3S6FA

Crystal structure of a putative acetyltransferase (dr_1678) from deinococcus radiodurans r1 at 1.19 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
143
structure length
143
Chain Sequence
MTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILAASIPLLEVQAGWRSLGLGSELMRRVLTELGDLYMVDLSCDDDVVPFYERLGLKRANAMFLRRYDNQAGIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical acetyltransferase (DR_1678) from Deinococcus radiodurans at 1.19 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Transferase
molecule keywords Hypothetical acetyltransferase
total genus 33
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3s6fA00
2B4BA 4JWPA 3S6GA 3T9YA 3JUWA 5C88A 1S7FA 3C26A 3TCVA 2ATRA 2QMLA 3TOAA 4LUAA 2ZW5A 1I1DA 4XPKA 3VWDA 2NMTA 1Q2CA 2OZGA 3R96A 5DWNA 4R9MA 1XEBA 3BLNA 1NMTA 3GKRA 1QSNA 2Y0MA 3VWEA 3ZJ0A 5JPHA 2R8VA 2JLMA 1YREA 5IX3A 2G3AA 2ZW6A 1MJBA 4L89A 4KORA 5KTCA 1MK4A 2HV2A 1R57A 3W6SA 3G3SA 2REFA 1M4IA 4B5PB 2P6EA 1P0HA 4K30A 5ISVA 4JXQA 2PDOA 1U6MA 3LODA 4L8AA 2BEIA 4UA3A 2D4OA 2VQYA 3IGRA 3TO7A 4AB7A 4HKFA 5C82A 2Q0YA 2R98A 4NCZA 3GY9A 4LX9A 3D2MA 1LRZA 1K4JA 1WWZA 3QB8A 3T90A 2Z11A 1TIQA 4GS4A 3IWGA 3EFAA 1M44A 4XPDC 4X5KA 1SQHA 3LD2A 4MJ8A 2Q4YA 3R9GA 2PQ8A 4MBUA 4CAWA 1UFHA 2VI7A 1M1DA 1BOBA 2FXFA 1QSMA 3FNCA 3D3SA 2D4PA 4AVBA 2P0WA 1S5KA 1Z9UA 4QVTA 1GHEA 4H6UA 2WPXA 3MGDA 1S7KA 2FS5A 4QC6A 1S7NA 4BMHA 3DNSA 3SXOA 4UWJA 2Q04A 3CXPA 1Y9WA 4OAEA 4CAXA 1Z4RA 4E8OA 4KOUA 2HQYA 1N71A 2ARHA 3DSBA 3FIXA 2B3UA 3TO6A 4CS0B 4QB9A 4FD6A 4II9A 5EC4A 2OU2A 4ORFA 1QSTA 4R87A 3B8GA 4NSQA 1YR0A 2DXQA 4YRHA 3R95A 4JXRA 1CJWA 3JVNA 3FYNA 3FRMA 2BSWA 4RS2A 3F8KA 4M3SA 2CNSA 1XE4A 4CRZB 3G8WA 5JQ4A 1VKCA 5FVJA 2J8RA 3PZJA 3TE4A 4DNCA 1B6BA 4NEXA 2AJ6A 2B4DB 5EBVA 2FIWA 1Q2YA 1XF8A 2B4DA 4U9ZA 1NE9A 3H4QA 1YVOA 2WPWA 4KVXA 4IUSA 1L0CA 2Z10A 1CM0A 2A4NA 2P6GA 4KOWA 4KZTA 2QIRA 1S7LA 5IB0A 4NF1A 1OZPA 3CXSA 3N7ZA 1M4GA 3FXTA 2FT0A 4YGOA 4R3LA 2FL4A 4HNWB 4KLVA 4AG9A 3KKWA 2FIAA 1MJAA 3F5BA 4R57A 2Q4VA 3PP9A 3D2PA 4UBRA 5CNPA 1Z4EA 5F48A 4KLWA 2VEZA 4PSWA 2AE6A 3EY5A 5KTAA 2F5IA 3UY5A 5F46A 1YVKA 2KCWA 4U5YA 1KZFA 1QSOA 1Y9KA 1YX0A 4KUBA 2R7HA 2CNTA 5E96A 3S6FA 1FY7A 3QAHA 2ZW7A 4H89A 3BJ8A 2FCKA 2G3TA 4B5PA 3WR7A 4QBJA 4F6AA 4MI4A 4XPDB 3W6XA 1IYKA 2CY2A 4E2AA 2REEA 4B5OA 2FSRA 4KOSA 3NE7A 3BJ7A 2GIVA 5J8CA 2K5TA 2B5GB 4KVOE 2ZPAA 3ZZIA 1IICA 2G0BA 3TOBA 1V0CA 2VZZA 2Z0ZA 2GANA 1S60A 1YK3A 4ONUA 2EVNA 2JDCA 2GE3A 2J8MA 1KUXA 3S6KA 2HUZA 2QECA 1IYLA 4HNXB 2H5MA 3PGPA 4MY3A 3E0KA 2C27A 4UWIA 4XPLA 4I49A 4AG7A 4J3GA 4KOTA 2P6FA 3FB3A 1I21A 4MY0A 1NSLA 4ZBGA 1P4NA 3TFYA 2O28A 2R1IA 3W91A 3P2HA 3S6HA 1BO4A 3GYAA 4AVCA 5KTDA 2PRBA 1KUYA 3RYOA 2FE7A 4JD6A 3D8PA 2OZHA 1RO5A 2VZYA 1WK4A 2BL1A 4FD7A 2PSWA 4KVME 4JLYA 4M85A 1M4DA 1IB1E 1Q2DA 2B58A 1I12A 3P2FA 1ON0A 1QSRA 4R3KA 3EO4A 1S3ZA 2X7BA 2PC1A 3R1KA 4E0AA 2JDDA 1RXTA 2EUIA 1PU9A 4PSXA 4KOYA 4HNYB 3TT2A 5J8FA 4EVYA 3EXNA 3I9SA 1B87A 3DR8A 2IL4A 4PK3A 2B5GA 4AVAA 5F47A 4Y49C 2I79A 3DDDA 4FD5A 2CNMA 4KOVA 3CXQA 3EC4A 3TO9A 2Q44A 2Q7BA 1KUVA 1J4JA 2OZUA 3I3GA 1MJ9A 2BUEA 5H86A 4QUSA 4OADA 2ZXVA 2VBQA 4CAVA 2OH1A 3R9EA 2OB0A 4XNHB 3OWCA 4IF5A 5H84A 4FD4A 3R9FA 1PUAA 2PR8A 3F0AA 4RI1A 1XMTA 5IV0A 4NXYA 3V8IA 4Y49B 2VXKA 1XIXA 4PK2A 2B3VA 4YFJA 1YLEA 2ZW4A 5F49A 2I00A 3K9UA 1YGHA 3SXNA 2PR1A 1Y7RA 5I0CA 4H6ZA 4KUAA 4CRYB 4MHDA 4XNHC 5DWMA 2J8NA 5GCNA 1VHSA 3TTHA 3DR6A 4U9YA 1IIDA 3FBUA 5HH1A 4JJXA 2RC4A 3SHPA 4PV6A 2JEVA 4F0YA 4KOXA 4OLLA 5HMNA
chains in the Genus database with same CATH superfamily
4G1PA 2PJ0A 2B4BA 3RBUA 4JWPA 3S6GA 3ISXA 3KASA 2DEAA 4MMOA 3T9YA 3JUWA 4X8IA 1ARMA 4PPZA 5C88A 1S7FA 3WC7A 2ZENA 3C26A 3TCVA 2ATRA 2QMLA 3K2KA 3TOAA 4MFKA 4LUAA 3WC6A 2ZEMA 2ZW5A 1I1DA 4XPKA 3RAMA 1R3NA 3VWDA 4NGNA 2NMTA 4OIWA 1Q2CA 1TKFA 2O53A 4A32A 2OZGA 4C7HA 3R96A 3NFZA 5DWNA 4F9VA 2V8DA 3CDXA 2QVPA 4R9MA 1Z2LA 1XEBA 1CP6A 1F2PA 3BLNA 1NMTA 3DGVA 4MFZA 2YGWA 3GKRA 4B11A 1QSNA 4ZX8A 2Y0MA 3FF3A 3B3WA 3LACA 3VWEA 4UFWA 3ZJ0A 2R8VA 2JLMA 4PXCA 5JPHA 1YREA 3S9LA 1BPMA 5IX3A 4R76A 2G3AA 3BI0A 4RN7A 1GYTA 2ABZA 4W9YA 2ZW6A 1MJBA 3HLPA 4ZY0A 2AFWA 4L89A 5AG6A 4KORA 4ZGYB 5KTCA 1MK4A 2C6GA 2HV2A 2PRQA 4KSAA 4B6ZA 5I4MA 1R57A 2ZEEA 3W6SA 4CGNA 3G3SA 2DF5A 4OIDA 4C7IA 2REFA 1M4IA 4B10A 1IOIA 4B5PB 1QQ9A 4A31A 2CF4A 3IIBA 3BI1A 4EWTA 4OMEA 4RUHA 2P6EA 4DJLA 1P0HA 4K30A 4FUUA 5ISVA 4JXQA 2AFSA 2PDOA 1U6MA 3IWWA 5DS0A 4AXVA 1JQGA 5K8OA 3LODA 3GUXA 4H2KA 2PJBA 1ELMP 4L8AA 2BEIA 5HVFA 1LANA 4MCPA 4UA3A 2D4OA 4UF4A 2JBKA 2VQYA 1HDQA 3IGRA 3JRUA 4UIBA 4CAEA 3TO7A 3D7HA 4UCMA 2ZEGA 4HKFA 4AB7A 2Q0YA 2R98A 4NCZA 5C82A 3GY9A 5CPAA 3D4UA 3GIUA 4P4DA 2AFUA 3SJEA 3DLJA 4LX9A 3D2MA 1LRZA 1R43A 1K4JA 1WWZA 2XEGA 1BAVA 2CTBA 3QB8A 2Z11A 3T90A 1TIQA 4GS4A 3IWGA 4C2XA 8CPAA 3EFAA 1M44A 4XPDC 4OC1A 4A37A 3KZWA 2C1CA 4X5KA 2Z3PA 2AFMA 1SQHA 3LD2A 4MJ8A 2Q4YA 4FAIA 3R9GA 1ARLA 2PQ8A 4MBUA 4CAWA 1UFHA 2VI7A 1M1DA 4NGSA 3FX6A 1VHEA 4UFVA 5D29A 3SI0A 1BOBA 2FXFA 1QSMA 4OC0A 3B3CA 3FNCA 3IFEA 3D3SA 2D4PA 4AVBA 2P0WA 1CBXA 1LOKA 1S5KA 1Z9UA 4QVTA 1GHEA 4MHNA 4H6UA 4X3RA 2WPXA 4WWVA 5HXDA 3MGDA 5LYFA 3KR5A 1S7KA 3GB0A 4A38A 2AFZA 2FS5A 1S7NA 4QC6A 2PJ8A 4BMHA 3DNSA 3SXOA 3H8FA 4UWJA 2Q04A 3S9MA 4P4JA 2ZOGA 4MCSA 3CXPA 5JM6A 1Y9WA 3JTKA 4OAEA 5G20A 5ELYA 5JGFA 3B7IA 4B12A 4MFQA 4CAXA 4FBEA 4B13A 1Z4RA 3IWEA 3FEDA 3PFOA 3VARA 4E8OA 4KOUA 2HQYA 1N71A 3WC5A 2ARHA 2YNCA 4M6IA 1IU8A 3DSBA 1Z8LA 1Y7EA 4MHYA 3FIXA 2B3UA 2BCOA 4OC2A 3TO6A 4Z65A 4CS0B 4QB9A 3V38A 4FD6A 3PBBA 4II9A 5K8MA 1HEEA 3PBEA 1A2ZA 3D66A 4CYOA 1VIXA 5EC4A 2OU2A 3SJGA 4ORFA 1QSTA 1ZLHA 5F09A 4R87A 3B8GA 4NSQA 1YR0A 2DXQA 4UEEA 4YRHA 3BXMA 4NFRA 3R95A 4JXRA 4Q38A 1CJWA 3JVNA 3N5FA 3FYNA 3NH4A 4MHPA 3FRMA 2BSWA 4RS2A 4UCPA 5AG5A 2Z3OA 1CPXA 4UFXA 2PJ9A 3F8KA 4M3SA 2CNSA 1Y0RA 1XE4A 2ZEPA 4CRZB 1ZG8A 3G8WA 5JQ4A 1VKCA 1Z8TA 3A9LA 1LCPA 4TNUA 4DYOA 2PCUA 4HPSA 3QNVA 5FVJA 2J8RA 3PZJA 3NE8A 3TE4A 3TX8A 4DNCA 1B6BA 1Z5RA 2V8GA 4NEXA 3MRUA 2AJ6A 1TXRA 4PQAA 4CYNA 4NJQA 2B4DB 4P4FA 5EBVA 2FIWA 3PB4X 4BD9A 4BINA 1Q2YA 2V77A 4CGMA 1XF8A 2B4DA 4MCRA 3LMSA 4KS9A 4JYWA 4U9ZA 1NE9A 2NSMA 4IAVA 2EK9A 3H4QA 1YVOA 2WPWA 1TKHA 4NGRA 4P4EA 1ZO0A 1F2OA 4KVXA 3KQZA 1KWMA 3NH8A 4IUSA 1L0CA 2Z10A 4MFPA 1CM0A 1Y0YA 2A4NA 2OR4A 2AFXA 2P6GA 4KOWA 4KZTA 4CYQA 2QIRA 1S7LA 2Z3MA 4KSIA 4F0XA 3D7DA 5IB0A 3B2YA 2PJ6A 4OC5A 5HVHA 1UWYA 1Z8WA 2POKA 2YNCC 4NF1A 3VH9A 1OZPA 3CXSA 1CPSA 3FVLA 3D67A 3N7ZA 4O23A 4NGMA 1X12A 4JZ0A 4NGPA 1M4GA 3FXTA 2FT0A 4YGOA 3H5ZA 4ONWA 2FL4A 3NH5A 4R3LA 4HNWB 4KLVA 4KSFA 2Q43A 4AG9A 4OC3A 5K8NA 3KKWA 4P45A 2FIAA 1IOFA 1MJAA 4MFJA 4C2YA 1XFOA 3FECA 3F5BA 4R57A 2PJ2A 2Q4VA 3D7GA 3PP9A 4TWEA 5LYLA 5A28A 3D2PA 5AG4A 2XEJA 4UBRA 5CNPA 3VATA 4ZY2A 1Z4EA 5F48A 3TC8A 2QYVA 3ISZA 4KLWA 2VEZA 4MRIA 2AE6A 4PSWA 2O4HA 3T8WA 3EY5A 1AMPA 5KTAA 3IC1A 1JWQA 1ELLP 1BLLE 1LAMA 4A33A 2F5IA 3UY5A 5F46A 1LFWA 3MN8A 1IGBA 1YVKA 2C6CA 2KCWA 2ZEHA 4U5YA 1KZFA 1QSOA 1Y9KA 1YX0A 4ZX9A 4KUBA 4P6YA 2R7HA 2CNTA 2PVVA 4P10A 5E96A 1XOVA 2I3CA 3CT9A 3S6FA 6CPAA 1FY7A 2ANPA 2DPSA 3CPXA 3QAHA 1ZLIA 2PJ4A 2ZW7A 3FMCA 4GXHA 3PB9X 2PIYA 2ZEDA 4H89A 4LQ6A 3BJ8A 2FCKA 2VL1A 2G3TA 4A30A 4B5PA 3WR7A 4QBJA 2Z3LA 3H8GA 2PJ1A 5AG7A 4F6AA 2Z3KA 4C68A 4MI4A 4CAFA 4EFDA 4XPDB 3W6XA 1IYKA 2CY2A 3CZXA 3I1UA 3KGQA 4E2AA 4OP4A 3L2NA 1FT7A 2QJ8A 2PIZA 4F9UA 2WSAA 2PJ3A 2REEA 3KL9A 4MCQA 3LWUA 1NSAA 3RO0A 4B5OA 3IU1A 2FSRA 4KOSA 2V8VA 3NE7A 3KHZA 4NGTA 3BJ7A 2GIVA 4OC4A 5J8CA 2XEIA 3IU2A 1ZG9A 2B5GB 2K5TA 1Q7LA 3PB8X 4K3NA 1DTDA 1TKJA 2ZPAA 4KVOE 1IICA 2G0BA 2WYRA 5LRJA 1V0CA 2VZZA 3TOBA 2Z0ZA 3ZZIA 1IY7A 2GANA 4F8ZA 3SI2A 1S60A 2EO8A 1XMBA 1YK3A 4ONUA 2EVNA 1VHOA 2JDCA 2GE3A 2J8MA 1KUXA 1BPNA 3S6KA 2GU2A 1M4LA 2HUZA 2WUUA 2F7VA 3CPAA 2QECA 1IYLA 2WZNA 3PB7X 4HNXB 3D68A 2PJ7A 4P4BA 2H5MA 3PGPA 4MY3A 4CGLA 1AUGA 4MFLA 3RNZA 7CPAA 3E0KA 2C27A 4UWIA 4XPLA 4CGPA 5BWAB 2RFHA 4I49A 3QAYA 4AG7A 4J3GA 4KOTA 1XJOA 2P6FA 5LYDA 3IEHA 3FB3A 1TF8A 1ZG7A 5LYIA 3WT4A 1I21A 2Q51A 4MY0A 4ZBGA 1P4NA 1NSLA 3TFYA 4YU9A 2IMOA 2O28A 2R1IA 3W91A 2G9DA 4ZI6A 3P2HA 4M6HA 3SJXA 4A2ZA 3S6HA 4IK2A 1BO4A 3GYAA 4IHMA 4AVCA 3PRTA 3SI1A 4R7MA 1RTQA 2J9AA 2EBJA 5KTDA 1F57A 2PRBA 1KUYA 3RYOA 2FE7A 4JD6A 4X2TA 1YW6A 5G21A 3D8PA 2OZHA 1CP7A 5G1ZA 1RO5A 1X10A 1WK4A 2VZYA 2BL1A 2ZEFA 4P4IA 4FD7A 2ZELA 2ZOFA 2PSWA 2GLFA 4KVME 4JLYA 4M85A 1M4DA 5JH9A 2ODFA 1IB1E 1Q2DA 2PE3A 2B58A 3FJUA 2GFQA 1I12A 3P2FA 2PJCA 1ON0A 1QMUA 1QSRA 2Z3NA 2GLJA 3FEEA 4R3KA 1PYTB 3WABA 3EO4A 1S3ZA 2X7BA 2RB7A 2PC1A 3SJFA 2EK8A 3R1KA 2F8HA 3K9TA 4E0AA 2CIJA 2JDDA 2HB6A 1RXTA 2V8HA 2EUIA 1PU9A 4A94A 5THWA 2Q7SA 4PSXA 4YWYA 3NA6A 2EWBA 4KOYA 1YSJA 4ZY1A 5LRKA 4UCNA 4HNYB 2PJAA 3PFEA 3TT2A 2XEFA 2NYQA 1YLOA 3B35A 5J8FA 4EVYA 3EXNA 3I9SA 1B87A 3DR8A 3KQXA 1AYEA 2IL4A 4PK3A 4UIAA 2B5GA 5CBMA 4AVAA 1XRYA 1DE4C 5F47A 5G22A 4P44A 4EMEA 4Y49C 2I79A 4WJBA 3DDDA 2FVGA 1YMEA 3B3TA 4PXBA 4FD5A 3IJ3A 2CNMA 3H8EA 3CXQA 4KOVA 3EC4A 3B3SA 3FH4A 3TO9A 2Q44A 2Q7BA 1KUVA 1J4JA 4FWUA 1CX8A 2OZUA 3I3GA 1LAPA 5A27A 1MJ9A 2BUEA 4GM5A 5D8NA 5H86A 4QUSA 4OADA 2ZXVA 4MXUA 4R6TA 3RZAA 2VBQA 2PJ5A 1FNOA 4CAVA 2OH1A 5J1QA 5K8PA 3R9EA 4MHZA 2OB0A 2JEWA 4R8FA 1PCAA 1EE3P 2GREA 4XNHB 3OWCA 4IF5A 5H84A 4FD4A 3KHXA 3R9FA 1PUAA 3PB6X 2PR8A 1YW4A 3F0AA 4PXEA 4RI1A 1XMTA 3S9NA 4M6GA 5IV0A 4LQGA 4NXYA 3V8IA 4DUKA 4ZYQA 2Q4ZA 2IJZA 4Y49B 2VXKA 4UEZA 5EMIA 2PVWA 4NGQA 1XIXA 2YNEA 2BOAA 3HUVA 2B3VA 4PK2A 1YLEA 2ZW4A 2IQ6A 3IO1A 4YFJA 5LRGA 5F49A 2I00A 1OBRA 5AGEA 2ZEOA 3V7ZA 3K9UA 1YGHA 3SXNA 4OKOA 3BHXA 4PXDA 2PR1A 1Y7RA 3D7FA 4A95A 5HVGA 4UEFA 4Q7AA 4A39A 5I0CA 3B3VA 4H6ZA 4KUAA 4NJRA 4CRYB 2OOTA 4MHDA 4XNHC 2CXAA 1VGYA 5DWMA 1YQEA 2BO9A 2J8NA 4CPAA 5GCNA 1CG2A 1VHSA 3TTHA 4B14A 2CTCA 4CYPA 1HDUA 3KR4A 2C6PA 3DR6A 5IB9A 4U9YA 4C2ZA 1IIDA 3FBUA 5HH1A 3KI9A 1TF9A 2DPTA 4JJXA 2RC4A 2YNDA 2HC9A 3PEIA 1XBUA 3SHPA 4PV6A 2AFOA 4CGOA 4Q36A 4BBHA 1H8LA 3GLJA 2JEVA 1Z8XA 4F0YA 4KOXA 4OLLA 5HMNA 2JBJA
chains in the Genus database with same CATH topology
2B4BA 4JWPA 3S6GA 3T9YA 3JUWA 5C88A 1S7FA 3C26A 3TCVA 2ATRA 2QMLA 3TOAA 4MFKA 4LUAA 2ZW5A 1I1DA 4XPKA 3VWDA 2NMTA 1Q2CA 4A32A 2OZGA 4C7HA 3R96A 5DWNA 4R9MA 1XEBA 3BLNA 1NMTA 4MFZA 2YGWA 3GKRA 4B11A 1QSNA 2Y0MA 3VWEA 4UFWA 3ZJ0A 2R8VA 2JLMA 5JPHA 1YREA 5IX3A 2G3AA 2ZW6A 1MJBA 4L89A 5AG6A 4KORA 4ZGYB 5KTCA 1MK4A 2HV2A 4KSAA 1R57A 3W6SA 4CGNA 3G3SA 4C7IA 2REFA 1M4IA 4B10A 4B5PB 4A31A 2P6EA 1P0HA 4K30A 5ISVA 4JXQA 2PDOA 1U6MA 3LODA 4L8AA 2BEIA 4UA3A 2D4OA 2VQYA 3IGRA 4CAEA 3TO7A 4UCMA 4AB7A 4HKFA 5C82A 2Q0YA 2R98A 4NCZA 3GY9A 4LX9A 3D2MA 1LRZA 1K4JA 1WWZA 3QB8A 3T90A 2Z11A 1TIQA 4GS4A 3IWGA 4C2XA 3EFAA 1M44A 4XPDC 4X5KA 2Z3PA 1SQHA 3LD2A 4MJ8A 2Q4YA 3R9GA 2PQ8A 4MBUA 4CAWA 1UFHA 2VI7A 1M1DA 4UFVA 1BOBA 2FXFA 1QSMA 3FNCA 3D3SA 2D4PA 4AVBA 2P0WA 1S5KA 1Z9UA 4QVTA 1GHEA 4H6UA 2WPXA 3MGDA 1S7KA 2FS5A 4QC6A 1S7NA 4BMHA 3DNSA 3SXOA 4UWJA 2Q04A 3CXPA 3JTKA 1Y9WA 4OAEA 5G20A 4B12A 4MFQA 4CAXA 4B13A 1Z4RA 3IWEA 4E8OA 4KOUA 2HQYA 1N71A 2ARHA 2YNCA 3DSBA 3FIXA 2B3UA 3TO6A 4CS0B 4QB9A 4FD6A 4II9A 4CYOA 5EC4A 2OU2A 4ORFA 1QSTA 4R87A 3B8GA 4NSQA 1YR0A 2DXQA 4YRHA 3R95A 4JXRA 4Q38A 1CJWA 3JVNA 3FYNA 3FRMA 2BSWA 4RS2A 4UCPA 5AG5A 2Z3OA 4UFXA 3F8KA 4M3SA 2CNSA 1XE4A 4CRZB 3G8WA 5JQ4A 1VKCA 3A9LA 5FVJA 2J8RA 3PZJA 3TE4A 4DNCA 1B6BA 4NEXA 2AJ6A 4CYNA 2B4DB 5EBVA 2FIWA 1Q2YA 4CGMA 1XF8A 2B4DA 4KS9A 4U9ZA 1NE9A 3H4QA 1YVOA 2WPWA 1ZO0A 4KVXA 4IUSA 1L0CA 4MFPA 2Z10A 1CM0A 2A4NA 2P6GA 4KOWA 4KZTA 4CYQA 2QIRA 1S7LA 2Z3MA 5IB0A 4F0XA 4NF1A 2YNCC 1OZPA 3CXSA 3N7ZA 1M4GA 3FXTA 2FT0A 4YGOA 3H5ZA 4R3LA 2FL4A 4HNWB 4KLVA 4KSFA 4AG9A 3KKWA 2FIAA 4MFJA 1MJAA 4C2YA 3F5BA 4R57A 2Q4VA 3PP9A 5A28A 3D2PA 4UBRA 5CNPA 1Z4EA 5F48A 4KLWA 2VEZA 4PSWA 2AE6A 3EY5A 5KTAA 4A33A 2F5IA 3UY5A 5F46A 1YVKA 2KCWA 4U5YA 1KZFA 1QSOA 1Y9KA 1YX0A 4KUBA 2R7HA 2CNTA 5E96A 3S6FA 1FY7A 2DPSA 3QAHA 2ZW7A 4H89A 3BJ8A 2FCKA 2G3TA 4A30A 4B5PA 3WR7A 4QBJA 2Z3LA 5AG7A 4F6AA 2Z3KA 4C68A 4MI4A 4CAFA 4XPDB 3W6XA 1IYKA 2CY2A 4E2AA 2WSAA 2REEA 4B5OA 3IU1A 2FSRA 4KOSA 3NE7A 3BJ7A 2GIVA 5J8CA 3IU2A 2K5TA 2B5GB 4KVOE 2ZPAA 3ZZIA 1IICA 2G0BA 3TOBA 1V0CA 2VZZA 2Z0ZA 2GANA 1S60A 1YK3A 4ONUA 2EVNA 2JDCA 2GE3A 2J8MA 1KUXA 3S6KA 2HUZA 2WUUA 2QECA 1IYLA 4HNXB 2H5MA 3PGPA 4MY3A 4CGLA 4MFLA 3E0KA 2C27A 4UWIA 4XPLA 4CGPA 5BWAB 4I49A 4AG7A 4J3GA 4KOTA 2P6FA 3FB3A 1I21A 4MY0A 1NSLA 4ZBGA 1P4NA 3TFYA 2O28A 2R1IA 3W91A 3P2HA 4A2ZA 3S6HA 1BO4A 3GYAA 4AVCA 5KTDA 2PRBA 1KUYA 3RYOA 2FE7A 4JD6A 5G21A 3D8PA 2OZHA 5G1ZA 1RO5A 2VZYA 1WK4A 2BL1A 4FD7A 2PSWA 4KVME 4JLYA 4M85A 1M4DA 1IB1E 1Q2DA 2B58A 1I12A 3P2FA 1ON0A 5AG4A 1QSRA 2Z3NA 4R3KA 3EO4A 1S3ZA 2X7BA 2PC1A 3R1KA 4E0AA 2JDDA 1RXTA 2EUIA 1PU9A 4PSXA 4KOYA 4UCNA 4HNYB 3TT2A 5J8FA 4EVYA 3EXNA 3I9SA 1B87A 3DR8A 2IL4A 4PK3A 2B5GA 4AVAA 5F47A 5G22A 4Y49C 2I79A 3DDDA 4FD5A 2CNMA 4KOVA 3CXQA 3EC4A 3TO9A 2Q44A 2Q7BA 1KUVA 1J4JA 2OZUA 3I3GA 5A27A 1MJ9A 2BUEA 5H86A 4QUSA 4OADA 2ZXVA 2VBQA 4CAVA 2OH1A 3R9EA 2OB0A 4XNHB 3OWCA 4IF5A 5H84A 4FD4A 3R9FA 1PUAA 2PR8A 3F0AA 4RI1A 1XMTA 5IV0A 4NXYA 3V8IA 4Y49B 2VXKA 1XIXA 2YNEA 4PK2A 2B3VA 4YFJA 1YLEA 2ZW4A 5F49A 2I00A 5AGEA 3K9UA 1YGHA 3SXNA 2PR1A 1Y7RA 4A95A 5I0CA 4H6ZA 4KUAA 4CRYB 4MHDA 4XNHC 2CXAA 5DWMA 2J8NA 5GCNA 1VHSA 3TTHA 4B14A 4CYPA 3DR6A 4U9YA 4C2ZA 1IIDA 3FBUA 5HH1A 4JJXA 2DPTA 2RC4A 2YNDA 3SHPA 4PV6A 4CGOA 4Q36A 4BBHA 2JEVA 4F0YA 4KOXA 4OLLA 5HMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4B A;  4JWP A;  3S6G A;  3T9Y A;  3JUW A;  5C88 A;  1S7F A;  3C26 A;  3TCV A;  2ATR A;  2QML A;  3TOA A;  4LUA A;  2ZW5 A;  1I1D A;  4XPK A;  3VWD A;  2NMT A;  1Q2C A;  2OZG A;  3R96 A;  5DWN A;  4R9M A;  1XEB A;  3BLN A;  1NMT A;  3GKR A;  1QSN A;  2Y0M A;  3VWE A;  3ZJ0 A;  5JPH A;  2R8V A;  2JLM A;  1YRE A;  5IX3 A;  2G3A A;  2ZW6 A;  1MJB A;  4L89 A;  4KOR A;  5KTC A;  1MK4 A;  2HV2 A;  1R57 A;  3W6S A;  3G3S A;  2REF A;  1M4I A;  4B5P B;  2P6E A;  1P0H A;  4K30 A;  5ISV A;  4JXQ A;  2PDO A;  1U6M A;  3LOD A;  4L8A A;  2BEI A;  4UA3 A;  2D4O A;  2VQY A;  3IGR A;  3TO7 A;  4AB7 A;  4HKF A;  5C82 A;  2Q0Y A;  2R98 A;  4NCZ A;  3GY9 A;  4LX9 A;  3D2M A;  1LRZ A;  1K4J A;  1WWZ A;  3QB8 A;  3T90 A;  2Z11 A;  1TIQ A;  4GS4 A;  3IWG A;  3EFA A;  1M44 A;  4XPD C;  4X5K A;  1SQH A;  3LD2 A;  4MJ8 A;  2Q4Y A;  3R9G A;  2PQ8 A;  4MBU A;  4CAW A;  1UFH A;  2VI7 A;  1M1D A;  1BOB A;  2FXF A;  1QSM A;  3FNC A;  3D3S A;  2D4P A;  4AVB A;  2P0W A;  1S5K A;  1Z9U A;  4QVT A;  1GHE A;  4H6U A;  2WPX A;  3MGD A;  1S7K A;  2FS5 A;  4QC6 A;  1S7N A;  4BMH A;  3DNS A;  3SXO A;  4UWJ A;  2Q04 A;  3CXP A;  1Y9W A;  4OAE A;  4CAX A;  1Z4R A;  4E8O A;  4KOU A;  2HQY A;  1N71 A;  2ARH A;  3DSB A;  3FIX A;  2B3U A;  3TO6 A;  4CS0 B;  4QB9 A;  4FD6 A;  4II9 A;  5EC4 A;  2OU2 A;  4ORF A;  1QST A;  4R87 A;  3B8G A;  4NSQ A;  1YR0 A;  2DXQ A;  4YRH A;  3R95 A;  4JXR A;  1CJW A;  3JVN A;  3FYN A;  3FRM A;  2BSW A;  4RS2 A;  3F8K A;  4M3S A;  2CNS A;  1XE4 A;  4CRZ B;  3G8W A;  5JQ4 A;  1VKC A;  5FVJ A;  2J8R A;  3PZJ A;  3TE4 A;  4DNC A;  1B6B A;  4NEX A;  2AJ6 A;  2B4D B;  5EBV A;  2FIW A;  1Q2Y A;  1XF8 A;  2B4D A;  4U9Z A;  1NE9 A;  3H4Q A;  1YVO A;  2WPW A;  4KVX A;  4IUS A;  1L0C A;  2Z10 A;  1CM0 A;  2A4N A;  2P6G A;  4KOW A;  4KZT A;  2QIR A;  1S7L A;  5IB0 A;  4NF1 A;  1OZP A;  3CXS A;  3N7Z A;  1M4G A;  3FXT A;  2FT0 A;  4YGO A;  4R3L A;  2FL4 A;  4HNW B;  4KLV A;  4AG9 A;  3KKW A;  2FIA A;  1MJA A;  3F5B A;  4R57 A;  2Q4V A;  3PP9 A;  3D2P A;  4UBR A;  5CNP A;  1Z4E A;  5F48 A;  4KLW A;  2VEZ A;  4PSW A;  2AE6 A;  3EY5 A;  5KTA A;  2F5I A;  3UY5 A;  5F46 A;  1YVK A;  2KCW A;  4U5Y A;  1KZF A;  1QSO A;  1Y9K A;  1YX0 A;  4KUB A;  2R7H A;  2CNT A;  5E96 A;  3S6F A;  1FY7 A;  3QAH A;  2ZW7 A;  4H89 A;  3BJ8 A;  2FCK A;  2G3T A;  4B5P A;  3WR7 A;  4QBJ A;  4F6A A;  4MI4 A;  4XPD B;  3W6X A;  1IYK A;  2CY2 A;  4E2A A;  2REE A;  4B5O A;  2FSR A;  4KOS A;  3NE7 A;  3BJ7 A;  2GIV A;  5J8C A;  2K5T A;  2B5G B;  4KVO E;  2ZPA A;  3ZZI A;  1IIC A;  2G0B A;  3TOB A;  1V0C A;  2VZZ A;  2Z0Z A;  2GAN A;  1S60 A;  1YK3 A;  4ONU A;  2EVN A;  2JDC A;  2GE3 A;  2J8M A;  1KUX A;  3S6K A;  2HUZ A;  2QEC A;  1IYL A;  4HNX B;  2H5M A;  3PGP A;  4MY3 A;  3E0K A;  2C27 A;  4UWI A;  4XPL A;  4I49 A;  4AG7 A;  4J3G A;  4KOT A;  2P6F A;  3FB3 A;  1I21 A;  4MY0 A;  1NSL A;  4ZBG A;  1P4N A;  3TFY A;  2O28 A;  2R1I A;  3W91 A;  3P2H A;  3S6H A;  1BO4 A;  3GYA A;  4AVC A;  5KTD A;  2PRB A;  1KUY A;  3RYO A;  2FE7 A;  4JD6 A;  3D8P A;  2OZH A;  1RO5 A;  2VZY A;  1WK4 A;  2BL1 A;  4FD7 A;  2PSW A;  4KVM E;  4JLY A;  4M85 A;  1M4D A;  1IB1 E;  1Q2D A;  2B58 A;  1I12 A;  3P2F A;  1ON0 A;  1QSR A;  4R3K A;  3EO4 A;  1S3Z A;  2X7B A;  2PC1 A;  3R1K A;  4E0A A;  2JDD A;  1RXT A;  2EUI A;  1PU9 A;  4PSX A;  4KOY A;  4HNY B;  3TT2 A;  5J8F A;  4EVY A;  3EXN A;  3I9S A;  1B87 A;  3DR8 A;  2IL4 A;  4PK3 A;  2B5G A;  4AVA A;  5F47 A;  4Y49 C;  2I79 A;  3DDD A;  4FD5 A;  2CNM A;  4KOV A;  3CXQ A;  3EC4 A;  3TO9 A;  2Q44 A;  2Q7B A;  1KUV A;  1J4J A;  2OZU A;  3I3G A;  1MJ9 A;  2BUE A;  5H86 A;  4QUS A;  4OAD A;  2ZXV A;  2VBQ A;  4CAV A;  2OH1 A;  3R9E A;  2OB0 A;  4XNH B;  3OWC A;  4IF5 A;  5H84 A;  4FD4 A;  3R9F A;  1PUA A;  2PR8 A;  3F0A A;  4RI1 A;  1XMT A;  5IV0 A;  4NXY A;  3V8I A;  4Y49 B;  2VXK A;  1XIX A;  4PK2 A;  2B3V A;  4YFJ A;  1YLE A;  2ZW4 A;  5F49 A;  2I00 A;  3K9U A;  1YGH A;  3SXN A;  2PR1 A;  1Y7R A;  5I0C A;  4H6Z A;  4KUA A;  4CRY B;  4MHD A;  4XNH C;  5DWM A;  2J8N A;  5GCN A;  1VHS A;  3TTH A;  3DR6 A;  4U9Y A;  1IID A;  3FBU A;  5HH1 A;  4JJX A;  2RC4 A;  3SHP A;  4PV6 A;  2JEV A;  4F0Y A;  4KOX A;  4OLL A;  5HMN A; 
#chains in the Genus database with same CATH topology
 4G1P A;  2PJ0 A;  2B4B A;  3RBU A;  4JWP A;  3S6G A;  3ISX A;  3KAS A;  2DEA A;  4MMO A;  3T9Y A;  3JUW A;  4X8I A;  1ARM A;  4PPZ A;  5C88 A;  1S7F A;  3WC7 A;  2ZEN A;  3C26 A;  3TCV A;  2ATR A;  2QML A;  3K2K A;  3TOA A;  4MFK A;  4LUA A;  3WC6 A;  2ZEM A;  2ZW5 A;  1I1D A;  4XPK A;  3RAM A;  1R3N A;  3VWD A;  4NGN A;  2NMT A;  4OIW A;  1Q2C A;  1TKF A;  2O53 A;  4A32 A;  2OZG A;  4C7H A;  3R96 A;  3NFZ A;  5DWN A;  4F9V A;  2V8D A;  3CDX A;  2QVP A;  4R9M A;  1Z2L A;  1XEB A;  1CP6 A;  1F2P A;  3BLN A;  1NMT A;  3DGV A;  4MFZ A;  2YGW A;  3GKR A;  4B11 A;  1QSN A;  4ZX8 A;  2Y0M A;  3FF3 A;  3B3W A;  3LAC A;  3VWE A;  4UFW A;  3ZJ0 A;  2R8V A;  2JLM A;  4PXC A;  5JPH A;  1YRE A;  3S9L A;  1BPM A;  5IX3 A;  4R76 A;  2G3A A;  3BI0 A;  4RN7 A;  1GYT A;  2ABZ A;  4W9Y A;  2ZW6 A;  1MJB A;  3HLP A;  4ZY0 A;  2AFW A;  4L89 A;  5AG6 A;  4KOR A;  4ZGY B;  5KTC A;  1MK4 A;  2C6G A;  2HV2 A;  2PRQ A;  4KSA A;  4B6Z A;  5I4M A;  1R57 A;  2ZEE A;  3W6S A;  4CGN A;  3G3S A;  2DF5 A;  4OID A;  4C7I A;  2REF A;  1M4I A;  4B10 A;  1IOI A;  4B5P B;  1QQ9 A;  4A31 A;  2CF4 A;  3IIB A;  3BI1 A;  4EWT A;  4OME A;  4RUH A;  2P6E A;  4DJL A;  1P0H A;  4K30 A;  4FUU A;  5ISV A;  4JXQ A;  2AFS A;  2PDO A;  1U6M A;  3IWW A;  5DS0 A;  4AXV A;  1JQG A;  5K8O A;  3LOD A;  3GUX A;  4H2K A;  2PJB A;  1ELM P;  4L8A A;  2BEI A;  5HVF A;  1LAN A;  4MCP A;  4UA3 A;  2D4O A;  4UF4 A;  2JBK A;  2VQY A;  1HDQ A;  3IGR A;  3JRU A;  4UIB A;  4CAE A;  3TO7 A;  3D7H A;  4UCM A;  2ZEG A;  4HKF A;  4AB7 A;  2Q0Y A;  2R98 A;  4NCZ A;  5C82 A;  3GY9 A;  5CPA A;  3D4U A;  3GIU A;  4P4D A;  2AFU A;  3SJE A;  3DLJ A;  4LX9 A;  3D2M A;  1LRZ A;  1R43 A;  1K4J A;  1WWZ A;  2XEG A;  1BAV A;  2CTB A;  3QB8 A;  2Z11 A;  3T90 A;  1TIQ A;  4GS4 A;  3IWG A;  4C2X A;  8CPA A;  3EFA A;  1M44 A;  4XPD C;  4OC1 A;  4A37 A;  3KZW A;  2C1C A;  4X5K A;  2Z3P A;  2AFM A;  1SQH A;  3LD2 A;  4MJ8 A;  2Q4Y A;  4FAI A;  3R9G A;  1ARL A;  2PQ8 A;  4MBU A;  4CAW A;  1UFH A;  2VI7 A;  1M1D A;  4NGS A;  3FX6 A;  1VHE A;  4UFV A;  5D29 A;  3SI0 A;  1BOB A;  2FXF A;  1QSM A;  4OC0 A;  3B3C A;  3FNC A;  3IFE A;  3D3S A;  2D4P A;  4AVB A;  2P0W A;  1CBX A;  1LOK A;  1S5K A;  1Z9U A;  4QVT A;  1GHE A;  4MHN A;  4H6U A;  4X3R A;  2WPX A;  4WWV A;  5HXD A;  3MGD A;  5LYF A;  3KR5 A;  1S7K A;  3GB0 A;  4A38 A;  2AFZ A;  2FS5 A;  1S7N A;  4QC6 A;  2PJ8 A;  4BMH A;  3DNS A;  3SXO A;  3H8F A;  4UWJ A;  2Q04 A;  3S9M A;  4P4J A;  2ZOG A;  4MCS A;  3CXP A;  5JM6 A;  1Y9W A;  3JTK A;  4OAE A;  5G20 A;  5ELY A;  5JGF A;  3B7I A;  4B12 A;  4MFQ A;  4CAX A;  4FBE A;  4B13 A;  1Z4R A;  3IWE A;  3FED A;  3PFO A;  3VAR A;  4E8O A;  4KOU A;  2HQY A;  1N71 A;  3WC5 A;  2ARH A;  2YNC A;  4M6I A;  1IU8 A;  3DSB A;  1Z8L A;  1Y7E A;  4MHY A;  3FIX A;  2B3U A;  2BCO A;  4OC2 A;  3TO6 A;  4Z65 A;  4CS0 B;  4QB9 A;  3V38 A;  4FD6 A;  3PBB A;  4II9 A;  5K8M A;  1HEE A;  3PBE A;  1A2Z A;  3D66 A;  4CYO A;  1VIX A;  5EC4 A;  2OU2 A;  3SJG A;  4ORF A;  1QST A;  1ZLH A;  5F09 A;  4R87 A;  3B8G A;  4NSQ A;  1YR0 A;  2DXQ A;  4UEE A;  4YRH A;  3BXM A;  4NFR A;  3R95 A;  4JXR A;  4Q38 A;  1CJW A;  3JVN A;  3N5F A;  3FYN A;  3NH4 A;  4MHP A;  3FRM A;  2BSW A;  4RS2 A;  4UCP A;  5AG5 A;  2Z3O A;  1CPX A;  4UFX A;  2PJ9 A;  3F8K A;  4M3S A;  2CNS A;  1Y0R A;  1XE4 A;  2ZEP A;  4CRZ B;  1ZG8 A;  3G8W A;  5JQ4 A;  1VKC A;  1Z8T A;  3A9L A;  1LCP A;  4TNU A;  4DYO A;  2PCU A;  4HPS A;  3QNV A;  5FVJ A;  2J8R A;  3PZJ A;  3NE8 A;  3TE4 A;  3TX8 A;  4DNC A;  1B6B A;  1Z5R A;  2V8G A;  4NEX A;  3MRU A;  2AJ6 A;  1TXR A;  4PQA A;  4CYN A;  4NJQ A;  2B4D B;  4P4F A;  5EBV A;  2FIW A;  3PB4 X;  4BD9 A;  4BIN A;  1Q2Y A;  2V77 A;  4CGM A;  1XF8 A;  2B4D A;  4MCR A;  3LMS A;  4KS9 A;  4JYW A;  4U9Z A;  1NE9 A;  2NSM A;  4IAV A;  2EK9 A;  3H4Q A;  1YVO A;  2WPW A;  1TKH A;  4NGR A;  4P4E A;  1ZO0 A;  1F2O A;  4KVX A;  3KQZ A;  1KWM A;  3NH8 A;  4IUS A;  1L0C A;  2Z10 A;  4MFP A;  1CM0 A;  1Y0Y A;  2A4N A;  2OR4 A;  2AFX A;  2P6G A;  4KOW A;  4KZT A;  4CYQ A;  2QIR A;  1S7L A;  2Z3M A;  4KSI A;  4F0X A;  3D7D A;  5IB0 A;  3B2Y A;  2PJ6 A;  4OC5 A;  5HVH A;  1UWY A;  1Z8W A;  2POK A;  2YNC C;  4NF1 A;  3VH9 A;  1OZP A;  3CXS A;  1CPS A;  3FVL A;  3D67 A;  3N7Z A;  4O23 A;  4NGM A;  1X12 A;  4JZ0 A;  4NGP A;  1M4G A;  3FXT A;  2FT0 A;  4YGO A;  3H5Z A;  4ONW A;  2FL4 A;  3NH5 A;  4R3L A;  4HNW B;  4KLV A;  4KSF A;  2Q43 A;  4AG9 A;  4OC3 A;  5K8N A;  3KKW A;  4P45 A;  2FIA A;  1IOF A;  1MJA A;  4MFJ A;  4C2Y A;  1XFO A;  3FEC A;  3F5B A;  4R57 A;  2PJ2 A;  2Q4V A;  3D7G A;  3PP9 A;  4TWE A;  5LYL A;  5A28 A;  3D2P A;  5AG4 A;  2XEJ A;  4UBR A;  5CNP A;  3VAT A;  4ZY2 A;  1Z4E A;  5F48 A;  3TC8 A;  2QYV A;  3ISZ A;  4KLW A;  2VEZ A;  4MRI A;  2AE6 A;  4PSW A;  2O4H A;  3T8W A;  3EY5 A;  1AMP A;  5KTA A;  3IC1 A;  1JWQ A;  1ELL P;  1BLL E;  1LAM A;  4A33 A;  2F5I A;  3UY5 A;  5F46 A;  1LFW A;  3MN8 A;  1IGB A;  1YVK A;  2C6C A;  2KCW A;  2ZEH A;  4U5Y A;  1KZF A;  1QSO A;  1Y9K A;  1YX0 A;  4ZX9 A;  4KUB A;  4P6Y A;  2R7H A;  2CNT A;  2PVV A;  4P10 A;  5E96 A;  1XOV A;  2I3C A;  3CT9 A;  3S6F A;  6CPA A;  1FY7 A;  2ANP A;  2DPS A;  3CPX A;  3QAH A;  1ZLI A;  2PJ4 A;  2ZW7 A;  3FMC A;  4GXH A;  3PB9 X;  2PIY A;  2ZED A;  4H89 A;  4LQ6 A;  3BJ8 A;  2FCK A;  2VL1 A;  2G3T A;  4A30 A;  4B5P A;  3WR7 A;  4QBJ A;  2Z3L A;  3H8G A;  2PJ1 A;  5AG7 A;  4F6A A;  2Z3K A;  4C68 A;  4MI4 A;  4CAF A;  4EFD A;  4XPD B;  3W6X A;  1IYK A;  2CY2 A;  3CZX A;  3I1U A;  3KGQ A;  4E2A A;  4OP4 A;  3L2N A;  1FT7 A;  2QJ8 A;  2PIZ A;  4F9U A;  2WSA A;  2PJ3 A;  2REE A;  3KL9 A;  4MCQ A;  3LWU A;  1NSA A;  3RO0 A;  4B5O A;  3IU1 A;  2FSR A;  4KOS A;  2V8V A;  3NE7 A;  3KHZ A;  4NGT A;  3BJ7 A;  2GIV A;  4OC4 A;  5J8C A;  2XEI A;  3IU2 A;  1ZG9 A;  2B5G B;  2K5T A;  1Q7L A;  3PB8 X;  4K3N A;  1DTD A;  1TKJ A;  2ZPA A;  4KVO E;  1IIC A;  2G0B A;  2WYR A;  5LRJ A;  1V0C A;  2VZZ A;  3TOB A;  2Z0Z A;  3ZZI A;  1IY7 A;  2GAN A;  4F8Z A;  3SI2 A;  1S60 A;  2EO8 A;  1XMB A;  1YK3 A;  4ONU A;  2EVN A;  1VHO A;  2JDC A;  2GE3 A;  2J8M A;  1KUX A;  1BPN A;  3S6K A;  2GU2 A;  1M4L A;  2HUZ A;  2WUU A;  2F7V A;  3CPA A;  2QEC A;  1IYL A;  2WZN A;  3PB7 X;  4HNX B;  3D68 A;  2PJ7 A;  4P4B A;  2H5M A;  3PGP A;  4MY3 A;  4CGL A;  1AUG A;  4MFL A;  3RNZ A;  7CPA A;  3E0K A;  2C27 A;  4UWI A;  4XPL A;  4CGP A;  5BWA B;  2RFH A;  4I49 A;  3QAY A;  4AG7 A;  4J3G A;  4KOT A;  1XJO A;  2P6F A;  5LYD A;  3IEH A;  3FB3 A;  1TF8 A;  1ZG7 A;  5LYI A;  3WT4 A;  1I21 A;  2Q51 A;  4MY0 A;  4ZBG A;  1P4N A;  1NSL A;  3TFY A;  4YU9 A;  2IMO A;  2O28 A;  2R1I A;  3W91 A;  2G9D A;  4ZI6 A;  3P2H A;  4M6H A;  3SJX A;  4A2Z A;  3S6H A;  4IK2 A;  1BO4 A;  3GYA A;  4IHM A;  4AVC A;  3PRT A;  3SI1 A;  4R7M A;  1RTQ A;  2J9A A;  2EBJ A;  5KTD A;  1F57 A;  2PRB A;  1KUY A;  3RYO A;  2FE7 A;  4JD6 A;  4X2T A;  1YW6 A;  5G21 A;  3D8P A;  2OZH A;  1CP7 A;  5G1Z A;  1RO5 A;  1X10 A;  1WK4 A;  2VZY A;  2BL1 A;  2ZEF A;  4P4I A;  4FD7 A;  2ZEL A;  2ZOF A;  2PSW A;  2GLF A;  4KVM E;  4JLY A;  4M85 A;  1M4D A;  5JH9 A;  2ODF A;  1IB1 E;  1Q2D A;  2PE3 A;  2B58 A;  3FJU A;  2GFQ A;  1I12 A;  3P2F A;  2PJC A;  1ON0 A;  1QMU A;  1QSR A;  2Z3N A;  2GLJ A;  3FEE A;  4R3K A;  1PYT B;  3WAB A;  3EO4 A;  1S3Z A;  2X7B A;  2RB7 A;  2PC1 A;  3SJF A;  2EK8 A;  3R1K A;  2F8H A;  3K9T A;  4E0A A;  2CIJ A;  2JDD A;  2HB6 A;  1RXT A;  2V8H A;  2EUI A;  1PU9 A;  4A94 A;  5THW A;  2Q7S A;  4PSX A;  4YWY A;  3NA6 A;  2EWB A;  4KOY A;  1YSJ A;  4ZY1 A;  5LRK A;  4UCN A;  4HNY B;  2PJA A;  3PFE A;  3TT2 A;  2XEF A;  2NYQ A;  1YLO A;  3B35 A;  5J8F A;  4EVY A;  3EXN A;  3I9S A;  1B87 A;  3DR8 A;  3KQX A;  1AYE A;  2IL4 A;  4PK3 A;  4UIA A;  2B5G A;  5CBM A;  4AVA A;  1XRY A;  1DE4 C;  5F47 A;  5G22 A;  4P44 A;  4EME A;  4Y49 C;  2I79 A;  4WJB A;  3DDD A;  2FVG A;  1YME A;  3B3T A;  4PXB A;  4FD5 A;  3IJ3 A;  2CNM A;  3H8E A;  3CXQ A;  4KOV A;  3EC4 A;  3B3S A;  3FH4 A;  3TO9 A;  2Q44 A;  2Q7B A;  1KUV A;  1J4J A;  4FWU A;  1CX8 A;  2OZU A;  3I3G A;  1LAP A;  5A27 A;  1MJ9 A;  2BUE A;  4GM5 A;  5D8N A;  5H86 A;  4QUS A;  4OAD A;  2ZXV A;  4MXU A;  4R6T A;  3RZA A;  2VBQ A;  2PJ5 A;  1FNO A;  4CAV A;  2OH1 A;  5J1Q A;  5K8P A;  3R9E A;  4MHZ A;  2OB0 A;  2JEW A;  4R8F A;  1PCA A;  1EE3 P;  2GRE A;  4XNH B;  3OWC A;  4IF5 A;  5H84 A;  4FD4 A;  3KHX A;  3R9F A;  1PUA A;  3PB6 X;  2PR8 A;  1YW4 A;  3F0A A;  4PXE A;  4RI1 A;  1XMT A;  3S9N A;  4M6G A;  5IV0 A;  4LQG A;  4NXY A;  3V8I A;  4DUK A;  4ZYQ A;  2Q4Z A;  2IJZ A;  4Y49 B;  2VXK A;  4UEZ A;  5EMI A;  2PVW A;  4NGQ A;  1XIX A;  2YNE A;  2BOA A;  3HUV A;  2B3V A;  4PK2 A;  1YLE A;  2ZW4 A;  2IQ6 A;  3IO1 A;  4YFJ A;  5LRG A;  5F49 A;  2I00 A;  1OBR A;  5AGE A;  2ZEO A;  3V7Z A;  3K9U A;  1YGH A;  3SXN A;  4OKO A;  3BHX A;  4PXD A;  2PR1 A;  1Y7R A;  3D7F A;  4A95 A;  5HVG A;  4UEF A;  4Q7A A;  4A39 A;  5I0C A;  3B3V A;  4H6Z A;  4KUA A;  4NJR A;  4CRY B;  2OOT A;  4MHD A;  4XNH C;  2CXA A;  1VGY A;  5DWM A;  1YQE A;  2BO9 A;  2J8N A;  4CPA A;  5GCN A;  1CG2 A;  1VHS A;  3TTH A;  4B14 A;  2CTC A;  4CYP A;  1HDU A;  3KR4 A;  2C6P A;  3DR6 A;  5IB9 A;  4U9Y A;  4C2Z A;  1IID A;  3FBU A;  5HH1 A;  3KI9 A;  1TF9 A;  2DPT A;  4JJX A;  2RC4 A;  2YND A;  2HC9 A;  3PEI A;  1XBU A;  3SHP A;  4PV6 A;  2AFO A;  4CGO A;  4Q36 A;  4BBH A;  1H8L A;  3GLJ A;  2JEV A;  1Z8X A;  4F0Y A;  4KOX A;  4OLL A;  5HMN A;  2JBJ A; 
#chains in the Genus database with same CATH homology
 2B4B A;  4JWP A;  3S6G A;  3T9Y A;  3JUW A;  5C88 A;  1S7F A;  3C26 A;  3TCV A;  2ATR A;  2QML A;  3TOA A;  4MFK A;  4LUA A;  2ZW5 A;  1I1D A;  4XPK A;  3VWD A;  2NMT A;  1Q2C A;  4A32 A;  2OZG A;  4C7H A;  3R96 A;  5DWN A;  4R9M A;  1XEB A;  3BLN A;  1NMT A;  4MFZ A;  2YGW A;  3GKR A;  4B11 A;  1QSN A;  2Y0M A;  3VWE A;  4UFW A;  3ZJ0 A;  2R8V A;  2JLM A;  5JPH A;  1YRE A;  5IX3 A;  2G3A A;  2ZW6 A;  1MJB A;  4L89 A;  5AG6 A;  4KOR A;  4ZGY B;  5KTC A;  1MK4 A;  2HV2 A;  4KSA A;  1R57 A;  3W6S A;  4CGN A;  3G3S A;  4C7I A;  2REF A;  1M4I A;  4B10 A;  4B5P B;  4A31 A;  2P6E A;  1P0H A;  4K30 A;  5ISV A;  4JXQ A;  2PDO A;  1U6M A;  3LOD A;  4L8A A;  2BEI A;  4UA3 A;  2D4O A;  2VQY A;  3IGR A;  4CAE A;  3TO7 A;  4UCM A;  4AB7 A;  4HKF A;  5C82 A;  2Q0Y A;  2R98 A;  4NCZ A;  3GY9 A;  4LX9 A;  3D2M A;  1LRZ A;  1K4J A;  1WWZ A;  3QB8 A;  3T90 A;  2Z11 A;  1TIQ A;  4GS4 A;  3IWG A;  4C2X A;  3EFA A;  1M44 A;  4XPD C;  4X5K A;  2Z3P A;  1SQH A;  3LD2 A;  4MJ8 A;  2Q4Y A;  3R9G A;  2PQ8 A;  4MBU A;  4CAW A;  1UFH A;  2VI7 A;  1M1D A;  4UFV A;  1BOB A;  2FXF A;  1QSM A;  3FNC A;  3D3S A;  2D4P A;  4AVB A;  2P0W A;  1S5K A;  1Z9U A;  4QVT A;  1GHE A;  4H6U A;  2WPX A;  3MGD A;  1S7K A;  2FS5 A;  4QC6 A;  1S7N A;  4BMH A;  3DNS A;  3SXO A;  4UWJ A;  2Q04 A;  3CXP A;  3JTK A;  1Y9W A;  4OAE A;  5G20 A;  4B12 A;  4MFQ A;  4CAX A;  4B13 A;  1Z4R A;  3IWE A;  4E8O A;  4KOU A;  2HQY A;  1N71 A;  2ARH A;  2YNC A;  3DSB A;  3FIX A;  2B3U A;  3TO6 A;  4CS0 B;  4QB9 A;  4FD6 A;  4II9 A;  4CYO A;  5EC4 A;  2OU2 A;  4ORF A;  1QST A;  4R87 A;  3B8G A;  4NSQ A;  1YR0 A;  2DXQ A;  4YRH A;  3R95 A;  4JXR A;  4Q38 A;  1CJW A;  3JVN A;  3FYN A;  3FRM A;  2BSW A;  4RS2 A;  4UCP A;  5AG5 A;  2Z3O A;  4UFX A;  3F8K A;  4M3S A;  2CNS A;  1XE4 A;  4CRZ B;  3G8W A;  5JQ4 A;  1VKC A;  3A9L A;  5FVJ A;  2J8R A;  3PZJ A;  3TE4 A;  4DNC A;  1B6B A;  4NEX A;  2AJ6 A;  4CYN A;  2B4D B;  5EBV A;  2FIW A;  1Q2Y A;  4CGM A;  1XF8 A;  2B4D A;  4KS9 A;  4U9Z A;  1NE9 A;  3H4Q A;  1YVO A;  2WPW A;  1ZO0 A;  4KVX A;  4IUS A;  1L0C A;  4MFP A;  2Z10 A;  1CM0 A;  2A4N A;  2P6G A;  4KOW A;  4KZT A;  4CYQ A;  2QIR A;  1S7L A;  2Z3M A;  5IB0 A;  4F0X A;  4NF1 A;  2YNC C;  1OZP A;  3CXS A;  3N7Z A;  1M4G A;  3FXT A;  2FT0 A;  4YGO A;  3H5Z A;  4R3L A;  2FL4 A;  4HNW B;  4KLV A;  4KSF A;  4AG9 A;  3KKW A;  2FIA A;  4MFJ A;  1MJA A;  4C2Y A;  3F5B A;  4R57 A;  2Q4V A;  3PP9 A;  5A28 A;  3D2P A;  4UBR A;  5CNP A;  1Z4E A;  5F48 A;  4KLW A;  2VEZ A;  4PSW A;  2AE6 A;  3EY5 A;  5KTA A;  4A33 A;  2F5I A;  3UY5 A;  5F46 A;  1YVK A;  2KCW A;  4U5Y A;  1KZF A;  1QSO A;  1Y9K A;  1YX0 A;  4KUB A;  2R7H A;  2CNT A;  5E96 A;  3S6F A;  1FY7 A;  2DPS A;  3QAH A;  2ZW7 A;  4H89 A;  3BJ8 A;  2FCK A;  2G3T A;  4A30 A;  4B5P A;  3WR7 A;  4QBJ A;  2Z3L A;  5AG7 A;  4F6A A;  2Z3K A;  4C68 A;  4MI4 A;  4CAF A;  4XPD B;  3W6X A;  1IYK A;  2CY2 A;  4E2A A;  2WSA A;  2REE A;  4B5O A;  3IU1 A;  2FSR A;  4KOS A;  3NE7 A;  3BJ7 A;  2GIV A;  5J8C A;  3IU2 A;  2K5T A;  2B5G B;  4KVO E;  2ZPA A;  3ZZI A;  1IIC A;  2G0B A;  3TOB A;  1V0C A;  2VZZ A;  2Z0Z A;  2GAN A;  1S60 A;  1YK3 A;  4ONU A;  2EVN A;  2JDC A;  2GE3 A;  2J8M A;  1KUX A;  3S6K A;  2HUZ A;  2WUU A;  2QEC A;  1IYL A;  4HNX B;  2H5M A;  3PGP A;  4MY3 A;  4CGL A;  4MFL A;  3E0K A;  2C27 A;  4UWI A;  4XPL A;  4CGP A;  5BWA B;  4I49 A;  4AG7 A;  4J3G A;  4KOT A;  2P6F A;  3FB3 A;  1I21 A;  4MY0 A;  1NSL A;  4ZBG A;  1P4N A;  3TFY A;  2O28 A;  2R1I A;  3W91 A;  3P2H A;  4A2Z A;  3S6H A;  1BO4 A;  3GYA A;  4AVC A;  5KTD A;  2PRB A;  1KUY A;  3RYO A;  2FE7 A;  4JD6 A;  5G21 A;  3D8P A;  2OZH A;  5G1Z A;  1RO5 A;  2VZY A;  1WK4 A;  2BL1 A;  4FD7 A;  2PSW A;  4KVM E;  4JLY A;  4M85 A;  1M4D A;  1IB1 E;  1Q2D A;  2B58 A;  1I12 A;  3P2F A;  1ON0 A;  5AG4 A;  1QSR A;  2Z3N A;  4R3K A;  3EO4 A;  1S3Z A;  2X7B A;  2PC1 A;  3R1K A;  4E0A A;  2JDD A;  1RXT A;  2EUI A;  1PU9 A;  4PSX A;  4KOY A;  4UCN A;  4HNY B;  3TT2 A;  5J8F A;  4EVY A;  3EXN A;  3I9S A;  1B87 A;  3DR8 A;  2IL4 A;  4PK3 A;  2B5G A;  4AVA A;  5F47 A;  5G22 A;  4Y49 C;  2I79 A;  3DDD A;  4FD5 A;  2CNM A;  4KOV A;  3CXQ A;  3EC4 A;  3TO9 A;  2Q44 A;  2Q7B A;  1KUV A;  1J4J A;  2OZU A;  3I3G A;  5A27 A;  1MJ9 A;  2BUE A;  5H86 A;  4QUS A;  4OAD A;  2ZXV A;  2VBQ A;  4CAV A;  2OH1 A;  3R9E A;  2OB0 A;  4XNH B;  3OWC A;  4IF5 A;  5H84 A;  4FD4 A;  3R9F A;  1PUA A;  2PR8 A;  3F0A A;  4RI1 A;  1XMT A;  5IV0 A;  4NXY A;  3V8I A;  4Y49 B;  2VXK A;  1XIX A;  2YNE A;  4PK2 A;  2B3V A;  4YFJ A;  1YLE A;  2ZW4 A;  5F49 A;  2I00 A;  5AGE A;  3K9U A;  1YGH A;  3SXN A;  2PR1 A;  1Y7R A;  4A95 A;  5I0C A;  4H6Z A;  4KUA A;  4CRY B;  4MHD A;  4XNH C;  2CXA A;  5DWM A;  2J8N A;  5GCN A;  1VHS A;  3TTH A;  4B14 A;  4CYP A;  3DR6 A;  4U9Y A;  4C2Z A;  1IID A;  3FBU A;  5HH1 A;  4JJX A;  2DPT A;  2RC4 A;  2YND A;  3SHP A;  4PV6 A;  4CGO A;  4Q36 A;  4BBH A;  2JEV A;  4F0Y A;  4KOX A;  4OLL A;  5HMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...