3IFEA

1.55 angstrom resolution crystal structure of peptidase t (pept-1) from bacillus anthracis str. 'ames ancestor'.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
416
structure length
416
Chain Sequence
b'YFQSNAMKEELIERFTRYVKIDTQSNEDSHTVPTTPGQIEFGKLLVEELKEVGLTEVTMDDNGYVMATLPANTDKDVPVIGFLAHLDTATDFTGKNVKPQIHENFDGNAITLNEELNIVLTPEQFPELPSYKGHTIITTDGTTLLGADDKAGLTEIMVAMNYLIHNPQIKHGKIRVAFTPDEEIGRGPAHFDVEAFGASFAYMMDGGPLGGLEYESFNAAGAKLTFNGTNTHPGTAKNKMRNATKLAMEFNGHLPVEEAPEYTEGYEGFYHLLSLNGDVEQSKAYYIIRDFDRKNFEARKNTIENIVKQMQEKYGQDAVVLEMNDQYYNMLEKIEPVREIVDIAYEAMKSLNIEPNIHPIRGGTDGSQLSYMGLPTPNIFTGGENYHGKFEYVSVDVMEKAVQVIIEIARRFEEQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase T
publication title 1.55 Angstrom Resolution Crystal Structure of Peptidase T (pepT-1) from Bacillus anthracis str. 'Ames Ancestor'.
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 145
structure length 416
sequence length 416
ec nomenclature ec 3.4.11.4: Tripeptide aminopeptidase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ifeA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ifeA01
2I3CA 2XEIA 4WWVA 3PFOA 5LRGA 3K2KA 2C6PA 3CPXA 5JGFA 5I4MA 3GLJA 3I1UA 3T8WA 4WJBA 1BPNA 3TX8A 3CT9A 4OC3A 1F2OA 3DGVA 5CPAA 1CPXA 3QNVA 2CTCA 2WZNA 3NA6A 5LRKA 4H2KA 4OP4A 7CPAA 1R43A 3NH8A 1PCAA 3IJ3A 2ZEPA 1YW6A 3MRUA 3VARA 8CPAA 4PQAA 3WT4A 1ARLA 3KQZA 1CP6A 3FMCA 3SJEA 4Q7AA 4YWYA 5JM6A 4OC1A 4IHMA 3ISXA 2RFHA 4NGSA 3WC7A 4ONWA 5HXDA 5K8OA 3ISZA 3IEHA 2ZEOA 3S9LA 5JH9A 3PBEA 3S9NA 3RBUA 4ZX8A 2PJ2A 1VHEA 2PVVA 1BPMA 5LRJA 2HB6A 2ZEMA 2POKA 2Q51A 1UWYA 1TKHA 2IQ6A 4P6YA 4P10A 1IGBA 4P44A 1VGYA 3IWWA 4PXCA 1PYTB 4Z65A 1ARMA 2BOAA 3WC6A 2PVWA 2ZEEA 4X3RA 1Z8LA 1LAMA 2FVGA 4NJQA 2WYRA 3D7HA 4G1PA 1HDQA 2PIYA 2AFUA 2PJ8A 1LANA 4MCRA 4LQGA 4MHYA 4IAVA 1LOKA 3SJGA 4P45A 3PB8X 4R6TA 4F9UA 5CBMA 1BAVA 4TNUA 4YU9A 3LWUA 4OIDA 1AYEA 3PBBA 3B2YA 2ZOFA 2XEFA 4NGTA 1ZG7A 2IJZA 1NSAA 5LYIA 1YLOA 3GB0A 4NGQA 2PJ3A 1TKFA 5D29A 4MRIA 3DLJA 1FT7A 2BCOA 3NH4A 1BLLE 4NJRA 2V8HA 2PJBA 2O53A 5LYLA 6CPAA 3NH5A 2PJ4A 3PB9X 4UIAA 2RB7A 3S9MA 5LYFA 1XMBA 4PXDA 3VH9A 2NSMA 1HEEA 3HUVA 3IC1A 1CX8A 5K8MA 2OOTA 1ZG9A 4NGPA 2EK8A 3BXMA 3D7DA 2JBJA 3H8GA 3D7FA 2AFOA 1TF8A 4KSIA 2OR4A 1Z5RA 3D7GA 2ZEHA 2ANPA 3FEDA 4FUUA 3WC5A 4P4JA 1ZLHA 4FBEA 1R3NA 2VL1A 4GM5A 4P4IA 3KGQA 4BD9A 3BI0A 1VHOA 3SJXA 4ZY0A 4OC4A 2C1CA 2PJ9A 3FECA 4A94A 3PFEA 2PJ0A 1HDUA 1DTDA 4ZY2A 1ZG8A 2V77A 1IY7A 2ZELA 2V8GA 4X8IA 1KWMA 2GREA 5THWA 1ELMP 2ZOGA 4MHNA 4PPZA 4MCPA 2AFXA 2ZEDA 1Y7EA 4MCSA 1H8LA 3NFZA 4K3NA 4X2TA 4P4DA 3GUXA 4MCQA 1M4LA 3PB6X 4OC2A 4AXVA 2PJ6A 1GYTA 4UIBA 4JYWA 2EWBA 4MMOA 3JRUA 1FNOA 4ZY1A 2CTBA 1ZLIA 4NGRA 3B3SA 1AMPA 3LMSA 1YSJA 4TWEA 4OIWA 2QJ8A 3FX6A 3B3VA 2ZEFA 1JQGA 2Q43A 2C6CA 2ZENA 3KR5A 4DUKA 2XEJA 4NGMA 1XJOA 5HVGA 3FJUA 1ELLP 1TF9A 3D4UA 3SI2A 5ELYA 3CPAA 3WABA 4OMEA 1Q7LA 2ZEGA 3SJFA 3N5FA 3B35A 4A37A 2V8VA 2PCUA 4NFRA 2QYVA 4P4FA 4EWTA 2JEWA 2O4HA 4CPAA 4EMEA 1YW4A 4A38A 5D8NA 4RUHA 4UEEA 2V8DA 1CP7A 3KHXA 3K9TA 1TXRA 4W9YA 3FF3A 1F57A 1OBRA 2PJAA 2C6GA 3SI0A 4R8FA 4R7MA 4OC5A 1LAPA 3FEEA 4OKOA 3VATA 1F2PA 3HLPA 2PJ5A 1CBXA 4MXUA 4F9VA 3IIBA 4R76A 1XRYA 4ZYQA 3D68A 2AFZA 3V38A 1Y0RA 5K8PA 3B7IA 2XEGA 2GLFA 2AFSA 4DYOA 5IB9A 2BO9A 3BHXA 2NYQA 4EFDA 3KZWA 4DJLA 3PB7X 2GLJA 5HVHA 4UEZA 5K8NA 3FVLA 2HC9A 3TC8A 4NGNA 4UF4A 3H8FA 2PIZA 2F8HA 2J9AA 3B3CA 2DEAA 2AFWA 2JBKA 2EK9A 1LFWA 1YMEA 3V7ZA 3L2NA 2ABZA 2CIJA 1CG2A 4JZ0A 4P4BA 5LYDA 2Q4ZA 1QMUA 2PJ7A 1XFOA 3KHZA 3D66A 3KL9A 1QQ9A 3RZAA 4PXBA 4ZI6A 1EE3P 3BI1A 3CDXA 4MHZA 4OC0A 5F09A 3H8EA 4F8ZA 3KR4A 1Z2LA 1LCPA 4P4EA 4ZX9A 3IO1A 3B3TA 3B3WA 1DE4C 4B6ZA 2AFMA 3KASA 3D67A 2F7VA 3MN8A 4FWUA 5J1QA 3FH4A 3KI9A 2CF4A 3SI1A 3PB4X 3RAMA 4IK2A 1XBUA 5DS0A 1CPSA 1Y0YA 1RTQA 2PRQA 3PEIA 3PRTA 4FAIA 2G9DA 2GU2A 4UEFA 2PJ1A 2IMOA 3IFEA 1TKJA 1VIXA 4PXEA 4A39A 2PE3A 2PJCA 3KQXA 5HVFA 2QVPA 4MHPA 4O23A
chains in the Genus database with same CATH superfamily
2ZEJA 5G4DA 3HM9A 3GIJA 2H5IB 2QIFA 2YNFA 1ELOA 3RBXA 2I5JA 2RQCA 2DR5A 1U6FA 1WJ9A 2FS5A 5I0CA 1EIYB 4RI1A 1WF1A 3S6KA 5LSRA 4H6UA 5C25A 4WWSA 2CJXB 2YKQA 1U2FA 2BJ9A 4UTGA 1NSPA 2O67A 1OY6A 1CJUB 2W25A 2VF3A 3W5ZA 1U1MA 2V68A 2HVEA 1T94A 2LEBA 2D74B 3FMCA 1T9VA 3QFHA 2IFXA 3R3TA 5J2NA 4I2PA 2DPTA 1HW8A 3N4WA 1ZM9A 4C7HA 3KNAA 3KLIA 1E6YB 1RT2A 4PSWA 3AOCA 2R8KA 4U7UK 3RYLA 4KC5A 3KG4A 1X4HA 3EUNA 4C3LA 5HP1A 3DOLA 2W2NP 3T3FA 2UXBJ 5FLXY 3WC0A 5KOXA 3CSKA 4B9MA 1NE9A 3G6YA 1VLOA 1JLQB 2G2YA 1VGYA 2HQ3A 1ZOTA 1JLCB 3LWLA 1KLMB 4UOGA 4CYOA 4A8YA 4FXDA 4X3RA 3CCVS 3PNIA 3MAAA 1KQFB 1GAOA 3HFKA 2IAJA 1Q53A 4F6AA 4FYVB 2XHWA 5AT1B 2PJ8A 1RTZA 1LANA 2CQIA 3KLGA 1J5OA 3LWUA 4OIDA 4NRTA 5IM0B 2VC1A 4LF6F 1RT1A 3DHXA 1UEVA 2OSQA 2CQDA 2MSSA 1F60B 2XB2D 2QLXA 4X62J 4ALZA 2B43A 3SEOA 1U7LA 3NGUA 1S77D 1DQ8A 3GYNA 2B4UA 4AYBD 3FK4A 4F25A 1Z2ZA 1URRA 2LEAA 2QGFB 1YBAA 1CX8A 5IXUA 5AE1A 3MR2A 4MFKA 4ZOSA 2HLUA 3BXMA 3CJKB 4JI7F 3ZTRA 1GMWD 4KY3A 1FEHA 2AFOA 1PYSB 4C9DA 2W9CA 2ZEHA 2ANPA 3SXNA 4DSIA 3TVYA 4ES1A 4GC6A 4C8YA 5KFHA 4WTOB 4DFMA 1OWXA 3OVAA 2ZW6A 4YRHA 3ZTSA 3MEGA 3AD8C 2CRLA 3M9OB 5E7OB 3CXQA 2V69A 1OPIA 1AUSL 2IJNA 1NJYA 3CJ0A 4MYTA 3KKFA 1RWVB 4X8IA 4O0IA 4NLQA 4MHDA 3LH2S 4DJBA 4J9NA 4MI4A 1ELMP 3NEKA 2E1PA 3G82A 1RT7A 1RTIB 2MQNA 1WWZA 3NFZA 4IUFA 4ZJQA 2Z58B 3KJFB 4KT0C 3E3XA 2KH9A 1GXTA 4Z7CA 3JRUA 2RDIA 1S12A 4Y49B 3LTOA 2LMIA 4U8YA 4G3IA 4KFBB 1X5PA 3LMSA 1S9EB 4I2QA 4NCBA 2DEIA 2XTJP 2FVSA 5A8RA 2UP1A 2ZENA 5B0GA 4USMA 3QWUA 1SL0A 1L3VA 2HVZA 2LA6A 4ECUA 4C3MA 1K9MT 1J2VA 2CG8A 1K47A 3CPAA 2BM0A 4WIQA 1NK8A 3B35A 4NYPA 3CIMA 4DV0J 3WHIA 1NNDA 2YX4A 1Y7PA 3Q2TC 4YMEA 2QZ8A 1QSLA 2YNIA 3HSDA 4ZITA 2NCKL 3MUMP 4KHMA 1RWKB 2JEIA 2A2CA 1ON0A 1HNXJ 2IJFA 2GMJA 2C6GA 2NS1B 3VV2B 3FEEA 4OL8A 1JXEA 1HKAA 4CLLA 4WPAA 1RT4A 1NPRA 2M0GB 3JVNA 5KFUA 3FXTA 3QT6A 1PYOB 3EZ5A 2GV1A 3FMBA 3SSRA 1Y0RA 2RF2B 5K9FA 1U09A 3IU1A 4M1KA 1AUDA 2LLZA 3C6UA 2OEJA 5A2QU 2VD3A 4XPCA 1VR6A 4P7VA 2OFGX 4MFBA 1CJWA 5DZ7A 4U9RA 3KJQB 4UEZA 2BQUA 4R8UB 2HQFA 1N6QA 4DI6A 2OIHA 2EUIA 3BQ0A 1EQ0A 2PRBA 2CPFA 1N32F 3NMRA 3GONA 3L2NA 3O8WA 2MLYA 1MLAA 1Y00A 2VJUA 1VKCA 4P4BA 4B12A 3GMGA 2AEFA 4LSNB 4Z37A 4MY3A 1FVSA 1IVZA 2OMLA 3PY8A 1DRZA 5E3AA 2KVIA 4H54A 3G86A 4ZLLA 5B0CA 3HO1A 3KR4A 3HD1A 2IDEA 4YS2A 1VS3A 4P4EA 1TL1B 1HNWJ 2W8LA 3F0NA 3D7SB 2HPUA 4DUTA 1IBKJ 2MQ8A 3AODA 2HEKA 2B4OA 4RW6A 4YR0A 1SH0A 3TAMA 4M8LA 4LF4J 4FWUA 1HWIA 1VBZA 3R5AA 4X66F 2HZCA 4CYQA 1IIDA 1RTQA 1GX6A 2WW4A 3IFEA 2CJKA 5A8KA 1X4BA 4AQYF 4P2XA 4ZPWR 2YWKA 3OR2B 2B6AA 1ZETA 4MHPA 2R7TA 3UCGA 3KUHA 1UWBA 2CQPA 5IFMA 2B5JB 4CLZA 4C2ZA 3BBBA 4GS4A 1P1TA 5A76A 2CQ0A 2XS2A 4TNOA 5BR8F 3RNZA 3OR1A 2Y1RI 2Z3OA 5E33A 2VI7A 1FWLA 3H5SA 4XNHB 4JI0J 2OSRA 3CMES 1DQ9A 3IJ3A 1BQMA 1JLEA 3CDUA 4A95A 2FTRA 4M5GA 1BGXT 3TW0A 1RTJB 2XY6A 4KKOB 1FK9B 3FIXA 4B11A 4Y2IA 1CJTB 3OL9A 5HAOA 1RT3B 3ISXA 1JWQA 2AU0A 5DRKA 3GYAA 2RU9A 2K1RA 3ADAC 2ZH6A 1NDLA 3HVTB 4RBVA 4DV2J 3SCKE 5EC4A 4MK9A 2I79A 4HHJA 2XGQA 1SUQB 1NK9A 2HW3A 4ZX8A 3MM9A 1NH7A 5KT2A 4DN0A 2IY5B 4ZN1A 1FRLA 1T9WA 5CA5A 2KO1A 1Q8LA 2QECA 3EJMA 1VOMA 3CPWR 3OL7A 1M90T 2XSJA 4P71A 2MQLA 2FVGA 3BDPA 1RT5B 3ZTQA 5D3GB 3EM1A 4ED2A 2JLFA 1R8CA 4P45A 4WYLA 2ZOFA 4OI6A 1HARA 2VQEJ 2ACYA 3LGMA 4X4RA 1OY9A 3M9MB 4A8FA 3GR1A 3MMAB 3C16A 1LWEA 2HBQB 1ZPWX 4DV3F 1KNZA 4RPFA 2HG4A 4ZPAA 4B9SA 1EETB 2BMBA 2HHPA 1CLFA 4XIUA 1IKVA 3IRWP 3CCLS 3KG1A 2QLBB 3SMZA 1UP1A 2R7XA 2Z3LA 4BHQA 5A8WB 4ED3A 4RBTA 3QT8A 2V4QA 3OFGA 4U6PA 4FP9A 4KSEB 5EWFA 1N36F 1U1QA 5KG7A 2D1CA 1S4FA 2GIFA 3DRYA 4ZY0A 3H0PA 3IAM9 1JJHA 1GMUA 2BL1A 4A94A 5F3ZA 1GMVA 3MUVP 3MOZA 2PEBA 2CG4A 3RYOA 4TQSA 1N52B 4ED1A 3Q86A 2DF5A 3JAMU 5DGAA 2UXCF 3B4MA 4ANCA 2ZM6F 1FJCA 1LXJA 3D28A 2J8AA 1N5SA 4K3NA 4AD6A 2ZH9A 1YBTA 4OADA 2MLXA 1S57A 2E1MC 3G4SS 1VRTA 1N5YB 1RHMB 5B0FA 1AMPA 4LF5J 2G1DA 4U9ZA 5JQ4A 2D3O1 1WEYA 4ID5B 3F5BA 4QIVA 3KR5A 2Q6BA 2AGOA 1RHRB 5HVGA 2UUBJ 3VQSA 3TO7A 2JEFA 1YJTA 4HT7A 4OMEA 4O3SA 1UMJA 3THTA 1NJXA 2RKIB 2D3ZA 3TVZA 4NFRA 4EMEA 3J7A1 5AE3A 3W62A 2N4CA 4CLYA 4RUHA 4AFFA 1HBNA 4EGLA 3C15A 2CNSA 4XAKA 1GFWB 4Y2KA 4FD5A 1U47A 3CB4A 3QGGA 3SSSA 1FEEA 2NYIA 1C1CB 1VHSA 4N5SA 2RS2A 1O5JA 5J2MB 2VZ9A 3ENVA 3Q22A 3GY9A 3NRBA 3PGPA 4BDPA 4B3TJ 2HGNA 4Q0BB 2LQ9A 2DISA 2ZD1B 1TQLA 3TQ1A 1ZA1B 5IOLA 2B58A 4G6VB 2VODA 4UQGA 4USJC 1GK8A 2CNMA 2F5GA 4GKJF 3MGJA 2PA8D 3TNVA 4NI2B 2ZJQQ 1AXQA 3TWZA 4CO5A 3FVLA 4YFJA 3DSBA 3AD9C 2H1YA 3HVRA 4RR5A 4NGNA 3QNWB 1VISA 2BW2A 2P6TA 3I0SB 4B3OB 5IT9Y 4F26A 2RS8A 3JQKA 1VQOS 4C8LA 2CNKB 4NCZA 1SKRA 4OYZA 1S7KA 4PRFA 4P72A 2FIAA 1NBEB 3VZIA 5GADU 4L8AA 2ODFA 4CO1A 2AX1A 4DU7A 2PSWA 4ANEA 4F8ZA 4F2RA 4HTJA 3T1YJ 1HWKA 2HHVA 1QE1A 4OZ0A 1TKDA 3EMTA 2YNDA 4CLKA 3EVMA 3CF5Q 5AJ3J 2X7IA 3T5KA 4O3QA 4WTYA 5B0BA 1X5TA 1CEZA 2BA9A 1VC5A 2L9WA 4ZIVA 3MEDB 4XPDC 4F67A 3GJRB 2X1AA 5BYSA 2ZH2A 4UZCA 1FNMA 1RDRA 4OFZA 1VJWA 5ISVA 4LF2A 5AG5A 1FD2A 3E8OA 1FX2A 4LFCJ 5HL7Q 4P74A 3CJRA 3U1NA 4K5RA 2FSRA 3QNVA 1SV5B 5AXMA 1X12A 3UD4P 2PC6A 2XGPA 4EEYA 3VARA 4TQRA 4DQQA 4PQAA 2EO8A 2AGPA 1QSRA 2VFSA 3LWMA 2OD4A 3LPEA 2L9NA 3GCWP 3ZZIA 1CP6A 1CC8A 3OWCA 3OUYB 4P2SA 3ENAA 1HQUB 3TP2A 3K7RA 3D0IE 2VBQA 4OYOA 3GYGA 2BE2B 4CZCA 3IN5A 2GZOA 2VBZA 5K8OA 2MY7A 2BANB 4OYXA 2CQCA 3PJ9A 1AB8A 2VIHA 2CZ9A 5HMNA 3CCES 2PDAA 4OLPA 3D6MB 2XCAA 2PVVA 2RUSA 4KGKA 2VOOA 1Z8WA 3POTB 5DQHA 3KLHA 3B82A 3BO3A 5E3RA 4LBPA 1TV6A 2BUNA 1S7HA 3PXGa 1S1VB 2DR9A 3VGTA 4OYPA 3WC6A 4ECYA 2IDLA 1LFPA 3FNCA 2HRYA 1KHVA 4OHYA 3ET6A 5C7PA 2ZH4A 5DG7A 2DT9A 1X4AA 1UVNA 2XI3A 2MXYA 3KLFA 3SHPA 5T7LB 2IL4A 4ZN3A 1WKLA 3B78A 2DHXA 3C6TB 2KXFA 2YNCA 5CNPA 4FPRA 4P2MA 4ZP9A 1VJQA 2QSFA 4U9YA 1U1NA 2O53A 4I4BA 3W64A 3GIKA 2J8NA 2DD8S 5J2PB 3ULHA 4CO3A 4NZ6A 2Y8YA 3U1MA 1UZDA 1HI0P 3TYTA 3JTPA 2LECA 2NZ4A 3DU6A 1YRUA 2VICA 3TI0A 4ED4A 3VF0B 2FJDB 2WB4A 2J0QD 3SDEA 2B3VA 4IR1A 4DR7F 2DXQA 2RQKA 1EARA 3PJXA 3KGQA 3NXZA 3QB8A 1XR5A 1N5QA 4IOAQ 1MWZA 4B3SJ 5FDLA 1YLEA 3TOAA 3ZZRA 2IA6A 1JMTA 3UI3A 1K73T 1S6PA 1IY7A 3PRVA 4OZ1A 5GAHU 3NS5A 3ZZYA 3M30B 1U25A 2IHR1 5SUHA 5CCLA 3A3NB 4C7IA 1VQ8S 2XWYA 2AHOB 3TT2A 4IO1A 5KFZA 3GV7B 2YNFB 5GMKa 3PX0A 4AXVA 2I5JB 4DPXA 3MFHA 3R95A 4NX9A 1K1QA 4PSXA 2PR1A 3LOUA 1X9MA 3B3SA 2JL9A 1WSRA 3W5YA 1JQGA 2Q43A 1PG5B 3C14B 2XEJA 1UWAA 1XMQJ 2J9DE 4DR1J 1S9GB 2JNJA 4CO0A 1U2CA 2Z3PA 5J2NB 3E01A 4I2PB 4N77A 2GW8A 3KLIB 2J6TA 4ZDNA 4UBRA 1RT2B 2HVHA 1C0UA 4WE1A 1NKBA 2OFHX 1U45A 3S6EA 3RG6A 2O4HA 4CPAA 3M6WA 2V34A 1N8RT 2CY2A 4WZMA 4TY8A 2CIMA 1C1BB 1MJAA 4KHRA 4W9YA 4LF9J 3PP9A 4ZJOA 4GXHA 1Q5YA 2V67A 3TQEA 2G0BA 2I9SA 5DG8A 3IS9B 3D0HE 5U47A 3O5TB 1F2PA 4JUZA 4HACA 2H5MA 1CBXA 5FVJA 4UFXA 4F9VA 4OZ3A 3MAAB 5LMUJ 4CNZA 2IAJB 5E41A 1ULRA 4DEZA 2ERRA 2MZ1A 1XOVA 4OLOA 1J5OB 2MKHA 1RAEB 2M8DB 2F4VJ 2KYZA 4DSFA 3H90A 3J7YI 4N7TA 1BMQB 4KGZB 4ZPDA 4X4QA 4MT1A 2ZHOA 2A1BA 1XN9A 2GX8A 4ZVSB 4PG7A 4FVCA 4WP8A 2EW9A 2Y0SD 3VAFA 4LQ9A 3LF0A 1WI6A 1YRTA 4IRCA 3ILJA 2EK9A 1YMEA 5D77A 4L76A 1K8AT 1KUYA 1FY7A 1S6UA 1HBUB 1XFOA 3V6KA 4DX5A 3WC2A 3H7HB 2DNHA 1QSNA 4C0BA 5F09A 1KS2A 3RTVA 3QGPA 4HI2A 2X1GA 4RNHA 3PR4A 3W3SA 3V81B 3B3WA 3D6HB 3SXLA 2PO4A 3EPIA 3J7AN 4CAXA 1FFWB 3BLNA 4M6GA 5MAOA 4NEXA 4URGA 4R3LA 1XNQF 2Q0YA 3G82B 3DLLQ 1RT7B 1KRPA 3HSJA 2B4BA 1SC3B 1VIXA 5A0YA 2H5EA 2IYIA 7FDRA 4CWBA 2QVPA 2HMIA 1VQ4S 1X7VA 2VHGA 2XEIA 2AJ6A 2W4PA 5LRGA 3K2KA 3M05A 1YJRA 2CNLB 1BPNA 5KFIA 4ATNA 1VQPS 5A8RB 4CLSA 1B7FA 2HQDA 4OHVA 4OX9F 1X5SA 1NHVA 2NMTA 3AQOA 3KKWA 5MLCV 3RR8A 2WPXA 1HNVB 4RUCA 4KGVB 4F04B 2DVIA 2JEJA 3KMQA 2DH7A 3AH6A 4DUZJ 5B09A 4NGSA 5GMEA 1LW0A 1HYSB 1TL7A 2VPXB 3ISZA 1Q7YT 5JH9A 4FD7A 4I68A 3HX9A 1S48A 2PT0A 4J5OA 2VDIA 5HN0A 4UFWA 1RHJB 1YTYA 1UWYA 3A8KA 3MCNA 3OHBA 4P6YA 4OHWA 3M1VA 2OH2A 4CRZB 3R1KA 1TIQA 2I38A 2H4WB 2J0XA 2JWNA 1IJFB 5HMWA 2GFQA 1UL3A 3F44A 1LAMA 1RB0A 5F9LA 4Y0FA 4QCLA 3IR6B 3BPDA 4B3MF 4CYUB 3C6UB 5HQMA 3J81j 2IJRA 3VGUA 4WK1A 3A8JA 5CBMA 3BSNA 4YU9A 3AD7C 3HKWA 3ZZOA 4DL0C 4C98A 3D9BA 1WEZA 4C97A 1TL5A 1Q2CA 3FJ2A 4R5PB 2R7SA 3PDNA 2ZH3A 4KUBA 3W6SA 1T02A 1KKHA 2GCFA 3OSNA 1S1XA 5ETKA 5D4PA 3HUVA 3DNSA 3NCPA 4IQMA 3H8GA 1DJ0A 4Q38A 2QA1A 4ILMA 4DSEA 4PWWA 2MLZA 2UZAA 2MZTA 3PZJA 2F5IA 2DGWA 1QLNA 3PKYA 2ADCA 2QEXS 3KHHA 4RW6B 2UUCF 3JS9A 4F4AA 2KM8B 5GADI 1ZPVA 1TKTB 1X4FA 1FWKA 4X65F 4MKAA 1IN0A 2VKRA 2R9LA 3N9UC 4I69A 5KFEA 1MWYA 4JV5J 2J0WA 4MK8A 5CYMA 2F8EX 2YKMA 1YG0A 5L46A 5KG6A 1XMOF 5T41A 2B6AB 4C8MA 4BC9A 3RB3A 1UWBB 2KFNA 4K7QA 5KFXA 3BS9A 1S97A 4TXSA 1N34F 1DAXA 3OR1B 5C5JA 1FNOA 1C4CA 2RDDA 1KOOA 1TZ0A 2PN6A 1D0EA 3VTIA 2ZBIA 3IAS9 3TUZC 2CPYA 2C6CA 2ZE2B 1XTZA 1JLEB 3MEKA 3WX4A 4FYXB 1I3OB 1T3OA 1PBUA 4JB8B 3EVWA 1S5KA 3JSMB 4F2SA 2MDAA 4UOCA 1VQNS 1JNZB 2L9DA 1NJZA 2HVDA 3QIPB 5IX3A 4HKQA 2ZEGA 3UD5A 4WFXA 4GC7A 3I9SA 3M32A 1XQIA 2K1RB 1RHKB 4PUOB 5KTDA 4ONUA 1U1OA 1IBLJ 4RW8A 1UJ5A 1TK0A 1Y5IB 4B10A 3MM9B 4UWIA 4LT6A 5BYQA 2ZW4A 5KFRA 2HNDA 2OD6A 2DKOB 4MJ8A 3V4MA 2HGMA 2IM3A 1LAPA 2WB1D 4FKXA 2W9AA 2UUTA 1DTQA 4YB5A 2HURA 2CFXA 1R8HA 3BB5A 2C2MB 3CCZA 4IRDA 1RWMB 2W7OA 3PW4A 2ASDA 3SBMA 2LQJA 4CI0B 3B8HA 5JVGQ 1SH2A 2JSXA 2OZGA 3EVOA 4OZLA 1UFHA 4K8RA 1H0HB 3NOGA 3MDFA 5C42A 3PO5A 1SJFA 4LUBA 4ED8A 4V1Ak 1LWEB 4EFDA 4DJLA 4M6IA 2EBEA 3LA0A 4DCJB 4CCHA 3DMJA 3JAMY 3HF5A 4ZCLA 3UE2A 1QM9A 1Q82T 3K9UA 2MKKA 2W4DA 2I0XA 5CHCB 2IVFB 1IKVB 2F8HA 5L1JA 2J9AA 3BSCA 2DEAA 3GKRA 5ETMA 4Y34A 3CCTA 3CIZA 2M3DA 4LVNP 3CJTA 3PZPA 3PO4A 4GO7X 1CG2A 3KMSA 2CPEA 4E98A 3D66A 2F40A 3TARA 5HJXA 3I6PA 2ZBCA 4KOUA 4EZ6A 4YY3J 3BGOP 3UNYA 3Q23A 3M2VB 1CJKA 2IMWP 1HBOA 4ZLPA 4P52A 1JB0C 5AXLA 3B8GA 3CD5A 2YNGA 4BCAA 3D5MA 5KFMA 3DNCA 3BJYA 1ZAWA 3CJ4A 2UXBF 3PEIA 2GJ2A 2G9DA 2C2RA 2GU2A 4Y49C 3TOQA 1M4IA 3HLUA 1URNA 1AZSB 2G2OA 3UR3C 1PIEA 3M6VA 2LP4A 3PFOA 2B7BB 2H5JB 1CULA 1VRTB 1YVKA 5I4MA 4ECXA 1VHFA 3TA2A 2R3VA 3BR8A 3CWJA 4F8RA 1S1TA 3R6LB 4YP3A 8CPAA 1PAUB 1RHUB 1SQEA 4NLVA 1IKXA 2JDCA 3FEZA 3QJJA 4NLSA 5BJRA 4IOBA 3NCRA 3E2EA 5LL6d 2ZVSA 9RUBA 3NOCA 2H51B 2B5GB 4JI4F 1ZZFA 1AFIA 4TU7A 2R2SA 3C15B 4NMLA 2HYIB 3S9NA 1YJ7A 4EMDA 3ENQA 4NCGA 3OT9A 1S99A 1NCLA 1ICEB 1D09B 3DDNA 3HVAA 4LRCA 4NLXA 2XMKA 4X2BA 1A2ZA 1DLOA 1T0TV 1KDNA 4HKFA 1TU0B 2YQ0A 3OTOJ 2W4CA 1KD1T 5F47A 4KVOE 1YLXA 4LFAJ 1WACA 2PIYA 4RU2A 1AFJA 4DR4J 3P2HA 3S6HA 1FE0A 4KH0B 1OY8A 3UDLA 4NLTA 5LXYA 5LYIA 3UDEA 3W2WB 2Z8QA 1UFWA 3K0JA 2QG9B 2DH8A 2ZW7A 4MFZA 2H3EB 3T6JA 5KFBA 4J9UE 2F9JA 1PU9A 2Z4PA 2V8HA 2PJ4A 4O4GA 3T9YA 2R1IA 3VH9A 1RAHB 2BEIA 3SSQA 1Y4ZB 4RKUC 1BQNA 4M85A 3FCHA 2VG7A 5K20B 1KQGB 3D7FA 3MFIA 3PV8A 4JLYA 1H2TZ 4WP9A 3DDDA 4DR2F 3P8BB 2VH7A 3QYYA 2AYMA 4ZP7A 2LXIA 1R3NA 2DO4A 3FZ2A 1QE1B 1IM4A 2PA3A 4WF9Q 4MFPA 1JLGA 2JDJA 1UTAA 3DOKA 4BWMA 4KOSA 2QT7A 5A27A 1F5BA 4YGOA 1M5KC 1FKOA 3AAWB 3BR9A 2V77A 3CMAS 2ZELA 4R25A 1HNXF 4AUKA 2DBBA 1U1KA 3K5PA 3IM8A 4LR8A 1TKXA 2WBMA 3TA0A 1KSPA 4B9TA 1YVOA 2VPWB 4C4WA 1M4DA 4XNHC 4WCEQ 4C2YA 1UW9A 4ECRA 3E51A 4PG5A 4C2XA 1E6VA 4MMOA 2XLKA 2FGCA 2UU9J 4UOHA 3HZGA 1U49A 3L7UA 3B3VA 1QY7A 2GE3A 5LSOA 3RAXA 4H4OB 2HZVA 1DY3A 1QVGR 5KFNA 2J0SD 2QLFB 3PYGA 2ZVIA 4F0MA 1TP7A 5ELYA 1S1WA 2OPRB 2FLPA 5L1LA 3QMQA 1FXRA 5DM7Q 4NEYA 4OX8A 2YWGA 1S7IA 4ZCKA 1DURA 2PCUA 3G6VA 2DGUA 3UVJA 2HK3A 5CYQA 3K58A 1GHEA 2R98A 4FS1A 1F9HA 1SKWA 4FS2A 3MZIA 3FQLA 1O51A 2PJAA 4EYHB 4MKYA 2MJUA 5T14A 2ZJPQ 1HNIB 3ZZPA 2JLGA 3HLPA 4N56A 2OEMA 1R31A 4OYMA 3HD2A 2BM1A 4LBIA 4R76A 2Z11A 4CAWA 4MKBA 1XMTA 1N5VA 2REFA 3DYAA 1RTHA 2FQQB 5KFQA 2AP6A 3CZXA 2GLJA 3UN3A 4KPCA 1PGZA 2MTLA 4FDFA 2QA4G 2WPWA 3PR5B 3UFCX 3TOBA 1FERA 3QT7A 4NZ0A 2CZ4A 3U7JA 2C3UA 2HHSA 1S0MA 2CYYA 5KG4A 3PX4A 4EUVA 1SJQA 2HFZA 3G3SA 2OPSB 2QL9B 2Q4ZA 5IC4B 3KHZA 3HHKA 2BSWA 3KL9A 5EBVA 1WG5A 1WI8A 4PXBA 5D4NA 3PG9A 1FHTA 3LAMA 2CZVC 1WG1A 3DRSB 2V6AA 3KUGA 5HO4A 4FBTA 1FKAF 5FDLB 3UDCA 4E2FB 2FJVA 2JRSA 1TL3A 5KT3A 1XEZA 1ZO0A 2BJEA 4DBQA 4KO0A 2R8IA 4ANDA 3HJFA 4LRFA 2CF4A 4HHHA 2VFUA 3I31A 4NYOA 1EJ7L 3G71S 1FXLA 3VWDA 2YWFA 1VYAA 2XYGB 2HVIA 3NGRA 4WFYA 3RAQA 1KTVA 4S0MA 1REGX 4X4TA 2KB2A 4DS4A 3P96A 3NS6A 4EO6A 1H7XA 2R8VA 4USIA 3DGVA 3L09A 5GMDA 3HDSA 1J4JA 2FJBB 2ZEPA 4RW7A 4YHHF 2VQEF 1A7GE 3CDWA 1N4LA 4CRYB 3E01B 3CD6S 4QPTA 1HL6A 2CNNB 1YZ7A 1UZHA 3FSIA 1C0UB 1CC7A 2OO4A 2XYPB 4UQTA 2P2CB 4IHMA 1ZYQA 2C2KB 1J5EF 1RJJA 4HYKA 3Q8PB 4UW2A 3KK1B 4LFBF 2HGLA 2G0IA 5ETPA 2PJ2A 3G2XA 2DXFA 2B8QA 2OJ3A 4DV1F 3BV8A 4JYAJ 4LF1A 2B9WA 2JVRA 4Q8FA 2KG0A 3QZ7A 2XWXA 4AL6A 5KFDA 5H86A 3FRYA 1FI4A 1S1UA 4NZ7A 1NEEA 2AMCB 2DIUA 4IH5A 2MEWA 4MHYA 2ZZTA 3SJGA 3KUEA 3CW2C 1U1LA 2BJ8A 4Y6IA 3DOMA 4OX6A 1S3ZA 5D8HB 4YR2A 3G8TA 4XO0A 3MCOA 4U7CA 2HBYB 2CAJA 4KOYA 4PG6A 4O44B 2BABA 4U8VA 1EP4A 5KFGA 2HBRB 3QT5A 3MTJA 5HJYA 4RN7A 2UVUA 2E66A 1IUJA 2WSEC 1O0PA 1T95A 3OTCA 3GR0A 1GT8A 3G8SA 3HHLA 3JB9k 1TF8A 3V6JA 3KJVB 1S10A 1ZAXA 1HBMA 3P45B 1MJ9A 1U4BA 2UUBF 1FJGJ 3P2FA 1ZLHA 2XS7A 2A6MA 1IR2A 2GHVC 3ETMA 4WKRA 4M5DB 5HBMB 2BQ3A 3R5CA 1BLUA 5LMNF 1NH8A 1WEXA 4IG3A 4Q45A 1SJ1A 2PJ9A 1SKUB 2F3JA 1FCAA 3N6MA 5KFPA 4NLWA 4Q36A 3G6XA 3TR5A 3VGSA 2LU2A 1IJEB 4B3RF 2VA2A 3KLVA 2HRUA 3T90A 1VBYA 5F0WA 3MUTP 2ZNYA 2KVQE 1T05A 2GREA 1R0AA 2V2KA 3DLGA 1K44A 1K0TA 3TO8A 3MR3A 3R7BB 4ZMMA 3PEHA 2HLTA 2HMIB 5CXTA 1SB6A 1RP5A 4AVAA 4LSLA 4IDKB 1L5UA 3GFHA 1NLKL 4B3TF 4MTPA 2RMLA 2QSWA 4XPEA 2C2DA 1VQ9S 4DX6A 1D9DA 1WC3A 4ZY1A 3LP2A 3PX6A 2JC1A 1S76D 1ZTWA 4NGMA 5LJ5Y 1R8AA 4UUWA 1FA0A 4DU8A 3D4UA 4A8OA 2REEA 2E7VA 2QYGA 2XBPA 2GANA 3WABA 1Q7LA 3NGTA 4OAEA 2NZCA 3DGPA 4A37A 4DS5A 3K8WA 4DX8H 1Q86T 2W2QP 2CJQA 4CT8A 3N28A 1V3SA 5J8CA 3RBZA 3ZO7A 4MIWA 4K4XA 3K57A 4MFJA 2FJAB 4ZVOB 3BF4A 4H89A 1XNRF 4NLDA 5C2GA 3MMBB 2B9XA 4R8FA 1Y7RA 3QLHA 4QYRA 1T7PA 3MPYA 2CNOB 4Z2XA 2HQYA 1QSOA 2EFPA 2RVJA 2AZ1A 2HIQA 1GMWA 2Q79A 4ED7A 3FBUA 2GLFA 3TAPA 4ZVEA 5GAGU 4X4UA 4LF6J 4WU3A 3GE9A 3M8QA 5E5NA 1XR6A 4OI3A 2XG8A 3NLCA 4LQ6A 1JXLA 2OH1A 4UF4A 5KFFA 2RQMA 2KJVA 1X9WA 2JBKA 2R7WA 5CYJA 2Y1JA 2MKCA 4A32A 3AFGA 1WUUA 1HWJA 3VQTA 4XK8C 4LFCF 5ETOA 3OHAA 2BXJA 2FZCB 5LYDA 5FIIA 1QMUA 2J8SA 1QQ9A 4DR5J 2Y0BB 3NNCA 3AOBA 2YNEA 1N0VC 1K4JA 4OYAA 3GIMA 4R0JA 3A3OB 3V6DA 2EBJA 3VWEA 1M1KT 3BBCA 3GJQB 1A9NB 1LKZA 5I3UA 3SI1A 4RW4A 2YNHA 4FAIA 4DV5J 4LF7F 2DR6A 2ZC4A 4CTAA 4PWDA 4DR3F 2LQBA 3N5BA 1WDDA 4L72B 4F36A 2CQBA 4ITSA 1RACB 2WSCC 2C6PA 1Z4EA 3MPVA 2Z3KA 5KFJA 3PYDA 3T19A 4OYIA 2QN6B 4FN5A 3TEGA 4I49A 4L73A 3LD2A 1FESA 5D78A 3BKTA 4RWXA 5LRKA 4H2KA 3I0RA 3GP9A 1U6BA 2DK2A 1YW6A 1WTFA 2YKNB 3BEGB 1F9FA 3FUYA 3KQZA 2DNLA 4I7FB 2M5YA 2VDHA 3OSPA 2V2VA 2BKOA 5ETRA 3M32B 3T1HJ 4KJIA 3JQJA 3SFGA 2RFHA 5SZTA 2QV6A 3WC7A 3KG0A 2OPPA 5KTQA 4HDHA 5KFTA 5H9FJ 2R8JA 5HK4A 2HHWA 1QTMA 2DCUB 2XC9A 2P5VA 4FD6A 2HNDB 2ZUAA 5KT4A 1UVKA 2D41A 4QC6A 4J3GA 3IA0A 3CCRS 1IBMJ 2OEKA 1DTQB 4O0NA 1IGBA 4P44A 1Y10A 1RBLA 1ZA2B 1KVJA 2HHUA 4KV8B 2QMLA 4LX9A 4AL7A 2G0JA 4B3SF 2BOAA 3AOAA 1H73A 2FUG9 5KG2A 4FF1A 1FTCA 3HVWA 4HLBA 1W2IA 1RAJA 2GMLA 4QWEA 4IRKA 5C42B 2ZWPA 1PBAA 1S59A 1Z8TA 2W1BA 3B2YA 2ACMA 1X60A 4OHXA 2MGZA 2HQIA 3DMJB 2PJ3A 2CXEA 3DU5A 3FSYA 5LM7E 4JOUA 3IWXA 3HULA 2FE7A 4ZP8A 2D3UA 2ZOMA 1Q8KA 2JFKA 3BJ8A 2C2OB 1KBRA 2ALZA 1BXNA 2AJ1A 1KTQA 3OJUA 5GCNA 3TJAA 4EBEA 3FBEA 3MECA 3DRPA 4KSIA 4C3KA 3LW5C 4DR1F 1TMMA 3FNNA 1WF2A 2B56A 4P4JA 3DM2A 1F6TA 1NDCA 3J7Z5 2WBRA 4Q5VA 1FRMA 1RYRA 2V2ZA 3CCSS 2NXNA 2FVRA 4E8OA 4RNMA 4BS2A 3TO6A 1KVIA 4DSJA 3G87A 1HDUA 4DF4A 2LFVA 3VAMA 4LF9F 3BO2A 4A46A 2E1CA 1JJCB 2JJ4D 4JI8J 4R9MA 3MMCA 2OAUA 2AFXA 2A2DA 2CKWA 1Y7EA 3H5UA 4ZVTB 2ROEA 4GRSA 2J8MA 2NPFA 3TUPA 4AQYJ 1CULB 2J9CA 3EDQB 3EGWB 3FZBA 2B9EA 4HEA9 5CAAA 3M8PA 5LMUF 3I5CA 2DNOA 2AJFE 2CTBA 4C0HA 8RUCA 1S1TB 2MQPA 5BR8J 4FF3A 2I1RA 1QAYA 5G1ZA 5FD1A 1A0OB 1P0HA 4LF8J 2HNZB 3FC9A 5B0DA 1IKXB 3L7PA 3JYTB 1NZ8A 4ZVQB 4PQUB 2RJZA 4JXQA 1RAFB 3IWNC 4M95A 5HMZA 1APSA 3QSIA 4A38A 4NXNF 3TVKA 1G4CA 1R8PA 4WYWA 2VJVA 3HFZB 1YJ9S 4JI1F 3EGVA 1U24A 4IFYB 1IICA 3FDSA 3AA9A 4NCAA 4RX6A 3SI0A 3FCVA 1DLOB 4KLVA 1KR4A 3NAIA 2V4JA 2UUAF 1SIZA 3K5MA 2LVWA 5K14B 3DDIA 3QGIA 6FD1A 3IMQJ 2CUYA 3IIBA 1XRYA 3CD7A 3J81U 2CQ3A 4MJKA 4CGMA 3GJSB 2BKPA 2HFVA 2U2FA 2AFSA 4P73A 4U5YA 2W2OP 1I1GA 3OLAA 1VRUA 1VK3A 2KZZA 3I55S 3GSIA 2K3KA 2XO7A 2OZUA 1Z8XA 4ICLA 2C2NA 1X10A 4OMFG 5M2RA 3P6YC 1HHTP 3MXHP 3U1LA 2GO8A 5J1PA 4Y00A 1NKEA 1BQNB 1LFWA 4PCQA 2IPOB 3C26A 1N5TA 7FD1A 3UNGC 5IT4A 2XHCA 4EBCA 2FGOA 2ZW5A 4ZLJA 3TZZA 2F65A 2AYBA 2ZKTA 4QW8A 3V4IA 3H8EA 2DNKA 4CGPA 1CJUA 1LCPA 4ZHRA 2BDPA 2VEZA 4FXVA 1N36J 3K8VA 3DOKB 4ZVHA 2Q7SA 4AXJA 2BJDA 3D67A 2PMHA 1E6YA 4RW9A 1U0HA 3RBDA 2HNYB 4M5IA 5B0EA 2Y1IA 1I21A 1Y0YA 4DL5A 2O3DA 2KTQA 3PEJA 2Z57B 2UXCJ 1IQZA 2DGXA 3RR7A 1FXDA 2ZM6J 2HQCA 2R7HA 2PE3A 4BLGA 4OIXA 1D9AA 1JLQA 4C8ZA 4PK2A 2UXDJ 4WWVA 2MJNA 1RCXB 3BN7A 1E6VB 4TYAA 3CPXA 1WD6A 1IKYA 2SXLA 2CJ9A 2PFFB 1KLMA 1RXOB 4RNFA 4DV6F 1MW7A 5CPAA 2W8KA 4ETXA 2P8IA 4UUXA 1R43A 2XZWA 2A6OA 1S1WB 1ARLA 3CDEA 4I1TA 3F41A 4D3HA 3KTQA 2B4DA 3SXOA 4GKKF 5D0HA 2XO6A 4OC1A 4CH7A 1KN6A 4X64J 3RU0A 3Q0AA 1U0SA 4CAEA 2HSEB 4Y28C 5CYQB 1L3KA 2FHJA 4A47A 2HUZA 3I82A 2UVWA 3U02A 3S6FA 2O28A 4KLWA 2GIVA 2XLJA 4EI2A 2IQ6A 5ITHA 2COLA 1WHWA 1R0CB 2CPXA 4KSFA 4JV2A 4F0HA 4F4WA 3MAHA 4F0YA 3OL6A 4TVAB 3RRHA 2RRNA 1TAQA 3GILA 2QRRA 2BX6A 4DPWA 1NUEA 3IGVA 2OKQA 3DYAB 1YQEA 1RTHB 3B6BA 1FT8A 3D2PA 1RI7A 4BC7A 4ENOA 4AT1B 4GKJJ 4J9OA 1MMDA 3S1TA 2VONA 3E0KA 1OSCA 3NH4A 4ZA1A 2PJBA 3DLKA 3P4UB 1DTTB 2MHEA 4QIGA 3PB9X 1RTIA 1FD8A 4G1QA 5AE2A 3W2VA 3WIUA 4HI1A 9ATCB 1XMBA 3EDRB 4B5PA 4P7TA 1ZG9A 2G9OA 4RWWA 2CNTA 1RT6B 5AXKA 4OLLA 3V5RA 1S9EA 3OLBA 3WC5A 1HLWA 2QA2A 1V5VA 3M8ZA 3VAKA 4MH8A 1TL3B 3OW2R 5DG9A 1MK4A 3GQCA 2Q04A 1RA6A 1G2EA 3OTEA 1RAGB 5IB0A 1M5HA 2LQ5A 1IBLF 3SI8A 1HWUA 3Q8QB 1YJUA 2FVPA 1OYEA 1JLBA 5HQLA 3R7NB 1SQHA 3SQOP 2ZBRA 3LP1A 5JMNA 3R27A 4HR2A 4TY9A 4USUA 5CCMA 2FHMA 3K5LA 4OC2A 1GYTA 2EFNA 4H4MB 4QWAA 3OFFA 1QD1A 1G6BA 1ITPA 1SPBP 1HQEB 4KGXB 3H40A 2QMUB 1EKSA 5EWGA 2RF2A 3MM7B 1XJOA 5DDPC 3OTBA 4K2XA 1YRXA 5GAEU 3SI2A 1BUXA 2MQMA 4UY85 4L75A 1RWOB 5F9NA 1KFDA 5KFAA 1OYDA 4OI2A 3C46A 4FYWB 4FF4A 2MKYA 3CD0A 3KWMA 3TUJC 1N0UA 4R8UA 4NSQA 1MU2A 4KAIA 2GGPB 4UOFA 5AG4A 1U1RA 1TXRA 2WONB 4RUAA 2OTLS 5KFCA 5D4LA 3DI6B 3IBCB 1FRIA 3DLEB 4EU0A 2OMOA 2CADA 2QMXA 4EO8A 1IWAA 1RTDA 2DNPA 4NLOA 3VVTA 2GAGC 4L3NA 3R2DJ 1S6QB 4JI5F 1X0PA 2L48A 1S1UB 1TL1A 5EUHA 1CJVB 2UV8G 1P4NA 5HMXA 3B7IA 2BYCA 2MKIA 2BO9A 4GVLA 3CVKA 1NSLA 3KZWA 3VAHA 2ZBQA 1GXLA 1NSKL 3VHQA 5HVHA 1EP4B 2X3GA 5K8NA 2WK4A 2VFVA 2HC9A 4A8SA 3JSBA 2BW7A 1IR0A 2PIZA 2DNGA 3OR2A 2OELA 4NWBA 1S60A 3M8WA 1V6HA 4XPDB 1RO5A 3HHLB 2V9KA 1NDPA 1Y3JA 2B5JA 2NLWA 2EKNA 5ETQA 4N8NA 1S6OA 3K17A 3HXMA 1BD6A 1WKJA 4MHZA 2C42A 2IBKA 2XMJA 3ZNUA 2QFJA 1B64A 3NG8A 4C11A 5G0RA 1JWWA 1EAYC 3SCIE 2VU5A 3EYZA 2ZXVA 4WXWA 4DPOA 1S49A 1RT3A 1WDTA 3N7ZA 3FH4A 3GV5B 3CUNA 1T05B 4I6AA 1RXTA 4IK2A 4Q44A 4KVME 3MHYA 3HVTA 5DS0A 2WOMA 3O2IA 4RS2A 4AB7A 4UEFA 1SUQA 4P75A 2PJ1A 2RT3A 1JXVA 4LSLB 1UKUA 4G1IA 1PKUA 1T03A 4JI6J 4CNYA 4WFZA 3UCZP 2KL8A 3OTOF 2EXUA 2NYHA 3LP2B 3TX8A 3IG1A 2AD9A 4LFAF 4OC3A 5A6WA 1XWLA 2HWHA 2HFSA 2NQPA 4AG7A 1HA1A 3SV3A 4KQZA 2CTCA 2WZNA 2HHHF 4K2JA 3NA6A 1RT5A 1Q78A 4OP4A 2XULA 2V2QA 1OIAA 3NY0A 4ZVGA 3QPIA 5C24B 3BGFA 2K7KA 4B02A 2E5LF 2G1HA 2LXFA 3SJEA 2Y3YA 2ATRA 2KN4A 3DGPB 4Q7AA 3NBPA 4KIAA 5JM6A 2B3TB 3MMAA 1JKHA 1JLFA 5EMIA 3M2UB 3O44A 3QAHA 1XF8A 5AGEA 1LXNA 5E3QA 2VG5A 4QIFA 3L7OA 2NUHA 1WOOA 2HB6A 4ZJLA 3BYPA 4OV6A 2B3UA 3QLHB 1HHQA 2FJEB 1TKHA 2BBEA 5A8WA 1SIWB 5CZXA 1V5IB 3IRXA 3U27A 1Q95G 2B4PA 4BMHA 3LQVA 2MMYA 2QYCA 3PTWA 2WYRA 4G1PA 4DSKA 4DPUA 2AFUA 2JLMA 3PB8X 4A8KA 2DRBA 2DNMA 3M8QB 5KT5A 5CH7B 2MQOA 4O3OA 4CRJA 4QYZJ 3DLJA 2FYXA 3VGVA 5JUMA 1KUVA 1KHWA 2ARHA 3NH5A 4AL5A 3BREA 2MZRA 2RRAA 3H4QA 2HAFA 2HZAA 4ZCIA 2D3OR 1S0NA 5CABA 1R6VA 3RW7A 1HR0F 3UY5A 3FRZA 1YITS 3T5JA 4UY8T 4ID5A 2Q1LA 2RHQB 1B0TA 3WR7A 2VL1A 1V0CA 4P4IA 2KT5A 3V6DB 4J37A 3KK3B 4TU9A 1WK4A 4IR9A 3FECA 4YB1P 4QIWD 1NSQA 4JI3F 5HLFB 2IM0A 5I3UB 3ITHA 2V50A 3MPUB 2PJ0A 2RKIA 4RW4B 2YNHB 1TKZA 1NK4A 4C8OA 4ZY2A 1UEUA 2MKSA 3ZJ0A 3HI9A 5B0AA 4DV7J 3BGRB 1F5AA 3WX8A 1H3DA 3MTKA 4LSZB 5H9EK 4ELVA 2QTWA 1C1CA 3GUXA 4L6V3 4NOHA 4GVBA 2EFGA 2PJ6A 2DNZA 4Q0BA 4TWEA 2KJWA 1JK9B 2ZD1A 3I0RB 4XDDA 2FZKB 4X4NA 1FDBA 2W9BB 2EFOA 2FB0A 2ZZMA 3D2MA 3W5XA 5IWAF 4C6AA 1ELLP 2ZH1A 1L3TA 1LWFA 2LA4A 1S5ZA 3QIDA 1HI8A 1LNQA 2BOPA 1ZM2A 2Z0ZA 4WBFA 1H98A 2AEJA 2OPPB 1L3SA 4DXLA 5F8NA 4QBJA 3AA8A 4P4FA 2JEWA 4CLFA 3DDKA 3MCMA 2BACA 1YW4A 3VAJA 2ZH7A 1U8SA 1IOFA 1CP7A 3I0SA 1SXLA 2BJ7A 1NMEB 5JXSA 1IKWA 2V9WA 1F57A 1UAWA 5CD4H 3CC7S 1REVA 2KCWA 1RYSA 1RU2A 1KQKA 3EFAA 3BGLA 4N76A 4QWCA 1VQLS 3JQMA 5M2UA 4HH1A 2M4MA 1PYTA 5D0GA 1R89A 3SZ2A 3V2UC 4IUSA 1RQ0A 3BKUA 1ZM3A 4E0DA 2H4YB 3GJTB 4J9RA 1U26A 2MGZB 1D1UA 2NYQA 1NDKA 3PB7X 3JSRA 3VVUA 1JLAA 3MEDA 2FZGB 1RAAB 1L3UA 3LGNA 4OI4A 4QVTA 3H8FA 4CT9A 3MM8A 1PJ6A 1AW0A 3KNGA 2UVVA 4F7VA 3CO0P 3KK2B 3TTHA 2XS5A 3MECB 3DRPB 1NM2A 3EO4A 1LQ9A 1YX2A 1RUSA 2VBXA 3QO9A 2UUWA 4YB6A 4A8WA 2M8HA 3DM2B 4E2AA 2OI2A 1AROP 2KYXA 2HBZB 3R5DA 2NSBA 1W2BR 2KFYA 3D3SA 3ZZUA 2G3AA 2DGOA 1QSSA 1RK8A 4M63A 2GVDA 4B6ZA 1HPZA 4ECQA 1DQAA 2UUCJ 3FRMA 2QC3A 4M5LA 1NAQA 3KI9A 2AJ2A 1M5SA 4NLYA 8AT1B 3RAMA 4B13A 1XBUA 3TX0A 1BWEA 2O66A 4X65J 1CPSA 3MMCB 1BQXA 1UW4A 2XMUA 4JYAF 2R2RA 1XK8A 2Z10A 4DL4A 3R2CJ 3M8PB 2E44A 2ILZA 1OO0B 1TTHB 1N34J 1VQSA 5AG6A 1S1VA 1IYKA 5BYRA 2ILYA 2HAIA 3GIIA 1PC5A 1CPXA 4CYNA 2YH1A 7CPAA 3GSDA 2FCKA 3MPWA 3PYEA 3Q8UA 4IH6A 4U96A 3RJMB 5KG1A 1GEHA 2M2BA 2G13A 3KLEA 1SJ4P 2F1FA 4M5KA 3H5ZA 3C6TA 2GFFA 2DGSA 4ONWA 3R8YA 3IEHA 4C2MA 3FSXA 4DR6J 3PBEA 2FC8A 5F8HA 5J2PA 3CJ2A 2Z3MA 3Q8SB 4PKDB 3HKZD 2V4JB 1S7FA 4URSA 2VUGA 1Z9UA 1FJGF 5C25B 2CQ1A 4ETZA 4R3KA 2DHGA 2FIUA 1UCNA 1HDQA 2PFDA 3CCQS 1Z4UA 3OVSA 4JWPA 3HHDA 5DETA 4RO0A 1BAVA 4TNUA 2GQCA 4OJGA 1NPPA 4NGTA 2IJZA 2ZHBA 3T5LA 1H2UX 4ICLB 3EXNA 2IVMA 3UD3P 4DZDA 3HK2A 5JPHA 1XE4A 1RE1B 5HP1B 1OJ4A 3DOLB 5KFOA 2JEVA 2A3JA 2W7AA 2JHEA 1PSDA 3QAEA 3IXQA 2OOTA 1UVMA 1NKCA 3S7RA 3CTRA 2DY9A 5HI7A 1WC6A 3V4IB 3I56S 1WF0A 3C14A 3BBFA 4ZHRB 4JI2J 4FBEA 5J1NA 1NK5A 3BO4A 4GM5A 1S9GA 4J90A 4DFPA 3GTYX 4OC4A 2V4RA 4HH0A 2N7CA 4L74A 3KLGB 1BWVA 1QAXA 3ILLA 4CLPA 5IT0A 1UVLA 2D4OA 2M52A 3QSYB 2AZ3A 3QAYA 1RISA 1RT1B 4RW9B 1U0HB 3R7SB 4ZVPB 2DPJA 3H25A 4IYQA 3JTNA 2FC9A 3SQGA 1DTDA 3N6NA 3R9GA 2LQ8A 4V19X 3FBFA 5THWA 1C1BA 2ZOGA 2VOPA 3PW7A 1OMSA 1KVKA 4O4RA 4MCSA 4KVXA 1H8LA 1FRKA 3RO0A 2BKNA 2K06A 4B9NA 3THPA 4MCQA 1IKYB 1M4LA 1H74A 2DIVA 1YZ6A 3IS9A 1Y9WA 4KZTA 1CM0A 3GWCA 2ADBA 1P9YA 4YDDB 2QA4S 4MFLA 2W9CB 5J8FA 4WIIA 2ZEFA 4EVYA 2GQ2A 1Q5VA 4FZVA 2YWHA 4FNIA 3DXBA 3Q8VA 4DHVA 1WTBA 1TF9A 3GFXA 2B4DB 2B4VA 4KR0B 1UFLA 3MEGB 1AT1B 2GO9A 2E1AA 5A6PA 2DR7A 2BV3A 3D0GE 1Q4RA 1VHIA 1N33F 2XY5A 4JI4J 1TUVA 1NXIA 3LODA 3P5BP 2ZHAA 4J9PA 3S6GA 1ZH5A 5CD4A 2CPJA 4JV0A 1SL1A 3EZUA 4DR5F 3VATA 2M9KA 1HIYA 1HBUA 2JEGA 4BBYA 2NPIA 4IOCQ 2YKPA 2ATCB 2PD1A 2DO0A 4I2QB 1TUWA 5F41A 4M5HA 5DWMA 2E5HA 5GVQA 3D68A 1VQ5S 3V81A 1SL2A 4P2FA 3MPDA 4ZPBA 2XEGA 4DYOA 5IS2A 5IB9A 2C3MA 2AV5A 3I3GA 2HKEA 5A2QY 4DV5F 4FYDA 1Q8IA 4C48A 2ZDPA 3R9EA 3DLKB 1GXUA 1LV5A 4G1QB 3TC8A 3W2VB 3M8RA 2Q44A 2YNIB 3O1LA 4ORFA 4B5PB 2DJWA 1D3WA 1TELA 3T41A 2L41A 1C0TA 4WFNQ 4QOTA 3V7ZA 2GNKA 4DFKA 1WC0A 2F9DA 1P8GA 3CCMS 4R57A 1RT4B 1WHVA 3KFWX 2J7WA 2MY8A 3RB6A 1QSMA 1Z4RA 4IG0A 1T8EA 5I3PA 3LPYA 2Y8WA 3BGUA 4DR2J 4ELUA 3NMAA 2JVOA 3T1HF 3HSZA 1HNVA 4PABA 4F02A 3KASA 3W9JA 1Y0HA 4J9QA 1FRHA 3ZXWA 3NWRA 5E96A 2AIRB 4F0XA 5D0RA 1ACMB 4MFBB 2EC2A 3MF5A 3FGVA 1HYSA 1JLBB 3BQ1A 1T11A 3AQPA 1N6QB 3H8YA 1IBMF 3LP1B 2ZITA 3RUBL 4CP5A 5AG7A 1NRKA 2G4BA 2A10A 1NK7A 3OJSA 2XZTB 2RC4A 2EWHA 3T8WA 1EQMA 4TLQA 5DM6Q 1CSJA 2J76E 1QTNB 1WG4A 3A8IA 2A18A 1FKPA 4ZVUB 2XQCA 1M1DA 1H2VZ 4CYUA 4PG4A 4ED5A 1F1BB 3P3DA 1Q16B 1TFYA 3QRRA 2CDRB 3OXLA 2ZH5A 1C4AA 1X5OA 3TAMB 2ALYB 4KOXA 2HHQA 1MU2B 4R5PA 5HXDA 2AYGA 2DH9A 5IZHA 1Q79A 4MFQA 4NLPA 2PGCA 4M5MA 1M1GA 2AJ4A 5A8KB 1VHEA 3DCAA 2EI5A 4A31A 1P9QC 2ZEMA 3AT1B 3KHGA 1Q2YA 1G1XA 2QFIA 3W66A 4P10A 1RTDB 1Y11A 1U8WA 2FPHX 3DKDA 4CM0A 3EY5A 2R7VA 4NMXA 1Z8LA 4W92B 2IM1A 2D4PA 1I94J 3D6TB 3FBCA 4PWUA 2ZNZA 4MCRA 1BQMB 4KHPJ 4HDGA 5KFYA 4R6TA 4H4KC 4QR0A 1AYEA 2ZDOA 3OXGA 5FJ4A 1TKTA 2IYGA 1IBCB 2CQ4A 4JI8F 2E9TA 1TKFA 5D29A 2ABYA 4DV4J 4FBUA 2BE9B 3EZOA 1OZPA 3CXPA 4DMZA 3M9NB 3IM9A 4UIAA 5KTCA 3DR8A 2QL7B 4KS9A 3S9MA 3ONQA 4PXDA 2NSMA 4Z7YA 3BJ7A 2CPHA 5ETSA 2GJFA 2DEJA 5K8MA 4DLEA 1U2RA 2EG1A 3D7DA 2JBJA 6AT1B 4EBDA 4B9UA 4LF8F 5J1EA 3PIPQ 5DJBA 3D7GA 4LR7A 2XSJB 3BPSP 2AX0A 2EEYA 2ZE2A 2YBVA 2JFDA 2UVRA 1SKSA 3Q83A 4C11B 5G0RB 3GYXB 3KDOA 1KEKA 3JSMA 4LMZA 4NXMJ 2RU3A 3QIPA 4ZK7M 4LR9A 2A4NA 2X51A 3K89A 4PUOA 2VZZA 4DF8A 2WOMB 3C16B 2DB1A 1KWMA 4K0KF 4QPXA 1IQTA 4PPZA 3MMJA 4M6HA 1T9XA 3K59A 1RZMA 1T03B 4X2TA 2Z56B 3TUIC 3J7YU 4NE9C 5HROA 3IG1B 4JYWA 2J6UA 1HD1A 3PCOB 3GZ7A 4DPYA 4E0AA 3TZXA 2I2YA 1F0XA 2IC3A 4DL6A 1NJIT 1MG7A 2YWWA 1LK5A 1AUGA 2DXDA 4YHHJ 4OYWA 3NBPB 2OPQA 2B7CB 4KRWA 3OQ2A 1JKHB 1WOPA 1JLFB 2CPZA 5DLGA 2GC8A 2R8HA 2EK6A 2IA0A 2P6FA 4IQXA 2CJYB 2VASA 5D8NA 1J5EJ 4UEEA 3QAUA 5HATA 2V8DA 1I6JA 3QJLA 2VG5B 5DZ6A 3W91A 5C88A 1B70B 4LFBJ 2F63A 4ELTA 1M5OC 4LIRA 3PRBA 4B17A 1CS4A 4NA2A 4YOEA 3IRXB 1R0BG 4DV1J 2ZKUA 4J9VA 3BN4A 3NE7A 3W8GA 3W65A 3T6BA 2RNEA 4IKAA 5GAHI 2FVQA 2DNQA 4GO5X 4CAVA 2KDOA 1S7LA 2HS4A 2KRBA 4I6WA 5LSLA 2KKHA 3M2VA 2R4FA 5B08A 3BHXA 3L4BC 4UCPA 4X62F 4Y3CA 1J27A 1QDUB 2YX1A 1VC0A 2BJ3A 3QGHA 4XPLA 2KFZA 2DHSA 5E3PA 3R96A 3MEEA 1HBNB 3C2PA 2DRAA 1VI7A 2UXDF 1AZSA 4K4YA 2H9ZA 3R1HA 2X3DA 4DG1A 4CAFA 1LEOA 2W24A 2XYHB 3WZ0A 2U1AA 2YH0A 4C7QA 4URQU 4WFAQ 3LALA 4BINA 1H72C 4HL9A 5H1SV 2B9YA 1YR0A 4ZPTR 3AY0A 3GG1A 1FDNA 2KG1A 4X64F 4JD6A 5LMNJ 3ITHB 4TU8A 4TLRA 1TKZB 1LOUA 4IH7A 2B5GA 1P1LA 4B3RJ 3NNHA 3QBCA 3ELHA 2J5AA 1B6BA 2HQGA 2IMOA 1GTHA 3X3UA 3ISND 4A39A 5JVHQ 1RGVA 5G20A 4ZVRB 2DR8A 4GVBB 1D9FA 3TE4A 3B4DA 4PYAA 3A8EA 2X1FA 2NXUA 1LWCA 5KT7A 5ADZA 3HT3A 1VCTA 4KH1B 3H98A 3LO3A 1VDHA 3KHRA 4QWDA 2QMWA 1XIQA 3HHNB 1YBUA 2FHJD 3WDOA 5F3TA 1UJ4A 1LWFB 4CLTA 1M5PC 6FDRA 1VBKA 2AYEA 2FT0A 3VZHA 2Y0MA 3W2WA 4DV0F 1UETA 2LXUA 1TAUA 3VAIA 3MAQA 4RL1A 1YVFA 4CLUA 3S9LA 2FD2A 5E2QA 2ASYA 1IKWB 2GMHA 1KLNA 2AE6A 1KC8T 1XNRJ 1REVB 2FLNA 3A1YG 3PKMA 4X4VA 3AXMA 1RBOB 1HMVA 1B0PA 5EX0A 2WAQD 1PYTB 2CWKA 4KB7A 5I42A 4DLGA 2M70A 3LP0A 2D69A 4LQGA 2ZPAA 2CQ2A 2CPIA 2Q3PA 4NA3A 3AJ1A 3PBBA 2Y1LB 1V3ZA 3GB0A 3R5JB 1JLAB 1N88A 1N71A 4ZIWA 3BH6B 3HHLC 5D4OA 2BJ1A 4Q43A 4YQWA 4USTA 6CPAA 3S8SA 4F4YA 3K2YA 4Y2CA 3MM8B 3G8WA 1NB2A 2N4DA 2VQFJ 1FDAA 1RKJA 1SJ3P 3QO9B 5F8IA 1X4GA 4PYDA 3KLHB 1TV6B 4OJHA 2YXLA 1YK3A 1VQ7S 3NAHA 3ENWA 4H4OA 1FDDA 3TAQA 1HNWF 3QRPA 2GVDB 3CULA 3ET6B 3BI0A 1IBKF 3SJXA 5H9EJ 1HPZB 2ZFHA 2OPRA 3FKBA 4AVCA 3KLFB 3IGNA 4LF4F 4K4VA 3CJ5A 1LW2A 2Z2LA 2J7KA 2R7RA 2E7WA 4NLRA 4DUYJ 4B9VA 2AT1B 4J9MA 1FF2A 2E9ZA 3PW0A 4L89A 4UT4A 3M6UA 3QZ8A 2FJWA 4LF7J 4UZBA 2IVYA 4DR3J 1MN9A 4DZ6A 2Z3NA 1MROA 3CDAA 1X4EA 2F4FA 2XMAA 4IFVA 2XNRA 1ZTTA 1XJWB 1HNIA 4UIBA 2DRDA 2QLJB 1WOSA 3UCUP 2R7QA 3CC2S 4NGRA 5KFSA 2QJ8A 3FX6A 3SDEB 3ZNJ1 4JI0F 2OZHA 2DGTA 3UDVA 4M5JA 3G96A 3MD1A 4HPSA 3M4XA 3H2VE 1PUAA 2CQGA 4CO4A 4EYIB 1F2HA 3KLEB 1IM6A 3CDBA 3X1LB 3EWGA 5RUBA 4ZVFA 2NXJA 1RA7A 3C3LA 3H20A 3UQSA 1S0VA 1VQKS 2GAHC 1O6XA 4DV2F 1S6PB 3QATA 1Q0NA 4RLEA 4X4SA 1WNEA 1VRQC 3KHXA 4AG9A 3CEDA 2R7UA 3K9TA 3FEXB 3FF3A 3W6XA 2H65B 4BWJA 3HZEA 4DOZA 1SI9A 4QZVB 2OPSA 1TR0A 3DLHA 1XBWA 4ZPVR 1WC1A 2PJ5A 3W61A 2BR0A 1OQ3A 3DRSA 3ZZZA 4ZYQA 4FNHA 3V38A 3EX7B 5K8PA 1WKKA 2RIJA 4A4JA 3OFHA 4CH0S 3J80U 5DDRC 3W9IA 3NKYA 2K7JA 2BRLA 4QW9A 2VKZG 7AT1B 4WE1B 1TMJA 2FVCA 4NEZA 4TY8B 2PR8A 4JI6F 1X4CA 3AHPA 3B3CA 3BDEA 4FF2A 2AFWA 4BBHA 4B14A 4YDXA 4Q8EA 3IWEA 2OGUA 2JZ5A 1Y9OA 3S01A 1HNZJ 4K4SA 1MNEA 4HACB 3RZAA 4P6QA 2MHNA 3CDXA 2ZC3A 1A6LA 4ZX9A 2FIWA 3B3TA 4QR1A 3I32A 2NUUG 4QWBA 4V19J 2YKOA 4ECZA 2RILA 2YX7A 2RUGA 2WVCA 3SQGB 2CJAA 3G6ES 4U7UD 3PB4X 1PC4A 2NXCA 3H2LA 3P5TL 3KK1A 2J8RA 1R6YA 3R5GA 5ETVA 1NO8A 1GNKA 3GU0A 1TVRA 1TKJA 2HV2A 2CVIA 3V8IA 3FMWA 1VBXA 2HS0A 4DFJA 4O23A 2DPSA 1W7WA 4C8KA 1YKWA 5F49A 1F3VA 2V63A 4A8XA 2O1PA 1M4GA 2RHSB 1SBRA 3I1UA 4WJBA 4I0WA 4LF5F 3CT9A 3GCXP 1Q81T 3LANA 1U02A 3FB3A 2EG2A 3BH7B 2VBWA 2V5HG 1WSVA 1V3RA 1RLCL 4W4MA 2UV8A 3NS7B 5IV3A 3Q8YA 3MRUA 1VQ6S 5F8MA 3M7VA 2R8GA 2OHDA 3VALA 2XMTA 3VR1A 3D2WA 4QB9A 3THVA 4KORA 1JIHA 3SIPB 1NU4A 4O44A 4USHA 2ZEOA 1UPPA 3CC4S 3CMQA 2JLEA 4W90B 5K5MA 3O3LA 4NXNJ 3OXFA 2FL4A 3LAKA 5A0YB 1BPMA 1FTRA 4OI0A 4QBUA 1RHQB 4JI1J 5LRJA 2C28A 4MKVA 2Q51A 3I96A 3OD2A 5D15A 1CVJA 4FVMA 2UUAJ 2FY8A 3KJVA 1SC6A 4PR6A 3D3BJ 2VFRA 4NRUA 1ARMA 2BQRA 4TKTA 4K5SA 4M5DA 4NJQA 5HBMA 3WIVA 2Q66A 1YDLA 3NP5A 4HHUA 4J91A 2OUGA 4DSLA 4F9UA 4I64A 1WORA 3BKFA 1YX0A 1C2PA 1UVIA 4DV7F 4F4ZA 2VZYA 2DPIA 3K5OA 5A28A 4DDFA 3SCLE 2BCOA 4AXIA 4FYYB 1B4SA 4MBUA 1LW0B 2LEPA 1TL7B 4NJRA 5AXNA 1Q1KA 2HK2A 4HTIA 1BHNA 5G21A 1C0TB 3R9FA 2GA7A 2W2MP 2VPZB 4IDKA 4FD4A 4ZGYB 1R7IA 2CA9A 2EC0A 1BE4A 2C27A 3M1VB 3DXSX 3SFUA 3D1OA 4UCNA 4IG0B 3FEDA 1RCOB 2QE5A 2PQ8A 3KHLA 2B51A 4YR3A 4A30A 4CLWA 3T1YF 1VHOA 5AJ3F 2ZBPA 3ILIA 1Q8BA 2GQQA 3TFYA 4PPDA 4P9SA 3SYZA 4W98A 1PJ7A 4A48A 3MR5A 4DL7A 1VC6A 2WVBA 1WHYA 1RLDA 1KP6A 1TK5A 4HNXB 4IF5A 5C82A 3FYNA 4HNWB 4MHNA 4MCPA 1XC9A 2V94A 2GVZA 4DNCA 4FKYA 3Q8RB 2XCPA 1FO1A 1GQEA 1S1XB 4A33A 5F8GA 3MMBA 2WVEA 3UPFA 3OVBA 2I00A 1I5OB 3UO0A 4F3QA 1ZBTA 1VQMS 2ZWOA 5H9FK 3UW1A 1FKPB 2K2PA 2ASJA 2O5DA 3W9HA 4JI7J 4OIWA 3KOAA 1NHUA 5KT6A 4DV6J 5L9XA 5DGBA 2NXEA 3ZC4A 1IB1E 1U6ZA 4DUKA 3JXOA 2EKYA 3M2RA 3MOJB 2AWZA 3MGDA 2Z2ZA 4O3PA 2VG6A 1S4EA 1PAEX 2JX2A 3MI7X 2HWTA 4G65A 4GKKJ 3VCDA 4K30A 3VWSA 1WWHA 4XTTA 2RAQA 1XERA 4ZBGA 2QYVA 5CZVA 3CCUS 4B08A 2ROGA 2YQ3A 3I5AA 2JC0A 5DQIA 5CYMB 2YKMB 2R7OA 4DCOB 1CQNA 4II9A 3FEYB 3C66A 1DHMA 4ZP6A 4M3SA 2BUEA 4OKOA 2G2ZA 5IV0A 3MR7A 2IM2A 3MR6A 8ATCB 3IP0A 2FJXA 2DY1A 3M6XA 2ZUGA 2E7XA 2DNYA 3GPAA 1X0FA 4C8NA 4DQIA 1Y9KA 4F0KA 3CXCR 2NREA 2PI4A 2H54B 4I56A 1F2GA 2C3PA 4RW8B 1PILA 1FE4A 2MSTA 4ZPCA 1PO6A 3CJSA 4L3KA 1T9TA 3MD3A 5KFVA 4DL2A 2Q4VA 5EX3A 5J1EB 2J7UA 3CJ8A 4JZ0A 3KXDA 2PJ7A 2AQ4A 3BI1A 3LUYA 5I3QA 5KG0A 1QUPA 1KZFA 3ZTPA 1OQ6A 4QIEA 1QSYA 2L3MA 5L1KA 1FX4A 1P6TA 1MMNA 3RRKA 3MM5A 1FVQA 4RZRA 2YKNA 4PG8A 2MZQA 4K4UA 4I7FA 3AJDA 2KXHA 3MN8A 3A3PB 3PHTA 1LWXA 4DR6F 2VFTA 2BEFA 3M8YA 4KE5A 4HT5A 3M8SA 4O3NA 3PRTA 1IYLA 5KG3A 1ZZNA 2WVFA 4KYZA 4PXEA 1EHWA 3KQXA 5HVFA 3ISNC 3B54A 5HROB 1RAIB 2OU2A 5JGFA 2AKWB 4KV8A 2P6EA 3ZZ0A 1N32J 4DQRA 3LGHA 2IC3B 2M7SA 2L08A 2W01A 5LT5A 1XMQF 4KSAA 3CE8A 3HMJG 3WT4A 1BOBA 3US5A 1N54B 2OPQB 4OQJA 2ROPA 1VIOA 4HNYB 4ED0A 1YJWS 1CJKB 1HBOB 2ASLA 2HWIA 1BY9A 1TK8A 5J2QA 3MM6A 1VQYA 4A8QA 2YNGB 4MIBA 4C0OC 3I5BA 2HFOA 4DN9A 4ECVA 5EWEA 4ECSA 1H7WA 4X66J 2K5TA 5IV4A 3A9LA 3AB2B 2I8EA 1CS4B 2PIIA 4JJXA 3A4TA 3NE8A 5EHHA 2MB0B 4JI2F 2RQ4A 1YGYA 5CQGA 3IU2A 4WXOA 2W7PA 2JDDA 3IBWA 3Q24A 2QO3A 2F4VF 4JI5J 2WZ1A 2RH3A 4IAVA 3BZQA 5HMYA 1LOKA 2DGVA 3Q2SC 4ED6A 4NPOA 2VB6A 1SC1B 2APOA 5F8JA 2PDOA 1X9SA 1NSAA 1YLOA 2HFUA 5LOQA 2DHHA 3EGNA 2Q7BA 3MEEB 5LYLA 2CDQA 5L9NA 2RB7A 3FFIA 1M0SA 1B87A 4DG1B 4Q2MA 2OTJS 3TZYA 1ROFA 4NCGB 3OTDA 2LDYA 4LVOP 2VQYA 4OZ2A 4ECTA 2MQQA 2W2PP 4UCMA 4MY0A 4Y2AA 1W26A 2BE7D 5DS7A 1YI2S 2I6WA 1FNXH 4OZ5A 3RGIA 2V8PA 4RUBA 2HNZA 1LRZA 3JYTA 4M5NA 1U6MA 4U95A 2P9CA 4NASA 3H2UB 4PQUA 1B3TA 3D1HA 3DRRA 2AJQA 4UWJA 1S9FA 2E5JA 3G9CA 3TRGA 3PFEA 3QFWA 4QR2A 5C2CA 3KYLA 1GX5A 4K4TA 5ETNA 3BYRA 3OFEA 1ZAVA 4DV3J 4O4GB 4IFYA 4QU6A 3AXKA 5D6GA 2XSFA 2XI2A 3ICLA 3H4DA 2XMMA 2P9GA 4DL3A 2XY7A 1LWCB 2F8MA 5F48A 2EFQA 2VG7B 2EWBA 2K3IA 1MWQA 5K14A 5L8RC 1RSCA 5DDOC 2BRKA 3JSYA 1X4DA 1YSJA 4USKA 2ZH8A 4LRAA 2KM8C 3I87A 1I1DA 2HHHJ 3P49B 4MK7A 3PACA 1JLGB 4A2ZA 1SQGA 3I4HX 2E5LJ 4DUZF 4XPKA 4YUDA 2P0WA 2YVSA 3N5FA 3DC2A 2V8VA 3EXCX 1EKRA 2RSQA 5HSPA 3TA1A 1FKOB 4F4KA 2OLWA 1VFJA 4H4KA 1CBKA 1BO4A 2YTCA 2XLIA 2FDNA 1TKXB 3VAGA 1S79A 4JV1A 3L3CA 4R87A 1R27B 3PM9A 4OZJA 5EN1A 2P6SA 4X4OA 4R7MA 4OC5A 3PW2A 3DRXA 1HMVB 3TZWA 3QJPA 4CGOA 2D7SA 2E29A 3TEHB 1YJNS 4LRDA 1JLCA 4OHZA 5I42B 4MXUA 2LKZA 1IU8A 4YFUA 3LP0B 3RW6A 3PJWA 1JJ2R 3IBFB 3PVXA 3F73A 2AFZA 3TJ8A 3EPGA 5HQ8A 5JJBA 1YREA 1K0VA 5DLFA 4RNOA 3C19A 3JUWA 4X5KA 5IM0A 2ZZNA 3PYFA 2HNYA 2B8PA 2YY3A 3W63A 3UVJB 4K50A 1NZAA 3UN5A 5FLXU 4WK3A 3FCWA 5F8LA 2NSCA 2JOQA 3CCWA 1UA1A 3CJKA 3N0VA 3J7ZT 1QUVA 1HR0J 3ETOA 1EE3P 2ZJRQ 1ZM4A 2GS8A 2YPZA 4LUAA 3F56A 2OP5A 2GHWA 2AFMA 1LW2B 4WKYA 2QL5B 1UFKA 1PJ5A 4ZKAA 1HHSA 3FBBA 4JI3J 2N3OA 1M5VC 3MWBA 4JV5F 2R2UA 3N79A 1MN7A 5KG5A 4B5OA 2O01C 4EK2A 2DNNA 1TUGB 1NK6A 2AGQA 1I51B 1MROB 2DHAA 1WC5A 4IFVB 4IO9Q 4MYUA 4A8MP 2N3LA 1JNRB 4RBUA 2I3CA 5GAGI 3RRGA 2PI5A 1NHKL 3QRQA 2C2EA 1XEBA 3GIUA 3DR6A 1I94F 2D9PA 3R97A 2GHPA 1F2OA 4EZ9A 4ECWA 4KFBA 4KHPF 1SJRA 4CYPA 1EZZB 2RDJA 1PCAA 4GMKA 3T5HA 2X7BA 2EBGA 1YHQS 2IIHA 5IWAJ 5KOWA 3QQCD 4LREA 4DV4F 5DO2A 3J80Y 5ETTA 3NNAA 4DCPB 4KO0B 5F46A 1D8YA 4PEOA 2PMWA 1DTTA 2VBYA 3RBUA 4OV1A 1RAOA 2XM3A 1SQFA 5L1IA 1MJBA 4F50A 1L0CA 2CPDA 2E5GA 1RT6A 4F3OA 1S7NA 1QSTA 1U48A 4M94A 1DARA 2DGQA 4PXCA 4Z65A 2J9EA 2CQHA 4FPIA 4NXMF 2FLOA 2BVZA 3D7HA 1S72S 2PMZD 1EX8A 1HW9A 4RW7B 2AF6A 1NMTA 4NL5A 2YKAA 3SCJE 2XEFA 3PIOQ 3K5NA 4U67Q 4MRIA 4LJMA 2WSFC 1RU1A 3CJQA 2H48B 2HHXA 4QQBA 4MAKA 1WHXA 1DFDA 2HHTA 2N7YA 3IC1A 3JTKA 4NGPA 2WTFA 4J9KA 4H6ZA 4H4MA 4CGLA 4J9LA 1FRJA 3EGZA 1YIJS 3L95X 2KXNB 4WZQA 4PK3A 1HQEA 4LSNA 4FUUA 4YY3F 1QJHA 4LQ3A 3MM7A 1B7YB 2X1BA 4R0EA 5L39A 1YWXA 1KFSA 5DDQC 4RJVA 5H84A 2Z0GA 2C1CA 3T9NA 3IR7B 5IQQA 1NB7A 3H5XA 1FRXA 3DOMB 2GIQA 4K4WA 1UJ6A 4TN2A 5IQ6A 3IGRA 2MZJA 1ZG8A 1G7CB 1UVJA 2V8GA 1R57A 2V0NA 2Q4YA 2GGPA 1TVRB 4WP3A 3DHWC 2ZEDA 2WONA 2AW0A 2VV5A 4NLUA 2EVZA 3RBEA 2FHOB 4X84A 3DI6A 1DBDA 1B99A 1FFGB 3DLEA 4USWA 4UA3A 5G22A 3GIRA 5LJ3Y 4HVZA 2E5IA 1NK0A 1GTEA 2HRTA 4ERDA 3GFYA 2WHOA 3I9ZA 2QX0A 1S6QA 4KBIA 2D9OA 1HBMB 1Y5LB 1CJVA 1H38A 1JX4A 3HCXA 3OBIA 4DR7J 2R42A 4IG3B 1RBAA 1NPKA 2DXEA 1RTJA 1N48A 4KKOA 1FK9A 3R9LA 2E9RX 1CJTA 2CXAA 2MPUA 4KOTA 1KQSR 4RNNA 1R0AB 4NF1A 3TJ9A 3DLGB 1T3NA 3WQPA 2K8GA 4J7CA 1YQHA 1LK7A 3CNQP 4DQPA 4QYZK 1UA0A 3NGDA 3KDNA 4OI1A 3BM7A 1F3FA 4JP8A 3GV8B 1SH3A 3DN9A 2HIYA 2G3TA 2C3OA 4DR4F 1X31C 5D3GA 3EICA 3D1QA 4F4XA 2Q6CA 3HP6A 1KUXA 1Q7LB 1R8BA 2VPYB 4QUSA 2LDIA 2KZMA 1XIXA 2WRMA 2KI2A 4CS0B 4CH1A 4ID8A 4CIOA 1FJ7A 3NCQA 2KT2A 1HD0A 3W8PA 1EETA 1RKIA 2C3YA 3W1YC 5LXRA 4ES2A 3PW5A 1SC4B 2C2ZB 3Q89A 2ABZA 2CIJA 2KRRA 2M88A 4OC0A 1HWLA 3HPOA 4KTQA 2G0CA 2QJ3A 4X4PA 2PE8A 1Z2LA 4O3RA 3IO1A 2YNCC 5C24A 1DE4C 2EVNA 3HJVA 4UFVA 3I9V9 3RB0A 2DTJA 4ZCMA 1FJEB 4KOVA 5J1QA 3IR5B 2DYAA 1GH8A 2WSAA 4NLGA 5ETLA 3GFZA 4CQ1A 3M2UA 1KONA 2LCWA 1XR7A 3FQKA 1K1SA 3CGIA 3JTOA 1U1PA 2MZSA 2GVZB 2R2TA 3V6HA 1UEKA 1QAJA 1QAIA 2PJCA 1WELA 3F0AA 3R5BA 5F0UA 3N01A 3RB4A 4Q2LA 1TFWA 2UU9F 3GLJA 1X8DA 3D3CJ 1FFSB 3I4PA 2IRXA 3KJNB 4JBCA 4MIAA 1VMBA 3BSAA 1N5YA 3A12A 1Q2DA 4ZLNA 4QJVA 3M2RB 3NH8A 2A0FB 3GG0A 4DQSA 1YGHA 5KFKA 2VG6B 3HFVA 4Y65A 1IOIA 1OPZA 2FHKA 3IWGA 2E1RA 3OV7A 4N8OA 4YWYA 2MYFA 3PHEA 4AE5A 2ATLA 3R6GB 2J9DA 2FY1A 3H42A 4FXWA 1N33J 2XZDB 2VQFF 3H4BA 1HI1A 2LYVA 4CTAB 4PWDB 2KT3A 3W7BA 3WBZA 5DQGA 4DX7A 1NJWA 1Y3KA 3NWGA 3SV4A 1XNQJ 3R1LA 2POKA 1SVDA 5L38A 3IWWA 5J2MA 1M1HA 4B9LA 1F5CA 4KOWA 4D3GA 2WUUA 2PVWA 3N6LA 2ZEEA 3W60A 4LIWA 4K59A 4PAAA 2XMWA 5KTAA 3F8KA 3KK3A 2C1EB 3EE3A 4OX9J 5HLFA 3UWTA 4DUYF 1I12A 3O6QA 3T9ZA 1RWXB 1ZG7A 3AB4B 1OSDA 2AEMA 2RD5C 1YJVA 1F9EB 4NGQA 2JH3A 2KHCA 3BGRA 4NI2A 1FT7A 4XDCA 2IRUA 4KGMA 2BZ2A 1BLLE 2J6SA 3NL0A 5BXIA 1BC6A 4OYBA 2Z2YB 3ILOA 1EB0A 4E8UA 5LYFA 3TO9A 1HEEA 2FXFA 2DCLA 4B3OA 1RABB 1V9OA 2EK8A 1JJ4A 4NA1A 3HHEA 4I6YA 1TL4A 2NR0A 4LRBA 2OR4A 1Z5RA 1HFEL 2W9BA 4ZS6A 4PV6A 4DPTA 2Z2MA 3MM5B 4USVA 1O8BA 1RADB 5EGYA 3EC4A 4BD9A 4CO2A 4DWIA 1CQMA 4WU2A 4ER8A 2HS3A 4B3MJ 2VC0A 3LACA 4CDIA 4N47A 2YQ1A 4OX7A 4EFAC 1QVFR 4KPYA 5E0OA 1ZS6A 4PZVA 2QLWA 3D8PA 5IT9U 5BWAB 4P4DA 2EK1A 3D6FB 5M2PA 4NXYA 2CJBA 4J9SA 3PB6X 4ES3A 4WFBQ 3D4JA 2HFNA 5IC6B 2AJ0A 1ZLIA 3OPKA 1YK9A 2XMVA 1W25A 1S0OA 3QWPA 2XEXA 3UN2A 1SV5A 3C8YA 1D8ZA 2PEHA 3L9ZA 3FJUA 4K4ZA 5J2QB 3MM6B 5DWNA 2GIRA 2VA3A 3G8QA 3SJFA 3OUYA 1HQUA 1RWWB 3EXYA 4EWTA 1HQ2A 2BE2A 5HH1A 1RWPB 1SCJB 3DLBA 2QIRA 2BANA 5HANA 3DFEA 3ZFVA 1CPZA 2P6GA 3OL8A 1G3OA 4YB7A 2DNRA 1RWNB 1OBRA 1HNZF 3KK2A 2LU1A 2OB0A 3D54A 1VLYA 2EPIA 3BSOA 2GJIA 2WVDA 1XMOJ 3MCSA 1IWGA 3POTA 5E3CA 1P27B 3NGSA 3NGKA 1AA1B 2MKJA 2RRBA 1RWUA 3H59A 4OJ1A 4QU7A 1N56A 2CVEA 1MMLA 1Z1ZA 4RU9A 3TCVA 3CJ3A 2YWEA 3PRDA 2PSZA 2VXKA 2IBOA 2Y9HA 3FVYA 5KFLA 3J81Y 2EFVA 3A13A 4YN3B 5T7LA 5EDWA 4ILRA 5KAKA 2IRYA 1DZ5A 3BQ2A 2CWXA 2XNQA 1UPMB 1M44A 3FFIB 4LBHA 3HSGA 3CO9A 5GAEI 4N41A 4ILLA 2DITA 2YGWA 4CM2A 5D0EA 2WCXA 3TANA 4I67A 2PC1A 1OS5A 3HT0A 4ZI6A 5B7WA 4KUAA 3AJ2A 1IXKA 2C22A 4OJ3A 3UR0A 3DRRB 4TYBA 2RE1A 2B0GA 2F7VA 2KHDA 4AVBA 1T9UA 3MURP 4CGNA 1FWPA 3CCJS 3H5YA 1VRUB 2FLLA 1H6KX 2WW8A 4Y2MA 3ZZTA 4JXRA 3IWLA 2PRQA 2KU7A 3HHLD 2P9EA 1IR1A 3ZTOA 1B0VA 3M30A 1KOHA 4OZNA