2BSWA

Crystal structure of a glyphosate-n-acetyltransferase obtained by dna shuffling.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title DNA Shuffling as a Tool for Protein Crystallization.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transferase
total genus 36
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2bswA00
3F8KA 1N71A 2I00A 1MK4A 2JEVA 4EVYA 4KOWA 5JPHA 1I12A 2ARHA 3DNSA 4KOSA 4JJXA 1I21A 4FD7A 4GS4A 5HMNA 3B8GA 3D2MA 4FD5A 4MY3A 1QSTA 2B4DA 2QECA 4CAVA 1S7KA 3TE4A 4KVOE 4FD6A 2P0WA 2Z0ZA 3R1KA 2ATRA 2I79A 3SHPA 1NMTA 3TOBA 3QB8A 3F5BA 3CXQA 3G3SA 1B87A 2R1IA 5EBVA 3SXNA 2QIRA 1B6BA 3P2HA 1M1DA 4NCZA 3TT2A 3FBUA 3TFYA 1CM0A 4KLVA 2Q04A 5KTAA 1TIQA 2ZXVA 2PQ8A 1YVKA 3FNCA 3GYAA 4NF1A 3EXNA 1YK3A 5H86A 4IUSA 4KVXA 2OH1A 4XPDB 4I49A 1MJ9A 2FE7A 1Q2CA 5H84A 3T90A 4U9YA 2WPWA 4U9ZA 3R95A 3GY9A 2GIVA 4OAEA 1PU9A 1IB1E 3BJ7A 1IYKA 2P6FA 3W91A 2R98A 4L89A 5JQ4A 3TTHA 2R8VA 1QSMA 3I9SA 3SXOA 1S60A 5IB0A 1QSOA 2PSWA 5KTCA 3PZJA 2Q4VA 3FYNA 2JDDA 3IGRA 4MI4A 5FVJA 4JLYA 2FSRA 4AG9A 1IIDA 2C27A 2VZZA 1J4JA 4CRZB 3FB3A 2BEIA 2J8RA 1WK4A 3S6HA 2ZPAA 4X5KA 2Y0MA 3F0AA 5J8CA 1XE4A 3I3GA 3IWGA 4KUAA 4ONUA 4H6ZA 2D4OA 4OADA 2J8MA 2CNTA 5GCNA 4E0AA 3R9FA 5DWMA 2PR1A 1Z9UA 1Q2DA 2HUZA 2VQYA 5C82A 2WPXA 1YX0A 3GKRA 1YLEA 3PGPA 1I1DA 3FRMA 1UFHA 3P2FA 1YVOA 1Z4RA 3D8PA 2OZHA 3K9UA 3C26A 3VWDA 2F5IA 4YFJA 4KOYA 3KKWA 4YGOA 1Z4EA 4HNWB 1U6MA 3FXTA 2GE3A 4MY0A 1K4JA 2B3VA 4KOXA 3VWEA 2HQYA 3ZZIA 2OZUA 4KZTA 3WR7A 4XPKA 3S6GA 1IYLA 2ZW5A 3V8IA 1XMTA 2ZW6A 1MJBA 4QVTA 3BLNA 4UBRA 4OLLA 1XF8A 4K30A 4Y49B 2Q7BA 1KZFA 4UA3A 4AB7A 2FIWA 4B5PB 2VZYA 4CS0B 2B58A 1KUVA 4F6AA 4IF5A 2BSWA 4BMHA 4PK3A 2BL1A 3W6XA 3W6SA 4F0YA 4QBJA 3EC4A 5F48A 4ZBGA 2JLMA 3MGDA 3BJ8A 1VHSA 5DWNA 1NE9A 4HKFA 4M3SA 4XPDC 2BUEA 1YGHA 2CNSA 2HV2A 1XEBA 4B5OA 4UWJA 3UY5A 3R9EA 3D2PA 1RXTA 1VKCA 2A4NA 1QSNA 4KVME 3OWCA 1ON0A 2REEA 1MJAA 4KLWA 3TO6A 2ZW7A 1WWZA 1QSRA 2Q4YA 4J3GA 2O28A 5F49A 4JWPA 4KOVA 1Y7RA 1P0HA 2P6GA 4JD6A 3S6FA 4XNHB 4CRYB 3CXPA 2B5GB 4YRHA 3R96A 3LD2A 2OU2A 1R57A 4KOTA 4R3LA 4MBUA 4FD4A 1KUXA 4AG7A 2FL4A 1OZPA 4R9MA 1Y9WA 2G3TA 2J8NA 2OZGA 2ZW4A 3JUWA 2D4PA 2Z10A 3G8WA 2PC1A 5J8FA 5F47A 4B5PA 4MHDA 3TOAA 3CXSA 3E0KA 4AVBA 3QAHA 1M4IA 1FY7A 2EUIA 5I0CA 2CY2A 2VI7A 3EFAA 4XPLA 4PK2A 5CNPA 3PP9A 2PR8A 3DR8A 4PV6A 4AVAA 4QUSA 4L8AA 3DSBA 2VEZA 2VXKA 2KCWA 2AE6A 4PSXA 4RI1A 4QB9A 1M4DA 1YR0A 2G3AA 2NMTA 4PSWA 4HNXB 2Q44A 4RS2A 3LODA 4NXYA 3TO9A 4QC6A 1S7FA 2FXFA 4HNYB 1RO5A 2FS5A 4KORA 3ZJ0A 2B3UA 4CAWA 4R57A 5KTDA 1XIXA 3T9YA 1L0CA 4UWIA 1S7LA 1KUYA 2B4BA 4LUAA 3FIXA 1M4GA 4Y49C 2B5GA 4E2AA 5IX3A 5ISVA 4II9A 1GHEA 1V0CA 1NSLA 1S3ZA 2AJ6A 1PUAA 5C88A 3RYOA 4E8OA 1P4NA 1M44A 4H6UA 2FIAA 2Z11A 2RC4A 1SQHA 4ORFA 4R87A 4U5YA 4LX9A 3H4QA 3R9GA 2H5MA 4JXRA 2K5TA 4MJ8A 2DXQA 3DDDA 1IICA 4NEXA 2B4DB 2PDOA 1S7NA 2R7HA 1BOBA 3N7ZA 4JXQA 3DR6A 4AVCA 1Q2YA 2FT0A 5HH1A 3D3SA 4H89A 2OB0A 4M85A 3EO4A 1S5KA 3NE7A 4R3KA 1BO4A 4CAXA 2X7BA 2G0BA 2P6EA 5E96A 2JDCA 2GANA 1YREA 2PRBA 4XNHC 5F46A 1LRZA 4KOUA 3S6KA 2EVNA 1CJWA 4NSQA 4KUBA 2CNMA 2IL4A 1Y9KA 2Q0YA 2VBQA 3TCVA 3EY5A 2QMLA 4DNCA 5EC4A 5IV0A 3JVNA 2REFA 3TO7A 2FCKA
chains in the Genus database with same CATH superfamily
2XEFA 1IOFA 1N71A 2I00A 3F8KA 2QYVA 1MK4A 2JEVA 4OC1A 4P4EA 4EVYA 4KOWA 1XOVA 5HVHA 2BCOA 4K3NA 5JPHA 1I12A 2ARHA 1AYEA 2AFWA 4P4DA 5HVFA 1RTQA 1Q7LA 3DNSA 4KOSA 3GUXA 1YW6A 2XEGA 4WWVA 4JJXA 2ABZA 2ZEGA 1I21A 2POKA 3FECA 4CYPA 1KWMA 4FD7A 4GS4A 5HMNA 3B8GA 3D2MA 1CP6A 4UFVA 4F9UA 2EO8A 2V77A 4FD5A 4MY3A 2YGWA 4M6IA 3B3SA 4NGTA 1QSTA 2B4DA 2QECA 1LFWA 4CAVA 4ZI6A 1S7KA 3TE4A 4MCQA 1TKHA 4KVOE 3D4UA 4KSIA 2PE3A 2PVVA 3PBEA 4FD6A 3SI0A 3FMCA 5AG5A 2P0WA 2Z0ZA 1ELLP 2ATRA 3R1KA 4LQGA 4B11A 4C2XA 2I79A 4H2KA 3SHPA 4UIAA 2CIJA 1NMTA 4PQAA 3TOBA 2ZEDA 1TF9A 3FEEA 4M6GA 3B3WA 3QB8A 4A95A 3B3CA 3A9LA 2CXAA 3F5BA 3CXQA 3PB4X 3G3SA 4UEFA 1B87A 2R1IA 5EBVA 3FH4A 3NE8A 1AMPA 4LQ6A 3SXNA 2QIRA 1B6BA 3P2HA 3S9MA 1M1DA 4NCZA 3TT2A 4RN7A 3FBUA 7CPAA 2ZELA 3TFYA 1CM0A 4KLVA 2Q04A 2ZEOA 2QVPA 2ZEFA 5KTAA 1TIQA 2ZXVA 1JWQA 1EE3P 2BO9A 2F7VA 2PQ8A 3PFOA 3TX8A 1IY7A 1YVKA 3FNCA 3GYAA 3ISZA 3PB7X 4DUKA 3IWWA 4NF1A 2F8HA 4NGPA 1ARLA 4UCMA 3EXNA 1YK3A 5H86A 4IUSA 4PXCA 4KVXA 2G9DA 2OH1A 3NH8A 4XPDB 1CPXA 4I49A 4CGOA 1MJ9A 2EBJA 4P4IA 2EK9A 3VARA 2FE7A 1Q2CA 4IAVA 2PJ2A 5H84A 3T90A 4U9YA 1R43A 3NH4A 2WPWA 4U9ZA 3D7FA 4Q7AA 3MN8A 3R95A 1CX8A 1TKFA 3GY9A 2GIVA 2WYRA 1PU9A 1IB1E 3BJ7A 3NA6A 1UWYA 3NH5A 1FT7A 3PFEA 1IYKA 1QMUA 2JEWA 2P6FA 3QNVA 4MHPA 4X2TA 3W91A 3KR4A 2R98A 4A30A 4L89A 5JQ4A 1ARMA 5BWAB 3TTHA 2R8VA 1QSMA 3I9SA 3SXOA 1S60A 4Z65A 4CYQA 5IB0A 2RFHA 1CPSA 1QSOA 2PSWA 2Z3KA 2ODFA 4NFRA 5KTCA 3PZJA 4MFPA 2O53A 2Q4VA 1F57A 2NYQA 3FYNA 2NSMA 2JDDA 3GB0A 5HXDA 1ELMP 5HVGA 5LYIA 2ZEPA 2ANPA 3IGRA 2GLJA 3VH9A 4MI4A 1TF8A 5FVJA 4JLYA 4B6ZA 2FSRA 4AG9A 1IIDA 2C27A 4EWTA 4FBEA 3RBUA 2EK8A 2VZZA 1J4JA 4CRZB 5J1QA 4UF4A 3FB3A 1IOIA 3IJ3A 2BEIA 2J8RA 4KSAA 2J9AA 4UFWA 1LAPA 1WK4A 2PJ9A 4ZY0A 4A33A 1A2ZA 2YNCA 1Z8TA 2Q4ZA 4A31A 4IHMA 3S6HA 4AXVA 4PXEA 4YWYA 2ZPAA 4PXDA 4UCNA 4X5KA 2PCUA 2PJCA 2Y0MA 3F0AA 5J8CA 4BBHA 2C6CA 1XE4A 1PYTB 3I3GA 3IWGA 4KUAA 4ONUA 4H6ZA 4C68A 4CGPA 2D4OA 4B12A 2YNDA 4OADA 2J8MA 2CNTA 5GCNA 4E0AA 3R9FA 1ZG7A 5DWMA 2PR1A 4MRIA 2PIYA 1Z9UA 3T8WA 5IB9A 1Q2DA 1Y0RA 2HUZA 2VQYA 4OIDA 5C82A 2WPXA 1YX0A 3GKRA 5EMIA 1YLEA 3PGPA 2XEJA 3IIBA 1I1DA 3FRMA 1UFHA 4P6YA 3BXMA 3P2FA 4O23A 3DLJA 1YVOA 1Z4RA 3D8PA 2OZHA 5A27A 2GREA 2WUUA 3K9UA 3C26A 3PBBA 3WC6A 4C7IA 2AFOA 3VWDA 2O4HA 4UCPA 2F5IA 4YFJA 4NGRA 1HDUA 4OAEA 1TXRA 4KOYA 4OMEA 4A32A 1YMEA 2AFSA 3KKWA 4P4BA 4ZY1A 1BAVA 5LRJA 4YGOA 1ZG8A 3CDXA 1Z4EA 3I1UA 1IU8A 4HNWB 1U6MA 3FXTA 2GE3A 4MY0A 1XJOA 4UFXA 1K4JA 1XMBA 2B3VA 3JRUA 1X10A 3KHZA 4KOXA 1YSJA 3D7DA 1LCPA 1BLLE 2ZEHA 5G21A 3VWEA 4NGMA 4CPAA 2HQYA 3ZZIA 2OZUA 5JGFA 5G1ZA 4KZTA 3WR7A 4XPKA 3S6GA 1ZG9A 2JBKA 4X8IA 4OIWA 4RUHA 3IU2A 1IYLA 4GXHA 2ZW5A 3V8IA 1QQ9A 1XMTA 2WZNA 3B2YA 2ZW6A 1MJBA 2BOAA 2RB7A 5D8NA 4QVTA 2C6GA 1CP7A 4MCRA 3BLNA 2DEAA 2YNCC 5G22A 4UBRA 4OLLA 3WABA 1XF8A 1ZO0A 4K30A 4Y49B 2Q7BA 4OP4A 4TWEA 1KZFA 3B35A 4MMOA 2PJBA 5K8MA 4UA3A 4AB7A 2FIWA 4CAEA 4MFKA 3FEDA 2VZYA 4B5PB 1FNOA 2Q51A 4CS0B 2B58A 2Z3NA 1KUVA 4F6AA 4M6HA 3RZAA 4JYWA 3GIUA 3SJEA 3D66A 4IF5A 2BSWA 4BMHA 2V8HA 1Z8WA 4PK3A 2BL1A 3SJGA 5F09A 3W6XA 3W6SA 4F0YA 1YLOA 1CG2A 2Z3PA 4QBJA 3EC4A 5F48A 2DPTA 4ZBGA 4NJRA 2JLMA 4NGSA 4X3RA 4TNUA 5JH9A 2PJ5A 3PB9X 4PXBA 5DS0A 1IGBA 3MGDA 2ZEEA 1VHSA 3BJ8A 3LMSA 5DWNA 4C7HA 5LYLA 1NE9A 2OR4A 4HKFA 1CBXA 4M3SA 1HDQA 4MFJA 3PRTA 4W9YA 4XPDC 2BUEA 2V8VA 4MHNA 3KQXA 2PIZA 1YGHA 2CNSA 3V38A 2HV2A 2CTCA 2C1CA 1XEBA 2YNEA 5A28A 4B5OA 4UWJA 4A37A 3UY5A 3R9EA 1BPMA 3D2PA 5THWA 5JM6A 3FF3A 4EMEA 1RXTA 1VKCA 1H8LA 2A4NA 1QSNA 4KVME 3OWCA 3RAMA 5LYFA 1YQEA 1ON0A 4DYOA 2REEA 1MJAA 4KLWA 3TO6A 2ZW7A 1WWZA 3QAYA 1QSRA 2Q4YA 3RNZA 2PJ4A 3KGQA 2O28A 4J3GA 5F49A 4B10A 4JWPA 4KOVA 1Y7RA 2PJAA 1P0HA 2P6GA 5AG7A 2VL1A 2PRQA 3JTKA 4JD6A 4KSFA 1TKJA 3B7IA 4XNHB 3S6FA 4C2ZA 3CXPA 4CRYB 3H8EA 2B5GB 2Z3MA 3NFZA 4YRHA 3R96A 4OC4A 4G1PA 4MCSA 4UEZA 3TC8A 3LD2A 2HB6A 2OU2A 1R57A 4KOTA 3LWUA 4MBUA 4R3LA 4FD4A 1KUXA 3S9LA 4R6TA 4AG7A 2FL4A 1OZPA 3FVLA 4R9MA 4WJBA 3GLJA 1Y9WA 4MHZA 2G3TA 2J8NA 2OZGA 2ZW4A 3JUWA 2Z3LA 4JZ0A 5G20A 4ZX8A 2D4PA 4B13A 2Z10A 1XFOA 3PB6X 3G8WA 2PC1A 2ZOFA 3WC7A 5J8FA 4BINA 5F47A 2ZENA 4B5PA 2AFUA 5LYDA 4P10A 4MHDA 4CAFA 3TOAA 3CXSA 4ONWA 4A38A 5LRKA 3E0KA 3HUVA 4CGMA 4AVBA 4CYNA 3QAHA 1M4IA 1Y0YA 4CYOA 1FY7A 2EUIA 4R7MA 4F9VA 2FVGA 3SI1A 4MHYA 5I0CA 2CY2A 1LANA 2VI7A 5K8NA 3EFAA 4F0XA 1YW4A 5ELYA 4XPLA 5CBMA 1BPNA 2PJ6A 4YU9A 4PK2A 5CNPA 3RO0A 2PVWA 3PP9A 4FAIA 2PR8A 5AG4A 4HPSA 5LRGA 3CPXA 3DR8A 2IMOA 3PEIA 4PV6A 4AVAA 4QUSA 4L8AA 3KL9A 5AG6A 3DSBA 2PJ8A 2VEZA 2VXKA 4P4FA 3V7ZA 2KCWA 2AE6A 4PSXA 1DE4C 4RI1A 4QB9A 2Z3OA 5D29A 4A39A 1M4DA 1YR0A 2G3AA 4GM5A 2NMTA 4PSWA 5K8PA 4HNXB 3D7HA 2Q44A 4RS2A 4FWUA 3LODA 4MCPA 3SJXA 3B3TA 4OC3A 3WC5A 4NXYA 4A2ZA 1M4LA 3IFEA 1X12A 3TO9A 4QC6A 1PCAA 1S7FA 4BD9A 2FXFA 5CPAA 4HNYB 3BI0A 2FCKA 3IWEA 4NJQA 3KR5A 3KZWA 1Z2LA 1RO5A 1Z8LA 2FS5A 4KORA 3ZJ0A 2PJ1A 3HLPA 2B3UA 3FX6A 4CAWA 1ZLIA 3ISXA 4R57A 4FUUA 3SI2A 3H8FA 2PJ0A 1XIXA 2PJ7A 4P45A 3T9YA 4EFDA 5KTDA 3DGVA 1L0CA 3PB8X 4UWIA 3S9NA 3CZXA 1S7LA 1KUYA 1F2OA 2B4BA 4LUAA 1VIXA 3FIXA 1M4GA 4B14A 2ZOGA 3KQZA 4IK2A 4Q38A 4Y49C 4KS9A 2B5GA 4E2AA 5IX3A 5ISVA 4II9A 3KI9A 1GHEA 2V8GA 3SJFA 2GU2A 1ZLHA 1V0CA 3N5FA 1NSLA 2GFQA 1S3ZA 4DJLA 2AJ6A 4NGQA 2AFZA 4PPZA 1PUAA 2QJ8A 5C88A 3RYOA 4E8OA 4MFLA 3FJUA 3KASA 4R8FA 1P4NA 1M44A 4H6UA 3CPAA 1AUGA 3L2NA 2FIAA 2Z11A 1R3NA 2RC4A 1SQHA 2V8DA 4OKOA 4ORFA 4R87A 4U5YA 4A94A 4LX9A 3H4QA 3R9GA 2H5MA 4JXRA 3H8GA 2K5TA 1HEEA 4MJ8A 3IC1A 1OBRA 2DXQA 3DDDA 1IICA 4NEXA 2B4DB 4OC0A 8CPAA 2PDOA 4UIBA 4MXUA 2DF5A 4UEEA 1VGYA 1S7NA 1Y7EA 2R7HA 4P4JA 1BOBA 3BI1A 2HC9A 3N7ZA 4JXQA 3DR6A 4AVCA 2WSAA 1VHEA 1Q2YA 2FT0A 5HH1A 2OOTA 4OC2A 4Q36A 2DPSA 2GLFA 3B3VA 3D3SA 4ZYQA 4H89A 2OB0A 4MFQA 4M85A 3CT9A 3EO4A 1XBUA 1S5KA 1JQGA 1LOKA 2C6PA 2I3CA 3D7GA 3NE7A 1VHOA 2Q7SA 4R76A 4R3KA 1BO4A 4CAXA 1Z8XA 2Q43A 4ZX9A 2X7BA 2G0BA 2P6EA 5AGEA 5E96A 2JDCA 4MFZA 6CPAA 1DTDA 1NSAA 2AFXA 1XRYA 2PJ3A 1F2PA 3MRUA 2GANA 1YREA 2PRBA 3IEHA 3KHXA 4NGNA 1LRZA 4KOUA 4XNHC 3S6KA 4CGNA 2EVNA 4ZGYB 5F46A 1CJWA 2EWBA 3BHXA 3VATA 4F8ZA 4NSQA 4KUBA 2CNMA 2AFMA 2IL4A 3D68A 1Y9KA 2Q0YA 2VBQA 3TCVA 4P44A 2CTBA 2CF4A 3EY5A 3D67A 1Z5RA 3H5ZA 2QMLA 2ZEMA 4ZY2A 3IU1A 4OC5A 4DNCA 5EC4A 1LAMA 2JBJA 1GYTA 3WT4A 4C2YA 3K2KA 3LACA 5IV0A 3JVNA 2REFA 2XEIA 3IO1A 2IQ6A 3TO7A 5K8OA 5I4MA 4CGLA 3K9TA 2IJZA
chains in the Genus database with same CATH topology
3F8KA 1N71A 2I00A 1MK4A 2JEVA 4EVYA 4KOWA 5JPHA 1I12A 2ARHA 3DNSA 4KOSA 4JJXA 1I21A 4CYPA 4FD7A 4GS4A 5HMNA 3B8GA 3D2MA 4UFVA 4FD5A 4MY3A 2YGWA 1QSTA 2B4DA 2QECA 4CAVA 1S7KA 3TE4A 4KVOE 4FD6A 5AG5A 2P0WA 2Z0ZA 3R1KA 2ATRA 4B11A 4C2XA 2I79A 3SHPA 1NMTA 3TOBA 3QB8A 4A95A 3A9LA 2CXAA 3F5BA 3CXQA 3G3SA 1B87A 2R1IA 5EBVA 3SXNA 2QIRA 1B6BA 3P2HA 1M1DA 4NCZA 3TT2A 3FBUA 3TFYA 1CM0A 4KLVA 2Q04A 5KTAA 1TIQA 2ZXVA 2PQ8A 1YVKA 3FNCA 3GYAA 4NF1A 4UCMA 3EXNA 1YK3A 5H86A 4IUSA 4KVXA 2OH1A 4XPDB 4I49A 4CGOA 1MJ9A 2FE7A 1Q2CA 5H84A 3T90A 4U9YA 2WPWA 4U9ZA 3R95A 3GY9A 2GIVA 4OAEA 1PU9A 1IB1E 3BJ7A 1IYKA 2P6FA 3W91A 2R98A 4A30A 4L89A 5JQ4A 5BWAB 3TTHA 2R8VA 1QSMA 3I9SA 3SXOA 1S60A 5IB0A 4CYQA 2Z3KA 1QSOA 2PSWA 5KTCA 3PZJA 4MFPA 2Q4VA 3FYNA 2JDDA 3IGRA 4MI4A 5FVJA 4JLYA 2FSRA 4AG9A 1IIDA 2C27A 2VZZA 1J4JA 4CRZB 3FB3A 2BEIA 2J8RA 4KSAA 4UFWA 1WK4A 4A33A 2YNCA 4A31A 3S6HA 2ZPAA 4UCNA 4X5KA 2Y0MA 3F0AA 5J8CA 4BBHA 1XE4A 3I3GA 3IWGA 4KUAA 4ONUA 4C68A 4H6ZA 4CGPA 2D4OA 4B12A 2YNDA 4OADA 2J8MA 2CNTA 5GCNA 4E0AA 3R9FA 5DWMA 2PR1A 1Z9UA 1Q2DA 2HUZA 2VQYA 5C82A 2WPXA 1YX0A 3GKRA 1YLEA 3PGPA 1I1DA 3FRMA 1UFHA 3P2FA 1YVOA 1Z4RA 3D8PA 2OZHA 5A27A 2WUUA 3K9UA 3C26A 4C7IA 3VWDA 4UCPA 2F5IA 4YFJA 4KOYA 4A32A 3KKWA 4YGOA 1Z4EA 4HNWB 1U6MA 3FXTA 2GE3A 4MY0A 4UFXA 1K4JA 2B3VA 4KOXA 5G21A 3VWEA 2HQYA 3ZZIA 2OZUA 5G1ZA 4KZTA 3WR7A 4XPKA 3S6GA 3IU2A 1IYLA 2ZW5A 3V8IA 1XMTA 2ZW6A 1MJBA 4QVTA 3BLNA 2YNCC 5G22A 4UBRA 4OLLA 1XF8A 1ZO0A 4K30A 4Y49B 2Q7BA 1KZFA 4UA3A 4AB7A 2FIWA 4CAEA 4MFKA 4B5PB 2VZYA 4CS0B 2B58A 2Z3NA 1KUVA 4F6AA 4IF5A 2BSWA 4BMHA 4PK3A 2BL1A 3W6XA 3W6SA 4F0YA 2Z3PA 4QBJA 3EC4A 5F48A 2DPTA 4ZBGA 2JLMA 3MGDA 3BJ8A 1VHSA 5DWNA 4C7HA 1NE9A 4HKFA 4M3SA 4MFJA 4XPDC 2BUEA 1YGHA 2CNSA 2HV2A 1XEBA 2YNEA 5A28A 4B5OA 4UWJA 3UY5A 3R9EA 3D2PA 1RXTA 1VKCA 2A4NA 1QSNA 4KVME 3OWCA 1ON0A 2REEA 1MJAA 4KLWA 3TO6A 2ZW7A 1WWZA 1QSRA 2Q4YA 4J3GA 2O28A 5F49A 4B10A 4JWPA 4KOVA 1Y7RA 1P0HA 2P6GA 5AG7A 3JTKA 4JD6A 4KSFA 3S6FA 4XNHB 4C2ZA 4CRYB 3CXPA 2B5GB 2Z3MA 4YRHA 3R96A 3LD2A 2OU2A 1R57A 4KOTA 4R3LA 4MBUA 4FD4A 1KUXA 4AG7A 2FL4A 1OZPA 4R9MA 1Y9WA 2G3TA 2J8NA 2OZGA 2ZW4A 3JUWA 2Z3LA 5G20A 2D4PA 4B13A 2Z10A 3G8WA 2PC1A 5J8FA 5F47A 4B5PA 4CAFA 4MHDA 3TOAA 3CXSA 3E0KA 4CGMA 4AVBA 4CYNA 3QAHA 1M4IA 4CYOA 1FY7A 2EUIA 5I0CA 2CY2A 2VI7A 3EFAA 4F0XA 4XPLA 4PK2A 5CNPA 3PP9A 2PR8A 5AG4A 3DR8A 4PV6A 4AVAA 4QUSA 4L8AA 5AG6A 3DSBA 2VEZA 2VXKA 2KCWA 2AE6A 4PSXA 4RI1A 4QB9A 2Z3OA 1M4DA 1YR0A 2G3AA 2NMTA 4PSWA 4HNXB 2Q44A 4RS2A 3LODA 4NXYA 4A2ZA 3TO9A 4QC6A 1S7FA 2FXFA 4HNYB 3IWEA 1RO5A 2FS5A 4KORA 3ZJ0A 2B3UA 4CAWA 4R57A 5KTDA 1XIXA 3T9YA 1L0CA 4UWIA 1S7LA 1KUYA 2B4BA 4LUAA 3FIXA 1M4GA 4B14A 4Q38A 4Y49C 4KS9A 2B5GA 4E2AA 5IX3A 5ISVA 4II9A 1GHEA 1V0CA 1NSLA 1S3ZA 2AJ6A 1PUAA 5C88A 3RYOA 4E8OA 4MFLA 1P4NA 1M44A 4H6UA 2FIAA 2Z11A 2RC4A 1SQHA 4ORFA 4R87A 4U5YA 4LX9A 3H4QA 3R9GA 2H5MA 4JXRA 2K5TA 4MJ8A 2DXQA 3DDDA 1IICA 4NEXA 2B4DB 2PDOA 1S7NA 2R7HA 1BOBA 3N7ZA 4JXQA 3DR6A 4AVCA 2WSAA 1Q2YA 2FT0A 5HH1A 4Q36A 2DPSA 3D3SA 4H89A 2OB0A 4MFQA 4M85A 3EO4A 1S5KA 3NE7A 4R3KA 1BO4A 4CAXA 2X7BA 2G0BA 2P6EA 5AGEA 5E96A 2JDCA 4MFZA 2GANA 1YREA 2PRBA 4XNHC 5F46A 1LRZA 4KOUA 4CGNA 3S6KA 2EVNA 4ZGYB 1CJWA 4NSQA 4KUBA 2CNMA 2IL4A 1Y9KA 2Q0YA 2VBQA 3TCVA 3EY5A 3H5ZA 2QMLA 3IU1A 4DNCA 5EC4A 4C2YA 5IV0A 3JVNA 2REFA 3TO7A 4CGLA 2FCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8K A;  1N71 A;  2I00 A;  1MK4 A;  2JEV A;  4EVY A;  4KOW A;  5JPH A;  1I12 A;  2ARH A;  3DNS A;  4KOS A;  4JJX A;  1I21 A;  4FD7 A;  4GS4 A;  5HMN A;  3B8G A;  3D2M A;  4FD5 A;  4MY3 A;  1QST A;  2B4D A;  2QEC A;  4CAV A;  1S7K A;  3TE4 A;  4KVO E;  4FD6 A;  2P0W A;  2Z0Z A;  3R1K A;  2ATR A;  2I79 A;  3SHP A;  1NMT A;  3TOB A;  3QB8 A;  3F5B A;  3CXQ A;  3G3S A;  1B87 A;  2R1I A;  5EBV A;  3SXN A;  2QIR A;  1B6B A;  3P2H A;  1M1D A;  4NCZ A;  3TT2 A;  3FBU A;  3TFY A;  1CM0 A;  4KLV A;  2Q04 A;  5KTA A;  1TIQ A;  2ZXV A;  2PQ8 A;  1YVK A;  3FNC A;  3GYA A;  4NF1 A;  3EXN A;  1YK3 A;  5H86 A;  4IUS A;  4KVX A;  2OH1 A;  4XPD B;  4I49 A;  1MJ9 A;  2FE7 A;  1Q2C A;  5H84 A;  3T90 A;  4U9Y A;  2WPW A;  4U9Z A;  3R95 A;  3GY9 A;  2GIV A;  4OAE A;  1PU9 A;  1IB1 E;  3BJ7 A;  1IYK A;  2P6F A;  3W91 A;  2R98 A;  4L89 A;  5JQ4 A;  3TTH A;  2R8V A;  1QSM A;  3I9S A;  3SXO A;  1S60 A;  5IB0 A;  1QSO A;  2PSW A;  5KTC A;  3PZJ A;  2Q4V A;  3FYN A;  2JDD A;  3IGR A;  4MI4 A;  5FVJ A;  4JLY A;  2FSR A;  4AG9 A;  1IID A;  2C27 A;  2VZZ A;  1J4J A;  4CRZ B;  3FB3 A;  2BEI A;  2J8R A;  1WK4 A;  3S6H A;  2ZPA A;  4X5K A;  2Y0M A;  3F0A A;  5J8C A;  1XE4 A;  3I3G A;  3IWG A;  4KUA A;  4ONU A;  4H6Z A;  2D4O A;  4OAD A;  2J8M A;  2CNT A;  5GCN A;  4E0A A;  3R9F A;  5DWM A;  2PR1 A;  1Z9U A;  1Q2D A;  2HUZ A;  2VQY A;  5C82 A;  2WPX A;  1YX0 A;  3GKR A;  1YLE A;  3PGP A;  1I1D A;  3FRM A;  1UFH A;  3P2F A;  1YVO A;  1Z4R A;  3D8P A;  2OZH A;  3K9U A;  3C26 A;  3VWD A;  2F5I A;  4YFJ A;  4KOY A;  3KKW A;  4YGO A;  1Z4E A;  4HNW B;  1U6M A;  3FXT A;  2GE3 A;  4MY0 A;  1K4J A;  2B3V A;  4KOX A;  3VWE A;  2HQY A;  3ZZI A;  2OZU A;  4KZT A;  3WR7 A;  4XPK A;  3S6G A;  1IYL A;  2ZW5 A;  3V8I A;  1XMT A;  2ZW6 A;  1MJB A;  4QVT A;  3BLN A;  4UBR A;  4OLL A;  1XF8 A;  4K30 A;  4Y49 B;  2Q7B A;  1KZF A;  4UA3 A;  4AB7 A;  2FIW A;  4B5P B;  2VZY A;  4CS0 B;  2B58 A;  1KUV A;  4F6A A;  4IF5 A;  2BSW A;  4BMH A;  4PK3 A;  2BL1 A;  3W6X A;  3W6S A;  4F0Y A;  4QBJ A;  3EC4 A;  5F48 A;  4ZBG A;  2JLM A;  3MGD A;  3BJ8 A;  1VHS A;  5DWN A;  1NE9 A;  4HKF A;  4M3S A;  4XPD C;  2BUE A;  1YGH A;  2CNS A;  2HV2 A;  1XEB A;  4B5O A;  4UWJ A;  3UY5 A;  3R9E A;  3D2P A;  1RXT A;  1VKC A;  2A4N A;  1QSN A;  4KVM E;  3OWC A;  1ON0 A;  2REE A;  1MJA A;  4KLW A;  3TO6 A;  2ZW7 A;  1WWZ A;  1QSR A;  2Q4Y A;  4J3G A;  2O28 A;  5F49 A;  4JWP A;  4KOV A;  1Y7R A;  1P0H A;  2P6G A;  4JD6 A;  3S6F A;  4XNH B;  4CRY B;  3CXP A;  2B5G B;  4YRH A;  3R96 A;  3LD2 A;  2OU2 A;  1R57 A;  4KOT A;  4R3L A;  4MBU A;  4FD4 A;  1KUX A;  4AG7 A;  2FL4 A;  1OZP A;  4R9M A;  1Y9W A;  2G3T A;  2J8N A;  2OZG A;  2ZW4 A;  3JUW A;  2D4P A;  2Z10 A;  3G8W A;  2PC1 A;  5J8F A;  5F47 A;  4B5P A;  4MHD A;  3TOA A;  3CXS A;  3E0K A;  4AVB A;  3QAH A;  1M4I A;  1FY7 A;  2EUI A;  5I0C A;  2CY2 A;  2VI7 A;  3EFA A;  4XPL A;  4PK2 A;  5CNP A;  3PP9 A;  2PR8 A;  3DR8 A;  4PV6 A;  4AVA A;  4QUS A;  4L8A A;  3DSB A;  2VEZ A;  2VXK A;  2KCW A;  2AE6 A;  4PSX A;  4RI1 A;  4QB9 A;  1M4D A;  1YR0 A;  2G3A A;  2NMT A;  4PSW A;  4HNX B;  2Q44 A;  4RS2 A;  3LOD A;  4NXY A;  3TO9 A;  4QC6 A;  1S7F A;  2FXF A;  4HNY B;  1RO5 A;  2FS5 A;  4KOR A;  3ZJ0 A;  2B3U A;  4CAW A;  4R57 A;  5KTD A;  1XIX A;  3T9Y A;  1L0C A;  4UWI A;  1S7L A;  1KUY A;  2B4B A;  4LUA A;  3FIX A;  1M4G A;  4Y49 C;  2B5G A;  4E2A A;  5IX3 A;  5ISV A;  4II9 A;  1GHE A;  1V0C A;  1NSL A;  1S3Z A;  2AJ6 A;  1PUA A;  5C88 A;  3RYO A;  4E8O A;  1P4N A;  1M44 A;  4H6U A;  2FIA A;  2Z11 A;  2RC4 A;  1SQH A;  4ORF A;  4R87 A;  4U5Y A;  4LX9 A;  3H4Q A;  3R9G A;  2H5M A;  4JXR A;  2K5T A;  4MJ8 A;  2DXQ A;  3DDD A;  1IIC A;  4NEX A;  2B4D B;  2PDO A;  1S7N A;  2R7H A;  1BOB A;  3N7Z A;  4JXQ A;  3DR6 A;  4AVC A;  1Q2Y A;  2FT0 A;  5HH1 A;  3D3S A;  4H89 A;  2OB0 A;  4M85 A;  3EO4 A;  1S5K A;  3NE7 A;  4R3K A;  1BO4 A;  4CAX A;  2X7B A;  2G0B A;  2P6E A;  5E96 A;  2JDC A;  2GAN A;  1YRE A;  2PRB A;  4XNH C;  5F46 A;  1LRZ A;  4KOU A;  3S6K A;  2EVN A;  1CJW A;  4NSQ A;  4KUB A;  2CNM A;  2IL4 A;  1Y9K A;  2Q0Y A;  2VBQ A;  3TCV A;  3EY5 A;  2QML A;  4DNC A;  5EC4 A;  5IV0 A;  3JVN A;  2REF A;  3TO7 A;  2FCK A; 
#chains in the Genus database with same CATH topology
 2XEF A;  1IOF A;  1N71 A;  2I00 A;  3F8K A;  2QYV A;  1MK4 A;  2JEV A;  4OC1 A;  4P4E A;  4EVY A;  4KOW A;  1XOV A;  5HVH A;  2BCO A;  4K3N A;  5JPH A;  1I12 A;  2ARH A;  1AYE A;  2AFW A;  4P4D A;  5HVF A;  1RTQ A;  1Q7L A;  3DNS A;  4KOS A;  3GUX A;  1YW6 A;  2XEG A;  4WWV A;  4JJX A;  2ABZ A;  2ZEG A;  1I21 A;  2POK A;  3FEC A;  4CYP A;  1KWM A;  4FD7 A;  4GS4 A;  5HMN A;  3B8G A;  3D2M A;  1CP6 A;  4UFV A;  4F9U A;  2EO8 A;  2V77 A;  4FD5 A;  4MY3 A;  2YGW A;  4M6I A;  3B3S A;  4NGT A;  1QST A;  2B4D A;  2QEC A;  1LFW A;  4CAV A;  4ZI6 A;  1S7K A;  3TE4 A;  4MCQ A;  1TKH A;  4KVO E;  3D4U A;  4KSI A;  2PE3 A;  2PVV A;  3PBE A;  4FD6 A;  3SI0 A;  3FMC A;  5AG5 A;  2P0W A;  2Z0Z A;  1ELL P;  2ATR A;  3R1K A;  4LQG A;  4B11 A;  4C2X A;  2I79 A;  4H2K A;  3SHP A;  4UIA A;  2CIJ A;  1NMT A;  4PQA A;  3TOB A;  2ZED A;  1TF9 A;  3FEE A;  4M6G A;  3B3W A;  3QB8 A;  4A95 A;  3B3C A;  3A9L A;  2CXA A;  3F5B A;  3CXQ A;  3PB4 X;  3G3S A;  4UEF A;  1B87 A;  2R1I A;  5EBV A;  3FH4 A;  3NE8 A;  1AMP A;  4LQ6 A;  3SXN A;  2QIR A;  1B6B A;  3P2H A;  3S9M A;  1M1D A;  4NCZ A;  3TT2 A;  4RN7 A;  3FBU A;  7CPA A;  2ZEL A;  3TFY A;  1CM0 A;  4KLV A;  2Q04 A;  2ZEO A;  2QVP A;  2ZEF A;  5KTA A;  1TIQ A;  2ZXV A;  1JWQ A;  1EE3 P;  2BO9 A;  2F7V A;  2PQ8 A;  3PFO A;  3TX8 A;  1IY7 A;  1YVK A;  3FNC A;  3GYA A;  3ISZ A;  3PB7 X;  4DUK A;  3IWW A;  4NF1 A;  2F8H A;  4NGP A;  1ARL A;  4UCM A;  3EXN A;  1YK3 A;  5H86 A;  4IUS A;  4PXC A;  4KVX A;  2G9D A;  2OH1 A;  3NH8 A;  4XPD B;  1CPX A;  4I49 A;  4CGO A;  1MJ9 A;  2EBJ A;  4P4I A;  2EK9 A;  3VAR A;  2FE7 A;  1Q2C A;  4IAV A;  2PJ2 A;  5H84 A;  3T90 A;  4U9Y A;  1R43 A;  3NH4 A;  2WPW A;  4U9Z A;  3D7F A;  4Q7A A;  3MN8 A;  3R95 A;  1CX8 A;  1TKF A;  3GY9 A;  2GIV A;  2WYR A;  1PU9 A;  1IB1 E;  3BJ7 A;  3NA6 A;  1UWY A;  3NH5 A;  1FT7 A;  3PFE A;  1IYK A;  1QMU A;  2JEW A;  2P6F A;  3QNV A;  4MHP A;  4X2T A;  3W91 A;  3KR4 A;  2R98 A;  4A30 A;  4L89 A;  5JQ4 A;  1ARM A;  5BWA B;  3TTH A;  2R8V A;  1QSM A;  3I9S A;  3SXO A;  1S60 A;  4Z65 A;  4CYQ A;  5IB0 A;  2RFH A;  1CPS A;  1QSO A;  2PSW A;  2Z3K A;  2ODF A;  4NFR A;  5KTC A;  3PZJ A;  4MFP A;  2O53 A;  2Q4V A;  1F57 A;  2NYQ A;  3FYN A;  2NSM A;  2JDD A;  3GB0 A;  5HXD A;  1ELM P;  5HVG A;  5LYI A;  2ZEP A;  2ANP A;  3IGR A;  2GLJ A;  3VH9 A;  4MI4 A;  1TF8 A;  5FVJ A;  4JLY A;  4B6Z A;  2FSR A;  4AG9 A;  1IID A;  2C27 A;  4EWT A;  4FBE A;  3RBU A;  2EK8 A;  2VZZ A;  1J4J A;  4CRZ B;  5J1Q A;  4UF4 A;  3FB3 A;  1IOI A;  3IJ3 A;  2BEI A;  2J8R A;  4KSA A;  2J9A A;  4UFW A;  1LAP A;  1WK4 A;  2PJ9 A;  4ZY0 A;  4A33 A;  1A2Z A;  2YNC A;  1Z8T A;  2Q4Z A;  4A31 A;  4IHM A;  3S6H A;  4AXV A;  4PXE A;  4YWY A;  2ZPA A;  4PXD A;  4UCN A;  4X5K A;  2PCU A;  2PJC A;  2Y0M A;  3F0A A;  5J8C A;  4BBH A;  2C6C A;  1XE4 A;  1PYT B;  3I3G A;  3IWG A;  4KUA A;  4ONU A;  4H6Z A;  4C68 A;  4CGP A;  2D4O A;  4B12 A;  2YND A;  4OAD A;  2J8M A;  2CNT A;  5GCN A;  4E0A A;  3R9F A;  1ZG7 A;  5DWM A;  2PR1 A;  4MRI A;  2PIY A;  1Z9U A;  3T8W A;  5IB9 A;  1Q2D A;  1Y0R A;  2HUZ A;  2VQY A;  4OID A;  5C82 A;  2WPX A;  1YX0 A;  3GKR A;  5EMI A;  1YLE A;  3PGP A;  2XEJ A;  3IIB A;  1I1D A;  3FRM A;  1UFH A;  4P6Y A;  3BXM A;  3P2F A;  4O23 A;  3DLJ A;  1YVO A;  1Z4R A;  3D8P A;  2OZH A;  5A27 A;  2GRE A;  2WUU A;  3K9U A;  3C26 A;  3PBB A;  3WC6 A;  4C7I A;  2AFO A;  3VWD A;  2O4H A;  4UCP A;  2F5I A;  4YFJ A;  4NGR A;  1HDU A;  4OAE A;  1TXR A;  4KOY A;  4OME A;  4A32 A;  1YME A;  2AFS A;  3KKW A;  4P4B A;  4ZY1 A;  1BAV A;  5LRJ A;  4YGO A;  1ZG8 A;  3CDX A;  1Z4E A;  3I1U A;  1IU8 A;  4HNW B;  1U6M A;  3FXT A;  2GE3 A;  4MY0 A;  1XJO A;  4UFX A;  1K4J A;  1XMB A;  2B3V A;  3JRU A;  1X10 A;  3KHZ A;  4KOX A;  1YSJ A;  3D7D A;  1LCP A;  1BLL E;  2ZEH A;  5G21 A;  3VWE A;  4NGM A;  4CPA A;  2HQY A;  3ZZI A;  2OZU A;  5JGF A;  5G1Z A;  4KZT A;  3WR7 A;  4XPK A;  3S6G A;  1ZG9 A;  2JBK A;  4X8I A;  4OIW A;  4RUH A;  3IU2 A;  1IYL A;  4GXH A;  2ZW5 A;  3V8I A;  1QQ9 A;  1XMT A;  2WZN A;  3B2Y A;  2ZW6 A;  1MJB A;  2BOA A;  2RB7 A;  5D8N A;  4QVT A;  2C6G A;  1CP7 A;  4MCR A;  3BLN A;  2DEA A;  2YNC C;  5G22 A;  4UBR A;  4OLL A;  3WAB A;  1XF8 A;  1ZO0 A;  4K30 A;  4Y49 B;  2Q7B A;  4OP4 A;  4TWE A;  1KZF A;  3B35 A;  4MMO A;  2PJB A;  5K8M A;  4UA3 A;  4AB7 A;  2FIW A;  4CAE A;  4MFK A;  3FED A;  2VZY A;  4B5P B;  1FNO A;  2Q51 A;  4CS0 B;  2B58 A;  2Z3N A;  1KUV A;  4F6A A;  4M6H A;  3RZA A;  4JYW A;  3GIU A;  3SJE A;  3D66 A;  4IF5 A;  2BSW A;  4BMH A;  2V8H A;  1Z8W A;  4PK3 A;  2BL1 A;  3SJG A;  5F09 A;  3W6X A;  3W6S A;  4F0Y A;  1YLO A;  1CG2 A;  2Z3P A;  4QBJ A;  3EC4 A;  5F48 A;  2DPT A;  4ZBG A;  4NJR A;  2JLM A;  4NGS A;  4X3R A;  4TNU A;  5JH9 A;  2PJ5 A;  3PB9 X;  4PXB A;  5DS0 A;  1IGB A;  3MGD A;  2ZEE A;  1VHS A;  3BJ8 A;  3LMS A;  5DWN A;  4C7H A;  5LYL A;  1NE9 A;  2OR4 A;  4HKF A;  1CBX A;  4M3S A;  1HDQ A;  4MFJ A;  3PRT A;  4W9Y A;  4XPD C;  2BUE A;  2V8V A;  4MHN A;  3KQX A;  2PIZ A;  1YGH A;  2CNS A;  3V38 A;  2HV2 A;  2CTC A;  2C1C A;  1XEB A;  2YNE A;  5A28 A;  4B5O A;  4UWJ A;  4A37 A;  3UY5 A;  3R9E A;  1BPM A;  3D2P A;  5THW A;  5JM6 A;  3FF3 A;  4EME A;  1RXT A;  1VKC A;  1H8L A;  2A4N A;  1QSN A;  4KVM E;  3OWC A;  3RAM A;  5LYF A;  1YQE A;  1ON0 A;  4DYO A;  2REE A;  1MJA A;  4KLW A;  3TO6 A;  2ZW7 A;  1WWZ A;  3QAY A;  1QSR A;  2Q4Y A;  3RNZ A;  2PJ4 A;  3KGQ A;  2O28 A;  4J3G A;  5F49 A;  4B10 A;  4JWP A;  4KOV A;  1Y7R A;  2PJA A;  1P0H A;  2P6G A;  5AG7 A;  2VL1 A;  2PRQ A;  3JTK A;  4JD6 A;  4KSF A;  1TKJ A;  3B7I A;  4XNH B;  3S6F A;  4C2Z A;  3CXP A;  4CRY B;  3H8E A;  2B5G B;  2Z3M A;  3NFZ A;  4YRH A;  3R96 A;  4OC4 A;  4G1P A;  4MCS A;  4UEZ A;  3TC8 A;  3LD2 A;  2HB6 A;  2OU2 A;  1R57 A;  4KOT A;  3LWU A;  4MBU A;  4R3L A;  4FD4 A;  1KUX A;  3S9L A;  4R6T A;  4AG7 A;  2FL4 A;  1OZP A;  3FVL A;  4R9M A;  4WJB A;  3GLJ A;  1Y9W A;  4MHZ A;  2G3T A;  2J8N A;  2OZG A;  2ZW4 A;  3JUW A;  2Z3L A;  4JZ0 A;  5G20 A;  4ZX8 A;  2D4P A;  4B13 A;  2Z10 A;  1XFO A;  3PB6 X;  3G8W A;  2PC1 A;  2ZOF A;  3WC7 A;  5J8F A;  4BIN A;  5F47 A;  2ZEN A;  4B5P A;  2AFU A;  5LYD A;  4P10 A;  4MHD A;  4CAF A;  3TOA A;  3CXS A;  4ONW A;  4A38 A;  5LRK A;  3E0K A;  3HUV A;  4CGM A;  4AVB A;  4CYN A;  3QAH A;  1M4I A;  1Y0Y A;  4CYO A;  1FY7 A;  2EUI A;  4R7M A;  4F9V A;  2FVG A;  3SI1 A;  4MHY A;  5I0C A;  2CY2 A;  1LAN A;  2VI7 A;  5K8N A;  3EFA A;  4F0X A;  1YW4 A;  5ELY A;  4XPL A;  5CBM A;  1BPN A;  2PJ6 A;  4YU9 A;  4PK2 A;  5CNP A;  3RO0 A;  2PVW A;  3PP9 A;  4FAI A;  2PR8 A;  5AG4 A;  4HPS A;  5LRG A;  3CPX A;  3DR8 A;  2IMO A;  3PEI A;  4PV6 A;  4AVA A;  4QUS A;  4L8A A;  3KL9 A;  5AG6 A;  3DSB A;  2PJ8 A;  2VEZ A;  2VXK A;  4P4F A;  3V7Z A;  2KCW A;  2AE6 A;  4PSX A;  1DE4 C;  4RI1 A;  4QB9 A;  2Z3O A;  5D29 A;  4A39 A;  1M4D A;  1YR0 A;  2G3A A;  4GM5 A;  2NMT A;  4PSW A;  5K8P A;  4HNX B;  3D7H A;  2Q44 A;  4RS2 A;  4FWU A;  3LOD A;  4MCP A;  3SJX A;  3B3T A;  4OC3 A;  3WC5 A;  4NXY A;  4A2Z A;  1M4L A;  3IFE A;  1X12 A;  3TO9 A;  4QC6 A;  1PCA A;  1S7F A;  4BD9 A;  2FXF A;  5CPA A;  4HNY B;  3BI0 A;  2FCK A;  3IWE A;  4NJQ A;  3KR5 A;  3KZW A;  1Z2L A;  1RO5 A;  1Z8L A;  2FS5 A;  4KOR A;  3ZJ0 A;  2PJ1 A;  3HLP A;  2B3U A;  3FX6 A;  4CAW A;  1ZLI A;  3ISX A;  4R57 A;  4FUU A;  3SI2 A;  3H8F A;  2PJ0 A;  1XIX A;  2PJ7 A;  4P45 A;  3T9Y A;  4EFD A;  5KTD A;  3DGV A;  1L0C A;  3PB8 X;  4UWI A;  3S9N A;  3CZX A;  1S7L A;  1KUY A;  1F2O A;  2B4B A;  4LUA A;  1VIX A;  3FIX A;  1M4G A;  4B14 A;  2ZOG A;  3KQZ A;  4IK2 A;  4Q38 A;  4Y49 C;  4KS9 A;  2B5G A;  4E2A A;  5IX3 A;  5ISV A;  4II9 A;  3KI9 A;  1GHE A;  2V8G A;  3SJF A;  2GU2 A;  1ZLH A;  1V0C A;  3N5F A;  1NSL A;  2GFQ A;  1S3Z A;  4DJL A;  2AJ6 A;  4NGQ A;  2AFZ A;  4PPZ A;  1PUA A;  2QJ8 A;  5C88 A;  3RYO A;  4E8O A;  4MFL A;  3FJU A;  3KAS A;  4R8F A;  1P4N A;  1M44 A;  4H6U A;  3CPA A;  1AUG A;  3L2N A;  2FIA A;  2Z11 A;  1R3N A;  2RC4 A;  1SQH A;  2V8D A;  4OKO A;  4ORF A;  4R87 A;  4U5Y A;  4A94 A;  4LX9 A;  3H4Q A;  3R9G A;  2H5M A;  4JXR A;  3H8G A;  2K5T A;  1HEE A;  4MJ8 A;  3IC1 A;  1OBR A;  2DXQ A;  3DDD A;  1IIC A;  4NEX A;  2B4D B;  4OC0 A;  8CPA A;  2PDO A;  4UIB A;  4MXU A;  2DF5 A;  4UEE A;  1VGY A;  1S7N A;  1Y7E A;  2R7H A;  4P4J A;  1BOB A;  3BI1 A;  2HC9 A;  3N7Z A;  4JXQ A;  3DR6 A;  4AVC A;  2WSA A;  1VHE A;  1Q2Y A;  2FT0 A;  5HH1 A;  2OOT A;  4OC2 A;  4Q36 A;  2DPS A;  2GLF A;  3B3V A;  3D3S A;  4ZYQ A;  4H89 A;  2OB0 A;  4MFQ A;  4M85 A;  3CT9 A;  3EO4 A;  1XBU A;  1S5K A;  1JQG A;  1LOK A;  2C6P A;  2I3C A;  3D7G A;  3NE7 A;  1VHO A;  2Q7S A;  4R76 A;  4R3K A;  1BO4 A;  4CAX A;  1Z8X A;  2Q43 A;  4ZX9 A;  2X7B A;  2G0B A;  2P6E A;  5AGE A;  5E96 A;  2JDC A;  4MFZ A;  6CPA A;  1DTD A;  1NSA A;  2AFX A;  1XRY A;  2PJ3 A;  1F2P A;  3MRU A;  2GAN A;  1YRE A;  2PRB A;  3IEH A;  3KHX A;  4NGN A;  1LRZ A;  4KOU A;  4XNH C;  3S6K A;  4CGN A;  2EVN A;  4ZGY B;  5F46 A;  1CJW A;  2EWB A;  3BHX A;  3VAT A;  4F8Z A;  4NSQ A;  4KUB A;  2CNM A;  2AFM A;  2IL4 A;  3D68 A;  1Y9K A;  2Q0Y A;  2VBQ A;  3TCV A;  4P44 A;  2CTB A;  2CF4 A;  3EY5 A;  3D67 A;  1Z5R A;  3H5Z A;  2QML A;  2ZEM A;  4ZY2 A;  3IU1 A;  4OC5 A;  4DNC A;  5EC4 A;  1LAM A;  2JBJ A;  1GYT A;  3WT4 A;  4C2Y A;  3K2K A;  3LAC A;  5IV0 A;  3JVN A;  2REF A;  2XEI A;  3IO1 A;  2IQ6 A;  3TO7 A;  5K8O A;  5I4M A;  4CGL A;  3K9T A;  2IJZ A; 
#chains in the Genus database with same CATH homology
 3F8K A;  1N71 A;  2I00 A;  1MK4 A;  2JEV A;  4EVY A;  4KOW A;  5JPH A;  1I12 A;  2ARH A;  3DNS A;  4KOS A;  4JJX A;  1I21 A;  4CYP A;  4FD7 A;  4GS4 A;  5HMN A;  3B8G A;  3D2M A;  4UFV A;  4FD5 A;  4MY3 A;  2YGW A;  1QST A;  2B4D A;  2QEC A;  4CAV A;  1S7K A;  3TE4 A;  4KVO E;  4FD6 A;  5AG5 A;  2P0W A;  2Z0Z A;  3R1K A;  2ATR A;  4B11 A;  4C2X A;  2I79 A;  3SHP A;  1NMT A;  3TOB A;  3QB8 A;  4A95 A;  3A9L A;  2CXA A;  3F5B A;  3CXQ A;  3G3S A;  1B87 A;  2R1I A;  5EBV A;  3SXN A;  2QIR A;  1B6B A;  3P2H A;  1M1D A;  4NCZ A;  3TT2 A;  3FBU A;  3TFY A;  1CM0 A;  4KLV A;  2Q04 A;  5KTA A;  1TIQ A;  2ZXV A;  2PQ8 A;  1YVK A;  3FNC A;  3GYA A;  4NF1 A;  4UCM A;  3EXN A;  1YK3 A;  5H86 A;  4IUS A;  4KVX A;  2OH1 A;  4XPD B;  4I49 A;  4CGO A;  1MJ9 A;  2FE7 A;  1Q2C A;  5H84 A;  3T90 A;  4U9Y A;  2WPW A;  4U9Z A;  3R95 A;  3GY9 A;  2GIV A;  4OAE A;  1PU9 A;  1IB1 E;  3BJ7 A;  1IYK A;  2P6F A;  3W91 A;  2R98 A;  4A30 A;  4L89 A;  5JQ4 A;  5BWA B;  3TTH A;  2R8V A;  1QSM A;  3I9S A;  3SXO A;  1S60 A;  5IB0 A;  4CYQ A;  2Z3K A;  1QSO A;  2PSW A;  5KTC A;  3PZJ A;  4MFP A;  2Q4V A;  3FYN A;  2JDD A;  3IGR A;  4MI4 A;  5FVJ A;  4JLY A;  2FSR A;  4AG9 A;  1IID A;  2C27 A;  2VZZ A;  1J4J A;  4CRZ B;  3FB3 A;  2BEI A;  2J8R A;  4KSA A;  4UFW A;  1WK4 A;  4A33 A;  2YNC A;  4A31 A;  3S6H A;  2ZPA A;  4UCN A;  4X5K A;  2Y0M A;  3F0A A;  5J8C A;  4BBH A;  1XE4 A;  3I3G A;  3IWG A;  4KUA A;  4ONU A;  4C68 A;  4H6Z A;  4CGP A;  2D4O A;  4B12 A;  2YND A;  4OAD A;  2J8M A;  2CNT A;  5GCN A;  4E0A A;  3R9F A;  5DWM A;  2PR1 A;  1Z9U A;  1Q2D A;  2HUZ A;  2VQY A;  5C82 A;  2WPX A;  1YX0 A;  3GKR A;  1YLE A;  3PGP A;  1I1D A;  3FRM A;  1UFH A;  3P2F A;  1YVO A;  1Z4R A;  3D8P A;  2OZH A;  5A27 A;  2WUU A;  3K9U A;  3C26 A;  4C7I A;  3VWD A;  4UCP A;  2F5I A;  4YFJ A;  4KOY A;  4A32 A;  3KKW A;  4YGO A;  1Z4E A;  4HNW B;  1U6M A;  3FXT A;  2GE3 A;  4MY0 A;  4UFX A;  1K4J A;  2B3V A;  4KOX A;  5G21 A;  3VWE A;  2HQY A;  3ZZI A;  2OZU A;  5G1Z A;  4KZT A;  3WR7 A;  4XPK A;  3S6G A;  3IU2 A;  1IYL A;  2ZW5 A;  3V8I A;  1XMT A;  2ZW6 A;  1MJB A;  4QVT A;  3BLN A;  2YNC C;  5G22 A;  4UBR A;  4OLL A;  1XF8 A;  1ZO0 A;  4K30 A;  4Y49 B;  2Q7B A;  1KZF A;  4UA3 A;  4AB7 A;  2FIW A;  4CAE A;  4MFK A;  4B5P B;  2VZY A;  4CS0 B;  2B58 A;  2Z3N A;  1KUV A;  4F6A A;  4IF5 A;  2BSW A;  4BMH A;  4PK3 A;  2BL1 A;  3W6X A;  3W6S A;  4F0Y A;  2Z3P A;  4QBJ A;  3EC4 A;  5F48 A;  2DPT A;  4ZBG A;  2JLM A;  3MGD A;  3BJ8 A;  1VHS A;  5DWN A;  4C7H A;  1NE9 A;  4HKF A;  4M3S A;  4MFJ A;  4XPD C;  2BUE A;  1YGH A;  2CNS A;  2HV2 A;  1XEB A;  2YNE A;  5A28 A;  4B5O A;  4UWJ A;  3UY5 A;  3R9E A;  3D2P A;  1RXT A;  1VKC A;  2A4N A;  1QSN A;  4KVM E;  3OWC A;  1ON0 A;  2REE A;  1MJA A;  4KLW A;  3TO6 A;  2ZW7 A;  1WWZ A;  1QSR A;  2Q4Y A;  4J3G A;  2O28 A;  5F49 A;  4B10 A;  4JWP A;  4KOV A;  1Y7R A;  1P0H A;  2P6G A;  5AG7 A;  3JTK A;  4JD6 A;  4KSF A;  3S6F A;  4XNH B;  4C2Z A;  4CRY B;  3CXP A;  2B5G B;  2Z3M A;  4YRH A;  3R96 A;  3LD2 A;  2OU2 A;  1R57 A;  4KOT A;  4R3L A;  4MBU A;  4FD4 A;  1KUX A;  4AG7 A;  2FL4 A;  1OZP A;  4R9M A;  1Y9W A;  2G3T A;  2J8N A;  2OZG A;  2ZW4 A;  3JUW A;  2Z3L A;  5G20 A;  2D4P A;  4B13 A;  2Z10 A;  3G8W A;  2PC1 A;  5J8F A;  5F47 A;  4B5P A;  4CAF A;  4MHD A;  3TOA A;  3CXS A;  3E0K A;  4CGM A;  4AVB A;  4CYN A;  3QAH A;  1M4I A;  4CYO A;  1FY7 A;  2EUI A;  5I0C A;  2CY2 A;  2VI7 A;  3EFA A;  4F0X A;  4XPL A;  4PK2 A;  5CNP A;  3PP9 A;  2PR8 A;  5AG4 A;  3DR8 A;  4PV6 A;  4AVA A;  4QUS A;  4L8A A;  5AG6 A;  3DSB A;  2VEZ A;  2VXK A;  2KCW A;  2AE6 A;  4PSX A;  4RI1 A;  4QB9 A;  2Z3O A;  1M4D A;  1YR0 A;  2G3A A;  2NMT A;  4PSW A;  4HNX B;  2Q44 A;  4RS2 A;  3LOD A;  4NXY A;  4A2Z A;  3TO9 A;  4QC6 A;  1S7F A;  2FXF A;  4HNY B;  3IWE A;  1RO5 A;  2FS5 A;  4KOR A;  3ZJ0 A;  2B3U A;  4CAW A;  4R57 A;  5KTD A;  1XIX A;  3T9Y A;  1L0C A;  4UWI A;  1S7L A;  1KUY A;  2B4B A;  4LUA A;  3FIX A;  1M4G A;  4B14 A;  4Q38 A;  4Y49 C;  4KS9 A;  2B5G A;  4E2A A;  5IX3 A;  5ISV A;  4II9 A;  1GHE A;  1V0C A;  1NSL A;  1S3Z A;  2AJ6 A;  1PUA A;  5C88 A;  3RYO A;  4E8O A;  4MFL A;  1P4N A;  1M44 A;  4H6U A;  2FIA A;  2Z11 A;  2RC4 A;  1SQH A;  4ORF A;  4R87 A;  4U5Y A;  4LX9 A;  3H4Q A;  3R9G A;  2H5M A;  4JXR A;  2K5T A;  4MJ8 A;  2DXQ A;  3DDD A;  1IIC A;  4NEX A;  2B4D B;  2PDO A;  1S7N A;  2R7H A;  1BOB A;  3N7Z A;  4JXQ A;  3DR6 A;  4AVC A;  2WSA A;  1Q2Y A;  2FT0 A;  5HH1 A;  4Q36 A;  2DPS A;  3D3S A;  4H89 A;  2OB0 A;  4MFQ A;  4M85 A;  3EO4 A;  1S5K A;  3NE7 A;  4R3K A;  1BO4 A;  4CAX A;  2X7B A;  2G0B A;  2P6E A;  5AGE A;  5E96 A;  2JDC A;  4MFZ A;  2GAN A;  1YRE A;  2PRB A;  4XNH C;  5F46 A;  1LRZ A;  4KOU A;  4CGN A;  3S6K A;  2EVN A;  4ZGY B;  1CJW A;  4NSQ A;  4KUB A;  2CNM A;  2IL4 A;  1Y9K A;  2Q0Y A;  2VBQ A;  3TCV A;  3EY5 A;  3H5Z A;  2QML A;  3IU1 A;  4DNC A;  5EC4 A;  4C2Y A;  5IV0 A;  3JVN A;  2REF A;  3TO7 A;  4CGL A;  2FCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...