3S6FA

Crystal structure of a putative acetyltransferase (dr_1678) from deinococcus radiodurans r1 at 1.19 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
143
structure length
143
Chain Sequence
MTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILAASIPLLEVQAGWRSLGLGSELMRRVLTELGDLYMVDLSCDDDVVPFYERLGLKRANAMFLRRYDNQAGIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical acetyltransferase
publication title Crystal structure of a Hypothetical acetyltransferase (DR_1678) from Deinococcus radiodurans at 1.19 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Transferase
total genus 33
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3s6fA00
2P6GA 3FIXA 1KUVA 5J8FA 2IL4A 1NSLA 3LODA 3SXNA 3SHPA 3CXQA 4XNHB 1S60A 4KLWA 3FRMA 5I0CA 3F0AA 4JXRA 3KKWA 4JJXA 3TOBA 4M85A 1M4IA 2FIWA 4MJ8A 3CXPA 3N7ZA 3R9FA 1YGHA 1YVOA 5EC4A 1LRZA 2PDOA 1KUYA 3T90A 3S6KA 3IWGA 1S5KA 1CJWA 2FL4A 4I49A 4OAEA 4KUBA 4E0AA 3P2HA 1QSRA 2HUZA 2G0BA 2FCKA 1Z4RA 2VBQA 4KLVA 1MJAA 3PGPA 4UBRA 1S7NA 2GE3A 3S6HA 4B5PA 2CNMA 1QSMA 4RS2A 3DR6A 2BUEA 1Y9WA 3TTHA 1N71A 5JQ4A 3TOAA 1VHSA 4NF1A 3H4QA 2OB0A 2OZUA 3EC4A 2BL1A 1YVKA 2B5GA 2ZW7A 3IGRA 4YFJA 3R95A 3W91A 4R87A 1ON0A 4U9ZA 4X5KA 3R9EA 4KVME 1I12A 2ZXVA 5DWNA 5JPHA 5C82A 3D3SA 1Q2YA 1VKCA 1OZPA 3FXTA 2FSRA 2VZYA 4H6UA 2I79A 3SXOA 3TO9A 2GIVA 3S6GA 4Y49C 3FYNA 2ZW5A 1WK4A 1YX0A 4E8OA 4MI4A 4NEXA 3FNCA 4UWIA 2VI7A 1P4NA 4FD4A 2P0WA 4OLLA 2CNSA 3D2MA 1BO4A 5CNPA 3S6FA 4XPKA 3F8KA 4KVXA 4R3KA 3EFAA 3R9GA 2CNTA 2BSWA 3VWEA 3C26A 4KOSA 4NXYA 4HNWB 5FVJA 1IYKA 2B3VA 3FB3A 1MJ9A 2FT0A 2WPWA 3GKRA 3DNSA 4NCZA 5J8CA 4PSWA 2REFA 4KOWA 4XPDC 3B8GA 2B4BA 3JVNA 2NMTA 4MBUA 2QECA 4PV6A 2Z10A 3P2FA 4U9YA 4B5PB 5IB0A 5F49A 1YR0A 3GY9A 1XF8A 2G3TA 1XMTA 5GCNA 1QSNA 1Q2CA 2EVNA 1L0CA 4II9A 4KORA 4NSQA 3R96A 1Z9UA 2J8MA 1QSOA 2B3UA 2Z11A 4ONUA 1M4GA 4R3LA 2B5GB 4KOTA 2A4NA 4CRZB 4KZTA 5IX3A 1FY7A 1RXTA 4XNHC 5F47A 1Y7RA 3G3SA 1S7KA 4QUSA 3TO7A 3DR8A 3LD2A 1I21A 2D4OA 2Z0ZA 4KOUA 4KOXA 3EO4A 3E0KA 4PK3A 4KOYA 5H84A 3NE7A 2P6EA 4U5YA 1CM0A 3EXNA 4LUAA 4GS4A 2QIRA 1UFHA 2DXQA 2K5TA 4R57A 2OU2A 4R9MA 1PUAA 1V0CA 2FE7A 1GHEA 2OZHA 3BLNA 5F46A 1WWZA 4AB7A 2Q0YA 2REEA 4CS0B 2PC1A 2Q44A 4FD5A 4DNCA 3W6XA 3W6SA 1XIXA 1IYLA 4EVYA 2Q7BA 4RI1A 3D8PA 4AG9A 1RO5A 2Y0MA 4PK2A 2PQ8A 2Q4VA 5C88A 1YREA 1XEBA 1Y9KA 4L8AA 4QB9A 1R57A 1IB1E 1SQHA 3MGDA 4CAVA 4XPLA 4CAWA 3PP9A 2BEIA 3FBUA 1J4JA 2D4PA 2G3AA 2J8RA 2OZGA 2F5IA 2JDDA 4AVBA 2JLMA 3QAHA 2GANA 2PR8A 4H89A 2WPXA 1YK3A 4B5OA 4J3GA 5F48A 2R98A 3G8WA 3TCVA 4L89A 4QBJA 5DWMA 2FXFA 1IIDA 4YGOA 2PSWA 1IICA 5E96A 3TT2A 2AJ6A 1M44A 1YLEA 4KVOE 1KZFA 4LX9A 4UA3A 5HMNA 2I00A 3K9UA 3BJ7A 3UY5A 1P0HA 4IF5A 2Q04A 4AVCA 2KCWA 1S3ZA 4AVAA 1NMTA 2C27A 2B4DA 4CRYB 5EBVA 1S7FA 4FD7A 3OWCA 4MHDA 3TFYA 2PR1A 4OADA 3T9YA 1QSTA 4F0YA 2R1IA 4QC6A 4K30A 2P6FA 4CAXA 4ORFA 3RYOA 4M3SA 5KTAA 3TO6A 3QB8A 4BMHA 3EY5A 2Q4YA 3DDDA 2B58A 2QMLA 2H5MA 4UWJA 3DSBA 4MY0A 3JUWA 2J8NA 1Q2DA 2AE6A 2VQYA 5KTDA 4ZBGA 2HV2A 4JD6A 4JLYA 4H6ZA 2VXKA 1K4JA 1I1DA 4Y49B 5KTCA 2HQYA 1KUXA 4HKFA 4MY3A 3GYAA 3CXSA 4E2AA 4HNYB 3I9SA 2ARHA 2RC4A 3I3GA 1MJBA 4FD6A 4PSXA 5ISVA 1BOBA 2FS5A 2PRBA 3ZZIA 4YRHA 3TE4A 2VZZA 5HH1A 3ZJ0A 2EUIA 1PU9A 2R8VA 4AG7A 1XE4A 2ATRA 2ZW6A 2ZW4A 4JWPA 1B87A 3D2PA 3R1KA 1TIQA 1MK4A 4QVTA 4KUAA 5IV0A 2O28A 2ZPAA 4HNXB 4JXQA 4KOVA 3F5BA 4XPDB 2VEZA 1S7LA 2JDCA 2R7HA 1M4DA 2B4DB 3BJ8A 3VWDA 4F6AA 1Z4EA 5H86A 3WR7A 2FIAA 1U6MA 3V8IA 4IUSA 2JEVA 1M1DA 3PZJA 1B6BA 2OH1A 1NE9A 2CY2A 2X7BA
chains in the Genus database with same CATH superfamily
1GYTA 3GUXA 4CYNA 3BI0A 4NGNA 2P6GA 3FIXA 1KUVA 5J8FA 2IL4A 1NSLA 2OR4A 4UIBA 3CZXA 1JWQA 3LODA 3SXNA 3SHPA 3CXQA 4XNHB 4BINA 1S60A 4KLWA 4B6ZA 3SI1A 3FRMA 5I0CA 2ODFA 3FEDA 3B3WA 3F0AA 4F0XA 5AGEA 1XRYA 4ZYQA 2YNCA 3H8GA 4PXCA 3I1UA 4JXRA 3KKWA 2PCUA 3DGVA 1LFWA 3KASA 3SJXA 4UEFA 4JJXA 3B2YA 3TOBA 4M85A 1M4IA 2FIWA 3A9LA 3FMCA 4MJ8A 1KWMA 3NA6A 2QVPA 3CXPA 3N7ZA 3R9FA 3B3VA 1YGHA 1YVOA 5EC4A 4P6YA 1AYEA 4GXHA 1LRZA 2PDOA 2YNEA 1KUYA 3T90A 2Z3LA 4W9YA 3GLJA 3S6KA 2ABZA 2GU2A 3IWGA 4FWUA 1YW4A 4CGNA 4P4DA 1ZG8A 1S5KA 2HC9A 4UIAA 5G21A 4CGPA 1CJWA 2EWBA 2FL4A 4I49A 4OAEA 4KUBA 1ELLP 4KSAA 4E0AA 3P2HA 1QSRA 2HUZA 2G0BA 1ZO0A 1Z4RA 2FCKA 2VBQA 4KLVA 3NH5A 4MFLA 3KR5A 1MJAA 1F2PA 2Z3OA 2O4HA 3D7FA 3PGPA 3CT9A 4UBRA 1S7NA 2GE3A 3S6HA 4B5PA 3L2NA 2PJ7A 2CNMA 3SI0A 3RNZA 3BHXA 3IFEA 1QSMA 2AFWA 4RS2A 1R43A 3NE8A 5DS0A 1Y0YA 3DR6A 2BUEA 1Y9WA 3TTHA 1N71A 5JM6A 4DJLA 5JQ4A 2AFZA 3TOAA 1VHSA 4NF1A 3H4QA 1XOVA 2OB0A 1ZLHA 3FX6A 3WC5A 2OZUA 2EK8A 3IU1A 3EC4A 4KS9A 2BL1A 1YVKA 2B5GA 2ZW7A 3IGRA 4A95A 4YFJA 3R95A 3W91A 4R87A 4UF4A 1ON0A 4U9ZA 5K8PA 4PXDA 4KSFA 4MCSA 4X5KA 1CPSA 3R9EA 4KVME 4F9VA 2DPSA 1I12A 3PB8X 2ZXVA 1BPMA 5DWNA 5JPHA 4IK2A 2CF4A 2JBKA 4UEZA 3D3SA 1HDQA 3PB9X 5C82A 2Z3PA 8CPAA 3NH4A 3BXMA 1Q2YA 1VKCA 4NJRA 1OZPA 3FXTA 3PFOA 3D67A 2FSRA 2VZYA 4H6UA 1TF9A 2EBJA 2CTCA 2I79A 2HB6A 4R76A 2CXAA 3SXOA 4EMEA 3TO9A 2GIVA 4FBEA 3S6GA 4OIDA 2XEFA 1NE9A 4NGQA 4Y49C 4BBHA 3FYNA 1LAMA 3SJGA 4PQAA 1OBRA 2ZW5A 1WK4A 3DLJA 1Z8LA 4KSIA 4MFJA 1YX0A 4E8OA 4MI4A 4OC3A 4NEXA 3IEHA 5K8MA 1ZG7A 4Q36A 3FNCA 4X2TA 2GLJA 3CPXA 3PFEA 5LRKA 5D29A 4UWIA 2VI7A 1HDUA 1P4NA 4NGTA 2PVVA 4FD4A 2P0WA 4OLLA 1A2ZA 2V8DA 2ZEOA 2CNSA 1DTDA 3D2MA 1HEEA 3WT4A 1BO4A 5CNPA 3V7ZA 3S6FA 2VL1A 4XPKA 3F8KA 1X10A 3QNVA 1TXRA 4A30A 4KVXA 4R3KA 3EFAA 3R9GA 2Q7SA 2CNTA 2BSWA 3VWEA 3B3SA 3C26A 3IWWA 4KOSA 3S9LA 2PIZA 2PJ6A 1YLOA 2C6PA 2ZELA 4NXYA 4NGPA 4PXEA 4ZY2A 4HNWB 3D66A 4A31A 5K8NA 2I3CA 4HPSA 5FVJA 1IYKA 2B3VA 2ZEDA 3SI2A 3FB3A 1MJ9A 2FT0A 2WPWA 3GKRA 3DNSA 4NCZA 5J8CA 4PSWA 4X8IA 4NGSA 4P4IA 2REFA 4DYOA 3D7DA 4LQGA 4KOWA 1YMEA 1Q7LA 4XPDC 4MCPA 3B8GA 2B4BA 2ZEGA 5JH9A 3JVNA 5CBMA 3RO0A 2NMTA 4MBUA 1XFOA 2QECA 4PV6A 2Z10A 4P10A 3P2FA 4U9YA 1R3NA 4B5PB 5IB0A 2PE3A 4ONWA 5F49A 1YR0A 3GY9A 1XF8A 2G3TA 1XMTA 3MRUA 1XBUA 5GCNA 1QSNA 4UCNA 3VH9A 1Q2CA 2EVNA 1L0CA 5JGFA 2IQ6A 4II9A 3WC7A 4KORA 4NSQA 4UFVA 3SJFA 4YU9A 3R96A 3WABA 4MRIA 1Z9UA 2J8MA 1QQ9A 4C2YA 2WYRA 1F57A 4G1PA 1QSOA 2B3UA 2Z11A 4ONUA 5ELYA 4OP4A 1M4GA 4R3LA 2B5GB 4KOTA 2A4NA 3PB6X 5A27A 1YW6A 2PJ0A 4KZTA 4CRZB 5IX3A 1Z5RA 3IU2A 2AFMA 2IJZA 1FY7A 4B13A 1RXTA 4XNHC 5F47A 2PJ2A 1Y7RA 3G3SA 3KQXA 3FJUA 2PJAA 2Q43A 1S7KA 4P4BA 4QUSA 7CPAA 3TO7A 3DR8A 3LD2A 1BLLE 1I21A 2D4OA 2Z0ZA 4A2ZA 4KOUA 4KOXA 3EO4A 2PJ1A 3E0KA 4A37A 4PK3A 3N5FA 4TNUA 2EK9A 4M6IA 2AFUA 4KOYA 5H84A 4ZY1A 5J1QA 3NE7A 2P6EA 4U5YA 1LANA 3KHXA 1CM0A 3EXNA 5LYLA 2AFXA 4LUAA 4UCPA 4TWEA 3BI1A 4GS4A 4C68A 2C1CA 5HVGA 2QJ8A 1PCAA 3FH4A 1BAVA 1UFHA 2QIRA 3PBBA 4Q38A 2DXQA 3T8WA 2K5TA 4C7IA 1CX8A 2OU2A 4R57A 4OC1A 1CG2A 4R9MA 1PUAA 1V0CA 2Z3KA 5IB9A 2FE7A 1GHEA 2OZHA 2PJCA 1CP7A 3H8EA 2JBJA 5G22A 3BLNA 3CDXA 5F46A 4ZX9A 5LRGA 4AB7A 2Q0YA 2REEA 4C7HA 2Q51A 3KZWA 2WUUA 2PC1A 4CS0B 2Q44A 3H5ZA 3KR4A 4FD5A 3W6XA 1CP6A 4DNCA 4RUHA 1VHEA 3W6SA 1H8LA 1XIXA 3K2KA 4R8FA 4MMOA 2PJ5A 1IYLA 2RB7A 4EVYA 2Q7BA 2BOAA 2FVGA 4RI1A 3PEIA 3D8PA 1CPXA 4AG9A 1RO5A 1YSJA 3VATA 2Y0MA 4PK2A 2JEWA 4PPZA 2PQ8A 1PYTB 2ZEHA 2Q4VA 3HLPA 5C88A 2ZEPA 3S9NA 2ZOGA 1YREA 4IHMA 1XEBA 1Y9KA 1XJOA 3QAYA 4L8AA 4B12A 4O23A 4QB9A 1R57A 4K3NA 1IB1E 1SQHA 3MGDA 4CAVA 2EO8A 4XPLA 2PJ4A 4CAWA 3D68A 3PBEA 3PP9A 2C6GA 2NYQA 2BEIA 2BO9A 3FBUA 1J4JA 3TX8A 2D4PA 2G3AA 2Z3NA 1TF8A 5AG4A 2J8RA 4JZ0A 2POKA 3ISZA 4UFWA 5AG5A 3V38A 1X12A 6CPAA 2PIYA 2OZGA 4CGOA 4OMEA 4GM5A 5A28A 2F5IA 4RN7A 1TKHA 4MFZA 2GFQA 2JDDA 3FECA 4ZX8A 2YGWA 4AVBA 2JLMA 3D7HA 4WWVA 5THWA 4A33A 3QAHA 4C2XA 1CBXA 2GANA 3IO1A 1ZG9A 3HUVA 4OC5A 1ELMP 3KGQA 2Q4ZA 2ZEEA 4MCRA 2PR8A 4H89A 1JQGA 2ZEMA 3CPAA 4DUKA 4MHYA 3K9TA 3TC8A 2WPXA 1YK3A 4P4JA 4B5OA 4MHNA 4J3GA 3B3CA 3LACA 5F48A 3H8FA 2R98A 4MFPA 3G8WA 3TCVA 4L89A 4CGLA 5DWMA 4QBJA 2CTBA 5G20A 2WZNA 4NGMA 2FXFA 3MN8A 5HVHA 3B35A 4PXBA 1IIDA 2V8VA 2PSWA 4YGOA 1IICA 5HVFA 4CAEA 1IU8A 3FF3A 5E96A 4ZI6A 5I4MA 3TT2A 4FUUA 2J9AA 1IOFA 2ZENA 3ISXA 5EMIA 2F8HA 4B14A 1RTQA 2AJ6A 4A32A 1M44A 1YLEA 4KVOE 1KZFA 3LMSA 4LQ6A 4LX9A 4MFKA 4UA3A 1Z8XA 3KL9A 1XMBA 5HMNA 2I00A 4UFXA 3K9UA 2ZEFA 3BJ7A 2PRQA 2YNCC 4OC0A 3UY5A 4UEEA 1P0HA 4IF5A 2Q04A 4AVCA 2KCWA 1S3ZA 4AVAA 4P44A 1NMTA 3D7GA 1QMUA 1VHOA 2IMOA 4CYOA 2C27A 2B4DA 2V8HA 1DE4C 4R7MA 4CRYB 3IWEA 5EBVA 1S7FA 2BCOA 4Z65A 1NSAA 4FD7A 4MHPA 3OWCA 4MHDA 4OC2A 1BPNA 4NJQA 4CAFA 3KQZA 5AG7A 3TFYA 3JRUA 4MCQA 2PR1A 4OADA 3T9YA 1QSTA 4F0YA 2R1IA 3D4UA 4QC6A 4A38A 4K30A 3S9MA 4EWTA 2P6FA 5LYIA 4CAXA 4ORFA 3RYOA 4M3SA 4B11A 5KTAA 3TO6A 4P4EA 4FAIA 5HXDA 3QB8A 1VGYA 2XEIA 3IJ3A 4Q7AA 2F7VA 4BMHA 3EY5A 4CPAA 2Q4YA 2G9DA 4CYQA 3DDDA 1M4LA 1TKFA 2B58A 2V8GA 3RZAA 2PJ8A 5CPAA 2QMLA 2H5MA 3SJEA 4UWJA 3PRTA 1VIXA 3DSBA 3JUWA 2J8NA 1Q2DA 2ZOFA 4MY0A 2AE6A 2VQYA 3KI9A 5AG6A 2PJ9A 5KTDA 4ZBGA 1LOKA 2HV2A 4JD6A 2Z3MA 4P4FA 4JLYA 4H6ZA 2OOTA 2GLFA 2XEGA 1IGBA 2VXKA 5LYDA 3B7IA 1K4JA 3GB0A 1I1DA 4Y49B 3FVLA 2HQYA 4MHZA 1UWYA 4UCMA 4AXVA 5KTCA 1KUXA 4OKOA 2AFSA 4HKFA 1IY7A 2AFOA 3GYAA 4JYWA 4MY3A 4NGRA 5LRJA 5BWAB 1Z8TA 3IIBA 4YWYA 4B10A 4A94A 3GIUA 3CXSA 1FNOA 1TKJA 2ANPA 3PB7X 4HNYB 4E2AA 3I9SA 3B3TA 2ARHA 2RC4A 3NFZA 3I3GA 1MJBA 2DPTA 4FD6A 4PSXA 2RFHA 5ISVA 1BOBA 1FT7A 5D8NA 2FS5A 2PRBA 3ZZIA 4YRHA 3TE4A 1ARMA 3VARA 2VZZA 1Y7EA 2NSMA 3IC1A 4OIWA 4NFRA 5HH1A 4F8ZA 5G1ZA 3ZJ0A 2EUIA 1PU9A 2R8VA 4EFDA 4AG7A 3RBUA 2ATRA 2QYVA 2ZW6A 2ZW4A 4JWPA 4WJBA 1Z2LA 1B87A 3NH8A 3FEEA 3D2PA 3KHZA 3PB4X 3R1KA 3RAMA 1TIQA 2YNDA 2O53A 1MK4A 4M6HA 1YQEA 4P45A 4QVTA 4KUAA 1LCPA 5IV0A 4A39A 2O28A 2X7BA 4M6GA 2V77A 2ZPAA 3WC6A 4C2ZA 4HNXB 4CGMA 1AUGA 4MFQA 4R6TA 1AMPA 4JXQA 5K8OA 1Z8WA 2PJ3A 4KOVA 1IOIA 2C6CA 2DF5A 3F5BA 4MXUA 4XPDB 2VEZA 4F9UA 2XEJA 4OC4A 1S7LA 2GREA 2JDCA 4X3RA 2R7HA 1M4DA 2WSAA 1F2OA 1ARLA 4ZGYB 2B4DB 3BJ8A 3VWDA 4F6AA 4BD9A 1Z4EA 2PVWA 3LWUA 1Y0RA 4IAVA 5H86A 2FIAA 3WR7A 1U6MA 4CYPA 3V8IA 4IUSA 2JEVA 4ZY0A 1EE3P 1LAPA 1M1DA 3PZJA 1B6BA 5LYFA 1ZLIA 2DEAA 4H2KA 2CIJA 3JTKA 2OH1A 5F09A 1XE4A 2CY2A 1WWZA 2PJBA
chains in the Genus database with same CATH topology
4CYNA 2P6GA 3FIXA 1KUVA 5J8FA 2IL4A 1NSLA 3LODA 3SXNA 3SHPA 3CXQA 4XNHB 1S60A 4KLWA 3FRMA 5I0CA 3F0AA 4F0XA 5AGEA 2YNCA 4JXRA 3KKWA 4JJXA 3TOBA 4M85A 1M4IA 2FIWA 3A9LA 4MJ8A 3CXPA 3N7ZA 3R9FA 1YGHA 1YVOA 5EC4A 1LRZA 2PDOA 2YNEA 1KUYA 3T90A 2Z3LA 3S6KA 3IWGA 4CGNA 1S5KA 5G21A 4CGPA 1CJWA 2FL4A 4I49A 4OAEA 4KUBA 4KSAA 4E0AA 3P2HA 1QSRA 2HUZA 2G0BA 1ZO0A 1Z4RA 2FCKA 2VBQA 4KLVA 4MFLA 1MJAA 2Z3OA 3PGPA 4UBRA 1S7NA 2GE3A 3S6HA 4B5PA 2CNMA 1QSMA 4RS2A 3DR6A 2BUEA 1Y9WA 3TTHA 1N71A 5JQ4A 3TOAA 1VHSA 4NF1A 3H4QA 2OB0A 2OZUA 3IU1A 3EC4A 4KS9A 2BL1A 1YVKA 2B5GA 2ZW7A 3IGRA 4A95A 4YFJA 3R95A 3W91A 4R87A 1ON0A 4U9ZA 4KSFA 4X5KA 3R9EA 4KVME 2DPSA 1I12A 2ZXVA 5DWNA 5JPHA 5C82A 3D3SA 2Z3PA 1Q2YA 1VKCA 1OZPA 3FXTA 2FSRA 2VZYA 4H6UA 2I79A 3SXOA 2CXAA 3TO9A 2GIVA 3S6GA 4Y49C 4BBHA 3FYNA 2ZW5A 1WK4A 4MFJA 1YX0A 4E8OA 4MI4A 4NEXA 4Q36A 3FNCA 4UWIA 2VI7A 1P4NA 4FD4A 2P0WA 4OLLA 2CNSA 3D2MA 1BO4A 5CNPA 3S6FA 4XPKA 3F8KA 4A30A 4KVXA 4R3KA 3EFAA 3R9GA 2CNTA 2BSWA 3VWEA 3C26A 4KOSA 4NXYA 4A31A 4HNWB 5FVJA 1IYKA 2B3VA 3FB3A 1MJ9A 2FT0A 2WPWA 3GKRA 3DNSA 4NCZA 5J8CA 4PSWA 2REFA 4KOWA 4XPDC 3B8GA 2B4BA 3JVNA 2NMTA 4MBUA 2QECA 4PV6A 2Z10A 3P2FA 4U9YA 4B5PB 5IB0A 5F49A 1YR0A 3GY9A 1XF8A 2G3TA 1XMTA 5GCNA 1QSNA 4UCNA 1Q2CA 2EVNA 1L0CA 4II9A 4KORA 4NSQA 4UFVA 3R96A 1Z9UA 2J8MA 4C2YA 1QSOA 2B3UA 2Z11A 4ONUA 1M4GA 4R3LA 2B5GB 4KOTA 2A4NA 5A27A 4CRZB 4KZTA 5IX3A 3IU2A 1FY7A 4B13A 1RXTA 4XNHC 5F47A 1Y7RA 3G3SA 1S7KA 4QUSA 3TO7A 3DR8A 3LD2A 1I21A 2D4OA 2Z0ZA 4A2ZA 4KOUA 4KOXA 3EO4A 3E0KA 4PK3A 4KOYA 5H84A 3NE7A 2P6EA 4U5YA 1CM0A 3EXNA 4LUAA 4UCPA 4GS4A 4C68A 2QIRA 1UFHA 4Q38A 2DXQA 4C7IA 2K5TA 4R57A 2OU2A 4R9MA 1PUAA 1V0CA 2Z3KA 2FE7A 1GHEA 2OZHA 5G22A 3BLNA 5F46A 1WWZA 4AB7A 2Q0YA 2REEA 4C7HA 4CS0B 2WUUA 2PC1A 2Q44A 3H5ZA 4FD5A 4DNCA 3W6XA 3W6SA 1XIXA 1IYLA 4EVYA 2Q7BA 4RI1A 3D8PA 4AG9A 1RO5A 2Y0MA 4PK2A 2PQ8A 2Q4VA 5C88A 1YREA 1XEBA 1Y9KA 4L8AA 4B12A 4QB9A 1R57A 1IB1E 1SQHA 3MGDA 4CAVA 4XPLA 4CAWA 3PP9A 2BEIA 3FBUA 1J4JA 2D4PA 2G3AA 2Z3NA 5AG4A 2J8RA 4UFWA 5AG5A 5A28A 2OZGA 4CGOA 2F5IA 4MFZA 2JDDA 2YGWA 4AVBA 2JLMA 4A33A 3QAHA 4C2XA 2GANA 2PR8A 4H89A 2WPXA 1YK3A 4B5OA 4J3GA 5F48A 2R98A 4MFPA 3G8WA 3TCVA 4L89A 4CGLA 5DWMA 4QBJA 5G20A 2FXFA 1IIDA 4YGOA 2PSWA 4CAEA 1IICA 5E96A 3TT2A 4B14A 2AJ6A 4A32A 1M44A 1YLEA 4KVOE 1KZFA 4LX9A 4MFKA 4UA3A 5HMNA 2I00A 4UFXA 3K9UA 3BJ7A 2YNCC 3UY5A 1P0HA 4IF5A 2Q04A 4AVCA 2KCWA 1S3ZA 4AVAA 1NMTA 4CYOA 2C27A 2B4DA 4CRYB 3IWEA 5EBVA 1S7FA 4FD7A 3OWCA 4MHDA 4CAFA 5AG7A 3TFYA 2PR1A 4OADA 3T9YA 1QSTA 4F0YA 2R1IA 4QC6A 4K30A 2P6FA 4CAXA 4ORFA 3RYOA 4M3SA 4B11A 5KTAA 3TO6A 3QB8A 4BMHA 3EY5A 2Q4YA 4CYQA 3DDDA 2B58A 2QMLA 2H5MA 4UWJA 3DSBA 4MY0A 3JUWA 2J8NA 1Q2DA 5AG6A 2AE6A 2VQYA 5KTDA 4ZBGA 2HV2A 4JD6A 2Z3MA 4JLYA 4H6ZA 2VXKA 1K4JA 1I1DA 4Y49B 5KTCA 2HQYA 4UCMA 1KUXA 4HKFA 4MY3A 3GYAA 5BWAB 4B10A 3CXSA 4E2AA 4HNYB 3I9SA 2ARHA 2RC4A 3I3GA 1MJBA 2DPTA 4FD6A 4PSXA 5ISVA 1BOBA 2FS5A 2PRBA 3ZZIA 4YRHA 3TE4A 2VZZA 5HH1A 5G1ZA 3ZJ0A 2EUIA 1PU9A 2R8VA 4AG7A 1XE4A 2ATRA 2ZW6A 2ZW4A 4JWPA 1B87A 3D2PA 3R1KA 1TIQA 2YNDA 1MK4A 4QVTA 4KUAA 5IV0A 2O28A 2ZPAA 4C2ZA 4HNXB 4CGMA 4MFQA 4JXQA 4KOVA 3F5BA 4XPDB 2VEZA 1S7LA 2JDCA 2R7HA 1M4DA 2WSAA 4ZGYB 2B4DB 3BJ8A 3VWDA 4F6AA 1Z4EA 5H86A 3WR7A 2FIAA 1U6MA 4CYPA 3V8IA 4IUSA 2JEVA 1M1DA 3PZJA 1B6BA 3JTKA 2OH1A 1NE9A 2CY2A 2X7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6G A;  3FIX A;  1KUV A;  5J8F A;  2IL4 A;  1NSL A;  3LOD A;  3SXN A;  3SHP A;  3CXQ A;  4XNH B;  1S60 A;  4KLW A;  3FRM A;  5I0C A;  3F0A A;  4JXR A;  3KKW A;  4JJX A;  3TOB A;  4M85 A;  1M4I A;  2FIW A;  4MJ8 A;  3CXP A;  3N7Z A;  3R9F A;  1YGH A;  1YVO A;  5EC4 A;  1LRZ A;  2PDO A;  1KUY A;  3T90 A;  3S6K A;  3IWG A;  1S5K A;  1CJW A;  2FL4 A;  4I49 A;  4OAE A;  4KUB A;  4E0A A;  3P2H A;  1QSR A;  2HUZ A;  2G0B A;  2FCK A;  1Z4R A;  2VBQ A;  4KLV A;  1MJA A;  3PGP A;  4UBR A;  1S7N A;  2GE3 A;  3S6H A;  4B5P A;  2CNM A;  1QSM A;  4RS2 A;  3DR6 A;  2BUE A;  1Y9W A;  3TTH A;  1N71 A;  5JQ4 A;  3TOA A;  1VHS A;  4NF1 A;  3H4Q A;  2OB0 A;  2OZU A;  3EC4 A;  2BL1 A;  1YVK A;  2B5G A;  2ZW7 A;  3IGR A;  4YFJ A;  3R95 A;  3W91 A;  4R87 A;  1ON0 A;  4U9Z A;  4X5K A;  3R9E A;  4KVM E;  1I12 A;  2ZXV A;  5DWN A;  5JPH A;  5C82 A;  3D3S A;  1Q2Y A;  1VKC A;  1OZP A;  3FXT A;  2FSR A;  2VZY A;  4H6U A;  2I79 A;  3SXO A;  3TO9 A;  2GIV A;  3S6G A;  4Y49 C;  3FYN A;  2ZW5 A;  1WK4 A;  1YX0 A;  4E8O A;  4MI4 A;  4NEX A;  3FNC A;  4UWI A;  2VI7 A;  1P4N A;  4FD4 A;  2P0W A;  4OLL A;  2CNS A;  3D2M A;  1BO4 A;  5CNP A;  3S6F A;  4XPK A;  3F8K A;  4KVX A;  4R3K A;  3EFA A;  3R9G A;  2CNT A;  2BSW A;  3VWE A;  3C26 A;  4KOS A;  4NXY A;  4HNW B;  5FVJ A;  1IYK A;  2B3V A;  3FB3 A;  1MJ9 A;  2FT0 A;  2WPW A;  3GKR A;  3DNS A;  4NCZ A;  5J8C A;  4PSW A;  2REF A;  4KOW A;  4XPD C;  3B8G A;  2B4B A;  3JVN A;  2NMT A;  4MBU A;  2QEC A;  4PV6 A;  2Z10 A;  3P2F A;  4U9Y A;  4B5P B;  5IB0 A;  5F49 A;  1YR0 A;  3GY9 A;  1XF8 A;  2G3T A;  1XMT A;  5GCN A;  1QSN A;  1Q2C A;  2EVN A;  1L0C A;  4II9 A;  4KOR A;  4NSQ A;  3R96 A;  1Z9U A;  2J8M A;  1QSO A;  2B3U A;  2Z11 A;  4ONU A;  1M4G A;  4R3L A;  2B5G B;  4KOT A;  2A4N A;  4CRZ B;  4KZT A;  5IX3 A;  1FY7 A;  1RXT A;  4XNH C;  5F47 A;  1Y7R A;  3G3S A;  1S7K A;  4QUS A;  3TO7 A;  3DR8 A;  3LD2 A;  1I21 A;  2D4O A;  2Z0Z A;  4KOU A;  4KOX A;  3EO4 A;  3E0K A;  4PK3 A;  4KOY A;  5H84 A;  3NE7 A;  2P6E A;  4U5Y A;  1CM0 A;  3EXN A;  4LUA A;  4GS4 A;  2QIR A;  1UFH A;  2DXQ A;  2K5T A;  4R57 A;  2OU2 A;  4R9M A;  1PUA A;  1V0C A;  2FE7 A;  1GHE A;  2OZH A;  3BLN A;  5F46 A;  1WWZ A;  4AB7 A;  2Q0Y A;  2REE A;  4CS0 B;  2PC1 A;  2Q44 A;  4FD5 A;  4DNC A;  3W6X A;  3W6S A;  1XIX A;  1IYL A;  4EVY A;  2Q7B A;  4RI1 A;  3D8P A;  4AG9 A;  1RO5 A;  2Y0M A;  4PK2 A;  2PQ8 A;  2Q4V A;  5C88 A;  1YRE A;  1XEB A;  1Y9K A;  4L8A A;  4QB9 A;  1R57 A;  1IB1 E;  1SQH A;  3MGD A;  4CAV A;  4XPL A;  4CAW A;  3PP9 A;  2BEI A;  3FBU A;  1J4J A;  2D4P A;  2G3A A;  2J8R A;  2OZG A;  2F5I A;  2JDD A;  4AVB A;  2JLM A;  3QAH A;  2GAN A;  2PR8 A;  4H89 A;  2WPX A;  1YK3 A;  4B5O A;  4J3G A;  5F48 A;  2R98 A;  3G8W A;  3TCV A;  4L89 A;  4QBJ A;  5DWM A;  2FXF A;  1IID A;  4YGO A;  2PSW A;  1IIC A;  5E96 A;  3TT2 A;  2AJ6 A;  1M44 A;  1YLE A;  4KVO E;  1KZF A;  4LX9 A;  4UA3 A;  5HMN A;  2I00 A;  3K9U A;  3BJ7 A;  3UY5 A;  1P0H A;  4IF5 A;  2Q04 A;  4AVC A;  2KCW A;  1S3Z A;  4AVA A;  1NMT A;  2C27 A;  2B4D A;  4CRY B;  5EBV A;  1S7F A;  4FD7 A;  3OWC A;  4MHD A;  3TFY A;  2PR1 A;  4OAD A;  3T9Y A;  1QST A;  4F0Y A;  2R1I A;  4QC6 A;  4K30 A;  2P6F A;  4CAX A;  4ORF A;  3RYO A;  4M3S A;  5KTA A;  3TO6 A;  3QB8 A;  4BMH A;  3EY5 A;  2Q4Y A;  3DDD A;  2B58 A;  2QML A;  2H5M A;  4UWJ A;  3DSB A;  4MY0 A;  3JUW A;  2J8N A;  1Q2D A;  2AE6 A;  2VQY A;  5KTD A;  4ZBG A;  2HV2 A;  4JD6 A;  4JLY A;  4H6Z A;  2VXK A;  1K4J A;  1I1D A;  4Y49 B;  5KTC A;  2HQY A;  1KUX A;  4HKF A;  4MY3 A;  3GYA A;  3CXS A;  4E2A A;  4HNY B;  3I9S A;  2ARH A;  2RC4 A;  3I3G A;  1MJB A;  4FD6 A;  4PSX A;  5ISV A;  1BOB A;  2FS5 A;  2PRB A;  3ZZI A;  4YRH A;  3TE4 A;  2VZZ A;  5HH1 A;  3ZJ0 A;  2EUI A;  1PU9 A;  2R8V A;  4AG7 A;  1XE4 A;  2ATR A;  2ZW6 A;  2ZW4 A;  4JWP A;  1B87 A;  3D2P A;  3R1K A;  1TIQ A;  1MK4 A;  4QVT A;  4KUA A;  5IV0 A;  2O28 A;  2ZPA A;  4HNX B;  4JXQ A;  4KOV A;  3F5B A;  4XPD B;  2VEZ A;  1S7L A;  2JDC A;  2R7H A;  1M4D A;  2B4D B;  3BJ8 A;  3VWD A;  4F6A A;  1Z4E A;  5H86 A;  3WR7 A;  2FIA A;  1U6M A;  3V8I A;  4IUS A;  2JEV A;  1M1D A;  3PZJ A;  1B6B A;  2OH1 A;  1NE9 A;  2CY2 A;  2X7B A; 
#chains in the Genus database with same CATH topology
 1GYT A;  3GUX A;  4CYN A;  3BI0 A;  4NGN A;  2P6G A;  3FIX A;  1KUV A;  5J8F A;  2IL4 A;  1NSL A;  2OR4 A;  4UIB A;  3CZX A;  1JWQ A;  3LOD A;  3SXN A;  3SHP A;  3CXQ A;  4XNH B;  4BIN A;  1S60 A;  4KLW A;  4B6Z A;  3SI1 A;  3FRM A;  5I0C A;  2ODF A;  3FED A;  3B3W A;  3F0A A;  4F0X A;  5AGE A;  1XRY A;  4ZYQ A;  2YNC A;  3H8G A;  4PXC A;  3I1U A;  4JXR A;  3KKW A;  2PCU A;  3DGV A;  1LFW A;  3KAS A;  3SJX A;  4UEF A;  4JJX A;  3B2Y A;  3TOB A;  4M85 A;  1M4I A;  2FIW A;  3A9L A;  3FMC A;  4MJ8 A;  1KWM A;  3NA6 A;  2QVP A;  3CXP A;  3N7Z A;  3R9F A;  3B3V A;  1YGH A;  1YVO A;  5EC4 A;  4P6Y A;  1AYE A;  4GXH A;  1LRZ A;  2PDO A;  2YNE A;  1KUY A;  3T90 A;  2Z3L A;  4W9Y A;  3GLJ A;  3S6K A;  2ABZ A;  2GU2 A;  3IWG A;  4FWU A;  1YW4 A;  4CGN A;  4P4D A;  1ZG8 A;  1S5K A;  2HC9 A;  4UIA A;  5G21 A;  4CGP A;  1CJW A;  2EWB A;  2FL4 A;  4I49 A;  4OAE A;  4KUB A;  1ELL P;  4KSA A;  4E0A A;  3P2H A;  1QSR A;  2HUZ A;  2G0B A;  1ZO0 A;  1Z4R A;  2FCK A;  2VBQ A;  4KLV A;  3NH5 A;  4MFL A;  3KR5 A;  1MJA A;  1F2P A;  2Z3O A;  2O4H A;  3D7F A;  3PGP A;  3CT9 A;  4UBR A;  1S7N A;  2GE3 A;  3S6H A;  4B5P A;  3L2N A;  2PJ7 A;  2CNM A;  3SI0 A;  3RNZ A;  3BHX A;  3IFE A;  1QSM A;  2AFW A;  4RS2 A;  1R43 A;  3NE8 A;  5DS0 A;  1Y0Y A;  3DR6 A;  2BUE A;  1Y9W A;  3TTH A;  1N71 A;  5JM6 A;  4DJL A;  5JQ4 A;  2AFZ A;  3TOA A;  1VHS A;  4NF1 A;  3H4Q A;  1XOV A;  2OB0 A;  1ZLH A;  3FX6 A;  3WC5 A;  2OZU A;  2EK8 A;  3IU1 A;  3EC4 A;  4KS9 A;  2BL1 A;  1YVK A;  2B5G A;  2ZW7 A;  3IGR A;  4A95 A;  4YFJ A;  3R95 A;  3W91 A;  4R87 A;  4UF4 A;  1ON0 A;  4U9Z A;  5K8P A;  4PXD A;  4KSF A;  4MCS A;  4X5K A;  1CPS A;  3R9E A;  4KVM E;  4F9V A;  2DPS A;  1I12 A;  3PB8 X;  2ZXV A;  1BPM A;  5DWN A;  5JPH A;  4IK2 A;  2CF4 A;  2JBK A;  4UEZ A;  3D3S A;  1HDQ A;  3PB9 X;  5C82 A;  2Z3P A;  8CPA A;  3NH4 A;  3BXM A;  1Q2Y A;  1VKC A;  4NJR A;  1OZP A;  3FXT A;  3PFO A;  3D67 A;  2FSR A;  2VZY A;  4H6U A;  1TF9 A;  2EBJ A;  2CTC A;  2I79 A;  2HB6 A;  4R76 A;  2CXA A;  3SXO A;  4EME A;  3TO9 A;  2GIV A;  4FBE A;  3S6G A;  4OID A;  2XEF A;  1NE9 A;  4NGQ A;  4Y49 C;  4BBH A;  3FYN A;  1LAM A;  3SJG A;  4PQA A;  1OBR A;  2ZW5 A;  1WK4 A;  3DLJ A;  1Z8L A;  4KSI A;  4MFJ A;  1YX0 A;  4E8O A;  4MI4 A;  4OC3 A;  4NEX A;  3IEH A;  5K8M A;  1ZG7 A;  4Q36 A;  3FNC A;  4X2T A;  2GLJ A;  3CPX A;  3PFE A;  5LRK A;  5D29 A;  4UWI A;  2VI7 A;  1HDU A;  1P4N A;  4NGT A;  2PVV A;  4FD4 A;  2P0W A;  4OLL A;  1A2Z A;  2V8D A;  2ZEO A;  2CNS A;  1DTD A;  3D2M A;  1HEE A;  3WT4 A;  1BO4 A;  5CNP A;  3V7Z A;  3S6F A;  2VL1 A;  4XPK A;  3F8K A;  1X10 A;  3QNV A;  1TXR A;  4A30 A;  4KVX A;  4R3K A;  3EFA A;  3R9G A;  2Q7S A;  2CNT A;  2BSW A;  3VWE A;  3B3S A;  3C26 A;  3IWW A;  4KOS A;  3S9L A;  2PIZ A;  2PJ6 A;  1YLO A;  2C6P A;  2ZEL A;  4NXY A;  4NGP A;  4PXE A;  4ZY2 A;  4HNW B;  3D66 A;  4A31 A;  5K8N A;  2I3C A;  4HPS A;  5FVJ A;  1IYK A;  2B3V A;  2ZED A;  3SI2 A;  3FB3 A;  1MJ9 A;  2FT0 A;  2WPW A;  3GKR A;  3DNS A;  4NCZ A;  5J8C A;  4PSW A;  4X8I A;  4NGS A;  4P4I A;  2REF A;  4DYO A;  3D7D A;  4LQG A;  4KOW A;  1YME A;  1Q7L A;  4XPD C;  4MCP A;  3B8G A;  2B4B A;  2ZEG A;  5JH9 A;  3JVN A;  5CBM A;  3RO0 A;  2NMT A;  4MBU A;  1XFO A;  2QEC A;  4PV6 A;  2Z10 A;  4P10 A;  3P2F A;  4U9Y A;  1R3N A;  4B5P B;  5IB0 A;  2PE3 A;  4ONW A;  5F49 A;  1YR0 A;  3GY9 A;  1XF8 A;  2G3T A;  1XMT A;  3MRU A;  1XBU A;  5GCN A;  1QSN A;  4UCN A;  3VH9 A;  1Q2C A;  2EVN A;  1L0C A;  5JGF A;  2IQ6 A;  4II9 A;  3WC7 A;  4KOR A;  4NSQ A;  4UFV A;  3SJF A;  4YU9 A;  3R96 A;  3WAB A;  4MRI A;  1Z9U A;  2J8M A;  1QQ9 A;  4C2Y A;  2WYR A;  1F57 A;  4G1P A;  1QSO A;  2B3U A;  2Z11 A;  4ONU A;  5ELY A;  4OP4 A;  1M4G A;  4R3L A;  2B5G B;  4KOT A;  2A4N A;  3PB6 X;  5A27 A;  1YW6 A;  2PJ0 A;  4KZT A;  4CRZ B;  5IX3 A;  1Z5R A;  3IU2 A;  2AFM A;  2IJZ A;  1FY7 A;  4B13 A;  1RXT A;  4XNH C;  5F47 A;  2PJ2 A;  1Y7R A;  3G3S A;  3KQX A;  3FJU A;  2PJA A;  2Q43 A;  1S7K A;  4P4B A;  4QUS A;  7CPA A;  3TO7 A;  3DR8 A;  3LD2 A;  1BLL E;  1I21 A;  2D4O A;  2Z0Z A;  4A2Z A;  4KOU A;  4KOX A;  3EO4 A;  2PJ1 A;  3E0K A;  4A37 A;  4PK3 A;  3N5F A;  4TNU A;  2EK9 A;  4M6I A;  2AFU A;  4KOY A;  5H84 A;  4ZY1 A;  5J1Q A;  3NE7 A;  2P6E A;  4U5Y A;  1LAN A;  3KHX A;  1CM0 A;  3EXN A;  5LYL A;  2AFX A;  4LUA A;  4UCP A;  4TWE A;  3BI1 A;  4GS4 A;  4C68 A;  2C1C A;  5HVG A;  2QJ8 A;  1PCA A;  3FH4 A;  1BAV A;  1UFH A;  2QIR A;  3PBB A;  4Q38 A;  2DXQ A;  3T8W A;  2K5T A;  4C7I A;  1CX8 A;  2OU2 A;  4R57 A;  4OC1 A;  1CG2 A;  4R9M A;  1PUA A;  1V0C A;  2Z3K A;  5IB9 A;  2FE7 A;  1GHE A;  2OZH A;  2PJC A;  1CP7 A;  3H8E A;  2JBJ A;  5G22 A;  3BLN A;  3CDX A;  5F46 A;  4ZX9 A;  5LRG A;  4AB7 A;  2Q0Y A;  2REE A;  4C7H A;  2Q51 A;  3KZW A;  2WUU A;  2PC1 A;  4CS0 B;  2Q44 A;  3H5Z A;  3KR4 A;  4FD5 A;  3W6X A;  1CP6 A;  4DNC A;  4RUH A;  1VHE A;  3W6S A;  1H8L A;  1XIX A;  3K2K A;  4R8F A;  4MMO A;  2PJ5 A;  1IYL A;  2RB7 A;  4EVY A;  2Q7B A;  2BOA A;  2FVG A;  4RI1 A;  3PEI A;  3D8P A;  1CPX A;  4AG9 A;  1RO5 A;  1YSJ A;  3VAT A;  2Y0M A;  4PK2 A;  2JEW A;  4PPZ A;  2PQ8 A;  1PYT B;  2ZEH A;  2Q4V A;  3HLP A;  5C88 A;  2ZEP A;  3S9N A;  2ZOG A;  1YRE A;  4IHM A;  1XEB A;  1Y9K A;  1XJO A;  3QAY A;  4L8A A;  4B12 A;  4O23 A;  4QB9 A;  1R57 A;  4K3N A;  1IB1 E;  1SQH A;  3MGD A;  4CAV A;  2EO8 A;  4XPL A;  2PJ4 A;  4CAW A;  3D68 A;  3PBE A;  3PP9 A;  2C6G A;  2NYQ A;  2BEI A;  2BO9 A;  3FBU A;  1J4J A;  3TX8 A;  2D4P A;  2G3A A;  2Z3N A;  1TF8 A;  5AG4 A;  2J8R A;  4JZ0 A;  2POK A;  3ISZ A;  4UFW A;  5AG5 A;  3V38 A;  1X12 A;  6CPA A;  2PIY A;  2OZG A;  4CGO A;  4OME A;  4GM5 A;  5A28 A;  2F5I A;  4RN7 A;  1TKH A;  4MFZ A;  2GFQ A;  2JDD A;  3FEC A;  4ZX8 A;  2YGW A;  4AVB A;  2JLM A;  3D7H A;  4WWV A;  5THW A;  4A33 A;  3QAH A;  4C2X A;  1CBX A;  2GAN A;  3IO1 A;  1ZG9 A;  3HUV A;  4OC5 A;  1ELM P;  3KGQ A;  2Q4Z A;  2ZEE A;  4MCR A;  2PR8 A;  4H89 A;  1JQG A;  2ZEM A;  3CPA A;  4DUK A;  4MHY A;  3K9T A;  3TC8 A;  2WPX A;  1YK3 A;  4P4J A;  4B5O A;  4MHN A;  4J3G A;  3B3C A;  3LAC A;  5F48 A;  3H8F A;  2R98 A;  4MFP A;  3G8W A;  3TCV A;  4L89 A;  4CGL A;  5DWM A;  4QBJ A;  2CTB A;  5G20 A;  2WZN A;  4NGM A;  2FXF A;  3MN8 A;  5HVH A;  3B35 A;  4PXB A;  1IID A;  2V8V A;  2PSW A;  4YGO A;  1IIC A;  5HVF A;  4CAE A;  1IU8 A;  3FF3 A;  5E96 A;  4ZI6 A;  5I4M A;  3TT2 A;  4FUU A;  2J9A A;  1IOF A;  2ZEN A;  3ISX A;  5EMI A;  2F8H A;  4B14 A;  1RTQ A;  2AJ6 A;  4A32 A;  1M44 A;  1YLE A;  4KVO E;  1KZF A;  3LMS A;  4LQ6 A;  4LX9 A;  4MFK A;  4UA3 A;  1Z8X A;  3KL9 A;  1XMB A;  5HMN A;  2I00 A;  4UFX A;  3K9U A;  2ZEF A;  3BJ7 A;  2PRQ A;  2YNC C;  4OC0 A;  3UY5 A;  4UEE A;  1P0H A;  4IF5 A;  2Q04 A;  4AVC A;  2KCW A;  1S3Z A;  4AVA A;  4P44 A;  1NMT A;  3D7G A;  1QMU A;  1VHO A;  2IMO A;  4CYO A;  2C27 A;  2B4D A;  2V8H A;  1DE4 C;  4R7M A;  4CRY B;  3IWE A;  5EBV A;  1S7F A;  2BCO A;  4Z65 A;  1NSA A;  4FD7 A;  4MHP A;  3OWC A;  4MHD A;  4OC2 A;  1BPN A;  4NJQ A;  4CAF A;  3KQZ A;  5AG7 A;  3TFY A;  3JRU A;  4MCQ A;  2PR1 A;  4OAD A;  3T9Y A;  1QST A;  4F0Y A;  2R1I A;  3D4U A;  4QC6 A;  4A38 A;  4K30 A;  3S9M A;  4EWT A;  2P6F A;  5LYI A;  4CAX A;  4ORF A;  3RYO A;  4M3S A;  4B11 A;  5KTA A;  3TO6 A;  4P4E A;  4FAI A;  5HXD A;  3QB8 A;  1VGY A;  2XEI A;  3IJ3 A;  4Q7A A;  2F7V A;  4BMH A;  3EY5 A;  4CPA A;  2Q4Y A;  2G9D A;  4CYQ A;  3DDD A;  1M4L A;  1TKF A;  2B58 A;  2V8G A;  3RZA A;  2PJ8 A;  5CPA A;  2QML A;  2H5M A;  3SJE A;  4UWJ A;  3PRT A;  1VIX A;  3DSB A;  3JUW A;  2J8N A;  1Q2D A;  2ZOF A;  4MY0 A;  2AE6 A;  2VQY A;  3KI9 A;  5AG6 A;  2PJ9 A;  5KTD A;  4ZBG A;  1LOK A;  2HV2 A;  4JD6 A;  2Z3M A;  4P4F A;  4JLY A;  4H6Z A;  2OOT A;  2GLF A;  2XEG A;  1IGB A;  2VXK A;  5LYD A;  3B7I A;  1K4J A;  3GB0 A;  1I1D A;  4Y49 B;  3FVL A;  2HQY A;  4MHZ A;  1UWY A;  4UCM A;  4AXV A;  5KTC A;  1KUX A;  4OKO A;  2AFS A;  4HKF A;  1IY7 A;  2AFO A;  3GYA A;  4JYW A;  4MY3 A;  4NGR A;  5LRJ A;  5BWA B;  1Z8T A;  3IIB A;  4YWY A;  4B10 A;  4A94 A;  3GIU A;  3CXS A;  1FNO A;  1TKJ A;  2ANP A;  3PB7 X;  4HNY B;  4E2A A;  3I9S A;  3B3T A;  2ARH A;  2RC4 A;  3NFZ A;  3I3G A;  1MJB A;  2DPT A;  4FD6 A;  4PSX A;  2RFH A;  5ISV A;  1BOB A;  1FT7 A;  5D8N A;  2FS5 A;  2PRB A;  3ZZI A;  4YRH A;  3TE4 A;  1ARM A;  3VAR A;  2VZZ A;  1Y7E A;  2NSM A;  3IC1 A;  4OIW A;  4NFR A;  5HH1 A;  4F8Z A;  5G1Z A;  3ZJ0 A;  2EUI A;  1PU9 A;  2R8V A;  4EFD A;  4AG7 A;  3RBU A;  2ATR A;  2QYV A;  2ZW6 A;  2ZW4 A;  4JWP A;  4WJB A;  1Z2L A;  1B87 A;  3NH8 A;  3FEE A;  3D2P A;  3KHZ A;  3PB4 X;  3R1K A;  3RAM A;  1TIQ A;  2YND A;  2O53 A;  1MK4 A;  4M6H A;  1YQE A;  4P45 A;  4QVT A;  4KUA A;  1LCP A;  5IV0 A;  4A39 A;  2O28 A;  2X7B A;  4M6G A;  2V77 A;  2ZPA A;  3WC6 A;  4C2Z A;  4HNX B;  4CGM A;  1AUG A;  4MFQ A;  4R6T A;  1AMP A;  4JXQ A;  5K8O A;  1Z8W A;  2PJ3 A;  4KOV A;  1IOI A;  2C6C A;  2DF5 A;  3F5B A;  4MXU A;  4XPD B;  2VEZ A;  4F9U A;  2XEJ A;  4OC4 A;  1S7L A;  2GRE A;  2JDC A;  4X3R A;  2R7H A;  1M4D A;  2WSA A;  1F2O A;  1ARL A;  4ZGY B;  2B4D B;  3BJ8 A;  3VWD A;  4F6A A;  4BD9 A;  1Z4E A;  2PVW A;  3LWU A;  1Y0R A;  4IAV A;  5H86 A;  2FIA A;  3WR7 A;  1U6M A;  4CYP A;  3V8I A;  4IUS A;  2JEV A;  4ZY0 A;  1EE3 P;  1LAP A;  1M1D A;  3PZJ A;  1B6B A;  5LYF A;  1ZLI A;  2DEA A;  4H2K A;  2CIJ A;  3JTK A;  2OH1 A;  5F09 A;  1XE4 A;  2CY2 A;  1WWZ A;  2PJB A; 
#chains in the Genus database with same CATH homology
 4CYN A;  2P6G A;  3FIX A;  1KUV A;  5J8F A;  2IL4 A;  1NSL A;  3LOD A;  3SXN A;  3SHP A;  3CXQ A;  4XNH B;  1S60 A;  4KLW A;  3FRM A;  5I0C A;  3F0A A;  4F0X A;  5AGE A;  2YNC A;  4JXR A;  3KKW A;  4JJX A;  3TOB A;  4M85 A;  1M4I A;  2FIW A;  3A9L A;  4MJ8 A;  3CXP A;  3N7Z A;  3R9F A;  1YGH A;  1YVO A;  5EC4 A;  1LRZ A;  2PDO A;  2YNE A;  1KUY A;  3T90 A;  2Z3L A;  3S6K A;  3IWG A;  4CGN A;  1S5K A;  5G21 A;  4CGP A;  1CJW A;  2FL4 A;  4I49 A;  4OAE A;  4KUB A;  4KSA A;  4E0A A;  3P2H A;  1QSR A;  2HUZ A;  2G0B A;  1ZO0 A;  1Z4R A;  2FCK A;  2VBQ A;  4KLV A;  4MFL A;  1MJA A;  2Z3O A;  3PGP A;  4UBR A;  1S7N A;  2GE3 A;  3S6H A;  4B5P A;  2CNM A;  1QSM A;  4RS2 A;  3DR6 A;  2BUE A;  1Y9W A;  3TTH A;  1N71 A;  5JQ4 A;  3TOA A;  1VHS A;  4NF1 A;  3H4Q A;  2OB0 A;  2OZU A;  3IU1 A;  3EC4 A;  4KS9 A;  2BL1 A;  1YVK A;  2B5G A;  2ZW7 A;  3IGR A;  4A95 A;  4YFJ A;  3R95 A;  3W91 A;  4R87 A;  1ON0 A;  4U9Z A;  4KSF A;  4X5K A;  3R9E A;  4KVM E;  2DPS A;  1I12 A;  2ZXV A;  5DWN A;  5JPH A;  5C82 A;  3D3S A;  2Z3P A;  1Q2Y A;  1VKC A;  1OZP A;  3FXT A;  2FSR A;  2VZY A;  4H6U A;  2I79 A;  3SXO A;  2CXA A;  3TO9 A;  2GIV A;  3S6G A;  4Y49 C;  4BBH A;  3FYN A;  2ZW5 A;  1WK4 A;  4MFJ A;  1YX0 A;  4E8O A;  4MI4 A;  4NEX A;  4Q36 A;  3FNC A;  4UWI A;  2VI7 A;  1P4N A;  4FD4 A;  2P0W A;  4OLL A;  2CNS A;  3D2M A;  1BO4 A;  5CNP A;  3S6F A;  4XPK A;  3F8K A;  4A30 A;  4KVX A;  4R3K A;  3EFA A;  3R9G A;  2CNT A;  2BSW A;  3VWE A;  3C26 A;  4KOS A;  4NXY A;  4A31 A;  4HNW B;  5FVJ A;  1IYK A;  2B3V A;  3FB3 A;  1MJ9 A;  2FT0 A;  2WPW A;  3GKR A;  3DNS A;  4NCZ A;  5J8C A;  4PSW A;  2REF A;  4KOW A;  4XPD C;  3B8G A;  2B4B A;  3JVN A;  2NMT A;  4MBU A;  2QEC A;  4PV6 A;  2Z10 A;  3P2F A;  4U9Y A;  4B5P B;  5IB0 A;  5F49 A;  1YR0 A;  3GY9 A;  1XF8 A;  2G3T A;  1XMT A;  5GCN A;  1QSN A;  4UCN A;  1Q2C A;  2EVN A;  1L0C A;  4II9 A;  4KOR A;  4NSQ A;  4UFV A;  3R96 A;  1Z9U A;  2J8M A;  4C2Y A;  1QSO A;  2B3U A;  2Z11 A;  4ONU A;  1M4G A;  4R3L A;  2B5G B;  4KOT A;  2A4N A;  5A27 A;  4CRZ B;  4KZT A;  5IX3 A;  3IU2 A;  1FY7 A;  4B13 A;  1RXT A;  4XNH C;  5F47 A;  1Y7R A;  3G3S A;  1S7K A;  4QUS A;  3TO7 A;  3DR8 A;  3LD2 A;  1I21 A;  2D4O A;  2Z0Z A;  4A2Z A;  4KOU A;  4KOX A;  3EO4 A;  3E0K A;  4PK3 A;  4KOY A;  5H84 A;  3NE7 A;  2P6E A;  4U5Y A;  1CM0 A;  3EXN A;  4LUA A;  4UCP A;  4GS4 A;  4C68 A;  2QIR A;  1UFH A;  4Q38 A;  2DXQ A;  4C7I A;  2K5T A;  4R57 A;  2OU2 A;  4R9M A;  1PUA A;  1V0C A;  2Z3K A;  2FE7 A;  1GHE A;  2OZH A;  5G22 A;  3BLN A;  5F46 A;  1WWZ A;  4AB7 A;  2Q0Y A;  2REE A;  4C7H A;  4CS0 B;  2WUU A;  2PC1 A;  2Q44 A;  3H5Z A;  4FD5 A;  4DNC A;  3W6X A;  3W6S A;  1XIX A;  1IYL A;  4EVY A;  2Q7B A;  4RI1 A;  3D8P A;  4AG9 A;  1RO5 A;  2Y0M A;  4PK2 A;  2PQ8 A;  2Q4V A;  5C88 A;  1YRE A;  1XEB A;  1Y9K A;  4L8A A;  4B12 A;  4QB9 A;  1R57 A;  1IB1 E;  1SQH A;  3MGD A;  4CAV A;  4XPL A;  4CAW A;  3PP9 A;  2BEI A;  3FBU A;  1J4J A;  2D4P A;  2G3A A;  2Z3N A;  5AG4 A;  2J8R A;  4UFW A;  5AG5 A;  5A28 A;  2OZG A;  4CGO A;  2F5I A;  4MFZ A;  2JDD A;  2YGW A;  4AVB A;  2JLM A;  4A33 A;  3QAH A;  4C2X A;  2GAN A;  2PR8 A;  4H89 A;  2WPX A;  1YK3 A;  4B5O A;  4J3G A;  5F48 A;  2R98 A;  4MFP A;  3G8W A;  3TCV A;  4L89 A;  4CGL A;  5DWM A;  4QBJ A;  5G20 A;  2FXF A;  1IID A;  4YGO A;  2PSW A;  4CAE A;  1IIC A;  5E96 A;  3TT2 A;  4B14 A;  2AJ6 A;  4A32 A;  1M44 A;  1YLE A;  4KVO E;  1KZF A;  4LX9 A;  4MFK A;  4UA3 A;  5HMN A;  2I00 A;  4UFX A;  3K9U A;  3BJ7 A;  2YNC C;  3UY5 A;  1P0H A;  4IF5 A;  2Q04 A;  4AVC A;  2KCW A;  1S3Z A;  4AVA A;  1NMT A;  4CYO A;  2C27 A;  2B4D A;  4CRY B;  3IWE A;  5EBV A;  1S7F A;  4FD7 A;  3OWC A;  4MHD A;  4CAF A;  5AG7 A;  3TFY A;  2PR1 A;  4OAD A;  3T9Y A;  1QST A;  4F0Y A;  2R1I A;  4QC6 A;  4K30 A;  2P6F A;  4CAX A;  4ORF A;  3RYO A;  4M3S A;  4B11 A;  5KTA A;  3TO6 A;  3QB8 A;  4BMH A;  3EY5 A;  2Q4Y A;  4CYQ A;  3DDD A;  2B58 A;  2QML A;  2H5M A;  4UWJ A;  3DSB A;  4MY0 A;  3JUW A;  2J8N A;  1Q2D A;  5AG6 A;  2AE6 A;  2VQY A;  5KTD A;  4ZBG A;  2HV2 A;  4JD6 A;  2Z3M A;  4JLY A;  4H6Z A;  2VXK A;  1K4J A;  1I1D A;  4Y49 B;  5KTC A;  2HQY A;  4UCM A;  1KUX A;  4HKF A;  4MY3 A;  3GYA A;  5BWA B;  4B10 A;  3CXS A;  4E2A A;  4HNY B;  3I9S A;  2ARH A;  2RC4 A;  3I3G A;  1MJB A;  2DPT A;  4FD6 A;  4PSX A;  5ISV A;  1BOB A;  2FS5 A;  2PRB A;  3ZZI A;  4YRH A;  3TE4 A;  2VZZ A;  5HH1 A;  5G1Z A;  3ZJ0 A;  2EUI A;  1PU9 A;  2R8V A;  4AG7 A;  1XE4 A;  2ATR A;  2ZW6 A;  2ZW4 A;  4JWP A;  1B87 A;  3D2P A;  3R1K A;  1TIQ A;  2YND A;  1MK4 A;  4QVT A;  4KUA A;  5IV0 A;  2O28 A;  2ZPA A;  4C2Z A;  4HNX B;  4CGM A;  4MFQ A;  4JXQ A;  4KOV A;  3F5B A;  4XPD B;  2VEZ A;  1S7L A;  2JDC A;  2R7H A;  1M4D A;  2WSA A;  4ZGY B;  2B4D B;  3BJ8 A;  3VWD A;  4F6A A;  1Z4E A;  5H86 A;  3WR7 A;  2FIA A;  1U6M A;  4CYP A;  3V8I A;  4IUS A;  2JEV A;  1M1D A;  3PZJ A;  1B6B A;  3JTK A;  2OH1 A;  1NE9 A;  2CY2 A;  2X7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...