2P6FA

Crystal structures of saccharomyces cerevisiae n-myristoyltransferase with bound myristoyl-coa and inhibitors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
451
structure length
436
Chain Sequence
DKAKKLENLLKLLQLNNDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 110
structure length 436
sequence length 451
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2007-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6fA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p6fA02
1I12A 4XPLA 1YX0A 2Q04A 2KCWA 2G3TA 1QSRA 4GS4A 1YR0A 1MJ9A 2JDDA 5EC4A 4LX9A 2D4OA 4KOWA 4NF1A 3EO4A 4QBJA 4KUBA 2VI7A 1S7KA 1IYLA 4MY0A 4BMHA 1BOBA 5IV0A 4FD4A 2VEZA 2QMLA 1ON0A 3IGRA 3LODA 5C88A 3F5BA 4H89A 5J8CA 2P6GA 3R9GA 2OZGA 4XPKA 4UBRA 2PR1A 5DWNA 1YGHA 2OZUA 3C26A 3QB8A 1XIXA 1YVKA 2PSWA 2R1IA 4AVCA 4JXQA 4HNWB 4IF5A 3R95A 2ARHA 2Z10A 4UWJA 2FL4A 3W6XA 3S6HA 4EVYA 3FIXA 4HKFA 1L0CA 1QSNA 1OZPA 2CNMA 2JLMA 1Q2CA 2ATRA 4MBUA 4H6ZA 1PU9A 2FSRA 4E0AA 4KOTA 4QUSA 1IB1E 3TT2A 4NEXA 4YGOA 4LUAA 1M4DA 5FVJA 2R8VA 4E8OA 2BL1A 4AG7A 2OZHA 4CAVA 2WPXA 2D4PA 1YLEA 3T90A 4PV6A 5F48A 4CRZB 2X7BA 2Z0ZA 2IL4A 5KTAA 4U5YA 3PP9A 1J4JA 3EC4A 4KORA 4KLVA 1QSMA 1M1DA 4KUAA 3SXNA 4X5KA 1GHEA 1S60A 5HH1A 3GKRA 3SHPA 4KZTA 2EUIA 4R3LA 4R57A 2J8MA 1BO4A 5JPHA 2B58A 4JD6A 3S6FA 1YVOA 3EFAA 4AVBA 4HNXB 4ONUA 3UY5A 5GCNA 1XF8A 2K5TA 3BLNA 5HMNA 4B5PB 4E2AA 1S7NA 2NMTA 3D2PA 2P6FA 4ORFA 3R96A 4KOSA 1NSLA 1KUYA 5F49A 1MK4A 1TIQA 2HQYA 4R87A 3G3SA 3BJ7A 2PC1A 3I3GA 3VWEA 3ZJ0A 4M85A 4B5PA 1B87A 2J8NA 4KVOE 4UA3A 5KTDA 4PSWA 3NE7A 1Z9UA 1NE9A 2J8RA 2AE6A 4KOVA 3P2FA 2G0BA 1P4NA 3K9UA 2FE7A 3DNSA 2H5MA 5F46A 2Y0MA 3TE4A 3TFYA 2Q44A 1SQHA 2AJ6A 3W91A 4CAXA 4KOXA 1N71A 4R3KA 3GYAA 2VBQA 2OU2A 1IICA 3N7ZA 4OLLA 2VZYA 3D2MA 2ZW5A 2GE3A 2B4DB 2FS5A 3JVNA 4YFJA 2HV2A 4JWPA 3G8WA 2Q7BA 1WK4A 4H6UA 3S6KA 3RYOA 3D3SA 2GIVA 4XPDC 3WR7A 2VXKA 2FIWA 2B4DA 3JUWA 2Z11A 4NSQA 4NXYA 5E96A 3LD2A 2ZW6A 1Z4EA 1Q2YA 2Q0YA 4F0YA 3EY5A 5IX3A 3QAHA 5IB0A 4I49A 1RXTA 4OADA 1PUAA 2R7HA 2P6EA 1RO5A 4XPDB 1V0CA 3D8PA 1IIDA 5JQ4A 2B5GB 4QVTA 3FBUA 2VZZA 4IUSA 1S3ZA 3OWCA 2DXQA 5F47A 4HNYB 1NMTA 3R9FA 4UWIA 4JLYA 4U9YA 1S7LA 4CS0B 3BJ8A 2RC4A 2I00A 3DR6A 1CJWA 4AG9A 2FXFA 2B5GA 3W6SA 2B3UA 1IYKA 4JJXA 4XNHC 3FB3A 5DWMA 4F6AA 3GY9A 4MY3A 1WWZA 1KZFA 4RS2A 2QIRA 3SXOA 1YREA 2CNSA 2PQ8A 1MJBA 2G3AA 4PK2A 2JDCA 3P2HA 1FY7A 2PDOA 2ZW7A 3F8KA 4KVME 1Q2DA 1QSOA 2OB0A 5H86A 5KTCA 1LRZA 2REFA 3TOAA 2CNTA 3PZJA 5H84A 4MHDA 4L89A 4RI1A 4PK3A 2FIAA 4FD6A 4DNCA 4QB9A 4CAWA 1U6MA 3TCVA 5J8FA 3MGDA 3F0AA 2C27A 3TO9A 1YK3A 2REEA 4R9MA 4ZBGA 4K30A 4CRYB 4AB7A 2I79A 1I21A 1B6BA 3CXSA 4QC6A 4L8AA 2HUZA 1M4IA 2VQYA 3H4QA 2P0WA 3ZZIA 1S7FA 3FYNA 1KUVA 2R98A 5C82A 3TTHA 1R57A 4II9A 3R9EA 2BUEA 1M44A 4M3SA 3V8IA 4KLWA 1Z4RA 1XE4A 1Y9WA 4NCZA 2FT0A 5EBVA 4YRHA 2WPWA 2ZPAA 4FD7A 1Y7RA 4U9ZA 2ZW4A 4MI4A 3R1KA 5CNPA 2B4BA 2CY2A 3FNCA 4KOYA 3DSBA 1K4JA 3TO6A 3EXNA 1KUXA 4KOUA 3DDDA 4MJ8A 4OAEA 3KKWA 3PGPA 2Q4YA 4XNHB 3TOBA 4AVAA 1UFHA 1VKCA 1CM0A 5ISVA 2BSWA 2F5IA 3TO7A 4Y49C 2ZXVA 2BEIA 3I9SA 2Q4VA 1I1DA 3E0KA 1VHSA 2FCKA 1M4GA 3CXQA 3FXTA 2GANA 2PR8A 2EVNA 2PRBA 1MJAA 1QSTA 2B3VA 2O28A 5I0CA 4JXRA 1Y9KA 3B8GA 4J3GA 4Y49B 1XEBA 4PSXA 4FD5A 3IWGA 3S6GA 1XMTA 2A4NA 3FRMA 4B5OA 1S5KA 3T9YA 2QECA 1P0HA 4KVXA 2JEVA 3DR8A 3VWDA 3CXPA 2OH1A
chains in the Genus database with same CATH superfamily
1I12A 4NGSA 1BAVA 2ODFA 4XPLA 2XEFA 1YX0A 4CAFA 3PB9X 2Q04A 3H8GA 1Y0RA 3GIUA 4ZY1A 2KCWA 4MFQA 1ZLIA 2G3TA 3WC7A 1QSRA 2ABZA 4A37A 4F9UA 2YNDA 4KS9A 4KSFA 4NFRA 2CTCA 4PQAA 2PJ3A 4GS4A 4WWVA 5HVGA 1YR0A 4CYQA 3K9TA 1MJ9A 2JDDA 5EC4A 4LX9A 2YNEA 2D4OA 4KOWA 4NF1A 2V8GA 3FVLA 3EO4A 3FEEA 4OKOA 4DJLA 4YU9A 3CPAA 4QBJA 3HLPA 4KUBA 1TXRA 5ELYA 1LAMA 3B3TA 8CPAA 2VI7A 1S7KA 4R6TA 4OIDA 4C7IA 3BI0A 4B12A 1IYLA 4MY0A 3S9NA 3A9LA 4BMHA 2EK8A 3JRUA 1BOBA 5IV0A 4FD4A 2VEZA 1YMEA 1ON0A 2QMLA 3IGRA 4DYOA 4IAVA 3LODA 4WJBA 5A28A 5C88A 3F5BA 4H2KA 4H89A 5CPAA 3KHZA 3SJXA 5J8CA 5K8OA 1ELLP 2P6GA 4OMEA 3R9GA 4UIBA 1Z2LA 2OZGA 4MHPA 4XPKA 3IEHA 4UBRA 3B3WA 4PXDA 2PR1A 2ZEDA 5DWNA 4NGRA 1YGHA 2OZUA 3C26A 3QB8A 1XIXA 1YVKA 2PSWA 2C6CA 1OBRA 1UWYA 2R1IA 4AVCA 2Z3MA 4JXQA 1TKJA 4HNWB 2F8HA 4R76A 3D66A 3KZWA 4IF5A 3R95A 1TKHA 2ARHA 2Z10A 3CT9A 4UWJA 5LRJA 2FL4A 3W6XA 2AFXA 5K8MA 3S6HA 1JQGA 1TKFA 3FIXA 4EVYA 3T8WA 5LRKA 1VIXA 4HKFA 1L0CA 1QSNA 1OZPA 2CNMA 2JLMA 1Q2CA 2ATRA 4MBUA 3RZAA 1XOVA 4H6ZA 4FUUA 5HVHA 2QYVA 1AYEA 2YGWA 1PU9A 2FSRA 4E0AA 4KOTA 4QUSA 1IB1E 4MXUA 3V7ZA 4A33A 1Y7EA 3TT2A 2V8HA 4NEXA 4YGOA 2O4HA 3FECA 3SI0A 1KWMA 4RN7A 4LUAA 1M4DA 5FVJA 2R8VA 3PFEA 4E8OA 3S9LA 1JWQA 2BL1A 4AG7A 4BD9A 3I1UA 1LAPA 2OZHA 5JH9A 4X3RA 3V38A 4C2XA 4CAVA 2WPXA 2PJAA 3D7DA 4A32A 2D4PA 4MCPA 5G21A 4F8ZA 1YLEA 3T90A 4PV6A 4P4BA 5F48A 4BINA 1RTQA 2PIZA 1GYTA 2WYRA 4UFXA 4CRZB 2X7BA 6CPAA 2Z0ZA 2PJ1A 5LYIA 3NE8A 4B11A 1BLLE 4A39A 3GUXA 2IL4A 4GM5A 5KTAA 1EE3P 3D7HA 2XEJA 1PCAA 4AXVA 3KL9A 4U5YA 3PP9A 1J4JA 3EC4A 3RO0A 4KORA 1CP6A 1CG2A 4KLVA 4CYNA 3FH4A 3PB6X 1QSMA 3LWUA 1M1DA 4KUAA 3MRUA 3SXNA 4X5KA 1GHEA 1S60A 4CGPA 5HH1A 3VARA 3WC5A 5F09A 3GKRA 3SHPA 2AFSA 3B35A 4KZTA 2EUIA 2ZOGA 4R3LA 1CP7A 4UFVA 4R57A 4CYPA 3IU1A 2PVVA 4F9VA 2PCUA 2DPTA 2J8MA 1BO4A 3IIBA 5JPHA 1NSAA 4PXEA 1CPXA 4NGNA 2B58A 5I4MA 4Q36A 4JD6A 3WT4A 4ZGYB 3S6FA 1Z8XA 2PIYA 1YVOA 3EFAA 4A2ZA 1LFWA 3JTKA 4AVBA 2ZELA 4HNXB 1QMUA 3KI9A 3KQXA 4ONUA 2WUUA 3UY5A 5GCNA 2XEIA 1XF8A 2K5TA 3BLNA 1X10A 2ZEOA 2EWBA 2PJBA 5HMNA 4B5PB 4G1PA 1ZG9A 2JEWA 5G1ZA 4E2AA 5G22A 1S7NA 2NMTA 5LYFA 1FT7A 3KQZA 5G20A 3D2PA 2GFQA 2P6FA 3H8EA 3L2NA 5LYLA 1M4LA 4ORFA 3R96A 4EMEA 4KOSA 1DE4C 5J1QA 1NSLA 4EWTA 1KUYA 3KR5A 4CAEA 5F49A 1MK4A 1TIQA 2HQYA 4R87A 3G3SA 4NGMA 4FBEA 1XMBA 1F2PA 3BJ7A 2PC1A 3I3GA 4B14A 3VWEA 3ZJ0A 4M85A 4B5PA 5LRGA 1B87A 1XFOA 2J8NA 3D68A 4KVOE 1HDUA 4UA3A 5KTDA 4PSWA 2ZEPA 3NE7A 1Z9UA 1NE9A 4X2TA 2J8RA 2AE6A 3P2FA 4KOVA 2G0BA 1P4NA 3K9UA 2FE7A 1F57A 2EK9A 3DNSA 2H5MA 3NH4A 4P4FA 4MFPA 4P4DA 5F46A 2Y0MA 4IHMA 3TE4A 1Q7LA 3TFYA 2Q44A 1X12A 1SQHA 4MCRA 2AJ6A 4FWUA 3W91A 4CAXA 4KOXA 2CTBA 4YWYA 4NGQA 1N71A 2PJ5A 3NH5A 1VGYA 4R3KA 3GYAA 3CZXA 3KASA 2VBQA 1CX8A 1IGBA 1IICA 2OU2A 3N7ZA 4OLLA 2VZYA 3D2MA 2ZW5A 3FEDA 3QNVA 2GE3A 1YW6A 4UFWA 2JBJA 2B4DB 2FS5A 3JVNA 4TNUA 4YFJA 2CF4A 5AG6A 4CGLA 4A94A 2OOTA 2OR4A 3RAMA 2HV2A 4JWPA 1QQ9A 3FX6A 3G8WA 2Q7BA 3B2YA 1WK4A 2Q4ZA 1YSJA 2IJZA 4H6UA 2J9AA 3S6KA 5AG7A 4MFJA 3RYOA 3D3SA 5HVFA 2GIVA 3IU2A 4XPDC 3IC1A 3NFZA 5EMIA 5JM6A 1H8LA 2Z3NA 3H5ZA 3WR7A 2PJ8A 2PJ6A 1XJOA 2VXKA 2FIWA 3D4UA 2B4DA 3JUWA 1F2OA 1PYTB 2PJ0A 2Z11A 2ZEGA 2ZEEA 3SJGA 2PVWA 4NSQA 4NXYA 5E96A 2Z3PA 3LD2A 2ZW6A 1AMPA 1CPSA 1Z4EA 2C1CA 1Q2YA 1Y0YA 2Q0YA 4MFLA 4F0YA 1LANA 1LOKA 2GLJA 5A27A 5K8PA 3EY5A 5IX3A 3SI1A 3QAHA 5IB0A 4I49A 1RXTA 4OADA 1PUAA 2R7HA 4JZ0A 2P6EA 5JGFA 1RO5A 4OIWA 4XPDB 4C2ZA 4ZY0A 3BI1A 4K3NA 4Q38A 1V0CA 3D8PA 1ELMP 4M6HA 1IIDA 5JQ4A 2B5GB 4QVTA 3FBUA 2VZZA 3N5FA 1S3ZA 3K2KA 4IUSA 3SI2A 3OWCA 2DXQA 1CBXA 4ZI6A 4MFZA 5F47A 4HNYB 1NMTA 2I3CA 3R9FA 4MMOA 2PJ2A 4UWIA 4JLYA 4U9YA 3NH8A 1S7LA 1YQEA 1XBUA 3QAYA 4CS0B 5AG5A 4PXBA 3BJ8A 2GREA 2RC4A 2I00A 3MN8A 3DR6A 2CXAA 2PRQA 5D29A 1CJWA 3PEIA 4CGOA 3PB4X 4AG9A 4Q7AA 4GXHA 4RUHA 3DLJA 2FXFA 4EFDA 3PFOA 2B5GA 1ZG8A 2BOAA 3KHXA 3PB8X 3W6SA 2HC9A 4OC3A 2B3UA 1IYKA 4JJXA 4XNHC 4ZYQA 3BHXA 4KSIA 3FB3A 4NJQA 5DWMA 4F6AA 4UEZA 4IK2A 2NSMA 4C68A 3TX8A 3GY9A 4MY3A 1WWZA 2ZEMA 2Q51A 4MHZA 1KZFA 4RS2A 2HB6A 2QIRA 3SXOA 4NJRA 2C6PA 1IOFA 1YREA 2CNSA 2PQ8A 4ZY2A 4MHNA 4MHYA 4FAIA 4M6IA 1ZLHA 2DF5A 1MJBA 4OC4A 1LCPA 2G3AA 4PK2A 2JDCA 4B10A 4DUKA 3P2HA 3FJUA 1FY7A 2PDOA 2ZW7A 2ANPA 3F8KA 3IWWA 2AFZA 4KVME 4M6GA 1Q2DA 1AUGA 4ZX8A 3TC8A 4C2YA 2EBJA 4MFKA 1Z8TA 1QSOA 3VATA 2OB0A 5H86A 5BWAB 1LRZA 2REFA 5KTCA 2PJ7A 4PPZA 4UF4A 3TOAA 2CNTA 3PZJA 3B3CA 3LMSA 5H84A 4MHDA 2PJ4A 2POKA 4P44A 2IQ6A 1YLOA 2EO8A 2V8VA 4A30A 4ZX9A 4L89A 2CIJA 3VH9A 4RI1A 4PK3A 2FIAA 4FD6A 4DNCA 4QB9A 2WSAA 2RB7A 5CBMA 5IB9A 4CAWA 1U6MA 3TCVA 5J8FA 5LYDA 4CGNA 3MGDA 3F0AA 2C27A 3D67A 3TO9A 3IJ3A 1VHEA 4B13A 3CXPA 1YK3A 3FMCA 2REEA 4R9MA 2Z3OA 4ZBGA 4NGPA 5D8NA 2AFOA 4K30A 4UCMA 3SJFA 3WC6A 3B3SA 4OP4A 2Z3LA 2WZNA 4CRYB 4AB7A 2I79A 1IY7A 1I21A 1B6BA 1TF9A 3CXSA 4QC6A 3GB0A 3HUVA 2HUZA 2DEAA 2V77A 2ZENA 4L8AA 2PE3A 4P45A 2GU2A 4A95A 3PRTA 1M4IA 1YW4A 2VQYA 4A31A 4P4JA 3H4QA 2DPSA 2P0WA 3ZZIA 1S7FA 3FYNA 1KUVA 2R98A 5C82A 2V8DA 3TTHA 1R57A 3NA6A 1R3NA 4II9A 1HDQA 3R9EA 5K8NA 4X8IA 1M44A 1ZG7A 3DGVA 4M3SA 1Z5RA 1XRYA 4KLWA 4MRIA 1Z4RA 4OC2A 3V8IA 3PBEA 2VL1A 3CDXA 3IFEA 1XE4A 1Y9WA 4MCQA 4LQ6A 4UCPA 4BBHA 3S9MA 2ZEHA 4NCZA 2FT0A 2YNCC 1VHOA 5EBVA 4NGTA 4YRHA 2WPWA 2ZEFA 2ZPAA 2C6GA 4FD7A 4OC0A 1Y7RA 3D7FA 4U9ZA 2ZW4A 4MI4A 2FVGA 2PJCA 3R1KA 5CNPA 2Q43A 2AFMA 2B4BA 1TF8A 5THWA 2CY2A 2ZOFA 3FNCA 4OC5A 3PB7X 4KOYA 3DSBA 5AGEA 4CGMA 1K4JA 4CPAA 3TO6A 3EXNA 1KUXA 2AFWA 3DDDA 4KOUA 4MJ8A 4OAEA 2QJ8A 3KKWA 3PBBA 4UEFA 4F0XA 3PGPA 2Q4YA 2BCOA 4LQGA 4R7MA 4P10A 4Z65A 4XNHB 3B7IA 4O23A 3TOBA 4UEEA 3D7GA 4AVAA 3RNZA 1FNOA 1R43A 4PXCA 4P4EA 3H8FA 1UFHA 1Z8LA 2Z3KA 2G9DA 1VKCA 2XEGA 3LACA 1CM0A 5ISVA 2BSWA 3CPXA 2F5IA 1HEEA 4W9YA 3TO7A 4Y49C 4B6ZA 4UCNA 3ISXA 2NYQA 2ZXVA 4UIAA 5HXDA 1BPNA 2BEIA 1BPMA 3WABA 3I9SA 5AG4A 2BO9A 2Q4VA 4HPSA 4MCSA 2JBKA 1I1DA 3E0KA 3KR4A 1VHSA 3BXMA 2YNCA 4C7HA 1DTDA 2FCKA 3IWEA 1ARMA 1M4GA 3CXQA 3FXTA 1Z8WA 2IMOA 2GANA 2PR8A 2QVPA 2EVNA 2PRBA 3IO1A 3SJEA 1MJAA 1QSTA 2B3VA 2F7VA 4CYOA 4ONWA 2O28A 5I0CA 1ZO0A 2AFUA 4JXRA 1Y9KA 3B8GA 4OC1A 2PJ9A 4J3GA 5DS0A 2Q7SA 1ARLA 3FF3A 4Y49B 3KGQA 1XEBA 4PSXA 4KSAA 4FD5A 4P6YA 4TWEA 1IU8A 3IWGA 4A38A 7CPAA 3S6GA 3GLJA 4R8FA 1A2ZA 1XMTA 3RBUA 2A4NA 2O53A 3FRMA 4JYWA 4B5OA 1S5KA 3B3VA 2GLFA 3ISZA 3T9YA 2QECA 1P0HA 4KVXA 2JEVA 4P4IA 3DR8A 3VWDA 2BUEA 2RFHA 2OH1A 1IOIA
chains in the Genus database with same CATH topology
1I12A 4XPLA 1YX0A 4CAFA 2Q04A 2KCWA 4MFQA 2G3TA 1QSRA 2YNDA 4KS9A 4KSFA 4GS4A 1YR0A 4CYQA 1MJ9A 2JDDA 5EC4A 4LX9A 2YNEA 2D4OA 4KOWA 4NF1A 3EO4A 4QBJA 4KUBA 2VI7A 1S7KA 4C7IA 4B12A 1IYLA 4MY0A 3A9LA 4BMHA 1BOBA 5IV0A 4FD4A 2VEZA 2QMLA 1ON0A 3IGRA 5A28A 3LODA 5C88A 3F5BA 4H89A 5J8CA 2P6GA 3R9GA 2OZGA 4XPKA 4UBRA 2PR1A 5DWNA 1YGHA 2OZUA 3C26A 3QB8A 1XIXA 1YVKA 2PSWA 4ZGYB 2R1IA 4AVCA 2Z3MA 4JXQA 4HNWB 4IF5A 3R95A 2ARHA 2Z10A 4UWJA 2FL4A 3W6XA 3S6HA 4EVYA 3FIXA 4HKFA 1L0CA 1QSNA 1OZPA 2CNMA 2JLMA 1Q2CA 2ATRA 4MBUA 4H6ZA 2YGWA 1PU9A 2FSRA 4E0AA 4KOTA 4QUSA 1IB1E 4A33A 3TT2A 4NEXA 4YGOA 4LUAA 1M4DA 5FVJA 2R8VA 4E8OA 2BL1A 4AG7A 2OZHA 4CAVA 4C2XA 2WPXA 4A32A 2D4PA 5G21A 1YLEA 3T90A 4PV6A 5F48A 4UFXA 4CRZB 2X7BA 2Z0ZA 4B11A 2IL4A 5KTAA 4U5YA 3PP9A 1J4JA 3EC4A 4KORA 4KLVA 4CYNA 1QSMA 1M1DA 4KUAA 3SXNA 4X5KA 1GHEA 1S60A 4CGPA 5HH1A 3GKRA 3SHPA 4KZTA 2EUIA 4R3LA 4CYPA 4UFVA 4R57A 3IU1A 2DPTA 2J8MA 1BO4A 5JPHA 2B58A 4Q36A 4JD6A 3S6FA 1YVOA 3EFAA 4A2ZA 3JTKA 4AVBA 4HNXB 4ONUA 3UY5A 2WUUA 5GCNA 1XF8A 2K5TA 3BLNA 5HMNA 4B5PB 5G1ZA 4E2AA 5G22A 1S7NA 2NMTA 5G20A 3D2PA 2P6FA 4ORFA 3R96A 4KOSA 1NSLA 1KUYA 4CAEA 5F49A 1MK4A 1TIQA 2HQYA 4R87A 3G3SA 3BJ7A 2PC1A 3I3GA 4B14A 3VWEA 3ZJ0A 4M85A 4B5PA 1B87A 2J8NA 4KVOE 4UA3A 5KTDA 4PSWA 3NE7A 1Z9UA 1NE9A 2J8RA 2AE6A 3P2FA 4KOVA 2G0BA 1P4NA 3K9UA 2FE7A 3DNSA 2H5MA 4MFPA 5F46A 2Y0MA 3TE4A 3TFYA 2Q44A 1SQHA 2AJ6A 3W91A 4CAXA 4KOXA 1N71A 4R3KA 3GYAA 2VBQA 2OU2A 1IICA 3N7ZA 4OLLA 2VZYA 3D2MA 2ZW5A 2GE3A 4UFWA 2B4DB 2FS5A 3JVNA 4YFJA 5AG6A 4CGLA 2HV2A 4JWPA 3G8WA 2Q7BA 1WK4A 4H6UA 3S6KA 5AG7A 4MFJA 3RYOA 3D3SA 2GIVA 3IU2A 4XPDC 2Z3NA 3H5ZA 3WR7A 2VXKA 2FIWA 2B4DA 3JUWA 2Z11A 4NSQA 4NXYA 5E96A 2Z3PA 3LD2A 2ZW6A 1Z4EA 1Q2YA 2Q0YA 4MFLA 4F0YA 5A27A 3EY5A 5IX3A 3QAHA 5IB0A 4I49A 1RXTA 4OADA 1PUAA 2R7HA 2P6EA 1RO5A 4XPDB 4C2ZA 4Q38A 1V0CA 3D8PA 1IIDA 5JQ4A 2B5GB 4QVTA 3FBUA 2VZZA 4IUSA 1S3ZA 3OWCA 2DXQA 4MFZA 5F47A 4HNYB 1NMTA 3R9FA 4UWIA 4JLYA 4U9YA 1S7LA 4CS0B 5AG5A 3BJ8A 2RC4A 2I00A 3DR6A 2CXAA 1CJWA 4CGOA 4AG9A 2FXFA 2B5GA 3W6SA 2B3UA 1IYKA 4JJXA 4XNHC 3FB3A 5DWMA 4F6AA 4C68A 3GY9A 4MY3A 1WWZA 1KZFA 4RS2A 2QIRA 3SXOA 1YREA 2CNSA 2PQ8A 1MJBA 2G3AA 4PK2A 2JDCA 4B10A 3P2HA 1FY7A 2PDOA 2ZW7A 3F8KA 4KVME 1Q2DA 4C2YA 4MFKA 1QSOA 2OB0A 5H86A 5BWAB 1LRZA 2REFA 5KTCA 3TOAA 2CNTA 3PZJA 5H84A 4MHDA 4A30A 4L89A 4RI1A 4PK3A 2FIAA 4FD6A 4DNCA 4QB9A 2WSAA 4CAWA 1U6MA 3TCVA 5J8FA 4CGNA 3MGDA 3F0AA 2C27A 3TO9A 4B13A 1YK3A 2REEA 4R9MA 2Z3OA 4ZBGA 4K30A 4UCMA 2Z3LA 4CRYB 4AB7A 2I79A 1I21A 1B6BA 3CXSA 4QC6A 4L8AA 2HUZA 4A95A 1M4IA 2VQYA 4A31A 3H4QA 2DPSA 2P0WA 3ZZIA 1S7FA 3FYNA 1KUVA 2R98A 5C82A 3TTHA 1R57A 4II9A 3R9EA 2BUEA 1M44A 4M3SA 3V8IA 4KLWA 1Z4RA 4UCPA 1XE4A 1Y9WA 4BBHA 4NCZA 2FT0A 2YNCC 5EBVA 4YRHA 2WPWA 2ZPAA 4FD7A 1Y7RA 4U9ZA 2ZW4A 4MI4A 3R1KA 5CNPA 2B4BA 2CY2A 3FNCA 4KOYA 3DSBA 5AGEA 4CGMA 1K4JA 3TO6A 3EXNA 1KUXA 4KOUA 3DDDA 4MJ8A 4OAEA 4F0XA 3KKWA 3PGPA 2Q4YA 4XNHB 3TOBA 4AVAA 1UFHA 2Z3KA 1VKCA 1CM0A 5ISVA 2BSWA 2F5IA 3TO7A 4Y49C 4UCNA 2ZXVA 2BEIA 3I9SA 5AG4A 2Q4VA 1I1DA 3E0KA 1VHSA 2YNCA 4C7HA 2FCKA 3IWEA 1M4GA 3CXQA 3FXTA 2GANA 2PR8A 2EVNA 2PRBA 4CYOA 1MJAA 1QSTA 2B3VA 2O28A 5I0CA 1ZO0A 4JXRA 1Y9KA 3B8GA 4J3GA 4Y49B 1XEBA 4PSXA 4KSAA 4FD5A 3IWGA 3S6GA 1XMTA 2A4NA 3FRMA 4B5OA 1S5KA 3T9YA 2QECA 1P0HA 4KVXA 2JEVA 3DR8A 3VWDA 3CXPA 2OH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I12 A;  4XPL A;  1YX0 A;  2Q04 A;  2KCW A;  2G3T A;  1QSR A;  4GS4 A;  1YR0 A;  1MJ9 A;  2JDD A;  5EC4 A;  4LX9 A;  2D4O A;  4KOW A;  4NF1 A;  3EO4 A;  4QBJ A;  4KUB A;  2VI7 A;  1S7K A;  1IYL A;  4MY0 A;  4BMH A;  1BOB A;  5IV0 A;  4FD4 A;  2VEZ A;  2QML A;  1ON0 A;  3IGR A;  3LOD A;  5C88 A;  3F5B A;  4H89 A;  5J8C A;  2P6G A;  3R9G A;  2OZG A;  4XPK A;  4UBR A;  2PR1 A;  5DWN A;  1YGH A;  2OZU A;  3C26 A;  3QB8 A;  1XIX A;  1YVK A;  2PSW A;  2R1I A;  4AVC A;  4JXQ A;  4HNW B;  4IF5 A;  3R95 A;  2ARH A;  2Z10 A;  4UWJ A;  2FL4 A;  3W6X A;  3S6H A;  4EVY A;  3FIX A;  4HKF A;  1L0C A;  1QSN A;  1OZP A;  2CNM A;  2JLM A;  1Q2C A;  2ATR A;  4MBU A;  4H6Z A;  1PU9 A;  2FSR A;  4E0A A;  4KOT A;  4QUS A;  1IB1 E;  3TT2 A;  4NEX A;  4YGO A;  4LUA A;  1M4D A;  5FVJ A;  2R8V A;  4E8O A;  2BL1 A;  4AG7 A;  2OZH A;  4CAV A;  2WPX A;  2D4P A;  1YLE A;  3T90 A;  4PV6 A;  5F48 A;  4CRZ B;  2X7B A;  2Z0Z A;  2IL4 A;  5KTA A;  4U5Y A;  3PP9 A;  1J4J A;  3EC4 A;  4KOR A;  4KLV A;  1QSM A;  1M1D A;  4KUA A;  3SXN A;  4X5K A;  1GHE A;  1S60 A;  5HH1 A;  3GKR A;  3SHP A;  4KZT A;  2EUI A;  4R3L A;  4R57 A;  2J8M A;  1BO4 A;  5JPH A;  2B58 A;  4JD6 A;  3S6F A;  1YVO A;  3EFA A;  4AVB A;  4HNX B;  4ONU A;  3UY5 A;  5GCN A;  1XF8 A;  2K5T A;  3BLN A;  5HMN A;  4B5P B;  4E2A A;  1S7N A;  2NMT A;  3D2P A;  2P6F A;  4ORF A;  3R96 A;  4KOS A;  1NSL A;  1KUY A;  5F49 A;  1MK4 A;  1TIQ A;  2HQY A;  4R87 A;  3G3S A;  3BJ7 A;  2PC1 A;  3I3G A;  3VWE A;  3ZJ0 A;  4M85 A;  4B5P A;  1B87 A;  2J8N A;  4KVO E;  4UA3 A;  5KTD A;  4PSW A;  3NE7 A;  1Z9U A;  1NE9 A;  2J8R A;  2AE6 A;  4KOV A;  3P2F A;  2G0B A;  1P4N A;  3K9U A;  2FE7 A;  3DNS A;  2H5M A;  5F46 A;  2Y0M A;  3TE4 A;  3TFY A;  2Q44 A;  1SQH A;  2AJ6 A;  3W91 A;  4CAX A;  4KOX A;  1N71 A;  4R3K A;  3GYA A;  2VBQ A;  2OU2 A;  1IIC A;  3N7Z A;  4OLL A;  2VZY A;  3D2M A;  2ZW5 A;  2GE3 A;  2B4D B;  2FS5 A;  3JVN A;  4YFJ A;  2HV2 A;  4JWP A;  3G8W A;  2Q7B A;  1WK4 A;  4H6U A;  3S6K A;  3RYO A;  3D3S A;  2GIV A;  4XPD C;  3WR7 A;  2VXK A;  2FIW A;  2B4D A;  3JUW A;  2Z11 A;  4NSQ A;  4NXY A;  5E96 A;  3LD2 A;  2ZW6 A;  1Z4E A;  1Q2Y A;  2Q0Y A;  4F0Y A;  3EY5 A;  5IX3 A;  3QAH A;  5IB0 A;  4I49 A;  1RXT A;  4OAD A;  1PUA A;  2R7H A;  2P6E A;  1RO5 A;  4XPD B;  1V0C A;  3D8P A;  1IID A;  5JQ4 A;  2B5G B;  4QVT A;  3FBU A;  2VZZ A;  4IUS A;  1S3Z A;  3OWC A;  2DXQ A;  5F47 A;  4HNY B;  1NMT A;  3R9F A;  4UWI A;  4JLY A;  4U9Y A;  1S7L A;  4CS0 B;  3BJ8 A;  2RC4 A;  2I00 A;  3DR6 A;  1CJW A;  4AG9 A;  2FXF A;  2B5G A;  3W6S A;  2B3U A;  1IYK A;  4JJX A;  4XNH C;  3FB3 A;  5DWM A;  4F6A A;  3GY9 A;  4MY3 A;  1WWZ A;  1KZF A;  4RS2 A;  2QIR A;  3SXO A;  1YRE A;  2CNS A;  2PQ8 A;  1MJB A;  2G3A A;  4PK2 A;  2JDC A;  3P2H A;  1FY7 A;  2PDO A;  2ZW7 A;  3F8K A;  4KVM E;  1Q2D A;  1QSO A;  2OB0 A;  5H86 A;  5KTC A;  1LRZ A;  2REF A;  3TOA A;  2CNT A;  3PZJ A;  5H84 A;  4MHD A;  4L89 A;  4RI1 A;  4PK3 A;  2FIA A;  4FD6 A;  4DNC A;  4QB9 A;  4CAW A;  1U6M A;  3TCV A;  5J8F A;  3MGD A;  3F0A A;  2C27 A;  3TO9 A;  1YK3 A;  2REE A;  4R9M A;  4ZBG A;  4K30 A;  4CRY B;  4AB7 A;  2I79 A;  1I21 A;  1B6B A;  3CXS A;  4QC6 A;  4L8A A;  2HUZ A;  1M4I A;  2VQY A;  3H4Q A;  2P0W A;  3ZZI A;  1S7F A;  3FYN A;  1KUV A;  2R98 A;  5C82 A;  3TTH A;  1R57 A;  4II9 A;  3R9E A;  2BUE A;  1M44 A;  4M3S A;  3V8I A;  4KLW A;  1Z4R A;  1XE4 A;  1Y9W A;  4NCZ A;  2FT0 A;  5EBV A;  4YRH A;  2WPW A;  2ZPA A;  4FD7 A;  1Y7R A;  4U9Z A;  2ZW4 A;  4MI4 A;  3R1K A;  5CNP A;  2B4B A;  2CY2 A;  3FNC A;  4KOY A;  3DSB A;  1K4J A;  3TO6 A;  3EXN A;  1KUX A;  4KOU A;  3DDD A;  4MJ8 A;  4OAE A;  3KKW A;  3PGP A;  2Q4Y A;  4XNH B;  3TOB A;  4AVA A;  1UFH A;  1VKC A;  1CM0 A;  5ISV A;  2BSW A;  2F5I A;  3TO7 A;  4Y49 C;  2ZXV A;  2BEI A;  3I9S A;  2Q4V A;  1I1D A;  3E0K A;  1VHS A;  2FCK A;  1M4G A;  3CXQ A;  3FXT A;  2GAN A;  2PR8 A;  2EVN A;  2PRB A;  1MJA A;  1QST A;  2B3V A;  2O28 A;  5I0C A;  4JXR A;  1Y9K A;  3B8G A;  4J3G A;  4Y49 B;  1XEB A;  4PSX A;  4FD5 A;  3IWG A;  3S6G A;  1XMT A;  2A4N A;  3FRM A;  4B5O A;  1S5K A;  3T9Y A;  2QEC A;  1P0H A;  4KVX A;  2JEV A;  3DR8 A;  3VWD A;  3CXP A;  2OH1 A; 
#chains in the Genus database with same CATH topology
 1I12 A;  4NGS A;  1BAV A;  2ODF A;  4XPL A;  2XEF A;  1YX0 A;  4CAF A;  3PB9 X;  2Q04 A;  3H8G A;  1Y0R A;  3GIU A;  4ZY1 A;  2KCW A;  4MFQ A;  1ZLI A;  2G3T A;  3WC7 A;  1QSR A;  2ABZ A;  4A37 A;  4F9U A;  2YND A;  4KS9 A;  4KSF A;  4NFR A;  2CTC A;  4PQA A;  2PJ3 A;  4GS4 A;  4WWV A;  5HVG A;  1YR0 A;  4CYQ A;  3K9T A;  1MJ9 A;  2JDD A;  5EC4 A;  4LX9 A;  2YNE A;  2D4O A;  4KOW A;  4NF1 A;  2V8G A;  3FVL A;  3EO4 A;  3FEE A;  4OKO A;  4DJL A;  4YU9 A;  3CPA A;  4QBJ A;  3HLP A;  4KUB A;  1TXR A;  5ELY A;  1LAM A;  3B3T A;  8CPA A;  2VI7 A;  1S7K A;  4R6T A;  4OID A;  4C7I A;  3BI0 A;  4B12 A;  1IYL A;  4MY0 A;  3S9N A;  3A9L A;  4BMH A;  2EK8 A;  3JRU A;  1BOB A;  5IV0 A;  4FD4 A;  2VEZ A;  1YME A;  1ON0 A;  2QML A;  3IGR A;  4DYO A;  4IAV A;  3LOD A;  4WJB A;  5A28 A;  5C88 A;  3F5B A;  4H2K A;  4H89 A;  5CPA A;  3KHZ A;  3SJX A;  5J8C A;  5K8O A;  1ELL P;  2P6G A;  4OME A;  3R9G A;  4UIB A;  1Z2L A;  2OZG A;  4MHP A;  4XPK A;  3IEH A;  4UBR A;  3B3W A;  4PXD A;  2PR1 A;  2ZED A;  5DWN A;  4NGR A;  1YGH A;  2OZU A;  3C26 A;  3QB8 A;  1XIX A;  1YVK A;  2PSW A;  2C6C A;  1OBR A;  1UWY A;  2R1I A;  4AVC A;  2Z3M A;  4JXQ A;  1TKJ A;  4HNW B;  2F8H A;  4R76 A;  3D66 A;  3KZW A;  4IF5 A;  3R95 A;  1TKH A;  2ARH A;  2Z10 A;  3CT9 A;  4UWJ A;  5LRJ A;  2FL4 A;  3W6X A;  2AFX A;  5K8M A;  3S6H A;  1JQG A;  1TKF A;  3FIX A;  4EVY A;  3T8W A;  5LRK A;  1VIX A;  4HKF A;  1L0C A;  1QSN A;  1OZP A;  2CNM A;  2JLM A;  1Q2C A;  2ATR A;  4MBU A;  3RZA A;  1XOV A;  4H6Z A;  4FUU A;  5HVH A;  2QYV A;  1AYE A;  2YGW A;  1PU9 A;  2FSR A;  4E0A A;  4KOT A;  4QUS A;  1IB1 E;  4MXU A;  3V7Z A;  4A33 A;  1Y7E A;  3TT2 A;  2V8H A;  4NEX A;  4YGO A;  2O4H A;  3FEC A;  3SI0 A;  1KWM A;  4RN7 A;  4LUA A;  1M4D A;  5FVJ A;  2R8V A;  3PFE A;  4E8O A;  3S9L A;  1JWQ A;  2BL1 A;  4AG7 A;  4BD9 A;  3I1U A;  1LAP A;  2OZH A;  5JH9 A;  4X3R A;  3V38 A;  4C2X A;  4CAV A;  2WPX A;  2PJA A;  3D7D A;  4A32 A;  2D4P A;  4MCP A;  5G21 A;  4F8Z A;  1YLE A;  3T90 A;  4PV6 A;  4P4B A;  5F48 A;  4BIN A;  1RTQ A;  2PIZ A;  1GYT A;  2WYR A;  4UFX A;  4CRZ B;  2X7B A;  6CPA A;  2Z0Z A;  2PJ1 A;  5LYI A;  3NE8 A;  4B11 A;  1BLL E;  4A39 A;  3GUX A;  2IL4 A;  4GM5 A;  5KTA A;  1EE3 P;  3D7H A;  2XEJ A;  1PCA A;  4AXV A;  3KL9 A;  4U5Y A;  3PP9 A;  1J4J A;  3EC4 A;  3RO0 A;  4KOR A;  1CP6 A;  1CG2 A;  4KLV A;  4CYN A;  3FH4 A;  3PB6 X;  1QSM A;  3LWU A;  1M1D A;  4KUA A;  3MRU A;  3SXN A;  4X5K A;  1GHE A;  1S60 A;  4CGP A;  5HH1 A;  3VAR A;  3WC5 A;  5F09 A;  3GKR A;  3SHP A;  2AFS A;  3B35 A;  4KZT A;  2EUI A;  2ZOG A;  4R3L A;  1CP7 A;  4UFV A;  4R57 A;  4CYP A;  3IU1 A;  2PVV A;  4F9V A;  2PCU A;  2DPT A;  2J8M A;  1BO4 A;  3IIB A;  5JPH A;  1NSA A;  4PXE A;  1CPX A;  4NGN A;  2B58 A;  5I4M A;  4Q36 A;  4JD6 A;  3WT4 A;  4ZGY B;  3S6F A;  1Z8X A;  2PIY A;  1YVO A;  3EFA A;  4A2Z A;  1LFW A;  3JTK A;  4AVB A;  2ZEL A;  4HNX B;  1QMU A;  3KI9 A;  3KQX A;  4ONU A;  2WUU A;  3UY5 A;  5GCN A;  2XEI A;  1XF8 A;  2K5T A;  3BLN A;  1X10 A;  2ZEO A;  2EWB A;  2PJB A;  5HMN A;  4B5P B;  4G1P A;  1ZG9 A;  2JEW A;  5G1Z A;  4E2A A;  5G22 A;  1S7N A;  2NMT A;  5LYF A;  1FT7 A;  3KQZ A;  5G20 A;  3D2P A;  2GFQ A;  2P6F A;  3H8E A;  3L2N A;  5LYL A;  1M4L A;  4ORF A;  3R96 A;  4EME A;  4KOS A;  1DE4 C;  5J1Q A;  1NSL A;  4EWT A;  1KUY A;  3KR5 A;  4CAE A;  5F49 A;  1MK4 A;  1TIQ A;  2HQY A;  4R87 A;  3G3S A;  4NGM A;  4FBE A;  1XMB A;  1F2P A;  3BJ7 A;  2PC1 A;  3I3G A;  4B14 A;  3VWE A;  3ZJ0 A;  4M85 A;  4B5P A;  5LRG A;  1B87 A;  1XFO A;  2J8N A;  3D68 A;  4KVO E;  1HDU A;  4UA3 A;  5KTD A;  4PSW A;  2ZEP A;  3NE7 A;  1Z9U A;  1NE9 A;  4X2T A;  2J8R A;  2AE6 A;  3P2F A;  4KOV A;  2G0B A;  1P4N A;  3K9U A;  2FE7 A;  1F57 A;  2EK9 A;  3DNS A;  2H5M A;  3NH4 A;  4P4F A;  4MFP A;  4P4D A;  5F46 A;  2Y0M A;  4IHM A;  3TE4 A;  1Q7L A;  3TFY A;  2Q44 A;  1X12 A;  1SQH A;  4MCR A;  2AJ6 A;  4FWU A;  3W91 A;  4CAX A;  4KOX A;  2CTB A;  4YWY A;  4NGQ A;  1N71 A;  2PJ5 A;  3NH5 A;  1VGY A;  4R3K A;  3GYA A;  3CZX A;  3KAS A;  2VBQ A;  1CX8 A;  1IGB A;  1IIC A;  2OU2 A;  3N7Z A;  4OLL A;  2VZY A;  3D2M A;  2ZW5 A;  3FED A;  3QNV A;  2GE3 A;  1YW6 A;  4UFW A;  2JBJ A;  2B4D B;  2FS5 A;  3JVN A;  4TNU A;  4YFJ A;  2CF4 A;  5AG6 A;  4CGL A;  4A94 A;  2OOT A;  2OR4 A;  3RAM A;  2HV2 A;  4JWP A;  1QQ9 A;  3FX6 A;  3G8W A;  2Q7B A;  3B2Y A;  1WK4 A;  2Q4Z A;  1YSJ A;  2IJZ A;  4H6U A;  2J9A A;  3S6K A;  5AG7 A;  4MFJ A;  3RYO A;  3D3S A;  5HVF A;  2GIV A;  3IU2 A;  4XPD C;  3IC1 A;  3NFZ A;  5EMI A;  5JM6 A;  1H8L A;  2Z3N A;  3H5Z A;  3WR7 A;  2PJ8 A;  2PJ6 A;  1XJO A;  2VXK A;  2FIW A;  3D4U A;  2B4D A;  3JUW A;  1F2O A;  1PYT B;  2PJ0 A;  2Z11 A;  2ZEG A;  2ZEE A;  3SJG A;  2PVW A;  4NSQ A;  4NXY A;  5E96 A;  2Z3P A;  3LD2 A;  2ZW6 A;  1AMP A;  1CPS A;  1Z4E A;  2C1C A;  1Q2Y A;  1Y0Y A;  2Q0Y A;  4MFL A;  4F0Y A;  1LAN A;  1LOK A;  2GLJ A;  5A27 A;  5K8P A;  3EY5 A;  5IX3 A;  3SI1 A;  3QAH A;  5IB0 A;  4I49 A;  1RXT A;  4OAD A;  1PUA A;  2R7H A;  4JZ0 A;  2P6E A;  5JGF A;  1RO5 A;  4OIW A;  4XPD B;  4C2Z A;  4ZY0 A;  3BI1 A;  4K3N A;  4Q38 A;  1V0C A;  3D8P A;  1ELM P;  4M6H A;  1IID A;  5JQ4 A;  2B5G B;  4QVT A;  3FBU A;  2VZZ A;  3N5F A;  1S3Z A;  3K2K A;  4IUS A;  3SI2 A;  3OWC A;  2DXQ A;  1CBX A;  4ZI6 A;  4MFZ A;  5F47 A;  4HNY B;  1NMT A;  2I3C A;  3R9F A;  4MMO A;  2PJ2 A;  4UWI A;  4JLY A;  4U9Y A;  3NH8 A;  1S7L A;  1YQE A;  1XBU A;  3QAY A;  4CS0 B;  5AG5 A;  4PXB A;  3BJ8 A;  2GRE A;  2RC4 A;  2I00 A;  3MN8 A;  3DR6 A;  2CXA A;  2PRQ A;  5D29 A;  1CJW A;  3PEI A;  4CGO A;  3PB4 X;  4AG9 A;  4Q7A A;  4GXH A;  4RUH A;  3DLJ A;  2FXF A;  4EFD A;  3PFO A;  2B5G A;  1ZG8 A;  2BOA A;  3KHX A;  3PB8 X;  3W6S A;  2HC9 A;  4OC3 A;  2B3U A;  1IYK A;  4JJX A;  4XNH C;  4ZYQ A;  3BHX A;  4KSI A;  3FB3 A;  4NJQ A;  5DWM A;  4F6A A;  4UEZ A;  4IK2 A;  2NSM A;  4C68 A;  3TX8 A;  3GY9 A;  4MY3 A;  1WWZ A;  2ZEM A;  2Q51 A;  4MHZ A;  1KZF A;  4RS2 A;  2HB6 A;  2QIR A;  3SXO A;  4NJR A;  2C6P A;  1IOF A;  1YRE A;  2CNS A;  2PQ8 A;  4ZY2 A;  4MHN A;  4MHY A;  4FAI A;  4M6I A;  1ZLH A;  2DF5 A;  1MJB A;  4OC4 A;  1LCP A;  2G3A A;  4PK2 A;  2JDC A;  4B10 A;  4DUK A;  3P2H A;  3FJU A;  1FY7 A;  2PDO A;  2ZW7 A;  2ANP A;  3F8K A;  3IWW A;  2AFZ A;  4KVM E;  4M6G A;  1Q2D A;  1AUG A;  4ZX8 A;  3TC8 A;  4C2Y A;  2EBJ A;  4MFK A;  1Z8T A;  1QSO A;  3VAT A;  2OB0 A;  5H86 A;  5BWA B;  1LRZ A;  2REF A;  5KTC A;  2PJ7 A;  4PPZ A;  4UF4 A;  3TOA A;  2CNT A;  3PZJ A;  3B3C A;  3LMS A;  5H84 A;  4MHD A;  2PJ4 A;  2POK A;  4P44 A;  2IQ6 A;  1YLO A;  2EO8 A;  2V8V A;  4A30 A;  4ZX9 A;  4L89 A;  2CIJ A;  3VH9 A;  4RI1 A;  4PK3 A;  2FIA A;  4FD6 A;  4DNC A;  4QB9 A;  2WSA A;  2RB7 A;  5CBM A;  5IB9 A;  4CAW A;  1U6M A;  3TCV A;  5J8F A;  5LYD A;  4CGN A;  3MGD A;  3F0A A;  2C27 A;  3D67 A;  3TO9 A;  3IJ3 A;  1VHE A;  4B13 A;  3CXP A;  1YK3 A;  3FMC A;  2REE A;  4R9M A;  2Z3O A;  4ZBG A;  4NGP A;  5D8N A;  2AFO A;  4K30 A;  4UCM A;  3SJF A;  3WC6 A;  3B3S A;  4OP4 A;  2Z3L A;  2WZN A;  4CRY B;  4AB7 A;  2I79 A;  1IY7 A;  1I21 A;  1B6B A;  1TF9 A;  3CXS A;  4QC6 A;  3GB0 A;  3HUV A;  2HUZ A;  2DEA A;  2V77 A;  2ZEN A;  4L8A A;  2PE3 A;  4P45 A;  2GU2 A;  4A95 A;  3PRT A;  1M4I A;  1YW4 A;  2VQY A;  4A31 A;  4P4J A;  3H4Q A;  2DPS A;  2P0W A;  3ZZI A;  1S7F A;  3FYN A;  1KUV A;  2R98 A;  5C82 A;  2V8D A;  3TTH A;  1R57 A;  3NA6 A;  1R3N A;  4II9 A;  1HDQ A;  3R9E A;  5K8N A;  4X8I A;  1M44 A;  1ZG7 A;  3DGV A;  4M3S A;  1Z5R A;  1XRY A;  4KLW A;  4MRI A;  1Z4R A;  4OC2 A;  3V8I A;  3PBE A;  2VL1 A;  3CDX A;  3IFE A;  1XE4 A;  1Y9W A;  4MCQ A;  4LQ6 A;  4UCP A;  4BBH A;  3S9M A;  2ZEH A;  4NCZ A;  2FT0 A;  2YNC C;  1VHO A;  5EBV A;  4NGT A;  4YRH A;  2WPW A;  2ZEF A;  2ZPA A;  2C6G A;  4FD7 A;  4OC0 A;  1Y7R A;  3D7F A;  4U9Z A;  2ZW4 A;  4MI4 A;  2FVG A;  2PJC A;  3R1K A;  5CNP A;  2Q43 A;  2AFM A;  2B4B A;  1TF8 A;  5THW A;  2CY2 A;  2ZOF A;  3FNC A;  4OC5 A;  3PB7 X;  4KOY A;  3DSB A;  5AGE A;  4CGM A;  1K4J A;  4CPA A;  3TO6 A;  3EXN A;  1KUX A;  2AFW A;  3DDD A;  4KOU A;  4MJ8 A;  4OAE A;  2QJ8 A;  3KKW A;  3PBB A;  4UEF A;  4F0X A;  3PGP A;  2Q4Y A;  2BCO A;  4LQG A;  4R7M A;  4P10 A;  4Z65 A;  4XNH B;  3B7I A;  4O23 A;  3TOB A;  4UEE A;  3D7G A;  4AVA A;  3RNZ A;  1FNO A;  1R43 A;  4PXC A;  4P4E A;  3H8F A;  1UFH A;  1Z8L A;  2Z3K A;  2G9D A;  1VKC A;  2XEG A;  3LAC A;  1CM0 A;  5ISV A;  2BSW A;  3CPX A;  2F5I A;  1HEE A;  4W9Y A;  3TO7 A;  4Y49 C;  4B6Z A;  4UCN A;  3ISX A;  2NYQ A;  2ZXV A;  4UIA A;  5HXD A;  1BPN A;  2BEI A;  1BPM A;  3WAB A;  3I9S A;  5AG4 A;  2BO9 A;  2Q4V A;  4HPS A;  4MCS A;  2JBK A;  1I1D A;  3E0K A;  3KR4 A;  1VHS A;  3BXM A;  2YNC A;  4C7H A;  1DTD A;  2FCK A;  3IWE A;  1ARM A;  1M4G A;  3CXQ A;  3FXT A;  1Z8W A;  2IMO A;  2GAN A;  2PR8 A;  2QVP A;  2EVN A;  2PRB A;  3IO1 A;  3SJE A;  1MJA A;  1QST A;  2B3V A;  2F7V A;  4CYO A;  4ONW A;  2O28 A;  5I0C A;  1ZO0 A;  2AFU A;  4JXR A;  1Y9K A;  3B8G A;  4OC1 A;  2PJ9 A;  4J3G A;  5DS0 A;  2Q7S A;  1ARL A;  3FF3 A;  4Y49 B;  3KGQ A;  1XEB A;  4PSX A;  4KSA A;  4FD5 A;  4P6Y A;  4TWE A;  1IU8 A;  3IWG A;  4A38 A;  7CPA A;  3S6G A;  3GLJ A;  4R8F A;  1A2Z A;  1XMT A;  3RBU A;  2A4N A;  2O53 A;  3FRM A;  4JYW A;  4B5O A;  1S5K A;  3B3V A;  2GLF A;  3ISZ A;  3T9Y A;  2QEC A;  1P0H A;  4KVX A;  2JEV A;  4P4I A;  3DR8 A;  3VWD A;  2BUE A;  2RFH A;  2OH1 A;  1IOI A; 
#chains in the Genus database with same CATH homology
 1I12 A;  4XPL A;  1YX0 A;  4CAF A;  2Q04 A;  2KCW A;  4MFQ A;  2G3T A;  1QSR A;  2YND A;  4KS9 A;  4KSF A;  4GS4 A;  1YR0 A;  4CYQ A;  1MJ9 A;  2JDD A;  5EC4 A;  4LX9 A;  2YNE A;  2D4O A;  4KOW A;  4NF1 A;  3EO4 A;  4QBJ A;  4KUB A;  2VI7 A;  1S7K A;  4C7I A;  4B12 A;  1IYL A;  4MY0 A;  3A9L A;  4BMH A;  1BOB A;  5IV0 A;  4FD4 A;  2VEZ A;  2QML A;  1ON0 A;  3IGR A;  5A28 A;  3LOD A;  5C88 A;  3F5B A;  4H89 A;  5J8C A;  2P6G A;  3R9G A;  2OZG A;  4XPK A;  4UBR A;  2PR1 A;  5DWN A;  1YGH A;  2OZU A;  3C26 A;  3QB8 A;  1XIX A;  1YVK A;  2PSW A;  4ZGY B;  2R1I A;  4AVC A;  2Z3M A;  4JXQ A;  4HNW B;  4IF5 A;  3R95 A;  2ARH A;  2Z10 A;  4UWJ A;  2FL4 A;  3W6X A;  3S6H A;  4EVY A;  3FIX A;  4HKF A;  1L0C A;  1QSN A;  1OZP A;  2CNM A;  2JLM A;  1Q2C A;  2ATR A;  4MBU A;  4H6Z A;  2YGW A;  1PU9 A;  2FSR A;  4E0A A;  4KOT A;  4QUS A;  1IB1 E;  4A33 A;  3TT2 A;  4NEX A;  4YGO A;  4LUA A;  1M4D A;  5FVJ A;  2R8V A;  4E8O A;  2BL1 A;  4AG7 A;  2OZH A;  4CAV A;  4C2X A;  2WPX A;  4A32 A;  2D4P A;  5G21 A;  1YLE A;  3T90 A;  4PV6 A;  5F48 A;  4UFX A;  4CRZ B;  2X7B A;  2Z0Z A;  4B11 A;  2IL4 A;  5KTA A;  4U5Y A;  3PP9 A;  1J4J A;  3EC4 A;  4KOR A;  4KLV A;  4CYN A;  1QSM A;  1M1D A;  4KUA A;  3SXN A;  4X5K A;  1GHE A;  1S60 A;  4CGP A;  5HH1 A;  3GKR A;  3SHP A;  4KZT A;  2EUI A;  4R3L A;  4CYP A;  4UFV A;  4R57 A;  3IU1 A;  2DPT A;  2J8M A;  1BO4 A;  5JPH A;  2B58 A;  4Q36 A;  4JD6 A;  3S6F A;  1YVO A;  3EFA A;  4A2Z A;  3JTK A;  4AVB A;  4HNX B;  4ONU A;  3UY5 A;  2WUU A;  5GCN A;  1XF8 A;  2K5T A;  3BLN A;  5HMN A;  4B5P B;  5G1Z A;  4E2A A;  5G22 A;  1S7N A;  2NMT A;  5G20 A;  3D2P A;  2P6F A;  4ORF A;  3R96 A;  4KOS A;  1NSL A;  1KUY A;  4CAE A;  5F49 A;  1MK4 A;  1TIQ A;  2HQY A;  4R87 A;  3G3S A;  3BJ7 A;  2PC1 A;  3I3G A;  4B14 A;  3VWE A;  3ZJ0 A;  4M85 A;  4B5P A;  1B87 A;  2J8N A;  4KVO E;  4UA3 A;  5KTD A;  4PSW A;  3NE7 A;  1Z9U A;  1NE9 A;  2J8R A;  2AE6 A;  3P2F A;  4KOV A;  2G0B A;  1P4N A;  3K9U A;  2FE7 A;  3DNS A;  2H5M A;  4MFP A;  5F46 A;  2Y0M A;  3TE4 A;  3TFY A;  2Q44 A;  1SQH A;  2AJ6 A;  3W91 A;  4CAX A;  4KOX A;  1N71 A;  4R3K A;  3GYA A;  2VBQ A;  2OU2 A;  1IIC A;  3N7Z A;  4OLL A;  2VZY A;  3D2M A;  2ZW5 A;  2GE3 A;  4UFW A;  2B4D B;  2FS5 A;  3JVN A;  4YFJ A;  5AG6 A;  4CGL A;  2HV2 A;  4JWP A;  3G8W A;  2Q7B A;  1WK4 A;  4H6U A;  3S6K A;  5AG7 A;  4MFJ A;  3RYO A;  3D3S A;  2GIV A;  3IU2 A;  4XPD C;  2Z3N A;  3H5Z A;  3WR7 A;  2VXK A;  2FIW A;  2B4D A;  3JUW A;  2Z11 A;  4NSQ A;  4NXY A;  5E96 A;  2Z3P A;  3LD2 A;  2ZW6 A;  1Z4E A;  1Q2Y A;  2Q0Y A;  4MFL A;  4F0Y A;  5A27 A;  3EY5 A;  5IX3 A;  3QAH A;  5IB0 A;  4I49 A;  1RXT A;  4OAD A;  1PUA A;  2R7H A;  2P6E A;  1RO5 A;  4XPD B;  4C2Z A;  4Q38 A;  1V0C A;  3D8P A;  1IID A;  5JQ4 A;  2B5G B;  4QVT A;  3FBU A;  2VZZ A;  4IUS A;  1S3Z A;  3OWC A;  2DXQ A;  4MFZ A;  5F47 A;  4HNY B;  1NMT A;  3R9F A;  4UWI A;  4JLY A;  4U9Y A;  1S7L A;  4CS0 B;  5AG5 A;  3BJ8 A;  2RC4 A;  2I00 A;  3DR6 A;  2CXA A;  1CJW A;  4CGO A;  4AG9 A;  2FXF A;  2B5G A;  3W6S A;  2B3U A;  1IYK A;  4JJX A;  4XNH C;  3FB3 A;  5DWM A;  4F6A A;  4C68 A;  3GY9 A;  4MY3 A;  1WWZ A;  1KZF A;  4RS2 A;  2QIR A;  3SXO A;  1YRE A;  2CNS A;  2PQ8 A;  1MJB A;  2G3A A;  4PK2 A;  2JDC A;  4B10 A;  3P2H A;  1FY7 A;  2PDO A;  2ZW7 A;  3F8K A;  4KVM E;  1Q2D A;  4C2Y A;  4MFK A;  1QSO A;  2OB0 A;  5H86 A;  5BWA B;  1LRZ A;  2REF A;  5KTC A;  3TOA A;  2CNT A;  3PZJ A;  5H84 A;  4MHD A;  4A30 A;  4L89 A;  4RI1 A;  4PK3 A;  2FIA A;  4FD6 A;  4DNC A;  4QB9 A;  2WSA A;  4CAW A;  1U6M A;  3TCV A;  5J8F A;  4CGN A;  3MGD A;  3F0A A;  2C27 A;  3TO9 A;  4B13 A;  1YK3 A;  2REE A;  4R9M A;  2Z3O A;  4ZBG A;  4K30 A;  4UCM A;  2Z3L A;  4CRY B;  4AB7 A;  2I79 A;  1I21 A;  1B6B A;  3CXS A;  4QC6 A;  4L8A A;  2HUZ A;  4A95 A;  1M4I A;  2VQY A;  4A31 A;  3H4Q A;  2DPS A;  2P0W A;  3ZZI A;  1S7F A;  3FYN A;  1KUV A;  2R98 A;  5C82 A;  3TTH A;  1R57 A;  4II9 A;  3R9E A;  2BUE A;  1M44 A;  4M3S A;  3V8I A;  4KLW A;  1Z4R A;  4UCP A;  1XE4 A;  1Y9W A;  4BBH A;  4NCZ A;  2FT0 A;  2YNC C;  5EBV A;  4YRH A;  2WPW A;  2ZPA A;  4FD7 A;  1Y7R A;  4U9Z A;  2ZW4 A;  4MI4 A;  3R1K A;  5CNP A;  2B4B A;  2CY2 A;  3FNC A;  4KOY A;  3DSB A;  5AGE A;  4CGM A;  1K4J A;  3TO6 A;  3EXN A;  1KUX A;  4KOU A;  3DDD A;  4MJ8 A;  4OAE A;  4F0X A;  3KKW A;  3PGP A;  2Q4Y A;  4XNH B;  3TOB A;  4AVA A;  1UFH A;  2Z3K A;  1VKC A;  1CM0 A;  5ISV A;  2BSW A;  2F5I A;  3TO7 A;  4Y49 C;  4UCN A;  2ZXV A;  2BEI A;  3I9S A;  5AG4 A;  2Q4V A;  1I1D A;  3E0K A;  1VHS A;  2YNC A;  4C7H A;  2FCK A;  3IWE A;  1M4G A;  3CXQ A;  3FXT A;  2GAN A;  2PR8 A;  2EVN A;  2PRB A;  4CYO A;  1MJA A;  1QST A;  2B3V A;  2O28 A;  5I0C A;  1ZO0 A;  4JXR A;  1Y9K A;  3B8G A;  4J3G A;  4Y49 B;  1XEB A;  4PSX A;  4KSA A;  4FD5 A;  3IWG A;  3S6G A;  1XMT A;  2A4N A;  3FRM A;  4B5O A;  1S5K A;  3T9Y A;  2QEC A;  1P0H A;  4KVX A;  2JEV A;  3DR8 A;  3VWD A;  3CXP A;  2OH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...