2BSWA

Crystal structure of a glyphosate-n-acetyltransferase obtained by dna shuffling.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title DNA Shuffling as a Tool for Protein Crystallization.
pubmed doi rcsb
source organism Synthetic construct
total genus 36
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2bswA00
2G0BA 2P6GA 3TO7A 2I79A 2ZW7A 2ATRA 4B5OA 1MJAA 2A4NA 1RO5A 1ON0A 3EO4A 4HNXB 4AG7A 1P4NA 1M4GA 1YVKA 3MGDA 1K4JA 5KTAA 2CNTA 2Q0YA 2PSWA 1NE9A 1S5KA 3VWDA 1M1DA 3OWCA 5DWNA 3N7ZA 1I1DA 4I49A 2CNSA 2OZUA 5C82A 4MJ8A 4X5KA 4U9YA 3S6FA 5ISVA 3F0AA 4HKFA 5DWMA 2FIWA 4JJXA 3FXTA 4UWJA 3TO6A 5KTCA 1YREA 2GE3A 2H5MA 1TIQA 3V8IA 4E0AA 2VEZA 2J8MA 4KOYA 2BSWA 3I3GA 1Y9KA 2F5IA 2BL1A 3PGPA 3UY5A 4CAVA 3W91A 3F5BA 4CAXA 1Z4RA 2D4PA 5JPHA 2CY2A 4H6UA 4QB9A 1L0CA 2PRBA 4KLWA 3CXQA 2JLMA 2ZXVA 4CAWA 3LD2A 4KLVA 2QMLA 2OU2A 4KVME 3P2HA 4CRZB 1U6MA 2FSRA 5F48A 4KUBA 5F46A 4HNWB 4JLYA 2GANA 3T9YA 3F8KA 3W6SA 3EY5A 1V0CA 2OB0A 5F49A 2HV2A 1Y9WA 3GYAA 2QIRA 4PK2A 3IGRA 3D2PA 5J8FA 1QSRA 1YGHA 4OAEA 4Y49B 2VBQA 1YLEA 4H6ZA 3S6GA 2P6FA 1QSMA 2GIVA 3PZJA 4CRYB 2NMTA 2R1IA 4JWPA 3EXNA 4DNCA 4R3KA 1PUAA 4KOVA 4KUAA 2ZW6A 1XMTA 4IF5A 4XPLA 4L8AA 2B58A 4M3SA 2G3TA 3GKRA 3GY9A 3KKWA 1MJ9A 3H4QA 1VHSA 3S6KA 3FNCA 1QSTA 3CXPA 4R9MA 1VKCA 2VXKA 4U9ZA 2Z0ZA 4GS4A 4NF1A 4PK3A 2AE6A 1SQHA 4FD4A 5GCNA 3K9UA 1S7KA 2EUIA 3WR7A 2R8VA 3FYNA 5IB0A 5C88A 1CM0A 4R57A 4E2AA 4R87A 1QSNA 2K5TA 3ZJ0A 3S6HA 4KOSA 4MY0A 5H86A 3D2MA 2C27A 3R1KA 5F47A 2PR1A 1Q2CA 4FD5A 1MK4A 1IICA 4LX9A 4Y49C 4MHDA 5JQ4A 3BJ8A 1I21A 2FT0A 4R3LA 1R57A 2ZW4A 1KUVA 3TOAA 2PR8A 4QBJA 3DNSA 2JDCA 2Q7BA 4YGOA 3P2FA 1KZFA 5IV0A 1S7FA 2FCKA 4II9A 3G3SA 1PU9A 2G3AA 4KOXA 4XNHB 3R9EA 2REEA 2R98A 1WK4A 1M4DA 4PSXA 2QECA 1P0HA 5EBVA 4XPDB 2KCWA 4NEXA 4KZTA 5EC4A 1XIXA 3R96A 2FE7A 2OZHA 2OZGA 3D8PA 3SXNA 3FIXA 3TT2A 5HMNA 4AVBA 2JDDA 1RXTA 1FY7A 1IIDA 3G8WA 2IL4A 1J4JA 4UA3A 2P0WA 4OADA 3JUWA 1YK3A 1I12A 1Z4EA 3R9GA 2OH1A 4NXYA 3QAHA 1B87A 3TCVA 4YRHA 2O28A 4JXRA 2B5GA 1XF8A 4K30A 2D4OA 2Q4YA 2PC1A 3R95A 4AB7A 4ZBGA 3BLNA 4H89A 4YFJA 1XEBA 4HNYB 3DR6A 2P6EA 3TFYA 2J8NA 2DXQA 3D3SA 3E0KA 4MY3A 4UWIA 5J8CA 1N71A 4B5PA 3DR8A 2VI7A 5I0CA 5IX3A 1BO4A 2J8RA 4LUAA 4XNHC 2B5GB 4OLLA 1S7LA 5CNPA 3B8GA 3FRMA 4NSQA 4XPDC 4F6AA 1IYLA 3RYOA 2X7BA 3SXOA 4RI1A 4L89A 3FB3A 2CNMA 4CS0B 3QB8A 3I9SA 4UBRA 5H84A 2FS5A 4B5PB 3C26A 4ORFA 1GHEA 3TO9A 1S60A 1Z9UA 4AG9A 3NE7A 5HH1A 1Y7RA 2WPXA 4PV6A 1NSLA 1YVOA 2B4DA 2VQYA 3PP9A 4AVCA 5E96A 2BUEA 3SHPA 3VWEA 4U5YA 2Z11A 2BEIA 1B6BA 2Q44A 4JD6A 2B4BA 3FBUA 4M85A 1YR0A 4J3GA 3W6XA 3BJ7A 4KVXA 1QSOA 2FXFA 2B3UA 4KOTA 3EFAA 3R9FA 2FL4A 4E8OA 4KOWA 2RC4A 4FD6A 3TOBA 2ZPAA 3JVNA 2B4DB 3T90A 1XE4A 4KORA 2VZYA 1YX0A 2PDOA 4BMHA 2HUZA 4RS2A 1CJWA 4XPKA 4QVTA 2ZW5A 1Q2DA 2REFA 1Q2YA 5KTDA 2ARHA 2JEVA 2Z10A 3IWGA 3DSBA 4FD7A 1KUXA 4PSWA 4F0YA 4ONUA 3DDDA 2Y0MA 4EVYA 4AVAA 3TTHA 3ZZIA 2VZZA 1OZPA 4JXQA 1M44A 2PQ8A 4QC6A 4IUSA 2FIAA 1S3ZA 4MI4A 1M4IA 1BOBA 1MJBA 1IYKA 4KVOE 2AJ6A 3EC4A 1UFHA 1LRZA 2WPWA 2Q4VA 1WWZA 2R7HA 2Q04A 1S7NA 2B3VA 4QUSA 4MBUA 4NCZA 2HQYA 3LODA 3TE4A 1KUYA 2I00A 1NMTA 5FVJA 4KOUA 1IB1E 3CXSA 2EVNA
chains in the Genus database with same CATH superfamily
3NH5A 2AFXA 2G0BA 3JTKA 2P6GA 5THWA 6CPAA 1QMUA 3TO7A 2I79A 2ZW7A 2ATRA 4MFPA 4B5OA 4BD9A 2A4NA 1MJAA 1RO5A 1ON0A 3EO4A 3FJUA 4MMOA 4HNXB 4AG7A 1P4NA 3DLJA 2CIJA 2V8HA 4P4EA 4CAFA 1M4GA 4O23A 4ZI6A 1YVKA 4NGSA 3MGDA 1K4JA 4UFXA 5KTAA 2JBKA 4ZGYB 2PJBA 2CNTA 2CXAA 5HVFA 4Z65A 2Q0YA 2PSWA 4MXUA 1NE9A 1S5KA 1IGBA 1ZLIA 1M1DA 3OWCA 3VWDA 4PQAA 5DWNA 3D7FA 3N7ZA 4TWEA 1I1DA 3SI2A 4I49A 2CNSA 2GLFA 2OZUA 1ELMP 4Q7AA 1XRYA 5JM6A 5C82A 2ZEPA 4MFLA 4MJ8A 5EMIA 4X5KA 4U9YA 4B14A 3S6FA 5ISVA 4MCRA 3F0AA 4YU9A 4MFJA 4HKFA 5DWMA 3H5ZA 1Z8TA 4MCSA 2FIWA 3GLJA 3IWEA 4JJXA 1VIXA 1XBUA 2Q4ZA 4ZX9A 1TKJA 2V8VA 2PVWA 3FXTA 4UWJA 3TO6A 3LWUA 4CAEA 4RUHA 5KTCA 3H8GA 1X10A 1YREA 2GE3A 2H5MA 1TIQA 3V8IA 2PJ2A 3T8WA 4E0AA 2VEZA 3ISZA 2J8MA 4C7HA 1XJOA 4A94A 4KOYA 2BSWA 3I3GA 1Y9KA 1JWQA 1YQEA 5LRJA 2F5IA 2BL1A 3S9MA 3PGPA 4FUUA 1YLOA 3IJ3A 3UY5A 3FECA 4CAVA 2Z3PA 5LYIA 3W91A 3RAMA 4IAVA 3CZXA 3B3SA 3KL9A 3F5BA 2ANPA 4CAXA 3VARA 4A37A 5CPAA 5K8NA 1Z4RA 3RBUA 2D4PA 3HLPA 3KI9A 4DYOA 5JPHA 4OC2A 1X12A 4OKOA 1RTQA 3SJGA 1CX8A 2CY2A 4H6UA 4QB9A 3KHXA 3B7IA 1L0CA 2PRBA 2YNDA 3KHZA 4KLWA 3CXQA 2JLMA 2Z3LA 4GXHA 4EFDA 2ZXVA 4CAWA 3PB8X 3LD2A 4KLVA 2QMLA 1BPNA 4NGQA 3CDXA 3FH4A 1GYTA 2OU2A 1F57A 3PB4X 4KVME 1H8LA 3P2HA 4MCQA 4CGLA 5A28A 1CG2A 2Q43A 1U6MA 2FSRA 3DGVA 4CRZB 5F48A 4KUBA 5F46A 2AFMA 3FMCA 2CTBA 4R76A 4HNWB 2ZEGA 4JLYA 4P45A 1F2PA 3FEEA 2GANA 3T9YA 1ZG8A 4IK2A 4UEZA 3F8KA 3W6SA 3KR5A 3EY5A 2PJCA 1V0CA 2OB0A 5F49A 2HV2A 1Y9WA 1DE4C 2QIRA 1Z8LA 3GYAA 2ODFA 4B12A 1Z2LA 4PK2A 1KWMA 3IGRA 1YW4A 3BI0A 3D2PA 5J8FA 4MFQA 3IO1A 1QSRA 2PJAA 1YW6A 1R3NA 1Z5RA 1YGHA 1CPSA 1PCAA 4CPAA 4OAEA 4FBEA 3S9NA 4Y49B 2VBQA 2PJ0A 2C6CA 1HDUA 1YLEA 7CPAA 4HPSA 4H6ZA 4C2ZA 2C6GA 4M6HA 3GB0A 3S6GA 5IB9A 5K8MA 5F09A 2P6FA 1QSMA 2GIVA 1F2OA 2PJ4A 4P4FA 1Y0YA 3PZJA 4CRYB 2C1CA 4MFZA 2NMTA 2R1IA 4JWPA 4KSFA 5D8NA 3EXNA 1YMEA 4DNCA 4R3KA 1PUAA 2J9AA 4R8FA 4OIDA 1BLLE 4PXBA 3IWWA 4B10A 4KOVA 4WWVA 3RO0A 4KUAA 1LANA 2ZW6A 4UF4A 2O4HA 3IEHA 2ZEHA 1XMTA 4IF5A 4R7MA 4XPLA 4L8AA 3IU2A 2ZEDA 2B58A 4M3SA 2GFQA 2G3TA 2WYRA 3GKRA 3GY9A 1MJ9A 3KKWA 4JZ0A 2JEWA 3H4QA 3CPAA 1VHSA 1Z8XA 2OOTA 1VHEA 2FVGA 2WSAA 3S6KA 3D7HA 1IU8A 3FNCA 2IJZA 5LYLA 3IU1A 1QSTA 5G20A 5K8OA 2QVPA 1R43A 3CXPA 4A33A 4R9MA 4NGRA 2PE3A 1VKCA 4F9VA 2VXKA 4UEEA 4U9ZA 2Z0ZA 3JRUA 4GS4A 4NF1A 3TC8A 2I3CA 4CYOA 4PK3A 2AE6A 1SQHA 1UWYA 4FD4A 5GCNA 3K9UA 1XMBA 1S7KA 2V8GA 2EBJA 2EUIA 3WC6A 3WR7A 4NGPA 2R8VA 4K3NA 3FYNA 3WC7A 4A38A 1OBRA 2ZEMA 3SI0A 5IB0A 2PRQA 1ELLP 5C88A 1CM0A 3KR4A 4R57A 3PFEA 4E2AA 3D66A 4EMEA 4P4JA 4R87A 1QSNA 4X8IA 2K5TA 2PIYA 3ZJ0A 4OC0A 3S6HA 2PIZA 4KOSA 4MY0A 3PBEA 3WABA 4P44A 2AFOA 2PJ3A 5H86A 3B3WA 3D2MA 2C27A 3R1KA 5F47A 5JGFA 2PR1A 1Q2CA 4FD5A 1MK4A 4R6TA 4CGNA 1IICA 4LX9A 4Y49C 4MHDA 3PBBA 4FAIA 5HVGA 4H2KA 1VGYA 5JQ4A 4PXCA 3I1UA 3BJ8A 1I21A 1LFWA 2FT0A 4UFVA 4CGMA 4R3LA 1R57A 2ZW4A 1KUVA 1ZLHA 2PR8A 3TOAA 4RN7A 1ZO0A 4QBJA 3DNSA 2JDCA 2Q7BA 3B2YA 4YGOA 4A39A 3P2FA 1KZFA 5IV0A 2O53A 1S7FA 2FCKA 3NA6A 4II9A 3G3SA 1PU9A 2G3AA 4KOXA 4XNHB 5LRGA 3R9EA 2REEA 4F0XA 3B3CA 2PJ8A 2R98A 3HUVA 2OR4A 3PB7X 4NJQA 4A95A 1ARLA 3MN8A 1WK4A 1M4DA 3LACA 4CYQA 4PSXA 3GUXA 2QECA 1P0HA 5EBVA 2GLJA 4W9YA 2ZENA 4XPDB 1QQ9A 2KCWA 4NGMA 4NEXA 1IOFA 4KZTA 4OC1A 1XFOA 5EC4A 4TNUA 1XIXA 4JYWA 4P4DA 2FE7A 4X3RA 3R96A 5A27A 3BHXA 2OZHA 1TKFA 2OZGA 3D8PA 2ZEEA 3CT9A 3SXNA 5AG4A 3FIXA 3TT2A 3NH4A 5HMNA 4M6IA 1TKHA 5G1ZA 4AVBA 4CYNA 1Q7LA 2JDDA 1RXTA 4BINA 1FY7A 1IIDA 3G8WA 4MHZA 2IL4A 1J4JA 5LYDA 4UA3A 1IOIA 2AFSA 2P0WA 4A30A 4OADA 2EO8A 2Q51A 4C68A 3JUWA 1YK3A 4BBHA 1I12A 1Z4EA 5AG7A 3R9GA 4ZY0A 2ZELA 5DS0A 2OH1A 2RFHA 4NXYA 4MCPA 4OC4A 5K8PA 2PJ5A 2RB7A 3QAHA 2EK8A 4CGOA 2PJ1A 1B87A 1HDQA 1HEEA 4YRHA 3TCVA 4ZYQA 2O28A 4MHYA 4JXRA 2B5GA 4UFWA 3T90A 4F9UA 1XF8A 3L2NA 4K30A 2YGWA 2D4OA 2Q4YA 2PC1A 4WJBA 2Q7SA 3R95A 4ZBGA 4AB7A 3BLNA 4H89A 4YFJA 4M6GA 1XEBA 2DPSA 4UCMA 4HNYB 3KASA 2ABZA 2BOAA 5G22A 3DR6A 3D7GA 2P6EA 5I4MA 3TFYA 3PEIA 1Y7EA 1CP6A 2J8NA 3IIBA 2BCOA 2DXQA 2BO9A 3D3SA 4IHMA 3RZAA 3E0KA 4MY3A 4UWIA 5J8CA 1N71A 2XEFA 1FNOA 2Z3KA 4UIAA 4B5PA 3DR8A 3H8FA 2VI7A 3NH8A 3SJXA 5I0CA 1ZG9A 2IMOA 5IX3A 1BO4A 2Z3NA 3GIUA 3PB9X 4UCNA 5D29A 2J8RA 4LUAA 4XNHC 4A2ZA 2B5GB 1XOVA 5JH9A 4OLLA 4OMEA 4G1PA 3VATA 1S7LA 4MHNA 5CNPA 3B8GA 3WT4A 8CPAA 3FRMA 2DPTA 4NSQA 4OP4A 3V7ZA 3FF3A 4XPDC 4NGTA 2IQ6A 2ZOGA 2ZEOA 4F6AA 1IYLA 3RYOA 2X7BA 1A2ZA 3SXOA 4RI1A 4CGPA 4L89A 3KQXA 3FB3A 2CNMA 2WUUA 5LYFA 2CF4A 2GU2A 2V8DA 4MRIA 4CS0B 1DTDA 3QB8A 3I9SA 1AMPA 4UBRA 4UEFA 5H84A 3ISXA 1CBXA 5AG5A 1LAPA 2FS5A 4B5PB 2F8HA 2EK9A 3C26A 5CBMA 2JBJA 3FVLA 4DUKA 4A32A 4B6ZA 4C7IA 1LOKA 2PJ6A 4ORFA 1GHEA 3TO9A 4FWUA 3D67A 4P10A 1S60A 2YNCC 1Z9UA 3B3VA 3S9LA 4OIWA 4AG9A 3CPXA 2Z3MA 3NE7A 5HH1A 4OC5A 1BAVA 2HC9A 1Y7RA 4PPZA 2C6PA 2CTCA 2WPXA 4PV6A 1NSLA 4OC3A 3LMSA 1YVOA 1LAMA 2B4DA 4YWYA 1ARMA 1JQGA 1IY7A 1YSJA 2VQYA 3PP9A 4AVCA 5E96A 2BUEA 3SHPA 3VWEA 3WC5A 4U5YA 2AFUA 2F7VA 1AUGA 4MFKA 2Z11A 3D7DA 1ZG7A 3K2KA 2BEIA 3A9LA 1B6BA 3IFEA 2QYVA 2Q44A 4KSAA 4NFRA 4JD6A 2B4BA 2YNCA 3FBUA 3KZWA 4M85A 4P6YA 1YR0A 4J3GA 2AFWA 3W6XA 4B13A 1BPMA 3BJ7A 4DJLA 4B11A 4KVXA 4ZY2A 1QSOA 5LRKA 2FXFA 2B3UA 2YNEA 4P4IA 4KOTA 3EFAA 4NJRA 2FL4A 4P4BA 4KOWA 4Q38A 3R9FA 4E8OA 4A31A 2RC4A 4KS9A 4EWTA 3QAYA 3B3TA 1LCPA 4FD6A 3TOBA 3PFOA 4LQGA 2ZPAA 3JVNA 2B4DB 3KGQA 1XE4A 3KQZA 3N5FA 3PRTA 3BI1A 4ZX8A 5AG6A 4KORA 4LQ6A 2PJ9A 2VZYA 1YX0A 2PDOA 4BMHA 2HUZA 4RS2A 1CJWA 4XPKA 4QVTA 2ZW5A 1Q2DA 1TF8A 3IC1A 5HXDA 3V38A 4C2YA 2REFA 4C2XA 1Q2YA 5KTDA 1PYTB 2PJ7A 5ELYA 2ARHA 2PVVA 2JEVA 1AYEA 3B35A 2Z10A 3IWGA 3DSBA 3QNVA 4FD7A 1KUXA 2WZNA 4PSWA 4ONWA 1NSAA 4UCPA 1Y0RA 2NSMA 4ONUA 2DEAA 3DDDA 2Y0MA 3H8EA 3PB6X 3SJEA 2ZOFA 4EVYA 3MRUA 4ZY1A 2HB6A 3TTHA 3ZZIA 4AVAA 2VZZA 4F0YA 3NE8A 1OZPA 3D4UA 4JXQA 1M44A 1FT7A 2PQ8A 4UIBA 4QC6A 4IUSA 4X2TA 4F8ZA 1TF9A 2XEJA 4MHPA 2FIAA 1S3ZA 3NFZA 3VH9A 4CYPA 5J1QA 1CP7A 4MI4A 4Q36A 1CPXA 4KSIA 1M4IA 4NGNA 2ZEFA 3FX6A 1BOBA 1MJBA 3SJFA 1VHOA 1IYKA 2AFZA 2EWBA 1Z8WA 2AJ6A 2GREA 3EC4A 1UFHA 4KVOE 1LRZA 5BWAB 2V77A 2XEGA 2QJ8A 2WPWA 5AGEA 5G21A 3TX8A 3RNZA 2Q4VA 3K9TA 2DF5A 2VL1A 1WWZA 3FEDA 2R7HA 2Q04A 3D68A 2G9DA 1S7NA 2B3VA 4QUSA 2Z3OA 3BXMA 4MBUA 2NYQA 4NCZA 4PXDA 5HVHA 4AXVA 2HQYA 3LODA 3TE4A 1M4LA 1EE3P 2XEIA 4PXEA 1KUYA 2POKA 2I00A 1NMTA 3SI1A 4GM5A 5FVJA 4KOUA 2PCUA 1IB1E 3CXSA 1TXRA 2EVNA
chains in the Genus database with same CATH topology
2G0BA 3JTKA 2P6GA 3TO7A 2I79A 2ZW7A 2ATRA 4MFPA 4B5OA 1MJAA 2A4NA 1RO5A 1ON0A 3EO4A 4HNXB 4AG7A 1P4NA 4CAFA 1M4GA 1YVKA 3MGDA 1K4JA 4UFXA 5KTAA 4ZGYB 2CNTA 2CXAA 2Q0YA 2PSWA 1NE9A 1S5KA 3VWDA 1M1DA 3OWCA 5DWNA 3N7ZA 1I1DA 4I49A 2CNSA 2OZUA 5C82A 4MFLA 4MJ8A 4X5KA 4U9YA 4B14A 3S6FA 5ISVA 3F0AA 4MFJA 4HKFA 5DWMA 3H5ZA 2FIWA 3IWEA 4JJXA 3FXTA 4UWJA 3TO6A 4CAEA 5KTCA 1YREA 2GE3A 2H5MA 1TIQA 3V8IA 4E0AA 2VEZA 2J8MA 4C7HA 4KOYA 2BSWA 3I3GA 1Y9KA 2F5IA 2BL1A 3PGPA 3UY5A 4CAVA 2Z3PA 3W91A 3F5BA 4CAXA 1Z4RA 2D4PA 5JPHA 2CY2A 4H6UA 4QB9A 1L0CA 2PRBA 2YNDA 4KLWA 3CXQA 2JLMA 2Z3LA 2ZXVA 4CAWA 3LD2A 4KLVA 2QMLA 2OU2A 4KVME 4CGLA 3P2HA 5A28A 4CRZB 1U6MA 2FSRA 5F48A 4KUBA 5F46A 4HNWB 4JLYA 2GANA 3T9YA 3F8KA 3W6SA 3EY5A 1V0CA 2OB0A 5F49A 2HV2A 1Y9WA 3GYAA 2QIRA 4B12A 4PK2A 3IGRA 3D2PA 5J8FA 4MFQA 1QSRA 1YGHA 4OAEA 4Y49B 2VBQA 1YLEA 4H6ZA 4C2ZA 3S6GA 2P6FA 1QSMA 2GIVA 3PZJA 4CRYB 4MFZA 2NMTA 2R1IA 4JWPA 4KSFA 3EXNA 4DNCA 4R3KA 1PUAA 4B10A 4KOVA 4KUAA 2ZW6A 1XMTA 4IF5A 4XPLA 4L8AA 3IU2A 2B58A 4M3SA 2G3TA 3GKRA 3GY9A 3KKWA 1MJ9A 3H4QA 1VHSA 3S6KA 2WSAA 3FNCA 3IU1A 1QSTA 5G20A 4A33A 3CXPA 4R9MA 1VKCA 2VXKA 4U9ZA 2Z0ZA 4GS4A 4NF1A 4CYOA 4PK3A 2AE6A 1SQHA 4FD4A 5GCNA 3K9UA 1S7KA 2EUIA 3WR7A 2R8VA 3FYNA 5IB0A 5C88A 1CM0A 4R57A 4E2AA 4R87A 1QSNA 2K5TA 3ZJ0A 3S6HA 4KOSA 4MY0A 5H86A 3D2MA 2C27A 3R1KA 5F47A 2PR1A 1Q2CA 4FD5A 1MK4A 4CGNA 1IICA 4LX9A 4Y49C 4MHDA 5JQ4A 3BJ8A 1I21A 4UFVA 2FT0A 4CGMA 4R3LA 1R57A 2ZW4A 1KUVA 3TOAA 2PR8A 1ZO0A 4QBJA 3DNSA 2JDCA 2Q7BA 4YGOA 3P2FA 1KZFA 5IV0A 1S7FA 2FCKA 4II9A 3G3SA 1PU9A 2G3AA 4KOXA 4XNHB 3R9EA 4F0XA 2REEA 2R98A 4A95A 1WK4A 1M4DA 4CYQA 4PSXA 2QECA 1P0HA 5EBVA 4XPDB 2KCWA 4NEXA 4KZTA 5EC4A 1XIXA 3R96A 2FE7A 5A27A 2OZHA 2OZGA 3D8PA 5AG4A 3SXNA 3FIXA 3TT2A 5HMNA 5G1ZA 4AVBA 4CYNA 2JDDA 1RXTA 1FY7A 1IIDA 3G8WA 2IL4A 1J4JA 4UA3A 2P0WA 4A30A 4OADA 3JUWA 1YK3A 4BBHA 1I12A 1Z4EA 3R9GA 2OH1A 4NXYA 4CGOA 3QAHA 1B87A 3TCVA 4YRHA 2O28A 4JXRA 2B5GA 4UFWA 1XF8A 4K30A 2YGWA 2D4OA 2Q4YA 2PC1A 3R95A 4AB7A 4ZBGA 3BLNA 4H89A 4YFJA 1XEBA 2DPSA 4UCMA 4HNYB 5G22A 3DR6A 2P6EA 3TFYA 2J8NA 2DXQA 3D3SA 3E0KA 4MY3A 4UWIA 5J8CA 1N71A 2Z3KA 4B5PA 3DR8A 2VI7A 5I0CA 5IX3A 1BO4A 2Z3NA 4UCNA 2J8RA 4LUAA 4XNHC 4A2ZA 2B5GB 4OLLA 1S7LA 5CNPA 3B8GA 3FRMA 2DPTA 4NSQA 4XPDC 4F6AA 1IYLA 3RYOA 2X7BA 3SXOA 4CGPA 4RI1A 4L89A 3FB3A 2CNMA 2WUUA 4CS0B 3QB8A 3I9SA 4UBRA 5H84A 5AG5A 2FS5A 4B5PB 3C26A 4A32A 4C7IA 4ORFA 1GHEA 3TO9A 1S60A 2YNCC 1Z9UA 4AG9A 3NE7A 2Z3MA 5HH1A 1Y7RA 2WPXA 4PV6A 1NSLA 1YVOA 2B4DA 2VQYA 3PP9A 4AVCA 5E96A 2BUEA 3SHPA 3VWEA 4U5YA 4MFKA 2Z11A 2BEIA 3A9LA 1B6BA 4KSAA 5AG7A 2Q44A 4JD6A 2B4BA 2YNCA 3FBUA 4M85A 1YR0A 4J3GA 3W6XA 4B13A 3BJ7A 4B11A 4KVXA 1QSOA 2FXFA 2B3UA 2YNEA 4KOTA 3EFAA 4Q38A 2FL4A 3R9FA 4KOWA 4E8OA 4A31A 2RC4A 4KS9A 4FD6A 3TOBA 2ZPAA 3JVNA 2B4DB 3T90A 1XE4A 5AG6A 4KORA 2VZYA 1YX0A 2PDOA 4BMHA 2HUZA 4RS2A 1CJWA 4XPKA 4QVTA 2ZW5A 1Q2DA 4C2YA 2REFA 4C2XA 1Q2YA 5KTDA 2ARHA 2JEVA 2Z10A 3IWGA 3DSBA 4FD7A 1KUXA 4PSWA 4UCPA 4F0YA 4ONUA 3DDDA 2Y0MA 4EVYA 4AVAA 3TTHA 3ZZIA 2VZZA 1OZPA 4JXQA 1M44A 2PQ8A 4QC6A 4IUSA 2FIAA 1S3ZA 4CYPA 4MI4A 4Q36A 1M4IA 1BOBA 1MJBA 1IYKA 4KVOE 4C68A 5BWAB 2AJ6A 3EC4A 1UFHA 1LRZA 5AGEA 2WPWA 5G21A 2Q4VA 1WWZA 2R7HA 2Q04A 1S7NA 2B3VA 4QUSA 2Z3OA 4MBUA 4NCZA 2HQYA 3LODA 3TE4A 1KUYA 2I00A 1NMTA 5FVJA 4KOUA 1IB1E 3CXSA 2EVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0B A;  2P6G A;  3TO7 A;  2I79 A;  2ZW7 A;  2ATR A;  4B5O A;  1MJA A;  2A4N A;  1RO5 A;  1ON0 A;  3EO4 A;  4HNX B;  4AG7 A;  1P4N A;  1M4G A;  1YVK A;  3MGD A;  1K4J A;  5KTA A;  2CNT A;  2Q0Y A;  2PSW A;  1NE9 A;  1S5K A;  3VWD A;  1M1D A;  3OWC A;  5DWN A;  3N7Z A;  1I1D A;  4I49 A;  2CNS A;  2OZU A;  5C82 A;  4MJ8 A;  4X5K A;  4U9Y A;  3S6F A;  5ISV A;  3F0A A;  4HKF A;  5DWM A;  2FIW A;  4JJX A;  3FXT A;  4UWJ A;  3TO6 A;  5KTC A;  1YRE A;  2GE3 A;  2H5M A;  1TIQ A;  3V8I A;  4E0A A;  2VEZ A;  2J8M A;  4KOY A;  2BSW A;  3I3G A;  1Y9K A;  2F5I A;  2BL1 A;  3PGP A;  3UY5 A;  4CAV A;  3W91 A;  3F5B A;  4CAX A;  1Z4R A;  2D4P A;  5JPH A;  2CY2 A;  4H6U A;  4QB9 A;  1L0C A;  2PRB A;  4KLW A;  3CXQ A;  2JLM A;  2ZXV A;  4CAW A;  3LD2 A;  4KLV A;  2QML A;  2OU2 A;  4KVM E;  3P2H A;  4CRZ B;  1U6M A;  2FSR A;  5F48 A;  4KUB A;  5F46 A;  4HNW B;  4JLY A;  2GAN A;  3T9Y A;  3F8K A;  3W6S A;  3EY5 A;  1V0C A;  2OB0 A;  5F49 A;  2HV2 A;  1Y9W A;  3GYA A;  2QIR A;  4PK2 A;  3IGR A;  3D2P A;  5J8F A;  1QSR A;  1YGH A;  4OAE A;  4Y49 B;  2VBQ A;  1YLE A;  4H6Z A;  3S6G A;  2P6F A;  1QSM A;  2GIV A;  3PZJ A;  4CRY B;  2NMT A;  2R1I A;  4JWP A;  3EXN A;  4DNC A;  4R3K A;  1PUA A;  4KOV A;  4KUA A;  2ZW6 A;  1XMT A;  4IF5 A;  4XPL A;  4L8A A;  2B58 A;  4M3S A;  2G3T A;  3GKR A;  3GY9 A;  3KKW A;  1MJ9 A;  3H4Q A;  1VHS A;  3S6K A;  3FNC A;  1QST A;  3CXP A;  4R9M A;  1VKC A;  2VXK A;  4U9Z A;  2Z0Z A;  4GS4 A;  4NF1 A;  4PK3 A;  2AE6 A;  1SQH A;  4FD4 A;  5GCN A;  3K9U A;  1S7K A;  2EUI A;  3WR7 A;  2R8V A;  3FYN A;  5IB0 A;  5C88 A;  1CM0 A;  4R57 A;  4E2A A;  4R87 A;  1QSN A;  2K5T A;  3ZJ0 A;  3S6H A;  4KOS A;  4MY0 A;  5H86 A;  3D2M A;  2C27 A;  3R1K A;  5F47 A;  2PR1 A;  1Q2C A;  4FD5 A;  1MK4 A;  1IIC A;  4LX9 A;  4Y49 C;  4MHD A;  5JQ4 A;  3BJ8 A;  1I21 A;  2FT0 A;  4R3L A;  1R57 A;  2ZW4 A;  1KUV A;  3TOA A;  2PR8 A;  4QBJ A;  3DNS A;  2JDC A;  2Q7B A;  4YGO A;  3P2F A;  1KZF A;  5IV0 A;  1S7F A;  2FCK A;  4II9 A;  3G3S A;  1PU9 A;  2G3A A;  4KOX A;  4XNH B;  3R9E A;  2REE A;  2R98 A;  1WK4 A;  1M4D A;  4PSX A;  2QEC A;  1P0H A;  5EBV A;  4XPD B;  2KCW A;  4NEX A;  4KZT A;  5EC4 A;  1XIX A;  3R96 A;  2FE7 A;  2OZH A;  2OZG A;  3D8P A;  3SXN A;  3FIX A;  3TT2 A;  5HMN A;  4AVB A;  2JDD A;  1RXT A;  1FY7 A;  1IID A;  3G8W A;  2IL4 A;  1J4J A;  4UA3 A;  2P0W A;  4OAD A;  3JUW A;  1YK3 A;  1I12 A;  1Z4E A;  3R9G A;  2OH1 A;  4NXY A;  3QAH A;  1B87 A;  3TCV A;  4YRH A;  2O28 A;  4JXR A;  2B5G A;  1XF8 A;  4K30 A;  2D4O A;  2Q4Y A;  2PC1 A;  3R95 A;  4AB7 A;  4ZBG A;  3BLN A;  4H89 A;  4YFJ A;  1XEB A;  4HNY B;  3DR6 A;  2P6E A;  3TFY A;  2J8N A;  2DXQ A;  3D3S A;  3E0K A;  4MY3 A;  4UWI A;  5J8C A;  1N71 A;  4B5P A;  3DR8 A;  2VI7 A;  5I0C A;  5IX3 A;  1BO4 A;  2J8R A;  4LUA A;  4XNH C;  2B5G B;  4OLL A;  1S7L A;  5CNP A;  3B8G A;  3FRM A;  4NSQ A;  4XPD C;  4F6A A;  1IYL A;  3RYO A;  2X7B A;  3SXO A;  4RI1 A;  4L89 A;  3FB3 A;  2CNM A;  4CS0 B;  3QB8 A;  3I9S A;  4UBR A;  5H84 A;  2FS5 A;  4B5P B;  3C26 A;  4ORF A;  1GHE A;  3TO9 A;  1S60 A;  1Z9U A;  4AG9 A;  3NE7 A;  5HH1 A;  1Y7R A;  2WPX A;  4PV6 A;  1NSL A;  1YVO A;  2B4D A;  2VQY A;  3PP9 A;  4AVC A;  5E96 A;  2BUE A;  3SHP A;  3VWE A;  4U5Y A;  2Z11 A;  2BEI A;  1B6B A;  2Q44 A;  4JD6 A;  2B4B A;  3FBU A;  4M85 A;  1YR0 A;  4J3G A;  3W6X A;  3BJ7 A;  4KVX A;  1QSO A;  2FXF A;  2B3U A;  4KOT A;  3EFA A;  3R9F A;  2FL4 A;  4E8O A;  4KOW A;  2RC4 A;  4FD6 A;  3TOB A;  2ZPA A;  3JVN A;  2B4D B;  3T90 A;  1XE4 A;  4KOR A;  2VZY A;  1YX0 A;  2PDO A;  4BMH A;  2HUZ A;  4RS2 A;  1CJW A;  4XPK A;  4QVT A;  2ZW5 A;  1Q2D A;  2REF A;  1Q2Y A;  5KTD A;  2ARH A;  2JEV A;  2Z10 A;  3IWG A;  3DSB A;  4FD7 A;  1KUX A;  4PSW A;  4F0Y A;  4ONU A;  3DDD A;  2Y0M A;  4EVY A;  4AVA A;  3TTH A;  3ZZI A;  2VZZ A;  1OZP A;  4JXQ A;  1M44 A;  2PQ8 A;  4QC6 A;  4IUS A;  2FIA A;  1S3Z A;  4MI4 A;  1M4I A;  1BOB A;  1MJB A;  1IYK A;  4KVO E;  2AJ6 A;  3EC4 A;  1UFH A;  1LRZ A;  2WPW A;  2Q4V A;  1WWZ A;  2R7H A;  2Q04 A;  1S7N A;  2B3V A;  4QUS A;  4MBU A;  4NCZ A;  2HQY A;  3LOD A;  3TE4 A;  1KUY A;  2I00 A;  1NMT A;  5FVJ A;  4KOU A;  1IB1 E;  3CXS A;  2EVN A; 
#chains in the Genus database with same CATH topology
 3NH5 A;  2AFX A;  2G0B A;  3JTK A;  2P6G A;  5THW A;  6CPA A;  1QMU A;  3TO7 A;  2I79 A;  2ZW7 A;  2ATR A;  4MFP A;  4B5O A;  4BD9 A;  2A4N A;  1MJA A;  1RO5 A;  1ON0 A;  3EO4 A;  3FJU A;  4MMO A;  4HNX B;  4AG7 A;  1P4N A;  3DLJ A;  2CIJ A;  2V8H A;  4P4E A;  4CAF A;  1M4G A;  4O23 A;  4ZI6 A;  1YVK A;  4NGS A;  3MGD A;  1K4J A;  4UFX A;  5KTA A;  2JBK A;  4ZGY B;  2PJB A;  2CNT A;  2CXA A;  5HVF A;  4Z65 A;  2Q0Y A;  2PSW A;  4MXU A;  1NE9 A;  1S5K A;  1IGB A;  1ZLI A;  1M1D A;  3OWC A;  3VWD A;  4PQA A;  5DWN A;  3D7F A;  3N7Z A;  4TWE A;  1I1D A;  3SI2 A;  4I49 A;  2CNS A;  2GLF A;  2OZU A;  1ELM P;  4Q7A A;  1XRY A;  5JM6 A;  5C82 A;  2ZEP A;  4MFL A;  4MJ8 A;  5EMI A;  4X5K A;  4U9Y A;  4B14 A;  3S6F A;  5ISV A;  4MCR A;  3F0A A;  4YU9 A;  4MFJ A;  4HKF A;  5DWM A;  3H5Z A;  1Z8T A;  4MCS A;  2FIW A;  3GLJ A;  3IWE A;  4JJX A;  1VIX A;  1XBU A;  2Q4Z A;  4ZX9 A;  1TKJ A;  2V8V A;  2PVW A;  3FXT A;  4UWJ A;  3TO6 A;  3LWU A;  4CAE A;  4RUH A;  5KTC A;  3H8G A;  1X10 A;  1YRE A;  2GE3 A;  2H5M A;  1TIQ A;  3V8I A;  2PJ2 A;  3T8W A;  4E0A A;  2VEZ A;  3ISZ A;  2J8M A;  4C7H A;  1XJO A;  4A94 A;  4KOY A;  2BSW A;  3I3G A;  1Y9K A;  1JWQ A;  1YQE A;  5LRJ A;  2F5I A;  2BL1 A;  3S9M A;  3PGP A;  4FUU A;  1YLO A;  3IJ3 A;  3UY5 A;  3FEC A;  4CAV A;  2Z3P A;  5LYI A;  3W91 A;  3RAM A;  4IAV A;  3CZX A;  3B3S A;  3KL9 A;  3F5B A;  2ANP A;  4CAX A;  3VAR A;  4A37 A;  5CPA A;  5K8N A;  1Z4R A;  3RBU A;  2D4P A;  3HLP A;  3KI9 A;  4DYO A;  5JPH A;  4OC2 A;  1X12 A;  4OKO A;  1RTQ A;  3SJG A;  1CX8 A;  2CY2 A;  4H6U A;  4QB9 A;  3KHX A;  3B7I A;  1L0C A;  2PRB A;  2YND A;  3KHZ A;  4KLW A;  3CXQ A;  2JLM A;  2Z3L A;  4GXH A;  4EFD A;  2ZXV A;  4CAW A;  3PB8 X;  3LD2 A;  4KLV A;  2QML A;  1BPN A;  4NGQ A;  3CDX A;  3FH4 A;  1GYT A;  2OU2 A;  1F57 A;  3PB4 X;  4KVM E;  1H8L A;  3P2H A;  4MCQ A;  4CGL A;  5A28 A;  1CG2 A;  2Q43 A;  1U6M A;  2FSR A;  3DGV A;  4CRZ B;  5F48 A;  4KUB A;  5F46 A;  2AFM A;  3FMC A;  2CTB A;  4R76 A;  4HNW B;  2ZEG A;  4JLY A;  4P45 A;  1F2P A;  3FEE A;  2GAN A;  3T9Y A;  1ZG8 A;  4IK2 A;  4UEZ A;  3F8K A;  3W6S A;  3KR5 A;  3EY5 A;  2PJC A;  1V0C A;  2OB0 A;  5F49 A;  2HV2 A;  1Y9W A;  1DE4 C;  2QIR A;  1Z8L A;  3GYA A;  2ODF A;  4B12 A;  1Z2L A;  4PK2 A;  1KWM A;  3IGR A;  1YW4 A;  3BI0 A;  3D2P A;  5J8F A;  4MFQ A;  3IO1 A;  1QSR A;  2PJA A;  1YW6 A;  1R3N A;  1Z5R A;  1YGH A;  1CPS A;  1PCA A;  4CPA A;  4OAE A;  4FBE A;  3S9N A;  4Y49 B;  2VBQ A;  2PJ0 A;  2C6C A;  1HDU A;  1YLE A;  7CPA A;  4HPS A;  4H6Z A;  4C2Z A;  2C6G A;  4M6H A;  3GB0 A;  3S6G A;  5IB9 A;  5K8M A;  5F09 A;  2P6F A;  1QSM A;  2GIV A;  1F2O A;  2PJ4 A;  4P4F A;  1Y0Y A;  3PZJ A;  4CRY B;  2C1C A;  4MFZ A;  2NMT A;  2R1I A;  4JWP A;  4KSF A;  5D8N A;  3EXN A;  1YME A;  4DNC A;  4R3K A;  1PUA A;  2J9A A;  4R8F A;  4OID A;  1BLL E;  4PXB A;  3IWW A;  4B10 A;  4KOV A;  4WWV A;  3RO0 A;  4KUA A;  1LAN A;  2ZW6 A;  4UF4 A;  2O4H A;  3IEH A;  2ZEH A;  1XMT A;  4IF5 A;  4R7M A;  4XPL A;  4L8A A;  3IU2 A;  2ZED A;  2B58 A;  4M3S A;  2GFQ A;  2G3T A;  2WYR A;  3GKR A;  3GY9 A;  1MJ9 A;  3KKW A;  4JZ0 A;  2JEW A;  3H4Q A;  3CPA A;  1VHS A;  1Z8X A;  2OOT A;  1VHE A;  2FVG A;  2WSA A;  3S6K A;  3D7H A;  1IU8 A;  3FNC A;  2IJZ A;  5LYL A;  3IU1 A;  1QST A;  5G20 A;  5K8O A;  2QVP A;  1R43 A;  3CXP A;  4A33 A;  4R9M A;  4NGR A;  2PE3 A;  1VKC A;  4F9V A;  2VXK A;  4UEE A;  4U9Z A;  2Z0Z A;  3JRU A;  4GS4 A;  4NF1 A;  3TC8 A;  2I3C A;  4CYO A;  4PK3 A;  2AE6 A;  1SQH A;  1UWY A;  4FD4 A;  5GCN A;  3K9U A;  1XMB A;  1S7K A;  2V8G A;  2EBJ A;  2EUI A;  3WC6 A;  3WR7 A;  4NGP A;  2R8V A;  4K3N A;  3FYN A;  3WC7 A;  4A38 A;  1OBR A;  2ZEM A;  3SI0 A;  5IB0 A;  2PRQ A;  1ELL P;  5C88 A;  1CM0 A;  3KR4 A;  4R57 A;  3PFE A;  4E2A A;  3D66 A;  4EME A;  4P4J A;  4R87 A;  1QSN A;  4X8I A;  2K5T A;  2PIY A;  3ZJ0 A;  4OC0 A;  3S6H A;  2PIZ A;  4KOS A;  4MY0 A;  3PBE A;  3WAB A;  4P44 A;  2AFO A;  2PJ3 A;  5H86 A;  3B3W A;  3D2M A;  2C27 A;  3R1K A;  5F47 A;  5JGF A;  2PR1 A;  1Q2C A;  4FD5 A;  1MK4 A;  4R6T A;  4CGN A;  1IIC A;  4LX9 A;  4Y49 C;  4MHD A;  3PBB A;  4FAI A;  5HVG A;  4H2K A;  1VGY A;  5JQ4 A;  4PXC A;  3I1U A;  3BJ8 A;  1I21 A;  1LFW A;  2FT0 A;  4UFV A;  4CGM A;  4R3L A;  1R57 A;  2ZW4 A;  1KUV A;  1ZLH A;  2PR8 A;  3TOA A;  4RN7 A;  1ZO0 A;  4QBJ A;  3DNS A;  2JDC A;  2Q7B A;  3B2Y A;  4YGO A;  4A39 A;  3P2F A;  1KZF A;  5IV0 A;  2O53 A;  1S7F A;  2FCK A;  3NA6 A;  4II9 A;  3G3S A;  1PU9 A;  2G3A A;  4KOX A;  4XNH B;  5LRG A;  3R9E A;  2REE A;  4F0X A;  3B3C A;  2PJ8 A;  2R98 A;  3HUV A;  2OR4 A;  3PB7 X;  4NJQ A;  4A95 A;  1ARL A;  3MN8 A;  1WK4 A;  1M4D A;  3LAC A;  4CYQ A;  4PSX A;  3GUX A;  2QEC A;  1P0H A;  5EBV A;  2GLJ A;  4W9Y A;  2ZEN A;  4XPD B;  1QQ9 A;  2KCW A;  4NGM A;  4NEX A;  1IOF A;  4KZT A;  4OC1 A;  1XFO A;  5EC4 A;  4TNU A;  1XIX A;  4JYW A;  4P4D A;  2FE7 A;  4X3R A;  3R96 A;  5A27 A;  3BHX A;  2OZH A;  1TKF A;  2OZG A;  3D8P A;  2ZEE A;  3CT9 A;  3SXN A;  5AG4 A;  3FIX A;  3TT2 A;  3NH4 A;  5HMN A;  4M6I A;  1TKH A;  5G1Z A;  4AVB A;  4CYN A;  1Q7L A;  2JDD A;  1RXT A;  4BIN A;  1FY7 A;  1IID A;  3G8W A;  4MHZ A;  2IL4 A;  1J4J A;  5LYD A;  4UA3 A;  1IOI A;  2AFS A;  2P0W A;  4A30 A;  4OAD A;  2EO8 A;  2Q51 A;  4C68 A;  3JUW A;  1YK3 A;  4BBH A;  1I12 A;  1Z4E A;  5AG7 A;  3R9G A;  4ZY0 A;  2ZEL A;  5DS0 A;  2OH1 A;  2RFH A;  4NXY A;  4MCP A;  4OC4 A;  5K8P A;  2PJ5 A;  2RB7 A;  3QAH A;  2EK8 A;  4CGO A;  2PJ1 A;  1B87 A;  1HDQ A;  1HEE A;  4YRH A;  3TCV A;  4ZYQ A;  2O28 A;  4MHY A;  4JXR A;  2B5G A;  4UFW A;  3T90 A;  4F9U A;  1XF8 A;  3L2N A;  4K30 A;  2YGW A;  2D4O A;  2Q4Y A;  2PC1 A;  4WJB A;  2Q7S A;  3R95 A;  4ZBG A;  4AB7 A;  3BLN A;  4H89 A;  4YFJ A;  4M6G A;  1XEB A;  2DPS A;  4UCM A;  4HNY B;  3KAS A;  2ABZ A;  2BOA A;  5G22 A;  3DR6 A;  3D7G A;  2P6E A;  5I4M A;  3TFY A;  3PEI A;  1Y7E A;  1CP6 A;  2J8N A;  3IIB A;  2BCO A;  2DXQ A;  2BO9 A;  3D3S A;  4IHM A;  3RZA A;  3E0K A;  4MY3 A;  4UWI A;  5J8C A;  1N71 A;  2XEF A;  1FNO A;  2Z3K A;  4UIA A;  4B5P A;  3DR8 A;  3H8F A;  2VI7 A;  3NH8 A;  3SJX A;  5I0C A;  1ZG9 A;  2IMO A;  5IX3 A;  1BO4 A;  2Z3N A;  3GIU A;  3PB9 X;  4UCN A;  5D29 A;  2J8R A;  4LUA A;  4XNH C;  4A2Z A;  2B5G B;  1XOV A;  5JH9 A;  4OLL A;  4OME A;  4G1P A;  3VAT A;  1S7L A;  4MHN A;  5CNP A;  3B8G A;  3WT4 A;  8CPA A;  3FRM A;  2DPT A;  4NSQ A;  4OP4 A;  3V7Z A;  3FF3 A;  4XPD C;  4NGT A;  2IQ6 A;  2ZOG A;  2ZEO A;  4F6A A;  1IYL A;  3RYO A;  2X7B A;  1A2Z A;  3SXO A;  4RI1 A;  4CGP A;  4L89 A;  3KQX A;  3FB3 A;  2CNM A;  2WUU A;  5LYF A;  2CF4 A;  2GU2 A;  2V8D A;  4MRI A;  4CS0 B;  1DTD A;  3QB8 A;  3I9S A;  1AMP A;  4UBR A;  4UEF A;  5H84 A;  3ISX A;  1CBX A;  5AG5 A;  1LAP A;  2FS5 A;  4B5P B;  2F8H A;  2EK9 A;  3C26 A;  5CBM A;  2JBJ A;  3FVL A;  4DUK A;  4A32 A;  4B6Z A;  4C7I A;  1LOK A;  2PJ6 A;  4ORF A;  1GHE A;  3TO9 A;  4FWU A;  3D67 A;  4P10 A;  1S60 A;  2YNC C;  1Z9U A;  3B3V A;  3S9L A;  4OIW A;  4AG9 A;  3CPX A;  2Z3M A;  3NE7 A;  5HH1 A;  4OC5 A;  1BAV A;  2HC9 A;  1Y7R A;  4PPZ A;  2C6P A;  2CTC A;  2WPX A;  4PV6 A;  1NSL A;  4OC3 A;  3LMS A;  1YVO A;  1LAM A;  2B4D A;  4YWY A;  1ARM A;  1JQG A;  1IY7 A;  1YSJ A;  2VQY A;  3PP9 A;  4AVC A;  5E96 A;  2BUE A;  3SHP A;  3VWE A;  3WC5 A;  4U5Y A;  2AFU A;  2F7V A;  1AUG A;  4MFK A;  2Z11 A;  3D7D A;  1ZG7 A;  3K2K A;  2BEI A;  3A9L A;  1B6B A;  3IFE A;  2QYV A;  2Q44 A;  4KSA A;  4NFR A;  4JD6 A;  2B4B A;  2YNC A;  3FBU A;  3KZW A;  4M85 A;  4P6Y A;  1YR0 A;  4J3G A;  2AFW A;  3W6X A;  4B13 A;  1BPM A;  3BJ7 A;  4DJL A;  4B11 A;  4KVX A;  4ZY2 A;  1QSO A;  5LRK A;  2FXF A;  2B3U A;  2YNE A;  4P4I A;  4KOT A;  3EFA A;  4NJR A;  2FL4 A;  4P4B A;  4KOW A;  4Q38 A;  3R9F A;  4E8O A;  4A31 A;  2RC4 A;  4KS9 A;  4EWT A;  3QAY A;  3B3T A;  1LCP A;  4FD6 A;  3TOB A;  3PFO A;  4LQG A;  2ZPA A;  3JVN A;  2B4D B;  3KGQ A;  1XE4 A;  3KQZ A;  3N5F A;  3PRT A;  3BI1 A;  4ZX8 A;  5AG6 A;  4KOR A;  4LQ6 A;  2PJ9 A;  2VZY A;  1YX0 A;  2PDO A;  4BMH A;  2HUZ A;  4RS2 A;  1CJW A;  4XPK A;  4QVT A;  2ZW5 A;  1Q2D A;  1TF8 A;  3IC1 A;  5HXD A;  3V38 A;  4C2Y A;  2REF A;  4C2X A;  1Q2Y A;  5KTD A;  1PYT B;  2PJ7 A;  5ELY A;  2ARH A;  2PVV A;  2JEV A;  1AYE A;  3B35 A;  2Z10 A;  3IWG A;  3DSB A;  3QNV A;  4FD7 A;  1KUX A;  2WZN A;  4PSW A;  4ONW A;  1NSA A;  4UCP A;  1Y0R A;  2NSM A;  4ONU A;  2DEA A;  3DDD A;  2Y0M A;  3H8E A;  3PB6 X;  3SJE A;  2ZOF A;  4EVY A;  3MRU A;  4ZY1 A;  2HB6 A;  3TTH A;  3ZZI A;  4AVA A;  2VZZ A;  4F0Y A;  3NE8 A;  1OZP A;  3D4U A;  4JXQ A;  1M44 A;  1FT7 A;  2PQ8 A;  4UIB A;  4QC6 A;  4IUS A;  4X2T A;  4F8Z A;  1TF9 A;  2XEJ A;  4MHP A;  2FIA A;  1S3Z A;  3NFZ A;  3VH9 A;  4CYP A;  5J1Q A;  1CP7 A;  4MI4 A;  4Q36 A;  1CPX A;  4KSI A;  1M4I A;  4NGN A;  2ZEF A;  3FX6 A;  1BOB A;  1MJB A;  3SJF A;  1VHO A;  1IYK A;  2AFZ A;  2EWB A;  1Z8W A;  2AJ6 A;  2GRE A;  3EC4 A;  1UFH A;  4KVO E;  1LRZ A;  5BWA B;  2V77 A;  2XEG A;  2QJ8 A;  2WPW A;  5AGE A;  5G21 A;  3TX8 A;  3RNZ A;  2Q4V A;  3K9T A;  2DF5 A;  2VL1 A;  1WWZ A;  3FED A;  2R7H A;  2Q04 A;  3D68 A;  2G9D A;  1S7N A;  2B3V A;  4QUS A;  2Z3O A;  3BXM A;  4MBU A;  2NYQ A;  4NCZ A;  4PXD A;  5HVH A;  4AXV A;  2HQY A;  3LOD A;  3TE4 A;  1M4L A;  1EE3 P;  2XEI A;  4PXE A;  1KUY A;  2POK A;  2I00 A;  1NMT A;  3SI1 A;  4GM5 A;  5FVJ A;  4KOU A;  2PCU A;  1IB1 E;  3CXS A;  1TXR A;  2EVN A; 
#chains in the Genus database with same CATH homology
 2G0B A;  3JTK A;  2P6G A;  3TO7 A;  2I79 A;  2ZW7 A;  2ATR A;  4MFP A;  4B5O A;  1MJA A;  2A4N A;  1RO5 A;  1ON0 A;  3EO4 A;  4HNX B;  4AG7 A;  1P4N A;  4CAF A;  1M4G A;  1YVK A;  3MGD A;  1K4J A;  4UFX A;  5KTA A;  4ZGY B;  2CNT A;  2CXA A;  2Q0Y A;  2PSW A;  1NE9 A;  1S5K A;  3VWD A;  1M1D A;  3OWC A;  5DWN A;  3N7Z A;  1I1D A;  4I49 A;  2CNS A;  2OZU A;  5C82 A;  4MFL A;  4MJ8 A;  4X5K A;  4U9Y A;  4B14 A;  3S6F A;  5ISV A;  3F0A A;  4MFJ A;  4HKF A;  5DWM A;  3H5Z A;  2FIW A;  3IWE A;  4JJX A;  3FXT A;  4UWJ A;  3TO6 A;  4CAE A;  5KTC A;  1YRE A;  2GE3 A;  2H5M A;  1TIQ A;  3V8I A;  4E0A A;  2VEZ A;  2J8M A;  4C7H A;  4KOY A;  2BSW A;  3I3G A;  1Y9K A;  2F5I A;  2BL1 A;  3PGP A;  3UY5 A;  4CAV A;  2Z3P A;  3W91 A;  3F5B A;  4CAX A;  1Z4R A;  2D4P A;  5JPH A;  2CY2 A;  4H6U A;  4QB9 A;  1L0C A;  2PRB A;  2YND A;  4KLW A;  3CXQ A;  2JLM A;  2Z3L A;  2ZXV A;  4CAW A;  3LD2 A;  4KLV A;  2QML A;  2OU2 A;  4KVM E;  4CGL A;  3P2H A;  5A28 A;  4CRZ B;  1U6M A;  2FSR A;  5F48 A;  4KUB A;  5F46 A;  4HNW B;  4JLY A;  2GAN A;  3T9Y A;  3F8K A;  3W6S A;  3EY5 A;  1V0C A;  2OB0 A;  5F49 A;  2HV2 A;  1Y9W A;  3GYA A;  2QIR A;  4B12 A;  4PK2 A;  3IGR A;  3D2P A;  5J8F A;  4MFQ A;  1QSR A;  1YGH A;  4OAE A;  4Y49 B;  2VBQ A;  1YLE A;  4H6Z A;  4C2Z A;  3S6G A;  2P6F A;  1QSM A;  2GIV A;  3PZJ A;  4CRY B;  4MFZ A;  2NMT A;  2R1I A;  4JWP A;  4KSF A;  3EXN A;  4DNC A;  4R3K A;  1PUA A;  4B10 A;  4KOV A;  4KUA A;  2ZW6 A;  1XMT A;  4IF5 A;  4XPL A;  4L8A A;  3IU2 A;  2B58 A;  4M3S A;  2G3T A;  3GKR A;  3GY9 A;  3KKW A;  1MJ9 A;  3H4Q A;  1VHS A;  3S6K A;  2WSA A;  3FNC A;  3IU1 A;  1QST A;  5G20 A;  4A33 A;  3CXP A;  4R9M A;  1VKC A;  2VXK A;  4U9Z A;  2Z0Z A;  4GS4 A;  4NF1 A;  4CYO A;  4PK3 A;  2AE6 A;  1SQH A;  4FD4 A;  5GCN A;  3K9U A;  1S7K A;  2EUI A;  3WR7 A;  2R8V A;  3FYN A;  5IB0 A;  5C88 A;  1CM0 A;  4R57 A;  4E2A A;  4R87 A;  1QSN A;  2K5T A;  3ZJ0 A;  3S6H A;  4KOS A;  4MY0 A;  5H86 A;  3D2M A;  2C27 A;  3R1K A;  5F47 A;  2PR1 A;  1Q2C A;  4FD5 A;  1MK4 A;  4CGN A;  1IIC A;  4LX9 A;  4Y49 C;  4MHD A;  5JQ4 A;  3BJ8 A;  1I21 A;  4UFV A;  2FT0 A;  4CGM A;  4R3L A;  1R57 A;  2ZW4 A;  1KUV A;  3TOA A;  2PR8 A;  1ZO0 A;  4QBJ A;  3DNS A;  2JDC A;  2Q7B A;  4YGO A;  3P2F A;  1KZF A;  5IV0 A;  1S7F A;  2FCK A;  4II9 A;  3G3S A;  1PU9 A;  2G3A A;  4KOX A;  4XNH B;  3R9E A;  4F0X A;  2REE A;  2R98 A;  4A95 A;  1WK4 A;  1M4D A;  4CYQ A;  4PSX A;  2QEC A;  1P0H A;  5EBV A;  4XPD B;  2KCW A;  4NEX A;  4KZT A;  5EC4 A;  1XIX A;  3R96 A;  2FE7 A;  5A27 A;  2OZH A;  2OZG A;  3D8P A;  5AG4 A;  3SXN A;  3FIX A;  3TT2 A;  5HMN A;  5G1Z A;  4AVB A;  4CYN A;  2JDD A;  1RXT A;  1FY7 A;  1IID A;  3G8W A;  2IL4 A;  1J4J A;  4UA3 A;  2P0W A;  4A30 A;  4OAD A;  3JUW A;  1YK3 A;  4BBH A;  1I12 A;  1Z4E A;  3R9G A;  2OH1 A;  4NXY A;  4CGO A;  3QAH A;  1B87 A;  3TCV A;  4YRH A;  2O28 A;  4JXR A;  2B5G A;  4UFW A;  1XF8 A;  4K30 A;  2YGW A;  2D4O A;  2Q4Y A;  2PC1 A;  3R95 A;  4AB7 A;  4ZBG A;  3BLN A;  4H89 A;  4YFJ A;  1XEB A;  2DPS A;  4UCM A;  4HNY B;  5G22 A;  3DR6 A;  2P6E A;  3TFY A;  2J8N A;  2DXQ A;  3D3S A;  3E0K A;  4MY3 A;  4UWI A;  5J8C A;  1N71 A;  2Z3K A;  4B5P A;  3DR8 A;  2VI7 A;  5I0C A;  5IX3 A;  1BO4 A;  2Z3N A;  4UCN A;  2J8R A;  4LUA A;  4XNH C;  4A2Z A;  2B5G B;  4OLL A;  1S7L A;  5CNP A;  3B8G A;  3FRM A;  2DPT A;  4NSQ A;  4XPD C;  4F6A A;  1IYL A;  3RYO A;  2X7B A;  3SXO A;  4CGP A;  4RI1 A;  4L89 A;  3FB3 A;  2CNM A;  2WUU A;  4CS0 B;  3QB8 A;  3I9S A;  4UBR A;  5H84 A;  5AG5 A;  2FS5 A;  4B5P B;  3C26 A;  4A32 A;  4C7I A;  4ORF A;  1GHE A;  3TO9 A;  1S60 A;  2YNC C;  1Z9U A;  4AG9 A;  3NE7 A;  2Z3M A;  5HH1 A;  1Y7R A;  2WPX A;  4PV6 A;  1NSL A;  1YVO A;  2B4D A;  2VQY A;  3PP9 A;  4AVC A;  5E96 A;  2BUE A;  3SHP A;  3VWE A;  4U5Y A;  4MFK A;  2Z11 A;  2BEI A;  3A9L A;  1B6B A;  4KSA A;  5AG7 A;  2Q44 A;  4JD6 A;  2B4B A;  2YNC A;  3FBU A;  4M85 A;  1YR0 A;  4J3G A;  3W6X A;  4B13 A;  3BJ7 A;  4B11 A;  4KVX A;  1QSO A;  2FXF A;  2B3U A;  2YNE A;  4KOT A;  3EFA A;  4Q38 A;  2FL4 A;  3R9F A;  4KOW A;  4E8O A;  4A31 A;  2RC4 A;  4KS9 A;  4FD6 A;  3TOB A;  2ZPA A;  3JVN A;  2B4D B;  3T90 A;  1XE4 A;  5AG6 A;  4KOR A;  2VZY A;  1YX0 A;  2PDO A;  4BMH A;  2HUZ A;  4RS2 A;  1CJW A;  4XPK A;  4QVT A;  2ZW5 A;  1Q2D A;  4C2Y A;  2REF A;  4C2X A;  1Q2Y A;  5KTD A;  2ARH A;  2JEV A;  2Z10 A;  3IWG A;  3DSB A;  4FD7 A;  1KUX A;  4PSW A;  4UCP A;  4F0Y A;  4ONU A;  3DDD A;  2Y0M A;  4EVY A;  4AVA A;  3TTH A;  3ZZI A;  2VZZ A;  1OZP A;  4JXQ A;  1M44 A;  2PQ8 A;  4QC6 A;  4IUS A;  2FIA A;  1S3Z A;  4CYP A;  4MI4 A;  4Q36 A;  1M4I A;  1BOB A;  1MJB A;  1IYK A;  4KVO E;  4C68 A;  5BWA B;  2AJ6 A;  3EC4 A;  1UFH A;  1LRZ A;  5AGE A;  2WPW A;  5G21 A;  2Q4V A;  1WWZ A;  2R7H A;  2Q04 A;  1S7N A;  2B3V A;  4QUS A;  2Z3O A;  4MBU A;  4NCZ A;  2HQY A;  3LOD A;  3TE4 A;  1KUY A;  2I00 A;  1NMT A;  5FVJ A;  4KOU A;  1IB1 E;  3CXS A;  2EVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...