3IFEA

1.55 angstrom resolution crystal structure of peptidase t (pept-1) from bacillus anthracis str. 'ames ancestor'.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
416
structure length
416
Chain Sequence
YFQSNAMKEELIERFTRYVKIDTQSNEDSHTVPTTPGQIEFGKLLVEELKEVGLTEVTMDDNGYVMATLPANTDKDVPVIGFLAHLDTATDFTGKNVKPQIHENFDGNAITLNEELNIVLTPEQFPELPSYKGHTIITTDGTTLLGADDKAGLTEIMVAMNYLIHNPQIKHGKIRVAFTPDEEIGRGPAHFDVEAFGASFAYMMDGGPLGGLEYESFNAAGAKLTFNGTNTHPGTAKNKMRNATKLAMEFNGHLPVEEAPEYTEGYEGFYHLLSLNGDVEQSKAYYIIRDFDRKNFEARKNTIENIVKQMQEKYGQDAVVLEMNDQYYNMLEKIEPVREIVDIAYEAMKSLNIEPNIHPIRGGTDGSQLSYMGLPTPNIFTGGENYHGKFEYVSVDVMEKAVQVIIEIARRFEEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidase T
publication title 1.55 Angstrom Resolution Crystal Structure of Peptidase T (pepT-1) from Bacillus anthracis str. 'Ames Ancestor'.
rcsb
source organism Bacillus anthracis
total genus 145
structure length 416
sequence length 416
ec nomenclature ec 3.4.11.4: Tripeptide aminopeptidase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ifeA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ifeA01
4PXDA 1ZLHA 4P44A 1PYTB 1CP7A 4F9UA 1CX8A 2ZENA 4PXCA 2XEIA 3H8GA 4WJBA 4PPZA 1AYEA 4FBEA 3B3VA 4MCPA 3WC5A 3PEIA 3HUVA 4UEFA 3FMCA 5D8NA 3PB6X 1TF8A 5CBMA 4MHZA 2IQ6A 1CG2A 2ZOGA 1YW4A 4O23A 4Q7AA 1YLOA 2PJ7A 3FH4A 1LCPA 2AFOA 3JRUA 3H8EA 4MHPA 4F9VA 3SI0A 4ZY2A 3FECA 3KHZA 3S9MA 4LQGA 2I3CA 2XEFA 4NJQA 3IWWA 3B3TA 2PIZA 3FX6A 2O4HA 1ELLP 3D68A 3FEEA 3B35A 1TKHA 5LRJA 2AFMA 3D7DA 2PIYA 4PXEA 2AFSA 3BI1A 2AFZA 1BLLE 3DLJA 4B6ZA 2ZELA 1ARMA 2C6CA 2Q51A 4NGQA 2PJ5A 1HDQA 3IIBA 3FEDA 4CPAA 4FUUA 5ELYA 3GB0A 2ABZA 3WABA 4GM5A 5D29A 2HB6A 3PB9X 2PVVA 3PRTA 1LANA 1LOKA 2GLFA 3PFOA 1LFWA 3QNVA 1M4LA 4OMEA 3K2KA 3KQZA 3T8WA 1Q7LA 4NFRA 2ANPA 2IJZA 4ONWA 2PJ0A 3KASA 3SJFA 3WC6A 5CPAA 2AFXA 2J9AA 4G1PA 2FVGA 2ZOFA 3SJEA 8CPAA 3BHXA 4R7MA 2PVWA 4R8FA 3TX8A 4Z65A 1Z8LA 4NGRA 2ZEEA 4X2TA 4AXVA 3S9NA 2JBJA 1FNOA 4ZY1A 4IK2A 1Y0RA 4DUKA 3KR4A 3NH4A 2PJ8A 5F09A 2CIJA 3L2NA 1Y0YA 5LYIA 1XJOA 1YSJA 1JQGA 2PE3A 4NGSA 3KL9A 2WZNA 3D66A 4OP4A 3FVLA 3K9TA 3RZAA 2QJ8A 4ZI6A 3KQXA 4A38A 2ZEHA 3IEHA 5LYLA 4A94A 3SI2A 2C6GA 1XRYA 4OC0A 4JZ0A 5K8PA 1TF9A 4UEEA 5DS0A 3NA6A 4TNUA 2JEWA 1IGBA 1CP6A 1GYTA 3MRUA 4P4EA 4A37A 3PB8X 3B2YA 4MCQA 2IMOA 1QMUA 1TKFA 3FF3A 2XEJA 3VATA 4MMOA 3NFZA 4NGNA 3VH9A 5HXDA 3SJGA 1XFOA 1HDUA 4P6YA 5HVGA 3WT4A 4RUHA 4W9YA 2QYVA 2RFHA 2XEGA 1AMPA 4P4DA 5I4MA 4OIDA 3VARA 3PFEA 4PXBA 4IHMA 3WC7A 4MHNA 1PCAA 3NH8A 5LRKA 2GREA 3CPXA 2OR4A 3V7ZA 3CT9A 2V8VA 2PJAA 3KGQA 2PRQA 3KI9A 1Z2LA 4P4FA 5HVFA 1CPXA 1YMEA 4DYOA 3RBUA 4EWTA 1F2PA 3IO1A 3IJ3A 6CPAA 2EWBA 5K8MA 2EK8A 1TXRA 4NGPA 4K3NA 3GUXA 4ZX8A 1YW6A 3B3WA 7CPAA 2O53A 1IY7A 4UF4A 2GLJA 4ZX9A 3PBEA 4KSIA 4MHYA 1ZLIA 3MN8A 4FWUA 5LRGA 4OC4A 1DTDA 1LAPA 4X8IA 3D7GA 3SJXA 4TWEA 2G9DA 2F8HA 4BD9A 3IC1A 3PBBA 2POKA 2CF4A 2DEAA 2PCUA 4UIBA 4ZYQA 1H8LA 1CBXA 3RAMA 3PB7X 3KZWA 2ZEFA 4OC2A 5LYDA 4F8ZA 1ZG8A 2OOTA 1F57A 3PB4X 5JGFA 4IAVA 3B3SA 2JBKA 2AFUA 2ZEGA 4P4JA 4DJLA 4H2KA 1TKJA 2PJ1A 5JH9A 2PJ4A 3NH5A 2C1CA 4OC5A 2BO9A 2GU2A 3DGVA 4UIAA 5J1QA 4UEZA 1UWYA 1F2OA 1ZG9A 2PJBA 3GLJA 2PJ2A 1Y7EA 4NGTA 2WYRA 1XBUA 4MRIA 3ISXA 4OKOA 2V8GA 5JM6A 5K8NA 2ZEPA 1ARLA 2Q43A 2CTCA 3S9LA 2PJCA 3I1UA 4P4BA 2HC9A 4OC3A 1VIXA 4JYWA 3D67A 2ZEOA 5LYFA 1QQ9A 3B3CA 1BPMA 4MCRA 1DE4C 3KR5A 5IB9A 3CPAA 4MCSA 1NSAA 1XMBA 1HEEA 1VHOA 4EFDA 5HVHA 2VL1A 1EE3P 3V38A 4ZY0A 3KHXA 2CTBA 4P45A 2F7VA 5K8OA 1R3NA 2ZEMA 1RTQA 2V77A 2C6PA 2EK9A 4WWVA 2PJ9A 2NYQA 1ELMP 4OIWA 1FT7A 1VGYA 4YU9A 3H8FA 3LWUA 4MXUA 3D7HA 1CPSA 4YWYA 1BPNA 3BI0A 1LAMA 4R76A 1R43A 4NGMA 4R6TA 3SI1A 4OC1A 1BAVA 4NJRA 4P10A 4P4IA 3B7IA 2NSMA 3CDXA 2AFWA 1KWMA 1OBRA 2PJ3A 3D4UA 4A39A 2Q4ZA 4EMEA 5THWA 4FAIA 3D7FA 2QVPA 3ISZA 1ZG7A 2RB7A 3HLPA 2BOAA 2V8DA 2BCOA 2V8HA 4X3RA 3LMSA 3N5FA 2ZEDA 3BXMA 4PQAA 3FJUA 1Z5RA 3IFEA 1VHEA 2PJ6A 3TC8A
chains in the Genus database with same CATH superfamily
2IYIA 1H72C 2GIFA 1H74A 1CX8A 2R8VA 2EFOA 1NH8A 4B9VA 2XEIA 3H8GA 3LALA 3NL0A 3NCPA 4H6UA 4N5SA 2DB1A 5ETOA 3VVUA 2IQ6A 2BANB 2OU2A 2W2OP 1Q8IA 1DURA 1CJUA 5C25B 1Q8KA 1FJGJ 3DDKA 1CJKA 4B08A 3IWGA 1HBOB 3W1YC 4LREA 3US5A 2MZJA 4BC7A 4E8UA 1ICEB 2CZVC 3B35A 3H5XA 2Z3KA 4YB1P 1KUVA 3GV5B 1N56A 4PXEA 4X65F 4ID5B 2FJEB 4EZ9A 3DLJA 4Y6IA 5LT5A 2I1RA 2OSRA 2W9CA 4WK3A 3MM9A 4ZDNA 3IIBA 4QCLA 3Q8UA 1TL7A 2DIUA 4UOCA 3GB0A 4QIWD 5K14A 5LJ5Y 4KFBB 1MJ9A 1L3TA 1AUSL 5EGYA 3GCXP 3CXQA 4YR0A 3E2EA 4DSFA 1QSRA 1T95A 1AT1B 2QTWA 3ZC4A 3CDUA 5GADU 3KASA 2REFA 2DH9A 2CNOB 4TU7A 3MR6A 3SSRA 4K2XA 2PVWA 1YQEA 2O3DA 3FEYB 2UU9F 2BACA 4YFJA 4MK9A 1BXNA 4LF7F 1Y0YA 1H3DA 4OIXA 5BYSA 5F8JA 3LGNA 2NSCA 5B0CA 4ZI6A 1N6QB 2R7QA 2HNDA 4P52A 3SI2A 2HHXA 1FFWB 3ZZ0A 3UPFA 3DSBA 4JI1F 3CJSA 3NA6A 1Q4RA 2BEIA 3MFHA 1IGBA 2FC8A 3C6TB 1IR0A 2CPJA 2QG9B 1QJHA 2GGPB 4DBQA 3L95X 1JXEA 1Y9WA 4MMOA 2IVFB 1Y10A 4PYAA 3MR5A 4DV6F 4OZLA 4W9YA 2VA3A 1F5AA 1WF1A 5A8KA 4Y3CA 2KM8C 5EHHA 2C42A 4CRZB 3BV8A 2VBZA 4ZPAA 4OI0A 2GREA 3DRRB 3E0KA 3J81Y 2W2QP 2YKPA 3BGLA 4PG8A 3MEDA 4ICLA 1IJFB 5CNPA 4A2ZA 4II9A 2Z30B 3KGQA 4QVTA 2G4BA 2VQFF 3RBUA 1RGVA 3AOBA 3NWRA 4DQQA 5E5NA 1SB6A 3ZNUA 3R9GA 1P8GA 4Y49C 2W7AA 1F3VA 1T9YA 1YHQS 3GUXA 4DV7F 1QSMA 3HDSA 4UF4A 1RAFB 4ZX9A 1SKRA 5G21A 2O66A 1JLCB 4C68A 5LRGA 1ZM4A 3FNNA 3KLHB 1EJ7L 1LV5A 4RS2A 2A6MA 4X8IA 4HTJA 4TWEA 4R5PA 4JI8J 2GJFA 2UZAA 2VQYA 2POKA 1UWBA 2CUYA 4XDCA 1U24A 4UIBA 2VZ9A 2C27A 2KZZA 1QY7A 3EPGA 4HACB 4YDDB 2PD1A 2R8GA 2FVCA 3ET6B 3BM7A 1KVKA 3BS9A 5JGFA 2XMTA 1OQ6A 4OX9F 1WC3A 2AFUA 2HBRB 1UA0A 3W7BA 4RWWA 1EIYB 2PJ1A 2P6FA 1RHQB 3IU2A 2OHDA 2BO9A 3MM8A 5J1QA 2BJ7A 3ZTRA 1ZG9A 2GV1A 2HHPA 2WYRA 2JRSA 5SZTA 4KLVA 2JZ5A 4J9UE 1WKLA 2ZBIA 5K8NA 1RAIB 2EK6A 2Q43A 5DZ7A 2VG6A 4IH7A 4ZPTR 1B64A 2MZQA 2MEWA 3NS6A 4CYUB 4MTPA 2BQ3A 5DLGA 1PKUA 1MN9A 3BDEA 3B3CA 3ZZYA 2IRUA 1RI7A 3TAMB 4DF8A 2GMLA 3FJ2A 3QWPA 1C0TA 3EJMA 2NUUG 1S9GB 1X0FA 2H4WB 4B5PA 4KGXB 5ADZA 4MFQA 2W2NP 2IRYA 1A2ZA 4FYWB 1FFGB 3G96A 3CO0P 1FT7A 1R27B 2D4OA 2C2ZB 2YKNB 3D1QA 2GAHC 3VAKA 4Q45A 1WUUA 2B3VA 4FBTA 4DFKA 1B7YB 1T3NA 4FYVB 4I7FB 5GAHI 2HRUA 2IA0A 2FVRA 4FAIA 3D7FA 2JDDA 2BOAA 1OSCA 3IAS9 4LSZB 2J0SD 4BCAA 3BXMA 3LMSA 3OJSA 2F4FA 3FFIA 3TJ9A 1HQUB 3VAFA 2V5HG 4M5DB 4L74A 1NCLA 4KOSA 4L89A 4KOVA 4PWDB 1N5QA 1HQEB 1BQMA 2AJ6A 1RTIA 2VG5A 4XIUA 3O8WA 4WP8A 2KJWA 4V19X 5D8NA 1SH3A 4N56A 1LKZA 4OZ1A 5KFKA 2V4QA 3CULA 5IWAJ 3H5YA 1HYSA 1K0VA 5BJRA 2CPIA 3OHAA 4DFMA 4KT0C 3L7PA 2PMWA 4PG4A 5EX3A 5KOXA 3TQ1A 2QL7B 4ATNA 3OW2R 4I6AA 3VWSA 4MFBA 3S8SA 3EVOA 4DR4J 1OZPA 2DNZA 1QSYA 4NCGA 5IB0A 2A4NA 1VQ6S 4AL7A 4OZ0A 2H3EB 3DOKA 2YNCA 4MBUA 1UPPA 2BOPA 2LXFA 1YK3A 5D0RA 4XDDA 2Q1LA 4YB5A 4FF2A 4OYZA 4MFPA 1WEXA 2QO3A 3MI7X 4IYQA 2HHSA 1H6KX 3SJFA 2G0BA 2VG7A 5HQ8A 2J9AA 3DM2A 2YNFA 4E8OA 2R2SA 2ZOFA 3A4TA 1IIDA 3H2VE 1TK8A 4DX5A 2WW8A 5DDQC 1FDAA 3FQLA 2OLWA 3W9IA 1KUXA 4DR6F 1WG4A 2PDOA 4LSLA 4UZBA 2AJ2A 1S12A 1SBRA 5KG7A 2P0WA 2B5JB 2AW0A 4KOTA 3THPA 3HVTA 2N4CA 4A38A 1FT8A 2RDJA 3J7YI 4ZP8A 4LF9J 3IGVA 4J9NA 5C2GA 1TL1A 2HW3A 3RW7A 1U6BA 4ECYA 4C8LA 3A1YG 1MROB 3NBPB 3QFHA 1OPIA 3B2YA 1R6YA 5T7LB 4LF8J 4G65A 1KLNA 3WQPA 2RNEA 4WIIA 3BBFA 4J5OA 2XEGA 3C26A 1NEEA 4DR5F 4DX8H 4IFYA 4ZVEA 3FBUA 3HLUA 2VZZA 2RQCA 4CO4A 4NEXA 4RX6A 3R95A 4DN0A 3CF5Q 5I42A 3H59A 4U8YA 3JB9k 3GJQB 1D3WA 4PG5A 6FD1A 4YR2A 1DQAA 4JI6J 1D9DA 3KHRA 5M2PA 1UA1A 3EY5A 2BKPA 5KFVA 1U6ZA 4U7UK 1CPXA 5C82A 1T94A 4TNOA 3TO6A 2OPPA 4H54A 5CZVA 3PY8A 2WCXA 5K8MA 2YNEA 3NG8A 2QGFB 3FYNA 5C7PA 1UAWA 2HVEA 1SI9A 4ZX8A 3B3WA 1ZM3A 3AB2B 2KDOA 3GY9A 3IR6B 3B8GA 1OPZA 5AE1A 1B4SA 1UCNA 1HFEL 3MN8A 2DO4A 3M32A 3AHPA 2K5TA 1QSOA 3NE7A 2FZGB 3IRXA 3S7RA 5KFGA 4K4SA 4IG0B 4DV0J 2UUCF 4EUVA 1U09A 1YWXA 4C8KA 3HXMA 3HD1A 2F63A 2VFSA 2H54B 4DUYJ 4X4PA 2VV5A 1H8LA 4UOGA 1NSPA 4RU9A 4BDPA 4KO0A 3ISNC 5FVJA 1LFPA 2JC0A 2KRRA 2B4OA 4OYBA 1OY8A 1GK8A 4ED0A 4J7CA 1UP1A 1S7FA 1SV5B 2CQ1A 2FC9A 2HK3A 1RXTA 3HSZA 4LQ3A 4CO1A 1PYOB 2ZW4A 2R7SA 3VGSA 2AJ4A 4NYPA 4ECWA 4MJ8A 2YNCC 1GX6A 4CDIA 8RUCA 5DQIA 1K47A 3G6ES 4EVYA 1RT4B 3LP1B 1H7WA 1U1MA 5H1SV 1HD1A 3I3GA 4NLVA 4C2XA 4KY3A 5DDPC 2KL8A 2YNHB 1IKVA 2LEAA 3QYYA 4AXJA 4KYZA 2HWTA 2O1PA 2XGPA 1CSJA 4LF4J 2ZUGA 3SMZA 4WK1A 1RBOB 1VHOA 3HHLA 2R2TA 3E51A 1X10A 1Z8TA 3MMAA 2LFVA 2BE2B 2GQQA 2DCLA 2ZEJA 5L39A 3DR8A 4ZVOB 1X5OA 1S1VB 2AT1B 1JLBA 1S9EB 4CAWA 2EK9A 3CDBA 5F9LA 5BYRA 2FYXA 4OIWA 4OI3A 2C2DA 2CZ9A 4NL5A 2LQ9A 1HQ2A 4LR8A 2AZ3A 2CDRB 2KM8B 2PDAA 2J5AA 2P9GA 2YBVA 3IBFB 4AL5A 3RBXA 2HMIB 1YGHA 1XNQF 4X4VA 3AD9C 4EMEA 2NXJA 1FJ7A 3RUBL 5D3GB 4IOAQ 1RSCA 4C11B 4QR0A 2OD4A 4O4RA 1Z5RA 1FK9B 4IH6A 3QLHB 5I3PA 4DV1F 2F4VF 5A8RB 3NCQA 4Y49B 4PXDA 4ZPVR 4KHMA 4A8SA 3GYXB 1JWWA 3TA1A 4MFJA 4CGOA 2CXAA 4C7HA 1KS2A 2GVZA 4IOCQ 2FY8A 3F0NA 2C22A 3O1LA 1FRHA 4FNHA 2B8PA 2DGWA 4DCOB 2XWYA 2MMYA 2QYCA 4OL8A 1AB8A 2VIHA 2A2CA 1CJUB 3R5CA 4Q7AA 3MM7A 4OX6A 5GAGI 1S7KA 4CI0B 1NPRA 1MJAA 2W9BA 3H8EA 4DFJA 3IS9A 3BGRA 3FECA 3S9MA 1S6QA 4LRAA 2XZWA 1VHIA 4NJQA 3B3TA 4K5SA 1I51B 1I3OB 3P2HA 1F9HA 3G3SA 4H4KA 2VASA 1X4CA 3CO9A 5A8WB 1TK5A 3NAIA 4LF1A 2F5GA 4AG7A 1NDCA 1FKPA 1RTDA 3ILLA 2W9CB 3MAAA 3MM9B 4QW8A 1GMWD 1TL7B 4CLUA 1N5YA 1HARA 2RHSB 5K14B 3RW6A 4UY85 3J7ZT 1DTQB 1LOKA 2X7IA 3JTNA 4DMZA 5HJYA 3KTQA 2IJZA 1XMOF 2GC8A 3GIRA 3V5RA 1PG5B 1U6FA 2MGZA 2WB4A 3OBIA 1TKTA 1AZSA 4RBTA 3S6FA 3BGOP 4O3NA 2DXFA 4HI2A 1WC4A 2YVSA 2WZ1A 2GJIA 4KV8B 4GVBA 2JEGA 1X9MA 4RUBA 2L48A 4X4QA 2ZUAA 4M5NA 2KZMA 2N3OA 1YSJA 3A3PB 2MQPA 2AGQA 1X4DA 2W4PA 2E7WA 2J0XA 1WDDA 2YWEA 2HNDB 1P1TA 5FLXU 4JYAJ 1Z4UA 3R3TA 4CLSA 4WFNQ 2CJYB 3OL7A 1LWCA 1QSLA 8AT1B 3T5LA 1NB2A 3IBWA 1DRZA 1Q1KA 3HHLC 1DJ0A 1UFHA 2KVIA 1JLGA 1N36J 4F0KA 2WVEA 1WOPA 1QMUA 4H89A 4J9VA 3BEGB 3NFZA 4RBUA 4KVME 5G22A 1SUQA 1X9WA 3QAHA 2KB2A 2AJ1A 2CQCA 5C2CA 3M6UA 3VGVA 4ECQA 5A8KB 3WC7A 1WF2A 1S1WA 4LIRA 2Y0SD 3M4XA 2HWIA 4HH0A 4JV2A 1RT2A 1YX2A 2XSJA 4HH1A 2LQJA 2X3GA 2XNQA 2M4MA 4NLYA 4X62F 3MEDB 4UUXA 2PJAA 4ILMA 1DAXA 2QMWA 4I6YA 2FD2A 1F2PA 4AL6A 3EVMA 6CPAA 3HSGA 1KLMA 4IO9Q 2UP1A 3AOCA 1WG1A 4NYZA 1TFWA 4UCMA 2OEKA 3UFCX 4JP8A 1FXDA 3QT5A 4PAAA 4ERDA 2AYEA 1IY7A 3WR7A 2WPWA 4OJHA 4ZVRB 1OY9A 4RNOA 1EX8A 2ZC3A 4C6AA 4QPXA 1Y0HA 4R5PB 2GS8A 3IMQJ 4PR6A 3D5MA 1UWBB 3KK1A 3DGPA 1RBAA 1HNVA 5L8RC 5C24A 2VB6A 3MR3A 4LFCF 2FCKA 1VQKS 1HMVB 2D3O1 4GKKJ 4H4KC 4JXRA 1RT5A 3QPIA 5A6PA 2XLIA 4MIAA 3CTRA 3D6MB 4ZBGA 1TKJA 4DEZA 1NK4A 3OFGA 1DTTA 4O3OA 3HHEA 4F04B 2Y1RI 1IKWA 1UWAA 1EP4A 4WIQA 5CD4A 3MM8B 1TL3A 2V50A 2ZBRA 2WBMA 1RWKB 4XNHC 2VOOA 4NLUA 4OKOA 3LGHA 5HMZA 2F9JA 2VG6B 2HS3A 5A28A 2FT0A 2C1EB 4NXYA 3KYLA 4V1Ak 3GIUA 4MCSA 5FJ4A 3CC4S 2R8JA 1C0TB 3QIPA 1Q86T 2JDJA 3UD3P 4B5PB 5F9NA 4A8QA 2RUSA 1F5BA 4WXWA 5H9EJ 1H2VZ 3W66A 4OHZA 1X4BA 3O2IA 3SDEA 4WWVA 1XR6A 3CJ3A 3WX8A 4MXUA 3D7HA 2F9DA 2AKWB 3I96A 1FRLA 1RZMA 4ES3A 4M5HA 1CQNA 4NCAA 2Z57B 2KN4A 4JV0A 2DCUB 2BSWA 4U96A 3R96A 3T6JA 1M5PC 4A39A 3EZ5A 2Q4ZA 3MEGB 3MTJA 1ZETA 2RB7A 4YB7A 1KUYA 3MD3A 4DUZF 4CGLA 3MM5A 2ZENA 4C0BA 4RU2A 2MQQA 1AXQA 3GTYX 1NPPA 4PK3A 4UWIA 5KFCA 1BQMB 1VI7A 2GIVA 1NB7A 1RTIB 4ZLJA 4ELVA 4EK2A 4CP5A 4CTAA 4EBCA 1YJ9S 2B9XA 1HYSB 2OMLA 4AQYJ 3TZXA 4MHPA 3DCAA 4U9ZA 2YNGA 2XO6A 2EUIA 4KPCA 1XMQF 1D8YA 5LRJA 4MFBB 3B78A 2PIYA 4E0DA 1FRXA 4DOZA 2AFSA 5ETMA 4BWMA 3H5ZA 4NCGB 2MY8A 3FEDA 4N47A 3MPYA 4DR7F 1U7LA 2Q04A 2B3UA 1R8AA 2JX2A 4N7TA 1F1BB 3DOKB 2OZUA 3AA8A 3AAWB 2HWHA 4ES1A 4RZRA 5J1EA 2D69A 5F48A 4DL4A 3GFYA 3I0RB 2JFKA 4OAEA 2CXEA 1Q95G 1UW9A 2VG7B 4Y2CA 1M5HA 5KT7A 3W8PA 2FVGA 3DM2B 4B13A 2YNFB 3T41A 1JNZB 1KDNA 1KKHA 1WELA 4K50A 2IVMA 4FD5A 3IR7B 3FCHA 3M2UA 4DX7A 5ITHA 1Z9UA 1JMTA 4LSLB 1LWEA 4EI2A 4YGOA 2LYVA 1U48A 4IDKA 3HVTB 2XM3A 2YH1A 4JV5J 4JI3F 5LYLA 1X4EA 3OTCA 1XRYA 2AU0A 3SYZA 1IB1E 1XR7A 2ERRA 2DITA 4GS4A 1SVDA 3QT7A 3LP0A 1TL1B 3PW5A 4O3RA 1I1DA 3HSJA 1N0VC 4KE5A 2FHMA 2OEJA 4OJGA 2IJRA 2XMVA 3DMJA 1HDUA 2R3VA 3HPOA 1RABB 2DNRA 5IV0A 3K5MA 5AE3A 3IN5A 2CQ0A 4IFYB 2ZPAA 5LRKA 7FDRA 2CPXA 4CAEA 1SXLA 5I42B 1VQ4S 3T1YJ 1H98A 4PSXA 3OTOJ 4LFAF 3GCWP 4HEA9 3IO1A 2A6OA 2MQOA 2Q7BA 5EWEA 2E29A 2OPPB 2EK8A 4FD4A 1SKWA 3R5BA 1DFDA 3T1HF 5DRKA 2PR8A 3M8WA 1S57A 5T14A 3ZXWA 4F2RA 4NXNJ 2E9TA 4OJ3A 3J81U 1GNKA 3KLIA 5GADI 3CPWR 4OZ3A 1KQFB 2WVFA 3UDCA 3M32B 4KVXA 2LP4A 1XMTA 1RWMB 2CG8A 3TAPA 5G0RB 2PMZD 2ZM6J 1FWKA 2XZTB 1FJGF 1SKSA 1VS3A 1JKHA 2ABYA 1CJVA 1U8WA 1J5OA 2AF6A 1NMTA 4N76A 3LODA 3QO9A 1T02A 4OC2A 1JX4A 1ZG8A 4EEYA 5KT5A 1RT3A 1PC4A 4JB8B 4DJLA 2N3LA 1DLOB 4EYIB 2KHDA 1SL2A 2E9ZA 4WKRA 3C6UB 4CLZA 2IPOB 3FDSA 4Q0BA 1RAOA 3FVYA 3EC4A 1DZ5A 2PJ2A 3KNGA 1Y7PA 3I31A 1EB0A 1NM2A 2V94A 2R7VA 1LK7A 4K4XA 2PJCA 3UN2A 4ZCIA 3AJ1A 2CQGA 1IBMJ 2IAJA 1IKVB 4WE1A 1UW4A 3UCUP 1UFLA 4ED8A 3V6DB 1VBYA 2KT3A 3C15A 3D28A 2WUUA 1M5KC 3HHLB 3B6BA 2CQ2A 3P8BB 4X4TA 3MMAB 4P9SA 1UL3A 2MPUA 3W9HA 2NREA 4CT9A 1URRA 1Y5IB 1JLBB 4X4RA 2FVSA 2Y8YA 4HHHA 2PJ9A 2VUGA 3BSNA 3G82B 3FRZA 1M1KT 1GH8A 4R76A 2WONA 1YJTA 3FRYA 3HKWA 2ZJQQ 1K44A 1OIAA 4LJMA 5LOQA 3W64A 3JSMA 3EGZA 2GVDA 2VXKA 2KI2A 1HLWA 2PT0A 3UD4P 2CJ9A 4NXMF 4I64A 2JOQA 1ZG7A 4JI4J 1SIWB 3MCOA 2EFNA 2A3JA 4X3RA 1X7VA 2GJ2A 2JWNA 3U1LA 1NDPA 4IRDA 3CVKA 5LSOA 3R7SB 3TC8A 2Z3NA 2VICA 4IF5A 2HHHJ 2ZKTA 2Z0ZA 1NU4A 4PPZA 3WBZA 1HNIA 1U0SA 3B3VA 2VJUA 4R9MA 2GVZB 2ZVSA 3IWXA 3HUVA 3UDLA 1NRKA 5KFYA 4MHZA 4B9MA 4PPDA 2QIRA 4R57A 1RB0A 2VFRA 2B43A 4C98A 3M8ZA 3PW0A 3MM7B 4BINA 2PRBA 2AJ0A 1Y9KA 1U25A 2W9BB 3GFHA 1VQNS 3BGRB 3UVJB 3QGGA 5I0CA 1S6QB 4PZVA 2ZDOA 1WWZA 2AFMA 4RWXA 3D7DA 3W91A 3P2FA 2ZH4A 1S5KA 3PV8A 3BN7A 3TARA 3JSRA 2EPIA 2K3IA 1FO1A 5EWFA 4DR2F 1FKPB 1M5SA 3MAAB 4TLRA 4WZQA 4XAKA 4YB6A 3PB9X 1N5YB 1VYAA 1LANA 4XNHB 4X5KA 4ORFA 2MLXA 3T8WA 2MY7A 4R8UA 5CZXA 1ON0A 4E98A 3WC6A 3EGWB 2DEIA 2MGZB 1FHTA 3N01A 2OMOA 4DI6A 3D2PA 2E7XA 3KLEB 4G1PA 3E01A 4X84A 1AZSB 4YP3A 1RA6A 1X4AA 4X4NA 1J2VA 3N6NA 4KIAA 1GMVA 1Q7YT 4R8FA 3TX8A 1LRZA 4OLLA 2Z3MA 4MK8A 3UD5A 2CWKA 2L08A 3IA0A 4GVBB 2F8EX 3D0IE 1QVFR 4P72A 4OHWA 4XPEA 2BMBA 1XERA 1HPZA 2RUGA 4OP4A 2HGMA 3KKWA 4JI0J 3GSDA 2C3UA 2DHXA 1RWPB 3IEHA 4ILLA 1S4EA 2C6GA 1RU2A 2ATRA 2REEA 3GQCA 2EFPA 3K59A 1TF9A 1IICA 4UEEA 3TANA 4CCHA 1FRKA 3NY0A 1Q53A 5KT4A 1NDLA 1LWCB 3MRUA 3G6VA 3HM9A 2C3YA 3LO3A 1JLGB 3CD7A 3VATA 4OZ5A 1YBTA 4A8OA 1WC5A 3RYLA 2J9CA 1SUQB 4RUHA 3CD5A 4M8LA 2MJUA 3UN5A 3T9YA 2X7BA 3B54A 5HROA 1N33J 5F0WA 4TU9A 1YTYA 4ZP9A 2BKNA 3Q24A 3UY5A 1XQIA 4FF1A 3QGPA 1RT2B 2XSJB 3BKFA 5KFMA 2OP5A 2OPQB 2PI5A 1AUGA 3GZ7A 4C8YA 4P4FA 1YMEA 3IBCB 1VQMS 1I12A 1ZPWX 1KZFA 2EWBA 2HRYA 1NJWA 1YKWA 3JTKA 1W2BR 2M0GB 3OQ2A 2Y0MA 3SFUA 2HHUA 3PR5B 3K8WA 4PWWA 3HT0A 1GQEA 3RAQA 3UR3C 2HFZA 2BBEA 1HW8A 4KH1B 4KPYA 4U6PA 1YDLA 5DDRC 2DHAA 4OC4A 2MYFA 4CLKA 3LTOA 3TVKA 2ZW5A 3A3OB 4M95A 5IWAF 2YQ1A 4PUOA 4XPKA 2QA4G 4QWDA 3QZ7A 3SIPB 4ZHRB 1M90T 3O44A 3KK1B 3NGKA 3DGPB 2CZ4A 3A8IA 3HMJG 1HNVB 3UCZP 1I1GA 3ZZRA 5C24B 3ZZUA 3J7YU 2NR0A 1R8BA 1QM9A 2XTJP 2W2PP 2OFHX 1RT5B 2YPZA 3AB4B 4DR4F 4H4MB 4ZOSA 2R98A 4H2KA 1NPKA 4XPLA 1N54B 1Q2YA 3OT9A 3Q8SB 2EG1A 2H4YB 2HQYA 1SC4B 2KYXA 1IKWB 1EP4B 2BANA 1TL3B 3PNIA 3OD2A 4OI4A 1RKIA 4PYDA 1XBUA 4MYTA 2ZKUA 4L76A 3ZJ0A 2W2MP 2V8GA 1S59A 2ZEPA 2Q44A 3OLAA 3S9LA 1FTRA 3MPVA 4UBRA 4M5KA 4HTIA 3JYTA 1C4CA 3GMGA 3DC2A 2AIRB 4C97A 4QUSA 5IB9A 3VALA 4RNFA 2ARHA 2CQPA 3TA0A 1WEYA 2ACYA 3PKYA 4KORA 1EE3P 2HK2A 5KFNA 1GMWA 4A32A 3QIPB 4IKAA 2K1RA 1YJRA 4B12A 3ZZZA 3CSKA 2C2MB 3SXLA 1O51A 1YITS 3SDEB 4FYDA 4YY3J 2PC1A 4LF9F 3K8VA 4HNWB 1R8HA 1V5VA 2VF3A 4QYZJ 1RYRA 1MMLA 4FNIA 4ZK7M 2JLEA 1QVGR 5E41A 4LF8F 1ZM9A 2EBJA 3TTHA 4KSFA 5KFSA 2J6UA 3HLPA 3VTIA 3H42A 5EDWA 2UVRA 3QMQA 5I3UB 1VLOA 5JQ4A 3H25A 3F5BA 3ZFVA 1JK9B 4RL1A 4U8VA 4F9UA 3MM5B 4C9DA 1S7IA 2QC3A 3BH6B 2KKHA 2UV8A 2G0IA 1FX4A 3ADAC 1VIOA 1XIQA 1S1TA 3UDVA 1ZS6A 2C2EA 2RC4A 2RS2A 3BQ0A 2EK1A 4FKXA 2IHR1 3R27A 3MPWA 1VRQC 2HBYB 1K1SA 3K2YA 4DPUA 4YUDA 2WAQD 2MJNA 2B9YA 1EQ0A 3SI0A 2QLXA 3KHZA 4NA3A 1LNQA 2DTJA 1YJWS 2YNGB 1S49A 1VHSA 3D68A 4KGMA 1RWXB 4ETXA 3EICA 2GW8A 2BM1A 5D77A 1HHTP 3DRRA 4Y34A 3U27A 3M8PA 4H4OB 1Z4EA 1G4CA 3PJ9A 2W25A 4DV0F 3CCLS 2HGNA 5ELYA 1D0EA 3LA0A 3FB3A 1FEHA 3G2XA 2HB6A 3R5AA 4DUYF 3C14A 3F56A 2B51A 1NJZA 2HGLA 2VBYA 1VISA 3G4SS 4JI2F 4K59A 5F8GA 1VQPS 1VFJA 5H9EK 5B7WA 2ANPA 5J1EB 1NSQA 5CPAA 1RLDA 1NO8A 1TUVA 2MXYA 3IRWP 3I9SA 2OAUA 3KDNA 1OWXA 5KTAA 3BHXA 1JLCA 3GJTB 1UMJA 3TVYA 2FY1A 5HAOA 5F0UA 3WIVA 5IS2A 4CAFA 3NH4A 1M1DA 3D4JA 4M5JA 4UZCA 3M2UB 4IR1A 2RQKA 3S1TA 1M0SA 2WZNA 1LWEB 4IDKB 1VQLS 2ZDPA 5E7OB 2FDNA 2ATCB 3ET6A 3M8RA 3Q23A 5K8PA 4WF9Q 4U7UD 2XLKA 3CGIA 2GIQA 4LF4F 2K06A 4OX7A 4F4XA 2FIAA 2ROEA 4LBHA 3LP0B 4DWIA 3L3CA 3ZZIA 4QC6A 2K7JA 1YI2S 3MCSA 3R6GB 4K2JA 3HP6A 1N71A 3DMJB 2QYVA 4PXBA 4A8XA 2ZBQA 4EFAC 4HHJA 1PCAA 1KVIA 1MW7A 2OSQA 4MT1A 2HHTA 3FBCA 3CJQA 1DHMA 4Z7CA 5BWAB 5KTQA 3ULHA 2DHSA 4GRSA 5CYMB 2PRQA 3KI9A 3J7A1 2CYYA 3QJJA 3A8JA 3R9FA 5L38A 4NA1A 1C0UA 2E44A 1S0VA 3F0AA 4F4YA 4QU7A 4QBJA 2I8EA 3OTDA 4LT6A 7CPAA 2XWXA 3H4DA 3PO5A 4OADA 3MUVP 1NMEB 2HZVA 3NEKA 2YKNA 3HHNB 2PMHA 3SCJE 1MMDA 3IP0A 2VBXA 3OLBA 3KLIB 3V4IA 4RKUC 3IGRA 1P9YA 2ALZA 3SQGB 1IUJA 4I7FA 3F73A 3C19A 2JH3A 3LOUA 5DWNA 3IC1A 4OZNA 1VQ7S 1KQKA 5CH7B 3GIMA 2PFFB 1JKHB 1CBXA 2Y1IA 1CJVB 5EUHA 1J5OB 4HYKA 2JVRA 3QO9B 1HQUA 1TU0B 1U4BA 3TUZC 4Q5VA 3HVWA 3VWDA 1AFIA 4EBEA 1C1CA 1RT3B 3TEGA 4RNNA 3T19A 4P4JA 1ZZNA 4G1QB 2QA2A 1VRTA 1WOSA 2BV3A 5HQMA 1YBUA 1B70B 1Z1ZA 1K73T 4Q0BB 1XJWB 3T90A 3MZIA 3FC9A 3I55S 3HJVA 2CTCA 3EDQB 5HN0A 5IQQA 2VPZB 4B11A 1FWLA 2IAJB 3AXMA 1OYEA 2V6AA 1QQ9A 3RRHA 3RB4A 1R6VA 2VC1A 1Q8LA 2FVPA 3W8GA 4WE1B 3BSOA 1B0VA 3FXTA 1WSRA 3C15B 1Y5NB 2YKQA 2LA4A 3J81j 3NGSA 3P49B 1U0HA 1R3NA 2AYBA 3UDEA 2H5IB 4W4MA 2Q7SA 1FXLA 3RB3A 1ELOA 2EG2A 3H8FA 1OSDA 3FMBA 4JYAF 3H5SA 1MSWD 1TKDA 1R43A 4DNCA 5IT9U 4B9LA 3GFZA 4DZDA 3CCQS 2WONB 4X65J 2K3KA 4DCJB 3EZUA 1ZPVA 3LAKA 1B0TA 3JSMB 1JB0C 2P6GA 2KRBA 3R5JB 1KWMA 2GVDB 2PJ3A 3D4UA 3ICLA 4RW4A 3CXCR 5THWA 2RRBA 2CJBA 1WDTA 1S1UA 3FJUA 4DV3F 1LXJA 2Q79A 3IFEA 3RU0A 4ANDA 2MKCA 2VFUA 1Y4ZB 4WFXA 1ZLHA 1NE9A 3DHXA 3HT3A 1BOBA 4F2SA 2DVIA 1S5ZA 3DLKA 2BQRA 1HNIB 3MD1A 2VOPA 4WWSA 4LF7J 2HNZB 1MROA 3NBPA 5EMIA 1RCOB 2XYPB 5KG4A 3Q2SC 4B3RF 1D09B 1NK0A 3MHYA 2PJ7A 1K4JA 5HI7A 2XSFA 3BSAA 2KTQA 2DXDA 4NZ7A 1QAIA 3HHKA 4X64J 1OYDA 4NYOA 2KT2A 2YWGA 4I49A 2P6TA 1K1QA 3VHQA 2Z3LA 2JEVA 4NZ0A 2EKNA 2M70A 3IG1B 4DU7A 2CQIA 1TP7A 2GE3A 1Y5LB 4TN2A 5HLFA 1GMUA 2B58A 4FUUA 2V9WA 4CLFA 1WF0A 1OS5A 4KSAA 1SQHA 2ADBA 4P2SA 3G8WA 3Q8YA 1JJ2R 4DQPA 1IQZA 3GKRA 1MNEA 2JVOA 1REVA 2N7CA 4GKKF 4E0AA 1OY6A 1FERA 4R8UB 3NP5A 1N8RT 5I3QA 5KG1A 1PU9A 5ETTA 3BGUA 5GMEA 2Y1JA 2DXEA 1HWKA 1VRUA 2VQFJ 3D2MA 2B4DB 4YN3B 2KYZA 2VH7A 3QRRA 4RO0A 4X2BA 3AJDA 4I2QA 3ZZPA 4C0HA 2KT5A 1HPZB 2HHWA 4NLWA 3KQXA 2M88A 3PTWA 3K7RA 4JBCA 4K8RA 2NMTA 6FDRA 4ECUA 2BJEA 5JPHA 3PYDA 4YEAA 1EZZB 3JTOA 1MK4A 1FESA 1B7FA 2AYMA 2QEXS 3SZ2A 4F4WA 4F67A 4I2PB 1IKYA 1HR0J 2CDQA 3TVZA 3ZTQA 5IFMA 3BLNA 7FD1A 5ETRA 3NNCA 1XFOA 4OLPA 4JWPA 2CNLB 2FLPA 1CS4B 5DG9A 5DGAA 4PWUA 2GANA 1FCAA 3ZO7A 4OX9J 4O3QA 2NYHA 5HROB 3KG4A 4LQ9A 3N9UC 3L09A 2KJVA 4C8NA 2ZZMA 1XIXA 4U95A 1IYKA 2Z10A 2B7CB 2BE2A 2VODA 3SCKE 5CYQA 3MCMA 4YMEA 3UWTA 4JV1A 2FJDB 2YKMA 4NGPA 4CLTA 4K3NA 1XTZA 1HA1A 5F8LA 2HVZA 3GYNA 3S01A 4EGLA 2QA4S 3SI8A 2R7HA 4KQZA 1UVMA 1VQSA 5J2QA 3TYTA 4C3KA 1RT7A 4F25A 3W62A 2DNQA 1N5VA 4ZLLA 4J9PA 2R8IA 4ZPCA 1EETB 2OI2A 3QSYB 1NBEB 2E1PA 3GG0A 1ULRA 4DLEA 4PUOB 1SJQA 4RUCA 2CF4A 2VI7A 4AQYF 5E96A 1VMBA 5ETNA 5DETA 4B9UA 1NKBA 4NMXA 5A8RA 1HD0A 3D6FB 4IAVA 1VQ9S 4ZVUB 3B3SA 5B08A 1TIQA 1KSPA 1WTBA 1Z8WA 2RKIB 2PJ4A 2MLYA 1XWLA 1F2OA 2OZGA 1QTMA 2IVYA 1Y7EA 1JLAB 4CGPA 1PYSB 4C8OA 5G20A 5HP1B 1ARLA 2LDYA 1VR6A 3BB5A 1MJBA 3DFEA 5IX3A 3GONA 4DL3A 1J5EF 2HZAA 1CJWA 2XCAA 2LQBA 2WSAA 4OC3A 3A3NB 5F8NA 4ED7A 3JYTB 2ZEOA 1G1XA 1DE4C 3D8PA 3KUGA 5A8WA 1HEEA 1T3OA 2QSWA 1Z4RA 1NKCA 3K5PA 1YVKA 3AH6A 5HO4A 2K1RB 4JI5F 2E5GA 1DTQA 4JV5F 3PW4A 1WSVA 3VQTA 4LFBJ 1CPSA 4YWYA 4MH8A 2D7SA 4BWJA 4M85A 2HIYA 2BJ1A 2HRTA 2HSEB 4Q2MA 1WI6A 1S6OA 5K20B 2MLZA 2DHGA 4CIOA 2NSMA 5KFZA 4KV8A 2RRNA 2O5DA 1CC7A 2QVPA 4FS2A 1APSA 1U6MA 1FE0A 3P96A 3FMWA 3UE2A 1UEKA 1JIHA 1RKJA 2KXHA 1A9NB 3WC0A 1UTAA 2NZCA 2BKOA 1PYTA 3PM9A 2ZOMA 1FVQA 1CP7A 2EFGA 3G9CA 4JI7F 2V4JA 4PXCA 4XPDB 2LDIA 2LXUA 3TZZA 2V67A 1WC0A 5C42A 4UWJA 3FBFA 4PK2A 2AZ1A 4IUSA 3WC5A 5CCLA 3T1YF 4ILRA 1ZAXA 4UEFA 4DR6J 1S1TB 2GNKA 3OTOF 3NXZA 4ANEA 4E2FB 3MXHP 3VCDA 4C2MA 2EC2A 2L9NA 1I5OB 4FXWA 2CJXB 2PA3A 4QYRA 3MMJA 4DSIA 1BE4A 2KH9A 2WOMA 4TU8A 3TAQA 4I67A 4DL6A 3PCOB 4LQGA 1T9VA 5AXMA 4NXNF 4DG1B 4UFWA 2QL9B 4FDFA 1IBLF 1ELLP 3HSDA 3PO4A 3M30A 1P1LA 1UZHA 1IVZA 4CNYA 2FHKA 1B99A 2AFZA 1BLLE 4W98A 5BR8J 2BUEA 3M8PB 4J9MA 2C6CA 2ZW6A 3SCLE 2ZM6F 2CQBA 1M5OC 3NNHA 5DO2A 4EYHB 2G9OA 2ILZA 4LIWA 1MWYA 3C14B 4DSKA 4DCPB 1LFWA 4CYNA 3K2KA 3W63A 1V6HA 3MWBA 2CPYA 2BE7D 4YFUA 2MZSA 2QJ3A 3A8KA 1VBXA 2ZH6A 3GR1A 1QSSA 3CJTA 8CPAA 1U1KA 2X1FA 3DDNA 3M2VA 4U67Q 3IWNC 3CCSS 3S9NA 4WFZA 3EXCX 2X3DA 4IK2A 2QFIA 1NSKL 3UNGC 3I82A 1JQGA 1P6TA 3QFWA 3Q2TC 3PYGA 3SFGA 5L1IA 2BZ2A 3DI6B 2QLWA 4OYMA 2I38A 4QB9A 3D54A 3QWUA 1IBMF 2ZWPA 1HMVA 2YX7A 1NK9A 2KXFA 2XLJA 2ZJRQ 3W6SA 4TQSA 4LRBA 4J91A 2IIHA 1REGX 4ECRA 1FD2A 5KFLA 3L7OA 4F3QA 1VLYA 2WVBA 5LMNF 1X4FA 2HIQA 2HLTA 4LR7A 3THVA 1JLFA 5IV3A 1UPMB 4AVCA 3EGNA 4K4TA 4P4DA 3MCNA 3ETOA 4P71A 3KHGA 2NZ4A 3HKZD 4KOXA 1SPBP 3PKMA 4ZCLA 2G3TA 2QLFB 3V7ZA 2B4UA 2A0FB 2IM1A 3AFGA 4JI4F 2DY1A 4J9RA 1RWWB 1RWVB 2PO4A 1C0UB 3RRGA 5CD4H 4HVZA 2V69A 2XG8A 2D41A 2JLMA 4C8MA 5KT2A 2HHHF 2YNDA 2KU7A 3MAHA 3HZEA 4G6VB 3GU0A 1V0CA 2JLGA 4P74A 3V4IB 1FKAF 1G3OA 1N34F 3K5LA 3MTKA 4IQXA 3BPSP 3PVXA 3MEGA 3K9UA 2R4FA 2YNIA 3KJVA 2QYGA 3N7ZA 4OZJA 3VV2B 1YK9A 5KAKA 2X51A 3PB7X 5D0EA 3OVSA 2FE7A 4F3OA 2B56A 2VPYB 3AY0A 2J8RA 5J8CA 4NRTA 3ENWA 1A6LA 3M6VA 1C1CB 4TY8A 1IR1A 1PAEX 5F8MA 1BO4A 1VRTB 4UEZA 2XMJA 3W65A 4B10A 1TUWA 2D3UA 2XS2A 2F4VJ 2DPTA 5KFIA 2OZHA 3TOBA 2DT9A 1N0UA 4CH0S 1YQHA 4KOYA 4KR0B 5JUMA 4KGVB 4F0XA 4MK7A 1CM0A 4ECSA 2NYIA 4MYUA 5A76A 1I6JA 4G3IA 4AFFA 3BO3A 1WHYA 2IA6A 2E7VA 5HVHA 2E5IA 2C2RA 2KFNA 4RR5A 5KT6A 4Q8FA 3KHXA 2P2CB 3DU6A 5ETKA 2ZH1A 2ZEMA 4WU3A 1U0HB 4JI0F 1BQNB 4B3MF 2XC9A 1IM6A 2Z2ZA 3UCGA 5KG3A 4Y2KA 1SL0A 3BZQA 3FGVA 3I0RA 3T9NA 2HFOA 4Z7YA 2UUAJ 4NGMA 5AG7A 1RUSA 3S6GA 4P75A 1KQSR 3UW1A 3M9MB 2QLJB 4F3MA 1RAHB 4A95A 4PRFA 1FY7A 3ISZA 4RW4B 3CCMS 1PGZA 1HWUA 4C7IA 2V8DA 3NOCA 2BCOA 2FL4A 2NSBA 3K58A 1MWQA 2DNGA 2XULA 5B09A 1S1UB 5AGEA 3MM6A 2HBQB 1N33F 3M9NB 2DR7A 5AJ3F 5C88A 1X0PA 2L9DA 4TYAA 5LJ3Y 4ZPWR 3M2RB 3DLKB 2HVIA 3RNZA 4KLWA 2BM0A 3C66A 1TZ0A 2NCKL 1TFYA 1MU2A 3VF0B 3GPAA 5HSPA 2RDDA 2XHWA 3V8IA 3HD2A 3AT1B 3R7BB 5A0YA 3PP9A 3MMCA 3BR9A 2Z11A 5ETPA 2UXCJ 2AD9A 4NRUA 2DNMA 4OHXA 4AB7A 1F2HA 1ROFA 2OB0A 3RG6A 5LL6d 2G1HA 1NK6A 4EMDA 1U1RA 5HLFB 1TMMA 2RJZA 3DRXA 3GIIA 3U7JA 1FNXH 5D29A 2BEFA 4EO8A 3KFWX 4PQUB 1FFSB 1ZAWA 4OMEA 4ZVTB 5KFEA 4DQIA 2BE9B 1REVB 2MHEA 3WX4A 2ZD1A 3GP9A 1UEUA 2E9RX 4C0OC 3SJEA 5CQGA 1IYLA 4X62J 2JSXA 4NGRA 3TUPA 1ZYQA 2V0NA 5LMUJ 3G8QA 1VRUB 3J80Y 2WPXA 5G0RA 1TKZA 2UVWA 4I2QB 4PABA 2K2PA 3MEEA 1Z2ZA 3ONQA 4CRJA 2ZEHA 2ZJPQ 2ZH2A 1YVOA 2Y3YA 2F40A 1JWQA 3IWLA 3VGUA 3RBZA 2ZXVA 4DSLA 1O6XA 2HQGA 1XNRF 1RAGB 1OMSA 2G2OA 3POTA 1WG5A 2JEJA 4HLBA 3I5BA 1DLOA 1N5TA 3LPYA 4B9SA 2EWHA 1TMJA 1IKYB 3W2VA 3C6UA 2BVZA 2QIFA 3SJGA 3WHIA 5HQLA 2SXLA 2WK4A 3I32A 4OYPA 3RB6A 2GFFA 1N48A 5F47A 4OIDA 1S0OA 3VARA 4LX9A 4YY3F 5C5JA 2RF2B 1U2CA 3ENVA 4FBUA 3BJ7A 2XMMA 3PJXA 1Q78A 3NH8A 2FZCB 4S0MA 1M1HA 4MKYA 1QE1B 4WXOA 2CQ4A 3TNVA 4CGNA 2DR5A 3SXNA 2PIIA 3CT9A 2QE5A 3V6DA 3KG0A 1R89A 5A2QU 2QLBB 4ID8A 4D3HA 4NSQA 5KFHA 5CYQB 3TEHB 3NGUA 2ZE2A 2YKMB 4I1TA 2EO8A 4DQRA 1YW6A 3OFHA 3IU1A 3LQVA 5FLXY 4M6HA 2HZCA 4X4SA 4USIA 3G82A 4CZCA 1V3RA 1IOFA 1TL4A 2BX6A 5J2QB 5L9XA 2MDAA 1RT7B 3KXDA 1WHVA 2GQCA 3CDWA 3JTPA 4RJVA 1EARA 4GVLA 4DV5F 2G9DA 3ILJA 3CMQA 2ACMA 4ZCMA 5AE2A 3OXGA 2ZH5A 1XF8A 2PCUA 3AODA 2DH8A 5J1PA 3RRKA 2UUTA 3K5OA 2CJAA 3K57A 3NKYA 2OOTA 5KG2A 3I9ZA 4NLRA 2B4BA 5E3QA 4CRYB 3N79A 1WD6A 1RE1B 1ZA2B 3OFFA 1GAOA 2FXFA 4B3TJ 3HFKA 3I0SB 3BYRA 4F0MA 3EFAA 4ED1A 1U1NA 3O6QA 3FSIA 1KBRA 1KOHA 3MAQA 3DGVA 4BLGA 3WDOA 3KLFA 4MI4A 3NS5A 2KG1A 1UWYA 3PDNA 3P5TL 3TJ8A 2DNKA 1C1BA 4DV4J 2B9EA 2B8QA 5JM6A 3I6PA 1N32J 4DUZJ 4FPIA 4NLDA 1YRUA 3CCZA 3VZHA 2R7OA 4I56A 2G13A 3EXYA 3UVJA 2R2RA 5IC6B 1RQ0A 4FF3A 1A0OB 5LYFA 3ETMA 3CPAA 1NSLA 2QA1A 2OPSA 3L9ZA 2Z3OA 4QIFA 1L3VA 3V38A 1S4FA 1NHKL 2OELA 2CPEA 1XK8A 4LF5F 2YY3A 2UXDJ 1RTQA 1HNXJ 4UFXA 4ZP7A 1ELMP 4A30A 4CT8A 3HFVA 1CLFA 2FHOB 4ED4A 4UOHA 4J37A 1X4GA 4DSJA 5ISVA 2D9PA 2HNYA 2UXBF 3KLEA 1WHXA 1GHEA 4ZPDA 4HKQA 1HIYA 1WK4A 1S76D 1RCXB 2ZH8A 3CD0A 3SBMA 2DR8A 4CYQA 1SC1B 1WOOA 1Y00A 5IC4B 2J9DA 1I94F 2ZEDA 2ZWOA 2JHEA 3W9JA 3NLCA 3LH2S 1KRPA 1PYTB 4Y00A 5DDOC 2N82B 1HNZJ 2LCWA 4WJBA 2V4JB 2XO7A 1RU1A 2ZZTA 4QPTA 5C42B 4HDGA 4NZ6A 4FKYA 3KUEA 4P2XA 3HK2A 3FMCA 1S7NA 4CQ1A 1KR4A 2VFTA 3N6MA 3M6XA 2H5JB 1NK8A 4MY3A 4KC5A 1HKAA 3GV8B 4MKBA 1YLOA 4M1KA 2FGCA 1IBKJ 3KK3A 2FPHX 1V5IB 2RQ4A 2N7YA 4ZY2A 2WOMB 1PAUB 2XEFA 4ZMMA 3IWWA 2PIZA 3Q86A 4IFVA 5KFOA 2NXUA 2O4HA 2DGXA 3M30B 4C3MA 3EUNA 2RIJA 2WTFA 1W7WA 3FZBA 1YR0A 2OPQA 3WABA 4O3SA 2ZHAA 1TTHB 4QIGA 3ITHA 2MTLA 4IH5A 2F3JA 2CG4A 4D3GA 2RHQB 1M4LA 1XC9A 2G2ZA 2J8AA 1K9MT 1O0PA 1N5SA 2M8HA 5KG5A 2AFXA 4DR1J 2R7TA 5RUBA 3CCTA 1E6VB 4F7VA 1H73A 3VVTA 5ETLA 4LFAJ 3IWEA 4CLWA 3M2VB 4YHHJ 1Y0RA 3KR4A 3PGPA 4U9RA 1R8CA 3L2NA 2H9ZA 2KO1A 4W90B 3OR2B 3PZPA 3FCWA 2BJ9A 2CPDA 4ZHRA 4IUFA 2DR9A 2RAQA 2P9EA 1HWJA 1U26A 2Z2LA 1TAUA 2DY9A 2QMUB 2QV6A 5D78A 3H7HB 2XQCA 2Y1LB 2J0QD 3DLGA 4DU8A 3KMQA 4ZN3A 4H4MA 2P6SA 3AD7C 4P4EA 1VBKA 3BYPA 3H4QA 3JQKA 3HJFA 4I68A 2VQEJ 1KHVA 3OL8A 3R9LA 2LKZA 1PSDA 3FBEA 5HVGA 2OUGA 1JLFB 3W3SA 1FDNA 4ZA1A 3FNCA 4NLTA 4TXSA 2AWZA 1S9FA 4XPCA 4N8OA 3CPXA 3NE8A 1F9FA 4RW6A 4R3KA 4X4OA 3LD2A 4ZJQA 2NQPA 4NX9A 4UT4A 3OXLA 3R1KA 4NLPA 4WFAQ 1Z2LA 4K7QA 2IY5B 4DYOA 2IL4A 5GVQA 1LWFA 3IJ3A 4USUA 4JUZA 2C28A 1T9WA 3H40A 3FUYA 2DIVA 1U1QA 1S77D 2QMXA 2B5GA 5F8HA 4USTA 4HT5A 2FB0A 1CJTA 1LXNA 4L6V3 5DQGA 2XMAA 3SEOA 1YZ6A 4R0EA 2WSCC 1RA7A 3GYAA 2YWKA 2YNIB 3KJVB 3VQSA 1NKEA 1GX5A 2DH7A 5I3UA 4URSA 4X64F 5J2NA 3CWJA 4RW9A 4L72B 4CH1A 3IM8A 2PEHA 4I6WA 5DJBA 2VHGA 1MN7A 4OC5A 4TY8B 4NXMJ 4DL2A 1X5PA 3M7VA 2I0XA 3DRYA 2XB2D 5HMNA 4FP9A 1RHMB 1M4IA 1TL5A 5E3RA 5KFWA 3QBCA 4CLLA 1LK5A 3TOQA 3D9BA 4P4BA 1H2UX 2QT7A 1KTQA 3MURP 3A12A 5J2PA 5M2UA 3DNCA 5KFJA 1VQ5S 3U1MA 2G1DA 2J8MA 3FEZA 1KQGB 1NSAA 1XMBA 2C3OA 2FJWA 4H4OA 3F41A 1BMQB 3THTA 4KJIA 4P45A 3I4HX 4P7TA 2UUBF 4DR3J 4UQTA 4HR2A 2FHJD 2R2UA 4DQSA 2XY7A 2VONA 3OR1A 3SV3A 5GCNA 1BPNA 1KC8T 2X1GA 1BLUA 1AW0A 1KONA 3D6TB 2B4PA 1R7IA 6AT1B 4DLGA 2D3OR 4ES2A 4NJRA 4P4IA 1KFSA 1VOMA 5CAAA 3C8YA 1UVIA 1FWPA 4DR2J 1HR0F 2ASDA 1PJ7A 2AGOA 3J7Z5 1J4JA 4PQAA 1W26A 4FYYB 3PX0A 1IKXA 1SC6A 3FKBA 2ZH7A 2JJ4D 3CJ4A 3MM6B 2XCPA 2OTLS 1JJCB 3FK4A 1HBNA 1ZAVA 1RLCL 2J6SA 2ROGA 1SJ3P 4MHDA 2QZ8A 2HFSA 5H86A 2IJNA 4LF6J 1R0BG 5CBMA 2W4DA 4YQWA 5CABA 1SC3B 4UOFA 1OQ3A 3NRBA 2GO9A 2J76E 3MOJB 1MU2B 3VWEA 4B9NA 1LCPA 2J9EA 3M1VA 4ZVPB 5A0YB 2MKSA 3MMCB 2CVIA 2Q6CA 2I3CA 2LQ8A 2FJBB 1Q5VA 5CHCB 2J7WA 3EZOA 1VQOS 3LPEA 1TKHA 3KG1A 4N8NA 3TFYA 4A4JA 5KG0A 1RT1A 2KCWA 4ZIVA 1Q2DA 2XEXA 2A10A 3KWMA 4WTOB 1Y9OA 4QJVA 2AV5A 4L75A 5CYMA 3GJRB 1IXKA 2EW9A 3NNAA 2VEZA 1P9QC 1VK3A 3GE9A 1VC6A 3W61A 1RAAB 4P73A 4NFRA 5MAOA 2PJ0A 2RSQA 1DQ9A 2J6TA 3DLLQ 3DLBA 1IM4A 2UUWA 1X12A 2ZD1B 3RJMB 4A46A 5LSLA 3D7SB 1NJIT 3A9LA 4KGZB 3CB4A 3SQGA 2QFJA 4ZY1A 2ADCA 3G6YA 2CNSA 2PJ8A 4QR1A 2CIJA 3CMAS 1KEKA 3H0PA 4DHVA 2J7UA 1V9OA 3MUTP 3D2WA 5KFUA 1S10A 3D1HA 4NGSA 3KL9A 1TKZB 2B3TB 3T5KA 4Y2AA 4ZCKA 1S60A 3UNYA 3MEEB 2FQQB 4UTGA 4HT7A 1RT6A 3BJ8A 4K30A 2CA9A 3B4MA 3QGHA 2AJQA 3JS9A 3MPUB 3T9ZA 3HZGA 3E8OA 5FDLA 2QECA 1UVNA 3P45B 1CP6A 4A37A 2D9OA 3POTB 5B0AA 4G1QA 1R8PA 2JL9A 4ZGYB 3CJ2A 4RW8A 4ED3A 3RBEA 2C3PA 2RU3A 4LBPA 3R1HA 1S0NA 3W2VB 3KJQB 2CQHA 4P6YA 4J90A 2AMCB 4UW2A 4UY8T 2V2KA 3A8EA 4QWBA 3TWZA 2UVUA 4LFBF 2O28A 2DO0A 2GIRA 4TQRA 3P6YC 2KHCA 4IG3B 1YX0A 4A8MP 1PJ5A 4U9YA 1KN6A 2Q4YA 1PBUA 2M2BA 1M44A 2DD8S 4OJ1A 2LECA 4YDXA 4TLQA 5JJBA 3NWGA 4ECZA 4W92B 4ZJOA 4R3LA 3QT8A 2RE1A 4N41A 2ZE2B 2ZZNA 4QWAA 4OYWA 1NJXA 1S1XA 1HL6A 3V6KA 4DV2J 4KSIA 1SQGA 4FWUA 3CJ5A 3QAUA 3W5YA 1T9XA 4FVMA 4Y65A 1RTJA 3SJXA 2MZTA 1UJ5A 3DLHA 2YTCA 2F8HA 1Q81T 2DNYA 1EQMA 4DPWA 4UFVA 2PA8D 4F0HA 4ZYQA 3OV7A 3UR0A 3OUYA 2BABA 2ZEFA 3M8QA 4F8ZA 1D9AA 2AX0A 3C2PA 3K5NA 2I5JA 3V4MA 4NE9C 9ATCB 5HL7Q 2J9DE 1UZDA 3GSIA 3Q22A 3TA2A 5BR8F 2BXJA 3GILA 2FLLA 5G4DA 3NGDA 4QOTA 5LXRA 4KOUA 4UIAA 2HNZA 1M4GA 3TO9A 4KBIA 5ETSA 3KLFB 2DYAA 3AOAA 2PJBA 2XI2A 4MRIA 1C1BB 1CQMA 4EBDA 1UVLA 4B3SJ 3VAJA 2VDHA 2NXEA 4QBUA 5EX0A 4ZP6A 1HI0P 1ACMB 3T3FA 2HBZB 1VIXA 2OPRA 2NPIA 3OPKA 3KR5A 4OYXA 3KDOA 9RUBA 3LAMA 3IG1A 1RJJA 1JJ4A 4AG9A 2MZ1A 3CCVS 2OPSB 4JJXA 2CTBA 5KTDA 5KFAA 2EBEA 4JI8F 4J9SA 2G2YA 3R7NB 2XZDB 2ODFA 1E6YA 3BBCA 3BBBA 4MFLA 2C6PA 5ETVA 3KK2A 3W5ZA 4PCQA 4M6IA 1H7XA 3LWUA 4GO5X 1RTHA 2LMIA 2CAJA 1RHJB 4ELTA 1HHQA 4USVA 5CYJA 4GMKA 4DUTA 1QAXA 4RPFA 4J9KA 3QAYA 4YOEA 2LLZA 2HNYB 4O0NA 5H9FJ 4RNMA 5DM6Q 2FLNA 4O44A 5GAEU 4BBYA 2JNJA 1H38A 3QB8A 3J7AN 1Q0NA 1BWEA 3EYZA 5AT1B 2B4DA 3FQKA 1LWXA 3G6XA 3CCJS 4HI1A 1PIEA 4JI2J 3QATA 2VZYA 4GC7A 4ZVSB 4RBVA 2ATLA 1FTCA 3ENAA 4A8KA 2V63A 4USHA 1AYEA 5B0BA 1BHNA 4MCPA 1SQFA 1U2RA 5IV4A 3R9EA 1TF8A 4I2PA 2G0CA 4AVAA 3X1LB 3C16A 2NPFA 4MKAA 4AYBD 5CA5A 2ZBCA 3KK3B 3GWCA 4F9VA 4ZN1A 1CS4A 4LSNB 1TV6A 3B82A 1NK7A 1IBCB 1K8AT 2JFDA 3HVAA 3QSIA 3ZTSA 4IFVB 1X5SA 4RN7A 1WORA 4A31A 1T9UA 4B6ZA 2KFZA 2Q51A 1FKOA 3JVNA 2PJ5A 1HDQA 5DWMA 4CPAA 1SH0A 4ETZA 2IM3A 1N88A 4GM5A 2GHPA 1FJEB 2CQDA 2DK2A 3TO7A 4Y28C 3ITHB 4Q8EA 2L9WA 1RO5A 4KB7A 2WW4A 2ALYB 2Z8QA 2Q66A 2XY5A 4PV6A 1D1UA 3OWCA 4FD6A 3NMAA 2B9WA 3TE4A 4CLPA 1Z8LA 3FIXA 1EETA 3LACA 2FVQA 2JBJA 1G2EA 4HKFA 4DUKA 5B0FA 2C2NA 2ZFHA 2I79A 5D0GA 1VHFA 1P4NA 3I87A 4KS9A 1R0CB 4A8YA 3HVRA 2GFQA 4KGKA 3SV4A 3RZAA 2QJ8A 2DF5A 1S97A 1WC6A 4A94A 2Z56B 1MLAA 4JZ0A 1YJUA 1AA1B 2U1AA 1ITPA 2W1BA 3S6HA 4ELUA 2D4PA 2HKEA 1XE4A 3DLGB 2EFQA 1GYTA 1X4HA 4P2FA 1HBMA 4C3LA 3R8YA 2H48B 3CC7S 1JLQA 2RKIA 3J80U 3FF3A 2XEJA 4B3OA 3PHEA 1S3ZA 1HHSA 4AUKA 5JXSA 3VH9A 2VKZG 2R8KA 2OO4A 4HNXB 1JLAA 1CJKB 4LBIA 4KOWA 1ZH5A 3NOGA 4NPOA 1NUEA 1KTVA 2DRAA 3PFEA 2DNLA 5HP1A 4C7QA 2AEFA 4WZMA 1X5TA 2V2ZA 3DDIA 1RWNB 2UUAF 1URNA 4KHPJ 2HQ3A 2V9KA 2JDCA 1GXUA 4WTYA 2ZNYA 2HHQA 5IZHA 4X66J 2B6AA 4RW6B 2W8KA 4JOUA 4OI1A 4RI1A 3QT6A 3DRSA 5IM0A 1BQXA 2EEYA 1LWFB 2PEBA 2CJQA 5ETQA 4Z37A 2FUG9 4N77A 2A2DA 5KFXA 4LVNP 3ZTPA 3D3BJ 1JNRB 3HCXA 5L9NA 3TR5A 3HHDA 2O53A 4RW7A 1NZ8A 4JD6A 3ILIA 2R8HA 5A6WA 1TK0A 2V68A 2B5GB 4F8RA 1FXRA 3TUJC 2RH3A 2YX4A 4OYOA 1ZLIA 3LWMA 2HUZA 1S72S 1CJTB 4K0KJ 1Q2CA 3JAMY 4OV1A 4OLOA 3QAEA 4LR9A 3VAHA 2RDIA 3T5HA 3TOAA 4BMHA 2WRMA 3PBBA 3CXSA 4OMFG 4YS2A 2DEAA 2E5JA 1L0CA 4USKA 3RB0A 1U2FA 2WBRA 2UXCF 1ZOTA 5LYDA 4KTQA 1VJQA 1U8SA 5J2NB 1H0HB 1F57A 4FVCA 3PB4X 2YQ0A 4RW9B 4NEZA 4Q36A 4OFZA 2ZEGA 1RDRA 2XI3A 3Q8RB 4J9LA 4ZS6A 3BN4A 3F44A 5J2MA 1BD6A 2C2KB 3TZWA 1FD8A 1PO6A 3W6XA 4JI6F 1F2GA 2ILYA 2H5MA 2WB1D 2NUHA 4MJKA 4DV3J 3LF0A 4NGTA 1M5VC 2DGTA 2Z2MA 4M5GA 2XHCA 3F8KA 2B0GA 4NLSA 3O3LA 4DG1A 1SJRA 2LU2A 1AFJA 2HFNA 1R0AA 4XO0A 3PIPQ 4WPAA 5KFPA 2XNRA 5J2PB 3I5AA 3CJKA 2FIWA 1GTHA 1UEVA 3VGTA 4ICLB 3UI3A 5KTCA 5LMUF 4F36A 1RTZA 3Q8QB 2WSFC 2V2VA 4ALZA 4B3RJ 3CIMA 3LGMA 2M7SA 5K8OA 4M94A 2L3MA 2JC1A 3HULA 2V77A 4Y0FA 5J1NA 3WIUA 2J0WA 4MFKA 1OO0B 2HS4A 1UFWA 3TZYA 2A1BA 3ZTOA 3OSNA 2ZNZA 3OR1B 1F60B 1D9FA 1X31C 1TQLA 2W9AA 3MGJA 4B17A 1VQYA 1BAVA 2FZKB 4Q2LA 3B7IA 4WP3A 2XS7A 2IJFA 2AP6A 2AFWA 4USMA 3DOMA 2FS5A 2H5EA 2VJVA 3W5XA 4BHQA 4XK8C 2DNOA 3X3UA 4C2YA 2V8HA 4K4UA 2AEMA 4WFBQ 1HI1A 2DBBA 5D4OA 4QU6A 1AUDA 2RRAA 4FXDA 1TUGB 2PJ6A 3DI6A 2YPYA 2MKYA 1IKXB 3KUHA 3C3LA 2GHVC 2UVVA 1EKRA 4I69A 3B8HA 4O0IA 3LWLA 4QR2A 1WHWA 3TX0A 1HBNB 3SHPA 2BJ3A 4OI6A 5BYQA 3H2LA 2PR1A 1K0TA 3D0GE 4FN5A 2CNTA 1N52B 5B0EA 3LUYA 2RVJA 5FD1A 4FXVA 5D4PA 3BJYA 3UN3A 4NMLA 3OHBA 2CPZA 3ELHA 4K4VA 4LUBA 1WACA 1F0XA 3M1VB 3EE3A 4DL5A 1P0HA 2I6WA 5IT9Y 5DGBA 2ZH9A 1VC0A 3PR4A 1RT1B 3PRBA 2K7KA 4FPRA 3CDAA 4KKOA 3CW2C 4L73A 1HNWJ 1WJ9A 3AA9A 1ZZFA 4GKJJ 2BL1A 1W25A 3PRTA 1T8EA 3KQZA 3GYGA 3K0JA 3OL6A 4ONWA 1CULA 5MLCV 3AQOA 5JVHQ 1SJ1A 4XPDC 2MQ8A 2IFXA 4B02A 4B3TF 1S6PA 4FZVA 2COLA 5HBMA 3BO2A 3M05A 1S6UA 2GCFA 4AXVA 3TW0A 1YZ7A 3M6WA 5F09A 3NS7B 4AT1B 4DV4F 2XMKA 2DHHA 2QL5B 4CYPA 1N32F 3FFIB 1CC8A 3E3XA 2QMLA 5G1ZA 1LW2A 3D1OA 3MECA 1CVJA 2E5LJ 2GX8A 1RT6B 3KHLA 2BYCA 5DS0A 5KFBA 2VG5B 4IR9A 2ZW7A 2RT3A 4MAKA 3CIZA 5FDLB 2YGWA 4NCZA 5AG4A 2LA6A 4RW8B 1FNMA 4QIVA 4NGNA 2UXDF 3KNAA 1HNXF 4F4ZA 3R2DJ 2RFHA 1NHVA 4NLQA 4LRDA 1KFDA 3PZJA 4R0JA 5F41A 1FA0A 5HATA 4Q38A 4MHNA 4ECTA 3OJUA 4MIWA 1VKCA 3EPIA 3CJRA 2OR4A 3CCES 2HEKA 4ONUA 2YX1A 2AGPA 3GG1A 3L7UA 3RTVA 1ZO0A 4CAVA 3G71S 2QRRA 3OVBA 2EVZA 1FRIA 3RR8A 3MUMP 2HAFA 2FHJA 1TXRA 1IQTA 3V81A 1RBLA 4CLYA 1J5EJ 1BQNA 2HLUA 2BDPA 4HDHA 4M63A 2FTRA 5GMKa 3PRVA 1HNZF 1S1XB 2FSRA 3PYEA 3DDDA 3JSBA 1Q5YA 1KP6A 3D3CJ 3R1LA 4BD9A 1RTJB 1B6BA 2PI4A 1N36F 4ENOA 1FRMA 5IQ6A 4JI5J 2UV8G 1IBKF 4OHYA 1IJEB 3RAMA 3EO4A 3Q89A 3KZWA 1MWZA 3OUYB 3BPDA 2QX0A 2ASLA 2JEIA 3M8QB 1Q8BA 5D15A 1YG0A 2OJ3A 2VKRA 4FYXB 4L3KA 2I5JB 2KXNB 1F9EB 2WVCA 2VDIA 2HYIB 3M2RA 1PILA 2C1CA 2UU9J 2DXQA 4V19J 1TELA 3M8SA 3H5UA 4FD7A 2HVDA 3ISXA 3FEXB 2EBGA 2P6EA 1L3SA 4JI7J 4KHRA 2XMUA 3QIDA 1T03A 5E2QA 3KOAA 4DR1F 3OXFA 4CO3A 4JI1J 5DG8A 1YRXA 3I9V9 2OPRB 4MCRA 3IXQA 2YKOA 5EN1A 4EFDA 1G6BA 4ED2A 4YHHF 2LQ5A 1YJNS 3S6EA 3U02A 2F7VA 5JVGQ 3VAGA 2P5VA 2LU1A 1NJYA 1E6YB 2DNNA 4ECXA 4KSEB 3KJNB 4DV6J 3CDEA 1J27A 4PQUA 4IO1A 4WCEQ 3CMES 3KK2B 1IBLJ 3BI0A 1RTHB 3W2WA 3KHHA 4F0YA 2D3ZA 4OC1A 2KG0A 4IOBA 3G87A 4QWCA 1V3SA 4DFPA 3IRXB 4A48A 2VQEF 3CDXA 1VCTA 4O44B 3BGFA 5EBVA 3QRQA 2AYGA 2MSTA 1NDKA 4TY9A 2IYGA 2RQMA 1UKUA 4MIBA 2W7PA 4UQGA 4KO0B 4CM0A 2VA2A 1VHEA 4B5OA 3C46A 2P9CA 5CCMA 4DV7J 5F3TA 4P44A 2LEBA 4PG7A 2M52A 1WI8A 2B4VA 4MY0A 1T05A 3PHTA 4I4BA 3U1NA 2CNNB 2E1RA 4AXIA 2CKWA 5D4NA 3AJ2A 3TRGA 1YJ7A 3PB6X 2AQ4A 5HANA 4KVOE 2ZOGA 2R7WA 4ZITA 2O67A 2CADA 5HMXA 2V2QA 3C16B 2H51B 2DPIA 2RF2A 4R25A 1TV6B 3G86A 2CNMA 3FX6A 2J8NA 2KVQE 3A13A 2ZHBA 1QE1A 5KOWA 3SXOA 5LMNJ 3QRPA 2V4RA 1BC6A 4ZVFA 4NGQA 4HHUA 1U02A 1FKOB 1RXOB 2MSSA 4ER8A 2ZVIA 4TYBA 1T7PA 1SH2A 2CPFA 5D0HA 2R9LA 3NGRA 1WNEA 3MOZA 3EX7B 5JMNA 2PVVA 3TQEA 3DOLA 2GLFA 1RHUB 2DKOB 1BUXA 3LP2A 2J8SA 3BREA 1BGXT 1Q7LA 1GXLA 2IDLA 2IM2A 2OH1A 1IOIA 4ED5A 3PIOQ 4C2ZA 4JXQA 1FEEA 3JUWA 1RK8A 4IRCA 2R7RA 4Z65A 1QUVA 5H9FK 2VU5A 3VR1A 1FNOA 4LVOP 5LXYA 2RU9A 1M1GA 1TKXA 1U49A 4CS0B 2PE3A 3DYAA 3GR0A 1C4AA 3D66A 4EO6A 3VAIA 3K9TA 2MQLA 1A7GE 5D8HB 2HS0A 2Q6BA 4ITSA 3M8YA 3H90A 5B0DA 2FJVA 2R7XA 2HQIA 2JEWA 1N34J 3I0SA 2HAIA 1WKKA 4HNYB 5AG5A 1SCJB 2RD5C 2XGQA 3CJ8A 1HBMB 3PEHA 1JLQB 2NXNA 4CGMA 1X9SA 1TKFA 2CVEA 1JLEA 4B3OB 3BO4A 5HXDA 4DR3F 2M9KA 3RR7A 3IS9B 5F8IA 5K9FA 4IHMA 4G1IA 2QN6B 2WHOA 3MPDA 1AROP 4HL9A 1UETA 3DRPA 3MMBA 2JEFA 8ATCB 1RISA 3FBBA 4KUBA 2I9SA 2GAGC 4CO2A 2CY2A 2B6AB 3AQPA 5DZ6A 1RTDB 2V8VA 1HBUA 4F26A 2PGCA 3OSPA 3BSCA 3DRSB 1LW0A 5IM0B 3ZZTA 2CWXA 3QGIA 4F02A 3BH7B 2E1CA 1FDDA 4DPYA 3CEDA 3KJFB 3QJPA 4P2MA 3EGVA 4WFYA 5L1LA 2ZHOA 3TJAA 1TKTB 4GC6A 1WWHA 4RW7B 5GAHU 3PYFA 3PACA 3FSYA 4LF6F 2DR6A 1QAJA 2HQDA 1Y3JA 3GV7B 3JSYA 1S7LA 1S48A 3NMRA 1Y3KA 1B0PA 3DLEA 1JXLA 4B3MJ 1DY3A 3NGTA 5EWGA 5HJXA 5KG6A 4QZVB 5E3PA 2HVHA 4I0WA 4DS4A 3QJLA 4M6GA 2LXIA 2YXLA 2ZH3A 5K5MA 3D6HB 1SIZA 5J2MB 2XBPA 1FVSA 1IWAA 2Y8WA 4A8FA 2YQ3A 4IRKA 1XBWA 2DGSA 2EC0A 3DR6A 1S7HA 4KZTA 5H84A 2LVWA 4WU2A 1S1WB 5AJ3J 3I1UA 4K5RA 3BR8A 1KOOA 3K89A 3W60A 4JYWA 1R0AB 3RAXA 3KLGA 3DHWC 2M8DB 3CJKB 1QDUB 4NEYA 1OJ4A 2VPWB 4XTTA 4DX6A 2OIHA 4O4GA 3MEKA 1W2IA 2CFXA 1GT8A 1KLMB 2BUNA 1VJWA 1C2PA 4NI2A 2OH2A 5DLFA 1WEZA 2PSWA 4EU0A 1FRJA 1WTFA 1VGYA 4URGA 3R5GA 5LSRA 4DR5J 3N6LA 4ECVA 5HMYA 1VDHA 1HW9A 2DGVA 3PX4A 1Q79A 4NF1A 3SI1A 1XR5A 1QAYA 4OX8A 1E6VA 2IC3A 3D3SA 3DNSA 1OBRA 1IWGA 4QYZK 2ZITA 1TVRA 1T9TA 2C2OB 3CNQP 3DOMB 2XS5A 1F5CA 3PXGa 1LOUA 1S79A 4J9QA 1YBAA 2Z58B 3N5FA 3OR2A 2ASYA 1VQ8S 2F5IA 2VBQA 1XEZA 1L3UA 3CXPA 4MFZA 2HFVA 3OTBA 2VFVA 2F8MA 4K4YA 3I56S 2CIMA 1MMNA 2RMLA 4DS5A 3JQMA 2PE8A 4FBEA 2E1AA 2E66A 5J8FA 7AT1B 2MQMA 2Q0YA 4E2AA 3PEIA 1PJ6A 1DTTB 3HF5A 3BKTA 5DQHA 2FJXA 1YRTA 3LW5C 3R2CJ 1B3TA 2UUCJ 1CG2A 1FE4A 5C25A 2OEMA 2BRKA 1YW4A 4O23A 4EZ6A 2IM0A 1DBDA 3IM9A 4ZVGA 4M3SA 3FH4A 1SL1A 4IQMA 2HPUA 1JXVA 3JRUA 4BS2A 3MR2A 4OV6A 1HBOA 4CO0A 2F1FA 4B14A 4K4ZA 4DV2F 1XNRJ 3FEEA 1X8DA 2BQUA 3BF4A 4ID5A 3MGDA 1NAQA 3SSQA 3FSXA 3Q83A 4HPSA 1ZA1B 2DPSA 2ZELA 2DRDA 4A33A 4ZJLA 3MF5A 1IN0A 4KFBA 4KKOB 2ABZA 3H98A 4DZ6A 4QQBA 4RLEA 3PFOA 2PFDA 4QIEA 3QNWB 4Y2IA 1FX2A 2D1CA 3PEJA 4O3PA 3B4DA 4Z2XA 5BXIA 1HWIA 3KKFA 4DL0C 1CULB 5T41A 2VD3A 5KFRA 4OZ2A 1RP5A 1T0TV 4BC9A 4R7MA 1S6PB 5HBMB 4X2TA 2EKYA 3ZNJ1 2CPHA 3R97A 3CCWA 1KNZA 4LRFA 4ZLPA 2YWWA 4NLOA 5GAEI 5L1KA 5LYIA 1F6TA 3HFZB 1XJOA 2PQ8A 2DPJA 2YKAA 3PG9A 4B3SF 4PKDB 1N6QA 3FVLA 4LF2A 1XOVA 4NASA 3KMSA 2O01C 1FF2A 1LW2B 2PSZA 2M3DA 4OC0A 3MECB 3N5BA 1QSNA 1ZTTA 2FLOA 4TNUA 2XYGB 3C6TA 2F65A 2DEJA 2W4CA 1O5JA 4DV5J 5F3ZA 2GGPA 5KFQA 3CE8A 3PB8X 4CTAB 4L8AA 4MCQA 5M2RA 3G8TA 2H65B 1XNQJ 3H20A 4CM2A 3IGNA 3FRMA 4J3GA 5B0GA 3FZ2A 3P3DA 2RILA 4DXLA 3WT4A 3O5TB 5L1JA 3WC2A 4DV1J 3P4UB 3P5BP 4ZVHA 4QWEA 1LEOA 2DNHA 3ISND 2ASJA 3V6HA 4RNHA 2V8PA 4OI2A 2MKHA 1N4LA 1SJ4P 1V3ZA 1UJ4A 2WVDA 2GHWA 1U1OA 2APOA 1NHUA 4MKVA 3R5DA 4PSWA 4WYLA 3TUIC 1GEHA 4Q43A 2CRLA 2FGOA 4CNZA 5U47A 4EWTA 2YH0A 1RACB 2R7UA 2K8GA 1QUPA 2DGUA 4ZLNA 5D4LA 3RBDA 2IBKA 3V81B 5DG7A 1H2TZ 2JLFA 3GFXA 3LANA 2VC0A 1YLEA 4MHYA 5A27A 3KLHA 1CBKA 2FIUA 2W01A 1DTDA 4WKYA 2HFUA 4LMZA 4ZIWA 3D7GA 2U2FA 4FS1A 5AXNA 3EM1A 2Q4VA 3HO1A 5F49A 1PC5A 4URQU 2RS8A 5AXLA 4DPXA 4DPOA 1MG7A 4LF5J 1SKUB 2HHVA 4HACA 3G8SA 2MZRA 4C4WA 2I00A 5KT3A 3PJWA 3TP2A 1XMOJ 2HURA 3N28A 2UXBJ 4PEOA 2JBKA 5L46A 1Q16B 4F4AA 4DF4A 2N4DA 3JAMU 5JH9A 2DGOA 2GU2A 4CAXA 1QSTA 5A2QY 1BWVA 4B9TA 4ZPBA 5HMWA 5GAGU 4RUAA 3GLJA 4DJBA 1I94J 1R57A 1FI4A 4DPTA 3CCRS 3PRDA 1SQEA 3N4WA 2HC9A 5AXKA 4CYUA 1T03B 4C8ZA 3TAMA 1BPMA 3CZXA 2V34A 1S9GA 2W24A 5HK4A 1YVFA 4BBHA 3EDRB 1ZTWA 1CPZA 4LRCA 3EWGA 4ZKAA 2Y0BB 4ED6A 2HQFA 1I21A 4UUWA 3DKDA 2AJFE 1NZAA 5SUHA 4YU9A 1TAQA 4AE5A 3BQ2A 4ANCA 1R31A 2NXCA 1UJ6A 3WZ0A 3W2WB 2R42A 3AXKA 4M5LA 1Y7RA 2AX1A 4P10A 2NLWA 4FF4A 5FIIA 2DISA 2GQ2A 1QTNB 4J9OA 4WBFA 3DU5A 2OTJS 4CH7A 1XEBA 4OHVA 2XMWA 1L5UA 1VK8A 4M5DA 4KHPF 1Y11A 3TO8A 4CWBA 2VBWA 4PWDA 5HH1A 1HQEA 2GO8A 1T05B 4USWA 5E3CA 4X66F 2D74B 2HQCA 3BQ1A 3GIJA 1BY9A 1D8ZA 3T1AA 2I2YA 1XN9A 2BJ8A 4R87A 1SJFA 4U7CA 1YREA 1S0MA 4M5MA 5F46A 1F3FA 3CCUS 3S6KA 1EKSA 1S99A 4K4WA 2AFOA 2X1AA 4OYAA 4NLXA 4LFCJ 3OVAA 3PW7A 2MKJA 1FDBA 5DM7Q 3JXOA 2NS1B 4IG3A 1RYSA 3PW2A 1Q82T 3BI1A 4L3NA 2MKIA 4K0KF 2ROPA 3HHLD 3ZZOA 1GXTA 2G0JA 1ARMA 3EVWA 3MR7A 2BW7A 4NCBA 5IOLA 2BW2A 4AD6A 4JLYA 3GIKA 1YLXA 3I4PA 3QNVA 3DOLB 3LP2B 1QLNA 1ZM2A 3QZ8A 3CD6S 1Q7LB 3RO0A 4F4KA 4F6AA 2VPXB 3T5JA 1DQ8A 4KH0B 1VC5A 2EI5A 2HG4A 1P27B 5E0OA 2QSFA 4KRWA 2E1MC 2G3AA 2ZEEA 3ILOA 1B87A 1JJHA 4GXHA 4OQJA 1PBAA 2DGQA 2GZOA 3NCRA 1RWOB 2B5JA 5E33A 1YGYA 5GMDA 1TKXB 3DYAB 1GTEA 3CC2S 4QW9A 5DS7A 3VAMA 3GJSB 3Q8PB 2PC6A 4TVAB 4OYIA 3TT2A 4CYOA 1NXIA 4A8WA 4LUAA 4DN9A 1EHWA 5T7LA 2IMOA 3AD8C 1U45A 3OTEA 2X1BA 1RAJA 4A47A 1JLEB 2IBOA 3TCVA 3UQSA 2W7OA 3DN9A 1AMPA 1VBZA 5I4MA 4Y2MA 4NOHA 1TR0A 1WC1A 5KFFA 2AEJA 2EVNA 1NNDA 3BKUA 1PUAA 3DRPB 3MMBB 4UCPA 4NA2A 4Q44A 4ZVQB 3HI9A 2EXUA 2OD6A 4DSEA 1G7CB 3KLVA 2YWHA 4PG6A 5HVFA 1HBUB 2FJAB 2MKKA 4KAIA 3OL9A 1RHRB 2Q3PA 1LW0B 2Z0GA 1FJCA 3UO0A 3IAM9 3H8YA 3EMTA 1HWLA 2XYHB 4GO7X 3R6LB 1DARA 4KUAA 4M5IA 2GLJA 1KVJA 2PN6A 2J7KA 3PBEA 5E3AA 3E01B 1XMQJ 2OGUA 4CO5A 3N0VA 5IT4A 2AE6A 1IU8A 1X60A 1LAPA 4IG0A 2Z2YB 3ENQA 3FCVA 2UUBJ 4UA3A 4DR7J 1HI8A 3V2UC 1O8BA 4NLGA 3RYOA 3TI0A 2IDEA 3DLEB 2IMWP 2HV2A 3MFIA 3I5CA 2AHOB 4DL7A 4TKTA 2DRBA 2MB0B 4C48A 2Z4PA 4X4UA 2GMJA 2OKQA 1SV5A 5CXTA 3DXBA 2GMHA 4NWBA 1U47A 1Z8XA 1LQ9A 2BJDA 4H6ZA 2GA7A 1RWUA 5D6GA 3NH5A 1U1PA 1ZBTA 1L3KA 1HNWF 3PX6A 4WYWA 1T11A 4GKJF 1RT4A 3LP1A 5IT0A 2ZC4A 4F50A 2DNPA 1YJVA 2H1YA 2BRLA 2C3MA 3K17A 2M5YA 2YNHA 1WKJA 1KD1T 1NH7A 2KFYA 1M4DA 4P7VA 4JI3J 2OFGX 3L4BC 4LSNA 4P6QA 3NAHA 3D0HE 3IR5B 2BA9A 5KFTA 3QQCD 4U5YA 3D67A 1UFKA 5AG6A 2LEPA 3KLGB 3Q8VA 3H4BA 2P8IA 1GFWB 2VL1A 3CUNA 1QD1A 4ZY0A 4USJC 1U1LA 4O4GB 3SQOP 1S1VA 3HX9A 1RADB 2Y9HA 3BDPA 1S9EA 2W8LA 3V6JA 3M9OB 2CQ3A 4NI2B 2B7BB 2BR0A 3SCIE 2NYQA 2YWFA 3VZIA 2WSEC 3MDFA 1YIJS 5IXUA 2XY6A 2E5LF 1LAMA 2MQNA 2E5HA 4LQ6A 3JQJA 1UVKA 1KHWA 3CJ0A 1NLKL 4R6TA 5EC4A 2R1IA 1EAYC 4YR3A 2CJKA 3OFEA 2IRXA 2HMIA 2A18A 3DXSX 4AVBA 1RAEB 4YRHA 3RGIA 5KFDA 4WP9A 2Z3PA 2IC3B 2EFVA 1CEZA 4DDFA 1IR2A 3H2UB 5D3GA 2L41A 1NK5A 2DJWA