3RO0 A;  4AG7 A;  2JDC A;  4RN7 A;  2POK A;  4CAV A;  2NMT A;  4EVY A;  4AXV A;  3FB3 A;  3I1U A;  5LYD A;  2PJ3 A;  2PVW A;  3VH9 A;  2HB6 A;  2H5M A;  2WSA A;  3B3C A;  4UEZ A;  4HPS A;  5EMI A;  2WPW A;  3GKR A;  4A37 A;  2PJ7 A;  4OC0 A;  5AG6 A;  5LYL A;  2AFM A;  1RTQ A;  3RAM A;  4UEF A;  4WWV A;  1XFO A;  2ZEG A;  3WC5 A;  2ZW5 A;  3G3S A;  4JYW A;  1Z8X A;  1XMT A;  2CNS A;  4KOS A;  4P6Y A;  3RYO A;  3W6S A;  1Z9U A;  1XE4 A;  4Q36 A;  4X8I A;  4K30 A;  5IX3 A;  3BI0 A;  2YNC C;  2IJZ A;  5G21 A;  4A39 A;  2ZW6 A;  2AFO A;  3KHX A;  3B3W A;  4CGL A;  4ZY0 A;  4OC1 A;  4PXD A;  3WAB A;  4MBU A;  4F6A A;  3D68 A;  7CPA A;  3IWG A;  4CS0 B;  1S60 A;  1CJW A;  1CP6 A;  4HNW B;  4QC6 A;  1IOI A;  2Q51 A;  2FIW A;  3PB4 X;  2F8H A;  3NH4 A;  3D7G A;  2DPS A;  3EO4 A;  1YLO A;  2Z10 A;  3TOB A;  4CYN A;  4A2Z A;  4AVA A;  4M6G A;  3SJG A;  1YW4 A;  1XMB A;  1TKJ A;  1RO5 A;  3NFZ A;  5G22 A;  3PFE A;  3CPA A;  4NGR A;  2VZY A;  4KVO E;  3S6K A;  2BSW A;  2V8D A;  2Z3L A;  3PFO A;  3JVN A;  3F5B A;  3C26 A;  5JPH A;  2A4N A;  3B35 A;  4ONU A;  2ZXV A;  2PSW A;  4TWE A;  4AVC A;  1CBX A;  2Z0Z A;  3DNS A;  3JTK A;  3LOD A;  2J8N A;  4U9Z A;  2G0B A;  2RB7 A;  4ONW A;  4EWT A;  2GU2 A;  3D7F A;  3D8P A;  3DDD A;  3KAS A;  4KVM E;  1B6B A;  2C1C A;  3FRM A;  2FS5 A;  4HNX B;  2G3A A;  4ZY1 A;  5JGF A;  3R96 A;  3GB0 A;  1YVO A;  3R1K A;  2EBJ A;  3E0K A;  3IEH A;  4B11 A;  3IJ3 A;  1XRY A;  4NGM A;  3A9L A;  2EK9 A;  3EY5 A;  3FF3 A;  3WC6 A;  1N71 A;  2CXA A;  3BI1 A;  4MMO A;  4CYO A;  4MFK A;  1CPS A;  2VBQ A;  3NE8 A;  1LCP A;  4MY3 A;  3B3T A;  5HH1 A;  3S6H A;  3IIB A;  5GCN A;  1Q2Y A;  5ELY A;  5IV0 A;  2O28 A;  1IOF A;  4IUS A;  4I49 A;  4L89 A;  4R7M A;  1RXT A;  2FT0 A;  5LRK A;  4PPZ A;  3PB7 X;  4P4B A;  2PJ4 A;  3PZJ A;  4FBE A;  1Z8W A;  4YGO A;  4H89 A;  1KZF A;  4UFV A;  2Y0M A;  3OWC A;  4KOY A;  2Z3P A;  4UA3 A;  3S9M A;  4B5P A;  2PIY A;  2FSR A;  2RFH A;  4B5P B;  1PUA A;  4B12 A;  1CX8 A;  2JDD A;  4CGN A;  1R57 A;  1S7L A;  2GAN A;  5LYI A;  3TO6 A;  5E96 A;  4C7I A;  4X2T A;  2EVN A;  3SXO A;  3VWE A;  2PJ9 A;  3QAY A;  4A30 A;  3D3S A;  3K9U A;  3S6F A;  1ZG7 A;  2JLM A;  1YK3 A;  3ISZ A;  1AMP A;  4PV6 A;  3RZA A;  1CG2 A;  3IWW A;  2PJ5 A;  1YLE A;  1YVK A;  5AG4 A;  3I3G A;  3TT2 A;  3NA6 A;  4MFZ A;  5F09 A;  4KOW A;  1ZG8 A;  4OIW A;  4OKO A;  4BBH A;  2VI7 A;  1I21 A;  4CGO A;  2DEA A;  4NGQ A;  4MFQ A;  4MHN A;  3IGR A;  2HQY A;  2QML A;  3PB9 X;  1UFH A;  4OP4 A;  3G8W A;  2P6G A;  3W6X A;  4R87 A;  4C2Y A;  1NMT A;  1PU9 A;  3H5Z A;  1OZP A;  3PRT A;  3CDX A;  4QUS A;  4FD7 A;  2B3V A;  2OZG A;  2FVG A;  1L0C A;  1EE3 P;  1VHS A;  3CZX A;  2PJ6 A;  3L2N A;  4KLV A;  5F46 A;  2EO8 A;  4R57 A;  3FXT A;  1TKF A;  4CYQ A;  2PJ2 A;  4CYP A;  2ARH A;  1Y0R A;  2Q7S A;  1ON0 A;  3LMS A;  2PR8 A;  2REE A;  1BLL E;  1DE4 C;  1LRZ A;  2AFS A;  2FL4 A;  2GE3 A;  1Z2L A;  2V8H A;  3KQZ A;  3NH5 A;  2ABZ A;  3DSB A;  1F2O A;  4QB9 A;  2J9A A;  5K8M A;  1VKC A;  4PXE A;  5J8F A;  3IU2 A;  2OZU A;  4MI4 A;  2CF4 A;  2D4P A;  3TTH A;  1R3N A;  2IMO A;  4W9Y A;  2PJA A;  4OME A;  1ARL A;  1JQG A;  4NGP A;  5DWN A;  2R7H A;  4OLL A;  4DYO A;  4AG9 A;  3ZJ0 A;  4FD6 A;  3KHZ A;  4KSF A;  4OAD A;  1BAV A;  2DPT A;  3GUX A;  1Y7R A;  3HLP A;  1Z8T A;  3QB8 A;  3SJF A;  3WR7 A;  3TE4 A;  2Q4V A;  5HXD A;  2J8R A;  4MCR A;  4E0A A;  3FEE A;  4UEE A;  4JD6 A;  1XF8 A;  6CPA A;  1Q2C A;  2PJC A;  1F57 A;  2QIR A;  2VXK A;  4B14 A;  3KKW A;  2O53 A;  4LUA A;  4KSA A;  4JXR A;  4OID A;  4P4E A;  2ATR A;  4J3G A;  3K2K A;  4UIB A;  3R95 A;  2GRE A;  2PJ1 A;  2Z3O A;  3SJX A;  1KUV A;  2AE6 A;  4HNY B;  4P4D A;  3T9Y A;  5F48 A;  4WJB A;  5HMN A;  2HC9 A;  4UF4 A;  4B5O A;  4F0X A;  1HDU A;  2CTC A;  4CAW A;  2OU2 A;  3V8I A;  4X3R A;  1Z4E A;  1DTD A;  3FH4 A;  2G3T A;  4F9U A;  2GFQ A;  2P6F A;  3FVL A;  5K8O A;  1LAP A;  1ZLI A;  4UWJ A;  2C27 A;  2XEI A;  3DGV A;  4KVX A;  4MXU A;  4F8Z A;  3FMC A;  1CPX A;  2BUE A;  4FAI A;  1PCA A;  2VEZ A;  5JM6 A;  3MRU A;  4RS2 A;  2I3C A;  4KLW A;  4UCP A;  2ZEO A;  2F5I A;  3TX8 A;  3MGD A;  2FIA A;  4PK2 A;  5J1Q A;  4ZGY B;  2V77 A;  4UFX A;  3B7I A;  4BIN A;  2GLF A;  3FIX A;  4MCS A;  4ZY2 A;  3CPX A;  3PB6 X;  3LD2 A;  1S3Z A;  1IY7 A;  4UIA A;  4KOT A;  4R6T A; 
#chains in the Genus database with same CATH homology
 2P0W A;  3W91 A;  2K5T A;  1B87 A;  1KUX A;  3PP9 A;  4JXQ A;  1MJB A;  3F0A A;  2B4B A;  2B58 A;  2HV2 A;  2PRB A;  3R9E A;  4CRZ B;  2R1I A;  2WUU A;  2BL1 A;  4Y49 B;  1QSO A;  1Q2D A;  2GIV A;  4R9M A;  2EUI A;  1FY7 A;  5J8C A;  1XIX A;  1WWZ A;  3ZZI A;  1YRE A;  1M4D A;  4PSX A;  3PGP A;  4HKF A;  2Z3N A;  4XPK A;  4RI1 A;  1XEB A;  3TCV A;  5G20 A;  4KOU A;  2PDO A;  1M1D A;  3QAH A;  2IL4 A;  3CXP A;  1Y9K A;  4MJ8 A;  3UY5 A;  1CM0 A;  5DWM A;  4NCZ A;  3CXQ A;  4C2X A;  2KCW A;  5AGE A;  2B4D A;  2J8M A;  2B4D B;  4NF1 A;  4H6U A;  4Y49 C;  2DXQ A;  2D4O A;  2FXF A;  2I00 A;  1S7N A;  1Z4R A;  2X7B A;  4MY0 A;  4UFW A;  3TFY A;  2OB0 A;  5H84 A;  3CXS A;  3EC4 A;  2Z3K A;  3VWD A;  5KTC A;  4ZBG A;  1YR0 A;  2PQ8 A;  5JQ4 A;  5AG5 A;  3SHP A;  1QSM A;  4MFL A;  4M3S A;  4A31 A;  1M4G A;  4BMH A;  2QEC A;  5A28 A;  1P0H A;  2ZW7 A;  4QVT A;  2CY2 A;  5EC4 A;  1MK4 A;  5F47 A;  4DNC A;  4C7H A;  4C68 A;  2PR1 A;  2CNM A;  4CAE A;  1K4J A;  4JJX A;  4CAX A;  4L8A A;  4R3L A;  2FE7 A;  2VQY A;  3FYN A;  2CNT A;  2B5G A;  4CAF A;  2B5G B;  4FD4 A;  5C88 A;  4CGP A;  3BJ8 A;  5KTD A;  1KUY A;  4OAE A;  1NSL A;  4MHD A;  1IYL A;  2BEI A;  4F0Y A;  3P2F A;  4KUA A;  3N7Z A;  5G1Z A;  2YND A;  4JWP A;  4GS4 A;  3DR8 A;  2Q4Y A;  4Q38 A;  2YNE A;  5AG7 A;  1YGH A;  1BOB A;  1M4I A;  1SQH A;  4UCN A;  4H6Z A;  3SXN A;  1I12 A;  5H86 A;  2Z3M A;  3R9F A;  2YGW A;  3IWE A;  1QSN A;  1GHE A;  4X5K A;  4KZT A;  1YX0 A;  5C82 A;  5KTA A;  2P6E A;  3EFA A;  3FNC A;  4KOX A;  1P4N A;  4YRH A;  4PK3 A;  4KUB A;  3BJ7 A;  4XPD B;  4NXY A;  2Q04 A;  4E8O A;  4KS9 A;  1IID A;  2PC1 A;  2Q0Y A;  2B3U A;  2WPX A;  2JEV A;  1S7K A;  4XNH B;  1U6M A;  1S7F A;  2HUZ A;  3TO9 A;  4II9 A;  3S6G A;  3R9G A;  1NE9 A;  2REF A;  2OZH A;  4FD5 A;  2Q7B A;  2OH1 A;  4A32 A;  2I79 A;  4B10 A;  5ISV A;  2Q44 A;  5BWA B;  1IYK A;  5F49 A;  2Z11 A;  1BO4 A;  4LX9 A;  1MJ9 A;  4QBJ A;  5CNP A;  4XPL A;  1V0C A;  4XPD C;  4PSW A;  3NE7 A;  4MFP A;  3T90 A;  3IU1 A;  4IF5 A;  5FVJ A;  5I0C A;  5IB0 A;  4U5Y A;  1I1D A;  4KOR A;  4CGM A;  1IB1 E;  4XNH C;  1MJA A;  2R98 A;  4A33 A;  4UCM A;  2ZPA A;  3FBU A;  1J4J A;  4AVB A;  4NSQ A;  3TOA A;  3BLN A;  4YFJ A;  4B13 A;  1IIC A;  3B8G A;  3GY9 A;  4AB7 A;  3GYA A;  3EXN A;  5EBV A;  3P2H A;  3DR6 A;  2VZZ A;  3TO7 A;  4JLY A;  4KOV A;  1ZO0 A;  4MFJ A;  4NEX A;  5A27 A;  1S5K A;  4ORF A;  1M44 A;  4UBR A;  1QSR A;  1QST A;  3D2P A;  4UWI A;  3D2M A;  3I9S A;  1WK4 A;  2YNC A;  4M85 A;  2AJ6 A;  3F8K A;  2R8V A;  3H4Q A;  4A95 A;  2FCK A;  4U9Y A;  2RC4 A;  3JUW A;  1Y9W A;  4CRY B;  4E2A A;  2ZW4 A;  1TIQ A;  4C2Z A;  4AG7 A;  2JDC A;  4CAV A;  2NMT A;  4EVY A;  3FB3 A;  2H5M A;  2WSA A;  2WPW A;  3GKR A;  5AG6 A;  2ZW5 A;  3G3S A;  1XMT A;  2CNS A;  4KOS A;  3RYO A;  3W6S A;  1Z9U A;  1XE4 A;  4Q36 A;  4K30 A;  5IX3 A;  2YNC C;  5G21 A;  2ZW6 A;  4CGL A;  4F6A A;  4MBU A;  3IWG A;  4CS0 B;  1S60 A;  1CJW A;  4QC6 A;  4HNW B;  2FIW A;  2DPS A;  3EO4 A;  2Z10 A;  3TOB A;  4CYN A;  4A2Z A;  4AVA A;  1RO5 A;  5G22 A;  2VZY A;  4KVO E;  3S6K A;  2BSW A;  2Z3L A;  3JVN A;  3F5B A;  3C26 A;  5JPH A;  2A4N A;  4ONU A;  2ZXV A;  2PSW A;  4AVC A;  3DNS A;  2Z0Z A;  3JTK A;  3LOD A;  2J8N A;  4U9Z A;  2G0B A;  3D8P A;  3DDD A;  4KVM E;  1B6B A;  3FRM A;  2FS5 A;  4HNX B;  2G3A A;  3R96 A;  1YVO A;  3R1K A;  3E0K A;  4B11 A;  3A9L A;  3EY5 A;  1N71 A;  2CXA A;  4CYO A;  4MFK A;  2VBQ A;  4MY3 A;  5HH1 A;  3S6H A;  5GCN A;  1Q2Y A;  5IV0 A;  2O28 A;  4IUS A;  4L89 A;  4I49 A;  1RXT A;  2FT0 A;  3PZJ A;  4YGO A;  4H89 A;  1KZF A;  4UFV A;  2Y0M A;  3OWC A;  4KOY A;  2Z3P A;  4UA3 A;  4B5P A;  2FSR A;  4B5P B;  1PUA A;  4B12 A;  2JDD A;  4CGN A;  1R57 A;  1S7L A;  2GAN A;  3TO6 A;  5E96 A;  4C7I A;  2EVN A;  3SXO A;  3VWE A;  4A30 A;  3D3S A;  3K9U A;  3S6F A;  2JLM A;  1YK3 A;  4PV6 A;  1YLE A;  1YVK A;  5AG4 A;  3I3G A;  3TT2 A;  4MFZ A;  4KOW A;  4BBH A;  2VI7 A;  1I21 A;  4CGO A;  4MFQ A;  3IGR A;  2HQY A;  2QML A;  1UFH A;  3G8W A;  2P6G A;  3W6X A;  4R87 A;  4C2Y A;  1NMT A;  1PU9 A;  3H5Z A;  1OZP A;  4QUS A;  4FD7 A;  2B3V A;  2OZG A;  1L0C A;  1VHS A;  5F46 A;  4KLV A;  4R57 A;  3FXT A;  4CYQ A;  4CYP A;  2ARH A;  1ON0 A;  2PR8 A;  2REE A;  4R3K A;  2FL4 A;  1LRZ A;  2GE3 A;  4QB9 A;  3DSB A;  1VKC A;  5J8F A;  3IU2 A;  2OZU A;  4MI4 A;  2D4P A;  3TTH A;  5DWN A;  2R7H A;  4OLL A;  4AG9 A;  3ZJ0 A;  4FD6 A;  4KSF A;  4OAD A;  2DPT A;  1Y7R A;  3QB8 A;  3WR7 A;  3TE4 A;  2Q4V A;  2J8R A;  4E0A A;  4JD6 A;  1XF8 A;  1Q2C A;  4B14 A;  2QIR A;  2VXK A;  3KKW A;  4LUA A;  4KSA A;  4JXR A;  2ATR A;  4J3G A;  3R95 A;  2Z3O A;  1KUV A;  2AE6 A;  4HNY B;  5HMN A;  3T9Y A;  5F48 A;  4B5O A;  4F0X A;  4CAW A;  2OU2 A;  3V8I A;  1Z4E A;  2G3T A;  2P6F A;  4UWJ A;  2C27 A;  4KVX A;  2BUE A;  2VEZ A;  4RS2 A;  4KLW A;  4UCP A;  2F5I A;  3MGD A;  2FIA A;  4PK2 A;  4ZGY B;  4UFX A;  3FIX A;  3LD2 A;  1S3Z A;  4KOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...