2BSWA

Crystal structure of a glyphosate-n-acetyltransferase obtained by dna shuffling.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
b'IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title DNA Shuffling as a Tool for Protein Crystallization.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Transferase
total genus 36
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2bswA00
4MJ8A 1IIDA 2B4BA 3W91A 4H6UA 5KTDA 2ZW7A 4PSXA 4FD5A 1R57A 5H84A 2OU2A 3TO6A 5FVJA 1VKCA 4QBJA 3T90A 1KZFA 3KKWA 3S6GA 2X7BA 1Q2CA 1S7KA 2VQYA 4HNWB 2JDCA 5DWMA 2CNTA 3TO7A 3LD2A 4KOVA 3P2HA 2QIRA 2ZPAA 2BEIA 2AE6A 5HH1A 2NMTA 2C27A 3MGDA 1XIXA 3FNCA 3PP9A 3QB8A 5J8FA 1NE9A 2HQYA 2FL4A 4XPKA 4PV6A 1ON0A 2JDDA 4QUSA 2FXFA 4KLVA 4JWPA 3TFYA 4MHDA 1B6BA 1Y9KA 4KVXA 4AG9A 3V8IA 2PDOA 3G3SA 2EVNA 1YREA 3GKRA 5E96A 1Q2YA 3TTHA 4KVOE 4XNHB 2VXKA 3TCVA 1XF8A 3FYNA 1S7LA 3SXOA 4QVTA 1FY7A 3JVNA 1Z4RA 2Q04A 3DR8A 4F6AA 1MK4A 2WPWA 3UY5A 4AG7A 2G0BA 3WR7A 1XE4A 1M4GA 4R9MA 4B5PA 2PC1A 1B87A 1Y9WA 2VZYA 5F48A 4MY0A 1I1DA 1PUAA 3W6SA 3N7ZA 1IB1E 3FXTA 4RS2A 3NE7A 4HKFA 4AB7A 5I0CA 4IF5A 1XEBA 3D3SA 2ZW5A 3IGRA 1MJBA 2ARHA 4H89A 2OZUA 5GCNA 2FT0A 2FS5A 2B3VA 1GHEA 4M85A 3CXPA 2G3AA 5HMNA 2EUIA 1LRZA 1YLEA 4L89A 2D4PA 4NEXA 2AJ6A 3GYAA 4CAXA 4I49A 2BL1A 2IL4A 2GE3A 2K5TA 2R8VA 1S5KA 3C26A 1RXTA 2ZW4A 3R1KA 2R1IA 4YFJA 1Q2DA 4XPDB 2B5GB 2JEVA 4NXYA 4JXQA 2VI7A 4QC6A 3G8WA 2I79A 3R9GA 2Z10A 1M44A 3TE4A 3S6FA 1S7NA 2QECA 2VZZA 4CAVA 1N71A 1UFHA 1PU9A 4IUSA 4NCZA 1QSNA 2KCWA 3F8KA 2R7HA 4JLYA 2OZHA 3QAHA 1Z4EA 3FIXA 3F5BA 3R96A 2Q7BA 1YVOA 4ORFA 2CNMA 1YK3A 2ZXVA 2PRBA 5F49A 4UWIA 2P6EA 3FBUA 1KUYA 1QSRA 1S60A 2A4NA 5JPHA 3EFAA 1IICA 3CXQA 4AVCA 3DNSA 4UBRA 2Q0YA 4FD6A 3JUWA 3ZZIA 1M4IA 4UA3A 2B58A 3S6HA 4B5OA 4Y49C 3FRMA 1QSMA 2B4DB 4J3GA 4BMHA 4F0YA 1BOBA 3IWGA 2Z11A 1KUXA 3P2FA 3I9SA 2BSWA 1VHSA 5F46A 3EY5A 2P6FA 1WWZA 1YX0A 3PGPA 4PK3A 5C88A 5ISVA 3TOBA 4CRZB 2G3TA 4FD4A 3BJ7A 3S6KA 3GY9A 5CNPA 4PK2A 1XMTA 3W6XA 5EC4A 5IV0A 2QMLA 1S7FA 3E0KA 4MY3A 3EO4A 2J8RA 3I3GA 4ZBGA 4EVYA 2PSWA 2H5MA 3EC4A 2FIWA 4OADA 4MI4A 3K9UA 3R9FA 2ATRA 1NMTA 4CAWA 4JD6A 1MJ9A 4NSQA 2P6GA 2REEA 5EBVA 4R3KA 4U5YA 4AVBA 3BJ8A 1KUVA 4RI1A 1TIQA 5KTCA 3TT2A 2J8MA 2OZGA 4KVME 1Y7RA 3H4QA 5J8CA 1M4DA 4HNYB 2J8NA 3R95A 1U6MA 3EXNA 1IYLA 3LODA 1L0CA 3D2PA 4YGOA 1V0CA 1QSOA 2P0WA 4M3SA 1QSTA 4KOYA 3VWDA 2Q4YA 4GS4A 2PR1A 1I12A 2Y0MA 2PR8A 1P0HA 2WPXA 4II9A 2F5IA 2B5GA 2R98A 2OH1A 4U9YA 4CRYB 4K30A 3DSBA 3OWCA 1BO4A 3R9EA 1CM0A 1YVKA 2D4OA 4JXRA 2B3UA 3DR6A 4KOUA 4E0AA 4XNHC 1WK4A 1MJAA 2Q4VA 2Q44A 3D2MA 3RYOA 5JQ4A 2FIAA 1J4JA 2GIVA 4KUAA 4KOXA 4MBUA 2FCKA 4KORA 4OLLA 4OAEA 5IX3A 4U9ZA 5KTAA 3D8PA 4LX9A 3PZJA 1RO5A 1P4NA 3BLNA 2GANA 4B5PB 1I21A 5IB0A 4AVAA 4NF1A 4KOWA 3T9YA 3TOAA 4KOSA 3DDDA 3B8GA 2CY2A 2BUEA 4QB9A 1OZPA 4HNXB 1SQHA 3SXNA 2B4DA 2RC4A 4DNCA 3FB3A 4Y49B 2O28A 4E2AA 4PSWA 1YR0A 2HV2A 2FSRA 4YRHA 1CJWA 2VEZA 4KLWA 2I00A 1S3ZA 3TO9A 4UWJA 2OB0A 4KZTA 1M1DA 5F47A 4X5KA 4XPDC 3CXSA 2VBQA 1K4JA 4H6ZA 2FE7A 4XPLA 1Z9UA 4KUBA 2HUZA 4FD7A 3ZJ0A 2Z0ZA 2REFA 4CS0B 2ZW6A 1IYKA 4L8AA 3SHPA 1YGHA 2PQ8A 5H86A 5C82A 4KOTA 4JJXA 4LUAA 4R57A 5DWNA 4ONUA 2DXQA 1NSLA 3F0AA 2CNSA 2JLMA 4E8OA 3VWEA 4R87A 4R3LA
chains in the Genus database with same CATH superfamily
3D4UA 3B35A 2EWBA 4MJ8A 4A2ZA 4YWYA 1IIDA 3IU1A 2AFXA 2B4BA 4A39A 1OBRA 3W91A 4H6UA 5KTDA 2ZW7A 2Z3KA 5ELYA 4PSXA 5LRKA 4FD5A 4CGPA 1R57A 5H84A 2OU2A 1ELLP 3TO6A 5FVJA 1VKCA 4QBJA 3T90A 1KZFA 3KKWA 1YMEA 3S6GA 3SI2A 2X7BA 1Q2CA 4RUHA 5A27A 4M6HA 2AFMA 5LYFA 3GB0A 3PRTA 1VHEA 1S7KA 4MCRA 2VQYA 1EE3P 2JDCA 2QJ8A 4HNWB 5DWMA 5G20A 2CNTA 3TO7A 2V8GA 1Z8XA 3LD2A 4KOVA 3P2HA 4UFWA 2QIRA 4MRIA 4OC4A 2ZPAA 2BEIA 2AE6A 5HH1A 2NMTA 2C27A 3MGDA 3MN8A 2C1CA 1XIXA 3FNCA 3PP9A 1R43A 3QB8A 5LRGA 5I4MA 5J8FA 3LACA 1ZLIA 1NE9A 1Z8TA 2ANPA 2HQYA 2PJ2A 3KI9A 2FL4A 2YGWA 4FUUA 4MHYA 4UCMA 4PV6A 4XPKA 4MFJA 3NH8A 1ON0A 2JDDA 4A38A 4CGLA 4UIBA 4QUSA 4A95A 2PJ5A 2FXFA 2POKA 4KLVA 4JWPA 2Z3MA 4F0XA 3TFYA 4MHDA 1F2OA 2YNCC 1VHOA 4CAFA 1B6BA 5LYDA 1Y9KA 4KVXA 4AG9A 2BCOA 2IQ6A 3V8IA 4NGMA 4MFKA 2PDOA 3G3SA 3H8GA 1LAMA 1Z8LA 2EVNA 2PRQA 1IGBA 1LFWA 4F9VA 3DLJA 1YREA 3FH4A 3GKRA 5E96A 1Q2YA 2PJ4A 2RFHA 3TTHA 3NH4A 4KVOE 3LMSA 4FWUA 4LQ6A 2VXKA 4ONWA 1XF8A 4OC2A 2JBKA 4XNHB 3TCVA 3TX8A 3FYNA 1S7LA 4CYPA 3SXOA 2ZELA 1PCAA 4QVTA 1FY7A 4YU9A 3JVNA 1Z4RA 2Q04A 1XRYA 5LYLA 3DGVA 3DR8A 3PB4X 4NGPA 4OKOA 4NGNA 4HPSA 4O23A 4F6AA 3HLPA 1MK4A 2WPWA 4UFXA 3UY5A 4AG7A 2G0BA 3WR7A 1XE4A 1M4GA 1TKHA 4R9MA 3D67A 2PC1A 4B5PA 4UCNA 1TF9A 1B87A 1Y9WA 2VZYA 5F48A 4MY0A 2GFQA 5HVFA 3KASA 1I1DA 1PUAA 3W6SA 3N7ZA 1IB1E 3FXTA 4RS2A 2J9AA 3NE7A 1DE4C 5LRJA 2AFUA 4HKFA 2ZOFA 3K9TA 4AB7A 1X12A 4M6IA 2O53A 4X2TA 5I0CA 3D7DA 2EBJA 4IF5A 1XEBA 3B2YA 3D3SA 4F9UA 3LWUA 2ZW5A 5AG6A 3IGRA 3WC7A 1MJBA 2NSMA 2ARHA 3D7FA 4H89A 4H2KA 4ZY2A 2OZUA 5GCNA 2FT0A 2FS5A 2B3VA 1XMBA 1GHEA 4M85A 4GXHA 5G21A 4Q36A 4OC1A 3CXPA 2G3AA 4M6GA 4MFQA 2EO8A 4MFZA 2ODFA 5HMNA 2EUIA 3NFZA 1LRZA 1YLEA 5F09A 2ZEDA 5CPAA 4L89A 2C6CA 3KL9A 1YW6A 2D4PA 2EK9A 4EWTA 4NEXA 2AJ6A 3GYAA 1YQEA 3H8FA 4NGQA 4CAXA 4DUKA 2AFWA 4CYNA 4I49A 5HVHA 4BBHA 2BL1A 2IL4A 2GE3A 2K5TA 2JBJA 3IIBA 3BHXA 3B3CA 3PB9X 2R8VA 4OC0A 4CAEA 4PXCA 1S5KA 1ARLA 1RXTA 3C26A 2ZW4A 3R1KA 2PVVA 3WT4A 2V8HA 5EMIA 2R1IA 4YFJA 4A37A 1Q2DA 3IWEA 3IFEA 1ZG7A 2B5GB 4XPDB 4X3RA 5G22A 3NA6A 1Z5RA 3IEHA 2JEVA 2WUUA 4NXYA 4WJBA 2ZEGA 4JXQA 1IOIA 2VI7A 4QC6A 1BPMA 3G8WA 2OR4A 3KR5A 4OMEA 2I79A 4P4BA 3R9GA 2Z10A 3WC5A 2GLFA 1M44A 3TE4A 2ABZA 5LYIA 1S7NA 2QECA 2VZZA 3S6FA 3SI0A 4CGNA 4CAVA 3KGQA 1HEEA 4ZGYB 1N71A 1UFHA 3H5ZA 3PBEA 1PU9A 4IUSA 1A2ZA 4NCZA 4OC3A 1QSNA 2KCWA 3FEDA 3SJEA 3F8KA 3B3VA 3T8WA 1DTDA 2R7HA 4JLYA 2OZHA 4TWEA 1UWYA 4CGOA 3PFOA 3QAHA 1Z4EA 3FIXA 3KR4A 1TKFA 3F5BA 3R96A 3CDXA 2Q7BA 4CPAA 3B7IA 5K8MA 1YVOA 4C68A 2Q7SA 4ORFA 3BI0A 3JRUA 2AFZA 2CNMA 3SJGA 1YK3A 4BINA 2ZXVA 2PRBA 2XEIA 5F49A 1ELMP 4ZY1A 4UWIA 2P6EA 1CPSA 3FBUA 3RO0A 2CIJA 1KUYA 5G1ZA 1QSRA 1S60A 2A4NA 3WABA 3KQZA 2Z3PA 3PB6X 5JPHA 2F7VA 3EFAA 4EMEA 2PJ3A 1IICA 3SJFA 3VATA 3CXQA 4AVCA 3DNSA 4P4DA 4R7MA 4UBRA 2Q0YA 4BD9A 4LQGA 3IC1A 4FD6A 1XJOA 3JUWA 3ZZIA 1M4IA 1ZG8A 4UA3A 2B58A 2HB6A 4PPZA 3S6HA 4B5OA 2GU2A 4Y49C 2PIYA 4OIDA 3FRMA 5D29A 5JGFA 1QSMA 3IJ3A 2PIZA 2B4DB 2ZEHA 3KZWA 2Z3LA 5JM6A 1FT7A 4P44A 4A94A 4TNUA 4Z65A 4J3GA 3V7ZA 2O4HA 3RBUA 1AYEA 3SJXA 1JWQA 4BMHA 4F0YA 1BOBA 2JEWA 3IWGA 3QAYA 2Z11A 1KUXA 4IHMA 3P2FA 3I9SA 2BSWA 4R8FA 1VHSA 5F46A 3EY5A 1AUGA 2P6FA 1PYTB 3VARA 4MXUA 4FAIA 1WWZA 1YX0A 3PGPA 4PK3A 4ZY0A 5C88A 4PXEA 5ISVA 3TOBA 3CZXA 4CRZB 2G3TA 2YNDA 4FD4A 3BJ7A 4ZX8A 1GYTA 3S6KA 3FECA 3GY9A 4NJQA 4C7HA 5CNPA 4PK2A 1XMTA 3W6XA 5EC4A 4NJRA 3VH9A 5IV0A 2QMLA 4MHPA 1IU8A 2NYQA 1S7FA 4PXDA 3E0KA 4MY3A 3EO4A 4OIWA 2J8RA 3I3GA 4ZBGA 1IY7A 4EVYA 5THWA 1KWMA 1Y0RA 2H5MA 2PSWA 3EC4A 4K3NA 2FIWA 3D68A 3IU2A 4MI4A 2ZEEA 4OADA 4UEFA 3HUVA 3K9UA 3R9FA 3FX6A 2ATRA 1QQ9A 4IK2A 3RAMA 1NMTA 4CAWA 4JD6A 1BLLE 2CTBA 1MJ9A 2PJ7A 2G9DA 2CTCA 4NSQA 4UCPA 4B12A 2P6GA 2REEA 1NSAA 5EBVA 4R3KA 4U5YA 4AVBA 3BJ8A 2XEFA 4NGSA 2PJAA 4NGRA 4KSFA 2ZEFA 4B11A 3B3WA 1KUVA 3QNVA 4RI1A 1Q7LA 2YNEA 3ISZA 1IOFA 1R3NA 1TIQA 4Q38A 4P4EA 2OOTA 2DPTA 4W9YA 3B3SA 3TT2A 2J8MA 2OZGA 4KVME 4C2ZA 1TF8A 1Y7RA 4B13A 1QMUA 2BOAA 3H4QA 4ZX9A 1M4DA 4HNYB 2J8NA 2IMOA 3R95A 3BI1A 4NFRA 5J8CA 1U6MA 1Z8WA 2GREA 3IWWA 2WYRA 5KTCA 1F57A 3EXNA 2PJBA 6CPAA 1IYLA 3LODA 5JH9A 2CXAA 2ZEPA 4MFLA 4MMOA 1L0CA 2BO9A 3D2PA 3JTKA 2DF5A 4YGOA 2AFOA 2DPSA 1V0CA 4UEEA 1X10A 4MHNA 2QVPA 3NH5A 2AFSA 1QSOA 5D8NA 5AG4A 2P0WA 4M3SA 4UFVA 3S9LA 1QSTA 4B14A 3IO1A 1VIXA 4KOYA 4UF4A 2PCUA 3VWDA 2Q4YA 2VL1A 4G1PA 4GS4A 3ISXA 2PR1A 1I12A 3FEEA 4MCSA 4CYQA 2Y0MA 4NGTA 2PR8A 1P0HA 2WPXA 5HVGA 4II9A 4AXVA 2WSAA 2Z3OA 2F5IA 2V8VA 2B5GA 5BWAB 4MCPA 2R98A 3V38A 2OH1A 2PJ1A 4U9YA 4CRYB 1ZLHA 4K30A 3DSBA 1CP6A 3SI1A 3OWCA 1BPNA 1BO4A 3CPXA 1YW4A 3R9EA 1CM0A 1YVKA 2D4OA 4JXRA 2B3UA 3DR6A 2HC9A 4KOUA 2PJCA 4E0AA 5CBMA 1XOVA 4XNHC 2PJ6A 1WK4A 4ZYQA 4UIAA 1AMPA 4DYOA 3D7GA 3GLJA 1YSJA 1MJAA 2Q4VA 2QYVA 2Q44A 3D2MA 3RYOA 3CPAA 3PB8X 5JQ4A 2FIAA 3NE8A 3WC6A 4C2YA 4JZ0A 4B10A 1J4JA 2GIVA 4KUAA 1CP7A 1YLOA 4KOXA 1JQGA 4JYWA 4MBUA 4P4FA 2FCKA 4KORA 1CPXA 5IB9A 2V8DA 1FNOA 4EFDA 2XEJA 4OLLA 4ZI6A 4OAEA 3RZAA 4B6ZA 5IX3A 4U9ZA 5J1QA 2PJ8A 3PB7X 5KTAA 3D8PA 4KSAA 4LX9A 2PE3A 3CT9A 3GUXA 3PZJA 4RN7A 1ZO0A 1RO5A 1P4NA 3BLNA 2C6PA 5AG5A 2GANA 4B5PB 1I21A 4FBEA 5IB0A 1RTQA 2ZEMA 4AVAA 4NF1A 3A9LA 4KOWA 1XBUA 1Y7EA 3T9YA 2IJZA 3PBBA 3TOAA 4KOSA 5A28A 3DDDA 3B8GA 3FVLA 4A31A 1CX8A 2CY2A 2BUEA 1F2PA 3FJUA 4QB9A 2CF4A 4P10A 4MFPA 4OC5A 1OZPA 4P6YA 2GLJA 1TXRA 4HNXB 2PVWA 3PFEA 1SQHA 4KSIA 2B4DA 1Z2LA 2RC4A 3SXNA 4DNCA 3FB3A 4Y49B 4A30A 2O28A 7CPAA 2ZOGA 3K2KA 1ZG9A 4CYOA 4E2AA 3BXMA 2WZNA 2YNCA 2C6GA 4PSWA 3GIUA 4Q7AA 1YR0A 2ZENA 5AG7A 2HV2A 2FSRA 5K8PA 5K8OA 4YRHA 1CJWA 2VEZA 4KLWA 4DJLA 1ARMA 2I00A 4R6TA 1BAVA 2ZEOA 4R76A 1S3ZA 2Z3NA 3H8EA 3TO9A 4UWJA 2DEAA 2OB0A 3PEIA 3KQXA 4KZTA 1LANA 1M1DA 2FVGA 2Q4ZA 2Q43A 5F47A 4X5KA 4X8IA 4XPDC 3CXSA 4MCQA 4UEZA 3D7HA 4P45A 4F8ZA 2RB7A 1VGYA 2VBQA 1K4JA 4H6ZA 2FE7A 4PQAA 4WWVA 4XPLA 4A32A 3I1UA 1Z9UA 4KUBA 1CBXA 2HUZA 3FMCA 4FD7A 2I3CA 3ZJ0A 8CPAA 2PJ0A 4OP4A 4C7IA 3MRUA 4MHZA 1XFOA 2Z0ZA 1HDQA 3KHXA 3S9MA 1Y0YA 2REFA 4CS0B 4C2XA 2ZW6A 1IYKA 4L8AA 3D66A 1CG2A 4P4IA 1M4LA 3N5FA 3SHPA 1YGHA 2Q51A 2PQ8A 5H86A 1TKJA 2PJ9A 3TC8A 5C82A 4KOTA 3KHZA 4JJXA 3RNZA 4LUAA 1LCPA 4PXBA 5DS0A 4R57A 5AGEA 5DWNA 1HDUA 3S9NA 4ONUA 2DXQA 3L2NA 1LAPA 1NSLA 2XEGA 2CNSA 3F0AA 2JLMA 4CGMA 4P4JA 4E8OA 1LOKA 3B3TA 4R87A 1H8LA 3VWEA 5K8NA 2EK8A 3FF3A 2F8HA 2V77A 4A33A 4IAVA 4KS9A 5HXDA 4GM5A 4R3LA
chains in the Genus database with same CATH topology
4MJ8A 4A2ZA 1IIDA 3IU1A 2B4BA 3W91A 4H6UA 5KTDA 2ZW7A 2Z3KA 4PSXA 4FD5A 4CGPA 1R57A 5H84A 2OU2A 3TO6A 5FVJA 1VKCA 4QBJA 3T90A 1KZFA 3KKWA 3S6GA 5A27A 2X7BA 1Q2CA 1S7KA 2VQYA 4HNWB 2JDCA 5DWMA 5G20A 2CNTA 3TO7A 3LD2A 4KOVA 3P2HA 4UFWA 2QIRA 2ZPAA 2BEIA 2AE6A 5HH1A 2NMTA 2C27A 3MGDA 1XIXA 3FNCA 3PP9A 3QB8A 5J8FA 1NE9A 2HQYA 4UCMA 2FL4A 2YGWA 4XPKA 4PV6A 4MFJA 1ON0A 2JDDA 4CGLA 4QUSA 4A95A 2FXFA 4KLVA 4JWPA 2Z3MA 4F0XA 3TFYA 4MHDA 2YNCC 4CAFA 1B6BA 1Y9KA 4KVXA 4AG9A 3V8IA 4MFKA 2PDOA 3G3SA 2EVNA 1YREA 3GKRA 5E96A 1Q2YA 3TTHA 4KVOE 4XNHB 2VXKA 3TCVA 1XF8A 3FYNA 1S7LA 4CYPA 3SXOA 4QVTA 1FY7A 3JVNA 1Z4RA 2Q04A 3DR8A 4F6AA 1MK4A 2WPWA 4UFXA 3UY5A 4AG7A 2G0BA 3WR7A 1XE4A 1M4GA 4R9MA 4B5PA 2PC1A 4UCNA 1B87A 1Y9WA 2VZYA 5F48A 4MY0A 1I1DA 1PUAA 3W6SA 3N7ZA 1IB1E 3FXTA 4RS2A 3NE7A 4HKFA 4AB7A 5I0CA 4IF5A 1XEBA 3D3SA 2ZW5A 5AG6A 3IGRA 1MJBA 2ARHA 4H89A 2OZUA 5GCNA 2FT0A 2FS5A 2B3VA 1GHEA 4M85A 5G21A 4Q36A 3CXPA 2G3AA 4MFQA 4MFZA 5HMNA 2EUIA 1LRZA 1YLEA 4L89A 2D4PA 4NEXA 2AJ6A 3GYAA 4CAXA 4CYNA 4I49A 4BBHA 2BL1A 2IL4A 2GE3A 2K5TA 2R8VA 4CAEA 1S5KA 3C26A 1RXTA 2ZW4A 3R1KA 2R1IA 4YFJA 1Q2DA 3IWEA 4XPDB 5G22A 2B5GB 2JEVA 2WUUA 4NXYA 4JXQA 2VI7A 4QC6A 3G8WA 2I79A 3R9GA 2Z10A 1M44A 3TE4A 4CGNA 3S6FA 1S7NA 2QECA 2VZZA 4CAVA 4ZGYB 1N71A 1UFHA 3H5ZA 1PU9A 4IUSA 4NCZA 1QSNA 2KCWA 3F8KA 2R7HA 4JLYA 2OZHA 4CGOA 3QAHA 1Z4EA 3FIXA 3F5BA 3R96A 2Q7BA 1YVOA 4C68A 4ORFA 2CNMA 1YK3A 2ZXVA 2PRBA 5F49A 4UWIA 2P6EA 3FBUA 1KUYA 5G1ZA 1QSRA 1S60A 2A4NA 2Z3PA 5JPHA 3EFAA 1IICA 3CXQA 4AVCA 3DNSA 4UBRA 2Q0YA 4FD6A 3JUWA 3ZZIA 1M4IA 4UA3A 2B58A 3S6HA 4B5OA 4Y49C 3FRMA 1QSMA 2B4DB 2Z3LA 4J3GA 4BMHA 4F0YA 1BOBA 3IWGA 2Z11A 1KUXA 3P2FA 3I9SA 2BSWA 1VHSA 5F46A 3EY5A 2P6FA 1WWZA 1YX0A 3PGPA 4PK3A 5C88A 5ISVA 3TOBA 4CRZB 2G3TA 2YNDA 4FD4A 3BJ7A 3S6KA 3GY9A 4C7HA 5CNPA 4PK2A 1XMTA 3W6XA 5EC4A 5IV0A 2QMLA 1S7FA 3E0KA 4MY3A 3EO4A 2J8RA 3I3GA 4ZBGA 4EVYA 2PSWA 2H5MA 3EC4A 2FIWA 3IU2A 4MI4A 4OADA 3K9UA 3R9FA 2ATRA 1NMTA 4CAWA 4JD6A 1MJ9A 4UCPA 4B12A 4NSQA 2P6GA 2REEA 5EBVA 4R3KA 4U5YA 4AVBA 3BJ8A 4B11A 4KSFA 1KUVA 4RI1A 4Q38A 2YNEA 1TIQA 5KTCA 3TT2A 2DPTA 4C2ZA 2J8MA 2OZGA 4KVME 1Y7RA 4B13A 3H4QA 5J8CA 1M4DA 4HNYB 2J8NA 3R95A 1U6MA 3EXNA 1IYLA 3LODA 2CXAA 4MFLA 1L0CA 3D2PA 3JTKA 4YGOA 2DPSA 1V0CA 1QSOA 5AG4A 2P0WA 4M3SA 4UFVA 1QSTA 4B14A 4KOYA 3VWDA 2Q4YA 4GS4A 2PR1A 1I12A 4CYQA 2Y0MA 2PR8A 1P0HA 2WPXA 4II9A 2WSAA 2Z3OA 2F5IA 2B5GA 5BWAB 2R98A 2OH1A 4U9YA 4CRYB 4K30A 3DSBA 3OWCA 1BO4A 3R9EA 1CM0A 1YVKA 2D4OA 4JXRA 2B3UA 3DR6A 4KOUA 4E0AA 4XNHC 1WK4A 1MJAA 2Q4VA 2Q44A 3D2MA 3RYOA 5JQ4A 2FIAA 4C2YA 4B10A 1J4JA 2GIVA 4KUAA 4KOXA 4MBUA 2FCKA 4KORA 4OLLA 4OAEA 5IX3A 4U9ZA 5KTAA 3D8PA 4KSAA 4LX9A 3PZJA 1ZO0A 1RO5A 1P4NA 3BLNA 5AG5A 2GANA 4B5PB 1I21A 5IB0A 4AVAA 4NF1A 3A9LA 4KOWA 3T9YA 3TOAA 4KOSA 5A28A 3DDDA 3B8GA 4A31A 2CY2A 2BUEA 4QB9A 4MFPA 1OZPA 4HNXB 1SQHA 3SXNA 2B4DA 2RC4A 4DNCA 3FB3A 4Y49B 4A30A 2O28A 4CYOA 4E2AA 4PSWA 2YNCA 5AG7A 1YR0A 2HV2A 2FSRA 4YRHA 1CJWA 2VEZA 4KLWA 2I00A 1S3ZA 2Z3NA 3TO9A 4UWJA 2OB0A 4KZTA 1M1DA 5F47A 4X5KA 4XPDC 3CXSA 2VBQA 1K4JA 4H6ZA 2FE7A 4XPLA 4A32A 1Z9UA 4KUBA 2HUZA 4FD7A 3ZJ0A 4C7IA 2Z0ZA 2REFA 4CS0B 4C2XA 2ZW6A 1IYKA 4L8AA 3SHPA 1YGHA 2PQ8A 5H86A 5C82A 4KOTA 4JJXA 4LUAA 4R57A 5AGEA 5DWNA 4ONUA 2DXQA 1NSLA 3F0AA 2CNSA 2JLMA 4CGMA 4E8OA 3VWEA 4R87A 4A33A 4KS9A 4R3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJ8 A;  1IID A;  2B4B A;  3W91 A;  4H6U A;  5KTD A;  2ZW7 A;  4PSX A;  4FD5 A;  1R57 A;  5H84 A;  2OU2 A;  3TO6 A;  5FVJ A;  1VKC A;  4QBJ A;  3T90 A;  1KZF A;  3KKW A;  3S6G A;  2X7B A;  1Q2C A;  1S7K A;  2VQY A;  4HNW B;  2JDC A;  5DWM A;  2CNT A;  3TO7 A;  3LD2 A;  4KOV A;  3P2H A;  2QIR A;  2ZPA A;  2BEI A;  2AE6 A;  5HH1 A;  2NMT A;  2C27 A;  3MGD A;  1XIX A;  3FNC A;  3PP9 A;  3QB8 A;  5J8F A;  1NE9 A;  2HQY A;  2FL4 A;  4XPK A;  4PV6 A;  1ON0 A;  2JDD A;  4QUS A;  2FXF A;  4KLV A;  4JWP A;  3TFY A;  4MHD A;  1B6B A;  1Y9K A;  4KVX A;  4AG9 A;  3V8I A;  2PDO A;  3G3S A;  2EVN A;  1YRE A;  3GKR A;  5E96 A;  1Q2Y A;  3TTH A;  4KVO E;  4XNH B;  2VXK A;  3TCV A;  1XF8 A;  3FYN A;  1S7L A;  3SXO A;  4QVT A;  1FY7 A;  3JVN A;  1Z4R A;  2Q04 A;  3DR8 A;  4F6A A;  1MK4 A;  2WPW A;  3UY5 A;  4AG7 A;  2G0B A;  3WR7 A;  1XE4 A;  1M4G A;  4R9M A;  4B5P A;  2PC1 A;  1B87 A;  1Y9W A;  2VZY A;  5F48 A;  4MY0 A;  1I1D A;  1PUA A;  3W6S A;  3N7Z A;  1IB1 E;  3FXT A;  4RS2 A;  3NE7 A;  4HKF A;  4AB7 A;  5I0C A;  4IF5 A;  1XEB A;  3D3S A;  2ZW5 A;  3IGR A;  1MJB A;  2ARH A;  4H89 A;  2OZU A;  5GCN A;  2FT0 A;  2FS5 A;  2B3V A;  1GHE A;  4M85 A;  3CXP A;  2G3A A;  5HMN A;  2EUI A;  1LRZ A;  1YLE A;  4L89 A;  2D4P A;  4NEX A;  2AJ6 A;  3GYA A;  4CAX A;  4I49 A;  2BL1 A;  2IL4 A;  2GE3 A;  2K5T A;  2R8V A;  1S5K A;  3C26 A;  1RXT A;  2ZW4 A;  3R1K A;  2R1I A;  4YFJ A;  1Q2D A;  4XPD B;  2B5G B;  2JEV A;  4NXY A;  4JXQ A;  2VI7 A;  4QC6 A;  3G8W A;  2I79 A;  3R9G A;  2Z10 A;  1M44 A;  3TE4 A;  3S6F A;  1S7N A;  2QEC A;  2VZZ A;  4CAV A;  1N71 A;  1UFH A;  1PU9 A;  4IUS A;  4NCZ A;  1QSN A;  2KCW A;  3F8K A;  2R7H A;  4JLY A;  2OZH A;  3QAH A;  1Z4E A;  3FIX A;  3F5B A;  3R96 A;  2Q7B A;  1YVO A;  4ORF A;  2CNM A;  1YK3 A;  2ZXV A;  2PRB A;  5F49 A;  4UWI A;  2P6E A;  3FBU A;  1KUY A;  1QSR A;  1S60 A;  2A4N A;  5JPH A;  3EFA A;  1IIC A;  3CXQ A;  4AVC A;  3DNS A;  4UBR A;  2Q0Y A;  4FD6 A;  3JUW A;  3ZZI A;  1M4I A;  4UA3 A;  2B58 A;  3S6H A;  4B5O A;  4Y49 C;  3FRM A;  1QSM A;  2B4D B;  4J3G A;  4BMH A;  4F0Y A;  1BOB A;  3IWG A;  2Z11 A;  1KUX A;  3P2F A;  3I9S A;  2BSW A;  1VHS A;  5F46 A;  3EY5 A;  2P6F A;  1WWZ A;  1YX0 A;  3PGP A;  4PK3 A;  5C88 A;  5ISV A;  3TOB A;  4CRZ B;  2G3T A;  4FD4 A;  3BJ7 A;  3S6K A;  3GY9 A;  5CNP A;  4PK2 A;  1XMT A;  3W6X A;  5EC4 A;  5IV0 A;  2QML A;  1S7F A;  3E0K A;  4MY3 A;  3EO4 A;  2J8R A;  3I3G A;  4ZBG A;  4EVY A;  2PSW A;  2H5M A;  3EC4 A;  2FIW A;  4OAD A;  4MI4 A;  3K9U A;  3R9F A;  2ATR A;  1NMT A;  4CAW A;  4JD6 A;  1MJ9 A;  4NSQ A;  2P6G A;  2REE A;  5EBV A;  4R3K A;  4U5Y A;  4AVB A;  3BJ8 A;  1KUV A;  4RI1 A;  1TIQ A;  5KTC A;  3TT2 A;  2J8M A;  2OZG A;  4KVM E;  1Y7R A;  3H4Q A;  5J8C A;  1M4D A;  4HNY B;  2J8N A;  3R95 A;  1U6M A;  3EXN A;  1IYL A;  3LOD A;  1L0C A;  3D2P A;  4YGO A;  1V0C A;  1QSO A;  2P0W A;  4M3S A;  1QST A;  4KOY A;  3VWD A;  2Q4Y A;  4GS4 A;  2PR1 A;  1I12 A;  2Y0M A;  2PR8 A;  1P0H A;  2WPX A;  4II9 A;  2F5I A;  2B5G A;  2R98 A;  2OH1 A;  4U9Y A;  4CRY B;  4K30 A;  3DSB A;  3OWC A;  1BO4 A;  3R9E A;  1CM0 A;  1YVK A;  2D4O A;  4JXR A;  2B3U A;  3DR6 A;  4KOU A;  4E0A A;  4XNH C;  1WK4 A;  1MJA A;  2Q4V A;  2Q44 A;  3D2M A;  3RYO A;  5JQ4 A;  2FIA A;  1J4J A;  2GIV A;  4KUA A;  4KOX A;  4MBU A;  2FCK A;  4KOR A;  4OLL A;  4OAE A;  5IX3 A;  4U9Z A;  5KTA A;  3D8P A;  4LX9 A;  3PZJ A;  1RO5 A;  1P4N A;  3BLN A;  2GAN A;  4B5P B;  1I21 A;  5IB0 A;  4AVA A;  4NF1 A;  4KOW A;  3T9Y A;  3TOA A;  4KOS A;  3DDD A;  3B8G A;  2CY2 A;  2BUE A;  4QB9 A;  1OZP A;  4HNX B;  1SQH A;  3SXN A;  2B4D A;  2RC4 A;  4DNC A;  3FB3 A;  4Y49 B;  2O28 A;  4E2A A;  4PSW A;  1YR0 A;  2HV2 A;  2FSR A;  4YRH A;  1CJW A;  2VEZ A;  4KLW A;  2I00 A;  1S3Z A;  3TO9 A;  4UWJ A;  2OB0 A;  4KZT A;  1M1D A;  5F47 A;  4X5K A;  4XPD C;  3CXS A;  2VBQ A;  1K4J A;  4H6Z A;  2FE7 A;  4XPL A;  1Z9U A;  4KUB A;  2HUZ A;  4FD7 A;  3ZJ0 A;  2Z0Z A;  2REF A;  4CS0 B;  2ZW6 A;  1IYK A;  4L8A A;  3SHP A;  1YGH A;  2PQ8 A;  5H86 A;  5C82 A;  4KOT A;  4JJX A;  4LUA A;  4R57 A;  5DWN A;  4ONU A;  2DXQ A;  1NSL A;  3F0A A;  2CNS A;  2JLM A;  4E8O A;  3VWE A;  4R87 A;  4R3L A; 
#chains in the Genus database with same CATH topology
 3D4U A;  3B35 A;  2EWB A;  4MJ8 A;  4A2Z A;  4YWY A;  1IID A;  3IU1 A;  2AFX A;  2B4B A;  4A39 A;  1OBR A;  3W91 A;  4H6U A;  5KTD A;  2ZW7 A;  2Z3K A;  5ELY A;  4PSX A;  5LRK A;  4FD5 A;  4CGP A;  1R57 A;  5H84 A;  2OU2 A;  1ELL P;  3TO6 A;  5FVJ A;  1VKC A;  4QBJ A;  3T90 A;  1KZF A;  3KKW A;  1YME A;  3S6G A;  3SI2 A;  2X7B A;  1Q2C A;  4RUH A;  5A27 A;  4M6H A;  2AFM A;  5LYF A;  3GB0 A;  3PRT A;  1VHE A;  1S7K A;  4MCR A;  2VQY A;  1EE3 P;  2JDC A;  2QJ8 A;  4HNW B;  5DWM A;  5G20 A;  2CNT A;  3TO7 A;  2V8G A;  1Z8X A;  3LD2 A;  4KOV A;  3P2H A;  4UFW A;  2QIR A;  4MRI A;  4OC4 A;  2ZPA A;  2BEI A;  2AE6 A;  5HH1 A;  2NMT A;  2C27 A;  3MGD A;  3MN8 A;  2C1C A;  1XIX A;  3FNC A;  3PP9 A;  1R43 A;  3QB8 A;  5LRG A;  5I4M A;  5J8F A;  3LAC A;  1ZLI A;  1NE9 A;  1Z8T A;  2ANP A;  2HQY A;  2PJ2 A;  3KI9 A;  2FL4 A;  2YGW A;  4FUU A;  4MHY A;  4UCM A;  4PV6 A;  4XPK A;  4MFJ A;  3NH8 A;  1ON0 A;  2JDD A;  4A38 A;  4CGL A;  4UIB A;  4QUS A;  4A95 A;  2PJ5 A;  2FXF A;  2POK A;  4KLV A;  4JWP A;  2Z3M A;  4F0X A;  3TFY A;  4MHD A;  1F2O A;  2YNC C;  1VHO A;  4CAF A;  1B6B A;  5LYD A;  1Y9K A;  4KVX A;  4AG9 A;  2BCO A;  2IQ6 A;  3V8I A;  4NGM A;  4MFK A;  2PDO A;  3G3S A;  3H8G A;  1LAM A;  1Z8L A;  2EVN A;  2PRQ A;  1IGB A;  1LFW A;  4F9V A;  3DLJ A;  1YRE A;  3FH4 A;  3GKR A;  5E96 A;  1Q2Y A;  2PJ4 A;  2RFH A;  3TTH A;  3NH4 A;  4KVO E;  3LMS A;  4FWU A;  4LQ6 A;  2VXK A;  4ONW A;  1XF8 A;  4OC2 A;  2JBK A;  4XNH B;  3TCV A;  3TX8 A;  3FYN A;  1S7L A;  4CYP A;  3SXO A;  2ZEL A;  1PCA A;  4QVT A;  1FY7 A;  4YU9 A;  3JVN A;  1Z4R A;  2Q04 A;  1XRY A;  5LYL A;  3DGV A;  3DR8 A;  3PB4 X;  4NGP A;  4OKO A;  4NGN A;  4HPS A;  4O23 A;  4F6A A;  3HLP A;  1MK4 A;  2WPW A;  4UFX A;  3UY5 A;  4AG7 A;  2G0B A;  3WR7 A;  1XE4 A;  1M4G A;  1TKH A;  4R9M A;  3D67 A;  2PC1 A;  4B5P A;  4UCN A;  1TF9 A;  1B87 A;  1Y9W A;  2VZY A;  5F48 A;  4MY0 A;  2GFQ A;  5HVF A;  3KAS A;  1I1D A;  1PUA A;  3W6S A;  3N7Z A;  1IB1 E;  3FXT A;  4RS2 A;  2J9A A;  3NE7 A;  1DE4 C;  5LRJ A;  2AFU A;  4HKF A;  2ZOF A;  3K9T A;  4AB7 A;  1X12 A;  4M6I A;  2O53 A;  4X2T A;  5I0C A;  3D7D A;  2EBJ A;  4IF5 A;  1XEB A;  3B2Y A;  3D3S A;  4F9U A;  3LWU A;  2ZW5 A;  5AG6 A;  3IGR A;  3WC7 A;  1MJB A;  2NSM A;  2ARH A;  3D7F A;  4H89 A;  4H2K A;  4ZY2 A;  2OZU A;  5GCN A;  2FT0 A;  2FS5 A;  2B3V A;  1XMB A;  1GHE A;  4M85 A;  4GXH A;  5G21 A;  4Q36 A;  4OC1 A;  3CXP A;  2G3A A;  4M6G A;  4MFQ A;  2EO8 A;  4MFZ A;  2ODF A;  5HMN A;  2EUI A;  3NFZ A;  1LRZ A;  1YLE A;  5F09 A;  2ZED A;  5CPA A;  4L89 A;  2C6C A;  3KL9 A;  1YW6 A;  2D4P A;  2EK9 A;  4EWT A;  4NEX A;  2AJ6 A;  3GYA A;  1YQE A;  3H8F A;  4NGQ A;  4CAX A;  4DUK A;  2AFW A;  4CYN A;  4I49 A;  5HVH A;  4BBH A;  2BL1 A;  2IL4 A;  2GE3 A;  2K5T A;  2JBJ A;  3IIB A;  3BHX A;  3B3C A;  3PB9 X;  2R8V A;  4OC0 A;  4CAE A;  4PXC A;  1S5K A;  1ARL A;  1RXT A;  3C26 A;  2ZW4 A;  3R1K A;  2PVV A;  3WT4 A;  2V8H A;  5EMI A;  2R1I A;  4YFJ A;  4A37 A;  1Q2D A;  3IWE A;  3IFE A;  1ZG7 A;  2B5G B;  4XPD B;  4X3R A;  5G22 A;  3NA6 A;  1Z5R A;  3IEH A;  2JEV A;  2WUU A;  4NXY A;  4WJB A;  2ZEG A;  4JXQ A;  1IOI A;  2VI7 A;  4QC6 A;  1BPM A;  3G8W A;  2OR4 A;  3KR5 A;  4OME A;  2I79 A;  4P4B A;  3R9G A;  2Z10 A;  3WC5 A;  2GLF A;  1M44 A;  3TE4 A;  2ABZ A;  5LYI A;  1S7N A;  2QEC A;  2VZZ A;  3S6F A;  3SI0 A;  4CGN A;  4CAV A;  3KGQ A;  1HEE A;  4ZGY B;  1N71 A;  1UFH A;  3H5Z A;  3PBE A;  1PU9 A;  4IUS A;  1A2Z A;  4NCZ A;  4OC3 A;  1QSN A;  2KCW A;  3FED A;  3SJE A;  3F8K A;  3B3V A;  3T8W A;  1DTD A;  2R7H A;  4JLY A;  2OZH A;  4TWE A;  1UWY A;  4CGO A;  3PFO A;  3QAH A;  1Z4E A;  3FIX A;  3KR4 A;  1TKF A;  3F5B A;  3R96 A;  3CDX A;  2Q7B A;  4CPA A;  3B7I A;  5K8M A;  1YVO A;  4C68 A;  2Q7S A;  4ORF A;  3BI0 A;  3JRU A;  2AFZ A;  2CNM A;  3SJG A;  1YK3 A;  4BIN A;  2ZXV A;  2PRB A;  2XEI A;  5F49 A;  1ELM P;  4ZY1 A;  4UWI A;  2P6E A;  1CPS A;  3FBU A;  3RO0 A;  2CIJ A;  1KUY A;  5G1Z A;  1QSR A;  1S60 A;  2A4N A;  3WAB A;  3KQZ A;  2Z3P A;  3PB6 X;  5JPH A;  2F7V A;  3EFA A;  4EME A;  2PJ3 A;  1IIC A;  3SJF A;  3VAT A;  3CXQ A;  4AVC A;  3DNS A;  4P4D A;  4R7M A;  4UBR A;  2Q0Y A;  4BD9 A;  4LQG A;  3IC1 A;  4FD6 A;  1XJO A;  3JUW A;  3ZZI A;  1M4I A;  1ZG8 A;  4UA3 A;  2B58 A;  2HB6 A;  4PPZ A;  3S6H A;  4B5O A;  2GU2 A;  4Y49 C;  2PIY A;  4OID A;  3FRM A;  5D29 A;  5JGF A;  1QSM A;  3IJ3 A;  2PIZ A;  2B4D B;  2ZEH A;  3KZW A;  2Z3L A;  5JM6 A;  1FT7 A;  4P44 A;  4A94 A;  4TNU A;  4Z65 A;  4J3G A;  3V7Z A;  2O4H A;  3RBU A;  1AYE A;  3SJX A;  1JWQ A;  4BMH A;  4F0Y A;  1BOB A;  2JEW A;  3IWG A;  3QAY A;  2Z11 A;  1KUX A;  4IHM A;  3P2F A;  3I9S A;  2BSW A;  4R8F A;  1VHS A;  5F46 A;  3EY5 A;  1AUG A;  2P6F A;  1PYT B;  3VAR A;  4MXU A;  4FAI A;  1WWZ A;  1YX0 A;  3PGP A;  4PK3 A;  4ZY0 A;  5C88 A;  4PXE A;  5ISV A;  3TOB A;  3CZX A;  4CRZ B;  2G3T A;  2YND A;  4FD4 A;  3BJ7 A;  4ZX8 A;  1GYT A;  3S6K A;  3FEC A;  3GY9 A;  4NJQ A;  4C7H A;  5CNP A;  4PK2 A;  1XMT A;  3W6X A;  5EC4 A;  4NJR A;  3VH9 A;  5IV0 A;  2QML A;  4MHP A;  1IU8 A;  2NYQ A;  1S7F A;  4PXD A;  3E0K A;  4MY3 A;  3EO4 A;  4OIW A;  2J8R A;  3I3G A;  4ZBG A;  1IY7 A;  4EVY A;  5THW A;  1KWM A;  1Y0R A;  2H5M A;  2PSW A;  3EC4 A;  4K3N A;  2FIW A;  3D68 A;  3IU2 A;  4MI4 A;  2ZEE A;  4OAD A;  4UEF A;  3HUV A;  3K9U A;  3R9F A;  3FX6 A;  2ATR A;  1QQ9 A;  4IK2 A;  3RAM A;  1NMT A;  4CAW A;  4JD6 A;  1BLL E;  2CTB A;  1MJ9 A;  2PJ7 A;  2G9D A;  2CTC A;  4NSQ A;  4UCP A;  4B12 A;  2P6G A;  2REE A;  1NSA A;  5EBV A;  4R3K A;  4U5Y A;  4AVB A;  3BJ8 A;  2XEF A;  4NGS A;  2PJA A;  4NGR A;  4KSF A;  2ZEF A;  4B11 A;  3B3W A;  1KUV A;  3QNV A;  4RI1 A;  1Q7L A;  2YNE A;  3ISZ A;  1IOF A;  1R3N A;  1TIQ A;  4Q38 A;  4P4E A;  2OOT A;  2DPT A;  4W9Y A;  3B3S A;  3TT2 A;  2J8M A;  2OZG A;  4KVM E;  4C2Z A;  1TF8 A;  1Y7R A;  4B13 A;  1QMU A;  2BOA A;  3H4Q A;  4ZX9 A;  1M4D A;  4HNY B;  2J8N A;  2IMO A;  3R95 A;  3BI1 A;  4NFR A;  5J8C A;  1U6M A;  1Z8W A;  2GRE A;  3IWW A;  2WYR A;  5KTC A;  1F57 A;  3EXN A;  2PJB A;  6CPA A;  1IYL A;  3LOD A;  5JH9 A;  2CXA A;  2ZEP A;  4MFL A;  4MMO A;  1L0C A;  2BO9 A;  3D2P A;  3JTK A;  2DF5 A;  4YGO A;  2AFO A;  2DPS A;  1V0C A;  4UEE A;  1X10 A;  4MHN A;  2QVP A;  3NH5 A;  2AFS A;  1QSO A;  5D8N A;  5AG4 A;  2P0W A;  4M3S A;  4UFV A;  3S9L A;  1QST A;  4B14 A;  3IO1 A;  1VIX A;  4KOY A;  4UF4 A;  2PCU A;  3VWD A;  2Q4Y A;  2VL1 A;  4G1P A;  4GS4 A;  3ISX A;  2PR1 A;  1I12 A;  3FEE A;  4MCS A;  4CYQ A;  2Y0M A;  4NGT A;  2PR8 A;  1P0H A;  2WPX A;  5HVG A;  4II9 A;  4AXV A;  2WSA A;  2Z3O A;  2F5I A;  2V8V A;  2B5G A;  5BWA B;  4MCP A;  2R98 A;  3V38 A;  2OH1 A;  2PJ1 A;  4U9Y A;  4CRY B;  1ZLH A;  4K30 A;  3DSB A;  1CP6 A;  3SI1 A;  3OWC A;  1BPN A;  1BO4 A;  3CPX A;  1YW4 A;  3R9E A;  1CM0 A;  1YVK A;  2D4O A;  4JXR A;  2B3U A;  3DR6 A;  2HC9 A;  4KOU A;  2PJC A;  4E0A A;  5CBM A;  1XOV A;  4XNH C;  2PJ6 A;  1WK4 A;  4ZYQ A;  4UIA A;  1AMP A;  4DYO A;  3D7G A;  3GLJ A;  1YSJ A;  1MJA A;  2Q4V A;  2QYV A;  2Q44 A;  3D2M A;  3RYO A;  3CPA A;  3PB8 X;  5JQ4 A;  2FIA A;  3NE8 A;  3WC6 A;  4C2Y A;  4JZ0 A;  4B10 A;  1J4J A;  2GIV A;  4KUA A;  1CP7 A;  1YLO A;  4KOX A;  1JQG A;  4JYW A;  4MBU A;  4P4F A;  2FCK A;  4KOR A;  1CPX A;  5IB9 A;  2V8D A;  1FNO A;  4EFD A;  2XEJ A;  4OLL A;  4ZI6 A;  4OAE A;  3RZA A;  4B6Z A;  5IX3 A;  4U9Z A;  5J1Q A;  2PJ8 A;  3PB7 X;  5KTA A;  3D8P A;  4KSA A;  4LX9 A;  2PE3 A;  3CT9 A;  3GUX A;  3PZJ A;  4RN7 A;  1ZO0 A;  1RO5 A;  1P4N A;  3BLN A;  2C6P A;  5AG5 A;  2GAN A;  4B5P B;  1I21 A;  4FBE A;  5IB0 A;  1RTQ A;  2ZEM A;  4AVA A;  4NF1 A;  3A9L A;  4KOW A;  1XBU A;  1Y7E A;  3T9Y A;  2IJZ A;  3PBB A;  3TOA A;  4KOS A;  5A28 A;  3DDD A;  3B8G A;  3FVL A;  4A31 A;  1CX8 A;  2CY2 A;  2BUE A;  1F2P A;  3FJU A;  4QB9 A;  2CF4 A;  4P10 A;  4MFP A;  4OC5 A;  1OZP A;  4P6Y A;  2GLJ A;  1TXR A;  4HNX B;  2PVW A;  3PFE A;  1SQH A;  4KSI A;  2B4D A;  1Z2L A;  2RC4 A;  3SXN A;  4DNC A;  3FB3 A;  4Y49 B;  4A30 A;  2O28 A;  7CPA A;  2ZOG A;  3K2K A;  1ZG9 A;  4CYO A;  4E2A A;  3BXM A;  2WZN A;  2YNC A;  2C6G A;  4PSW A;  3GIU A;  4Q7A A;  1YR0 A;  2ZEN A;  5AG7 A;  2HV2 A;  2FSR A;  5K8P A;  5K8O A;  4YRH A;  1CJW A;  2VEZ A;  4KLW A;  4DJL A;  1ARM A;  2I00 A;  4R6T A;  1BAV A;  2ZEO A;  4R76 A;  1S3Z A;  2Z3N A;  3H8E A;  3TO9 A;  4UWJ A;  2DEA A;  2OB0 A;  3PEI A;  3KQX A;  4KZT A;  1LAN A;  1M1D A;  2FVG A;  2Q4Z A;  2Q43 A;  5F47 A;  4X5K A;  4X8I A;  4XPD C;  3CXS A;  4MCQ A;  4UEZ A;  3D7H A;  4P45 A;  4F8Z A;  2RB7 A;  1VGY A;  2VBQ A;  1K4J A;  4H6Z A;  2FE7 A;  4PQA A;  4WWV A;  4XPL A;  4A32 A;  3I1U A;  1Z9U A;  4KUB A;  1CBX A;  2HUZ A;  3FMC A;  4FD7 A;  2I3C A;  3ZJ0 A;  8CPA A;  2PJ0 A;  4OP4 A;  4C7I A;  3MRU A;  4MHZ A;  1XFO A;  2Z0Z A;  1HDQ A;  3KHX A;  3S9M A;  1Y0Y A;  2REF A;  4CS0 B;  4C2X A;  2ZW6 A;  1IYK A;  4L8A A;  3D66 A;  1CG2 A;  4P4I A;  1M4L A;  3N5F A;  3SHP A;  1YGH A;  2Q51 A;  2PQ8 A;  5H86 A;  1TKJ A;  2PJ9 A;  3TC8 A;  5C82 A;  4KOT A;  3KHZ A;  4JJX A;  3RNZ A;  4LUA A;  1LCP A;  4PXB A;  5DS0 A;  4R57 A;  5AGE A;  5DWN A;  1HDU A;  3S9N A;  4ONU A;  2DXQ A;  3L2N A;  1LAP A;  1NSL A;  2XEG A;  2CNS A;  3F0A A;  2JLM A;  4CGM A;  4P4J A;  4E8O A;  1LOK A;  3B3T A;  4R87 A;  1H8L A;  3VWE A;  5K8N A;  2EK8 A;  3FF3 A;  2F8H A;  2V77 A;  4A33 A;  4IAV A;  4KS9 A;  5HXD A;  4GM5 A;  4R3L A; 
#chains in the Genus database with same CATH homology
 4MJ8 A;  4A2Z A;  1IID A;  3IU1 A;  2B4B A;  3W91 A;  4H6U A;  5KTD A;  2ZW7 A;  2Z3K A;  4PSX A;  4FD5 A;  4CGP A;  1R57 A;  5H84 A;  2OU2 A;  3TO6 A;  5FVJ A;  1VKC A;  4QBJ A;  3T90 A;  1KZF A;  3KKW A;  3S6G A;  5A27 A;  2X7B A;  1Q2C A;  1S7K A;  2VQY A;  4HNW B;  2JDC A;  5DWM A;  5G20 A;  2CNT A;  3TO7 A;  3LD2 A;  4KOV A;  3P2H A;  4UFW A;  2QIR A;  2ZPA A;  2BEI A;  2AE6 A;  5HH1 A;  2NMT A;  2C27 A;  3MGD A;  1XIX A;  3FNC A;  3PP9 A;  3QB8 A;  5J8F A;  1NE9 A;  2HQY A;  4UCM A;  2FL4 A;  2YGW A;  4XPK A;  4PV6 A;  4MFJ A;  1ON0 A;  2JDD A;  4CGL A;  4QUS A;  4A95 A;  2FXF A;  4KLV A;  4JWP A;  2Z3M A;  4F0X A;  3TFY A;  4MHD A;  2YNC C;  4CAF A;  1B6B A;  1Y9K A;  4KVX A;  4AG9 A;  3V8I A;  4MFK A;  2PDO A;  3G3S A;  2EVN A;  1YRE A;  3GKR A;  5E96 A;  1Q2Y A;  3TTH A;  4KVO E;  4XNH B;  2VXK A;  3TCV A;  1XF8 A;  3FYN A;  1S7L A;  4CYP A;  3SXO A;  4QVT A;  1FY7 A;  3JVN A;  1Z4R A;  2Q04 A;  3DR8 A;  4F6A A;  1MK4 A;  2WPW A;  4UFX A;  3UY5 A;  4AG7 A;  2G0B A;  3WR7 A;  1XE4 A;  1M4G A;  4R9M A;  4B5P A;  2PC1 A;  4UCN A;  1B87 A;  1Y9W A;  2VZY A;  5F48 A;  4MY0 A;  1I1D A;  1PUA A;  3W6S A;  3N7Z A;  1IB1 E;  3FXT A;  4RS2 A;  3NE7 A;  4HKF A;  4AB7 A;  5I0C A;  4IF5 A;  1XEB A;  3D3S A;  2ZW5 A;  5AG6 A;  3IGR A;  1MJB A;  2ARH A;  4H89 A;  2OZU A;  5GCN A;  2FT0 A;  2FS5 A;  2B3V A;  1GHE A;  4M85 A;  5G21 A;  4Q36 A;  3CXP A;  2G3A A;  4MFQ A;  4MFZ A;  5HMN A;  2EUI A;  1LRZ A;  1YLE A;  4L89 A;  2D4P A;  4NEX A;  2AJ6 A;  3GYA A;  4CAX A;  4CYN A;  4I49 A;  4BBH A;  2BL1 A;  2IL4 A;  2GE3 A;  2K5T A;  2R8V A;  4CAE A;  1S5K A;  3C26 A;  1RXT A;  2ZW4 A;  3R1K A;  2R1I A;  4YFJ A;  1Q2D A;  3IWE A;  4XPD B;  5G22 A;  2B5G B;  2JEV A;  2WUU A;  4NXY A;  4JXQ A;  2VI7 A;  4QC6 A;  3G8W A;  2I79 A;  3R9G A;  2Z10 A;  1M44 A;  3TE4 A;  4CGN A;  3S6F A;  1S7N A;  2QEC A;  2VZZ A;  4CAV A;  4ZGY B;  1N71 A;  1UFH A;  3H5Z A;  1PU9 A;  4IUS A;  4NCZ A;  1QSN A;  2KCW A;  3F8K A;  2R7H A;  4JLY A;  2OZH A;  4CGO A;  3QAH A;  1Z4E A;  3FIX A;  3F5B A;  3R96 A;  2Q7B A;  1YVO A;  4C68 A;  4ORF A;  2CNM A;  1YK3 A;  2ZXV A;  2PRB A;  5F49 A;  4UWI A;  2P6E A;  3FBU A;  1KUY A;  5G1Z A;  1QSR A;  1S60 A;  2A4N A;  2Z3P A;  5JPH A;  3EFA A;  1IIC A;  3CXQ A;  4AVC A;  3DNS A;  4UBR A;  2Q0Y A;  4FD6 A;  3JUW A;  3ZZI A;  1M4I A;  4UA3 A;  2B58 A;  3S6H A;  4B5O A;  4Y49 C;  3FRM A;  1QSM A;  2B4D B;  2Z3L A;  4J3G A;  4BMH A;  4F0Y A;  1BOB A;  3IWG A;  2Z11 A;  1KUX A;  3P2F A;  3I9S A;  2BSW A;  1VHS A;  5F46 A;  3EY5 A;  2P6F A;  1WWZ A;  1YX0 A;  3PGP A;  4PK3 A;  5C88 A;  5ISV A;  3TOB A;  4CRZ B;  2G3T A;  2YND A;  4FD4 A;  3BJ7 A;  3S6K A;  3GY9 A;  4C7H A;  5CNP A;  4PK2 A;  1XMT A;  3W6X A;  5EC4 A;  5IV0 A;  2QML A;  1S7F A;  3E0K A;  4MY3 A;  3EO4 A;  2J8R A;  3I3G A;  4ZBG A;  4EVY A;  2PSW A;  2H5M A;  3EC4 A;  2FIW A;  3IU2 A;  4MI4 A;  4OAD A;  3K9U A;  3R9F A;  2ATR A;  1NMT A;  4CAW A;  4JD6 A;  1MJ9 A;  4UCP A;  4B12 A;  4NSQ A;  2P6G A;  2REE A;  5EBV A;  4R3K A;  4U5Y A;  4AVB A;  3BJ8 A;  4B11 A;  4KSF A;  1KUV A;  4RI1 A;  4Q38 A;  2YNE A;  1TIQ A;  5KTC A;  3TT2 A;  2DPT A;  4C2Z A;  2J8M A;  2OZG A;  4KVM E;  1Y7R A;  4B13 A;  3H4Q A;  5J8C A;  1M4D A;  4HNY B;  2J8N A;  3R95 A;  1U6M A;  3EXN A;  1IYL A;  3LOD A;  2CXA A;  4MFL A;  1L0C A;  3D2P A;  3JTK A;  4YGO A;  2DPS A;  1V0C A;  1QSO A;  5AG4 A;  2P0W A;  4M3S A;  4UFV A;  1QST A;  4B14 A;  4KOY A;  3VWD A;  2Q4Y A;  4GS4 A;  2PR1 A;  1I12 A;  4CYQ A;  2Y0M A;  2PR8 A;  1P0H A;  2WPX A;  4II9 A;  2WSA A;  2Z3O A;  2F5I A;  2B5G A;  5BWA B;  2R98 A;  2OH1 A;  4U9Y A;  4CRY B;  4K30 A;  3DSB A;  3OWC A;  1BO4 A;  3R9E A;  1CM0 A;  1YVK A;  2D4O A;  4JXR A;  2B3U A;  3DR6 A;  4KOU A;  4E0A A;  4XNH C;  1WK4 A;  1MJA A;  2Q4V A;  2Q44 A;  3D2M A;  3RYO A;  5JQ4 A;  2FIA A;  4C2Y A;  4B10 A;  1J4J A;  2GIV A;  4KUA A;  4KOX A;  4MBU A;  2FCK A;  4KOR A;  4OLL A;  4OAE A;  5IX3 A;  4U9Z A;  5KTA A;  3D8P A;  4KSA A;  4LX9 A;  3PZJ A;  1ZO0 A;  1RO5 A;  1P4N A;  3BLN A;  5AG5 A;  2GAN A;  4B5P B;  1I21 A;  5IB0 A;  4AVA A;  4NF1 A;  3A9L A;  4KOW A;  3T9Y A;  3TOA A;  4KOS A;  5A28 A;  3DDD A;  3B8G A;  4A31 A;  2CY2 A;  2BUE A;  4QB9 A;  4MFP A;  1OZP A;  4HNX B;  1SQH A;  3SXN A;  2B4D A;  2RC4 A;  4DNC A;  3FB3 A;  4Y49 B;  4A30 A;  2O28 A;  4CYO A;  4E2A A;  4PSW A;  2YNC A;  5AG7 A;  1YR0 A;  2HV2 A;  2FSR A;  4YRH A;  1CJW A;  2VEZ A;  4KLW A;  2I00 A;  1S3Z A;  2Z3N A;  3TO9 A;  4UWJ A;  2OB0 A;  4KZT A;  1M1D A;  5F47 A;  4X5K A;  4XPD C;  3CXS A;  2VBQ A;  1K4J A;  4H6Z A;  2FE7 A;  4XPL A;  4A32 A;  1Z9U A;  4KUB A;  2HUZ A;  4FD7 A;  3ZJ0 A;  4C7I A;  2Z0Z A;  2REF A;  4CS0 B;  4C2X A;  2ZW6 A;  1IYK A;  4L8A A;  3SHP A;  1YGH A;  2PQ8 A;  5H86 A;  5C82 A;  4KOT A;  4JJX A;  4LUA A;  4R57 A;  5AGE A;  5DWN A;  4ONU A;  2DXQ A;  1NSL A;  3F0A A;  2CNS A;  2JLM A;  4CGM A;  4E8O A;  3VWE A;  4R87 A;  4A33 A;  4KS9 A;  4R3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...