3S6FA

Crystal structure of a putative acetyltransferase (dr_1678) from deinococcus radiodurans r1 at 1.19 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
143
structure length
143
Chain Sequence
MTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILAASIPLLEVQAGWRSLGLGSELMRRVLTELGDLYMVDLSCDDDVVPFYERLGLKRANAMFLRRYDNQAGIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical acetyltransferase
publication title Crystal structure of a Hypothetical acetyltransferase (DR_1678) from Deinococcus radiodurans at 1.19 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Transferase
total genus 33
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3s6fA00
1ON0A 3C26A 2I79A 4CS0B 3W91A 3FB3A 3CXSA 4KOSA 5C88A 2J8MA 4HKFA 4NXYA 2VBQA 2J8NA 3DSBA 2REEA 1UFHA 4XPKA 2OB0A 4KUAA 1IYKA 2J8RA 2NMTA 4HNYB 2ZW6A 3R9EA 2PR8A 4Y49B 5H86A 5IX3A 4YGOA 4U9ZA 4OADA 1P4NA 4E0AA 4EVYA 5FVJA 1YX0A 1KZFA 2P6EA 2GE3A 1OZPA 1CM0A 4RS2A 3EFAA 2PR1A 2B3VA 4H89A 4AVBA 4QVTA 3GYAA 2P6GA 3H4QA 3TFYA 3SHPA 2JDCA 2CNSA 4MHDA 1Y9WA 3TOAA 3W6SA 4F6AA 2HQYA 4I49A 4AVCA 1Q2CA 1P0HA 3D3SA 1KUVA 4ORFA 3TT2A 4HNXB 2PQ8A 2FS5A 2VZYA 4NCZA 4R3KA 3LD2A 2CY2A 2ZPAA 4JXRA 3BLNA 1WWZA 3B8GA 1S5KA 1VHSA 1XIXA 4KOXA 2R98A 4NEXA 3N7ZA 5EC4A 3ZZIA 2D4OA 4JD6A 1NMTA 4CRYB 4U5YA 1N71A 3PZJA 2BL1A 2DXQA 3FBUA 4UBRA 3D2PA 2AE6A 1YGHA 5IB0A 1XMTA 4MBUA 4KOTA 2EVNA 4XPDB 1QSMA 2Q04A 3BJ8A 4B5PA 1YVKA 4QB9A 2WPWA 4PV6A 4KOWA 4IUSA 2OZUA 1M4IA 2B4DA 1MJBA 2PDOA 3GKRA 4F0YA 4KLWA 3SXOA 4PK2A 3DDDA 4KOUA 3MGDA 2FT0A 2PSWA 4QC6A 4FD7A 2ZW5A 2EUIA 4MI4A 4LUAA 4H6UA 3T90A 2B58A 3WR7A 4CRZB 4XNHC 4NSQA 5JPHA 3G3SA 1L0CA 3P2FA 4L8AA 3D8PA 5F48A 2JLMA 5H84A 1Q2DA 4KVXA 1S7LA 2B4BA 5E96A 1KUYA 1S3ZA 2G3TA 1I1DA 3OWCA 4DNCA 2B3UA 4YFJA 1QSNA 1RXTA 4PK3A 4II9A 4AVAA 4U9YA 2VZZA 3R9GA 1IB1E 2ATRA 2Q0YA 3I3GA 3TOBA 1Z4EA 1B87A 4MY3A 2A4NA 3KKWA 1LRZA 2P0WA 5KTAA 1XE4A 5F47A 1MK4A 3EXNA 3CXPA 3LODA 1YVOA 4J3GA 4JJXA 2C27A 2D4PA 4R3LA 4R87A 1YK3A 4OLLA 2O28A 3D2MA 1Q2YA 1IYLA 1SQHA 3IGRA 4Y49C 2R7HA 4B5OA 3S6FA 4HNWB 3TO9A 3DR8A 1BOBA 2G3AA 2RC4A 5DWMA 1XEBA 4AG7A 1K4JA 2OH1A 1TIQA 5HMNA 4FD4A 4KUBA 4PSWA 1M4DA 3FYNA 2IL4A 3FIXA 1QSOA 4KVME 4R57A 1S7FA 2AJ6A 2VEZA 2ARHA 2OZHA 2Y0MA 2FE7A 2I00A 3T9YA 4NF1A 4MJ8A 2Z10A 3EO4A 3QAHA 4KORA 1MJAA 1NE9A 1NSLA 4CAVA 2CNTA 3PGPA 1QSRA 3JVNA 1PUAA 2PRBA 3SXNA 3UY5A 4JLYA 2BSWA 2GANA 5J8CA 2QMLA 3NE7A 1YR0A 4UWIA 3F8KA 3PP9A 3I9SA 4YRHA 1CJWA 1GHEA 1U6MA 4KLVA 4MY0A 4JWPA 2B5GB 2VQYA 2R8VA 3R95A 4K30A 3EC4A 1S60A 1VKCA 4XNHB 2HV2A 5DWNA 5KTCA 4FD5A 1KUXA 1RO5A 2G0BA 2K5TA 1IICA 1MJ9A 1V0CA 1Y7RA 3BJ7A 2KCWA 2GIVA 3E0KA 5JQ4A 4R9MA 3TO7A 2VXKA 2ZXVA 1XF8A 5F49A 2Q4YA 3K9UA 4M3SA 4ZBGA 3R9FA 1YREA 4RI1A 1Z4RA 3VWDA 2X7BA 4CAWA 4BMHA 4XPLA 4IF5A 2OU2A 4KOVA 4KOYA 1PU9A 3FXTA 1BO4A 1QSTA 2PC1A 4E2AA 5F46A 3FRMA 5I0CA 4AB7A 1Z9UA 3F0AA 3QB8A 4PSXA 3TTHA 3S6KA 3CXQA 4X5KA 3TCVA 4AG9A 2FIWA 2P6FA 3DR6A 1R57A 3IWGA 2BEIA 3JUWA 2Q7BA 4GS4A 2QIRA 3S6GA 2R1IA 1J4JA 5ISVA 1S7KA 5J8FA 4ONUA 1B6BA 3EY5A 3P2HA 2QECA 1I12A 2FL4A 5GCNA 4QUSA 4KVOE 2FSRA 4FD6A 2OZGA 5C82A 4JXQA 3TO6A 3R1KA 3R96A 2F5IA 1M4GA 3FNCA 5CNPA 2FCKA 3G8WA 5EBVA 1Y9KA 2FXFA 2JEVA 2H5MA 1IIDA 4UWJA 3W6XA 4E8OA 2HUZA 3S6HA 2VI7A 2JDDA 4L89A 2FIAA 3RYOA 1M44A 2ZW4A 5KTDA 2WPXA 4OAEA 1M1DA 3DNSA 4KZTA 2Q4VA 3ZJ0A 1WK4A 2REFA 2ZW7A 1S7NA 3V8IA 2B5GA 4CAXA 1FY7A 5HH1A 4UA3A 3GY9A 4QBJA 4B5PB 4XPDC 3TE4A 2BUEA 4M85A 5IV0A 2Z0ZA 3F5BA 3VWEA 1YLEA 2B4DB 4H6ZA 1I21A 2Q44A 2Z11A 2CNMA 4LX9A
chains in the Genus database with same CATH superfamily
4B12A 1ON0A 2PJCA 3C26A 2I79A 4CS0B 3W91A 3FB3A 2YNCC 3GLJA 3CXSA 4KOSA 1TKJA 4B14A 5LYIA 3PB8X 4C7IA 3IU1A 2J9AA 2J8MA 5C88A 3H8GA 4HKFA 1HDUA 4MCRA 4NXYA 2VBQA 3H5ZA 2J8NA 4P4IA 1HDQA 3DSBA 2REEA 2JBKA 1UFHA 4XPKA 2OB0A 4CGNA 3IEHA 4KUAA 1IYKA 1DTDA 1LAPA 2J8RA 2V8HA 3IWWA 2NMTA 4KSAA 1TF9A 2ZW6A 4HNYB 1CPSA 4TNUA 3R9EA 2PR8A 4UFVA 4C2YA 4PXDA 4Y49B 2DPSA 5H86A 2XEFA 4WJBA 1CBXA 4UCPA 4OKOA 4YGOA 5IX3A 4U9ZA 6CPAA 3H8FA 4OADA 4G1PA 7CPAA 3FVLA 4C7HA 1P4NA 5LYLA 4E0AA 4EVYA 5FVJA 1YX0A 2QYVA 1KZFA 2P6EA 2GE3A 2AFUA 3QAYA 4C2XA 1OZPA 1CM0A 1X12A 2PJ6A 4RS2A 3EFAA 2PR1A 2B3VA 4A2ZA 4H89A 4CAFA 3S9NA 1CPXA 4AVBA 4QVTA 3GYAA 2P6GA 1IOIA 3H4QA 5D8NA 3TFYA 4H2KA 1YMEA 3SHPA 4CYQA 3LWUA 2JDCA 2CNSA 3I1UA 4MHDA 1Y9WA 3TOAA 1AYEA 2ZEOA 1CG2A 3NH8A 3RZAA 1Z2LA 4A39A 5CBMA 3V7ZA 3W6SA 4OC4A 4M6HA 4EFDA 4UEFA 4F6AA 2HQYA 4I49A 4AVCA 1Q2CA 5G1ZA 2PRQA 1P0HA 3D3SA 1KUVA 3IO1A 1BLLE 2Q4ZA 4ORFA 2DPTA 3TT2A 3K2KA 2WSAA 4HNXB 4OP4A 2PQ8A 2FS5A 2VZYA 1BPNA 3KL9A 4MFLA 1NSAA 2V77A 3IWEA 4NCZA 4R3KA 3SI0A 5A27A 3FECA 2Q51A 3LD2A 4P4EA 2O4HA 2CY2A 2AFOA 2ZPAA 4JXRA 4ZY2A 3S9MA 4MRIA 3FMCA 3BLNA 1WWZA 4NFRA 3B8GA 5G21A 4AXVA 4NGMA 4PXCA 1S5KA 1VHSA 1XIXA 4W9YA 3D7FA 2Z3NA 3TC8A 4DUKA 4KOXA 2R98A 4NEXA 1R43A 2IJZA 3N7ZA 5EC4A 3ZZIA 4RN7A 2D4OA 4JD6A 3B7IA 5D29A 1XBUA 3LMSA 3B3TA 4MHNA 1NMTA 4CRYB 4U5YA 1XJOA 2EO8A 2PJ7A 2V8DA 2OOTA 3FH4A 1N71A 1VGYA 2F7VA 2PJ9A 3PZJA 2BL1A 2GLJA 2DXQA 3WC7A 3FBUA 4UBRA 3VH9A 2C1CA 4F9VA 3D2PA 2AE6A 1YGHA 2ZEFA 1XMTA 3MRUA 3K9TA 5IB0A 3PEIA 4MBUA 3D67A 3KI9A 4KOTA 3SI2A 2EVNA 2ABZA 4XPDB 4CPAA 3D68A 1QSMA 2AFXA 2Q04A 4EWTA 3BJ8A 4FBEA 3PB4X 4B5PA 1YVKA 2AFSA 4QB9A 3QNVA 2WPWA 5CPAA 1M4LA 4KOWA 4PV6A 4IUSA 2OZUA 4KSFA 4HPSA 5AG5A 2QJ8A 4ZYQA 8CPAA 3PFOA 1M4IA 2B4DA 1MJBA 2PDOA 2GLFA 3GKRA 4F0YA 1LCPA 1XMBA 4KLWA 4A33A 2BCOA 4M6GA 5AG7A 3SXOA 4NGSA 2EK9A 4PK2A 3DDDA 4KOUA 3MGDA 2FT0A 2PSWA 4QC6A 4FD7A 2WUUA 5LYFA 4OIWA 3T8WA 2ZW5A 1XFOA 2EUIA 3IU2A 4MI4A 4LUAA 4H6UA 1ZG7A 3T90A 2B58A 3WR7A 4B13A 4XNHC 4CRZB 4NSQA 5JPHA 3G3SA 3PB6X 1L0CA 2Q43A 1ELLP 1F57A 3P2FA 4L8AA 4C2ZA 3D8PA 4PXBA 4NJRA 4CGPA 5F48A 3KHZA 4KSIA 2JLMA 1IU8A 4CAEA 5H84A 1Q2DA 2Z3OA 1S7LA 4KVXA 2RFHA 1CP7A 1XOVA 2B4BA 5LRJA 5E96A 5K8MA 1KUYA 3RNZA 1S3ZA 2G3TA 3KHXA 2Z3KA 5LYDA 1I1DA 2ZEMA 3IJ3A 4OC0A 3OWCA 4DNCA 2B3UA 3PB7X 2F8HA 3ISXA 4YFJA 1QSNA 2ZEEA 1RXTA 3ISZA 4PK3A 5HXDA 1H8LA 2DEAA 2ZEGA 4JYWA 4II9A 4AVAA 4U9YA 2VZZA 2ZEDA 1IB1E 1VHOA 3R9GA 4IAVA 2ATRA 2Q0YA 3I3GA 3TOBA 3V38A 1Z4EA 2AFZA 1B87A 4Z65A 4MY3A 2A4NA 4ZGYB 3KKWA 1LRZA 1TKFA 2P0WA 1XE4A 2PJAA 3WC6A 5KTAA 2PJBA 2CXAA 5F47A 1KWMA 1MK4A 2VL1A 3B2YA 3EXNA 3CXPA 2WYRA 2O53A 1LFWA 1YVOA 3LODA 4J3GA 2ZOGA 4JJXA 4ZY1A 2C27A 2D4PA 4R3LA 4R87A 1YK3A 3NH5A 1IOFA 4OLLA 4P4BA 2O28A 3D2MA 1Q2YA 1IYLA 1SQHA 3IGRA 4P4FA 1CX8A 3BI0A 4NGPA 2V8GA 4DJLA 1TXRA 2R7HA 4Y49C 3TX8A 2ODFA 4B5OA 1HEEA 3BI1A 4NGRA 3S6FA 3WC5A 4HNWB 3RBUA 3TO9A 3DR8A 1Q7LA 1BOBA 2AFWA 1LAMA 5K8OA 2G3AA 2RC4A 4R76A 5DWMA 1XEBA 4OC1A 5ELYA 4ZI6A 3IIBA 4MFJA 4A37A 2PVWA 1Y7EA 4P44A 4AG7A 4GM5A 4MCQA 1K4JA 4MHZA 3KZWA 2FVGA 1AMPA 2OH1A 1TIQA 5THWA 2DF5A 4B10A 5HMNA 1Y0RA 4FD4A 2PJ2A 4KUBA 4PSWA 1F2OA 1M4DA 3FYNA 1VIXA 2I3CA 3B3WA 1PCAA 2IQ6A 2IL4A 2YGWA 3FIXA 1JQGA 5JH9A 1QSOA 4KVME 4P10A 4R57A 1S7FA 4LQ6A 2AJ6A 2VEZA 2ARHA 2OZHA 3H8EA 2Y0MA 2FE7A 2I00A 4B6ZA 1Z8LA 2ZOFA 2OR4A 4MCSA 3T9YA 4UCNA 3NH4A 4NF1A 5DS0A 4NJQA 3KGQA 3SJXA 4MJ8A 1QMUA 3CPAA 2Z10A 2CTCA 3EO4A 3QAHA 4KORA 4A32A 3MN8A 4LQGA 4BINA 5EMIA 1MJAA 4CGMA 1NE9A 3SI1A 2PJ0A 1BPMA 3KR4A 3PBBA 4A38A 1Z8WA 1NSLA 3KASA 1R3NA 2EWBA 2IMOA 1PYTB 2WZNA 4CAVA 2CNTA 3VATA 3B3VA 1YSJA 2EK8A 3PGPA 1QSRA 3JVNA 4MFZA 1PUAA 2PRBA 3SXNA 3UY5A 4BBHA 3FF3A 4JLYA 4FWUA 2BSWA 2GANA 4KS9A 4RUHA 1ZO0A 5J8CA 1X10A 4TWEA 4A31A 4C68A 2AFMA 2QMLA 4UIBA 3RAMA 1RTQA 2HB6A 3S9LA 2XEGA 3NE7A 4WWVA 1YR0A 4BD9A 4UEZA 4UWIA 3F8KA 3A9LA 4P6YA 4FAIA 3PP9A 2C6PA 2JEWA 5A28A 4MFKA 3I9SA 4YRHA 1CJWA 1GHEA 1U6MA 1ZG8A 4KLVA 4CYPA 4MY0A 4JWPA 4EMEA 2B5GB 3SJFA 2VQYA 2R8VA 3R95A 5BWAB 3L2NA 4K30A 5G22A 4PPZA 4IHMA 3WABA 3EC4A 4A94A 1S60A 1VKCA 4XNHB 1ELMP 2YNCA 4M6IA 4OC3A 4CGOA 2HV2A 5G20A 3GB0A 4YU9A 5F09A 1Z5RA 2CIJA 4PXEA 4ZX9A 5DWNA 2Z3LA 3SJEA 4P45A 5KTCA 4FD5A 1KUXA 4FUUA 5HVGA 2V8VA 4PQAA 1RO5A 2G0BA 2K5TA 2PJ4A 4UFWA 2PCUA 2NYQA 3B3CA 1IICA 4ONWA 5JGFA 2G9DA 1MJ9A 1V0CA 1Y7RA 3BJ7A 2KCWA 2GIVA 3E0KA 4MFPA 4B11A 4CYOA 3FEDA 5JQ4A 4R9MA 3HUVA 4CYNA 1ARLA 3TO7A 2EBJA 2VXKA 2ZXVA 1XF8A 2PJ5A 5F49A 1A2ZA 2Q4YA 1YLOA 3K9UA 4OIDA 3KR5A 1GYTA 4NGTA 4M3SA 4ZBGA 2CTBA 3HLPA 1YREA 4RI1A 1Z4RA 2XEIA 3FX6A 3R9FA 3SJGA 3VWDA 2X7BA 4CAWA 4R7MA 4BMHA 3D4UA 4A95A 2PVVA 4UFXA 4IF5A 4XPLA 2PJ3A 1JWQA 2OU2A 2PJ8A 3DGVA 2PIZA 4KOYA 4KOVA 1PU9A 3FXTA 1BO4A 3GIUA 1F2PA 5K8NA 2C6GA 4MFQA 4MHYA 1QSTA 2Z3MA 5JM6A 2PC1A 4E2AA 4ZY0A 5F46A 3FRMA 2ZENA 5I0CA 3FJUA 4AB7A 2NSMA 1Z9UA 3F0AA 3QB8A 4PSXA 4X8IA 3TTHA 3S6KA 4Q38A 3CXQA 4X5KA 3TCVA 4AG9A 2FIWA 5LRKA 2P6FA 2BO9A 3DR6A 1BAVA 2PIYA 1R57A 4Q7AA 3IWGA 2BEIA 3D7HA 3JUWA 4A30A 4OMEA 2Q7BA 4GS4A 3FEEA 4GXHA 4MHPA 2QIRA 3CZXA 4X2TA 3S6GA 4CGLA 2R1IA 1J4JA 1QQ9A 3NA6A 5ISVA 1S7KA 5J8FA 4MMOA 2GREA 4ONUA 3B35A 1B6BA 4UIAA 3CPXA 3PRTA 3EY5A 4R8FA 3NFZA 4JZ0A 1XRYA 5J1QA 1LOKA 2QECA 3P2HA 2JBJA 1I12A 1AUGA 2FL4A 1CP6A 4QUSA 4R6TA 5GCNA 1YQEA 4KVOE 1ZG9A 2FSRA 4Q36A 4MCPA 4FD6A 2QVPA 4UCMA 2CF4A 2OZGA 2YNEA 5C82A 4JXQA 3BXMA 3TO6A 2XEJA 3D7DA 3R1KA 3RO0A 3R96A 2F5IA 4F0XA 1M4GA 2POKA 2RB7A 2FCKA 2YNDA 3FNCA 3G8WA 4P4JA 5CNPA 4OC2A 5EBVA 3WT4A 1Y9KA 2FXFA 5HVHA 2Z3PA 3PB9X 2C6CA 2H5MA 2JEVA 3KQZA 4IK2A 1IIDA 1YW4A 4UWJA 4ZX8A 3W6XA 4E8OA 3IC1A 4YWYA 3BHXA 2PE3A 2HUZA 1ARMA 3D7GA 4P4DA 5K8PA 3S6HA 1EE3P 1ZLHA 2GFQA 2VI7A 2ANPA 2JDDA 4L89A 2FIAA 1IY7A 5LRGA 3RYOA 2ZELA 1FNOA 1M44A 2ZW4A 1TF8A 5KTDA 2WPXA 4OAEA 5HVFA 1UWYA 3IFEA 3PBEA 4O23A 1M1DA 1ZLIA 4NGQA 5AG4A 4OC5A 3B3SA 3DNSA 1FT7A 2HC9A 2Q4VA 2ZEPA 4KZTA 3N5FA 3ZJ0A 1WK4A 3PFEA 2REFA 1Z8TA 5AG6A 2ZW7A 1S7NA 3DLJA 3V8IA 3GUXA 2B5GA 2BOAA 4CAXA 3JTKA 4X3RA 4DYOA 1FY7A 1LANA 3CDXA 3D66A 3NE8A 4NGNA 4UA3A 4UEEA 5HH1A 4F8ZA 3GY9A 3CT9A 1OBRA 3LACA 5I4MA 3JRUA 4QBJA 1TKHA 4MXUA 3KQXA 4B5PB 4XPDC 2Q7SA 3TE4A 1IGBA 2BUEA 4UF4A 2PJ1A 4M85A 1Z8XA 1VHEA 2Z0ZA 3F5BA 5IV0A 3VWEA 1YLEA 1YW6A 1DE4C 2B4DB 4H6ZA 1I21A 5IB9A 2Q44A 2Z11A 5AGEA 2ZEHA 2CNMA 4K3NA 4F9UA 2GU2A 3VARA 1Y0YA 4LX9A
chains in the Genus database with same CATH topology
4B12A 1ON0A 3C26A 2I79A 4CS0B 3W91A 3FB3A 2YNCC 3CXSA 4KOSA 4B14A 4C7IA 3IU1A 5C88A 2J8MA 4HKFA 4NXYA 2VBQA 3H5ZA 2J8NA 3DSBA 2REEA 1UFHA 4XPKA 2OB0A 4CGNA 4KSAA 4KUAA 1IYKA 2J8RA 4C68A 2NMTA 4HNYB 2ZW6A 3R9EA 2PR8A 4UFVA 4C2YA 4Y49B 2DPSA 5H86A 4UCPA 5IX3A 4YGOA 4U9ZA 4OADA 4C7HA 1P4NA 4E0AA 4EVYA 5FVJA 1YX0A 1KZFA 2P6EA 2GE3A 4C2XA 1OZPA 1CM0A 4RS2A 3EFAA 2PR1A 2B3VA 4A2ZA 4H89A 4CAFA 4AVBA 4QVTA 3GYAA 2P6GA 3H4QA 3TFYA 3SHPA 4CYQA 2JDCA 2CNSA 4MHDA 1Y9WA 3TOAA 3W6SA 4F6AA 2HQYA 4I49A 4AVCA 1Q2CA 5G1ZA 1P0HA 3D3SA 1KUVA 4ORFA 2DPTA 3TT2A 2WSAA 4HNXB 2PQ8A 2FS5A 2VZYA 4MFLA 3IWEA 4NCZA 4R3KA 5A27A 3LD2A 2CY2A 2ZPAA 4JXRA 3BLNA 1WWZA 3B8GA 5G21A 1S5KA 1VHSA 1XIXA 2Z3NA 4KOXA 2R98A 4NEXA 3N7ZA 5EC4A 3ZZIA 2D4OA 4JD6A 1NMTA 4CRYB 4U5YA 1N71A 3PZJA 2BL1A 2DXQA 3FBUA 4UBRA 3D2PA 2AE6A 1YGHA 5IB0A 1XMTA 4MBUA 4KOTA 2EVNA 4XPDB 1QSMA 2Q04A 3BJ8A 4B5PA 1YVKA 4QB9A 2WPWA 4PV6A 4KOWA 4IUSA 2OZUA 4KSFA 5AG5A 1M4IA 2B4DA 1MJBA 2PDOA 3GKRA 4F0YA 4KLWA 4A33A 3SXOA 5AG7A 4PK2A 3DDDA 4KOUA 3MGDA 2FT0A 2PSWA 4QC6A 4FD7A 2WUUA 2ZW5A 2EUIA 3IU2A 4MI4A 4LUAA 4H6UA 3T90A 2B58A 3WR7A 4B13A 4XNHC 4CRZB 4NSQA 5JPHA 3G3SA 1L0CA 3P2FA 4L8AA 4C2ZA 3D8PA 4CGPA 5F48A 4CAEA 2JLMA 5H84A 1Q2DA 2Z3OA 1S7LA 4KVXA 2B4BA 5E96A 1KUYA 1S3ZA 2G3TA 2Z3KA 1I1DA 3OWCA 4DNCA 2B3UA 4YFJA 1QSNA 1RXTA 4PK3A 4II9A 4AVAA 4U9YA 2VZZA 3R9GA 1IB1E 2ATRA 2Q0YA 3I3GA 3TOBA 1Z4EA 1B87A 4MY3A 2A4NA 4ZGYB 3KKWA 1LRZA 2P0WA 5KTAA 1XE4A 2CXAA 5F47A 1MK4A 3EXNA 3CXPA 3LODA 1YVOA 4J3GA 4JJXA 2C27A 2D4PA 4R3LA 4R87A 1YK3A 4OLLA 2O28A 3D2MA 1Q2YA 1IYLA 1SQHA 3IGRA 4Y49C 2R7HA 4B5OA 3S6FA 4HNWB 3TO9A 3DR8A 1BOBA 2G3AA 2RC4A 5DWMA 1XEBA 4MFJA 4AG7A 1K4JA 2OH1A 1TIQA 4B10A 5HMNA 4FD4A 4KUBA 4PSWA 1M4DA 3FYNA 2YGWA 2IL4A 3FIXA 1QSOA 4KVME 4R57A 1S7FA 2AJ6A 2VEZA 2ARHA 2OZHA 2Y0MA 2FE7A 2I00A 3T9YA 4UCNA 4NF1A 4MJ8A 2Z10A 3EO4A 3QAHA 4KORA 4A32A 1MJAA 4CGMA 1NE9A 1NSLA 4CAVA 2CNTA 3PGPA 1QSRA 3JVNA 4MFZA 1PUAA 2PRBA 3SXNA 3UY5A 4BBHA 4KS9A 4JLYA 2BSWA 2GANA 1ZO0A 5J8CA 4A31A 2QMLA 3NE7A 1YR0A 4UWIA 3F8KA 3A9LA 3PP9A 5A28A 4MFKA 3I9SA 4YRHA 1CJWA 1GHEA 1U6MA 4KLVA 4CYPA 4MY0A 4JWPA 2B5GB 2VQYA 2R8VA 3R95A 5BWAB 4K30A 5G22A 3EC4A 1S60A 1VKCA 4XNHB 2YNCA 4CGOA 2HV2A 5G20A 5DWNA 2Z3LA 5KTCA 4FD5A 1KUXA 1RO5A 2G0BA 2K5TA 4UFWA 1IICA 1MJ9A 1V0CA 1Y7RA 3BJ7A 4B11A 2KCWA 2GIVA 3E0KA 4MFPA 4CYOA 5JQ4A 4R9MA 4CYNA 3TO7A 2VXKA 2ZXVA 1XF8A 5F49A 2Q4YA 3K9UA 4M3SA 4ZBGA 3R9FA 1YREA 4RI1A 1Z4RA 3VWDA 2X7BA 4CAWA 4BMHA 4A95A 4UFXA 4XPLA 4IF5A 2OU2A 4KOVA 4KOYA 1PU9A 3FXTA 1BO4A 4MFQA 1QSTA 2Z3MA 2PC1A 4E2AA 5F46A 3FRMA 5I0CA 4AB7A 1Z9UA 3F0AA 3QB8A 4PSXA 3TTHA 3S6KA 4Q38A 3CXQA 4X5KA 3TCVA 4AG9A 2FIWA 2P6FA 3DR6A 1R57A 3IWGA 2BEIA 3JUWA 4A30A 2Q7BA 4GS4A 4CGLA 2QIRA 3S6GA 2R1IA 1J4JA 5ISVA 1S7KA 5J8FA 4ONUA 1B6BA 3EY5A 3P2HA 2QECA 1I12A 2FL4A 5GCNA 4QUSA 4KVOE 2FSRA 4Q36A 4FD6A 4UCMA 2OZGA 2YNEA 5C82A 4JXQA 3TO6A 3R1KA 3R96A 2F5IA 4F0XA 3FNCA 1M4GA 2YNDA 2FCKA 5CNPA 3G8WA 5EBVA 1Y9KA 2FXFA 2Z3PA 2JEVA 2H5MA 1IIDA 4UWJA 3W6XA 4E8OA 2HUZA 3S6HA 2VI7A 2JDDA 4L89A 2FIAA 3RYOA 1M44A 2ZW4A 5KTDA 2WPXA 4OAEA 1M1DA 5AG4A 3DNSA 4KZTA 2Q4VA 3ZJ0A 1WK4A 2REFA 5AG6A 2ZW7A 1S7NA 3V8IA 2B5GA 4CAXA 3JTKA 1FY7A 5HH1A 4UA3A 3GY9A 4QBJA 4B5PB 4XPDC 3TE4A 2BUEA 4M85A 5IV0A 2Z0ZA 3F5BA 3VWEA 1YLEA 2B4DB 4H6ZA 1I21A 2Q44A 2Z11A 5AGEA 2CNMA 4LX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ON0 A;  3C26 A;  2I79 A;  4CS0 B;  3W91 A;  3FB3 A;  3CXS A;  4KOS A;  5C88 A;  2J8M A;  4HKF A;  4NXY A;  2VBQ A;  2J8N A;  3DSB A;  2REE A;  1UFH A;  4XPK A;  2OB0 A;  4KUA A;  1IYK A;  2J8R A;  2NMT A;  4HNY B;  2ZW6 A;  3R9E A;  2PR8 A;  4Y49 B;  5H86 A;  5IX3 A;  4YGO A;  4U9Z A;  4OAD A;  1P4N A;  4E0A A;  4EVY A;  5FVJ A;  1YX0 A;  1KZF A;  2P6E A;  2GE3 A;  1OZP A;  1CM0 A;  4RS2 A;  3EFA A;  2PR1 A;  2B3V A;  4H89 A;  4AVB A;  4QVT A;  3GYA A;  2P6G A;  3H4Q A;  3TFY A;  3SHP A;  2JDC A;  2CNS A;  4MHD A;  1Y9W A;  3TOA A;  3W6S A;  4F6A A;  2HQY A;  4I49 A;  4AVC A;  1Q2C A;  1P0H A;  3D3S A;  1KUV A;  4ORF A;  3TT2 A;  4HNX B;  2PQ8 A;  2FS5 A;  2VZY A;  4NCZ A;  4R3K A;  3LD2 A;  2CY2 A;  2ZPA A;  4JXR A;  3BLN A;  1WWZ A;  3B8G A;  1S5K A;  1VHS A;  1XIX A;  4KOX A;  2R98 A;  4NEX A;  3N7Z A;  5EC4 A;  3ZZI A;  2D4O A;  4JD6 A;  1NMT A;  4CRY B;  4U5Y A;  1N71 A;  3PZJ A;  2BL1 A;  2DXQ A;  3FBU A;  4UBR A;  3D2P A;  2AE6 A;  1YGH A;  5IB0 A;  1XMT A;  4MBU A;  4KOT A;  2EVN A;  4XPD B;  1QSM A;  2Q04 A;  3BJ8 A;  4B5P A;  1YVK A;  4QB9 A;  2WPW A;  4PV6 A;  4KOW A;  4IUS A;  2OZU A;  1M4I A;  2B4D A;  1MJB A;  2PDO A;  3GKR A;  4F0Y A;  4KLW A;  3SXO A;  4PK2 A;  3DDD A;  4KOU A;  3MGD A;  2FT0 A;  2PSW A;  4QC6 A;  4FD7 A;  2ZW5 A;  2EUI A;  4MI4 A;  4LUA A;  4H6U A;  3T90 A;  2B58 A;  3WR7 A;  4CRZ B;  4XNH C;  4NSQ A;  5JPH A;  3G3S A;  1L0C A;  3P2F A;  4L8A A;  3D8P A;  5F48 A;  2JLM A;  5H84 A;  1Q2D A;  4KVX A;  1S7L A;  2B4B A;  5E96 A;  1KUY A;  1S3Z A;  2G3T A;  1I1D A;  3OWC A;  4DNC A;  2B3U A;  4YFJ A;  1QSN A;  1RXT A;  4PK3 A;  4II9 A;  4AVA A;  4U9Y A;  2VZZ A;  3R9G A;  1IB1 E;  2ATR A;  2Q0Y A;  3I3G A;  3TOB A;  1Z4E A;  1B87 A;  4MY3 A;  2A4N A;  3KKW A;  1LRZ A;  2P0W A;  5KTA A;  1XE4 A;  5F47 A;  1MK4 A;  3EXN A;  3CXP A;  3LOD A;  1YVO A;  4J3G A;  4JJX A;  2C27 A;  2D4P A;  4R3L A;  4R87 A;  1YK3 A;  4OLL A;  2O28 A;  3D2M A;  1Q2Y A;  1IYL A;  1SQH A;  3IGR A;  4Y49 C;  2R7H A;  4B5O A;  3S6F A;  4HNW B;  3TO9 A;  3DR8 A;  1BOB A;  2G3A A;  2RC4 A;  5DWM A;  1XEB A;  4AG7 A;  1K4J A;  2OH1 A;  1TIQ A;  5HMN A;  4FD4 A;  4KUB A;  4PSW A;  1M4D A;  3FYN A;  2IL4 A;  3FIX A;  1QSO A;  4KVM E;  4R57 A;  1S7F A;  2AJ6 A;  2VEZ A;  2ARH A;  2OZH A;  2Y0M A;  2FE7 A;  2I00 A;  3T9Y A;  4NF1 A;  4MJ8 A;  2Z10 A;  3EO4 A;  3QAH A;  4KOR A;  1MJA A;  1NE9 A;  1NSL A;  4CAV A;  2CNT A;  3PGP A;  1QSR A;  3JVN A;  1PUA A;  2PRB A;  3SXN A;  3UY5 A;  4JLY A;  2BSW A;  2GAN A;  5J8C A;  2QML A;  3NE7 A;  1YR0 A;  4UWI A;  3F8K A;  3PP9 A;  3I9S A;  4YRH A;  1CJW A;  1GHE A;  1U6M A;  4KLV A;  4MY0 A;  4JWP A;  2B5G B;  2VQY A;  2R8V A;  3R95 A;  4K30 A;  3EC4 A;  1S60 A;  1VKC A;  4XNH B;  2HV2 A;  5DWN A;  5KTC A;  4FD5 A;  1KUX A;  1RO5 A;  2G0B A;  2K5T A;  1IIC A;  1MJ9 A;  1V0C A;  1Y7R A;  3BJ7 A;  2KCW A;  2GIV A;  3E0K A;  5JQ4 A;  4R9M A;  3TO7 A;  2VXK A;  2ZXV A;  1XF8 A;  5F49 A;  2Q4Y A;  3K9U A;  4M3S A;  4ZBG A;  3R9F A;  1YRE A;  4RI1 A;  1Z4R A;  3VWD A;  2X7B A;  4CAW A;  4BMH A;  4XPL A;  4IF5 A;  2OU2 A;  4KOV A;  4KOY A;  1PU9 A;  3FXT A;  1BO4 A;  1QST A;  2PC1 A;  4E2A A;  5F46 A;  3FRM A;  5I0C A;  4AB7 A;  1Z9U A;  3F0A A;  3QB8 A;  4PSX A;  3TTH A;  3S6K A;  3CXQ A;  4X5K A;  3TCV A;  4AG9 A;  2FIW A;  2P6F A;  3DR6 A;  1R57 A;  3IWG A;  2BEI A;  3JUW A;  2Q7B A;  4GS4 A;  2QIR A;  3S6G A;  2R1I A;  1J4J A;  5ISV A;  1S7K A;  5J8F A;  4ONU A;  1B6B A;  3EY5 A;  3P2H A;  2QEC A;  1I12 A;  2FL4 A;  5GCN A;  4QUS A;  4KVO E;  2FSR A;  4FD6 A;  2OZG A;  5C82 A;  4JXQ A;  3TO6 A;  3R1K A;  3R96 A;  2F5I A;  1M4G A;  3FNC A;  5CNP A;  2FCK A;  3G8W A;  5EBV A;  1Y9K A;  2FXF A;  2JEV A;  2H5M A;  1IID A;  4UWJ A;  3W6X A;  4E8O A;  2HUZ A;  3S6H A;  2VI7 A;  2JDD A;  4L89 A;  2FIA A;  3RYO A;  1M44 A;  2ZW4 A;  5KTD A;  2WPX A;  4OAE A;  1M1D A;  3DNS A;  4KZT A;  2Q4V A;  3ZJ0 A;  1WK4 A;  2REF A;  2ZW7 A;  1S7N A;  3V8I A;  2B5G A;  4CAX A;  1FY7 A;  5HH1 A;  4UA3 A;  3GY9 A;  4QBJ A;  4B5P B;  4XPD C;  3TE4 A;  2BUE A;  4M85 A;  5IV0 A;  2Z0Z A;  3F5B A;  3VWE A;  1YLE A;  2B4D B;  4H6Z A;  1I21 A;  2Q44 A;  2Z11 A;  2CNM A;  4LX9 A; 
#chains in the Genus database with same CATH topology
 4B12 A;  1ON0 A;  2PJC A;  3C26 A;  2I79 A;  4CS0 B;  3W91 A;  3FB3 A;  2YNC C;  3GLJ A;  3CXS A;  4KOS A;  1TKJ A;  4B14 A;  5LYI A;  3PB8 X;  4C7I A;  3IU1 A;  2J9A A;  2J8M A;  5C88 A;  3H8G A;  4HKF A;  1HDU A;  4MCR A;  4NXY A;  2VBQ A;  3H5Z A;  2J8N A;  4P4I A;  1HDQ A;  3DSB A;  2REE A;  2JBK A;  1UFH A;  4XPK A;  2OB0 A;  4CGN A;  3IEH A;  4KUA A;  1IYK A;  1DTD A;  1LAP A;  2J8R A;  2V8H A;  3IWW A;  2NMT A;  4KSA A;  1TF9 A;  2ZW6 A;  4HNY B;  1CPS A;  4TNU A;  3R9E A;  2PR8 A;  4UFV A;  4C2Y A;  4PXD A;  4Y49 B;  2DPS A;  5H86 A;  2XEF A;  4WJB A;  1CBX A;  4UCP A;  4OKO A;  4YGO A;  5IX3 A;  4U9Z A;  6CPA A;  3H8F A;  4OAD A;  4G1P A;  7CPA A;  3FVL A;  4C7H A;  1P4N A;  5LYL A;  4E0A A;  4EVY A;  5FVJ A;  1YX0 A;  2QYV A;  1KZF A;  2P6E A;  2GE3 A;  2AFU A;  3QAY A;  4C2X A;  1OZP A;  1CM0 A;  1X12 A;  2PJ6 A;  4RS2 A;  3EFA A;  2PR1 A;  2B3V A;  4A2Z A;  4H89 A;  4CAF A;  3S9N A;  1CPX A;  4AVB A;  4QVT A;  3GYA A;  2P6G A;  1IOI A;  3H4Q A;  5D8N A;  3TFY A;  4H2K A;  1YME A;  3SHP A;  4CYQ A;  3LWU A;  2JDC A;  2CNS A;  3I1U A;  4MHD A;  1Y9W A;  3TOA A;  1AYE A;  2ZEO A;  1CG2 A;  3NH8 A;  3RZA A;  1Z2L A;  4A39 A;  5CBM A;  3V7Z A;  3W6S A;  4OC4 A;  4M6H A;  4EFD A;  4UEF A;  4F6A A;  2HQY A;  4I49 A;  4AVC A;  1Q2C A;  5G1Z A;  2PRQ A;  1P0H A;  3D3S A;  1KUV A;  3IO1 A;  1BLL E;  2Q4Z A;  4ORF A;  2DPT A;  3TT2 A;  3K2K A;  2WSA A;  4HNX B;  4OP4 A;  2PQ8 A;  2FS5 A;  2VZY A;  1BPN A;  3KL9 A;  4MFL A;  1NSA A;  2V77 A;  3IWE A;  4NCZ A;  4R3K A;  3SI0 A;  5A27 A;  3FEC A;  2Q51 A;  3LD2 A;  4P4E A;  2O4H A;  2CY2 A;  2AFO A;  2ZPA A;  4JXR A;  4ZY2 A;  3S9M A;  4MRI A;  3FMC A;  3BLN A;  1WWZ A;  4NFR A;  3B8G A;  5G21 A;  4AXV A;  4NGM A;  4PXC A;  1S5K A;  1VHS A;  1XIX A;  4W9Y A;  3D7F A;  2Z3N A;  3TC8 A;  4DUK A;  4KOX A;  2R98 A;  4NEX A;  1R43 A;  2IJZ A;  3N7Z A;  5EC4 A;  3ZZI A;  4RN7 A;  2D4O A;  4JD6 A;  3B7I A;  5D29 A;  1XBU A;  3LMS A;  3B3T A;  4MHN A;  1NMT A;  4CRY B;  4U5Y A;  1XJO A;  2EO8 A;  2PJ7 A;  2V8D A;  2OOT A;  3FH4 A;  1N71 A;  1VGY A;  2F7V A;  2PJ9 A;  3PZJ A;  2BL1 A;  2GLJ A;  2DXQ A;  3WC7 A;  3FBU A;  4UBR A;  3VH9 A;  2C1C A;  4F9V A;  3D2P A;  2AE6 A;  1YGH A;  2ZEF A;  1XMT A;  3MRU A;  3K9T A;  5IB0 A;  3PEI A;  4MBU A;  3D67 A;  3KI9 A;  4KOT A;  3SI2 A;  2EVN A;  2ABZ A;  4XPD B;  4CPA A;  3D68 A;  1QSM A;  2AFX A;  2Q04 A;  4EWT A;  3BJ8 A;  4FBE A;  3PB4 X;  4B5P A;  1YVK A;  2AFS A;  4QB9 A;  3QNV A;  2WPW A;  5CPA A;  1M4L A;  4KOW A;  4PV6 A;  4IUS A;  2OZU A;  4KSF A;  4HPS A;  5AG5 A;  2QJ8 A;  4ZYQ A;  8CPA A;  3PFO A;  1M4I A;  2B4D A;  1MJB A;  2PDO A;  2GLF A;  3GKR A;  4F0Y A;  1LCP A;  1XMB A;  4KLW A;  4A33 A;  2BCO A;  4M6G A;  5AG7 A;  3SXO A;  4NGS A;  2EK9 A;  4PK2 A;  3DDD A;  4KOU A;  3MGD A;  2FT0 A;  2PSW A;  4QC6 A;  4FD7 A;  2WUU A;  5LYF A;  4OIW A;  3T8W A;  2ZW5 A;  1XFO A;  2EUI A;  3IU2 A;  4MI4 A;  4LUA A;  4H6U A;  1ZG7 A;  3T90 A;  2B58 A;  3WR7 A;  4B13 A;  4XNH C;  4CRZ B;  4NSQ A;  5JPH A;  3G3S A;  3PB6 X;  1L0C A;  2Q43 A;  1ELL P;  1F57 A;  3P2F A;  4L8A A;  4C2Z A;  3D8P A;  4PXB A;  4NJR A;  4CGP A;  5F48 A;  3KHZ A;  4KSI A;  2JLM A;  1IU8 A;  4CAE A;  5H84 A;  1Q2D A;  2Z3O A;  1S7L A;  4KVX A;  2RFH A;  1CP7 A;  1XOV A;  2B4B A;  5LRJ A;  5E96 A;  5K8M A;  1KUY A;  3RNZ A;  1S3Z A;  2G3T A;  3KHX A;  2Z3K A;  5LYD A;  1I1D A;  2ZEM A;  3IJ3 A;  4OC0 A;  3OWC A;  4DNC A;  2B3U A;  3PB7 X;  2F8H A;  3ISX A;  4YFJ A;  1QSN A;  2ZEE A;  1RXT A;  3ISZ A;  4PK3 A;  5HXD A;  1H8L A;  2DEA A;  2ZEG A;  4JYW A;  4II9 A;  4AVA A;  4U9Y A;  2VZZ A;  2ZED A;  1IB1 E;  1VHO A;  3R9G A;  4IAV A;  2ATR A;  2Q0Y A;  3I3G A;  3TOB A;  3V38 A;  1Z4E A;  2AFZ A;  1B87 A;  4Z65 A;  4MY3 A;  2A4N A;  4ZGY B;  3KKW A;  1LRZ A;  1TKF A;  2P0W A;  1XE4 A;  2PJA A;  3WC6 A;  5KTA A;  2PJB A;  2CXA A;  5F47 A;  1KWM A;  1MK4 A;  2VL1 A;  3B2Y A;  3EXN A;  3CXP A;  2WYR A;  2O53 A;  1LFW A;  1YVO A;  3LOD A;  4J3G A;  2ZOG A;  4JJX A;  4ZY1 A;  2C27 A;  2D4P A;  4R3L A;  4R87 A;  1YK3 A;  3NH5 A;  1IOF A;  4OLL A;  4P4B A;  2O28 A;  3D2M A;  1Q2Y A;  1IYL A;  1SQH A;  3IGR A;  4P4F A;  1CX8 A;  3BI0 A;  4NGP A;  2V8G A;  4DJL A;  1TXR A;  2R7H A;  4Y49 C;  3TX8 A;  2ODF A;  4B5O A;  1HEE A;  3BI1 A;  4NGR A;  3S6F A;  3WC5 A;  4HNW B;  3RBU A;  3TO9 A;  3DR8 A;  1Q7L A;  1BOB A;  2AFW A;  1LAM A;  5K8O A;  2G3A A;  2RC4 A;  4R76 A;  5DWM A;  1XEB A;  4OC1 A;  5ELY A;  4ZI6 A;  3IIB A;  4MFJ A;  4A37 A;  2PVW A;  1Y7E A;  4P44 A;  4AG7 A;  4GM5 A;  4MCQ A;  1K4J A;  4MHZ A;  3KZW A;  2FVG A;  1AMP A;  2OH1 A;  1TIQ A;  5THW A;  2DF5 A;  4B10 A;  5HMN A;  1Y0R A;  4FD4 A;  2PJ2 A;  4KUB A;  4PSW A;  1F2O A;  1M4D A;  3FYN A;  1VIX A;  2I3C A;  3B3W A;  1PCA A;  2IQ6 A;  2IL4 A;  2YGW A;  3FIX A;  1JQG A;  5JH9 A;  1QSO A;  4KVM E;  4P10 A;  4R57 A;  1S7F A;  4LQ6 A;  2AJ6 A;  2VEZ A;  2ARH A;  2OZH A;  3H8E A;  2Y0M A;  2FE7 A;  2I00 A;  4B6Z A;  1Z8L A;  2ZOF A;  2OR4 A;  4MCS A;  3T9Y A;  4UCN A;  3NH4 A;  4NF1 A;  5DS0 A;  4NJQ A;  3KGQ A;  3SJX A;  4MJ8 A;  1QMU A;  3CPA A;  2Z10 A;  2CTC A;  3EO4 A;  3QAH A;  4KOR A;  4A32 A;  3MN8 A;  4LQG A;  4BIN A;  5EMI A;  1MJA A;  4CGM A;  1NE9 A;  3SI1 A;  2PJ0 A;  1BPM A;  3KR4 A;  3PBB A;  4A38 A;  1Z8W A;  1NSL A;  3KAS A;  1R3N A;  2EWB A;  2IMO A;  1PYT B;  2WZN A;  4CAV A;  2CNT A;  3VAT A;  3B3V A;  1YSJ A;  2EK8 A;  3PGP A;  1QSR A;  3JVN A;  4MFZ A;  1PUA A;  2PRB A;  3SXN A;  3UY5 A;  4BBH A;  3FF3 A;  4JLY A;  4FWU A;  2BSW A;  2GAN A;  4KS9 A;  4RUH A;  1ZO0 A;  5J8C A;  1X10 A;  4TWE A;  4A31 A;  4C68 A;  2AFM A;  2QML A;  4UIB A;  3RAM A;  1RTQ A;  2HB6 A;  3S9L A;  2XEG A;  3NE7 A;  4WWV A;  1YR0 A;  4BD9 A;  4UEZ A;  4UWI A;  3F8K A;  3A9L A;  4P6Y A;  4FAI A;  3PP9 A;  2C6P A;  2JEW A;  5A28 A;  4MFK A;  3I9S A;  4YRH A;  1CJW A;  1GHE A;  1U6M A;  1ZG8 A;  4KLV A;  4CYP A;  4MY0 A;  4JWP A;  4EME A;  2B5G B;  3SJF A;  2VQY A;  2R8V A;  3R95 A;  5BWA B;  3L2N A;  4K30 A;  5G22 A;  4PPZ A;  4IHM A;  3WAB A;  3EC4 A;  4A94 A;  1S60 A;  1VKC A;  4XNH B;  1ELM P;  2YNC A;  4M6I A;  4OC3 A;  4CGO A;  2HV2 A;  5G20 A;  3GB0 A;  4YU9 A;  5F09 A;  1Z5R A;  2CIJ A;  4PXE A;  4ZX9 A;  5DWN A;  2Z3L A;  3SJE A;  4P45 A;  5KTC A;  4FD5 A;  1KUX A;  4FUU A;  5HVG A;  2V8V A;  4PQA A;  1RO5 A;  2G0B A;  2K5T A;  2PJ4 A;  4UFW A;  2PCU A;  2NYQ A;  3B3C A;  1IIC A;  4ONW A;  5JGF A;  2G9D A;  1MJ9 A;  1V0C A;  1Y7R A;  3BJ7 A;  2KCW A;  2GIV A;  3E0K A;  4MFP A;  4B11 A;  4CYO A;  3FED A;  5JQ4 A;  4R9M A;  3HUV A;  4CYN A;  1ARL A;  3TO7 A;  2EBJ A;  2VXK A;  2ZXV A;  1XF8 A;  2PJ5 A;  5F49 A;  1A2Z A;  2Q4Y A;  1YLO A;  3K9U A;  4OID A;  3KR5 A;  1GYT A;  4NGT A;  4M3S A;  4ZBG A;  2CTB A;  3HLP A;  1YRE A;  4RI1 A;  1Z4R A;  2XEI A;  3FX6 A;  3R9F A;  3SJG A;  3VWD A;  2X7B A;  4CAW A;  4R7M A;  4BMH A;  3D4U A;  4A95 A;  2PVV A;  4UFX A;  4IF5 A;  4XPL A;  2PJ3 A;  1JWQ A;  2OU2 A;  2PJ8 A;  3DGV A;  2PIZ A;  4KOY A;  4KOV A;  1PU9 A;  3FXT A;  1BO4 A;  3GIU A;  1F2P A;  5K8N A;  2C6G A;  4MFQ A;  4MHY A;  1QST A;  2Z3M A;  5JM6 A;  2PC1 A;  4E2A A;  4ZY0 A;  5F46 A;  3FRM A;  2ZEN A;  5I0C A;  3FJU A;  4AB7 A;  2NSM A;  1Z9U A;  3F0A A;  3QB8 A;  4PSX A;  4X8I A;  3TTH A;  3S6K A;  4Q38 A;  3CXQ A;  4X5K A;  3TCV A;  4AG9 A;  2FIW A;  5LRK A;  2P6F A;  2BO9 A;  3DR6 A;  1BAV A;  2PIY A;  1R57 A;  4Q7A A;  3IWG A;  2BEI A;  3D7H A;  3JUW A;  4A30 A;  4OME A;  2Q7B A;  4GS4 A;  3FEE A;  4GXH A;  4MHP A;  2QIR A;  3CZX A;  4X2T A;  3S6G A;  4CGL A;  2R1I A;  1J4J A;  1QQ9 A;  3NA6 A;  5ISV A;  1S7K A;  5J8F A;  4MMO A;  2GRE A;  4ONU A;  3B35 A;  1B6B A;  4UIA A;  3CPX A;  3PRT A;  3EY5 A;  4R8F A;  3NFZ A;  4JZ0 A;  1XRY A;  5J1Q A;  1LOK A;  2QEC A;  3P2H A;  2JBJ A;  1I12 A;  1AUG A;  2FL4 A;  1CP6 A;  4QUS A;  4R6T A;  5GCN A;  1YQE A;  4KVO E;  1ZG9 A;  2FSR A;  4Q36 A;  4MCP A;  4FD6 A;  2QVP A;  4UCM A;  2CF4 A;  2OZG A;  2YNE A;  5C82 A;  4JXQ A;  3BXM A;  3TO6 A;  2XEJ A;  3D7D A;  3R1K A;  3RO0 A;  3R96 A;  2F5I A;  4F0X A;  1M4G A;  2POK A;  2RB7 A;  2FCK A;  2YND A;  3FNC A;  3G8W A;  4P4J A;  5CNP A;  4OC2 A;  5EBV A;  3WT4 A;  1Y9K A;  2FXF A;  5HVH A;  2Z3P A;  3PB9 X;  2C6C A;  2H5M A;  2JEV A;  3KQZ A;  4IK2 A;  1IID A;  1YW4 A;  4UWJ A;  4ZX8 A;  3W6X A;  4E8O A;  3IC1 A;  4YWY A;  3BHX A;  2PE3 A;  2HUZ A;  1ARM A;  3D7G A;  4P4D A;  5K8P A;  3S6H A;  1EE3 P;  1ZLH A;  2GFQ A;  2VI7 A;  2ANP A;  2JDD A;  4L89 A;  2FIA A;  1IY7 A;  5LRG A;  3RYO A;  2ZEL A;  1FNO A;  1M44 A;  2ZW4 A;  1TF8 A;  5KTD A;  2WPX A;  4OAE A;  5HVF A;  1UWY A;  3IFE A;  3PBE A;  4O23 A;  1M1D A;  1ZLI A;  4NGQ A;  5AG4 A;  4OC5 A;  3B3S A;  3DNS A;  1FT7 A;  2HC9 A;  2Q4V A;  2ZEP A;  4KZT A;  3N5F A;  3ZJ0 A;  1WK4 A;  3PFE A;  2REF A;  1Z8T A;  5AG6 A;  2ZW7 A;  1S7N A;  3DLJ A;  3V8I A;  3GUX A;  2B5G A;  2BOA A;  4CAX A;  3JTK A;  4X3R A;  4DYO A;  1FY7 A;  1LAN A;  3CDX A;  3D66 A;  3NE8 A;  4NGN A;  4UA3 A;  4UEE A;  5HH1 A;  4F8Z A;  3GY9 A;  3CT9 A;  1OBR A;  3LAC A;  5I4M A;  3JRU A;  4QBJ A;  1TKH A;  4MXU A;  3KQX A;  4B5P B;  4XPD C;  2Q7S A;  3TE4 A;  1IGB A;  2BUE A;  4UF4 A;  2PJ1 A;  4M85 A;  1Z8X A;  1VHE A;  2Z0Z A;  3F5B A;  5IV0 A;  3VWE A;  1YLE A;  1YW6 A;  1DE4 C;  2B4D B;  4H6Z A;  1I21 A;  5IB9 A;  2Q44 A;  2Z11 A;  5AGE A;  2ZEH A;  2CNM A;  4K3N A;  4F9U A;  2GU2 A;  3VAR A;  1Y0Y A;  4LX9 A; 
#chains in the Genus database with same CATH homology
 4B12 A;  1ON0 A;  3C26 A;  2I79 A;  4CS0 B;  3W91 A;  3FB3 A;  2YNC C;  3CXS A;  4KOS A;  4B14 A;  4C7I A;  3IU1 A;  5C88 A;  2J8M A;  4HKF A;  4NXY A;  2VBQ A;  3H5Z A;  2J8N A;  3DSB A;  2REE A;  1UFH A;  4XPK A;  2OB0 A;  4CGN A;  4KSA A;  4KUA A;  1IYK A;  2J8R A;  4C68 A;  2NMT A;  4HNY B;  2ZW6 A;  3R9E A;  2PR8 A;  4UFV A;  4C2Y A;  4Y49 B;  2DPS A;  5H86 A;  4UCP A;  5IX3 A;  4YGO A;  4U9Z A;  4OAD A;  4C7H A;  1P4N A;  4E0A A;  4EVY A;  5FVJ A;  1YX0 A;  1KZF A;  2P6E A;  2GE3 A;  4C2X A;  1OZP A;  1CM0 A;  4RS2 A;  3EFA A;  2PR1 A;  2B3V A;  4A2Z A;  4H89 A;  4CAF A;  4AVB A;  4QVT A;  3GYA A;  2P6G A;  3H4Q A;  3TFY A;  3SHP A;  4CYQ A;  2JDC A;  2CNS A;  4MHD A;  1Y9W A;  3TOA A;  3W6S A;  4F6A A;  2HQY A;  4I49 A;  4AVC A;  1Q2C A;  5G1Z A;  1P0H A;  3D3S A;  1KUV A;  4ORF A;  2DPT A;  3TT2 A;  2WSA A;  4HNX B;  2PQ8 A;  2FS5 A;  2VZY A;  4MFL A;  3IWE A;  4NCZ A;  4R3K A;  5A27 A;  3LD2 A;  2CY2 A;  2ZPA A;  4JXR A;  3BLN A;  1WWZ A;  3B8G A;  5G21 A;  1S5K A;  1VHS A;  1XIX A;  2Z3N A;  4KOX A;  2R98 A;  4NEX A;  3N7Z A;  5EC4 A;  3ZZI A;  2D4O A;  4JD6 A;  1NMT A;  4CRY B;  4U5Y A;  1N71 A;  3PZJ A;  2BL1 A;  2DXQ A;  3FBU A;  4UBR A;  3D2P A;  2AE6 A;  1YGH A;  5IB0 A;  1XMT A;  4MBU A;  4KOT A;  2EVN A;  4XPD B;  1QSM A;  2Q04 A;  3BJ8 A;  4B5P A;  1YVK A;  4QB9 A;  2WPW A;  4PV6 A;  4KOW A;  4IUS A;  2OZU A;  4KSF A;  5AG5 A;  1M4I A;  2B4D A;  1MJB A;  2PDO A;  3GKR A;  4F0Y A;  4KLW A;  4A33 A;  3SXO A;  5AG7 A;  4PK2 A;  3DDD A;  4KOU A;  3MGD A;  2FT0 A;  2PSW A;  4QC6 A;  4FD7 A;  2WUU A;  2ZW5 A;  2EUI A;  3IU2 A;  4MI4 A;  4LUA A;  4H6U A;  3T90 A;  2B58 A;  3WR7 A;  4B13 A;  4XNH C;  4CRZ B;  4NSQ A;  5JPH A;  3G3S A;  1L0C A;  3P2F A;  4L8A A;  4C2Z A;  3D8P A;  4CGP A;  5F48 A;  4CAE A;  2JLM A;  5H84 A;  1Q2D A;  2Z3O A;  1S7L A;  4KVX A;  2B4B A;  5E96 A;  1KUY A;  1S3Z A;  2G3T A;  2Z3K A;  1I1D A;  3OWC A;  4DNC A;  2B3U A;  4YFJ A;  1QSN A;  1RXT A;  4PK3 A;  4II9 A;  4AVA A;  4U9Y A;  2VZZ A;  3R9G A;  1IB1 E;  2ATR A;  2Q0Y A;  3I3G A;  3TOB A;  1Z4E A;  1B87 A;  4MY3 A;  2A4N A;  4ZGY B;  3KKW A;  1LRZ A;  2P0W A;  5KTA A;  1XE4 A;  2CXA A;  5F47 A;  1MK4 A;  3EXN A;  3CXP A;  3LOD A;  1YVO A;  4J3G A;  4JJX A;  2C27 A;  2D4P A;  4R3L A;  4R87 A;  1YK3 A;  4OLL A;  2O28 A;  3D2M A;  1Q2Y A;  1IYL A;  1SQH A;  3IGR A;  4Y49 C;  2R7H A;  4B5O A;  3S6F A;  4HNW B;  3TO9 A;  3DR8 A;  1BOB A;  2G3A A;  2RC4 A;  5DWM A;  1XEB A;  4MFJ A;  4AG7 A;  1K4J A;  2OH1 A;  1TIQ A;  4B10 A;  5HMN A;  4FD4 A;  4KUB A;  4PSW A;  1M4D A;  3FYN A;  2YGW A;  2IL4 A;  3FIX A;  1QSO A;  4KVM E;  4R57 A;  1S7F A;  2AJ6 A;  2VEZ A;  2ARH A;  2OZH A;  2Y0M A;  2FE7 A;  2I00 A;  3T9Y A;  4UCN A;  4NF1 A;  4MJ8 A;  2Z10 A;  3EO4 A;  3QAH A;  4KOR A;  4A32 A;  1MJA A;  4CGM A;  1NE9 A;  1NSL A;  4CAV A;  2CNT A;  3PGP A;  1QSR A;  3JVN A;  4MFZ A;  1PUA A;  2PRB A;  3SXN A;  3UY5 A;  4BBH A;  4KS9 A;  4JLY A;  2BSW A;  2GAN A;  1ZO0 A;  5J8C A;  4A31 A;  2QML A;  3NE7 A;  1YR0 A;  4UWI A;  3F8K A;  3A9L A;  3PP9 A;  5A28 A;  4MFK A;  3I9S A;  4YRH A;  1CJW A;  1GHE A;  1U6M A;  4KLV A;  4CYP A;  4MY0 A;  4JWP A;  2B5G B;  2VQY A;  2R8V A;  3R95 A;  5BWA B;  4K30 A;  5G22 A;  3EC4 A;  1S60 A;  1VKC A;  4XNH B;  2YNC A;  4CGO A;  2HV2 A;  5G20 A;  5DWN A;  2Z3L A;  5KTC A;  4FD5 A;  1KUX A;  1RO5 A;  2G0B A;  2K5T A;  4UFW A;  1IIC A;  1MJ9 A;  1V0C A;  1Y7R A;  3BJ7 A;  4B11 A;  2KCW A;  2GIV A;  3E0K A;  4MFP A;  4CYO A;  5JQ4 A;  4R9M A;  4CYN A;  3TO7 A;  2VXK A;  2ZXV A;  1XF8 A;  5F49 A;  2Q4Y A;  3K9U A;  4M3S A;  4ZBG A;  3R9F A;  1YRE A;  4RI1 A;  1Z4R A;  3VWD A;  2X7B A;  4CAW A;  4BMH A;  4A95 A;  4UFX A;  4XPL A;  4IF5 A;  2OU2 A;  4KOV A;  4KOY A;  1PU9 A;  3FXT A;  1BO4 A;  4MFQ A;  1QST A;  2Z3M A;  2PC1 A;  4E2A A;  5F46 A;  3FRM A;  5I0C A;  4AB7 A;  1Z9U A;  3F0A A;  3QB8 A;  4PSX A;  3TTH A;  3S6K A;  4Q38 A;  3CXQ A;  4X5K A;  3TCV A;  4AG9 A;  2FIW A;  2P6F A;  3DR6 A;  1R57 A;  3IWG A;  2BEI A;  3JUW A;  4A30 A;  2Q7B A;  4GS4 A;  4CGL A;  2QIR A;  3S6G A;  2R1I A;  1J4J A;  5ISV A;  1S7K A;  5J8F A;  4ONU A;  1B6B A;  3EY5 A;  3P2H A;  2QEC A;  1I12 A;  2FL4 A;  5GCN A;  4QUS A;  4KVO E;  2FSR A;  4Q36 A;  4FD6 A;  4UCM A;  2OZG A;  2YNE A;  5C82 A;  4JXQ A;  3TO6 A;  3R1K A;  3R96 A;  2F5I A;  4F0X A;  3FNC A;  1M4G A;  2YND A;  2FCK A;  5CNP A;  3G8W A;  5EBV A;  1Y9K A;  2FXF A;  2Z3P A;  2JEV A;  2H5M A;  1IID A;  4UWJ A;  3W6X A;  4E8O A;  2HUZ A;  3S6H A;  2VI7 A;  2JDD A;  4L89 A;  2FIA A;  3RYO A;  1M44 A;  2ZW4 A;  5KTD A;  2WPX A;  4OAE A;  1M1D A;  5AG4 A;  3DNS A;  4KZT A;  2Q4V A;  3ZJ0 A;  1WK4 A;  2REF A;  5AG6 A;  2ZW7 A;  1S7N A;  3V8I A;  2B5G A;  4CAX A;  3JTK A;  1FY7 A;  5HH1 A;  4UA3 A;  3GY9 A;  4QBJ A;  4B5P B;  4XPD C;  3TE4 A;  2BUE A;  4M85 A;  5IV0 A;  2Z0Z A;  3F5B A;  3VWE A;  1YLE A;  2B4D B;  4H6Z A;  1I21 A;  2Q44 A;  2Z11 A;  5AGE A;  2CNM A;  4LX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...