3S6FA

Crystal structure of a putative acetyltransferase (dr_1678) from deinococcus radiodurans r1 at 1.19 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
143
structure length
143
Chain Sequence
MTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILAASIPLLEVQAGWRSLGLGSELMRRVLTELGDLYMVDLSCDDDVVPFYERLGLKRANAMFLRRYDNQAGIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical acetyltransferase (DR_1678) from Deinococcus radiodurans at 1.19 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Transferase
molecule keywords Hypothetical acetyltransferase
total genus 33
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3s6fA00
5E96A 3TO9A 2B5GA 2CY2A 2I79A 2QECA 4DNCA 3EY5A 4FD6A 2FXFA 4KVOE 4CAWA 3E0KA 2HUZA 1QSRA 3GYAA 5JPHA 2AJ6A 4UWIA 4B5PA 5HMNA 3IWGA 3TFYA 4XPDB 1NMTA 2PQ8A 1S60A 2Q4VA 1XF8A 2ZW4A 1FY7A 4KVME 2JEVA 1BOBA 1Q2DA 2B3UA 2VEZA 3H4QA 4R87A 2QMLA 4HKFA 5EC4A 1U6MA 3TOBA 2FCKA 1Z9UA 4IUSA 2ZW6A 3I9SA 4JXQA 2PSWA 5CNPA 3JUWA 3TTHA 3UY5A 2B4BA 2CNSA 1RO5A 1MJ9A 2CNTA 3R9FA 3NE7A 3FRMA 2PR1A 4H89A 4OADA 4QUSA 2BSWA 2HQYA 1PU9A 3FYNA 2OZGA 2J8RA 2P6EA 4I49A 3EO4A 3QAHA 1P4NA 1M4DA 3EXNA 1L0CA 2P0WA 1V0CA 3VWEA 3P2FA 4MI4A 1S5KA 2NMTA 1IYKA 4MY0A 1XMTA 3FIXA 4CRZB 3ZZIA 2X7BA 1M1DA 2WPWA 4XNHC 4R3KA 3B8GA 5KTDA 2Q0YA 2B4DB 5C82A 4KLVA 2JDCA 2FIAA 1R57A 2WPXA 5IX3A 3TT2A 2EUIA 4YFJA 4PK3A 3F8KA 1YVKA 4NCZA 1NE9A 4KUAA 2ZW7A 2VZZA 3G8WA 4OAEA 4MBUA 2G3AA 3D3SA 3BJ8A 4NEXA 1SQHA 4MY3A 2VBQA 4EVYA 4AG9A 1MJBA 2GE3A 2IL4A 2PDOA 4UWJA 1Y9WA 3LODA 3EC4A 3R9EA 4KOVA 3DNSA 1I21A 1YGHA 4QBJA 2VZYA 3S6HA 1YREA 2PC1A 3IGRA 3OWCA 1IIDA 2C27A 3DR6A 2ZXVA 3R9GA 2R1IA 1WK4A 5H84A 1K4JA 4UA3A 4H6ZA 5F46A 1IB1E 4E2AA 4KUBA 4F6AA 3R96A 3D2MA 4HNYB 1RXTA 2B5GB 5GCNA 1S7FA 2BUEA 4XPKA 3RYOA 3DR8A 3F5BA 4KORA 1B87A 1YR0A 2FIWA 4PV6A 3S6GA 3TOAA 5DWMA 1KUYA 3S6FA 1YLEA 4L8AA 2FL4A 4E8OA 3ZJ0A 1GHEA 2PRBA 3DSBA 2OU2A 4MJ8A 2P6FA 1J4JA 2K5TA 3F0AA 5JQ4A 1M44A 3N7ZA 1ON0A 2Y0MA 2J8NA 3GY9A 2Q04A 2Q44A 2VXKA 1Y7RA 2OZHA 4NSQA 3V8IA 4PSWA 4U9YA 2FSRA 3P2HA 4B5PB 1MK4A 3CXSA 3WR7A 2PR8A 3T90A 5F49A 1KUXA 1YK3A 3SHPA 2G3TA 1XE4A 4LX9A 3LD2A 5H86A 2OB0A 4E0AA 3PP9A 1I1DA 4FD5A 1S3ZA 3FNCA 4IF5A 4R57A 3VWDA 5J8FA 2R7HA 4HNWB 4U9ZA 3KKWA 4NF1A 5IB0A 2ZPAA 1XIXA 2F5IA 4KVXA 4FD4A 2B4DA 5F47A 2REFA 1MJAA 4PSXA 1PUAA 3D2PA 4QB9A 1Y9KA 4B5OA 5HH1A 4RS2A 3PGPA 1BO4A 2Z0ZA 3GKRA 2OH1A 4J3GA 3W6SA 1KUVA 4QVTA 2VI7A 4BMHA 3SXOA 4AVCA 1Z4EA 4OLLA 4KZTA 3CXPA 4X5KA 1B6BA 4KOUA 4YRHA 4U5YA 1M4GA 2FE7A 2P6GA 1XEBA 1NSLA 2QIRA 4KOYA 1Q2CA 4F0YA 5KTCA 1Z4RA 2HV2A 2VQYA 3R95A 1KZFA 1S7KA 2ARHA 4H6UA 2BL1A 3S6KA 1QSNA 3W6XA 4AVBA 5ISVA 5IV0A 1OZPA 1S7LA 4XPDC 4XPLA 2DXQA 4ZBGA 1VKCA 3QB8A 4CS0B 4ORFA 4AG7A 5EBVA 3PZJA 1YVOA 4L89A 2FT0A 4LUAA 2Z11A 3TO7A 4HNXB 2GANA 3EFAA 1WWZA 1CJWA 2R98A 1N71A 1QSMA 2A4NA 2ATRA 4CAVA 1QSOA 5DWNA 2AE6A 3FBUA 3BLNA 4PK2A 2Z10A 3I3GA 3TO6A 2J8MA 2REEA 4ONUA 4CRYB 3K9UA 3DDDA 1P0HA 4Y49B 4KOXA 3T9YA 3TCVA 2I00A 2JDDA 3TE4A 2GIVA 3G3SA 4KLWA 4R9MA 5J8CA 4JWPA 4KOSA 2B3VA 4M85A 1YX0A 2OZUA 5KTAA 5I0CA 1QSTA 2BEIA 4GS4A 1TIQA 2FS5A 2D4PA 1VHSA 1CM0A 3D8PA 3BJ7A 1IYLA 1IICA 1S7NA 1M4IA 4II9A 4JXRA 1Q2YA 4M3SA 3JVNA 5FVJA 4JJXA 4XNHB 4RI1A 3MGDA 3FXTA 2Q4YA 2R8VA 2KCWA 2JLMA 2D4OA 2H5MA 4NXYA 2ZW5A 4MHDA 4CAXA 4JD6A 2Q7BA 1LRZA 4KOTA 4JLYA 4AB7A 1I12A 4K30A 3SXNA 3CXQA 4UBRA 3W91A 2EVNA 2O28A 4KOWA 4Y49C 2G0BA 2CNMA 3R1KA 1UFHA 4FD7A 2B58A 4AVAA 2RC4A 5C88A 3FB3A 4R3LA 4QC6A 4YGOA 3C26A 5F48A
chains in the Genus database with same CATH superfamily
2BOAA 3SI1A 5E96A 5K8PA 4OIDA 3TO9A 1F57A 2V8VA 2B5GA 2CY2A 2I79A 2QECA 3HUVA 3NFZA 4DNCA 3EY5A 4FD6A 2FXFA 2C6GA 4X2TA 2FVGA 4MHYA 1Z8WA 1LAPA 2AFXA 4KVOE 4DUKA 3IO1A 4CAWA 3E0KA 2HUZA 1Z5RA 5IB9A 1QSRA 2GU2A 3BHXA 2QYVA 1CBXA 3KR4A 2PJBA 3FH4A 4YWYA 3GYAA 4CYQA 5JPHA 3B35A 2AJ6A 1XFOA 2C6PA 4CGOA 4UWIA 1ZG9A 2HC9A 3KHXA 3S9LA 4B5PA 4UEEA 2IMOA 5AG6A 5HMNA 3IWGA 3TFYA 3IEHA 4XPDB 1NMTA 2PQ8A 1S60A 2Q4VA 1XF8A 2ZW4A 4PXBA 1FY7A 1LOKA 2YGWA 4PXEA 4KVME 4A32A 4OC1A 2JEVA 3T8WA 1HDQA 2G9DA 3B3SA 3H8EA 1QQ9A 3H8FA 4UIAA 1BOBA 1Q2DA 2B3UA 2NSMA 2VEZA 3H4QA 2QMLA 4HKFA 3BI1A 4R87A 1U6MA 5EC4A 3D67A 2FCKA 3TOBA 2ZELA 1OBRA 4TNUA 3D68A 4UEZA 4ZY0A 1Z9UA 4IUSA 2ZW6A 3BXMA 2OOTA 4ZX8A 3I9SA 3SJXA 4JXQA 3D7GA 1VIXA 2PSWA 1ZLIA 5CNPA 4MHNA 3JUWA 2QJ8A 3TTHA 3UY5A 2B4BA 1ZLHA 2CNSA 2Z3PA 4OC5A 1A2ZA 4NGSA 4B14A 1RO5A 3DLJA 2CTCA 4IK2A 4MRIA 1MJ9A 2CNTA 3R9FA 2V77A 3GB0A 4NGQA 3NE7A 4P44A 2AFZA 3FRMA 2PR1A 4H89A 3KQZA 4OADA 4QUSA 2BSWA 2HQYA 1PU9A 3FYNA 4MFLA 4MXUA 2OZGA 2J8RA 5AG4A 2P6EA 1ELMP 4I49A 5G21A 2F8HA 1Z8XA 3EO4A 5CBMA 3KI9A 3QAHA 2ZENA 3LMSA 2I3CA 3SJEA 4OC2A 4B6ZA 5A28A 4MCQA 1P4NA 4F9VA 1IY7A 1M4DA 3EXNA 4P10A 5LYDA 3V7ZA 4EWTA 1CPSA 1L0CA 2P0WA 4UEFA 4OC3A 2Q43A 1V0CA 3VWEA 4CAFA 3P2FA 4MI4A 1XOVA 4LQGA 1S5KA 2NMTA 1IYKA 4MY0A 4OP4A 3PEIA 1XMTA 3FIXA 2PJ4A 4CRZB 2V8HA 7CPAA 3WABA 3WC7A 4CPAA 1JWQA 3ZZIA 2X7BA 4UFWA 1M1DA 2WPWA 1YLOA 4NGRA 4R3KA 4XNHC 3B8GA 4MFPA 5KTDA 2Q0YA 3IU1A 2Z3KA 3FVLA 3ISXA 1F2OA 1XRYA 2B4DB 3FMCA 5C82A 4KLVA 2JDCA 3S9MA 2FIAA 1R57A 2WPXA 5IX3A 3TT2A 2EUIA 2ZOFA 1ZG8A 4IHMA 1HDUA 1TF8A 2O53A 3B3WA 4UCNA 4YFJA 4MMOA 4PK3A 3F8KA 1YVKA 2V8DA 3FEDA 1NE9A 4NCZA 4KUAA 2PIYA 4YU9A 5DS0A 2ZW7A 2ZEEA 2VZZA 3FECA 2DPTA 3G8WA 4MBUA 4OAEA 3PBEA 2G3AA 3D3SA 3BJ8A 4NEXA 1IOIA 1JQGA 1SQHA 4MY3A 2DPSA 4A30A 2VBQA 1EE3P 4C2YA 4EVYA 4AG9A 4M6IA 1MJBA 2GE3A 2IL4A 4NJQA 4O23A 2PDOA 4UWJA 1Y9WA 3LODA 3EC4A 3L2NA 3R9EA 4B13A 4R8FA 2QVPA 2ANPA 4C2XA 4KOVA 3DNSA 1I21A 1YGHA 2CF4A 3SI0A 4QBJA 4DJLA 2VZYA 3S6HA 4BINA 1YREA 2PC1A 4Q36A 5HVGA 3IGRA 3OWCA 1TKJA 1IIDA 5AG5A 2CIJA 2C27A 4BBHA 4MCPA 4BD9A 3DR6A 4FWUA 2ZXVA 3KGQA 3RZAA 3PB6X 3WC5A 4P45A 4DYOA 3R9GA 2R1IA 1WK4A 5H84A 2YNCA 1K4JA 4UA3A 4CGPA 4H6ZA 5F46A 3RNZA 5ELYA 2ZEOA 4R6TA 5LRKA 1IB1E 4E2AA 1LAMA 4KUBA 4F6AA 3K2KA 3R96A 3D2MA 4NGMA 2PJ5A 2AFWA 4HNYB 5HVHA 1RXTA 2B5GB 2JEWA 2JBJA 5AG7A 1S7FA 2BUEA 4XPKA 5GCNA 4FUUA 3RYOA 3DR8A 2Q4ZA 3F5BA 1IU8A 3FEEA 5LYFA 4UFVA 2PJ0A 4KORA 3TX8A 2EK9A 4MFZA 1B87A 1YR0A 3B3VA 1LFWA 2FIWA 4JYWA 4PV6A 4UCPA 4ZX9A 2AFSA 4A33A 4A95A 1TXRA 3S6GA 3TOAA 1NSAA 4KS9A 2AFOA 5DWMA 1KUYA 2ZEHA 1UWYA 5D29A 3S6FA 1YLEA 3FF3A 3ISZA 4L8AA 2FL4A 4E8OA 1BAVA 3ZJ0A 3PB4X 5LYIA 1GHEA 2PRBA 1XBUA 3DSBA 1Y0YA 2OU2A 5G1ZA 4MJ8A 2P6FA 4OC0A 4R76A 5F09A 1J4JA 4MFKA 2WYRA 1YQEA 3WT4A 4MFJA 2RB7A 2K5TA 3F0AA 5JQ4A 3WC6A 1M44A 3N7ZA 1AYEA 3B2YA 2XEIA 1ON0A 4Q7AA 2AFUA 4RN7A 5EMIA 3B3TA 2Y0MA 3FJUA 3NE8A 2J8NA 3GY9A 5AGEA 4A94A 2EWBA 2Q44A 2Q04A 3V38A 2VXKA 4B12A 1CP7A 4CGLA 1M4LA 1Y7RA 2GLFA 2PJ7A 2PJ1A 2OZHA 2XEGA 5JGFA 4NSQA 3V8IA 2IJZA 4PSWA 3GUXA 3PFEA 1YW6A 4MFQA 5G20A 4U9YA 2FSRA 5I4MA 3P2HA 1Q7LA 4B5PB 1CPXA 2DEAA 3I1UA 3K9TA 1MK4A 4G1PA 3CXSA 4KSAA 2ZEDA 3KQXA 3WR7A 2Z3LA 2PR8A 3T90A 5F49A 4EMEA 1KUXA 5K8MA 1YK3A 3SHPA 1HEEA 2G3TA 1XE4A 3SI2A 4LX9A 4PQAA 3LD2A 3PBBA 5H86A 2BO9A 3B3CA 2OB0A 4E0AA 3PP9A 5HVFA 1Z8LA 1I1DA 3PB7X 3DGVA 4FD5A 4P4EA 1S3ZA 3FNCA 4IF5A 4R57A 3VWDA 5J8FA 4C68A 2R7HA 4HNWB 4IAVA 2HB6A 1GYTA 1FT7A 4P4FA 4U9ZA 1CP6A 3KKWA 1YSJA 4NF1A 1TKHA 4A38A 5IB0A 4GXHA 2ZPAA 1XIXA 4X8IA 1LANA 2F5IA 4KVXA 4FD4A 2B4DA 1Y0RA 3JRUA 5F47A 4B10A 2REFA 2WZNA 2Z3OA 4NFRA 1CG2A 1MJAA 8CPAA 4NGTA 2ZOGA 2Q7SA 5D8NA 4ONWA 4PSXA 1PUAA 3D2PA 4QB9A 1ARMA 5CPAA 1Y9KA 4OMEA 4B5OA 5BWAB 3VATA 5HH1A 4RS2A 3PGPA 4PPZA 1BO4A 2WUUA 2Z0ZA 3GKRA 5THWA 2OH1A 2GLJA 3QNVA 4CGNA 4J3GA 2ODFA 3W6SA 1KUVA 1ZG7A 4QVTA 2VI7A 4R7MA 2BCOA 4H2KA 4BMHA 4ZYQA 3SXOA 4AVCA 1Z4EA 3SJGA 4OLLA 3PRTA 2GREA 4F8ZA 4KZTA 3CXPA 2V8GA 3CZXA 4X5KA 1B6BA 1F2PA 4C7IA 4CYNA 4KOUA 4YRHA 3A9LA 5LRJA 4U5YA 1M4GA 2PRQA 2YNDA 2FE7A 2P6GA 2GFQA 1AMPA 1XEBA 1NSLA 4C2ZA 2QIRA 4WJBA 1IOFA 4KOYA 2PVVA 1Q2CA 4PXDA 4F0YA 5KTCA 1Z4RA 1Z2LA 2HV2A 2VQYA 2JBKA 3R95A 1KZFA 2VL1A 1S7KA 2ARHA 2O4HA 3RAMA 3H5ZA 1DTDA 2PJAA 4H6UA 2BL1A 3KASA 1QSNA 3S6KA 4EFDA 3W6XA 4AVBA 5JM6A 5JH9A 3IIBA 1Z8TA 4Z65A 5ISVA 2XEFA 5IV0A 1R43A 3D4UA 1LCPA 4MCSA 4W9YA 4HPSA 1OZPA 3NH4A 1S7LA 1YMEA 2C6CA 3LWUA 4F0XA 4XPDC 1X12A 4XPLA 4ZGYB 2DXQA 4ZBGA 5HXDA 4OKOA 1ARLA 1VKCA 3QB8A 1DE4C 2XEJA 4CS0B 2PJ6A 2AFMA 1AUGA 4ORFA 3IFEA 4AG7A 4ZY2A 5EBVA 2ZEPA 3CPXA 4PXCA 2ZEFA 4KSFA 3PZJA 1YVOA 4GM5A 1KWMA 4L89A 4MHPA 4OC4A 3CDXA 4P4DA 2FT0A 4LUAA 1ZO0A 2Z11A 4FAIA 3TO7A 4HNXB 2GANA 3KZWA 3EFAA 4UFXA 3IWWA 6CPAA 1WWZA 3CPAA 3SJFA 1CJWA 2Z3MA 2R98A 3MRUA 3NH8A 1N71A 4P4IA 1QSMA 4OIWA 4KSIA 2A4NA 3VH9A 1BLLE 2ATRA 1YW4A 4P6YA 1QSOA 4CAVA 3NH5A 4WWVA 4CYPA 2ABZA 5DWNA 1PCAA 2PJ9A 2AE6A 3PB9X 3FBUA 4CYOA 3BLNA 3MN8A 4PK2A 3TC8A 2Z10A 2CXAA 1TF9A 4LQ6A 3I3GA 4A37A 3TO6A 3D7FA 3B7IA 2PIZA 3VARA 5LRGA 2J8MA 1TKFA 5G22A 4A31A 2REEA 4JZ0A 4ONUA 4M6GA 3PB8X 4CRYB 3K9UA 4X3RA 1VHOA 4Q38A 3DDDA 2EO8A 4UCMA 4F9UA 1P0HA 1Y7EA 1VGYA 4Y49B 4KOXA 2YNEA 5K8OA 1XMBA 2ZEGA 3T9YA 3TCVA 4AXVA 2NYQA 2I00A 2JDDA 2YNCC 2Z3NA 2ZEMA 3FX6A 3TE4A 2PJ2A 4NGPA 5LYLA 2GIVA 3G3SA 4KLWA 4R9MA 1RTQA 2DF5A 2OR4A 3NA6A 2RFHA 4K3NA 5J8CA 4NGNA 3QAYA 4JWPA 4TWEA 1BPMA 1IGBA 1R3NA 4KOSA 1ELLP 4MCRA 2B3VA 4M85A 3IJ3A 3GLJA 1BPNA 3S9NA 4CGMA 1YX0A 2OZUA 5KTAA 5I0CA 4M6HA 1QSTA 1VHEA 2BEIA 4GS4A 2EK8A 1TIQA 2PJ8A 3KL9A 2FS5A 2D4PA 1VHSA 3KHZA 1CM0A 2PVWA 4RUHA 2F7VA 3D8PA 3BJ7A 1IYLA 1IICA 1S7NA 5J1QA 1M4IA 4UF4A 3D7DA 2EBJA 4UIBA 3KR5A 3RO0A 4II9A 3JTKA 4JXRA 1CX8A 1Q2YA 4M3SA 3JVNA 5FVJA 4JJXA 4XNHB 4P4BA 4RI1A 2CTBA 3FXTA 2PJCA 2Q4YA 3MGDA 3PFOA 4C7HA 3HLPA 2R8VA 2KCWA 2JLMA 4ZI6A 2D4OA 2PE3A 2H5MA 4NXYA 2PJ3A 2IQ6A 2ZW5A 3IWEA 4MHDA 4CAXA 3CT9A 4JD6A 4A39A 1QMUA 4P4JA 1LRZA 4KOTA 4NJRA 4JLYA 2Q7BA 1FNOA 3IU2A 1PYTB 1I12A 4AB7A 4K30A 5K8NA 3SXNA 3CXQA 4UBRA 3W91A 4MHZA 2EVNA 2J9AA 3D7HA 2O28A 2Q51A 1X10A 3LACA 3RBUA 3BI0A 4CAEA 3IC1A 4KOWA 4Y49C 2G0BA 2CNMA 2PCUA 5A27A 3R1KA 1UFHA 1XJOA 1H8LA 2WSAA 3D66A 4FD7A 2B58A 3N5FA 4AVAA 4A2ZA 2RC4A 5C88A 3FB3A 4R3LA 2C1CA 4QC6A 3GIUA 2POKA 4YGOA 3C26A 4ZY1A 3H8GA 5F48A 4B11A 4FBEA
chains in the Genus database with same CATH topology
5E96A 3TO9A 2B5GA 2CY2A 2I79A 2QECA 4DNCA 3EY5A 4FD6A 2FXFA 4KVOE 4CAWA 3E0KA 2HUZA 1QSRA 3GYAA 4CYQA 5JPHA 2AJ6A 4CGOA 4UWIA 4B5PA 5AG6A 5HMNA 3IWGA 3TFYA 4XPDB 1NMTA 2PQ8A 1S60A 2Q4VA 1XF8A 2ZW4A 1FY7A 2YGWA 4KVME 4A32A 2JEVA 1BOBA 1Q2DA 2B3UA 2VEZA 3H4QA 4R87A 2QMLA 4HKFA 5EC4A 1U6MA 3TOBA 2FCKA 1Z9UA 4IUSA 2ZW6A 3I9SA 4JXQA 2PSWA 5CNPA 3JUWA 3TTHA 3UY5A 2B4BA 2CNSA 2Z3PA 4B14A 1RO5A 1MJ9A 2CNTA 3R9FA 3NE7A 3FRMA 2PR1A 4H89A 4OADA 4QUSA 4MFLA 2BSWA 1PU9A 2HQYA 3FYNA 2OZGA 2J8RA 5AG4A 2P6EA 4I49A 5G21A 3EO4A 3QAHA 5A28A 1P4NA 1M4DA 3EXNA 1L0CA 2P0WA 1V0CA 3VWEA 4CAFA 3P2FA 4MI4A 1S5KA 2NMTA 1IYKA 4MY0A 1XMTA 3FIXA 4CRZB 3ZZIA 2X7BA 4UFWA 1M1DA 2WPWA 4XNHC 4R3KA 3B8GA 4MFPA 5KTDA 2Q0YA 3IU1A 2Z3KA 2B4DB 5C82A 4KLVA 2JDCA 2FIAA 1R57A 2WPXA 5IX3A 3TT2A 2EUIA 4YFJA 4UCNA 4PK3A 3F8KA 1YVKA 4NCZA 1NE9A 4KUAA 2ZW7A 2VZZA 3G8WA 2DPTA 4OAEA 4MBUA 2G3AA 3D3SA 3BJ8A 4NEXA 1SQHA 4MY3A 2DPSA 4A30A 2VBQA 4C2YA 4EVYA 4AG9A 1MJBA 2GE3A 2IL4A 2PDOA 4UWJA 1Y9WA 3LODA 3EC4A 3R9EA 4B13A 4C2XA 4KOVA 3DNSA 1I21A 1YGHA 4QBJA 2VZYA 3S6HA 1YREA 2PC1A 4Q36A 3IGRA 3OWCA 1IIDA 5AG5A 2C27A 4BBHA 3DR6A 2ZXVA 3R9GA 2R1IA 1WK4A 5H84A 2YNCA 1K4JA 4UA3A 4CGPA 4H6ZA 5F46A 1IB1E 4E2AA 4KUBA 4F6AA 3R96A 3D2MA 4HNYB 1RXTA 2B5GB 5AG7A 5GCNA 1S7FA 2BUEA 4XPKA 3RYOA 3DR8A 3F5BA 4UFVA 4KORA 4MFZA 1B87A 1YR0A 2FIWA 4UCPA 4PV6A 4A33A 4A95A 3S6GA 3TOAA 4KS9A 5DWMA 1KUYA 3S6FA 1YLEA 4L8AA 2FL4A 4E8OA 3ZJ0A 1GHEA 2PRBA 3DSBA 2OU2A 5G1ZA 4MJ8A 2P6FA 1J4JA 4MFKA 4MFJA 2K5TA 3F0AA 5JQ4A 1M44A 3N7ZA 1ON0A 2Y0MA 2J8NA 3GY9A 5AGEA 2Q04A 2Q44A 2VXKA 4B12A 4CGLA 1Y7RA 2OZHA 4NSQA 3V8IA 4PSWA 4MFQA 5G20A 4U9YA 2FSRA 3P2HA 4B5PB 1MK4A 4KSAA 3CXSA 3WR7A 2Z3LA 2PR8A 3T90A 5F49A 1KUXA 1YK3A 3SHPA 2G3TA 1XE4A 4LX9A 3LD2A 5H86A 2OB0A 4E0AA 3PP9A 1I1DA 4FD5A 1S3ZA 3FNCA 4IF5A 4R57A 3VWDA 5J8FA 4C68A 2R7HA 4HNWB 4U9ZA 3KKWA 4NF1A 5IB0A 2ZPAA 1XIXA 2F5IA 4KVXA 4FD4A 2B4DA 5F47A 4B10A 2REFA 2Z3OA 1MJAA 4PSXA 1PUAA 3D2PA 4QB9A 1Y9KA 4B5OA 5BWAB 5HH1A 4RS2A 3PGPA 1BO4A 2WUUA 2Z0ZA 3GKRA 2OH1A 4CGNA 4J3GA 3W6SA 1KUVA 4QVTA 2VI7A 4BMHA 3SXOA 4AVCA 1Z4EA 4OLLA 4KZTA 3CXPA 4X5KA 1B6BA 4C7IA 4CYNA 4KOUA 4YRHA 3A9LA 4U5YA 1M4GA 2YNDA 2FE7A 2P6GA 1XEBA 1NSLA 4C2ZA 2QIRA 4KOYA 1Q2CA 4F0YA 5KTCA 1Z4RA 2HV2A 2VQYA 3R95A 1KZFA 1S7KA 2ARHA 3H5ZA 4H6UA 2BL1A 3S6KA 1QSNA 3W6XA 4AVBA 5ISVA 5IV0A 1OZPA 1S7LA 4F0XA 4XPDC 4XPLA 4ZGYB 2DXQA 4ZBGA 1VKCA 3QB8A 4CS0B 4ORFA 4AG7A 5EBVA 4KSFA 3PZJA 1YVOA 4L89A 2FT0A 4LUAA 1ZO0A 2Z11A 3TO7A 4HNXB 2GANA 3EFAA 4UFXA 1WWZA 1CJWA 2Z3MA 2R98A 1N71A 1QSMA 2A4NA 2ATRA 4CAVA 1QSOA 4CYPA 5DWNA 2AE6A 3FBUA 4CYOA 3BLNA 4PK2A 2Z10A 2CXAA 3I3GA 3TO6A 2J8MA 5G22A 4A31A 2REEA 4ONUA 4CRYB 3K9UA 4Q38A 3DDDA 4UCMA 1P0HA 4Y49B 4KOXA 2YNEA 3T9YA 3TCVA 2I00A 2JDDA 2YNCC 2Z3NA 3TE4A 2GIVA 3G3SA 4KLWA 4R9MA 5J8CA 4JWPA 4KOSA 2B3VA 4M85A 4CGMA 1YX0A 2OZUA 5KTAA 5I0CA 1QSTA 2BEIA 4GS4A 1TIQA 2FS5A 2D4PA 1VHSA 1CM0A 3D8PA 3BJ7A 1IYLA 1IICA 1S7NA 1M4IA 4II9A 3JTKA 4JXRA 1Q2YA 4M3SA 3JVNA 5FVJA 4JJXA 4XNHB 4RI1A 3MGDA 3FXTA 2Q4YA 4C7HA 2R8VA 2KCWA 2JLMA 2D4OA 2H5MA 4NXYA 2ZW5A 3IWEA 4MHDA 4CAXA 4JD6A 2Q7BA 1LRZA 4KOTA 4JLYA 4AB7A 3IU2A 1I12A 4K30A 3SXNA 3CXQA 4UBRA 3W91A 2EVNA 2O28A 4CAEA 4KOWA 4Y49C 2G0BA 2CNMA 5A27A 3R1KA 1UFHA 2WSAA 4FD7A 2B58A 4AVAA 4A2ZA 2RC4A 5C88A 3FB3A 4R3LA 4QC6A 4YGOA 3C26A 5F48A 4B11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E96 A;  3TO9 A;  2B5G A;  2CY2 A;  2I79 A;  2QEC A;  4DNC A;  3EY5 A;  4FD6 A;  2FXF A;  4KVO E;  4CAW A;  3E0K A;  2HUZ A;  1QSR A;  3GYA A;  5JPH A;  2AJ6 A;  4UWI A;  4B5P A;  5HMN A;  3IWG A;  3TFY A;  4XPD B;  1NMT A;  2PQ8 A;  1S60 A;  2Q4V A;  1XF8 A;  2ZW4 A;  1FY7 A;  4KVM E;  2JEV A;  1BOB A;  1Q2D A;  2B3U A;  2VEZ A;  3H4Q A;  4R87 A;  2QML A;  4HKF A;  5EC4 A;  1U6M A;  3TOB A;  2FCK A;  1Z9U A;  4IUS A;  2ZW6 A;  3I9S A;  4JXQ A;  2PSW A;  5CNP A;  3JUW A;  3TTH A;  3UY5 A;  2B4B A;  2CNS A;  1RO5 A;  1MJ9 A;  2CNT A;  3R9F A;  3NE7 A;  3FRM A;  2PR1 A;  4H89 A;  4OAD A;  4QUS A;  2BSW A;  2HQY A;  1PU9 A;  3FYN A;  2OZG A;  2J8R A;  2P6E A;  4I49 A;  3EO4 A;  3QAH A;  1P4N A;  1M4D A;  3EXN A;  1L0C A;  2P0W A;  1V0C A;  3VWE A;  3P2F A;  4MI4 A;  1S5K A;  2NMT A;  1IYK A;  4MY0 A;  1XMT A;  3FIX A;  4CRZ B;  3ZZI A;  2X7B A;  1M1D A;  2WPW A;  4XNH C;  4R3K A;  3B8G A;  5KTD A;  2Q0Y A;  2B4D B;  5C82 A;  4KLV A;  2JDC A;  2FIA A;  1R57 A;  2WPX A;  5IX3 A;  3TT2 A;  2EUI A;  4YFJ A;  4PK3 A;  3F8K A;  1YVK A;  4NCZ A;  1NE9 A;  4KUA A;  2ZW7 A;  2VZZ A;  3G8W A;  4OAE A;  4MBU A;  2G3A A;  3D3S A;  3BJ8 A;  4NEX A;  1SQH A;  4MY3 A;  2VBQ A;  4EVY A;  4AG9 A;  1MJB A;  2GE3 A;  2IL4 A;  2PDO A;  4UWJ A;  1Y9W A;  3LOD A;  3EC4 A;  3R9E A;  4KOV A;  3DNS A;  1I21 A;  1YGH A;  4QBJ A;  2VZY A;  3S6H A;  1YRE A;  2PC1 A;  3IGR A;  3OWC A;  1IID A;  2C27 A;  3DR6 A;  2ZXV A;  3R9G A;  2R1I A;  1WK4 A;  5H84 A;  1K4J A;  4UA3 A;  4H6Z A;  5F46 A;  1IB1 E;  4E2A A;  4KUB A;  4F6A A;  3R96 A;  3D2M A;  4HNY B;  1RXT A;  2B5G B;  5GCN A;  1S7F A;  2BUE A;  4XPK A;  3RYO A;  3DR8 A;  3F5B A;  4KOR A;  1B87 A;  1YR0 A;  2FIW A;  4PV6 A;  3S6G A;  3TOA A;  5DWM A;  1KUY A;  3S6F A;  1YLE A;  4L8A A;  2FL4 A;  4E8O A;  3ZJ0 A;  1GHE A;  2PRB A;  3DSB A;  2OU2 A;  4MJ8 A;  2P6F A;  1J4J A;  2K5T A;  3F0A A;  5JQ4 A;  1M44 A;  3N7Z A;  1ON0 A;  2Y0M A;  2J8N A;  3GY9 A;  2Q04 A;  2Q44 A;  2VXK A;  1Y7R A;  2OZH A;  4NSQ A;  3V8I A;  4PSW A;  4U9Y A;  2FSR A;  3P2H A;  4B5P B;  1MK4 A;  3CXS A;  3WR7 A;  2PR8 A;  3T90 A;  5F49 A;  1KUX A;  1YK3 A;  3SHP A;  2G3T A;  1XE4 A;  4LX9 A;  3LD2 A;  5H86 A;  2OB0 A;  4E0A A;  3PP9 A;  1I1D A;  4FD5 A;  1S3Z A;  3FNC A;  4IF5 A;  4R57 A;  3VWD A;  5J8F A;  2R7H A;  4HNW B;  4U9Z A;  3KKW A;  4NF1 A;  5IB0 A;  2ZPA A;  1XIX A;  2F5I A;  4KVX A;  4FD4 A;  2B4D A;  5F47 A;  2REF A;  1MJA A;  4PSX A;  1PUA A;  3D2P A;  4QB9 A;  1Y9K A;  4B5O A;  5HH1 A;  4RS2 A;  3PGP A;  1BO4 A;  2Z0Z A;  3GKR A;  2OH1 A;  4J3G A;  3W6S A;  1KUV A;  4QVT A;  2VI7 A;  4BMH A;  3SXO A;  4AVC A;  1Z4E A;  4OLL A;  4KZT A;  3CXP A;  4X5K A;  1B6B A;  4KOU A;  4YRH A;  4U5Y A;  1M4G A;  2FE7 A;  2P6G A;  1XEB A;  1NSL A;  2QIR A;  4KOY A;  1Q2C A;  4F0Y A;  5KTC A;  1Z4R A;  2HV2 A;  2VQY A;  3R95 A;  1KZF A;  1S7K A;  2ARH A;  4H6U A;  2BL1 A;  3S6K A;  1QSN A;  3W6X A;  4AVB A;  5ISV A;  5IV0 A;  1OZP A;  1S7L A;  4XPD C;  4XPL A;  2DXQ A;  4ZBG A;  1VKC A;  3QB8 A;  4CS0 B;  4ORF A;  4AG7 A;  5EBV A;  3PZJ A;  1YVO A;  4L89 A;  2FT0 A;  4LUA A;  2Z11 A;  3TO7 A;  4HNX B;  2GAN A;  3EFA A;  1WWZ A;  1CJW A;  2R98 A;  1N71 A;  1QSM A;  2A4N A;  2ATR A;  4CAV A;  1QSO A;  5DWN A;  2AE6 A;  3FBU A;  3BLN A;  4PK2 A;  2Z10 A;  3I3G A;  3TO6 A;  2J8M A;  2REE A;  4ONU A;  4CRY B;  3K9U A;  3DDD A;  1P0H A;  4Y49 B;  4KOX A;  3T9Y A;  3TCV A;  2I00 A;  2JDD A;  3TE4 A;  2GIV A;  3G3S A;  4KLW A;  4R9M A;  5J8C A;  4JWP A;  4KOS A;  2B3V A;  4M85 A;  1YX0 A;  2OZU A;  5KTA A;  5I0C A;  1QST A;  2BEI A;  4GS4 A;  1TIQ A;  2FS5 A;  2D4P A;  1VHS A;  1CM0 A;  3D8P A;  3BJ7 A;  1IYL A;  1IIC A;  1S7N A;  1M4I A;  4II9 A;  4JXR A;  1Q2Y A;  4M3S A;  3JVN A;  5FVJ A;  4JJX A;  4XNH B;  4RI1 A;  3MGD A;  3FXT A;  2Q4Y A;  2R8V A;  2KCW A;  2JLM A;  2D4O A;  2H5M A;  4NXY A;  2ZW5 A;  4MHD A;  4CAX A;  4JD6 A;  2Q7B A;  1LRZ A;  4KOT A;  4JLY A;  4AB7 A;  1I12 A;  4K30 A;  3SXN A;  3CXQ A;  4UBR A;  3W91 A;  2EVN A;  2O28 A;  4KOW A;  4Y49 C;  2G0B A;  2CNM A;  3R1K A;  1UFH A;  4FD7 A;  2B58 A;  4AVA A;  2RC4 A;  5C88 A;  3FB3 A;  4R3L A;  4QC6 A;  4YGO A;  3C26 A;  5F48 A; 
#chains in the Genus database with same CATH topology
 2BOA A;  3SI1 A;  5E96 A;  5K8P A;  4OID A;  3TO9 A;  1F57 A;  2V8V A;  2B5G A;  2CY2 A;  2I79 A;  2QEC A;  3HUV A;  3NFZ A;  4DNC A;  3EY5 A;  4FD6 A;  2FXF A;  2C6G A;  4X2T A;  2FVG A;  4MHY A;  1Z8W A;  1LAP A;  2AFX A;  4KVO E;  4DUK A;  3IO1 A;  4CAW A;  3E0K A;  2HUZ A;  1Z5R A;  5IB9 A;  1QSR A;  2GU2 A;  3BHX A;  2QYV A;  1CBX A;  3KR4 A;  2PJB A;  3FH4 A;  4YWY A;  3GYA A;  4CYQ A;  5JPH A;  3B35 A;  2AJ6 A;  1XFO A;  2C6P A;  4CGO A;  4UWI A;  1ZG9 A;  2HC9 A;  3KHX A;  3S9L A;  4B5P A;  4UEE A;  2IMO A;  5AG6 A;  5HMN A;  3IWG A;  3TFY A;  3IEH A;  4XPD B;  1NMT A;  2PQ8 A;  1S60 A;  2Q4V A;  1XF8 A;  2ZW4 A;  4PXB A;  1FY7 A;  1LOK A;  2YGW A;  4PXE A;  4KVM E;  4A32 A;  4OC1 A;  2JEV A;  3T8W A;  1HDQ A;  2G9D A;  3B3S A;  3H8E A;  1QQ9 A;  3H8F A;  4UIA A;  1BOB A;  1Q2D A;  2B3U A;  2NSM A;  2VEZ A;  3H4Q A;  2QML A;  4HKF A;  3BI1 A;  4R87 A;  1U6M A;  5EC4 A;  3D67 A;  2FCK A;  3TOB A;  2ZEL A;  1OBR A;  4TNU A;  3D68 A;  4UEZ A;  4ZY0 A;  1Z9U A;  4IUS A;  2ZW6 A;  3BXM A;  2OOT A;  4ZX8 A;  3I9S A;  3SJX A;  4JXQ A;  3D7G A;  1VIX A;  2PSW A;  1ZLI A;  5CNP A;  4MHN A;  3JUW A;  2QJ8 A;  3TTH A;  3UY5 A;  2B4B A;  1ZLH A;  2CNS A;  2Z3P A;  4OC5 A;  1A2Z A;  4NGS A;  4B14 A;  1RO5 A;  3DLJ A;  2CTC A;  4IK2 A;  4MRI A;  1MJ9 A;  2CNT A;  3R9F A;  2V77 A;  3GB0 A;  4NGQ A;  3NE7 A;  4P44 A;  2AFZ A;  3FRM A;  2PR1 A;  4H89 A;  3KQZ A;  4OAD A;  4QUS A;  2BSW A;  2HQY A;  1PU9 A;  3FYN A;  4MFL A;  4MXU A;  2OZG A;  2J8R A;  5AG4 A;  2P6E A;  1ELM P;  4I49 A;  5G21 A;  2F8H A;  1Z8X A;  3EO4 A;  5CBM A;  3KI9 A;  3QAH A;  2ZEN A;  3LMS A;  2I3C A;  3SJE A;  4OC2 A;  4B6Z A;  5A28 A;  4MCQ A;  1P4N A;  4F9V A;  1IY7 A;  1M4D A;  3EXN A;  4P10 A;  5LYD A;  3V7Z A;  4EWT A;  1CPS A;  1L0C A;  2P0W A;  4UEF A;  4OC3 A;  2Q43 A;  1V0C A;  3VWE A;  4CAF A;  3P2F A;  4MI4 A;  1XOV A;  4LQG A;  1S5K A;  2NMT A;  1IYK A;  4MY0 A;  4OP4 A;  3PEI A;  1XMT A;  3FIX A;  2PJ4 A;  4CRZ B;  2V8H A;  7CPA A;  3WAB A;  3WC7 A;  4CPA A;  1JWQ A;  3ZZI A;  2X7B A;  4UFW A;  1M1D A;  2WPW A;  1YLO A;  4NGR A;  4R3K A;  4XNH C;  3B8G A;  4MFP A;  5KTD A;  2Q0Y A;  3IU1 A;  2Z3K A;  3FVL A;  3ISX A;  1F2O A;  1XRY A;  2B4D B;  3FMC A;  5C82 A;  4KLV A;  2JDC A;  3S9M A;  2FIA A;  1R57 A;  2WPX A;  5IX3 A;  3TT2 A;  2EUI A;  2ZOF A;  1ZG8 A;  4IHM A;  1HDU A;  1TF8 A;  2O53 A;  3B3W A;  4UCN A;  4YFJ A;  4MMO A;  4PK3 A;  3F8K A;  1YVK A;  2V8D A;  3FED A;  1NE9 A;  4NCZ A;  4KUA A;  2PIY A;  4YU9 A;  5DS0 A;  2ZW7 A;  2ZEE A;  2VZZ A;  3FEC A;  2DPT A;  3G8W A;  4MBU A;  4OAE A;  3PBE A;  2G3A A;  3D3S A;  3BJ8 A;  4NEX A;  1IOI A;  1JQG A;  1SQH A;  4MY3 A;  2DPS A;  4A30 A;  2VBQ A;  1EE3 P;  4C2Y A;  4EVY A;  4AG9 A;  4M6I A;  1MJB A;  2GE3 A;  2IL4 A;  4NJQ A;  4O23 A;  2PDO A;  4UWJ A;  1Y9W A;  3LOD A;  3EC4 A;  3L2N A;  3R9E A;  4B13 A;  4R8F A;  2QVP A;  2ANP A;  4C2X A;  4KOV A;  3DNS A;  1I21 A;  1YGH A;  2CF4 A;  3SI0 A;  4QBJ A;  4DJL A;  2VZY A;  3S6H A;  4BIN A;  1YRE A;  2PC1 A;  4Q36 A;  5HVG A;  3IGR A;  3OWC A;  1TKJ A;  1IID A;  5AG5 A;  2CIJ A;  2C27 A;  4BBH A;  4MCP A;  4BD9 A;  3DR6 A;  4FWU A;  2ZXV A;  3KGQ A;  3RZA A;  3PB6 X;  3WC5 A;  4P45 A;  4DYO A;  3R9G A;  2R1I A;  1WK4 A;  5H84 A;  2YNC A;  1K4J A;  4UA3 A;  4CGP A;  4H6Z A;  5F46 A;  3RNZ A;  5ELY A;  2ZEO A;  4R6T A;  5LRK A;  1IB1 E;  4E2A A;  1LAM A;  4KUB A;  4F6A A;  3K2K A;  3R96 A;  3D2M A;  4NGM A;  2PJ5 A;  2AFW A;  4HNY B;  5HVH A;  1RXT A;  2B5G B;  2JEW A;  2JBJ A;  5AG7 A;  1S7F A;  2BUE A;  4XPK A;  5GCN A;  4FUU A;  3RYO A;  3DR8 A;  2Q4Z A;  3F5B A;  1IU8 A;  3FEE A;  5LYF A;  4UFV A;  2PJ0 A;  4KOR A;  3TX8 A;  2EK9 A;  4MFZ A;  1B87 A;  1YR0 A;  3B3V A;  1LFW A;  2FIW A;  4JYW A;  4PV6 A;  4UCP A;  4ZX9 A;  2AFS A;  4A33 A;  4A95 A;  1TXR A;  3S6G A;  3TOA A;  1NSA A;  4KS9 A;  2AFO A;  5DWM A;  1KUY A;  2ZEH A;  1UWY A;  5D29 A;  3S6F A;  1YLE A;  3FF3 A;  3ISZ A;  4L8A A;  2FL4 A;  4E8O A;  1BAV A;  3ZJ0 A;  3PB4 X;  5LYI A;  1GHE A;  2PRB A;  1XBU A;  3DSB A;  1Y0Y A;  2OU2 A;  5G1Z A;  4MJ8 A;  2P6F A;  4OC0 A;  4R76 A;  5F09 A;  1J4J A;  4MFK A;  2WYR A;  1YQE A;  3WT4 A;  4MFJ A;  2RB7 A;  2K5T A;  3F0A A;  5JQ4 A;  3WC6 A;  1M44 A;  3N7Z A;  1AYE A;  3B2Y A;  2XEI A;  1ON0 A;  4Q7A A;  2AFU A;  4RN7 A;  5EMI A;  3B3T A;  2Y0M A;  3FJU A;  3NE8 A;  2J8N A;  3GY9 A;  5AGE A;  4A94 A;  2EWB A;  2Q44 A;  2Q04 A;  3V38 A;  2VXK A;  4B12 A;  1CP7 A;  4CGL A;  1M4L A;  1Y7R A;  2GLF A;  2PJ7 A;  2PJ1 A;  2OZH A;  2XEG A;  5JGF A;  4NSQ A;  3V8I A;  2IJZ A;  4PSW A;  3GUX A;  3PFE A;  1YW6 A;  4MFQ A;  5G20 A;  4U9Y A;  2FSR A;  5I4M A;  3P2H A;  1Q7L A;  4B5P B;  1CPX A;  2DEA A;  3I1U A;  3K9T A;  1MK4 A;  4G1P A;  3CXS A;  4KSA A;  2ZED A;  3KQX A;  3WR7 A;  2Z3L A;  2PR8 A;  3T90 A;  5F49 A;  4EME A;  1KUX A;  5K8M A;  1YK3 A;  3SHP A;  1HEE A;  2G3T A;  1XE4 A;  3SI2 A;  4LX9 A;  4PQA A;  3LD2 A;  3PBB A;  5H86 A;  2BO9 A;  3B3C A;  2OB0 A;  4E0A A;  3PP9 A;  5HVF A;  1Z8L A;  1I1D A;  3PB7 X;  3DGV A;  4FD5 A;  4P4E A;  1S3Z A;  3FNC A;  4IF5 A;  4R57 A;  3VWD A;  5J8F A;  4C68 A;  2R7H A;  4HNW B;  4IAV A;  2HB6 A;  1GYT A;  1FT7 A;  4P4F A;  4U9Z A;  1CP6 A;  3KKW A;  1YSJ A;  4NF1 A;  1TKH A;  4A38 A;  5IB0 A;  4GXH A;  2ZPA A;  1XIX A;  4X8I A;  1LAN A;  2F5I A;  4KVX A;  4FD4 A;  2B4D A;  1Y0R A;  3JRU A;  5F47 A;  4B10 A;  2REF A;  2WZN A;  2Z3O A;  4NFR A;  1CG2 A;  1MJA A;  8CPA A;  4NGT A;  2ZOG A;  2Q7S A;  5D8N A;  4ONW A;  4PSX A;  1PUA A;  3D2P A;  4QB9 A;  1ARM A;  5CPA A;  1Y9K A;  4OME A;  4B5O A;  5BWA B;  3VAT A;  5HH1 A;  4RS2 A;  3PGP A;  4PPZ A;  1BO4 A;  2WUU A;  2Z0Z A;  3GKR A;  5THW A;  2OH1 A;  2GLJ A;  3QNV A;  4CGN A;  4J3G A;  2ODF A;  3W6S A;  1KUV A;  1ZG7 A;  4QVT A;  2VI7 A;  4R7M A;  2BCO A;  4H2K A;  4BMH A;  4ZYQ A;  3SXO A;  4AVC A;  1Z4E A;  3SJG A;  4OLL A;  3PRT A;  2GRE A;  4F8Z A;  4KZT A;  3CXP A;  2V8G A;  3CZX A;  4X5K A;  1B6B A;  1F2P A;  4C7I A;  4CYN A;  4KOU A;  4YRH A;  3A9L A;  5LRJ A;  4U5Y A;  1M4G A;  2PRQ A;  2YND A;  2FE7 A;  2P6G A;  2GFQ A;  1AMP A;  1XEB A;  1NSL A;  4C2Z A;  2QIR A;  4WJB A;  1IOF A;  4KOY A;  2PVV A;  1Q2C A;  4PXD A;  4F0Y A;  5KTC A;  1Z4R A;  1Z2L A;  2HV2 A;  2VQY A;  2JBK A;  3R95 A;  1KZF A;  2VL1 A;  1S7K A;  2ARH A;  2O4H A;  3RAM A;  3H5Z A;  1DTD A;  2PJA A;  4H6U A;  2BL1 A;  3KAS A;  1QSN A;  3S6K A;  4EFD A;  3W6X A;  4AVB A;  5JM6 A;  5JH9 A;  3IIB A;  1Z8T A;  4Z65 A;  5ISV A;  2XEF A;  5IV0 A;  1R43 A;  3D4U A;  1LCP A;  4MCS A;  4W9Y A;  4HPS A;  1OZP A;  3NH4 A;  1S7L A;  1YME A;  2C6C A;  3LWU A;  4F0X A;  4XPD C;  1X12 A;  4XPL A;  4ZGY B;  2DXQ A;  4ZBG A;  5HXD A;  4OKO A;  1ARL A;  1VKC A;  3QB8 A;  1DE4 C;  2XEJ A;  4CS0 B;  2PJ6 A;  2AFM A;  1AUG A;  4ORF A;  3IFE A;  4AG7 A;  4ZY2 A;  5EBV A;  2ZEP A;  3CPX A;  4PXC A;  2ZEF A;  4KSF A;  3PZJ A;  1YVO A;  4GM5 A;  1KWM A;  4L89 A;  4MHP A;  4OC4 A;  3CDX A;  4P4D A;  2FT0 A;  4LUA A;  1ZO0 A;  2Z11 A;  4FAI A;  3TO7 A;  4HNX B;  2GAN A;  3KZW A;  3EFA A;  4UFX A;  3IWW A;  6CPA A;  1WWZ A;  3CPA A;  3SJF A;  1CJW A;  2Z3M A;  2R98 A;  3MRU A;  3NH8 A;  1N71 A;  4P4I A;  1QSM A;  4OIW A;  4KSI A;  2A4N A;  3VH9 A;  1BLL E;  2ATR A;  1YW4 A;  4P6Y A;  1QSO A;  4CAV A;  3NH5 A;  4WWV A;  4CYP A;  2ABZ A;  5DWN A;  1PCA A;  2PJ9 A;  2AE6 A;  3PB9 X;  3FBU A;  4CYO A;  3BLN A;  3MN8 A;  4PK2 A;  3TC8 A;  2Z10 A;  2CXA A;  1TF9 A;  4LQ6 A;  3I3G A;  4A37 A;  3TO6 A;  3D7F A;  3B7I A;  2PIZ A;  3VAR A;  5LRG A;  2J8M A;  1TKF A;  5G22 A;  4A31 A;  2REE A;  4JZ0 A;  4ONU A;  4M6G A;  3PB8 X;  4CRY B;  3K9U A;  4X3R A;  1VHO A;  4Q38 A;  3DDD A;  2EO8 A;  4UCM A;  4F9U A;  1P0H A;  1Y7E A;  1VGY A;  4Y49 B;  4KOX A;  2YNE A;  5K8O A;  1XMB A;  2ZEG A;  3T9Y A;  3TCV A;  4AXV A;  2NYQ A;  2I00 A;  2JDD A;  2YNC C;  2Z3N A;  2ZEM A;  3FX6 A;  3TE4 A;  2PJ2 A;  4NGP A;  5LYL A;  2GIV A;  3G3S A;  4KLW A;  4R9M A;  1RTQ A;  2DF5 A;  2OR4 A;  3NA6 A;  2RFH A;  4K3N A;  5J8C A;  4NGN A;  3QAY A;  4JWP A;  4TWE A;  1BPM A;  1IGB A;  1R3N A;  4KOS A;  1ELL P;  4MCR A;  2B3V A;  4M85 A;  3IJ3 A;  3GLJ A;  1BPN A;  3S9N A;  4CGM A;  1YX0 A;  2OZU A;  5KTA A;  5I0C A;  4M6H A;  1QST A;  1VHE A;  2BEI A;  4GS4 A;  2EK8 A;  1TIQ A;  2PJ8 A;  3KL9 A;  2FS5 A;  2D4P A;  1VHS A;  3KHZ A;  1CM0 A;  2PVW A;  4RUH A;  2F7V A;  3D8P A;  3BJ7 A;  1IYL A;  1IIC A;  1S7N A;  5J1Q A;  1M4I A;  4UF4 A;  3D7D A;  2EBJ A;  4UIB A;  3KR5 A;  3RO0 A;  4II9 A;  3JTK A;  4JXR A;  1CX8 A;  1Q2Y A;  4M3S A;  3JVN A;  5FVJ A;  4JJX A;  4XNH B;  4P4B A;  4RI1 A;  2CTB A;  3FXT A;  2PJC A;  2Q4Y A;  3MGD A;  3PFO A;  4C7H A;  3HLP A;  2R8V A;  2KCW A;  2JLM A;  4ZI6 A;  2D4O A;  2PE3 A;  2H5M A;  4NXY A;  2PJ3 A;  2IQ6 A;  2ZW5 A;  3IWE A;  4MHD A;  4CAX A;  3CT9 A;  4JD6 A;  4A39 A;  1QMU A;  4P4J A;  1LRZ A;  4KOT A;  4NJR A;  4JLY A;  2Q7B A;  1FNO A;  3IU2 A;  1PYT B;  1I12 A;  4AB7 A;  4K30 A;  5K8N A;  3SXN A;  3CXQ A;  4UBR A;  3W91 A;  4MHZ A;  2EVN A;  2J9A A;  3D7H A;  2O28 A;  2Q51 A;  1X10 A;  3LAC A;  3RBU A;  3BI0 A;  4CAE A;  3IC1 A;  4KOW A;  4Y49 C;  2G0B A;  2CNM A;  2PCU A;  5A27 A;  3R1K A;  1UFH A;  1XJO A;  1H8L A;  2WSA A;  3D66 A;  4FD7 A;  2B58 A;  3N5F A;  4AVA A;  4A2Z A;  2RC4 A;  5C88 A;  3FB3 A;  4R3L A;  2C1C A;  4QC6 A;  3GIU A;  2POK A;  4YGO A;  3C26 A;  4ZY1 A;  3H8G A;  5F48 A;  4B11 A;  4FBE A; 
#chains in the Genus database with same CATH homology
 5E96 A;  3TO9 A;  2B5G A;  2CY2 A;  2I79 A;  2QEC A;  4DNC A;  3EY5 A;  4FD6 A;  2FXF A;  4KVO E;  4CAW A;  3E0K A;  2HUZ A;  1QSR A;  3GYA A;  4CYQ A;  5JPH A;  2AJ6 A;  4CGO A;  4UWI A;  4B5P A;  5AG6 A;  5HMN A;  3IWG A;  3TFY A;  4XPD B;  1NMT A;  2PQ8 A;  1S60 A;  2Q4V A;  1XF8 A;  2ZW4 A;  1FY7 A;  2YGW A;  4KVM E;  4A32 A;  2JEV A;  1BOB A;  1Q2D A;  2B3U A;  2VEZ A;  3H4Q A;  4R87 A;  2QML A;  4HKF A;  5EC4 A;  1U6M A;  3TOB A;  2FCK A;  1Z9U A;  4IUS A;  2ZW6 A;  3I9S A;  4JXQ A;  2PSW A;  5CNP A;  3JUW A;  3TTH A;  3UY5 A;  2B4B A;  2CNS A;  2Z3P A;  4B14 A;  1RO5 A;  1MJ9 A;  2CNT A;  3R9F A;  3NE7 A;  3FRM A;  2PR1 A;  4H89 A;  4OAD A;  4QUS A;  4MFL A;  2BSW A;  1PU9 A;  2HQY A;  3FYN A;  2OZG A;  2J8R A;  5AG4 A;  2P6E A;  4I49 A;  5G21 A;  3EO4 A;  3QAH A;  5A28 A;  1P4N A;  1M4D A;  3EXN A;  1L0C A;  2P0W A;  1V0C A;  3VWE A;  4CAF A;  3P2F A;  4MI4 A;  1S5K A;  2NMT A;  1IYK A;  4MY0 A;  1XMT A;  3FIX A;  4CRZ B;  3ZZI A;  2X7B A;  4UFW A;  1M1D A;  2WPW A;  4XNH C;  4R3K A;  3B8G A;  4MFP A;  5KTD A;  2Q0Y A;  3IU1 A;  2Z3K A;  2B4D B;  5C82 A;  4KLV A;  2JDC A;  2FIA A;  1R57 A;  2WPX A;  5IX3 A;  3TT2 A;  2EUI A;  4YFJ A;  4UCN A;  4PK3 A;  3F8K A;  1YVK A;  4NCZ A;  1NE9 A;  4KUA A;  2ZW7 A;  2VZZ A;  3G8W A;  2DPT A;  4OAE A;  4MBU A;  2G3A A;  3D3S A;  3BJ8 A;  4NEX A;  1SQH A;  4MY3 A;  2DPS A;  4A30 A;  2VBQ A;  4C2Y A;  4EVY A;  4AG9 A;  1MJB A;  2GE3 A;  2IL4 A;  2PDO A;  4UWJ A;  1Y9W A;  3LOD A;  3EC4 A;  3R9E A;  4B13 A;  4C2X A;  4KOV A;  3DNS A;  1I21 A;  1YGH A;  4QBJ A;  2VZY A;  3S6H A;  1YRE A;  2PC1 A;  4Q36 A;  3IGR A;  3OWC A;  1IID A;  5AG5 A;  2C27 A;  4BBH A;  3DR6 A;  2ZXV A;  3R9G A;  2R1I A;  1WK4 A;  5H84 A;  2YNC A;  1K4J A;  4UA3 A;  4CGP A;  4H6Z A;  5F46 A;  1IB1 E;  4E2A A;  4KUB A;  4F6A A;  3R96 A;  3D2M A;  4HNY B;  1RXT A;  2B5G B;  5AG7 A;  5GCN A;  1S7F A;  2BUE A;  4XPK A;  3RYO A;  3DR8 A;  3F5B A;  4UFV A;  4KOR A;  4MFZ A;  1B87 A;  1YR0 A;  2FIW A;  4UCP A;  4PV6 A;  4A33 A;  4A95 A;  3S6G A;  3TOA A;  4KS9 A;  5DWM A;  1KUY A;  3S6F A;  1YLE A;  4L8A A;  2FL4 A;  4E8O A;  3ZJ0 A;  1GHE A;  2PRB A;  3DSB A;  2OU2 A;  5G1Z A;  4MJ8 A;  2P6F A;  1J4J A;  4MFK A;  4MFJ A;  2K5T A;  3F0A A;  5JQ4 A;  1M44 A;  3N7Z A;  1ON0 A;  2Y0M A;  2J8N A;  3GY9 A;  5AGE A;  2Q04 A;  2Q44 A;  2VXK A;  4B12 A;  4CGL A;  1Y7R A;  2OZH A;  4NSQ A;  3V8I A;  4PSW A;  4MFQ A;  5G20 A;  4U9Y A;  2FSR A;  3P2H A;  4B5P B;  1MK4 A;  4KSA A;  3CXS A;  3WR7 A;  2Z3L A;  2PR8 A;  3T90 A;  5F49 A;  1KUX A;  1YK3 A;  3SHP A;  2G3T A;  1XE4 A;  4LX9 A;  3LD2 A;  5H86 A;  2OB0 A;  4E0A A;  3PP9 A;  1I1D A;  4FD5 A;  1S3Z A;  3FNC A;  4IF5 A;  4R57 A;  3VWD A;  5J8F A;  4C68 A;  2R7H A;  4HNW B;  4U9Z A;  3KKW A;  4NF1 A;  5IB0 A;  2ZPA A;  1XIX A;  2F5I A;  4KVX A;  4FD4 A;  2B4D A;  5F47 A;  4B10 A;  2REF A;  2Z3O A;  1MJA A;  4PSX A;  1PUA A;  3D2P A;  4QB9 A;  1Y9K A;  4B5O A;  5BWA B;  5HH1 A;  4RS2 A;  3PGP A;  1BO4 A;  2WUU A;  2Z0Z A;  3GKR A;  2OH1 A;  4CGN A;  4J3G A;  3W6S A;  1KUV A;  4QVT A;  2VI7 A;  4BMH A;  3SXO A;  4AVC A;  1Z4E A;  4OLL A;  4KZT A;  3CXP A;  4X5K A;  1B6B A;  4C7I A;  4CYN A;  4KOU A;  4YRH A;  3A9L A;  4U5Y A;  1M4G A;  2YND A;  2FE7 A;  2P6G A;  1XEB A;  1NSL A;  4C2Z A;  2QIR A;  4KOY A;  1Q2C A;  4F0Y A;  5KTC A;  1Z4R A;  2HV2 A;  2VQY A;  3R95 A;  1KZF A;  1S7K A;  2ARH A;  3H5Z A;  4H6U A;  2BL1 A;  3S6K A;  1QSN A;  3W6X A;  4AVB A;  5ISV A;  5IV0 A;  1OZP A;  1S7L A;  4F0X A;  4XPD C;  4XPL A;  4ZGY B;  2DXQ A;  4ZBG A;  1VKC A;  3QB8 A;  4CS0 B;  4ORF A;  4AG7 A;  5EBV A;  4KSF A;  3PZJ A;  1YVO A;  4L89 A;  2FT0 A;  4LUA A;  1ZO0 A;  2Z11 A;  3TO7 A;  4HNX B;  2GAN A;  3EFA A;  4UFX A;  1WWZ A;  1CJW A;  2Z3M A;  2R98 A;  1N71 A;  1QSM A;  2A4N A;  2ATR A;  4CAV A;  1QSO A;  4CYP A;  5DWN A;  2AE6 A;  3FBU A;  4CYO A;  3BLN A;  4PK2 A;  2Z10 A;  2CXA A;  3I3G A;  3TO6 A;  2J8M A;  5G22 A;  4A31 A;  2REE A;  4ONU A;  4CRY B;  3K9U A;  4Q38 A;  3DDD A;  4UCM A;  1P0H A;  4Y49 B;  4KOX A;  2YNE A;  3T9Y A;  3TCV A;  2I00 A;  2JDD A;  2YNC C;  2Z3N A;  3TE4 A;  2GIV A;  3G3S A;  4KLW A;  4R9M A;  5J8C A;  4JWP A;  4KOS A;  2B3V A;  4M85 A;  4CGM A;  1YX0 A;  2OZU A;  5KTA A;  5I0C A;  1QST A;  2BEI A;  4GS4 A;  1TIQ A;  2FS5 A;  2D4P A;  1VHS A;  1CM0 A;  3D8P A;  3BJ7 A;  1IYL A;  1IIC A;  1S7N A;  1M4I A;  4II9 A;  3JTK A;  4JXR A;  1Q2Y A;  4M3S A;  3JVN A;  5FVJ A;  4JJX A;  4XNH B;  4RI1 A;  3MGD A;  3FXT A;  2Q4Y A;  4C7H A;  2R8V A;  2KCW A;  2JLM A;  2D4O A;  2H5M A;  4NXY A;  2ZW5 A;  3IWE A;  4MHD A;  4CAX A;  4JD6 A;  2Q7B A;  1LRZ A;  4KOT A;  4JLY A;  4AB7 A;  3IU2 A;  1I12 A;  4K30 A;  3SXN A;  3CXQ A;  4UBR A;  3W91 A;  2EVN A;  2O28 A;  4CAE A;  4KOW A;  4Y49 C;  2G0B A;  2CNM A;  5A27 A;  3R1K A;  1UFH A;  2WSA A;  4FD7 A;  2B58 A;  4AVA A;  4A2Z A;  2RC4 A;  5C88 A;  3FB3 A;  4R3L A;  4QC6 A;  4YGO A;  3C26 A;  5F48 A;  4B11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...