3S6FA

Crystal structure of a putative acetyltransferase (dr_1678) from deinococcus radiodurans r1 at 1.19 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
143
structure length
143
Chain Sequence
MTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILAASIPLLEVQAGWRSLGLGSELMRRVLTELGDLYMVDLSCDDDVVPFYERLGLKRANAMFLRRYDNQAGIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypothetical acetyltransferase
publication title Crystal structure of a Hypothetical acetyltransferase (DR_1678) from Deinococcus radiodurans at 1.19 A resolution
rcsb
source organism Deinococcus radiodurans
total genus 33
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3s6fA00
5I0CA 4CAWA 2QMLA 2C27A 4J3GA 4MBUA 4NCZA 1KUVA 2B5GA 3IWGA 4CRZB 2DXQA 1K4JA 4KVOE 2X7BA 1TIQA 1M44A 4B5OA 4IUSA 4JXQA 1IYKA 1SQHA 2J8RA 3BJ8A 1IIDA 3QB8A 3R1KA 2ZPAA 4PK3A 2FE7A 4UBRA 1PUAA 2O28A 3TE4A 2IL4A 2B4DA 4HNWB 3CXQA 3EFAA 3DR8A 3TOAA 1S7FA 2PSWA 2QIRA 2I00A 1Y7RA 4KOVA 1M1DA 1QSMA 5IX3A 3T90A 2I79A 1S7KA 3TO9A 1P0HA 4JLYA 2B3UA 5HH1A 3RYOA 1NE9A 1YK3A 1S7LA 5JPHA 3FXTA 1GHEA 3D3SA 3SHPA 1YGHA 1YVOA 3NE7A 2B58A 2JLMA 4R9MA 5DWMA 3LODA 3S6FA 4CAXA 3EO4A 4OAEA 5F48A 4LX9A 4CAVA 5CNPA 4X5KA 2VEZA 4L8AA 5ISVA 5F46A 1I1DA 2PDOA 2FXFA 4R57A 4MHDA 4PSWA 2OZHA 2FSRA 1B6BA 4U9ZA 4E8OA 4F0YA 5J8FA 4AVBA 2RC4A 4RS2A 1XIXA 1WWZA 4PK2A 3PP9A 4QUSA 1Z4EA 4KZTA 4QB9A 4F6AA 1UFHA 4K30A 3DR6A 1OZPA 2REEA 3DDDA 2F5IA 2OZUA 5GCNA 1IICA 3PZJA 1B87A 1QSOA 4HNXB 2VI7A 4XNHC 4AVCA 4HNYB 1LRZA 5FVJA 5C88A 2R98A 2FIWA 3S6GA 4YFJA 1NMTA 1P4NA 3R96A 1KZFA 4H6UA 2WPXA 2BSWA 4UA3A 1NSLA 5E96A 3JUWA 3P2HA 2Q44A 3IGRA 2JEVA 3R9GA 3DSBA 3FRMA 4AVAA 4AG9A 2ZXVA 2P6EA 1Q2CA 1KUXA 2G3TA 3TO6A 3BLNA 3GKRA 4B5PB 2HV2A 4KOYA 1R57A 2WPWA 3I9SA 1U6MA 1MJ9A 2Q4VA 3TFYA 3R95A 2R7HA 3MGDA 3SXOA 3I3GA 2Q4YA 1J4JA 1FY7A 4MJ8A 5H84A 3PGPA 5KTAA 2G3AA 4Y49C 3F5BA 4KUAA 4B5PA 2P0WA 3K9UA 5H86A 2FL4A 4KOXA 1RO5A 2VZZA 5KTDA 3B8GA 3EC4A 1YVKA 1XE4A 4ORFA 1XEBA 1Q2YA 3R9EA 3F8KA 2HQYA 4IF5A 3GY9A 2D4PA 1L0CA 2OZGA 4XNHB 3CXPA 1QSTA 4KUBA 2R1IA 3S6KA 5EC4A 1IB1E 2R8VA 4U9YA 2GE3A 4UWJA 4FD4A 1YLEA 3F0AA 2ZW6A 3FYNA 3QAHA 3EXNA 2B3VA 3H4QA 5F49A 2ARHA 2Z0ZA 1RXTA 4E2AA 2A4NA 3T9YA 4MY3A 4HKFA 2AJ6A 1XMTA 4M85A 2Z10A 1Y9KA 2CNSA 3N7ZA 2KCWA 3D2MA 1KUYA 4LUAA 4L89A 3ZZIA 3W6SA 4FD7A 1IYLA 2JDDA 3GYAA 4PV6A 3W91A 1ON0A 1M4IA 1QSNA 4YRHA 2D4OA 1CM0A 1Y9WA 4MY0A 2BUEA 4H89A 3LD2A 2PR8A 5EBVA 4YGOA 2EVNA 4KOTA 1BOBA 2CNMA 4NEXA 4Y49B 3VWEA 1CJWA 1MJAA 4AB7A 4R3LA 3C26A 4OADA 2OH1A 3G8WA 4ONUA 3VWDA 1Z4RA 3TTHA 4FD5A 2Q0YA 4UWIA 4CS0B 2B5GB 2CY2A 2NMTA 4KLWA 2CNTA 3S6HA 3ZJ0A 3G3SA 4KLVA 4I49A 2Q7BA 4JXRA 2REFA 5IV0A 4II9A 4U5YA 4KOSA 2ZW7A 4CRYB 1VHSA 3TOBA 2J8NA 1MJBA 3FNCA 3WR7A 2B4DB 5HMNA 3TCVA 4QBJA 4KVME 1M4DA 4PSXA 5JQ4A 4KOUA 3P2FA 2VBQA 3TO7A 5IB0A 4OLLA 1I12A 1MK4A 2Y0MA 3SXNA 2VZYA 3W6XA 4KOWA 3UY5A 3OWCA 2ZW5A 2OB0A 1YR0A 1YREA 2P6FA 4NXYA 4BMHA 1WK4A 3KKWA 4DNCA 2AE6A 4RI1A 2PRBA 2PC1A 1PU9A 2ZW4A 2FS5A 5KTCA 5C82A 4XPDB 4ZBGA 4NSQA 4E0AA 4NF1A 2JDCA 5DWNA 2OU2A 3JVNA 2PQ8A 2VQYA 3D2PA 4AG7A 3EY5A 3V8IA 4FD6A 2GANA 4R87A 2FCKA 3D8PA 4QC6A 1V0CA 1I21A 4XPLA 4KVXA 2P6GA 4H6ZA 1XF8A 2Z11A 3FIXA 1Q2DA 1S7NA 3E0KA 3DNSA 2Q04A 4EVYA 1VKCA 2G0BA 2QECA 3FB3A 2J8MA 2EUIA 2H5MA 2K5TA 2GIVA 5F47A 4GS4A 2ATRA 1QSRA 1S5KA 4JJXA 2B4BA 3R9FA 1S60A 2FT0A 1Z9UA 4QVTA 4R3KA 3TT2A 1YX0A 2PR1A 2VXKA 4XPDC 5J8CA 4JWPA 4KORA 4XPKA 1BO4A 1S3ZA 4JD6A 3CXSA 2HUZA 2BL1A 4M3SA 2BEIA 2FIAA 1N71A 1M4GA 4MI4A 3FBUA 3BJ7A
chains in the Genus database with same CATH superfamily
5I0CA 4MFJA 4CAWA 3FECA 2QMLA 2C27A 4J3GA 4C7HA 4MBUA 2EWBA 4MCQA 4NCZA 4OC5A 3WT4A 1Q7LA 1PCAA 1ZLHA 2V8HA 3GIUA 2YNEA 3RZAA 5D29A 2WUUA 3B3VA 1CG2A 1KUVA 3SJEA 2B5GA 2DF5A 3IWGA 3KL9A 4CAFA 4CRZB 3RO0A 2DXQA 1H8LA 5AG5A 5LYIA 3FJUA 1TKFA 3FX6A 1K4JA 1ELLP 4KVOE 4YWYA 2X7BA 4BINA 3BHXA 3PRTA 2Q7SA 4DYOA 1TIQA 1M44A 4X2TA 4B5OA 3MRUA 4CGPA 3PB4X 4IUSA 4JXQA 1BLLE 1IYKA 1SQHA 3CPAA 2J8RA 3BJ8A 1IIDA 3QB8A 3R1KA 4A2ZA 2ZPAA 2YNCC 4PK3A 2F7VA 2WYRA 2FE7A 1XJOA 3SJFA 3IC1A 4UBRA 1PUAA 2O28A 4A33A 4RUHA 2CF4A 3TE4A 4Q36A 3D4UA 2IL4A 1A2ZA 3PFEA 2B4DA 4HNWB 2CTCA 1YW6A 3L2NA 2PJ1A 3CXQA 3EFAA 3DR8A 3B2YA 2ZEPA 4MFLA 3TOAA 5F09A 1S7FA 2XEIA 2PSWA 1HDQA 3FVLA 5AGEA 3SI2A 2AFXA 4KSAA 2QIRA 2I00A 1Y7RA 2ZEHA 1M1DA 4KOVA 1QSMA 5IX3A 4NGTA 1ELMP 3T90A 2I79A 5LYLA 1JWQA 1S7KA 4P10A 2V8DA 3TO9A 1P0HA 4JLYA 2B3UA 5HH1A 3RYOA 1NE9A 1YK3A 4MHYA 4NFRA 1S7LA 4RN7A 2G9DA 4NGQA 5JPHA 3FXTA 4NGRA 1GHEA 3D3SA 3SHPA 1YGHA 1YVOA 3QAYA 2V77A 5HXDA 3NE7A 2B58A 2JLMA 4R9MA 3JRUA 5G1ZA 5DWMA 3LODA 3S6FA 3RNZA 3KASA 1IY7A 5BWAB 4CAXA 1VIXA 3V38A 4MXUA 3EO4A 1VHOA 4UEZA 4OAEA 5F48A 4LX9A 4OKOA 3IWEA 4K3NA 5CNPA 4A30A 3KHZA 4BD9A 1Y0YA 2VEZA 4P4JA 4L8AA 4X5KA 5JH9A 5ISVA 3VATA 5F46A 1F2OA 1I1DA 2PDOA 2FXFA 4NGSA 4R57A 3WC6A 1LANA 4MHDA 4PSWA 2GREA 5LRKA 2EO8A 2OZHA 2AFSA 4P44A 2FSRA 4P4IA 3CT9A 1CPXA 3VH9A 3RAMA 3JTKA 1B6BA 4U9ZA 4E8OA 4F0YA 5J8FA 3H5ZA 4AVBA 1CP7A 2PJAA 2RC4A 4C2XA 4NGMA 4RS2A 1XIXA 2EBJA 2ZEGA 1QMUA 1WWZA 3KI9A 5G20A 1DE4C 4CGNA 2ANPA 4W9YA 4ZX9A 4PK2A 3NH8A 4P4FA 2CTBA 3PP9A 4QUSA 1Z4EA 4KZTA 3MN8A 1XFOA 4QB9A 3SJGA 3KHXA 4F6AA 1AYEA 1F57A 1UFHA 4K30A 3DR6A 3SJXA 3S9MA 4P4BA 1OZPA 2REEA 1DTDA 3DDDA 5JM6A 2F5IA 2O53A 2OZUA 5GCNA 4ZX8A 1IICA 3PZJA 4UEFA 1B87A 1QSOA 4HNXB 2QJ8A 2Z3KA 2VI7A 1Z8XA 2GFQA 4XNHC 3SI1A 2ZELA 4AVCA 4Z65A 4HNYB 1LRZA 3FH4A 5FVJA 3KQZA 2ZEEA 5C88A 2R98A 2BO9A 4A37A 2FIWA 4MMOA 1XOVA 1ZG7A 3S6GA 4YFJA 2PJBA 4Q7AA 3IFEA 4C2YA 1NMTA 1P4NA 5LYFA 3R96A 1KZFA 4H6UA 4PXEA 2WPXA 2BSWA 4UA3A 1NSLA 3PB7X 1XBUA 4CAEA 5E96A 3JUWA 1ZO0A 3CZXA 3IJ3A 3A9LA 1TXRA 3P2HA 3LMSA 2Q44A 4OC0A 2PJ5A 2YGWA 3B35A 2JBKA 2YNCA 1LCPA 4PXBA 5A28A 3IGRA 2JEVA 3R9GA 3DSBA 5G22A 2CIJA 3FRMA 4FAIA 4PXCA 4AVAA 4AG9A 2ZXVA 3KGQA 1YSJA 1JQGA 2P6EA 4F8ZA 1Q2CA 1KUXA 2G3TA 3TO6A 1X12A 4OC1A 3BLNA 2Z3NA 3GKRA 2HV2A 4ZY2A 4B5PB 4KOYA 3CPXA 1R57A 4WJBA 3BI0A 3D68A 4UCMA 4FUUA 3KZWA 2WPWA 3I9SA 2YNDA 3B7IA 1YW4A 3PEIA 1ZG8A 4A39A 1U6MA 4P4DA 2DEAA 5HVGA 4MCPA 2ZEFA 1MJ9A 2Q4VA 2Q43A 3TFYA 3N5FA 3T8WA 4GM5A 3R95A 2R7HA 3FEEA 1RTQA 3MGDA 4PPZA 3I3GA 3SXOA 2Q4YA 3H8GA 3KR5A 3D66A 3D7HA 1CX8A 3LWUA 1R43A 1J4JA 1FY7A 4MJ8A 5H84A 2GU2A 1IU8A 3IEHA 3PGPA 5KTAA 2JBJA 1HEEA 2G3AA 4UIBA 2PRQA 1TKJA 5DS0A 2Z3OA 3K9TA 4BBHA 4Y49C 3F5BA 4KUAA 4B5PA 4B6ZA 5K8NA 1M4LA 2BCOA 2P0WA 2Z3PA 3K9UA 5H86A 2FL4A 4KOXA 1RO5A 2VZZA 4GXHA 4MFQA 3B8GA 5JGFA 5KTDA 3EC4A 4M6HA 1YVKA 1BAVA 3GLJA 3D7FA 3PBEA 1XE4A 4NGPA 4ORFA 1XEBA 1Q2YA 4TNUA 3NA6A 3R9EA 1YMEA 2HQYA 3F8KA 4IF5A 4IHMA 4LQ6A 3GY9A 4MHZA 4OIWA 2D4PA 3B3TA 4P4EA 4C68A 1L0CA 2OZGA 3DGVA 4MHNA 4XNHB 3CXPA 4EWTA 1QSTA 4MFKA 4KUBA 2R1IA 3S6KA 2PE3A 2GLFA 5EC4A 1IB1E 2R8VA 4U9YA 2GE3A 1NSAA 1XMBA 1ZG9A 1BPNA 2JEWA 3B3WA 4KSIA 4FD4A 4UWJA 1YLEA 2AFWA 2ZW6A 3F0AA 3RBUA 2IMOA 3FYNA 3NH5A 3QAHA 3EXNA 2B3VA 3TC8A 3H4QA 4JZ0A 2I3CA 5F49A 3HLPA 2ARHA 3CDXA 1YLOA 2V8VA 2Z0ZA 3ISXA 2PJ2A 1RXTA 4OIDA 4E2AA 2PIZA 1FT7A 2A4NA 3T9YA 4MY3A 4C2ZA 4HKFA 1CBXA 2AJ6A 1XMTA 3FMCA 4M85A 2Z10A 4EFDA 4IK2A 3PBBA 1Y9KA 2CNSA 3IU1A 3N7ZA 1YQEA 2KCWA 3D2MA 4KSFA 4MRIA 4UCPA 4CGLA 2FVGA 3IO1A 3PB6X 1KUYA 4LQGA 2Z3LA 4L89A 4LUAA 4OC4A 3ZZIA 4R8FA 1Z8TA 2PJ8A 2C6PA 2J9AA 3VARA 3W6SA 2XEFA 4FD7A 1IYLA 2IQ6A 2JDDA 2ODFA 3GYAA 4PV6A 3W91A 8CPAA 1ON0A 1M4IA 1AMPA 1VHEA 2ZOFA 1QSNA 4YRHA 2D4OA 3DLJA 4FBEA 1Z5RA 4HPSA 1CM0A 1Y9WA 4MY0A 2BUEA 4ZY0A 4H89A 3LD2A 4MFPA 2PR8A 2PJ6A 5EBVA 4YGOA 1VGYA 2EVNA 1BOBA 4KOTA 2CNMA 4NEXA 4Y49B 3VWEA 1CJWA 4KS9A 5I4MA 4UCNA 1MJAA 1IOIA 4AB7A 1CPSA 4R3LA 1R3NA 3NH4A 3C26A 3WC5A 4OADA 2OH1A 4UEEA 1GYTA 3G8WA 2PJ7A 4PQAA 4X3RA 4ONUA 3VWDA 1Z4RA 3KR4A 3TTHA 2VL1A 4FD5A 2Q0YA 4UWIA 4CS0B 4MCRA 1AUGA 4ONWA 2B5GB 1KWMA 3S9NA 2CY2A 4B10A 1UWYA 2NMTA 2XEGA 5THWA 4KLWA 2V8GA 2PVVA 2ZEOA 1Y7EA 3WABA 2CXAA 2WZNA 5EMIA 2CNTA 4CPAA 3S6HA 3ZJ0A 4B13A 3D7DA 3G3SA 4KLVA 4I49A 2Q7BA 7CPAA 2DPSA 2PJ4A 4JXRA 2REFA 1LOKA 5IV0A 3I1UA 3BI1A 5CBMA 1ARMA 3WC7A 4II9A 4U5YA 3IU2A 4KOSA 4A31A 5LRGA 2ZW7A 4CRYB 1VHSA 4A38A 3TOBA 5K8OA 2AFZA 1MJBA 2J8NA 3FNCA 3WR7A 3SI0A 3V7ZA 2B4DB 2HB6A 4F0XA 4NJQA 1OBRA 3NE8A 4YU9A 5HMNA 2Z3MA 2PCUA 3HUVA 3TCVA 3LACA 5HVHA 2OR4A 4QBJA 2O4HA 2Q4ZA 4CYQA 3D7GA 4KVME 5ELYA 2PJ9A 4CYNA 2IJZA 5AG4A 5LYDA 3B3CA 1M4DA 4PSXA 5JQ4A 4KOUA 3P2FA 1TF8A 5AG7A 5LRJA 5CPAA 2DPTA 5AG6A 3FEDA 3ISZA 3K2KA 4OMEA 2Q51A 1Z2LA 2WSAA 3FF3A 2GLJA 2VBQA 3H8FA 3TO7A 5IB0A 1FNOA 1EE3P 4NJRA 2ZEMA 4OLLA 4UIAA 2HC9A 2POKA 4NGNA 1I12A 5A27A 1MK4A 2Y0MA 3SXNA 2VZYA 3W6XA 4KOWA 5J1QA 3UY5A 2BOAA 2ZEDA 3OWCA 3IWWA 4PXDA 2ZW5A 4F9UA 2OB0A 4CYOA 4Q38A 1YR0A 3S9LA 2EK8A 1YREA 2P6FA 4NXYA 4BMHA 1Z8WA 2C6CA 1WK4A 1IOFA 3KKWA 4DNCA 2RFHA 1PYTB 4ZYQA 2AE6A 2F8HA 4RI1A 2AFUA 2PRBA 3PB9X 2PC1A 1PU9A 4EMEA 4R7MA 4X8IA 2ZW4A 4OC2A 2PJ3A 2FS5A 5KTCA 5C82A 4XPDB 4ZBGA 4NSQA 3H8EA 4E0AA 2NYQA 4NF1A 2JDCA 1ZLIA 4R76A 5DWNA 3NFZA 2OU2A 3PFOA 3JVNA 2PQ8A 1HDUA 4R6TA 2AFOA 2VQYA 3D2PA 4AG7A 1QQ9A 4G1PA 3EY5A 3V8IA 4FD6A 4DUKA 4JYWA 2GANA 4MHPA 4R87A 5IB9A 2FCKA 3D8PA 3QNVA 1V0CA 4M6IA 1I21A 4M6GA 4QC6A 3PB8X 1Z8LA 2P6GA 3GB0A 4H6ZA 4KVXA 1XF8A 4XPLA 2Z11A 1LAPA 3FIXA 1Q2DA 1S7NA 3E0KA 2XEJA 4OP4A 1XRYA 3DNSA 2Q04A 2QYVA 2PVWA 4EVYA 3KQXA 1VKCA 2G0BA 2QECA 3TX8A 4CYPA 2ZOGA 4UF4A 3FB3A 4B14A 2J8MA 4P6YA 5K8MA 2EUIA 2RB7A 3GUXA 2QVPA 2PJ0A 2C6GA 1ARLA 4IAVA 4P45A 4AXVA 4CGMA 2H5MA 2K5TA 2GIVA 4A32A 4ZGYB 5F47A 4WWVA 4B11A 4FWUA 5HVFA 4GS4A 4ZI6A 2ATRA 4UFVA 1QSRA 1S5KA 4JJXA 2B4BA 3R9FA 4CGOA 1S60A 1Y0RA 2FT0A 1CP6A 1Z9UA 4UFWA 4H2KA 5K8PA 3D67A 4MFZA 4QVTA 4R3KA 3TT2A 1YX0A 4DJLA 5G21A 6CPAA 2EK9A 4B12A 2PIYA 5D8NA 4UFXA 4C7IA 2PJCA 2PR1A 2VXKA 1TF9A 4XPDC 5J8CA 4JWPA 4KORA 2NSMA 4XPKA 1IGBA 1BO4A 4ZY1A 1LFWA 1LAMA 1S3ZA 4JD6A 4A94A 4CAVA 1TKHA 2C1CA 3CXSA 3IIBA 4MCSA 1BPMA 4O23A 2HUZA 2BL1A 4M3SA 2BEIA 1F2PA 3BXMA 2FIAA 2ZENA 1N71A 2OOTA 2ABZA 1M4GA 4TWEA 4F9VA 3B3SA 4A95A 4MI4A 2AFMA 4OC3A 1X10A 3FBUA 3BJ7A
chains in the Genus database with same CATH topology
5I0CA 4MFJA 4CAWA 2QMLA 2C27A 4J3GA 4C7HA 4MBUA 4NCZA 2YNEA 2WUUA 1KUVA 2B5GA 3IWGA 4CAFA 4CRZB 2DXQA 5AG5A 1K4JA 4KVOE 2X7BA 1TIQA 1M44A 4B5OA 4IUSA 4JXQA 1IYKA 1SQHA 2J8RA 3BJ8A 1IIDA 3QB8A 3R1KA 4A2ZA 2ZPAA 2YNCC 4PK3A 2FE7A 4UBRA 1PUAA 2O28A 4A33A 3TE4A 4Q36A 2IL4A 2B4DA 4HNWB 3CXQA 3EFAA 3DR8A 4MFLA 3TOAA 1S7FA 5AGEA 2PSWA 4KSAA 2QIRA 2I00A 1Y7RA 1M1DA 4KOVA 1QSMA 5IX3A 3T90A 2I79A 1S7KA 3TO9A 1P0HA 4JLYA 2B3UA 5HH1A 3RYOA 1NE9A 1YK3A 1S7LA 5JPHA 3FXTA 1GHEA 3D3SA 3SHPA 1YGHA 1YVOA 3NE7A 2B58A 2JLMA 4R9MA 5G1ZA 5DWMA 3LODA 3S6FA 5BWAB 4CAXA 3EO4A 4OAEA 5F48A 4LX9A 4A30A 3IWEA 5CNPA 4CAVA 4X5KA 2VEZA 4L8AA 5ISVA 5F46A 1I1DA 2PDOA 2FXFA 4R57A 4MHDA 4PSWA 2OZHA 2FSRA 3JTKA 1B6BA 4U9ZA 4E8OA 4F0YA 5J8FA 3H5ZA 4AVBA 2RC4A 4C2XA 4RS2A 1XIXA 1WWZA 5G20A 4CGNA 4PK2A 3PP9A 4QUSA 1Z4EA 4KZTA 4QB9A 4F6AA 1UFHA 4K30A 3DR6A 1OZPA 2REEA 3DDDA 2F5IA 2OZUA 5GCNA 1IICA 3PZJA 1B87A 1QSOA 4HNXB 2Z3KA 2VI7A 4XNHC 4AVCA 4HNYB 1LRZA 5FVJA 5C88A 2R98A 2FIWA 3S6GA 4YFJA 4C2YA 1NMTA 1P4NA 3R96A 1KZFA 4H6UA 2WPXA 2BSWA 4UA3A 1NSLA 4CAEA 5E96A 3JUWA 1ZO0A 3A9LA 3P2HA 2Q44A 2YGWA 2YNCA 5A28A 3IGRA 2JEVA 3R9GA 3DSBA 5G22A 3FRMA 4AVAA 4AG9A 2ZXVA 2P6EA 1Q2CA 1KUXA 2G3TA 3TO6A 3BLNA 2Z3NA 3GKRA 2HV2A 4B5PB 4KOYA 1R57A 4UCMA 2WPWA 3I9SA 2YNDA 1U6MA 1MJ9A 2Q4VA 3TFYA 3R95A 2R7HA 3MGDA 3SXOA 3I3GA 2Q4YA 1J4JA 1FY7A 4MJ8A 5H84A 3PGPA 5KTAA 2G3AA 2Z3OA 4BBHA 4Y49C 3F5BA 4KUAA 4B5PA 2P0WA 2Z3PA 3K9UA 5H86A 2FL4A 4KOXA 1RO5A 2VZZA 4MFQA 5KTDA 3B8GA 3EC4A 1YVKA 1XE4A 4ORFA 1XEBA 1Q2YA 3R9EA 4CGPA 3F8KA 2HQYA 4IF5A 3GY9A 2D4PA 4C68A 1L0CA 2OZGA 4XNHB 3CXPA 1QSTA 4MFKA 4KUBA 2R1IA 3S6KA 5EC4A 1IB1E 2R8VA 4U9YA 2GE3A 4UWJA 4FD4A 1YLEA 3F0AA 2ZW6A 3FYNA 3QAHA 3EXNA 2B3VA 3H4QA 5F49A 2ARHA 2Z0ZA 1RXTA 4E2AA 2A4NA 3T9YA 4MY3A 4C2ZA 4HKFA 2AJ6A 1XMTA 4M85A 2Z10A 1Y9KA 2CNSA 3IU1A 3N7ZA 2KCWA 3D2MA 4KSFA 4UCPA 4CGLA 1KUYA 2Z3LA 4L89A 4LUAA 3ZZIA 3W6SA 4FD7A 1IYLA 2JDDA 3GYAA 4PV6A 3W91A 1ON0A 1M4IA 1QSNA 4YRHA 2D4OA 1CM0A 1Y9WA 4MY0A 2BUEA 4H89A 3LD2A 4MFPA 2PR8A 5EBVA 4YGOA 2EVNA 1BOBA 4KOTA 2CNMA 4NEXA 4Y49B 3VWEA 1CJWA 4KS9A 4UCNA 1MJAA 4AB7A 4R3LA 3C26A 4OADA 2OH1A 3G8WA 4ONUA 3VWDA 1Z4RA 3TTHA 4FD5A 2Q0YA 4UWIA 4CS0B 2B5GB 2CY2A 4B10A 2NMTA 4KLWA 2CXAA 2CNTA 3S6HA 3ZJ0A 4B13A 3G3SA 4KLVA 4I49A 2Q7BA 2DPSA 4JXRA 2REFA 5IV0A 4II9A 4U5YA 3IU2A 4KOSA 4A31A 2ZW7A 4CRYB 1VHSA 3TOBA 2J8NA 1MJBA 3FNCA 3WR7A 2B4DB 4F0XA 5HMNA 2Z3MA 3TCVA 4QBJA 4CYQA 4KVME 4CYNA 5AG4A 1M4DA 4PSXA 5JQ4A 4KOUA 3P2FA 5AG7A 2DPTA 5AG6A 2WSAA 2VBQA 3TO7A 5IB0A 4OLLA 1I12A 5A27A 1MK4A 2Y0MA 3SXNA 2VZYA 3W6XA 4KOWA 3UY5A 3OWCA 2ZW5A 2OB0A 4CYOA 4Q38A 1YR0A 1YREA 2P6FA 4NXYA 4BMHA 1WK4A 3KKWA 4DNCA 2AE6A 4RI1A 2PRBA 2PC1A 1PU9A 2ZW4A 2FS5A 5KTCA 5C82A 4XPDB 4ZBGA 4NSQA 4E0AA 4NF1A 2JDCA 5DWNA 2OU2A 3JVNA 2PQ8A 2VQYA 3D2PA 4AG7A 3EY5A 3V8IA 4FD6A 2GANA 4R87A 2FCKA 3D8PA 4QC6A 1V0CA 1I21A 4XPLA 4H6ZA 2P6GA 4KVXA 1XF8A 2Z11A 3FIXA 1Q2DA 1S7NA 3E0KA 3DNSA 2Q04A 4EVYA 1VKCA 2G0BA 2QECA 4CYPA 3FB3A 4B14A 2J8MA 2EUIA 4CGMA 2H5MA 2K5TA 2GIVA 4A32A 4ZGYB 5F47A 4B11A 4GS4A 2ATRA 4UFVA 1QSRA 1S5KA 4JJXA 2B4BA 3R9FA 4CGOA 1S60A 2FT0A 1Z9UA 4UFWA 4MFZA 4QVTA 4R3KA 3TT2A 1YX0A 5G21A 4B12A 4C7IA 4UFXA 2PR1A 2VXKA 4XPDC 5J8CA 4JWPA 4KORA 4XPKA 1BO4A 1S3ZA 4JD6A 3CXSA 2HUZA 2BL1A 4M3SA 2BEIA 2FIAA 1N71A 1M4GA 4A95A 4MI4A 3FBUA 3BJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I0C A;  4CAW A;  2QML A;  2C27 A;  4J3G A;  4MBU A;  4NCZ A;  1KUV A;  2B5G A;  3IWG A;  4CRZ B;  2DXQ A;  1K4J A;  4KVO E;  2X7B A;  1TIQ A;  1M44 A;  4B5O A;  4IUS A;  4JXQ A;  1IYK A;  1SQH A;  2J8R A;  3BJ8 A;  1IID A;  3QB8 A;  3R1K A;  2ZPA A;  4PK3 A;  2FE7 A;  4UBR A;  1PUA A;  2O28 A;  3TE4 A;  2IL4 A;  2B4D A;  4HNW B;  3CXQ A;  3EFA A;  3DR8 A;  3TOA A;  1S7F A;  2PSW A;  2QIR A;  2I00 A;  1Y7R A;  4KOV A;  1M1D A;  1QSM A;  5IX3 A;  3T90 A;  2I79 A;  1S7K A;  3TO9 A;  1P0H A;  4JLY A;  2B3U A;  5HH1 A;  3RYO A;  1NE9 A;  1YK3 A;  1S7L A;  5JPH A;  3FXT A;  1GHE A;  3D3S A;  3SHP A;  1YGH A;  1YVO A;  3NE7 A;  2B58 A;  2JLM A;  4R9M A;  5DWM A;  3LOD A;  3S6F A;  4CAX A;  3EO4 A;  4OAE A;  5F48 A;  4LX9 A;  4CAV A;  5CNP A;  4X5K A;  2VEZ A;  4L8A A;  5ISV A;  5F46 A;  1I1D A;  2PDO A;  2FXF A;  4R57 A;  4MHD A;  4PSW A;  2OZH A;  2FSR A;  1B6B A;  4U9Z A;  4E8O A;  4F0Y A;  5J8F A;  4AVB A;  2RC4 A;  4RS2 A;  1XIX A;  1WWZ A;  4PK2 A;  3PP9 A;  4QUS A;  1Z4E A;  4KZT A;  4QB9 A;  4F6A A;  1UFH A;  4K30 A;  3DR6 A;  1OZP A;  2REE A;  3DDD A;  2F5I A;  2OZU A;  5GCN A;  1IIC A;  3PZJ A;  1B87 A;  1QSO A;  4HNX B;  2VI7 A;  4XNH C;  4AVC A;  4HNY B;  1LRZ A;  5FVJ A;  5C88 A;  2R98 A;  2FIW A;  3S6G A;  4YFJ A;  1NMT A;  1P4N A;  3R96 A;  1KZF A;  4H6U A;  2WPX A;  2BSW A;  4UA3 A;  1NSL A;  5E96 A;  3JUW A;  3P2H A;  2Q44 A;  3IGR A;  2JEV A;  3R9G A;  3DSB A;  3FRM A;  4AVA A;  4AG9 A;  2ZXV A;  2P6E A;  1Q2C A;  1KUX A;  2G3T A;  3TO6 A;  3BLN A;  3GKR A;  4B5P B;  2HV2 A;  4KOY A;  1R57 A;  2WPW A;  3I9S A;  1U6M A;  1MJ9 A;  2Q4V A;  3TFY A;  3R95 A;  2R7H A;  3MGD A;  3SXO A;  3I3G A;  2Q4Y A;  1J4J A;  1FY7 A;  4MJ8 A;  5H84 A;  3PGP A;  5KTA A;  2G3A A;  4Y49 C;  3F5B A;  4KUA A;  4B5P A;  2P0W A;  3K9U A;  5H86 A;  2FL4 A;  4KOX A;  1RO5 A;  2VZZ A;  5KTD A;  3B8G A;  3EC4 A;  1YVK A;  1XE4 A;  4ORF A;  1XEB A;  1Q2Y A;  3R9E A;  3F8K A;  2HQY A;  4IF5 A;  3GY9 A;  2D4P A;  1L0C A;  2OZG A;  4XNH B;  3CXP A;  1QST A;  4KUB A;  2R1I A;  3S6K A;  5EC4 A;  1IB1 E;  2R8V A;  4U9Y A;  2GE3 A;  4UWJ A;  4FD4 A;  1YLE A;  3F0A A;  2ZW6 A;  3FYN A;  3QAH A;  3EXN A;  2B3V A;  3H4Q A;  5F49 A;  2ARH A;  2Z0Z A;  1RXT A;  4E2A A;  2A4N A;  3T9Y A;  4MY3 A;  4HKF A;  2AJ6 A;  1XMT A;  4M85 A;  2Z10 A;  1Y9K A;  2CNS A;  3N7Z A;  2KCW A;  3D2M A;  1KUY A;  4LUA A;  4L89 A;  3ZZI A;  3W6S A;  4FD7 A;  1IYL A;  2JDD A;  3GYA A;  4PV6 A;  3W91 A;  1ON0 A;  1M4I A;  1QSN A;  4YRH A;  2D4O A;  1CM0 A;  1Y9W A;  4MY0 A;  2BUE A;  4H89 A;  3LD2 A;  2PR8 A;  5EBV A;  4YGO A;  2EVN A;  4KOT A;  1BOB A;  2CNM A;  4NEX A;  4Y49 B;  3VWE A;  1CJW A;  1MJA A;  4AB7 A;  4R3L A;  3C26 A;  4OAD A;  2OH1 A;  3G8W A;  4ONU A;  3VWD A;  1Z4R A;  3TTH A;  4FD5 A;  2Q0Y A;  4UWI A;  4CS0 B;  2B5G B;  2CY2 A;  2NMT A;  4KLW A;  2CNT A;  3S6H A;  3ZJ0 A;  3G3S A;  4KLV A;  4I49 A;  2Q7B A;  4JXR A;  2REF A;  5IV0 A;  4II9 A;  4U5Y A;  4KOS A;  2ZW7 A;  4CRY B;  1VHS A;  3TOB A;  2J8N A;  1MJB A;  3FNC A;  3WR7 A;  2B4D B;  5HMN A;  3TCV A;  4QBJ A;  4KVM E;  1M4D A;  4PSX A;  5JQ4 A;  4KOU A;  3P2F A;  2VBQ A;  3TO7 A;  5IB0 A;  4OLL A;  1I12 A;  1MK4 A;  2Y0M A;  3SXN A;  2VZY A;  3W6X A;  4KOW A;  3UY5 A;  3OWC A;  2ZW5 A;  2OB0 A;  1YR0 A;  1YRE A;  2P6F A;  4NXY A;  4BMH A;  1WK4 A;  3KKW A;  4DNC A;  2AE6 A;  4RI1 A;  2PRB A;  2PC1 A;  1PU9 A;  2ZW4 A;  2FS5 A;  5KTC A;  5C82 A;  4XPD B;  4ZBG A;  4NSQ A;  4E0A A;  4NF1 A;  2JDC A;  5DWN A;  2OU2 A;  3JVN A;  2PQ8 A;  2VQY A;  3D2P A;  4AG7 A;  3EY5 A;  3V8I A;  4FD6 A;  2GAN A;  4R87 A;  2FCK A;  3D8P A;  4QC6 A;  1V0C A;  1I21 A;  4XPL A;  4KVX A;  2P6G A;  4H6Z A;  1XF8 A;  2Z11 A;  3FIX A;  1Q2D A;  1S7N A;  3E0K A;  3DNS A;  2Q04 A;  4EVY A;  1VKC A;  2G0B A;  2QEC A;  3FB3 A;  2J8M A;  2EUI A;  2H5M A;  2K5T A;  2GIV A;  5F47 A;  4GS4 A;  2ATR A;  1QSR A;  1S5K A;  4JJX A;  2B4B A;  3R9F A;  1S60 A;  2FT0 A;  1Z9U A;  4QVT A;  4R3K A;  3TT2 A;  1YX0 A;  2PR1 A;  2VXK A;  4XPD C;  5J8C A;  4JWP A;  4KOR A;  4XPK A;  1BO4 A;  1S3Z A;  4JD6 A;  3CXS A;  2HUZ A;  2BL1 A;  4M3S A;  2BEI A;  2FIA A;  1N71 A;  1M4G A;  4MI4 A;  3FBU A;  3BJ7 A; 
#chains in the Genus database with same CATH topology
 5I0C A;  4MFJ A;  4CAW A;  3FEC A;  2QML A;  2C27 A;  4J3G A;  4C7H A;  4MBU A;  2EWB A;  4MCQ A;  4NCZ A;  4OC5 A;  3WT4 A;  1Q7L A;  1PCA A;  1ZLH A;  2V8H A;  3GIU A;  2YNE A;  3RZA A;  5D29 A;  2WUU A;  3B3V A;  1CG2 A;  1KUV A;  3SJE A;  2B5G A;  2DF5 A;  3IWG A;  3KL9 A;  4CAF A;  4CRZ B;  3RO0 A;  2DXQ A;  1H8L A;  5AG5 A;  5LYI A;  3FJU A;  1TKF A;  3FX6 A;  1K4J A;  1ELL P;  4KVO E;  4YWY A;  2X7B A;  4BIN A;  3BHX A;  3PRT A;  2Q7S A;  4DYO A;  1TIQ A;  1M44 A;  4X2T A;  4B5O A;  3MRU A;  4CGP A;  3PB4 X;  4IUS A;  4JXQ A;  1BLL E;  1IYK A;  1SQH A;  3CPA A;  2J8R A;  3BJ8 A;  1IID A;  3QB8 A;  3R1K A;  4A2Z A;  2ZPA A;  2YNC C;  4PK3 A;  2F7V A;  2WYR A;  2FE7 A;  1XJO A;  3SJF A;  3IC1 A;  4UBR A;  1PUA A;  2O28 A;  4A33 A;  4RUH A;  2CF4 A;  3TE4 A;  4Q36 A;  3D4U A;  2IL4 A;  1A2Z A;  3PFE A;  2B4D A;  4HNW B;  2CTC A;  1YW6 A;  3L2N A;  2PJ1 A;  3CXQ A;  3EFA A;  3DR8 A;  3B2Y A;  2ZEP A;  4MFL A;  3TOA A;  5F09 A;  1S7F A;  2XEI A;  2PSW A;  1HDQ A;  3FVL A;  5AGE A;  3SI2 A;  2AFX A;  4KSA A;  2QIR A;  2I00 A;  1Y7R A;  2ZEH A;  1M1D A;  4KOV A;  1QSM A;  5IX3 A;  4NGT A;  1ELM P;  3T90 A;  2I79 A;  5LYL A;  1JWQ A;  1S7K A;  4P10 A;  2V8D A;  3TO9 A;  1P0H A;  4JLY A;  2B3U A;  5HH1 A;  3RYO A;  1NE9 A;  1YK3 A;  4MHY A;  4NFR A;  1S7L A;  4RN7 A;  2G9D A;  4NGQ A;  5JPH A;  3FXT A;  4NGR A;  1GHE A;  3D3S A;  3SHP A;  1YGH A;  1YVO A;  3QAY A;  2V77 A;  5HXD A;  3NE7 A;  2B58 A;  2JLM A;  4R9M A;  3JRU A;  5G1Z A;  5DWM A;  3LOD A;  3S6F A;  3RNZ A;  3KAS A;  1IY7 A;  5BWA B;  4CAX A;  1VIX A;  3V38 A;  4MXU A;  3EO4 A;  1VHO A;  4UEZ A;  4OAE A;  5F48 A;  4LX9 A;  4OKO A;  3IWE A;  4K3N A;  5CNP A;  4A30 A;  3KHZ A;  4BD9 A;  1Y0Y A;  2VEZ A;  4P4J A;  4L8A A;  4X5K A;  5JH9 A;  5ISV A;  3VAT A;  5F46 A;  1F2O A;  1I1D A;  2PDO A;  2FXF A;  4NGS A;  4R57 A;  3WC6 A;  1LAN A;  4MHD A;  4PSW A;  2GRE A;  5LRK A;  2EO8 A;  2OZH A;  2AFS A;  4P44 A;  2FSR A;  4P4I A;  3CT9 A;  1CPX A;  3VH9 A;  3RAM A;  3JTK A;  1B6B A;  4U9Z A;  4E8O A;  4F0Y A;  5J8F A;  3H5Z A;  4AVB A;  1CP7 A;  2PJA A;  2RC4 A;  4C2X A;  4NGM A;  4RS2 A;  1XIX A;  2EBJ A;  2ZEG A;  1QMU A;  1WWZ A;  3KI9 A;  5G20 A;  1DE4 C;  4CGN A;  2ANP A;  4W9Y A;  4ZX9 A;  4PK2 A;  3NH8 A;  4P4F A;  2CTB A;  3PP9 A;  4QUS A;  1Z4E A;  4KZT A;  3MN8 A;  1XFO A;  4QB9 A;  3SJG A;  3KHX A;  4F6A A;  1AYE A;  1F57 A;  1UFH A;  4K30 A;  3DR6 A;  3SJX A;  3S9M A;  4P4B A;  1OZP A;  2REE A;  1DTD A;  3DDD A;  5JM6 A;  2F5I A;  2O53 A;  2OZU A;  5GCN A;  4ZX8 A;  1IIC A;  3PZJ A;  4UEF A;  1B87 A;  1QSO A;  4HNX B;  2QJ8 A;  2Z3K A;  2VI7 A;  1Z8X A;  2GFQ A;  4XNH C;  3SI1 A;  2ZEL A;  4AVC A;  4Z65 A;  4HNY B;  1LRZ A;  3FH4 A;  5FVJ A;  3KQZ A;  2ZEE A;  5C88 A;  2R98 A;  2BO9 A;  4A37 A;  2FIW A;  4MMO A;  1XOV A;  1ZG7 A;  3S6G A;  4YFJ A;  2PJB A;  4Q7A A;  3IFE A;  4C2Y A;  1NMT A;  1P4N A;  5LYF A;  3R96 A;  1KZF A;  4H6U A;  4PXE A;  2WPX A;  2BSW A;  4UA3 A;  1NSL A;  3PB7 X;  1XBU A;  4CAE A;  5E96 A;  3JUW A;  1ZO0 A;  3CZX A;  3IJ3 A;  3A9L A;  1TXR A;  3P2H A;  3LMS A;  2Q44 A;  4OC0 A;  2PJ5 A;  2YGW A;  3B35 A;  2JBK A;  2YNC A;  1LCP A;  4PXB A;  5A28 A;  3IGR A;  2JEV A;  3R9G A;  3DSB A;  5G22 A;  2CIJ A;  3FRM A;  4FAI A;  4PXC A;  4AVA A;  4AG9 A;  2ZXV A;  3KGQ A;  1YSJ A;  1JQG A;  2P6E A;  4F8Z A;  1Q2C A;  1KUX A;  2G3T A;  3TO6 A;  1X12 A;  4OC1 A;  3BLN A;  2Z3N A;  3GKR A;  2HV2 A;  4ZY2 A;  4B5P B;  4KOY A;  3CPX A;  1R57 A;  4WJB A;  3BI0 A;  3D68 A;  4UCM A;  4FUU A;  3KZW A;  2WPW A;  3I9S A;  2YND A;  3B7I A;  1YW4 A;  3PEI A;  1ZG8 A;  4A39 A;  1U6M A;  4P4D A;  2DEA A;  5HVG A;  4MCP A;  2ZEF A;  1MJ9 A;  2Q4V A;  2Q43 A;  3TFY A;  3N5F A;  3T8W A;  4GM5 A;  3R95 A;  2R7H A;  3FEE A;  1RTQ A;  3MGD A;  4PPZ A;  3I3G A;  3SXO A;  2Q4Y A;  3H8G A;  3KR5 A;  3D66 A;  3D7H A;  1CX8 A;  3LWU A;  1R43 A;  1J4J A;  1FY7 A;  4MJ8 A;  5H84 A;  2GU2 A;  1IU8 A;  3IEH A;  3PGP A;  5KTA A;  2JBJ A;  1HEE A;  2G3A A;  4UIB A;  2PRQ A;  1TKJ A;  5DS0 A;  2Z3O A;  3K9T A;  4BBH A;  4Y49 C;  3F5B A;  4KUA A;  4B5P A;  4B6Z A;  5K8N A;  1M4L A;  2BCO A;  2P0W A;  2Z3P A;  3K9U A;  5H86 A;  2FL4 A;  4KOX A;  1RO5 A;  2VZZ A;  4GXH A;  4MFQ A;  3B8G A;  5JGF A;  5KTD A;  3EC4 A;  4M6H A;  1YVK A;  1BAV A;  3GLJ A;  3D7F A;  3PBE A;  1XE4 A;  4NGP A;  4ORF A;  1XEB A;  1Q2Y A;  4TNU A;  3NA6 A;  3R9E A;  1YME A;  2HQY A;  3F8K A;  4IF5 A;  4IHM A;  4LQ6 A;  3GY9 A;  4MHZ A;  4OIW A;  2D4P A;  3B3T A;  4P4E A;  4C68 A;  1L0C A;  2OZG A;  3DGV A;  4MHN A;  4XNH B;  3CXP A;  4EWT A;  1QST A;  4MFK A;  4KUB A;  2R1I A;  3S6K A;  2PE3 A;  2GLF A;  5EC4 A;  1IB1 E;  2R8V A;  4U9Y A;  2GE3 A;  1NSA A;  1XMB A;  1ZG9 A;  1BPN A;  2JEW A;  3B3W A;  4KSI A;  4FD4 A;  4UWJ A;  1YLE A;  2AFW A;  2ZW6 A;  3F0A A;  3RBU A;  2IMO A;  3FYN A;  3NH5 A;  3QAH A;  3EXN A;  2B3V A;  3TC8 A;  3H4Q A;  4JZ0 A;  2I3C A;  5F49 A;  3HLP A;  2ARH A;  3CDX A;  1YLO A;  2V8V A;  2Z0Z A;  3ISX A;  2PJ2 A;  1RXT A;  4OID A;  4E2A A;  2PIZ A;  1FT7 A;  2A4N A;  3T9Y A;  4MY3 A;  4C2Z A;  4HKF A;  1CBX A;  2AJ6 A;  1XMT A;  3FMC A;  4M85 A;  2Z10 A;  4EFD A;  4IK2 A;  3PBB A;  1Y9K A;  2CNS A;  3IU1 A;  3N7Z A;  1YQE A;  2KCW A;  3D2M A;  4KSF A;  4MRI A;  4UCP A;  4CGL A;  2FVG A;  3IO1 A;  3PB6 X;  1KUY A;  4LQG A;  2Z3L A;  4L89 A;  4LUA A;  4OC4 A;  3ZZI A;  4R8F A;  1Z8T A;  2PJ8 A;  2C6P A;  2J9A A;  3VAR A;  3W6S A;  2XEF A;  4FD7 A;  1IYL A;  2IQ6 A;  2JDD A;  2ODF A;  3GYA A;  4PV6 A;  3W91 A;  8CPA A;  1ON0 A;  1M4I A;  1AMP A;  1VHE A;  2ZOF A;  1QSN A;  4YRH A;  2D4O A;  3DLJ A;  4FBE A;  1Z5R A;  4HPS A;  1CM0 A;  1Y9W A;  4MY0 A;  2BUE A;  4ZY0 A;  4H89 A;  3LD2 A;  4MFP A;  2PR8 A;  2PJ6 A;  5EBV A;  4YGO A;  1VGY A;  2EVN A;  1BOB A;  4KOT A;  2CNM A;  4NEX A;  4Y49 B;  3VWE A;  1CJW A;  4KS9 A;  5I4M A;  4UCN A;  1MJA A;  1IOI A;  4AB7 A;  1CPS A;  4R3L A;  1R3N A;  3NH4 A;  3C26 A;  3WC5 A;  4OAD A;  2OH1 A;  4UEE A;  1GYT A;  3G8W A;  2PJ7 A;  4PQA A;  4X3R A;  4ONU A;  3VWD A;  1Z4R A;  3KR4 A;  3TTH A;  2VL1 A;  4FD5 A;  2Q0Y A;  4UWI A;  4CS0 B;  4MCR A;  1AUG A;  4ONW A;  2B5G B;  1KWM A;  3S9N A;  2CY2 A;  4B10 A;  1UWY A;  2NMT A;  2XEG A;  5THW A;  4KLW A;  2V8G A;  2PVV A;  2ZEO A;  1Y7E A;  3WAB A;  2CXA A;  2WZN A;  5EMI A;  2CNT A;  4CPA A;  3S6H A;  3ZJ0 A;  4B13 A;  3D7D A;  3G3S A;  4KLV A;  4I49 A;  2Q7B A;  7CPA A;  2DPS A;  2PJ4 A;  4JXR A;  2REF A;  1LOK A;  5IV0 A;  3I1U A;  3BI1 A;  5CBM A;  1ARM A;  3WC7 A;  4II9 A;  4U5Y A;  3IU2 A;  4KOS A;  4A31 A;  5LRG A;  2ZW7 A;  4CRY B;  1VHS A;  4A38 A;  3TOB A;  5K8O A;  2AFZ A;  1MJB A;  2J8N A;  3FNC A;  3WR7 A;  3SI0 A;  3V7Z A;  2B4D B;  2HB6 A;  4F0X A;  4NJQ A;  1OBR A;  3NE8 A;  4YU9 A;  5HMN A;  2Z3M A;  2PCU A;  3HUV A;  3TCV A;  3LAC A;  5HVH A;  2OR4 A;  4QBJ A;  2O4H A;  2Q4Z A;  4CYQ A;  3D7G A;  4KVM E;  5ELY A;  2PJ9 A;  4CYN A;  2IJZ A;  5AG4 A;  5LYD A;  3B3C A;  1M4D A;  4PSX A;  5JQ4 A;  4KOU A;  3P2F A;  1TF8 A;  5AG7 A;  5LRJ A;  5CPA A;  2DPT A;  5AG6 A;  3FED A;  3ISZ A;  3K2K A;  4OME A;  2Q51 A;  1Z2L A;  2WSA A;  3FF3 A;  2GLJ A;  2VBQ A;  3H8F A;  3TO7 A;  5IB0 A;  1FNO A;  1EE3 P;  4NJR A;  2ZEM A;  4OLL A;  4UIA A;  2HC9 A;  2POK A;  4NGN A;  1I12 A;  5A27 A;  1MK4 A;  2Y0M A;  3SXN A;  2VZY A;  3W6X A;  4KOW A;  5J1Q A;  3UY5 A;  2BOA A;  2ZED A;  3OWC A;  3IWW A;  4PXD A;  2ZW5 A;  4F9U A;  2OB0 A;  4CYO A;  4Q38 A;  1YR0 A;  3S9L A;  2EK8 A;  1YRE A;  2P6F A;  4NXY A;  4BMH A;  1Z8W A;  2C6C A;  1WK4 A;  1IOF A;  3KKW A;  4DNC A;  2RFH A;  1PYT B;  4ZYQ A;  2AE6 A;  2F8H A;  4RI1 A;  2AFU A;  2PRB A;  3PB9 X;  2PC1 A;  1PU9 A;  4EME A;  4R7M A;  4X8I A;  2ZW4 A;  4OC2 A;  2PJ3 A;  2FS5 A;  5KTC A;  5C82 A;  4XPD B;  4ZBG A;  4NSQ A;  3H8E A;  4E0A A;  2NYQ A;  4NF1 A;  2JDC A;  1ZLI A;  4R76 A;  5DWN A;  3NFZ A;  2OU2 A;  3PFO A;  3JVN A;  2PQ8 A;  1HDU A;  4R6T A;  2AFO A;  2VQY A;  3D2P A;  4AG7 A;  1QQ9 A;  4G1P A;  3EY5 A;  3V8I A;  4FD6 A;  4DUK A;  4JYW A;  2GAN A;  4MHP A;  4R87 A;  5IB9 A;  2FCK A;  3D8P A;  3QNV A;  1V0C A;  4M6I A;  1I21 A;  4M6G A;  4QC6 A;  3PB8 X;  1Z8L A;  2P6G A;  3GB0 A;  4H6Z A;  4KVX A;  1XF8 A;  4XPL A;  2Z11 A;  1LAP A;  3FIX A;  1Q2D A;  1S7N A;  3E0K A;  2XEJ A;  4OP4 A;  1XRY A;  3DNS A;  2Q04 A;  2QYV A;  2PVW A;  4EVY A;  3KQX A;  1VKC A;  2G0B A;  2QEC A;  3TX8 A;  4CYP A;  2ZOG A;  4UF4 A;  3FB3 A;  4B14 A;  2J8M A;  4P6Y A;  5K8M A;  2EUI A;  2RB7 A;  3GUX A;  2QVP A;  2PJ0 A;  2C6G A;  1ARL A;  4IAV A;  4P45 A;  4AXV A;  4CGM A;  2H5M A;  2K5T A;  2GIV A;  4A32 A;  4ZGY B;  5F47 A;  4WWV A;  4B11 A;  4FWU A;  5HVF A;  4GS4 A;  4ZI6 A;  2ATR A;  4UFV A;  1QSR A;  1S5K A;  4JJX A;  2B4B A;  3R9F A;  4CGO A;  1S60 A;  1Y0R A;  2FT0 A;  1CP6 A;  1Z9U A;  4UFW A;  4H2K A;  5K8P A;  3D67 A;  4MFZ A;  4QVT A;  4R3K A;  3TT2 A;  1YX0 A;  4DJL A;  5G21 A;  6CPA A;  2EK9 A;  4B12 A;  2PIY A;  5D8N A;  4UFX A;  4C7I A;  2PJC A;  2PR1 A;  2VXK A;  1TF9 A;  4XPD C;  5J8C A;  4JWP A;  4KOR A;  2NSM A;  4XPK A;  1IGB A;  1BO4 A;  4ZY1 A;  1LFW A;  1LAM A;  1S3Z A;  4JD6 A;  4A94 A;  4CAV A;  1TKH A;  2C1C A;  3CXS A;  3IIB A;  4MCS A;  1BPM A;  4O23 A;  2HUZ A;  2BL1 A;  4M3S A;  2BEI A;  1F2P A;  3BXM A;  2FIA A;  2ZEN A;  1N71 A;  2OOT A;  2ABZ A;  1M4G A;  4TWE A;  4F9V A;  3B3S A;  4A95 A;  4MI4 A;  2AFM A;  4OC3 A;  1X10 A;  3FBU A;  3BJ7 A; 
#chains in the Genus database with same CATH homology
 5I0C A;  4MFJ A;  4CAW A;  2QML A;  2C27 A;  4J3G A;  4C7H A;  4MBU A;  4NCZ A;  2YNE A;  2WUU A;  1KUV A;  2B5G A;  3IWG A;  4CAF A;  4CRZ B;  2DXQ A;  5AG5 A;  1K4J A;  4KVO E;  2X7B A;  1TIQ A;  1M44 A;  4B5O A;  4IUS A;  4JXQ A;  1IYK A;  1SQH A;  2J8R A;  3BJ8 A;  1IID A;  3QB8 A;  3R1K A;  4A2Z A;  2ZPA A;  2YNC C;  4PK3 A;  2FE7 A;  4UBR A;  1PUA A;  2O28 A;  4A33 A;  3TE4 A;  4Q36 A;  2IL4 A;  2B4D A;  4HNW B;  3CXQ A;  3EFA A;  3DR8 A;  4MFL A;  3TOA A;  1S7F A;  5AGE A;  2PSW A;  4KSA A;  2QIR A;  2I00 A;  1Y7R A;  1M1D A;  4KOV A;  1QSM A;  5IX3 A;  3T90 A;  2I79 A;  1S7K A;  3TO9 A;  1P0H A;  4JLY A;  2B3U A;  5HH1 A;  3RYO A;  1NE9 A;  1YK3 A;  1S7L A;  5JPH A;  3FXT A;  1GHE A;  3D3S A;  3SHP A;  1YGH A;  1YVO A;  3NE7 A;  2B58 A;  2JLM A;  4R9M A;  5G1Z A;  5DWM A;  3LOD A;  3S6F A;  5BWA B;  4CAX A;  3EO4 A;  4OAE A;  5F48 A;  4LX9 A;  4A30 A;  3IWE A;  5CNP A;  4CAV A;  4X5K A;  2VEZ A;  4L8A A;  5ISV A;  5F46 A;  1I1D A;  2PDO A;  2FXF A;  4R57 A;  4MHD A;  4PSW A;  2OZH A;  2FSR A;  3JTK A;  1B6B A;  4U9Z A;  4E8O A;  4F0Y A;  5J8F A;  3H5Z A;  4AVB A;  2RC4 A;  4C2X A;  4RS2 A;  1XIX A;  1WWZ A;  5G20 A;  4CGN A;  4PK2 A;  3PP9 A;  4QUS A;  1Z4E A;  4KZT A;  4QB9 A;  4F6A A;  1UFH A;  4K30 A;  3DR6 A;  1OZP A;  2REE A;  3DDD A;  2F5I A;  2OZU A;  5GCN A;  1IIC A;  3PZJ A;  1B87 A;  1QSO A;  4HNX B;  2Z3K A;  2VI7 A;  4XNH C;  4AVC A;  4HNY B;  1LRZ A;  5FVJ A;  5C88 A;  2R98 A;  2FIW A;  3S6G A;  4YFJ A;  4C2Y A;  1NMT A;  1P4N A;  3R96 A;  1KZF A;  4H6U A;  2WPX A;  2BSW A;  4UA3 A;  1NSL A;  4CAE A;  5E96 A;  3JUW A;  1ZO0 A;  3A9L A;  3P2H A;  2Q44 A;  2YGW A;  2YNC A;  5A28 A;  3IGR A;  2JEV A;  3R9G A;  3DSB A;  5G22 A;  3FRM A;  4AVA A;  4AG9 A;  2ZXV A;  2P6E A;  1Q2C A;  1KUX A;  2G3T A;  3TO6 A;  3BLN A;  2Z3N A;  3GKR A;  2HV2 A;  4B5P B;  4KOY A;  1R57 A;  4UCM A;  2WPW A;  3I9S A;  2YND A;  1U6M A;  1MJ9 A;  2Q4V A;  3TFY A;  3R95 A;  2R7H A;  3MGD A;  3SXO A;  3I3G A;  2Q4Y A;  1J4J A;  1FY7 A;  4MJ8 A;  5H84 A;  3PGP A;  5KTA A;  2G3A A;  2Z3O A;  4BBH A;  4Y49 C;  3F5B A;  4KUA A;  4B5P A;  2P0W A;  2Z3P A;  3K9U A;  5H86 A;  2FL4 A;  4KOX A;  1RO5 A;  2VZZ A;  4MFQ A;  5KTD A;  3B8G A;  3EC4 A;  1YVK A;  1XE4 A;  4ORF A;  1XEB A;  1Q2Y A;  3R9E A;  4CGP A;  3F8K A;  2HQY A;  4IF5 A;  3GY9 A;  2D4P A;  4C68 A;  1L0C A;  2OZG A;  4XNH B;  3CXP A;  1QST A;  4MFK A;  4KUB A;  2R1I A;  3S6K A;  5EC4 A;  1IB1 E;  2R8V A;  4U9Y A;  2GE3 A;  4UWJ A;  4FD4 A;  1YLE A;  3F0A A;  2ZW6 A;  3FYN A;  3QAH A;  3EXN A;  2B3V A;  3H4Q A;  5F49 A;  2ARH A;  2Z0Z A;  1RXT A;  4E2A A;  2A4N A;  3T9Y A;  4MY3 A;  4C2Z A;  4HKF A;  2AJ6 A;  1XMT A;  4M85 A;  2Z10 A;  1Y9K A;  2CNS A;  3IU1 A;  3N7Z A;  2KCW A;  3D2M A;  4KSF A;  4UCP A;  4CGL A;  1KUY A;  2Z3L A;  4L89 A;  4LUA A;  3ZZI A;  3W6S A;  4FD7 A;  1IYL A;  2JDD A;  3GYA A;  4PV6 A;  3W91 A;  1ON0 A;  1M4I A;  1QSN A;  4YRH A;  2D4O A;  1CM0 A;  1Y9W A;  4MY0 A;  2BUE A;  4H89 A;  3LD2 A;  4MFP A;  2PR8 A;  5EBV A;  4YGO A;  2EVN A;  1BOB A;  4KOT A;  2CNM A;  4NEX A;  4Y49 B;  3VWE A;  1CJW A;  4KS9 A;  4UCN A;  1MJA A;  4AB7 A;  4R3L A;  3C26 A;  4OAD A;  2OH1 A;  3G8W A;  4ONU A;  3VWD A;  1Z4R A;  3TTH A;  4FD5 A;  2Q0Y A;  4UWI A;  4CS0 B;  2B5G B;  2CY2 A;  4B10 A;  2NMT A;  4KLW A;  2CXA A;  2CNT A;  3S6H A;  3ZJ0 A;  4B13 A;  3G3S A;  4KLV A;  4I49 A;  2Q7B A;  2DPS A;  4JXR A;  2REF A;  5IV0 A;  4II9 A;  4U5Y A;  3IU2 A;  4KOS A;  4A31 A;  2ZW7 A;  4CRY B;  1VHS A;  3TOB A;  2J8N A;  1MJB A;  3FNC A;  3WR7 A;  2B4D B;  4F0X A;  5HMN A;  2Z3M A;  3TCV A;  4QBJ A;  4CYQ A;  4KVM E;  4CYN A;  5AG4 A;  1M4D A;  4PSX A;  5JQ4 A;  4KOU A;  3P2F A;  5AG7 A;  2DPT A;  5AG6 A;  2WSA A;  2VBQ A;  3TO7 A;  5IB0 A;  4OLL A;  1I12 A;  5A27 A;  1MK4 A;  2Y0M A;  3SXN A;  2VZY A;  3W6X A;  4KOW A;  3UY5 A;  3OWC A;  2ZW5 A;  2OB0 A;  4CYO A;  4Q38 A;  1YR0 A;  1YRE A;  2P6F A;  4NXY A;  4BMH A;  1WK4 A;  3KKW A;  4DNC A;  2AE6 A;  4RI1 A;  2PRB A;  2PC1 A;  1PU9 A;  2ZW4 A;  2FS5 A;  5KTC A;  5C82 A;  4XPD B;  4ZBG A;  4NSQ A;  4E0A A;  4NF1 A;  2JDC A;  5DWN A;  2OU2 A;  3JVN A;  2PQ8 A;  2VQY A;  3D2P A;  4AG7 A;  3EY5 A;  3V8I A;  4FD6 A;  2GAN A;  4R87 A;  2FCK A;  3D8P A;  4QC6 A;  1V0C A;  1I21 A;  4XPL A;  4H6Z A;  2P6G A;  4KVX A;  1XF8 A;  2Z11 A;  3FIX A;  1Q2D A;  1S7N A;  3E0K A;  3DNS A;  2Q04 A;  4EVY A;  1VKC A;  2G0B A;  2QEC A;  4CYP A;  3FB3 A;  4B14 A;  2J8M A;  2EUI A;  4CGM A;  2H5M A;  2K5T A;  2GIV A;  4A32 A;  4ZGY B;  5F47 A;  4B11 A;  4GS4 A;  2ATR A;  4UFV A;  1QSR A;  1S5K A;  4JJX A;  2B4B A;  3R9F A;  4CGO A;  1S60 A;  2FT0 A;  1Z9U A;  4UFW A;  4MFZ A;  4QVT A;  4R3K A;  3TT2 A;  1YX0 A;  5G21 A;  4B12 A;  4C7I A;  4UFX A;  2PR1 A;  2VXK A;  4XPD C;  5J8C A;  4JWP A;  4KOR A;  4XPK A;  1BO4 A;  1S3Z A;  4JD6 A;  3CXS A;  2HUZ A;  2BL1 A;  4M3S A;  2BEI A;  2FIA A;  1N71 A;  1M4G A;  4A95 A;  4MI4 A;  3FBU A;  3BJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...