2BSWA

Crystal structure of a glyphosate-n-acetyltransferase obtained by dna shuffling.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Shuffling as a Tool for Protein Crystallization.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transferase
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
total genus 36
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2bswA00
2A4NA 3SXNA 4CS0B 3FRMA 2Q4YA 1B87A 5J8FA 3CXQA 4XPLA 1WWZA 2G0BA 4CAWA 1QSRA 4F0YA 3KKWA 5J8CA 4HNXB 2Y0MA 1YR0A 3PZJA 5I0CA 2FIWA 3EC4A 1LRZA 2I79A 2I00A 2EUIA 1CM0A 1P0HA 2VQYA 3P2HA 1S5KA 4QUSA 3ZJ0A 2HQYA 3D2MA 4M3SA 4FD4A 2HUZA 4KOUA 3UY5A 4NXYA 2QECA 2PDOA 4QB9A 5F47A 2VI7A 2HV2A 3P2FA 2VZYA 4YGOA 3DR6A 1NE9A 4EVYA 4ONUA 4UWJA 3S6KA 4PV6A 5KTDA 2R8VA 2B5GA 2RC4A 1YK3A 4H6ZA 4ORFA 1PU9A 4OLLA 3GKRA 4OAEA 1B6BA 3TTHA 2QIRA 5DWMA 3S6HA 1S3ZA 3D2PA 3FB3A 4KVOE 1L0CA 1Y9KA 1M44A 2B4DA 4MJ8A 4J3GA 1IYLA 1M1DA 3DNSA 1S7LA 3NE7A 5ISVA 2PR8A 1Q2DA 2PRBA 2FT0A 1BO4A 2CNTA 3TO6A 2R7HA 1QSMA 4L89A 4AVAA 2F5IA 1RO5A 2X7BA 4NF1A 1PUAA 4QC6A 1NSLA 4R3LA 2B4DB 3OWCA 1Z9UA 2AE6A 2D4OA 4FD7A 4QBJA 3T9YA 1Q2CA 1QSTA 3BJ7A 1M4DA 4ZBGA 1XIXA 5H84A 4KOSA 2K5TA 4PSXA 3R95A 2OB0A 3V8IA 2B5GB 3B8GA 4KOXA 3TOAA 1NMTA 1GHEA 4JXQA 2IL4A 3F0AA 4Y49B 1QSNA 4PK3A 3EFAA 2B3VA 2R1IA 2Z0ZA 3VWEA 5IV0A 4KOWA 3DR8A 1Z4EA 4KOVA 4KUAA 2PQ8A 1M4GA 3FXTA 2JEVA 2Z11A 3R9GA 1XMTA 2VBQA 4KVXA 4Y49C 4KOYA 4IF5A 3QB8A 2WPWA 4YRHA 3WR7A 2ZW5A 2P0WA 3F5BA 1VKCA 1UFHA 3E0KA 2KCWA 4K30A 4B5PB 3EXNA 2FSRA 2H5MA 4R9MA 2ZW7A 4UA3A 4AB7A 4KVME 2C27A 4QVTA 4KZTA 3TCVA 2ZW4A 3BJ8A 1S7NA 4BMHA 3I3GA 1XF8A 1VHSA 1IYKA 3W6XA 5CNPA 1FY7A 5JPHA 3D8PA 4KUBA 1YVOA 4OADA 3JUWA 3TT2A 4HNYB 2D4PA 3TE4A 4XPKA 2ATRA 1Z4RA 1S7KA 2Z10A 2J8MA 4AG7A 4LUAA 2FXFA 3C26A 1MJBA 4JLYA 3LD2A 3S6GA 1P4NA 2P6FA 4M85A 3BLNA 4L8AA 4UWIA 4CRYB 2WPXA 4GS4A 4NCZA 4F6AA 1MK4A 4CAVA 4JXRA 3RYOA 4KLVA 1WK4A 4I49A 1Y7RA 4XNHC 1MJ9A 3N7ZA 5KTCA 4B5PA 4NSQA 3QAHA 5C82A 4R3KA 4MHDA 4CAXA 1BOBA 2DXQA 2PC1A 4E0AA 1S60A 1XEBA 4NEXA 5E96A 2VXKA 3D3SA 2BUEA 2B4BA 5EC4A 2JLMA 1MJAA 2FIAA 3FYNA 4XPDB 3GY9A 4JD6A 2BSWA 4R87A 2P6GA 2BEIA 4H89A 3T90A 2O28A 4CRZB 1ON0A 3TO9A 5HH1A 3R9FA 5IB0A 4KOTA 4H6UA 3G8WA 5H86A 4YFJA 5EBVA 3JVNA 1CJWA 4MBUA 4MI4A 1XE4A 4FD5A 5C88A 3H4QA 4DNCA 2Q7BA 2QMLA 2Q4VA 3IGRA 2R98A 3DDDA 1KUVA 1TIQA 5DWNA 1S7FA 5IX3A 1YLEA 2AJ6A 1YVKA 2FL4A 2EVNA 2CNMA 2ZPAA 3FIXA 3G3SA 3CXSA 2OH1A 1KUXA 5FVJA 4PK2A 3SXOA 4FD6A 3LODA 1IIDA 3EO4A 4LX9A 4R57A 1V0CA 1N71A 1SQHA 2J8NA 2GANA 4HNWB 4UBRA 5JQ4A 3TFYA 1QSOA 1OZPA 1M4IA 4U9ZA 2OZHA 2OZUA 2FS5A 3FNCA 2GIVA 2Q44A 2Q0YA 3ZZIA 1YREA 3R1KA 4XPDC 2FE7A 4B5OA 1R57A 2NMTA 2G3TA 3K9UA 4MY3A 1I12A 2JDCA 2CNSA 2CY2A 4XNHB 4AG9A 4IUSA 4MY0A 2ZW6A 4PSWA 4JWPA 3R9EA 4RI1A 1RXTA 3MGDA 2OU2A 5HMNA 2JDDA 1IB1E 5F46A 3R96A 2REFA 3GYAA 2Q04A 3S6FA 3TOBA 3IWGA 4RS2A 5F48A 3F8KA 1J4JA 2ARHA 2J8RA 5KTAA 3W91A 4KLWA 1YX0A 3I9SA 4KORA 2ZXVA 4E8OA 3W6SA 3DSBA 2VEZA 2REEA 3VWDA 4AVBA 1I21A 5GCNA 1Y9WA 1KZFA 2VZZA 1IICA 2G3AA 2OZGA 5F49A 2B58A 3CXPA 4AVCA 2PSWA 3PP9A 3TO7A 1U6MA 4HKFA 2FCKA 4JJXA 2P6EA 4U5YA 1YGHA 2BL1A 3PGPA 1K4JA 4U9YA 4X5KA 2GE3A 1Q2YA 2B3UA 3SHPA 2PR1A 1KUYA 4E2AA 4II9A 1I1DA 3EY5A 3FBUA
chains in the Genus database with same CATH superfamily
2A4NA 3SXNA 1ELMP 1Z5RA 2C6GA 4CS0B 3PBBA 5JM6A 5LRKA 2JEWA 3FRMA 4ZX9A 1TXRA 2Q4YA 3L2NA 1B87A 2PJ8A 2AFUA 5J8FA 3KR5A 3CXQA 4XPLA 6CPAA 1WWZA 2G0BA 1IOIA 4PXCA 4CAWA 1QSRA 1A2ZA 1TF8A 1ZG9A 4F0YA 1OBRA 3KKWA 5J8CA 4MFZA 4HNXB 2C1CA 4KSAA 4F9UA 3IO1A 3PB9X 3FEEA 3HLPA 4UCNA 2Y0MA 2WUUA 1YR0A 3FX6A 3PZJA 4NGNA 4UF4A 4DUKA 5I0CA 2FIWA 3EC4A 2Q4ZA 3WC5A 4CAEA 4NGRA 5AG6A 1LRZA 2I79A 2I00A 3FBUA 2EUIA 5K8PA 1CM0A 1P0HA 2VQYA 3P2HA 1CX8A 1S5KA 2GU2A 3H5ZA 3K2KA 3NH5A 4QUSA 2PJAA 2YGWA 3ZJ0A 1IU8A 2HQYA 4NGSA 3D2MA 4M3SA 2PRQA 4FD4A 1X12A 3JTKA 2ZEGA 5HVFA 4MCSA 2HUZA 2V8HA 3D7DA 5IB9A 4KOUA 3UY5A 4NXYA 2QECA 4A94A 4AXVA 3PB7X 2PJ1A 2PDOA 4MHPA 4QB9A 4P4EA 5F47A 2VI7A 2HV2A 3P2FA 2VZYA 3B7IA 4YGOA 3CDXA 3DR6A 4BBHA 3VH9A 2OOTA 1Z8TA 1NE9A 1ARLA 5LRGA 4ONUA 4UWJA 4EVYA 2Q43A 4X8IA 1VGYA 3S6KA 4OC3A 4PV6A 5KTDA 2R8VA 2B5GA 1CPSA 2RC4A 3DGVA 1YK3A 4O23A 3GLJA 4DYOA 4H6ZA 4ORFA 1PU9A 4PXEA 4OLLA 3GKRA 4OAEA 4UEEA 4OIDA 1B6BA 3SJEA 2I3CA 4P4FA 4MXUA 2XEFA 3TTHA 4A38A 4LQGA 1M4LA 2QIRA 5DWMA 3S6HA 1S3ZA 2BO9A 2DEAA 3FF3A 3D2PA 4UCPA 1YLOA 2EBJA 4ONWA 1PCAA 3FB3A 4KVOE 3PEIA 5LRJA 1L0CA 1VHEA 1Y9KA 2YNCA 2NSMA 2JBJA 1M44A 2PCUA 2B4DA 4MJ8A 4J3GA 1IYLA 1M1DA 1YMEA 4P45A 3DNSA 1S7LA 4B13A 2EK9A 3NE7A 2HB6A 3BXMA 3KHXA 5JGFA 5ISVA 4IAVA 2PR8A 1Q2DA 4F8ZA 2PIZA 2Z3KA 4MRIA 1LFWA 3IJ3A 2PRBA 4NGMA 3CZXA 2FT0A 2AFWA 1BO4A 1Z8LA 3D7FA 2CNTA 3IWEA 4JYWA 3MN8A 4M6GA 3TO6A 2PE3A 4OIWA 3HUVA 2R7HA 1QSMA 4L89A 4OKOA 4AVAA 2F5IA 3D68A 5LYFA 3PFOA 4CYPA 1RO5A 5I4MA 1KWMA 3GUXA 5G21A 2X7BA 2O4HA 4M6HA 4NF1A 1PUAA 4QC6A 1NSLA 3T8WA 2WZNA 2GLFA 2B4DB 3KGQA 4P4BA 4R3LA 4CYNA 4Q7AA 3KQZA 4B12A 1F2OA 1XMBA 4KS9A 4MFPA 3OWCA 1Z9UA 2AE6A 2D4OA 4FD7A 1ELLP 2IJZA 1CP6A 4H2KA 3T9YA 1Q2CA 4QBJA 3BHXA 1QSTA 1Y0RA 3BJ7A 1M4DA 1LAPA 3IWWA 4BD9A 2AFOA 4ZBGA 1BAVA 4Q36A 2F7VA 3KI9A 2ZEFA 1XIXA 4M6IA 4NGTA 5H84A 5THWA 4KOSA 2K5TA 4PXDA 4PSXA 3R95A 2OB0A 3V8IA 2B5GB 1ZG8A 3B8GA 4KOXA 3TOAA 1NMTA 1GHEA 1PYTB 4X2TA 1BPNA 3IU2A 1Z8WA 2AFXA 4JXQA 4MFKA 4CYQA 2Z3PA 2IL4A 4NJRA 2JBKA 2CTCA 3MRUA 3F0AA 2QJ8A 4Y49B 2PJ2A 3B3CA 4PPZA 2G9DA 1HEEA 1QSNA 2WSAA 3SJFA 4PK3A 5K8OA 3EFAA 2B3VA 5A28A 5F09A 2R1IA 1ZLHA 2PJCA 2Z0ZA 3B3SA 4JZ0A 3VWEA 5IV0A 1ZG7A 4KOWA 3A9LA 3H8GA 4R6TA 3DR8A 1CG2A 4A95A 4G1PA 4IHMA 1Z4EA 4UFWA 4KOVA 4KUAA 2PQ8A 1M4GA 3CT9A 1XBUA 4OC5A 3D66A 4PXBA 4YU9A 4ZI6A 3RNZA 1XFOA 4BINA 4B14A 3RBUA 3FXTA 4CGLA 4MFQA 4FAIA 5AG7A 2JEVA 3S9MA 2Z11A 3DLJA 2QYVA 3R9GA 1XMTA 3V7ZA 4MFJA 5D29A 4ZY2A 2VBQA 4KVXA 3S9LA 4Y49C 4CGNA 4KOYA 2AFMA 4IF5A 4ZY0A 3QB8A 2WPWA 4YRHA 3WR7A 2ZEPA 2ZW5A 2GREA 2P0WA 3F5BA 1VKCA 3RZAA 1UFHA 4UEZA 3E0KA 2KCWA 4K30A 4B5PB 1Q7LA 3EXNA 3QAYA 4A37A 3D4UA 2FSRA 2H5MA 4R9MA 2ZW7A 4UA3A 1NSAA 4AB7A 3LACA 4UIAA 2EWBA 1Z8XA 8CPAA 4KVME 4EWTA 2C27A 4QVTA 4R7MA 4KZTA 3SI1A 2AFSA 2QVPA 3TCVA 2ZW4A 3BJ8A 1S7NA 3CPXA 4BMHA 3I3GA 5LYIA 4P44A 1XF8A 1VHSA 2PJ3A 1IYKA 3W6XA 5CNPA 1FY7A 4TWEA 3H8FA 1QMUA 5JPHA 3D8PA 4KUBA 5G20A 1X10A 1YVOA 4OADA 3JUWA 5LYLA 1IY7A 3TT2A 4F9VA 4HNYB 2D4PA 3FECA 1JQGA 3TE4A 4XPKA 2ATRA 1Z4RA 1S7KA 2Z10A 2PJBA 4GM5A 2J8MA 3KL9A 4AG7A 4ZYQA 2EK8A 2FXFA 1TKFA 3C26A 3D7HA 1MJBA 4JLYA 4LUAA 3LD2A 3GIUA 3S6GA 1P4NA 2P6FA 2ZELA 4W9YA 4NGQA 3RO0A 4CGOA 4M85A 2ZEDA 3BLNA 4UFVA 4L8AA 4UWIA 4CRYB 5AG5A 2ZOGA 2NYQA 3TC8A 2ABZA 1LCPA 2V8VA 2WPXA 2Z3MA 4GS4A 4B6ZA 4CYOA 4NCZA 4F6AA 2YNDA 1MK4A 4CAVA 4JXRA 3RYOA 1GYTA 2XEIA 4KLVA 4OC1A 4P10A 1WK4A 5K8MA 4I49A 1Y7RA 4OC2A 3GB0A 4XNHC 1MJ9A 3FJUA 3NFZA 3N7ZA 5KTCA 4B5PA 4NSQA 4MHYA 1XOVA 2POKA 4P6YA 3BI1A 3QAHA 4OC4A 3WT4A 4B10A 4DJLA 5C82A 4R3KA 4MHDA 4CAXA 1BOBA 3FMCA 2DXQA 2PC1A 4E0AA 1AMPA 3B3VA 2O53A 1S60A 5CPAA 1XEBA 4CGPA 4NEXA 1CPXA 4P4JA 5E96A 2VXKA 4OMEA 4MHZA 2V8GA 2BUEA 3D3SA 2B4BA 4MMOA 5EC4A 3ISZA 2JLMA 3WABA 4RUHA 1MJAA 2FIAA 4RN7A 5G22A 3B3WA 1YW6A 3FYNA 4XPDB 5K8NA 2CF4A 3PRTA 1CP7A 2FVGA 3GY9A 4JD6A 2BSWA 2VL1A 3KASA 3KZWA 4R87A 5HXDA 2P6GA 2BEIA 2Q51A 3KQXA 4H89A 4P4DA 3JRUA 3T90A 4A31A 2O28A 3LWUA 4CRZB 1ON0A 2PJ9A 2PJ5A 2OR4A 1Y0YA 3IFEA 3TO9A 5LYDA 5HH1A 3D7GA 1FT7A 1IGBA 3R9FA 4CAFA 3TX8A 5IB0A 4LQ6A 3KHZA 1Y7EA 4KOTA 4B11A 4H6UA 4K3NA 2AFZA 3G8WA 5HVHA 2ANPA 4UFXA 5H86A 4YFJA 5EBVA 4C7IA 2CXAA 2F8HA 3JVNA 1CJWA 4A32A 4F0XA 3QNVA 4MBUA 2HC9A 1XE4A 2PIYA 4FD5A 2ODFA 4MFLA 4MI4A 5C88A 3H4QA 4DNCA 4IK2A 2Q7BA 2C6PA 1ZO0A 4PQAA 3V38A 2Q7SA 2QMLA 2Q4VA 2Z3LA 4C7HA 3B3TA 3IGRA 2R98A 3DDDA 4ZY1A 1VIXA 4WWVA 1KUVA 1TIQA 1LANA 2RFHA 5DWNA 1S7FA 3VARA 2PJ6A 5IX3A 1YLEA 2AJ6A 4TNUA 1BLLE 3S9NA 1YVKA 1TKJA 2XEGA 2FL4A 2YNCC 2EVNA 2CNMA 2ZPAA 3FIXA 4UEFA 2RB7A 5DS0A 2V77A 1UWYA 3G3SA 3CXSA 1AYEA 1RTQA 2OH1A 1XJOA 2PJ7A 1KUXA 1IOFA 3NH8A 5FVJA 4PK2A 3SXOA 3D67A 4FD6A 3LODA 1IIDA 3EO4A 4LX9A 4NFRA 2DPTA 4OP4A 4R57A 2CTBA 4MCPA 5JH9A 3WC7A 1V0CA 2ZENA 2PJ0A 1N71A 1SQHA 2J8NA 2GANA 4HNWB 4UBRA 2ZEOA 1R3NA 5AGEA 5JQ4A 3TFYA 2CIJA 2XEJA 3I1UA 1HDUA 1QSOA 4FUUA 5G1ZA 1OZPA 4EFDA 1M4IA 5ELYA 1F57A 4U9ZA 3PFEA 2OZHA 4NGPA 3NH4A 2OZUA 2FS5A 2WYRA 4ZGYB 2BOAA 1QQ9A 2GIVA 3FNCA 3N5FA 2Q44A 2Q0YA 3ZZIA 3PB4X 3R1KA 4MCQA 4EMEA 4XPDC 4GXHA 2FE7A 2YNEA 4KSIA 4B5OA 1R57A 2NMTA 2G3TA 3IC1A 2DPSA 2PVVA 3K9UA 1F2PA 4MY3A 1I12A 2JDCA 4MCRA 2EO8A 2CNSA 2CY2A 4XNHB 4AG9A 2ZEMA 4C68A 3BI0A 3FEDA 1FNOA 4IUSA 4WJBA 3IEHA 5HVGA 4R8FA 4MY0A 2ZW6A 4PSWA 2IQ6A 4JWPA 3R9EA 1XRYA 4RI1A 3B35A 1RXTA 1ZLIA 3FVLA 1LAMA 3MGDA 2OU2A 1CBXA 1YW4A 4A2ZA 5HMNA 2JDDA 4KSFA 1BPMA 1IB1E 3FH4A 4UIBA 2GLJA 2C6CA 1Z2LA 1EE3P 4A33A 5F46A 3R96A 2REFA 3GYAA 2Q04A 3S6FA 2Z3NA 4Q38A 2IMOA 3TOBA 1HDQA 2BCOA 5EMIA 4Z65A 4A39A 4CPAA 3IWGA 4RS2A 5F48A 3F8KA 2DF5A 1J4JA 1JWQA 3B2YA 2ARHA 2J8RA 5KTAA 2PVWA 3W91A 3PBEA 3SJXA 3CPAA 4R76A 2GFQA 3H8EA 1YX0A 3I9SA 3PB8X 4KLWA 4KORA 4P4IA 3WC6A 3ISXA 2ZXVA 5J1QA 4E8OA 3W6SA 3DSBA 2VEZA 2J9AA 2REEA 3IIBA 5CBMA 3RAMA 4NJQA 3VWDA 4OC0A 4AVBA 1I21A 5GCNA 1Y9WA 1KZFA 4MHNA 2V8DA 2VZZA 5D8NA 1IICA 1AUGA 1DE4C 2G3AA 3K9TA 2OZGA 3PB6X 5F49A 4C2XA 2B58A 3CXPA 4AVCA 5A27A 3SI0A 2PSWA 2ZEHA 3LMSA 3PP9A 4HPSA 3TO7A 1U6MA 4HKFA 2ZEEA 2Z3OA 2FCKA 3NE8A 4C2YA 4X3RA 7CPAA 1H8LA 4CGMA 4JJXA 2P6EA 4FWUA 4U5YA 4UCMA 1TF9A 2ZOFA 4ZX8A 1YGHA 2BL1A 3VATA 1TKHA 3IU1A 2PJ4A 1LOKA 3NA6A 3PGPA 4YWYA 1ARMA 1K4JA 3SI2A 1YQEA 1DTDA 4U9YA 4FBEA 4X5KA 4A30A 2GE3A 1Q2YA 1VHOA 2B3UA 5AG4A 3SHPA 2PR1A 5BWAB 1YSJA 1KUYA 3KR4A 4E2AA 3SJGA 4II9A 1R43A 4C2ZA 1I1DA 3EY5A 1YREA
chains in the Genus database with same CATH topology
2A4NA 3SXNA 4CS0B 3FRMA 2Q4YA 1B87A 5J8FA 3CXQA 4XPLA 1WWZA 2G0BA 4CAWA 1QSRA 4F0YA 3KKWA 5J8CA 4MFZA 4HNXB 4KSAA 4UCNA 2Y0MA 2WUUA 1YR0A 3PZJA 5I0CA 2FIWA 3EC4A 4CAEA 5AG6A 1LRZA 2I79A 2I00A 2EUIA 1CM0A 1P0HA 2VQYA 3P2HA 1S5KA 3H5ZA 4QUSA 2YGWA 3ZJ0A 2HQYA 3D2MA 4M3SA 4FD4A 3JTKA 2HUZA 4KOUA 3UY5A 4NXYA 2QECA 2PDOA 4QB9A 5F47A 2VI7A 2HV2A 3P2FA 2VZYA 4YGOA 3DR6A 4BBHA 1NE9A 4EVYA 4ONUA 4UWJA 3S6KA 4PV6A 5KTDA 2R8VA 2B5GA 2RC4A 1YK3A 4H6ZA 4ORFA 1PU9A 4OLLA 3GKRA 4OAEA 1B6BA 3TTHA 2QIRA 5DWMA 3S6HA 1S3ZA 3D2PA 4UCPA 3FB3A 4KVOE 1L0CA 1Y9KA 2YNCA 1M44A 2B4DA 4MJ8A 4J3GA 1IYLA 1M1DA 3DNSA 1S7LA 4B13A 3NE7A 5ISVA 2PR8A 1Q2DA 2Z3KA 2PRBA 2FT0A 1BO4A 2CNTA 3IWEA 3TO6A 2R7HA 1QSMA 4L89A 4AVAA 2F5IA 4CYPA 1RO5A 5G21A 2X7BA 4NF1A 1PUAA 4QC6A 1NSLA 4R3LA 2B4DB 4CYNA 4B12A 4KS9A 4MFPA 3OWCA 1Z9UA 2AE6A 2D4OA 4FD7A 4QBJA 3T9YA 1Q2CA 1QSTA 3BJ7A 1M4DA 4ZBGA 4Q36A 1XIXA 5H84A 4KOSA 2K5TA 4PSXA 3R95A 2OB0A 3V8IA 2B5GB 3B8GA 4KOXA 3TOAA 1NMTA 1GHEA 4MFKA 3IU2A 4JXQA 4CYQA 2Z3PA 2IL4A 3F0AA 4Y49B 1QSNA 2WSAA 4PK3A 3EFAA 2B3VA 5A28A 2R1IA 2Z0ZA 3VWEA 5IV0A 4KOWA 3A9LA 3DR8A 4A95A 1Z4EA 4UFWA 4KOVA 4KUAA 2PQ8A 1M4GA 4B14A 3FXTA 4CGLA 4MFQA 5AG7A 2JEVA 2Z11A 3R9GA 1XMTA 4MFJA 2VBQA 4KVXA 4Y49C 4CGNA 4KOYA 4IF5A 3QB8A 2WPWA 4YRHA 3WR7A 2ZW5A 2P0WA 3F5BA 1VKCA 1UFHA 3E0KA 2KCWA 4K30A 4B5PB 3EXNA 2FSRA 2H5MA 4R9MA 2ZW7A 4UA3A 4AB7A 4KVME 2C27A 4QVTA 4KZTA 3TCVA 2ZW4A 3BJ8A 1S7NA 4BMHA 3I3GA 1XF8A 1VHSA 1IYKA 3W6XA 5CNPA 1FY7A 5JPHA 3D8PA 4KUBA 5G20A 1YVOA 4OADA 3JUWA 3TT2A 4HNYB 2D4PA 3TE4A 4XPKA 2ATRA 1Z4RA 1S7KA 2Z10A 2J8MA 4AG7A 4LUAA 2FXFA 3C26A 1MJBA 4JLYA 3LD2A 3S6GA 1P4NA 2P6FA 4CGOA 4M85A 3BLNA 4UFVA 4L8AA 4UWIA 4CRYB 5AG5A 2Z3MA 2WPXA 4GS4A 4CYOA 4NCZA 4F6AA 2YNDA 1MK4A 4CAVA 4JXRA 3RYOA 4KLVA 1WK4A 4I49A 1Y7RA 4XNHC 1MJ9A 3N7ZA 5KTCA 4B5PA 4NSQA 3QAHA 4B10A 5C82A 4R3KA 4MHDA 4CAXA 1BOBA 2DXQA 2PC1A 4E0AA 1S60A 1XEBA 4CGPA 4NEXA 5E96A 2VXKA 3D3SA 2BUEA 2B4BA 5EC4A 2JLMA 1MJAA 2FIAA 5G22A 3FYNA 4XPDB 3GY9A 4JD6A 2BSWA 4R87A 2P6GA 2BEIA 4H89A 3T90A 4A31A 2O28A 4CRZB 1ON0A 3TO9A 5HH1A 3R9FA 4CAFA 5IB0A 4KOTA 4B11A 4H6UA 3G8WA 4UFXA 5H86A 4YFJA 5EBVA 4C7IA 2CXAA 3JVNA 1CJWA 4A32A 4F0XA 4MBUA 4MI4A 1XE4A 4FD5A 4MFLA 5C88A 3H4QA 4DNCA 2Q7BA 1ZO0A 2QMLA 2Q4VA 2Z3LA 4C7HA 3IGRA 2R98A 3DDDA 1KUVA 1TIQA 5DWNA 1S7FA 5IX3A 1YLEA 2AJ6A 1YVKA 2FL4A 2YNCC 2EVNA 2CNMA 2ZPAA 3FIXA 3G3SA 3CXSA 2OH1A 1KUXA 5FVJA 4PK2A 3SXOA 4FD6A 3LODA 1IIDA 3EO4A 4LX9A 2DPTA 4R57A 1V0CA 1N71A 1SQHA 2J8NA 2GANA 4HNWB 4UBRA 5AGEA 5JQ4A 3TFYA 5G1ZA 1QSOA 1OZPA 1M4IA 4U9ZA 2OZHA 2OZUA 2FS5A 4ZGYB 3FNCA 2GIVA 2Q44A 2Q0YA 3ZZIA 1YREA 3R1KA 4XPDC 2FE7A 2YNEA 4B5OA 1R57A 2NMTA 2G3TA 2DPSA 3K9UA 4MY3A 1I12A 2JDCA 2CNSA 2CY2A 4XNHB 4AG9A 4C68A 4IUSA 4MY0A 2ZW6A 4PSWA 4JWPA 3R9EA 4RI1A 1RXTA 3MGDA 2OU2A 4A2ZA 5HMNA 2JDDA 4KSFA 1IB1E 4A33A 5F46A 3R96A 2REFA 3GYAA 2Q04A 3S6FA 2Z3NA 4Q38A 3TOBA 3IWGA 4RS2A 5F48A 3F8KA 1J4JA 2ARHA 2J8RA 5KTAA 3W91A 4KLWA 1YX0A 3I9SA 4KORA 2ZXVA 4E8OA 3W6SA 3DSBA 2VEZA 2REEA 3VWDA 4AVBA 1I21A 5GCNA 1Y9WA 1KZFA 2VZZA 1IICA 2G3AA 2OZGA 5F49A 4C2XA 2B58A 3CXPA 4AVCA 5A27A 2PSWA 3PP9A 3TO7A 1U6MA 4HKFA 2Z3OA 2FCKA 4C2YA 4CGMA 4JJXA 2P6EA 4UCMA 4U5YA 1YGHA 2BL1A 3IU1A 3PGPA 1K4JA 4U9YA 4X5KA 4A30A 2GE3A 1Q2YA 2B3UA 5AG4A 3SHPA 2PR1A 5BWAB 1KUYA 4E2AA 4II9A 4C2ZA 1I1DA 3EY5A 3FBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4N A;  3SXN A;  4CS0 B;  3FRM A;  2Q4Y A;  1B87 A;  5J8F A;  3CXQ A;  4XPL A;  1WWZ A;  2G0B A;  4CAW A;  1QSR A;  4F0Y A;  3KKW A;  5J8C A;  4HNX B;  2Y0M A;  1YR0 A;  3PZJ A;  5I0C A;  2FIW A;  3EC4 A;  1LRZ A;  2I79 A;  2I00 A;  2EUI A;  1CM0 A;  1P0H A;  2VQY A;  3P2H A;  1S5K A;  4QUS A;  3ZJ0 A;  2HQY A;  3D2M A;  4M3S A;  4FD4 A;  2HUZ A;  4KOU A;  3UY5 A;  4NXY A;  2QEC A;  2PDO A;  4QB9 A;  5F47 A;  2VI7 A;  2HV2 A;  3P2F A;  2VZY A;  4YGO A;  3DR6 A;  1NE9 A;  4EVY A;  4ONU A;  4UWJ A;  3S6K A;  4PV6 A;  5KTD A;  2R8V A;  2B5G A;  2RC4 A;  1YK3 A;  4H6Z A;  4ORF A;  1PU9 A;  4OLL A;  3GKR A;  4OAE A;  1B6B A;  3TTH A;  2QIR A;  5DWM A;  3S6H A;  1S3Z A;  3D2P A;  3FB3 A;  4KVO E;  1L0C A;  1Y9K A;  1M44 A;  2B4D A;  4MJ8 A;  4J3G A;  1IYL A;  1M1D A;  3DNS A;  1S7L A;  3NE7 A;  5ISV A;  2PR8 A;  1Q2D A;  2PRB A;  2FT0 A;  1BO4 A;  2CNT A;  3TO6 A;  2R7H A;  1QSM A;  4L89 A;  4AVA A;  2F5I A;  1RO5 A;  2X7B A;  4NF1 A;  1PUA A;  4QC6 A;  1NSL A;  4R3L A;  2B4D B;  3OWC A;  1Z9U A;  2AE6 A;  2D4O A;  4FD7 A;  4QBJ A;  3T9Y A;  1Q2C A;  1QST A;  3BJ7 A;  1M4D A;  4ZBG A;  1XIX A;  5H84 A;  4KOS A;  2K5T A;  4PSX A;  3R95 A;  2OB0 A;  3V8I A;  2B5G B;  3B8G A;  4KOX A;  3TOA A;  1NMT A;  1GHE A;  4JXQ A;  2IL4 A;  3F0A A;  4Y49 B;  1QSN A;  4PK3 A;  3EFA A;  2B3V A;  2R1I A;  2Z0Z A;  3VWE A;  5IV0 A;  4KOW A;  3DR8 A;  1Z4E A;  4KOV A;  4KUA A;  2PQ8 A;  1M4G A;  3FXT A;  2JEV A;  2Z11 A;  3R9G A;  1XMT A;  2VBQ A;  4KVX A;  4Y49 C;  4KOY A;  4IF5 A;  3QB8 A;  2WPW A;  4YRH A;  3WR7 A;  2ZW5 A;  2P0W A;  3F5B A;  1VKC A;  1UFH A;  3E0K A;  2KCW A;  4K30 A;  4B5P B;  3EXN A;  2FSR A;  2H5M A;  4R9M A;  2ZW7 A;  4UA3 A;  4AB7 A;  4KVM E;  2C27 A;  4QVT A;  4KZT A;  3TCV A;  2ZW4 A;  3BJ8 A;  1S7N A;  4BMH A;  3I3G A;  1XF8 A;  1VHS A;  1IYK A;  3W6X A;  5CNP A;  1FY7 A;  5JPH A;  3D8P A;  4KUB A;  1YVO A;  4OAD A;  3JUW A;  3TT2 A;  4HNY B;  2D4P A;  3TE4 A;  4XPK A;  2ATR A;  1Z4R A;  1S7K A;  2Z10 A;  2J8M A;  4AG7 A;  4LUA A;  2FXF A;  3C26 A;  1MJB A;  4JLY A;  3LD2 A;  3S6G A;  1P4N A;  2P6F A;  4M85 A;  3BLN A;  4L8A A;  4UWI A;  4CRY B;  2WPX A;  4GS4 A;  4NCZ A;  4F6A A;  1MK4 A;  4CAV A;  4JXR A;  3RYO A;  4KLV A;  1WK4 A;  4I49 A;  1Y7R A;  4XNH C;  1MJ9 A;  3N7Z A;  5KTC A;  4B5P A;  4NSQ A;  3QAH A;  5C82 A;  4R3K A;  4MHD A;  4CAX A;  1BOB A;  2DXQ A;  2PC1 A;  4E0A A;  1S60 A;  1XEB A;  4NEX A;  5E96 A;  2VXK A;  3D3S A;  2BUE A;  2B4B A;  5EC4 A;  2JLM A;  1MJA A;  2FIA A;  3FYN A;  4XPD B;  3GY9 A;  4JD6 A;  2BSW A;  4R87 A;  2P6G A;  2BEI A;  4H89 A;  3T90 A;  2O28 A;  4CRZ B;  1ON0 A;  3TO9 A;  5HH1 A;  3R9F A;  5IB0 A;  4KOT A;  4H6U A;  3G8W A;  5H86 A;  4YFJ A;  5EBV A;  3JVN A;  1CJW A;  4MBU A;  4MI4 A;  1XE4 A;  4FD5 A;  5C88 A;  3H4Q A;  4DNC A;  2Q7B A;  2QML A;  2Q4V A;  3IGR A;  2R98 A;  3DDD A;  1KUV A;  1TIQ A;  5DWN A;  1S7F A;  5IX3 A;  1YLE A;  2AJ6 A;  1YVK A;  2FL4 A;  2EVN A;  2CNM A;  2ZPA A;  3FIX A;  3G3S A;  3CXS A;  2OH1 A;  1KUX A;  5FVJ A;  4PK2 A;  3SXO A;  4FD6 A;  3LOD A;  1IID A;  3EO4 A;  4LX9 A;  4R57 A;  1V0C A;  1N71 A;  1SQH A;  2J8N A;  2GAN A;  4HNW B;  4UBR A;  5JQ4 A;  3TFY A;  1QSO A;  1OZP A;  1M4I A;  4U9Z A;  2OZH A;  2OZU A;  2FS5 A;  3FNC A;  2GIV A;  2Q44 A;  2Q0Y A;  3ZZI A;  1YRE A;  3R1K A;  4XPD C;  2FE7 A;  4B5O A;  1R57 A;  2NMT A;  2G3T A;  3K9U A;  4MY3 A;  1I12 A;  2JDC A;  2CNS A;  2CY2 A;  4XNH B;  4AG9 A;  4IUS A;  4MY0 A;  2ZW6 A;  4PSW A;  4JWP A;  3R9E A;  4RI1 A;  1RXT A;  3MGD A;  2OU2 A;  5HMN A;  2JDD A;  1IB1 E;  5F46 A;  3R96 A;  2REF A;  3GYA A;  2Q04 A;  3S6F A;  3TOB A;  3IWG A;  4RS2 A;  5F48 A;  3F8K A;  1J4J A;  2ARH A;  2J8R A;  5KTA A;  3W91 A;  4KLW A;  1YX0 A;  3I9S A;  4KOR A;  2ZXV A;  4E8O A;  3W6S A;  3DSB A;  2VEZ A;  2REE A;  3VWD A;  4AVB A;  1I21 A;  5GCN A;  1Y9W A;  1KZF A;  2VZZ A;  1IIC A;  2G3A A;  2OZG A;  5F49 A;  2B58 A;  3CXP A;  4AVC A;  2PSW A;  3PP9 A;  3TO7 A;  1U6M A;  4HKF A;  2FCK A;  4JJX A;  2P6E A;  4U5Y A;  1YGH A;  2BL1 A;  3PGP A;  1K4J A;  4U9Y A;  4X5K A;  2GE3 A;  1Q2Y A;  2B3U A;  3SHP A;  2PR1 A;  1KUY A;  4E2A A;  4II9 A;  1I1D A;  3EY5 A;  3FBU A; 
#chains in the Genus database with same CATH topology
 2A4N A;  3SXN A;  1ELM P;  1Z5R A;  2C6G A;  4CS0 B;  3PBB A;  5JM6 A;  5LRK A;  2JEW A;  3FRM A;  4ZX9 A;  1TXR A;  2Q4Y A;  3L2N A;  1B87 A;  2PJ8 A;  2AFU A;  5J8F A;  3KR5 A;  3CXQ A;  4XPL A;  6CPA A;  1WWZ A;  2G0B A;  1IOI A;  4PXC A;  4CAW A;  1QSR A;  1A2Z A;  1TF8 A;  1ZG9 A;  4F0Y A;  1OBR A;  3KKW A;  5J8C A;  4MFZ A;  4HNX B;  2C1C A;  4KSA A;  4F9U A;  3IO1 A;  3PB9 X;  3FEE A;  3HLP A;  4UCN A;  2Y0M A;  2WUU A;  1YR0 A;  3FX6 A;  3PZJ A;  4NGN A;  4UF4 A;  4DUK A;  5I0C A;  2FIW A;  3EC4 A;  2Q4Z A;  3WC5 A;  4CAE A;  4NGR A;  5AG6 A;  1LRZ A;  2I79 A;  2I00 A;  3FBU A;  2EUI A;  5K8P A;  1CM0 A;  1P0H A;  2VQY A;  3P2H A;  1CX8 A;  1S5K A;  2GU2 A;  3H5Z A;  3K2K A;  3NH5 A;  4QUS A;  2PJA A;  2YGW A;  3ZJ0 A;  1IU8 A;  2HQY A;  4NGS A;  3D2M A;  4M3S A;  2PRQ A;  4FD4 A;  1X12 A;  3JTK A;  2ZEG A;  5HVF A;  4MCS A;  2HUZ A;  2V8H A;  3D7D A;  5IB9 A;  4KOU A;  3UY5 A;  4NXY A;  2QEC A;  4A94 A;  4AXV A;  3PB7 X;  2PJ1 A;  2PDO A;  4MHP A;  4QB9 A;  4P4E A;  5F47 A;  2VI7 A;  2HV2 A;  3P2F A;  2VZY A;  3B7I A;  4YGO A;  3CDX A;  3DR6 A;  4BBH A;  3VH9 A;  2OOT A;  1Z8T A;  1NE9 A;  1ARL A;  5LRG A;  4ONU A;  4UWJ A;  4EVY A;  2Q43 A;  4X8I A;  1VGY A;  3S6K A;  4OC3 A;  4PV6 A;  5KTD A;  2R8V A;  2B5G A;  1CPS A;  2RC4 A;  3DGV A;  1YK3 A;  4O23 A;  3GLJ A;  4DYO A;  4H6Z A;  4ORF A;  1PU9 A;  4PXE A;  4OLL A;  3GKR A;  4OAE A;  4UEE A;  4OID A;  1B6B A;  3SJE A;  2I3C A;  4P4F A;  4MXU A;  2XEF A;  3TTH A;  4A38 A;  4LQG A;  1M4L A;  2QIR A;  5DWM A;  3S6H A;  1S3Z A;  2BO9 A;  2DEA A;  3FF3 A;  3D2P A;  4UCP A;  1YLO A;  2EBJ A;  4ONW A;  1PCA A;  3FB3 A;  4KVO E;  3PEI A;  5LRJ A;  1L0C A;  1VHE A;  1Y9K A;  2YNC A;  2NSM A;  2JBJ A;  1M44 A;  2PCU A;  2B4D A;  4MJ8 A;  4J3G A;  1IYL A;  1M1D A;  1YME A;  4P45 A;  3DNS A;  1S7L A;  4B13 A;  2EK9 A;  3NE7 A;  2HB6 A;  3BXM A;  3KHX A;  5JGF A;  5ISV A;  4IAV A;  2PR8 A;  1Q2D A;  4F8Z A;  2PIZ A;  2Z3K A;  4MRI A;  1LFW A;  3IJ3 A;  2PRB A;  4NGM A;  3CZX A;  2FT0 A;  2AFW A;  1BO4 A;  1Z8L A;  3D7F A;  2CNT A;  3IWE A;  4JYW A;  3MN8 A;  4M6G A;  3TO6 A;  2PE3 A;  4OIW A;  3HUV A;  2R7H A;  1QSM A;  4L89 A;  4OKO A;  4AVA A;  2F5I A;  3D68 A;  5LYF A;  3PFO A;  4CYP A;  1RO5 A;  5I4M A;  1KWM A;  3GUX A;  5G21 A;  2X7B A;  2O4H A;  4M6H A;  4NF1 A;  1PUA A;  4QC6 A;  1NSL A;  3T8W A;  2WZN A;  2GLF A;  2B4D B;  3KGQ A;  4P4B A;  4R3L A;  4CYN A;  4Q7A A;  3KQZ A;  4B12 A;  1F2O A;  1XMB A;  4KS9 A;  4MFP A;  3OWC A;  1Z9U A;  2AE6 A;  2D4O A;  4FD7 A;  1ELL P;  2IJZ A;  1CP6 A;  4H2K A;  3T9Y A;  1Q2C A;  4QBJ A;  3BHX A;  1QST A;  1Y0R A;  3BJ7 A;  1M4D A;  1LAP A;  3IWW A;  4BD9 A;  2AFO A;  4ZBG A;  1BAV A;  4Q36 A;  2F7V A;  3KI9 A;  2ZEF A;  1XIX A;  4M6I A;  4NGT A;  5H84 A;  5THW A;  4KOS A;  2K5T A;  4PXD A;  4PSX A;  3R95 A;  2OB0 A;  3V8I A;  2B5G B;  1ZG8 A;  3B8G A;  4KOX A;  3TOA A;  1NMT A;  1GHE A;  1PYT B;  4X2T A;  1BPN A;  3IU2 A;  1Z8W A;  2AFX A;  4JXQ A;  4MFK A;  4CYQ A;  2Z3P A;  2IL4 A;  4NJR A;  2JBK A;  2CTC A;  3MRU A;  3F0A A;  2QJ8 A;  4Y49 B;  2PJ2 A;  3B3C A;  4PPZ A;  2G9D A;  1HEE A;  1QSN A;  2WSA A;  3SJF A;  4PK3 A;  5K8O A;  3EFA A;  2B3V A;  5A28 A;  5F09 A;  2R1I A;  1ZLH A;  2PJC A;  2Z0Z A;  3B3S A;  4JZ0 A;  3VWE A;  5IV0 A;  1ZG7 A;  4KOW A;  3A9L A;  3H8G A;  4R6T A;  3DR8 A;  1CG2 A;  4A95 A;  4G1P A;  4IHM A;  1Z4E A;  4UFW A;  4KOV A;  4KUA A;  2PQ8 A;  1M4G A;  3CT9 A;  1XBU A;  4OC5 A;  3D66 A;  4PXB A;  4YU9 A;  4ZI6 A;  3RNZ A;  1XFO A;  4BIN A;  4B14 A;  3RBU A;  3FXT A;  4CGL A;  4MFQ A;  4FAI A;  5AG7 A;  2JEV A;  3S9M A;  2Z11 A;  3DLJ A;  2QYV A;  3R9G A;  1XMT A;  3V7Z A;  4MFJ A;  5D29 A;  4ZY2 A;  2VBQ A;  4KVX A;  3S9L A;  4Y49 C;  4CGN A;  4KOY A;  2AFM A;  4IF5 A;  4ZY0 A;  3QB8 A;  2WPW A;  4YRH A;  3WR7 A;  2ZEP A;  2ZW5 A;  2GRE A;  2P0W A;  3F5B A;  1VKC A;  3RZA A;  1UFH A;  4UEZ A;  3E0K A;  2KCW A;  4K30 A;  4B5P B;  1Q7L A;  3EXN A;  3QAY A;  4A37 A;  3D4U A;  2FSR A;  2H5M A;  4R9M A;  2ZW7 A;  4UA3 A;  1NSA A;  4AB7 A;  3LAC A;  4UIA A;  2EWB A;  1Z8X A;  8CPA A;  4KVM E;  4EWT A;  2C27 A;  4QVT A;  4R7M A;  4KZT A;  3SI1 A;  2AFS A;  2QVP A;  3TCV A;  2ZW4 A;  3BJ8 A;  1S7N A;  3CPX A;  4BMH A;  3I3G A;  5LYI A;  4P44 A;  1XF8 A;  1VHS A;  2PJ3 A;  1IYK A;  3W6X A;  5CNP A;  1FY7 A;  4TWE A;  3H8F A;  1QMU A;  5JPH A;  3D8P A;  4KUB A;  5G20 A;  1X10 A;  1YVO A;  4OAD A;  3JUW A;  5LYL A;  1IY7 A;  3TT2 A;  4F9V A;  4HNY B;  2D4P A;  3FEC A;  1JQG A;  3TE4 A;  4XPK A;  2ATR A;  1Z4R A;  1S7K A;  2Z10 A;  2PJB A;  4GM5 A;  2J8M A;  3KL9 A;  4AG7 A;  4ZYQ A;  2EK8 A;  2FXF A;  1TKF A;  3C26 A;  3D7H A;  1MJB A;  4JLY A;  4LUA A;  3LD2 A;  3GIU A;  3S6G A;  1P4N A;  2P6F A;  2ZEL A;  4W9Y A;  4NGQ A;  3RO0 A;  4CGO A;  4M85 A;  2ZED A;  3BLN A;  4UFV A;  4L8A A;  4UWI A;  4CRY B;  5AG5 A;  2ZOG A;  2NYQ A;  3TC8 A;  2ABZ A;  1LCP A;  2V8V A;  2WPX A;  2Z3M A;  4GS4 A;  4B6Z A;  4CYO A;  4NCZ A;  4F6A A;  2YND A;  1MK4 A;  4CAV A;  4JXR A;  3RYO A;  1GYT A;  2XEI A;  4KLV A;  4OC1 A;  4P10 A;  1WK4 A;  5K8M A;  4I49 A;  1Y7R A;  4OC2 A;  3GB0 A;  4XNH C;  1MJ9 A;  3FJU A;  3NFZ A;  3N7Z A;  5KTC A;  4B5P A;  4NSQ A;  4MHY A;  1XOV A;  2POK A;  4P6Y A;  3BI1 A;  3QAH A;  4OC4 A;  3WT4 A;  4B10 A;  4DJL A;  5C82 A;  4R3K A;  4MHD A;  4CAX A;  1BOB A;  3FMC A;  2DXQ A;  2PC1 A;  4E0A A;  1AMP A;  3B3V A;  2O53 A;  1S60 A;  5CPA A;  1XEB A;  4CGP A;  4NEX A;  1CPX A;  4P4J A;  5E96 A;  2VXK A;  4OME A;  4MHZ A;  2V8G A;  2BUE A;  3D3S A;  2B4B A;  4MMO A;  5EC4 A;  3ISZ A;  2JLM A;  3WAB A;  4RUH A;  1MJA A;  2FIA A;  4RN7 A;  5G22 A;  3B3W A;  1YW6 A;  3FYN A;  4XPD B;  5K8N A;  2CF4 A;  3PRT A;  1CP7 A;  2FVG A;  3GY9 A;  4JD6 A;  2BSW A;  2VL1 A;  3KAS A;  3KZW A;  4R87 A;  5HXD A;  2P6G A;  2BEI A;  2Q51 A;  3KQX A;  4H89 A;  4P4D A;  3JRU A;  3T90 A;  4A31 A;  2O28 A;  3LWU A;  4CRZ B;  1ON0 A;  2PJ9 A;  2PJ5 A;  2OR4 A;  1Y0Y A;  3IFE A;  3TO9 A;  5LYD A;  5HH1 A;  3D7G A;  1FT7 A;  1IGB A;  3R9F A;  4CAF A;  3TX8 A;  5IB0 A;  4LQ6 A;  3KHZ A;  1Y7E A;  4KOT A;  4B11 A;  4H6U A;  4K3N A;  2AFZ A;  3G8W A;  5HVH A;  2ANP A;  4UFX A;  5H86 A;  4YFJ A;  5EBV A;  4C7I A;  2CXA A;  2F8H A;  3JVN A;  1CJW A;  4A32 A;  4F0X A;  3QNV A;  4MBU A;  2HC9 A;  1XE4 A;  2PIY A;  4FD5 A;  2ODF A;  4MFL A;  4MI4 A;  5C88 A;  3H4Q A;  4DNC A;  4IK2 A;  2Q7B A;  2C6P A;  1ZO0 A;  4PQA A;  3V38 A;  2Q7S A;  2QML A;  2Q4V A;  2Z3L A;  4C7H A;  3B3T A;  3IGR A;  2R98 A;  3DDD A;  4ZY1 A;  1VIX A;  4WWV A;  1KUV A;  1TIQ A;  1LAN A;  2RFH A;  5DWN A;  1S7F A;  3VAR A;  2PJ6 A;  5IX3 A;  1YLE A;  2AJ6 A;  4TNU A;  1BLL E;  3S9N A;  1YVK A;  1TKJ A;  2XEG A;  2FL4 A;  2YNC C;  2EVN A;  2CNM A;  2ZPA A;  3FIX A;  4UEF A;  2RB7 A;  5DS0 A;  2V77 A;  1UWY A;  3G3S A;  3CXS A;  1AYE A;  1RTQ A;  2OH1 A;  1XJO A;  2PJ7 A;  1KUX A;  1IOF A;  3NH8 A;  5FVJ A;  4PK2 A;  3SXO A;  3D67 A;  4FD6 A;  3LOD A;  1IID A;  3EO4 A;  4LX9 A;  4NFR A;  2DPT A;  4OP4 A;  4R57 A;  2CTB A;  4MCP A;  5JH9 A;  3WC7 A;  1V0C A;  2ZEN A;  2PJ0 A;  1N71 A;  1SQH A;  2J8N A;  2GAN A;  4HNW B;  4UBR A;  2ZEO A;  1R3N A;  5AGE A;  5JQ4 A;  3TFY A;  2CIJ A;  2XEJ A;  3I1U A;  1HDU A;  1QSO A;  4FUU A;  5G1Z A;  1OZP A;  4EFD A;  1M4I A;  5ELY A;  1F57 A;  4U9Z A;  3PFE A;  2OZH A;  4NGP A;  3NH4 A;  2OZU A;  2FS5 A;  2WYR A;  4ZGY B;  2BOA A;  1QQ9 A;  2GIV A;  3FNC A;  3N5F A;  2Q44 A;  2Q0Y A;  3ZZI A;  3PB4 X;  3R1K A;  4MCQ A;  4EME A;  4XPD C;  4GXH A;  2FE7 A;  2YNE A;  4KSI A;  4B5O A;  1R57 A;  2NMT A;  2G3T A;  3IC1 A;  2DPS A;  2PVV A;  3K9U A;  1F2P A;  4MY3 A;  1I12 A;  2JDC A;  4MCR A;  2EO8 A;  2CNS A;  2CY2 A;  4XNH B;  4AG9 A;  2ZEM A;  4C68 A;  3BI0 A;  3FED A;  1FNO A;  4IUS A;  4WJB A;  3IEH A;  5HVG A;  4R8F A;  4MY0 A;  2ZW6 A;  4PSW A;  2IQ6 A;  4JWP A;  3R9E A;  1XRY A;  4RI1 A;  3B35 A;  1RXT A;  1ZLI A;  3FVL A;  1LAM A;  3MGD A;  2OU2 A;  1CBX A;  1YW4 A;  4A2Z A;  5HMN A;  2JDD A;  4KSF A;  1BPM A;  1IB1 E;  3FH4 A;  4UIB A;  2GLJ A;  2C6C A;  1Z2L A;  1EE3 P;  4A33 A;  5F46 A;  3R96 A;  2REF A;  3GYA A;  2Q04 A;  3S6F A;  2Z3N A;  4Q38 A;  2IMO A;  3TOB A;  1HDQ A;  2BCO A;  5EMI A;  4Z65 A;  4A39 A;  4CPA A;  3IWG A;  4RS2 A;  5F48 A;  3F8K A;  2DF5 A;  1J4J A;  1JWQ A;  3B2Y A;  2ARH A;  2J8R A;  5KTA A;  2PVW A;  3W91 A;  3PBE A;  3SJX A;  3CPA A;  4R76 A;  2GFQ A;  3H8E A;  1YX0 A;  3I9S A;  3PB8 X;  4KLW A;  4KOR A;  4P4I A;  3WC6 A;  3ISX A;  2ZXV A;  5J1Q A;  4E8O A;  3W6S A;  3DSB A;  2VEZ A;  2J9A A;  2REE A;  3IIB A;  5CBM A;  3RAM A;  4NJQ A;  3VWD A;  4OC0 A;  4AVB A;  1I21 A;  5GCN A;  1Y9W A;  1KZF A;  4MHN A;  2V8D A;  2VZZ A;  5D8N A;  1IIC A;  1AUG A;  1DE4 C;  2G3A A;  3K9T A;  2OZG A;  3PB6 X;  5F49 A;  4C2X A;  2B58 A;  3CXP A;  4AVC A;  5A27 A;  3SI0 A;  2PSW A;  2ZEH A;  3LMS A;  3PP9 A;  4HPS A;  3TO7 A;  1U6M A;  4HKF A;  2ZEE A;  2Z3O A;  2FCK A;  3NE8 A;  4C2Y A;  4X3R A;  7CPA A;  1H8L A;  4CGM A;  4JJX A;  2P6E A;  4FWU A;  4U5Y A;  4UCM A;  1TF9 A;  2ZOF A;  4ZX8 A;  1YGH A;  2BL1 A;  3VAT A;  1TKH A;  3IU1 A;  2PJ4 A;  1LOK A;  3NA6 A;  3PGP A;  4YWY A;  1ARM A;  1K4J A;  3SI2 A;  1YQE A;  1DTD A;  4U9Y A;  4FBE A;  4X5K A;  4A30 A;  2GE3 A;  1Q2Y A;  1VHO A;  2B3U A;  5AG4 A;  3SHP A;  2PR1 A;  5BWA B;  1YSJ A;  1KUY A;  3KR4 A;  4E2A A;  3SJG A;  4II9 A;  1R43 A;  4C2Z A;  1I1D A;  3EY5 A;  1YRE A; 
#chains in the Genus database with same CATH homology
 2A4N A;  3SXN A;  4CS0 B;  3FRM A;  2Q4Y A;  1B87 A;  5J8F A;  3CXQ A;  4XPL A;  1WWZ A;  2G0B A;  4CAW A;  1QSR A;  4F0Y A;  3KKW A;  5J8C A;  4MFZ A;  4HNX B;  4KSA A;  4UCN A;  2Y0M A;  2WUU A;  1YR0 A;  3PZJ A;  5I0C A;  2FIW A;  3EC4 A;  4CAE A;  5AG6 A;  1LRZ A;  2I79 A;  2I00 A;  2EUI A;  1CM0 A;  1P0H A;  2VQY A;  3P2H A;  1S5K A;  3H5Z A;  4QUS A;  2YGW A;  3ZJ0 A;  2HQY A;  3D2M A;  4M3S A;  4FD4 A;  3JTK A;  2HUZ A;  4KOU A;  3UY5 A;  4NXY A;  2QEC A;  2PDO A;  4QB9 A;  5F47 A;  2VI7 A;  2HV2 A;  3P2F A;  2VZY A;  4YGO A;  3DR6 A;  4BBH A;  1NE9 A;  4EVY A;  4ONU A;  4UWJ A;  3S6K A;  4PV6 A;  5KTD A;  2R8V A;  2B5G A;  2RC4 A;  1YK3 A;  4H6Z A;  4ORF A;  1PU9 A;  4OLL A;  3GKR A;  4OAE A;  1B6B A;  3TTH A;  2QIR A;  5DWM A;  3S6H A;  1S3Z A;  3D2P A;  4UCP A;  3FB3 A;  4KVO E;  1L0C A;  1Y9K A;  2YNC A;  1M44 A;  2B4D A;  4MJ8 A;  4J3G A;  1IYL A;  1M1D A;  3DNS A;  1S7L A;  4B13 A;  3NE7 A;  5ISV A;  2PR8 A;  1Q2D A;  2Z3K A;  2PRB A;  2FT0 A;  1BO4 A;  2CNT A;  3IWE A;  3TO6 A;  2R7H A;  1QSM A;  4L89 A;  4AVA A;  2F5I A;  4CYP A;  1RO5 A;  5G21 A;  2X7B A;  4NF1 A;  1PUA A;  4QC6 A;  1NSL A;  4R3L A;  2B4D B;  4CYN A;  4B12 A;  4KS9 A;  4MFP A;  3OWC A;  1Z9U A;  2AE6 A;  2D4O A;  4FD7 A;  4QBJ A;  3T9Y A;  1Q2C A;  1QST A;  3BJ7 A;  1M4D A;  4ZBG A;  4Q36 A;  1XIX A;  5H84 A;  4KOS A;  2K5T A;  4PSX A;  3R95 A;  2OB0 A;  3V8I A;  2B5G B;  3B8G A;  4KOX A;  3TOA A;  1NMT A;  1GHE A;  4MFK A;  3IU2 A;  4JXQ A;  4CYQ A;  2Z3P A;  2IL4 A;  3F0A A;  4Y49 B;  1QSN A;  2WSA A;  4PK3 A;  3EFA A;  2B3V A;  5A28 A;  2R1I A;  2Z0Z A;  3VWE A;  5IV0 A;  4KOW A;  3A9L A;  3DR8 A;  4A95 A;  1Z4E A;  4UFW A;  4KOV A;  4KUA A;  2PQ8 A;  1M4G A;  4B14 A;  3FXT A;  4CGL A;  4MFQ A;  5AG7 A;  2JEV A;  2Z11 A;  3R9G A;  1XMT A;  4MFJ A;  2VBQ A;  4KVX A;  4Y49 C;  4CGN A;  4KOY A;  4IF5 A;  3QB8 A;  2WPW A;  4YRH A;  3WR7 A;  2ZW5 A;  2P0W A;  3F5B A;  1VKC A;  1UFH A;  3E0K A;  2KCW A;  4K30 A;  4B5P B;  3EXN A;  2FSR A;  2H5M A;  4R9M A;  2ZW7 A;  4UA3 A;  4AB7 A;  4KVM E;  2C27 A;  4QVT A;  4KZT A;  3TCV A;  2ZW4 A;  3BJ8 A;  1S7N A;  4BMH A;  3I3G A;  1XF8 A;  1VHS A;  1IYK A;  3W6X A;  5CNP A;  1FY7 A;  5JPH A;  3D8P A;  4KUB A;  5G20 A;  1YVO A;  4OAD A;  3JUW A;  3TT2 A;  4HNY B;  2D4P A;  3TE4 A;  4XPK A;  2ATR A;  1Z4R A;  1S7K A;  2Z10 A;  2J8M A;  4AG7 A;  4LUA A;  2FXF A;  3C26 A;  1MJB A;  4JLY A;  3LD2 A;  3S6G A;  1P4N A;  2P6F A;  4CGO A;  4M85 A;  3BLN A;  4UFV A;  4L8A A;  4UWI A;  4CRY B;  5AG5 A;  2Z3M A;  2WPX A;  4GS4 A;  4CYO A;  4NCZ A;  4F6A A;  2YND A;  1MK4 A;  4CAV A;  4JXR A;  3RYO A;  4KLV A;  1WK4 A;  4I49 A;  1Y7R A;  4XNH C;  1MJ9 A;  3N7Z A;  5KTC A;  4B5P A;  4NSQ A;  3QAH A;  4B10 A;  5C82 A;  4R3K A;  4MHD A;  4CAX A;  1BOB A;  2DXQ A;  2PC1 A;  4E0A A;  1S60 A;  1XEB A;  4CGP A;  4NEX A;  5E96 A;  2VXK A;  3D3S A;  2BUE A;  2B4B A;  5EC4 A;  2JLM A;  1MJA A;  2FIA A;  5G22 A;  3FYN A;  4XPD B;  3GY9 A;  4JD6 A;  2BSW A;  4R87 A;  2P6G A;  2BEI A;  4H89 A;  3T90 A;  4A31 A;  2O28 A;  4CRZ B;  1ON0 A;  3TO9 A;  5HH1 A;  3R9F A;  4CAF A;  5IB0 A;  4KOT A;  4B11 A;  4H6U A;  3G8W A;  4UFX A;  5H86 A;  4YFJ A;  5EBV A;  4C7I A;  2CXA A;  3JVN A;  1CJW A;  4A32 A;  4F0X A;  4MBU A;  4MI4 A;  1XE4 A;  4FD5 A;  4MFL A;  5C88 A;  3H4Q A;  4DNC A;  2Q7B A;  1ZO0 A;  2QML A;  2Q4V A;  2Z3L A;  4C7H A;  3IGR A;  2R98 A;  3DDD A;  1KUV A;  1TIQ A;  5DWN A;  1S7F A;  5IX3 A;  1YLE A;  2AJ6 A;  1YVK A;  2FL4 A;  2YNC C;  2EVN A;  2CNM A;  2ZPA A;  3FIX A;  3G3S A;  3CXS A;  2OH1 A;  1KUX A;  5FVJ A;  4PK2 A;  3SXO A;  4FD6 A;  3LOD A;  1IID A;  3EO4 A;  4LX9 A;  2DPT A;  4R57 A;  1V0C A;  1N71 A;  1SQH A;  2J8N A;  2GAN A;  4HNW B;  4UBR A;  5AGE A;  5JQ4 A;  3TFY A;  5G1Z A;  1QSO A;  1OZP A;  1M4I A;  4U9Z A;  2OZH A;  2OZU A;  2FS5 A;  4ZGY B;  3FNC A;  2GIV A;  2Q44 A;  2Q0Y A;  3ZZI A;  1YRE A;  3R1K A;  4XPD C;  2FE7 A;  2YNE A;  4B5O A;  1R57 A;  2NMT A;  2G3T A;  2DPS A;  3K9U A;  4MY3 A;  1I12 A;  2JDC A;  2CNS A;  2CY2 A;  4XNH B;  4AG9 A;  4C68 A;  4IUS A;  4MY0 A;  2ZW6 A;  4PSW A;  4JWP A;  3R9E A;  4RI1 A;  1RXT A;  3MGD A;  2OU2 A;  4A2Z A;  5HMN A;  2JDD A;  4KSF A;  1IB1 E;  4A33 A;  5F46 A;  3R96 A;  2REF A;  3GYA A;  2Q04 A;  3S6F A;  2Z3N A;  4Q38 A;  3TOB A;  3IWG A;  4RS2 A;  5F48 A;  3F8K A;  1J4J A;  2ARH A;  2J8R A;  5KTA A;  3W91 A;  4KLW A;  1YX0 A;  3I9S A;  4KOR A;  2ZXV A;  4E8O A;  3W6S A;  3DSB A;  2VEZ A;  2REE A;  3VWD A;  4AVB A;  1I21 A;  5GCN A;  1Y9W A;  1KZF A;  2VZZ A;  1IIC A;  2G3A A;  2OZG A;  5F49 A;  4C2X A;  2B58 A;  3CXP A;  4AVC A;  5A27 A;  2PSW A;  3PP9 A;  3TO7 A;  1U6M A;  4HKF A;  2Z3O A;  2FCK A;  4C2Y A;  4CGM A;  4JJX A;  2P6E A;  4UCM A;  4U5Y A;  1YGH A;  2BL1 A;  3IU1 A;  3PGP A;  1K4J A;  4U9Y A;  4X5K A;  4A30 A;  2GE3 A;  1Q2Y A;  2B3U A;  5AG4 A;  3SHP A;  2PR1 A;  5BWA B;  1KUY A;  4E2A A;  4II9 A;  4C2Z A;  1I1D A;  3EY5 A;  3FBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...