1LRZA

X-ray crystal structure of staphylococcus aureus fema
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
412
structure length
400
Chain Sequence
MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Staphylococcus aureus FemA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic inhibitor
molecule keywords factor essential for expression of methicillin resistance
total genus 137
structure length 400
sequence length 412
ec nomenclature ec 2.3.2.17: N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N(6)-glycyl)-D-alanyl-D-
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02388 FemAB FemAB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1lrzA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA02
4LX9A 3GKRA 4KLVA 4JD6A 5HH1A 3JUWA 3R96A 2GE3A 2Q04A 4Y49C 3GYAA 1S5KA 3CKDA 2B4DA 4HNXB 2QIRA 2C27A 4K30A 4B6XA 2WPXA 1NE9A 4F6AA 2H5MA 4KVXA 4MY0A 4YRHA 1ON0A 2GANA 2CNMA 4II9A 3I9SA 1RXTA 1IJ6A 4FD7A 2C5KT 1LRZA 3EXNA 1U6MA 2QECA 4IUSA 4QC6A 3C26A 1M44A 1KZFA 3TE4A 2KCWA 1Z4EA 4KOYA 2ZW6A 2HV2A 1QSNA 2VEZA 4QUSA 4E0AA 2Q44A 2C5JA 2D4PA 4FD6A 1R57A 4XNHC 4QB9A 2CNTA 4CAVA 2KWIB 4KUBA 1P0HA 2VZZA 2PR8A 2VI7A 1S7NA 2P6EA 2NMTA 4B5OA 3VWEA 4AB7A 4OADA 4XPLA 4PK3A 5JPHA 2HUZA 4M3SA 1KUYA 1K4JA 4FD4A 4F0YA 3QB8A 3S6HA 3PZJA 4AG9A 5F49A 4X5KA 2VZYA 5EC4A 3TKLB 2EVNA 2R98A 4ORFA 3WR7A 3D8PA 2R8VA 4NF1A 1YX0A 2ARHA 2IC6A 4PK2A 3CVRA 4MBUA 1YGHA 4L0RA 2X9WA 3P2FA 4CRZB 1J4JA 5J8FA 4HNYB 1WK4A 3BLNA 3FXDB 3S6GA 3TOAA 3VWDA 2Z11A 2G3AA 3FRMA 1P4NA 4QBJA 1XF8A 1YR0A 4KVOE 2AE6A 1QSTA 1RO5A 2ATRA 4PV6A 4PSWA 4HNWB 4RI1A 4ZBGA 4MHDA 2J8NA 5I0CA 4HKFA 2PSWA 2AJ6A 5GCNA 4IF5A 2Q7BA 4U9YA 2Z10A 2REEA 1S7KA 2C5IT 3I3GA 3N5LA 4DNCA 2GIVA 3FXEB 2G3TA 5F48A 1IJ5A 2EUIA 3W6XA 5ISVA 3TO9A 3D2PA 4KOXA 2BL1A 1XEBA 2IC9A 3H4QA 1B87A 1Y7RA 2F5IA 1M4IA 1Z9UA 4CQIA 4KORA 4Y49B 4KOUA 1FY7A 4H6ZA 2K5TA 4L8AA 3DR8A 1V0CA 3F8KA 3JVNA 1Q2DA 4OLLA 3D2MA 3CXQA 5IX3A 4XPKA 2D4OA 4NXYA 3S4UA 1XIXA 4KOWA 4EVYA 4FI5A 1MJAA 4RS2A 3FBUA 1IB1E 3RYOA 3K9UA 3F0AA 4XPDC 5IV0A 4NSQA 3MXZA 1LVFA 3R9GA 1MJ9A 2X9YA 4J2CA 3QUJA 4UA3A 1VKCA 5KTCA 2XTLA 1PU9A 4NCZA 1VHSA 3L3PA 4H89A 4JXQA 4R3LA 3R1KA 2REFA 4R3KA 3CXPA 2FIAA 2VBQA 1B6BA 3N7ZA 3NE7A 2ZPAA 1MJBA 1TIQA 2JEVA 2R7HA 2JDDA 4XNHB 3TTHA 4GS4A 2IL4A 4KOTA 4E8OA 1YLEA 2PC1A 4CAWA 2FT0A 3BJ8A 3MGDA 3CXSA 4KLWA 3T90A 3DDDA 4PSXA 2VXKA 1UFHA 2PR1A 2RC4A 1N71A 2BUEA 3ZJ0A 3EFAA 4KOVA 3R9EA 2QMLA 3TO7A 2OH1A 2Z0ZA 1PUAA 4B5PB 2CA5A 3DNSA 5F47A 1S7FA 1I21A 4DNDA 2Q4VA 2OB0A 2JLMA 3PP9A 4MI4A 2P6FA 1KUVA 1BOBA 2BSWA 3W91A 2OZGA 5H86A 2FSRA 3EY5A 2J8MA 4ONUA 4LUAA 1S60A 4MJ8A 3LODA 2OZUA 1MK4A 5E96A 2B3VA 5F46A 3OWCA 3F5BA 3G3SA 3SXNA 2PQ8A 4JXRA 2FE7A 2O28A 5C88A 2FS5A 3LD2A 4JWPA 3EC4A 3FXTA 4JJXA 1M4DA 5DWNA 3B8GA 2JDCA 2ZXVA 4NEXA 1YVOA 1ZKEA 1WWZA 2MBGA 4XPDB 4AVBA 3P7IA 3TOBA 1YREA 2X7BA 4R87A 2WPWA 3DSBA 4QVTA 3QK6A 2B4DB 4MY3A 3FNCA 1QSDA 2PRBA 3EO4A 4UWIA 1Z0PA 1IYKA 1I1DA 4AVAA 5IB0A 5J8CA 4E2AA 2FIWA 2I79A 3PGPA 3R9FA 3UY5A 2B3UA 3S6KA 2CNSA 4R57A 4R9MA 2FXFA 3KKWA 5HMNA 3P2HA 3IGRA 4YFJA 4KVME 1BO4A 1S3ZA 2J8RA 3QAHA 2CY2A 3FB3A 4CS0B 1KUXA 5EBVA 1XE4A 3E0KA 5KTAA 1QSRA 2X9XA 2KWHA 3S6FA 1M4GA 1CM0A 3FIXA 4U5YA 3SXOA 2Y0MA 3IWGA 2ZW5A 4EYYR 1S7LA 3TCVA 3DR6A 2B58A 3BJ7A 5H84A 4OAEA 3TT2A 3R95A 1Y9KA 4KUAA 4CRYB 4AG7A 3ZZIA 4KZTA 1GHEA 5KTDA 2OZHA 4J3GA 2K48A 1SQHA 4JLYA 1YVKA 1L0CA 4UBRA 1Q2CA 1YK3A 2B5GA 5CNPA 2FL4A 3GY9A 1Q2YA 3V8IA 4BMHA 1QSMA 1M1DA 4M85A 2P6GA 3G8WA 3SHPA 3T9YA 2FCKA 2B5GB 3D3SA 1IYLA 2Q4YA 4L89A 2G0BA 4FD5A 1IICA 1Z4RA 1NMTA 3W6SA 2P0WA 2ZW4A 2B4BA 2VQYA 4H6UA 4B5PA 2PDOA 3FYNA 4AVCA 3TO6A 1IIDA 4UWJA 2OU2A 1NSLA 2G0UA 2BEIA 2ZW7A 4KOSA 2I00A 5C82A 4U9ZA 4I49A 3TFYA 2A4NA 5DWMA 1OZPA 5JQ4A 2Q0YA 4YGOA 1Y9WA 1XMTA 2R1IA 5FVJA 1QSOA 2DXQA 1CJWA 1I12A 2HQYA 4CAXA 1H7CA
chains in the Genus database with same CATH superfamily
2D0TA 5JDNA 1FEWA 2HPLA 3KHZA 4LX9A 4GYSA 1S35A 4PK5A 3PUAA 5IHYA 2YINA 3R96A 3PUVF 2LSKA 2Q04A 3CKDA 3VATA 2DNXA 2B4DA 4UFWA 5K8OA 1HFAA 2PJAA 1HEEA 4K30A 4B6XA 1NE9A 5AG4A 4HWHA 2VB6A 4LMKA 1WR6A 4UCNA 3LG7A 2PJ5A 2CLYC 4NJRA 2E9XC 4II9A 5EMIA 3NH4A 2XEGA 5AG6A 2C5KT 4MCRA 5ABFB 1U6MA 2XQ9A 4C7IA 4U33A 1M44A 4YJ2E 3D67A 4A33A 4CGLA 3FX6A 2FJEA 2F7VA 5JQGE 3CX8B 1KWMA 1M62A 3AE3A 3FZMB 1QSNA 4QUSA 5CB4E 2Y8DA 2DWGA 4HE8A 2D4PA 3AEGA 4XNHC 3KR4A 4NGPA 2VVNA 3KASA 2CNTA 4H2KA 4CAVA 3F31A 3SJFA 2XSAA 4EXTA 1AJ3A 3CQCB 5BMVE 2X51A 1DTDA 1UCUA 4IE6A 4AKLA 4IE0A 5HVFA 2BDEA 2NOXA 4CI1B 3O1IA 4B5OA 3M65A 3C51A 4OADA 1IBKT 2Q51A 4XPLA 4KHZF 4O23A 4A98A 4AQFA 4UIGA 2HUZA 2E5VA 5LYJE 2HC9A 5L4HA 3PZJA 2HPJA 2VZYA 4HPSA 3S9MA 4C2ZA 3AAEB 3D8PA 3VARA 4B3MT 1AUGA 4NF1A 3IO1A 2ARHA 2XSBA 2HN1A 2J62A 4CAFA 4MBUA 3P2FA 2Z3OA 5J8FA 1E1HB 3C50A 1WK4A 4R8FA 3BLNA 3FXDB 4U7IA 3IC1A 3I9WA 5FY0A 3VWDA 2POKA 2KMFA 2G3AA 1CHUA 3FRMA 4QBJA 4DR2T 3BI1A 3ZN0B 2AFUA 5CPAA 4TNVA 4ZI3D 2AE6A 1A2ZA 4ZY2A 3RQWA 4RI1A 6CPAA 2ATRA 4MHDA 1MIWA 3CK6A 3AXJA 4YU9A 2YOEA 4PK6A 2ZEDA 4LF6T 4AKHA 3HKDE 3RF1A 4IF5A 4QXCB 1HNZT 2CBIA 1HNWT 3RHWA 4OC1A 2REEA 3VKGA 5L3FB 4DNCA 2G3TA 1BPNA 1XNQT 2ZEOA 4U3CA 4EMEA 3A7MA 1FNOA 3LK3B 4OC5A 2MPKA 4KOXA 3H3MA 4OX9T 4GKKT 3WI3A 4UIAA 4EIWA 2WZNA 3LDQB 4I50E 3P4PA 3MKDA 4NGSA 5LG3A 1M4IA 3LMSA 2CF4A 3ZEFB 3CPZA 1ZG8A 2LOSA 3UU3A 1UWYA 4KOUA 3B2YA 2NW9A 2BKOA 5LGUB 1FJGT 2KLQA 1QQ9A 5FMNA 4L8AA 2X0HA 2ZENA 3DR8A 4X2TA 4AIUA 3CDXA 2XEJA 4IDOA 5IX3A 4Q25A 2D4OA 4NXYA 3S4UA 4ZX8A 4AQFC 2YDQA 4OHFA 2W2UA 2NSMA 1Z2LA 1MJAA 4MCSA 4FJOA 1LKXA 1VHEA 4NGNA 3ZT5A 1N32T 3RC8A 2W63A 4HFDA 1DE4C 4UA3A 2W0GA 4PXDA 5JREA 3UU4A 3CX6B 4ADZA 3BXMA 4W9YA 4H89A 2J1DG 3NE8A 5AQVB 3OYXA 1ELLP 4R3KA 1ZP0A 1S94A 4TZ4C 3R6NA 4UV8B 1B6BA 3N7ZA 4XNHB 4WNKA 3TTHA 4GS4A 2XQYA 1BR4A 2IL4A 1FMWA 4QH1A 4JI0T 3ZMSB 3K1SA 2PC1A 3PB7X 4CAWA 1U4QA 4A31A 3SS1A 3HLPA 1WYBA 4IDNA 3GUXA 1J5WA 2PR1A 4CI2B 1XMQT 4YLHA 3VKHA 2I6HA 1IU8A 5LHHB 2XQ3A 4KOVA 2YK0A 3L8RA 4MALA 3R9EA 2QMLA 4DBRA 3Q5DA 4A32A 4JUYA 1YW6A 2Z0ZA 5AFUL 3PURA 2GFQA 2PJQA 4M6GA 3N5FA 2X67A 4DR3T 5HVHA 2JLMA 4MLKA 3V5UA 4ZI2C 1F2PA 3NKZA 2Z6EA 1BOBA 4YSZA 3LJCA 4GK0E 2OZGA 3W91A 4P6YA 3Q9DA 2NR4A 3ZMUB 4U2ZA 2J8MA 3L39A 2Q9QD 3P4QA 3CT9A 3B7IA 3EABA 1Z8WA 2PG8A 1HG2A 2UUBT 1CPSA 1KF6A 3MJXA 4B6ZA 3PUXF 5HWXA 2XAQB 3VR9A 2RA1A 3PUYF 3X1DA 3G3SA 3WABA 3PRTA 4GIWA 4O8SA 3ZC1A 4NGRA 3PUQA 4WBNE 2O28A 3SI2A 2FS5A 3PUGA 4DR5T 3LD2A 3EC4A 5J1GA 3E08A 1OBRA 5M4YA 4JLEA 3CWZB 5JDQA 2ZXVA 5LP6E 4PAGA 3FJUA 2XQ7A 3NFZA 2X0YA 4UFVA 2WU5A 4X20E 3LK2B 3QK6A 5J0ZA 4DJLA 4MY3A 2CHOA 2PRBA 4YJ3E 3AE9A 5CGMA 1Z0PA 2PJ1A 3D7HA 1I1DA 4LQGA 4AVAA 5CA1E 4ILUA 2ZEFA 4NXMT 2BG9E 1PCAA 2I79A 2CE7A 2HN2A 3EDUA 3C4XA 3AE2A 4MFKA 1WFDA 4HN9A 2CNSA 4HWIB 4R9MA 3LBXA 2FXFA 3KKWA 3P2HA 4ILBA 4MBQA 4PFOA 3EI0A 4HWFA 3UU6A 1MMNA 5HEOA 3QOFA 1BO4A 4F0XA 2JMHA 4H9NC 5FXVA 3B3VA 3N9LA 2JQ9A 3FB3A 2WMOA 4CS0B 3OJAA 1NENA 1XE4A 4UV9B 5KTAA 4ZXLA 4IE5A 3TLSA 3FZFB 1M4GA 2MOZA 4R6TA 1CM0A 4UXNB 2P9BA 5JVDE 1YKHB 2JRKA 3DGVA 4IAVA 4HFEA 1F2OA 1JQGA 2ZW5A 2DPTA 2B58A 2H88A 3JCFA 3P8CD 4CXWA 1QUUA 5AQPB 1WRDA 1Y9KA 4KUAA 4EV6A 2YNEA 4C2YA 1GHEA 5KTDA 5L2LA 4TN7B 2BKPA 2Z3NA 2WMNA 3ZN1B 1BAVA 4JLYA 1YVKA 2QRXA 4WWVA 2K5BB 3D7GA 1YK3A 2B5GA 5CNPA 1VCSA 3ZCIA 2QVPA 4FBEA 2PJCA 4K0KT 5J2TE 2E2AA 2GK9A 5AQMB 2CTCA 4MRIA 1JNZA 1XDPA 3C64A 4P09A 4M85A 4UCPA 4X64T 2JBKA 3QB5K 3T9YA 3D3SA 2WDVA 1IYLA 3RI5A 3KQZA 3ZJ1A 4H63V 2G0BA 1IICA 3RIUA 5AG5A 1Z4RA 2V8HA 1MMGA 3PU8A 2ZW4A 2GLJA 4P44A 1LOKA 2ABZA 4P4BA 1TF8A 1XZYA 3KHXA 5LMNT 2AFWA 3I0OA 4YSYA 3FEDA 5HCJA 5LB7B 4ILCA 3C98B 3TO6A 1MMAA 2QJ8A 3FZHB 4UWJA 2HB6A 1NSLA 4K3NA 1M4LA 4KOSA 3AB3B 4I49A 2DI4A 1Y0RA 4OC0A 3ZSTA 2YN6A 5HXRA 3JC6C 5K8PA 4JYWA 2V8VA 3O1JA 1UGOA 2L9QA 4ZZBA 5FVJA 3RPUA 4CAXA 3AEAA 1ZLIA 3KGQA 4WBOA 4DMWA 4EAHA 3TC8A 1ARMA 3UTKA 4CAEA 4CGOA 5IWAT 5IUXA 4NFRA 3LSVA 2WBLA 5DQVA 3RYIE 3GYAA 2WCAA 4ISSA 3PFOA 3RRCA 1T8BA 2V5CA 1WLXA 2N1GA 2C27A 2X0LB 4PJNA 4QHOA 1E7PA 3PB8X 2KZ7B 4F6AA 3PB4X 4ZI7E 2JQQA 4B10A 4MY0A 2Y6XA 4FAIA 5L3BB 3BK9A 2YDSA 2LE8A 3AE8A 4O2BE 2QYVA 2NW7A 3FF3A 1RXTA 4FD7A 2V8DA 4LF4T 2ACZA 2V26A 3EXNA 2W66A 1I6ZA 1XWMA 2RB7A 2YNCC 3KI9A 1CPXA 4OC4A 2IMOA 4DUZT 1KZFA 4AXVA 3AXJB 3TE4A 4TWFA 1B7TA 5F3JA 4KOYA 2WDQA 2W67A 3I0QA 1SUMB 3TX8A 4E0AA 1Z8UA 4DO0A 2E9XD 4KHPT 3RYFE 3EHZA 3UUNA 4JI7T 1XJOA 2GLFA 3QNUA 4KUBA 3MK7C 4GXHA 3WC6A 5HEHA 4QX8B 5DQWA 2QGSA 4JZ0A 2M6IA 2BBJA 1OXZA 4DR7T 2H7OA 3KINB 4PNIA 3OPCA 2V6XA 2WP9A 4YTMA 4H9OC 2P6EA 2V77A 2UUAT 3NVOA 1Y7EA 2J4GA 4TWHA 4R7MA 2KSRA 2BKNA 4M3SA 4F0YA 3ZC0A 3QB8A 2G9DA 2H89A 5F49A 3PV0F 5JR9B 2EVNA 3WR7A 3K3QC 4QX7B 5THWA 1HR0T 2IHR1 4PXCA 3CVRA 2FJAA 5FKYA 4EEBA 1CP6A 1YGHA 4X3RA 3WAJA 1YMEA 1J4JA 4ZGYB 4JI5T 2CWOA 5AQTB 4I4TE 5KX5E 2LOPA 1OEDC 5FL0A 4BAYB 4MCQA 3HL6A 3EDVA 2VQFT 3P50A 4K0UA 2FJBA 2UU9T 2ODUA 1KEYA 3UULA 1QSTA 1RO5A 4PSWA 4HNWB 3OVUA 4PW8A 2VURA 2J8NA 1U5PA 1TKJA 4A37A 2PSWA 3RIUC 4A5XA 2AJ6A 4AQGA 4XBFB 2N2NA 4AQYT 4P1NA 4U9YA 3NRXA 4AISA 2XQ4A 5JDFA 1T72A 3N5LA 4YHJA 1YQ3A 2SPCA 5AQNB 2NTYA 3KV4A 4KMCA 2Q43A 5ISVA 2M67A 3TO9A 4MFQA 2DL1A 3E0ZA 4PJLA 2PBIA 3QC9A 2PJ0A 1XMOT 5C3JA 2WWUA 4A94A 2EBJA 4EOZB 4RUHA 2F5IA 5KDMC 1Z9UA 4MHCA 4MHZA 3RKGA 4CQIA 3SJGA 2XAFB 2XJ7A 4H6ZA 3G06A 4DYOA 2XPKA 3ABVA 3NRYA 2CM0A 5H6RB 4ERRA 4OLLA 3CXQA 5LG4A 1KNRA 4H9RC 4KOWA 4FI5A 1XDOA 4RS2A 2BO9A 3K9UA 3F0AA 1Z8TA 4XPDC 5IV0A 4JI6T 4NPPA 5A27A 1MJ9A 2X9YA 3QUJA 4DBQA 1DU2A 4X1KE 3HKBE 4DV7T 3RGLA 4G1PA 2BG9B 5KTCA 3KFWX 4P0BA 3L3PA 3R1KA 5CA0E 1HDQA 1LAMA 4UIBA 4B3RT 5DABA 2JEVA 1TXRA 2R7HA 2KXPB 3CPAA 5DS0A 1VCTA 4QKNA 2XASB 3C4WA 2LKHA 2H3RA 1TF9A 3T8OA 3CXSA 2WWVA 2C6CA 3DDDA 3GIUA 3UUBA 2VXKA 5FYMA 4ZEYA 3AE7A 3D7FA 2FUPA 4ZZCA 3ZJ0A 5LHGB 4UVAB 3S9LA 2OH1A 2I0MA 3MA9A 2XAGB 2XQAA 1PUAA 3ZLIA 1Y64B 4UEEA 4PFPA 3DNSA 5F47A 1S7FA 2OOTA 1I21A 4DNDA 2DF5A 2OB0A 5L3DB 2NWBA 4M6HA 2P6FA 1KUVA 4YSXA 1HNXT 3V7ZA 2BSWA 4AKRB 2XHEB 4ZS3A 4HFBA 3AECA 5AQFB 4LUAA 3AA1B 2WQYA 1S60A 4B14A 1XRYA 3LODA 4YTPA 1HDUA 3CQXC 1MK4A 4IGUA 3ONLC 5E96A 4MFZA 5G22A 4NUVA 5I4MA 4DIDB 4UEFA 4DV6T 3SXNA 3GA8A 4IL9A 1R3NA 2LKGA 3U3IA 2A72A 2C0SA 4TX5A 5C88A 4JWPA 4H63H 4JJXA 1M4DA 4B12A 2XQ8A 2JQHA 3B8GA 1SA0E 3ZT7A 3FHNA 2Q9QC 3RYCE 1WWZA 4XPDB 2ZEGA 4AVBA 5LYFA 5HEJA 3N9QA 3P7IA 2H7VC 3TOBA 3IWWA 2WPWA 4DV1T 3KVBA 3KV6A 5ABEA 1WYCA 1D0ZA 2BG9C 4IDPA 1OEDB 3FNCA 4WZXA 3EO4A 3NH8A 4I0UA 3NA6A 4AXPA 3F2EA 2BVMA 5IB0A 5L3CB 4E2AA 2AFSA 3PTRB 3B3WA 3ETUA 2FIWA 3ANWB 2DPSA 1CUNA 4P4IA 1YLOA 3NH5A 2EO8A 2QA7A 3L2NA 3UY5A 4A2ZA 4U7YA 5HXEA 5CBMA 4UF4A 2ODVA 2HH7A 3PU3A 3IGRA 2OLTA 2PJ7A 5FXZA 3AEEA 2IUBA 4KVME 1J5ET 1US7B 1VIXA 2IIUA 3JAEA 1IOFA 2LHNA 2CY2A 4ZOLE 5EK2A 1KUXA 5EBVA 5LGNB 5EK4A 1QSRA 3K2KA 1W09A 2X9XA 3FECA 3S6FA 2L3LA 3DLJA 3FB2A 1LFWA 3D68A 3FIXA 1VOMA 3SXOA 3GMIA 5LYIA 2N9DA 2Y0MA 1YSJA 3IWGA 2CCQA 3LFMA 1S7LA 4JI3T 3TCVA 2JJ9A 3DR6A 1WCRA 4IT4A 5H84A 4LMJA 4PPZA 4IDZA 2X66A 2WY2A 5L4EA 3RIAA 2WUUA 3ZSSA 4NJQA 3GLJA 2LRKA 2OZHA 1IBMT 3SFEA 1SQHA 2E5LT 2CMRA 2FJDA 1ZOYA 2YNCA 4TV9E 3GY9A 2ZM2A 5HVGA 4P4EA 1QSMA 5LRGA 3AE4A 3UT5E 2VK9A 3D7DA 5LMUT 4CYPA 2CBJA 3KQXA 2FCKA 2Z3KA 2B5GB 1RTQA 4CYOA 5C8YE 3H8FA 5AQGB 5AG7A 4LFBT 2DHRA 4FD5A 2AFZA 2BG9A 2XQ5A 1NMTA 3W6SA 4AI6A 4DUYT 2ZM8A 2V7MA 3HKEE 4B5PA 5LJMA 1ZLHA 2XQ6A 4MFJA 1IIDA 1N33T 5LNKA 5TAOA 2PE3A 1VHOA 2G0UA 2BEIA 2ZW7A 4AKGA 2I00A 5C82A 4O4IE 4EB6E 3JADA 1OZPA 5JQ4A 2Q0YA 4ZI3C 1XMTA 5JDHA 3WC5A 4UFXA 2X68A 2DXQA 4ZX9A 1I12A 4FWUA 2JPFA 3ZMZB 4YWYA 1D1AA 5FL1A 4O4HE 5LA6E 3OTOT 4KLVA 4JI4T 4JD6A 4HWDA 3AVRA 4Z90A 2GE3A 1Y01A 2GU2A 2MYSA 5LCYA 2Z3MA 3WT4A 2ACXA 1F57A 4HEAA 2QIRA 1NSAA 1X9BA 2XM1A 4CGNA 3K3OA 2H5MA 2ES0A 4KVXA 1W0BA 3S9NA 3HA4A 1ON0A 2GANA 3RYHE 2VL1A 3I9SA 1IJ6A 4X1YE 2AE9A 2IDOB 4IUSA 2QECA 4QC6A 3TLVA 3C26A 3PJAA 3FVLA 2VKOA 3AA7B 1E2AA 1Z4EA 1ARLA 4Q36A 4NXNT 1YXRA 4O4JE 1OEDE 2CXFA 2PRQA 3U78A 3GWHA 1IOIA 2VEZA 3CX7B 4F8HA 2C5JA 1R57A 2ZEEA 1IY7A 2MAWA 3A8YC 5LGTB 3T1YT 4QB9A 5D8NA 2Z3LA 2KWIB 4ANJA 3FMCA 4OYJA 1P0HA 2XM2A 3IHRA 2VI7A 4IE7A 1NAFA 2WYRA 5JTGA 2ZLYA 4BJNA 2D9DA 2IAKA 4P4DA 5FVKA 3SFDA 4L5GA 3D4UA 4PK3A 4LFAT 4PXEA 2F8HA 1CP7A 5JPHA 2CHNA 2LHRA 1K4JA 1T7SA 1UK5A 3PJAJ 3S6HA 5CFBA 1SE7A 3UFGA 5EC4A 4ORFA 4A97A 4BJMA 1GYTA 3DTOA 3SOLA 1CG2A 2R8VA 4ZY0A 3PUWF 4OK0A 2UXNB 8CPAA 4DR1T 2AFMA 4PK2A 4H9PC 5AQSB 4NGTA 4L0RA 2OV9A 4PJJA 5K8MA 1IBLT 2EWBA 3ZT6A 3N2KE 4TNUA 3S6GA 3TOAA 1FIOA 5ETWA 2K3WA 3FZLB 5FVLA 1XF8A 5IB9A 5FY1A 2HHHT 3J9X1 1YR0A 2IJZA 1PYTB 4KVOE 2CXLA 3IJ3A 1Q7LA 4MHYA 2PJBA 5FP3A 4MHNA 4PV6A 5JM6A 4N78D 2PJ4A 5I0CA 1R8IA 4LMLA 4HKFA 4KSIA 4OIWA 3H5ZA 5GCNA 3RX6A 4I55E 3MRUA 5LRKA 3MACA 3EVYA 3WC7A 4OYKA 4L9IA 5AQQB 3FXEB 2A3DA 5F48A 1YW0A 2CXAA 2V1DB 3IF8B 1IJ5A 3B57A 2EUIA 3W6XA 4OKOA 3B3CA 3PEIA 4X1IE 2JEWA 3VH9A 4QWNB 2ZOFA 4X62T 3H37A 1TKHA 1B87A 3KBUA 2PJ2A 5HEGA 2LLYA 5HWYA 2JIWA 2C6PA 4KORA 3OKQA 2WM9A 5L47A 4MHPA 1VGYA 1FY7A 5A28A 4C91A 2K5TA 2WDRA 2D0UA 4OC2A 4LFCT 3W15B 3F8KA 1Q2DA 4A39A 4DR4T 4PJMA 2V7LA 4UELA 4WW0A 4X66T 5FXWA 3ZMTB 2K24A 1XIXA 3K8PC 1AYEA 2KNDA 4EVYA 2BOAA 3FBUA 2WAUA 1SHZC 4H9QC 3R9GA 5LBQB 4J2CA 4ONWA 5BR8T 4P4FA 2V8GA 2XTLA 1LANA 1PU9A 4NCZA 2I59A 4JXQA 3IA3A 2VBQA 2ZPAA 3NE7A 1MJBA 1TIQA 3JTKA 1ZG7A 4F9VA 1MIVA 1O3XA 4HFHA 1BR0A 2B76A 1ZHCA 4KOTA 3AAAB 1YLEA 3B3TA 2VWAA 4EZHA 2FT0A 3IIBA 2ZEHA 3BJ8A 3MGDA 4KLWA 3P4SA 5AQKB 3L09A 2RC4A 1N71A 3P4RA 3I1UA 3ESLA 2BUEA 3B5MA 2UXBT 4Z65A 4X65T 4CN1A 1LCPA 2BS3A 3EFAA 1IZNB 4TWDA 1EE3P 3TO7A 5ABHA 1QMUA 2LM9A 3RLFF 4CXXA 4P10A 2Q7SA 3PE0A 2EHOB 4IHJE 3PDYA 3ZPOA 5HEUA 1XMBA 3RKOA 1TKFA 4MI4A 3UUMA 2LT3A 1D1BA 5F8PA 2PIYA 3Q5XA 1X10A 2FSRA 3GN5A 3EY5A 4ONUA 3V5SA 3HKCE 4MJ8A 4E7ZA 3FBZA 2OZUA 3CPXA 1M7KA 2Y48B 5F46A 4G63A 4JBWF 4LQ6A 3H3AA 2V7KA 3GB0A 3N9NA 5AQIB 4GYRA 2IW5B 3N9MA 1G8XA 4LF8T 2FE7A 4DUKA 2W00A 3FXTA 2J47A 5DWNA 3UQ7A 4JV5T 2JDCA 1UUSA 7CPAA 3HR0A 1MNEA 3ISZA 4JEUB 3RRWA 3CZXA 2W62A 1L0VA 3KVAA 3CIRA 2XAJB 4A30A 1XOVA 4UEZA 3JAFA 4UR9A 1YREA 3UUXB 2EHOD 2X7BA 5LBMA 4R87A 2XUEA 3TLUA 3DSBA 4QVTA 1ELMP 3D66A 2B4DB 2AXDS 4UWIA 1LVKA 4QXHB 4GM5A 4X5TA 1LAPA 4HGAA 3KV5A 4IL4A 5H6QB 3ONXA 2LM2A 1D0XA 2IMLA 2CXDA 2PTFA 2XAHB 5EZYE 3RC3A 5J1QA 2B3UA 1W0AA 1D1CA 4R57A 4HKAA 5ADXL 3ETVA 4HTEA 1D0YA 4YFJA 4F9UA 3IBPA 2YEVC 4C2XA 4R76A 1S3ZA 2EK9A 4KI0F 3N2OA 5LYLA 1XBUA 4GK5E 2MTQA 4BD9A 4DVDA 5AQOB 3AE1A 1Z8LA 4IREA 2X9HA 4KP3C 3Q5WA 4KUMB 3I1AA 4U5YA 2NYQA 4E7SA 4WJBA 3SJEA 2GREA 4M6IA 3ZCJA 5EK3A 4WYVA 3MN8A 1KNPA 4LF9T 4OAEA 4OC3A 4RN7A 2EHOC 4YFSA 4ILAA 4I43B 3TT2A 1N34T 3N9PA 2BCOA 4EFDA 4KZTA 2LSGA 2K48A 4B11A 4OFZA 4UBRA 1N36T 3QB5A 5JR9C 1Q2YA 3C4ZA 4V1Av 2PVVA 4G2AA 1VRBA 3V8IA 4BMHA 4TV8E 5JDMA 4UVCB 3G8WA 3AEDA 3VRAA 3T1HT 3VU7H 4IHMA 3AE6A 3A9LA 3KR5A 2Q4YA 4UF0B 1I94T 4L89A 3M3ZB 2VQET 2LEHA 3RAMA 4ZHQE 5JGFA 2ZM0A 3F57A 2ZM6T 2P0WA 4CGMA 4P0AA 2OA5A 2VQYA 4H6UA 4U31A 2VKHA 4F8ZA 3SWHA 4UEMA 2PDOA 4CYNA 5AQHB 4AVCA 3ZKRA 2QVAA 1MMDA 3PFEA 4DV3T 4DV5T 3E22E 2B1EA 2V5DA 2I3CA 2FBWA 5A1LA 5C2TA 4U9ZA 4B3TT 2NP9A 2A4NA 4QH5A 4YGOA 3V38A 4DV4T 4HFCA 1Z8XA 4OIDA 1QSOA 4P4JA 4KSAA 1BR2A 4DV2T 1H7CA 4MXUA 5JH9A 3SRZA 4X8IA 3Q2MA 4O2AE 3CMLA 4U72A 1IGBA 3RZAA 3GKRA 3B3SA 4KSFA 5HH1A 2YU2A 3JUWA 4Y49C 4LF7T 3OBVE 1S5KA 2E9XB 4HWCA 4M1PA 1OEDA 2LSIA 1V9DA 4HNXB 1X12A 2UXXB 5LYDA 2EK8A 2Q4ZA 2WPXA 1YD8G 3GN5B 1J1JA 2RP4A 3BI0A 2A2FX 2VL8A 2OR4A 4YRHA 3BQKA 2AFOA 5J2UE 5FXXA 2CNMA 1AMPA 3QAYA 4YXDA 1LRZA 3LACA 2PIZA 4MMOA 1KFYA 2AFXA 3PB9X 1UURA 2JBJA 2DCFA 1XNRT 2WSAA 2KCWA 3BQIA 3NZQA 1R43A 2YNDA 3FEEA 3LK42 4YY3T 2ZW6A 4XAXB 2HV2A 2J9AA 4A95A 2Q44A 4EWTA 2D2SA 4FD6A 3HI2A 3DJBA 1BLLE 4PXBA 3PBBA 5ELYA 2W4XA 3OYZA 5K8NA 3IFEA 4UCMA 2VZZA 3RNZA 2PR8A 5G20A 3VHLA 1S7NA 5FNVE 4DR6T 2PJ8A 5HXCA 2XEIA 2ODFA 3EAMA 5IYZE 2NMTA 3ISXA 4JEHB 3VWEA 5HXHA 1YKEB 4AB7A 2VASA 2F4VT 2BS4A 3KL9A 4COFA 1KUYA 4BBHA 4FD4A 1BPMA 5BWAB 2CRBA 4DMVA 3N2GE 2LJLA 3VRBA 1JWQA 5LRJA 4CN4A 4IK2A 4AG9A 3FZKB 4X5KA 2ZOGA 3DP7A 3TKLB 4IIJE 5LOVE 2R98A 3H8GA 4JI1T 3T8WA 3B35A 2YKSA 1YX0A 4Q38A 2IC6A 2V7IA 4C90A 3PBEA 2X9WA 4CRZB 4PQAA 5DJQC 5JR9A 4HNYB 4OMEA 1W9RA 2R6GF 3RIFA 2Z11A 5KXJA 1P4NA 4NGQA 4EEDA 1HTJF 1NEKA 2UXDT 3CQGB 1HCIA 2O4HA 4Z91A 1ZEEA 2PJ6A 5ABGA 4ZBGA 4NGMA 3IWEA 4P45A 3ZYLA 5G21A 1X79A 4IDQA 2C6GA 2Q7BA 4PK4A 3ZYKA 2Z10A 4ZI6A 1ZV4X 1S7KA 3RQUA 2C5IT 3I3GA 2GIVA 4CXYA 3EUHA 4U74A 2WZHA 1H8LA 3SJXA 3D2PA 1HS7A 2NW8A 2BL1A 1YQ4A 1XEBA 2PFVA 2IC9A 3H4QA 1Y7RA 2WSSV 3IU2A 4JI8T 2DWKA 2QYWA 2ZMAA 4Y49B 2YGWA 3VR8A 3RH3A 1IAPA 2LSJA 3A5XA 3AA6B 3H8EA 1V0CA 4OP4A 4EYUA 3ZMVB 3JVNA 3D2MA 4TWEA 4CI3B 4XPKA 4MFRA 4O4LE 1QLBA 4CGPA 1IB1E 3RO0A 3RYOA 2Q9QA 4NSQA 3MXZA 4GOUA 1LVFA 3O9XA 3D0TA 2XZEA 2UXCT 2EHOA 1VKCA 5LJNA 2VKJA 3R84B 5JH7E 2PJ3A 5AQRB 4TUYE 4DV0T 1GQEA 3FH4A 1VHSA 1JNRA 4R3LA 2REFA 2NTXA 3CXPA 2FIAA 1FT7A 5LXTE 2CEAA 4Q7AA 2VVSA 2JDDA 1EZ3A 3LWUA 3KDSE 4E8OA 2IQ6A 5LHIB 2VL0A 4GKJT 4KS9A 3FBLA 2ZEPA 3T90A 3B13A 2JMKA 2KT9A 4ZI2D 4PSXA 1UFHA 3IU1A 3BQLA 3KBTA 2W61A 4ZYQA 4MFPA 2A9UA 1HF8A 5E0OA 2CTBA 2V7JA 5L3EB 2UUCT 5HYAA 2YDRA 2CA5A 4B5PB 3ZYMA 2LRLA 2Q4VA 3PP9A 2WB5A 3SI0A 3P4WA 5G1ZA 5HAXA 3AEBA 5H86A 2ANPA 2Q9QB 4UVBB 5HXDA 5AGEA 4F6RC 5F09A 1BR1A 2JQKA 3UU8A 2B3VA 3OWCA 5FY7A 3F5BA 3ZJ2A 3AEFA 5JDLA 4A38A 3RBUA 2CPTA 3PUZF 3ONJA 4AKIA 4HFVA 5HXSA 1OWAA 4MCPA 2PQ8A 4JXRA 3AVSA 2XEFA 2PCUA 1UX4A 1CX8A 2BS2A 4B13A 1HG5A 1KK7A 2K9AA 3NBXX 5KMGP 3PB6X 4MFLA 4CN6A 3KZWA 4NEXA 1YVOA 2L8KA 1ZKEA 4CPAA 2MBGA 4FUUA 2VKDA 1YQEA 3K9TA 4KX6A 4NUUA 2D5UA 3ANWA 2V8SV 1QSDA 5HCMA 5JDGA 2CWYA 1CBXA 1IYKA 3HUVA 3LBXB 4A56A 4JYAT 5J8CA 1ZO0A 2WU2A 2CLYB 5F5WA 4JI2T 3AAIA 5GONE 3O1HA 3PUSA 4YT0A 3PGPA 5D29A 3R9FA 4BINA 3S6KA 2DLRA 2RPAA 2V6YA 5HMNA 3IEHA 4B3ST 5JRCA 4Z8XA 2J8RA 3QAHA 3WAKA 3AE5A 4ASKA 4YTNA 1HX8A 1Z5RA 3Q5EA 3E0KA 4H9SE 4UF0A 2KWHA 4C68A 4QH4A 2XY8B 1FMVA 4CZZB 5AQUB 3J7Yq 1Y0YA 5AQLB 2PVWA 4U2YA 4EYYR 2LSYA 4NIQA 3UFEA 1HX1B 3BJ7A 2PJ9A 3R95A 3NWIA 2ZELA 4CRYB 4AG7A 3ZZIA 2E9XA 4HFIA 2DEAA 3QNVA 3JRUA 1UX5A 4J3GA 2E8IA 5AQJB 4EGWA 1L0CA 1Q2CA 2YU1A 2C1CA 2RFHA 2ZEMA 2FL4A 2Z3PA 3SI1A 4TNWA 5JRCB 1M1DA 1KNZA 1G73A 3MZKB 2P6GA 4C7HA 2O53A 3SHPA 5CJ5A 2BVLA 2V6YB 4XZCA 4ISTA 5L3GB 3BHXA 2BZBA 4ZY1A 4EZ4A 3JC6D 3UQ4A 4LF5T 3N9OA 4BA9A 2B4BA 2KINB 3O4XE 3AA0B 5ABFA 1T98A 1MNDA 3KV9A 4QXBB 3FYNA 1YW4A 1WR0A 4ZS2A 2BBHA 3TLWA 1NWMX 2FVGA 4CYQA 4KBMB 3NZPA 1XFOA 2OU2A 4IE4A 3IEEA 3TFYA 4YHHT 5DWMA 3I9YA 3TLTA 1Y9WA 1ZG9A 2R1IA 2WS3A 2WZIA 3K3NA 1CJWA 2HQYA 2M6BA 1MIYA 2CIJA 3UU5A
chains in the Genus database with same CATH topology
2D0TA 5JDNA 1D1AA 1FEWA 3Q2MA 4O2AE 4WBOA 3CMLA 4DMWA 4EAHA 4U72A 3UTKA 4O4HE 5LA6E 4CAEA 2HPLA 4LX9A 3GKRA 4CGOA 4GYSA 1S35A 4PK5A 4KLVA 4JD6A 4KSFA 2YU2A 3JUWA 5HH1A 3AVRA 3PUAA 2WBLA 5DQVA 5IHYA 2YINA 3R96A 2GE3A 2LSKA 3RYIE 3OBVE 2Q04A 2MYSA 5LCYA 1S5KA 4ISSA 2E9XB 2ACXA 3CKDA 4M1PA 2Z3MA 3RRCA 2DNXA 2B4DA 4UFWA 2LSIA 1V9DA 1HFAA 4HEAA 4HNXB 2QIRA 2UXXB 1WLXA 2N1GA 4MI4A 2C27A 4K30A 2X0LB 4B6XA 4PJNA 4QHOA 2WPXA 1YD8G 3GN5B 1NE9A 2RP4A 5AG4A 2VB6A 2A2FX 2KZ7B 2VL8A 3K3OA 1WR6A 2H5MA 2ES0A 3LG7A 4KVXA 4ZI7E 4UCNA 2JQQA 4B10A 4MY0A 2Y6XA 4YRHA 3BQKA 5L3BB 3BK9A 2CLYC 3HA4A 5FXXA 5J2UE 1ON0A 2GANA 2LE8A 2E9XC 4O2BE 2CNMA 3RYHE 4II9A 2NW7A 3I9SA 1RXTA 1IJ6A 3PP9A 4FD7A 4X1YE 5AG6A 2C5KT 2V26A 5IV0A 1LRZA 3EXNA 3TFYA 1U6MA 2QECA 4IUSA 4QC6A 3C26A 4C7IA 2YNCC 1M44A 4YJ2E 2DCFA 4A33A 1KZFA 4CGLA 2VKOA 3AA7B 3TE4A 2WSAA 5JQGE 1B7TA 3CX8B 1Z4EA 3BQIA 3NZQA 5F3JA 2KCWA 4KOYA 4Q36A 2YNDA 3LK42 3I0QA 2CXFA 4O4JE 3U78A 2ZW6A 3GWHA 4XAXB 2HV2A 1QSNA 2VEZA 3CX7B 4A95A 4QUSA 5CB4E 2Y8DA 4E0AA 2DWGA 4HE8A 2Q44A 2C5JA 4DO0A 2E9XD 2D4PA 2D2SA 4FD6A 3HI2A 1R57A 4XNHC 3DJBA 3RYFE 4QB9A 3UUNA 5LGTB 2CNTA 4CAVA 3F31A 2Z3LA 2KWIB 4ANJA 4OYJA 3OYZA 3MK7C 4KUBA 1P0HA 2ZW4A 4UCMA 4QX8B 5DQWA 4EXTA 4ZGYB 2QGSA 1AJ3A 2VZZA 3IHRA 2PR8A 2VI7A 5G20A 3CQCB 4IE7A 1OXZA 3VHLA 2H7OA 2X51A 3KINB 4PNIA 1UCUA 1NAFA 4IE6A 5FNVE 4AKLA 4IE0A 5HXCA 1S7NA 2BDEA 5IYZE 2NOXA 4H9OC 2ZLYA 4BJNA 2IAKA 4CI1B 3O1IA 2NMTA 2P6EA 4B5OA 3M65A 4JEHB 3C51A 3VWEA 5HXHA 1YKEB 4AB7A 2VASA 4OADA 4L5GA 4XPLA 4PK3A 4AQFA 4UIGA 5BMVE 5JPHA 2HUZA 4M3SA 1KUYA 2LHRA 5LYJE 3ZC0A 1K4JA 4FD4A 4BBHA 4F0YA 4DMVA 5BWAB 3N2GE 2LJLA 3QB8A 3S6HA 3PZJA 2HPJA 5F49A 4AG9A 4X5KA 3DP7A 2VZYA 4C2ZA 5JR9B 3TKLB 4IIJE 5LOVE 2EVNA 2R98A 4ORFA 5EC4A 3AAEB 4BJMA 3WR7A 3DTOA 3K3QC 3SOLA 4QX7B 3D8PA 2R8VA 4OK0A 2UXNB 4NF1A 1YX0A 2ARHA 4Q38A 2IC6A 2V7IA 3CVRA 4PK2A 4H9PC 4C90A 4Y49C 4MBUA 4CAFA 1YGHA 4L0RA 2X9WA 3WAJA 3P2FA 4CRZB 1J4JA 4PJJA 1E1HB 2CWOA 3C50A 5DJQC 5JR9A 1WK4A 3N2KE 2Z3OA 4HNYB 3BLNA 3FXDB 3S6GA 3TOAA 3I9WA 5FY0A 1FIOA 3VWDA 4I4TE 5ETWA 2KMFA 2Z11A 2G3AA 3FRMA 1P4NA 4QBJA 5KX5E 2LOPA 4BAYB 1XF8A 3HL6A 3EDVA 5FY1A 4K0UA 3ZN0B 3J9X1 1YR0A 1HTJF 4KVOE 2CXLA 4ZI3D 3CQGB 2AE6A 5FP3A 2ODUA 1HCIA 3UULA 1QSTA 1ZEEA 1RO5A 2ATRA 4PV6A 4HNWB 4PSWA 4RI1A 4ZBGA 4N78D 4MHDA 4PW8A 2J8NA 3IWEA 5I0CA 1MIWA 1U5PA 4HKFA 3ZYLA 2PSWA 2AJ6A 3H5ZA 5G21A 4PK6A 4AQGA 1X79A 5GCNA 4AKHA 3HKDE 2N2NA 4I55E 3RX6A 4QXCB 4XBFB 4IF5A 2Q7BA 4PK4A 3ZYKA 4U9YA 3MACA 2Z10A 2REEA 3NRXA 4XPDC 3VKGA 1ZV4X 3EVYA 5JDFA 5L3FB 2C5IT 1S7KA 3I3GA 3N5LA 4DNCA 4OYKA 4L9IA 2GIVA 4YHJA 4CXYA 3FXEB 2A3DA 3EUHA 2SPCA 2G3TA 5F48A 4U74A 2NTYA 1YW0A 2CXAA 2V1DB 3IF8B 3KV4A 4KMCA 1IJ5A 3B57A 2EUIA 2M67A 3W6XA 5ISVA 3TO9A 3LK3B 3D2PA 1HS7A 4KOXA 4MFQA 3E0ZA 4PJLA 4X1IE 2NW8A 2PBIA 3QC9A 4QWNB 2BL1A 3WI3A 3H37A 1XEBA 2PFVA 2IC9A 4EIWA 3H4QA 2WWUA 1B87A 2WSSV 4I50E 1Y7RA 3IU2A 3MKDA 4EOZB 2F5IA 1M4IA 5KDMC 3KBUA 1Z9UA 2DWKA 5HWYA 4MHCA 3ZEFB 4CQIA 3CPZA 2LOSA 4KORA 3OKQA 2WM9A 4Y49B 2ZMAA 2YGWA 2XAFB 4KOUA 1FY7A 2NW9A 5LGUB 4C91A 3RH3A 2KLQA 4H6ZA 5A28A 5FMNA 2K5TA 4L8AA 1IAPA 2LSJA 2D0UA 3A5XA 3AA6B 3NRYA 1V0CA 3DR8A 4EYUA 3W15B 3ZMVB 2CM0A 5H6RB 4ERRA 1Q2DA 3F8KA 3JVNA 4OLLA 3D2MA 3CXQA 4PJMA 2V7LA 5IX3A 4CI3B 4UELA 4MFRA 4WW0A 4XPKA 5LG4A 5FXWA 3ZMTB 2D4OA 4NXYA 3S4UA 2K24A 4AQFC 1XIXA 3K8PC 4OHFA 4H9RC 2KNDA 4O4LE 4KOWA 4FI5A 4EVYA 1MJAA 4RS2A 3FBUA 4CGPA 1IB1E 2WAUA 3RYOA 3K9UA 4FJOA 3F0AA 1LKXA 1SHZC 2Q9QA 4NSQA 4H9QC 3MXZA 4GOUA 1LVFA 3O9XA 3RC8A 2W63A 5LBQB 1MJ9A 2X9YA 3D0TA 4J2CA 3R9GA 3QUJA 5A27A 2EHOA 4DBQA 4X1KE 1VKCA 4UA3A 2W0GA 3HKBE 5LJNA 2VKJA 3R84B 5JH7E 5JREA 4ADZA 3CX6B 5KTCA 2XTLA 1PU9A 3KFWX 4NCZA 4TUYE 4P0BA 2I59A 1VHSA 3L3PA 4H89A 4JXQA 4R3LA 2J1DG 3R1KA 2REFA 3OYXA 4R3KA 2NTXA 5CA0E 3CXPA 2FIAA 1S94A 4TZ4C 3R6NA 5LXTE 2VBQA 4UV8B 1B6BA 3N7ZA 5DABA 2ZPAA 3NE7A 1MJBA 2CEAA 1TIQA 2JEVA 2R7HA 3JTKA 1MIVA 1O3XA 1EZ3A 2KXPB 2JDDA 1BR0A 4XNHB 4WNKA 3TTHA 4GS4A 2XQYA 1ZHCA 3KDSE 1BR4A 4QKNA 2IL4A 4KOTA 1FMWA 4E8OA 2XASB 3AAAB 5LHIB 3C4WA 3ZMSB 1YLEA 2PC1A 2VWAA 2H3RA 1U4QA 4EZHA 2FT0A 4CAWA 4KS9A 4A31A 3SS1A 3BJ8A 3FBLA 3T8OA 3CXSA 3MGDA 4KLWA 1WYBA 3T90A 3B13A 2JMKA 2KT9A 3L09A 4ZI2D 2VXKA 3DDDA 1UFHA 4PSXA 3IU1A 5FYMA 4CI2B 2PR1A 4YLHA 1N71A 2RC4A 3VKHA 3ESLA 3BQLA 3KBTA 2BUEA 5LHHB 2W61A 3ZJ0A 3EFAA 4KOVA 1IZNB 4MFPA 2YK0A 1HF8A 4MALA 5E0OA 5LHGB 4UVAB 2QMLA 3R9EA 4DBRA 2OH1A 3TO7A 3MA9A 4A32A 4JUYA 2XAGB 2V7JA 5L3EB 2Z0ZA 1PUAA 5HYAA 2LM9A 3ZLIA 2CA5A 3PURA 5AFUL 1Y64B 4CXXA 4B5PB 4PFPA 2PJQA 3ZYMA 3DNSA 5F47A 3PE0A 1S7FA 2EHOB 2X67A 3PDYA 4IHJE 3ZPOA 4DNDA 1I21A 2OB0A 2JLMA 4MLKA 3RKOA 2NWBA 3UUMA 3V5UA 4ZI2C 2LT3A 5L3DB 1KUVA 2P6FA 1D1BA 2Z6EA 1BOBA 2BSWA 4AKRB 2XHEB 5F8PA 5G1ZA 4ZS3A 3LJCA 3Q5XA 4GK0E 5HAXA 2OZGA 3W91A 5H86A 3Q9DA 3GN5A 2FSRA 2J8MA 3ZMUB 3EY5A 4ONUA 3V5SA 2Q9QB 2Q9QD 3AA1B 3HKCE 4UVBB 1S60A 4LUAA 4MJ8A 3LODA 4B14A 5AGEA 3CQXC 4E7ZA 3FBZA 2OZUA 1MK4A 2PG8A 4IGUA 1HG2A 4F6RC 5E96A 1BR1A 4MFZA 2Y48B 5G22A 2B3VA 4NUVA 3OWCA 5F46A 5FY7A 3MJXA 4G63A 3F5BA 3ZJ2A 3H3AA 2V7KA 5HWXA 5JDLA 2XAQB 2RA1A 4GYRA 2IW5B 4AKIA 4HFVA 3GA8A 1OWAA 3N9MA 5HXSA 3G3SA 2PQ8A 3SXNA 4JXRA 3AVSA 4GIWA 1G8XA 2A72A 2C0SA 4O8SA 3U3IA 3ZC1A 2FE7A 4TX5A 1UX4A 2W00A 3PUQA 4WBNE 2O28A 4B13A 5C88A 2FS5A 3PUGA 3LD2A 4JWPA 4H63H 3EC4A 3FXTA 4JJXA 5J1GA 3E08A 1M4DA 1HG5A 1KK7A 5M4YA 5DWNA 4B12A 2K9AA 3NBXX 5KMGP 3B8GA 4JLEA 2JDCA 3CWZB 5JDQA 2ZXVA 3HR0A 4MFLA 1MNEA 5LP6E 1SA0E 4PAGA 4NEXA 4JEUB 2L8KA 3FHNA 3RRWA 1YVOA 1ZKEA 2Q9QC 2W62A 3RYCE 3KVAA 1WWZA 4UFVA 2MBGA 2XAJB 4XPDB 4AVBA 4A30A 3N9QA 3P7IA 2H7VC 1YREA 2VKDA 3TOBA 3UUXB 2EHOD 2X7BA 5LBMA 4R87A 2XUEA 2WPWA 3DSBA 4QVTA 4NUUA 2D5UA 3ANWA 4X20E 3KVBA 3LK2B 3KV6A 3QK6A 1WYCA 2Q4VA 1D0ZA 2B4DB 4MY3A 3FNCA 1QSDA 2PRBA 3EO4A 1LVKA 4QXHB 4UWIA 4YJ3E 4AXPA 1Z0PA 2CWYA 5JDGA 1IYKA 4HGAA 3KV5A 3F2EA 2BVMA 3ONXA 5H6QB 5CA1E 1I1DA 4AVAA 5IB0A 3LBXB 4A56A 5L3CB 5J8CA 4E2AA 3PTRB 4ILUA 3ETUA 1D0XA 1ZO0A 2FIWA 2CLYB 2CXDA 3ANWB 1CUNA 2DPSA 2XAHB 5EZYE 2QA7A 2I79A 3AAIA 5GONE 3O1HA 3PUSA 3PGPA 2CE7A 3RC3A 3EDUA 3C4XA 3R9FA 3UY5A 2B3UA 4MFKA 3S6KA 4A2ZA 4HN9A 2CNSA 2DLRA 1D1CA 4R57A 4HKAA 5ADXL 5HXEA 3LBXA 4R9MA 3ETVA 2FXFA 3KKWA 4HTEA 2ODVA 5HMNA 2HH7A 3PU3A 4MBQA 3IGRA 3P2HA 4PFOA 1D0YA 5FXZA 4YFJA 4KVME 3IBPA 1US7B 1MMNA 2YEVC 5JRCA 1BO4A 4C2XA 1S3ZA 2JMHA 4H9NC 4F0XA 3N2OA 4Z8XA 5FXVA 2J8RA 3QAHA 2LHNA 3N9LA 2CY2A 3WAKA 2WMOA 4ZOLE 5EK2A 4GK5E 2MTQA 4ASKA 3OJAA 3FB3A 4CS0B 1HX8A 1KUXA 5EBVA 1XE4A 4UV9B 4DVDA 5LGNB 3E0KA 5EK4A 1QSRA 5KTAA 4H9SE 4IE5A 2X9XA 4UF0A 2KWHA 4C68A 2X9HA 3S6FA 1M4GA 4KP3C 2L3LA 2MOZA 3Q5WA 1FMVA 3FB2A 3I1AA 4KUMB 4CZZB 1CM0A 4UXNB 2P9BA 3FIXA 3J7Yq 1VOMA 4U5YA 3SXOA 3GMIA 5JVDE 1YKHB 2JRKA 2N9DA 2Y0MA 4E7SA 3IWGA 2ZW5A 3ZCJA 2CCQA 5EK3A 4EYYR 2DPTA 2LSYA 3LFMA 1S7LA 3TCVA 2JJ9A 4F6AA 3DR6A 2B58A 3UFEA 3BJ7A 5H84A 4OAEA 2EHOC 4IDZA 2X66A 3P8CD 4YFSA 4I43B 4CXWA 3TT2A 3R95A 1QUUA 3N9PA 2WUUA 1WRDA 1Y9KA 4KUAA 4CRYB 2YNEA 3ZZIA 2E9XA 4KZTA 4AG7A 1GHEA 4C2YA 4CGNA 5KTDA 5L2LA 2OZHA 4TN7B 2LSGA 2Z3NA 2WMNA 1UX5A 4J3GA 2K48A 4B11A 2E8IA 1SQHA 3ZN1B 4OFZA 4JLYA 1YVKA 1L0CA 4UBRA 1Q2CA 2YU1A 2CMRA 2K5BB 1YK3A 2B5GA 5CNPA 2YNCA 2FL4A 4TV9E 3GY9A 5JR9C 1Q2YA 3C4ZA 2ZM2A 3ZCIA 4V1Av 2Z3PA 5J8FA 5J2TE 4G2AA 1VRBA 3V8IA 2GK9A 1QSMA 4TV8E 4BMHA 3UT5E 2VK9A 5JRCB 3C64A 4P09A 1G73A 3MZKB 1KNZA 1M1DA 2P6GA 5JDMA 4M85A 4UVCB 3G8WA 4UCPA 4CYPA 4C7HA 3SHPA 3T9YA 2FCKA 2Z3KA 2BVLA 2B5GB 3D3SA 1IYLA 3VU7H 4XZCA 4ISTA 5L3GB 3A9LA 4CYOA 5C8YE 2Q4YA 4UF0B 3ZJ1A 4L89A 2LEHA 5AG7A 4H63V 2DHRA 2BZBA 2G0BA 4ZHQE 4FD5A 1IICA 4EZ4A 2ZM0A 3JC6D 5AG5A 1Z4RA 1NMTA 3W6SA 1MMGA 3F57A 3PU8A 2P0WA 4CGMA 4P0AA 4AI6A 3N9OA 4BA9A 2B4BA 2KINB 2OA5A 2ZM8A 3O4XE 2V7MA 3AA0B 2VQYA 4H6UA 1T98A 2VKHA 3HKEE 1MNDA 3I0OA 3SWHA 4UEMA 4B5PA 5LJMA 3GYAA 3KV9A 4QXBB 2PDOA 3FYNA 4CYNA 4AVCA 3C98B 4MFJA 1MMAA 1MMDA 3TO6A 4ZS2A 1IIDA 4UWJA 1NWMX 5LNKA 4CYQA 3E22E 2B1EA 5TAOA 4KBMB 3NZPA 2OU2A 1NSLA 5A1LA 2G0UA 2BEIA 2ZW7A 4AKGA 4KOSA 4IE4A 3AB3B 3IEEA 2I00A 4I49A 2DI4A 4U9ZA 2NP9A 4O4IE 5C82A 4EB6E 3I9YA 2A4NA 5DWMA 1OZPA 5HXRA 5JQ4A 3JC6C 2Q0YA 4YGOA 4ZI3C 1XMTA 1Y9WA 5JDHA 2R1IA 3O1JA 3K3NA 4UFXA 2L9QA 2X68A 1QSOA 3RPUA 2DXQA 1CJWA 5FVJA 1I12A 2HQYA 1BR2A 4KSAA 4CAXA 1MIYA 1H7CA 3SRZA 3N9NA 2JPFA 3ZMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LX9 A;  3GKR A;  4KLV A;  4JD6 A;  5HH1 A;  3JUW A;  3R96 A;  2GE3 A;  2Q04 A;  4Y49 C;  3GYA A;  1S5K A;  3CKD A;  2B4D A;  4HNX B;  2QIR A;  2C27 A;  4K30 A;  4B6X A;  2WPX A;  1NE9 A;  4F6A A;  2H5M A;  4KVX A;  4MY0 A;  4YRH A;  1ON0 A;  2GAN A;  2CNM A;  4II9 A;  3I9S A;  1RXT A;  1IJ6 A;  4FD7 A;  2C5K T;  1LRZ A;  3EXN A;  1U6M A;  2QEC A;  4IUS A;  4QC6 A;  3C26 A;  1M44 A;  1KZF A;  3TE4 A;  2KCW A;  1Z4E A;  4KOY A;  2ZW6 A;  2HV2 A;  1QSN A;  2VEZ A;  4QUS A;  4E0A A;  2Q44 A;  2C5J A;  2D4P A;  4FD6 A;  1R57 A;  4XNH C;  4QB9 A;  2CNT A;  4CAV A;  2KWI B;  4KUB A;  1P0H A;  2VZZ A;  2PR8 A;  2VI7 A;  1S7N A;  2P6E A;  2NMT A;  4B5O A;  3VWE A;  4AB7 A;  4OAD A;  4XPL A;  4PK3 A;  5JPH A;  2HUZ A;  4M3S A;  1KUY A;  1K4J A;  4FD4 A;  4F0Y A;  3QB8 A;  3S6H A;  3PZJ A;  4AG9 A;  5F49 A;  4X5K A;  2VZY A;  5EC4 A;  3TKL B;  2EVN A;  2R98 A;  4ORF A;  3WR7 A;  3D8P A;  2R8V A;  4NF1 A;  1YX0 A;  2ARH A;  2IC6 A;  4PK2 A;  3CVR A;  4MBU A;  1YGH A;  4L0R A;  2X9W A;  3P2F A;  4CRZ B;  1J4J A;  5J8F A;  4HNY B;  1WK4 A;  3BLN A;  3FXD B;  3S6G A;  3TOA A;  3VWD A;  2Z11 A;  2G3A A;  3FRM A;  1P4N A;  4QBJ A;  1XF8 A;  1YR0 A;  4KVO E;  2AE6 A;  1QST A;  1RO5 A;  2ATR A;  4PV6 A;  4PSW A;  4HNW B;  4RI1 A;  4ZBG A;  4MHD A;  2J8N A;  5I0C A;  4HKF A;  2PSW A;  2AJ6 A;  5GCN A;  4IF5 A;  2Q7B A;  4U9Y A;  2Z10 A;  2REE A;  1S7K A;  2C5I T;  3I3G A;  3N5L A;  4DNC A;  2GIV A;  3FXE B;  2G3T A;  5F48 A;  1IJ5 A;  2EUI A;  3W6X A;  5ISV A;  3TO9 A;  3D2P A;  4KOX A;  2BL1 A;  1XEB A;  2IC9 A;  3H4Q A;  1B87 A;  1Y7R A;  2F5I A;  1M4I A;  1Z9U A;  4CQI A;  4KOR A;  4Y49 B;  4KOU A;  1FY7 A;  4H6Z A;  2K5T A;  4L8A A;  3DR8 A;  1V0C A;  3F8K A;  3JVN A;  1Q2D A;  4OLL A;  3D2M A;  3CXQ A;  5IX3 A;  4XPK A;  2D4O A;  4NXY A;  3S4U A;  1XIX A;  4KOW A;  4EVY A;  4FI5 A;  1MJA A;  4RS2 A;  3FBU A;  1IB1 E;  3RYO A;  3K9U A;  3F0A A;  4XPD C;  5IV0 A;  4NSQ A;  3MXZ A;  1LVF A;  3R9G A;  1MJ9 A;  2X9Y A;  4J2C A;  3QUJ A;  4UA3 A;  1VKC A;  5KTC A;  2XTL A;  1PU9 A;  4NCZ A;  1VHS A;  3L3P A;  4H89 A;  4JXQ A;  4R3L A;  3R1K A;  2REF A;  4R3K A;  3CXP A;  2FIA A;  2VBQ A;  1B6B A;  3N7Z A;  3NE7 A;  2ZPA A;  1MJB A;  1TIQ A;  2JEV A;  2R7H A;  2JDD A;  4XNH B;  3TTH A;  4GS4 A;  2IL4 A;  4KOT A;  4E8O A;  1YLE A;  2PC1 A;  4CAW A;  2FT0 A;  3BJ8 A;  3MGD A;  3CXS A;  4KLW A;  3T90 A;  3DDD A;  4PSX A;  2VXK A;  1UFH A;  2PR1 A;  2RC4 A;  1N71 A;  2BUE A;  3ZJ0 A;  3EFA A;  4KOV A;  3R9E A;  2QML A;  3TO7 A;  2OH1 A;  2Z0Z A;  1PUA A;  4B5P B;  2CA5 A;  3DNS A;  5F47 A;  1S7F A;  1I21 A;  4DND A;  2Q4V A;  2OB0 A;  2JLM A;  3PP9 A;  4MI4 A;  2P6F A;  1KUV A;  1BOB A;  2BSW A;  3W91 A;  2OZG A;  5H86 A;  2FSR A;  3EY5 A;  2J8M A;  4ONU A;  4LUA A;  1S60 A;  4MJ8 A;  3LOD A;  2OZU A;  1MK4 A;  5E96 A;  2B3V A;  5F46 A;  3OWC A;  3F5B A;  3G3S A;  3SXN A;  2PQ8 A;  4JXR A;  2FE7 A;  2O28 A;  5C88 A;  2FS5 A;  3LD2 A;  4JWP A;  3EC4 A;  3FXT A;  4JJX A;  1M4D A;  5DWN A;  3B8G A;  2JDC A;  2ZXV A;  4NEX A;  1YVO A;  1ZKE A;  1WWZ A;  2MBG A;  4XPD B;  4AVB A;  3P7I A;  3TOB A;  1YRE A;  2X7B A;  4R87 A;  2WPW A;  3DSB A;  4QVT A;  3QK6 A;  2B4D B;  4MY3 A;  3FNC A;  1QSD A;  2PRB A;  3EO4 A;  4UWI A;  1Z0P A;  1IYK A;  1I1D A;  4AVA A;  5IB0 A;  5J8C A;  4E2A A;  2FIW A;  2I79 A;  3PGP A;  3R9F A;  3UY5 A;  2B3U A;  3S6K A;  2CNS A;  4R57 A;  4R9M A;  2FXF A;  3KKW A;  5HMN A;  3P2H A;  3IGR A;  4YFJ A;  4KVM E;  1BO4 A;  1S3Z A;  2J8R A;  3QAH A;  2CY2 A;  3FB3 A;  4CS0 B;  1KUX A;  5EBV A;  1XE4 A;  3E0K A;  5KTA A;  1QSR A;  2X9X A;  2KWH A;  3S6F A;  1M4G A;  1CM0 A;  3FIX A;  4U5Y A;  3SXO A;  2Y0M A;  3IWG A;  2ZW5 A;  4EYY R;  1S7L A;  3TCV A;  3DR6 A;  2B58 A;  3BJ7 A;  5H84 A;  4OAE A;  3TT2 A;  3R95 A;  1Y9K A;  4KUA A;  4CRY B;  4AG7 A;  3ZZI A;  4KZT A;  1GHE A;  5KTD A;  2OZH A;  4J3G A;  2K48 A;  1SQH A;  4JLY A;  1YVK A;  1L0C A;  4UBR A;  1Q2C A;  1YK3 A;  2B5G A;  5CNP A;  2FL4 A;  3GY9 A;  1Q2Y A;  3V8I A;  4BMH A;  1QSM A;  1M1D A;  4M85 A;  2P6G A;  3G8W A;  3SHP A;  3T9Y A;  2FCK A;  2B5G B;  3D3S A;  1IYL A;  2Q4Y A;  4L89 A;  2G0B A;  4FD5 A;  1IIC A;  1Z4R A;  1NMT A;  3W6S A;  2P0W A;  2ZW4 A;  2B4B A;  2VQY A;  4H6U A;  4B5P A;  2PDO A;  3FYN A;  4AVC A;  3TO6 A;  1IID A;  4UWJ A;  2OU2 A;  1NSL A;  2G0U A;  2BEI A;  2ZW7 A;  4KOS A;  2I00 A;  5C82 A;  4U9Z A;  4I49 A;  3TFY A;  2A4N A;  5DWM A;  1OZP A;  5JQ4 A;  2Q0Y A;  4YGO A;  1Y9W A;  1XMT A;  2R1I A;  5FVJ A;  1QSO A;  2DXQ A;  1CJW A;  1I12 A;  2HQY A;  4CAX A;  1H7C A; 
#chains in the Genus database with same CATH topology
 2D0T A;  5JDN A;  1FEW A;  2HPL A;  3KHZ A;  4LX9 A;  4GYS A;  1S35 A;  4PK5 A;  3PUA A;  5IHY A;  2YIN A;  3R96 A;  3PUV F;  2LSK A;  2Q04 A;  3CKD A;  3VAT A;  2DNX A;  2B4D A;  4UFW A;  5K8O A;  1HFA A;  2PJA A;  1HEE A;  4K30 A;  4B6X A;  1NE9 A;  5AG4 A;  4HWH A;  2VB6 A;  4LMK A;  1WR6 A;  4UCN A;  3LG7 A;  2PJ5 A;  2CLY C;  4NJR A;  2E9X C;  4II9 A;  5EMI A;  3NH4 A;  2XEG A;  5AG6 A;  2C5K T;  4MCR A;  5ABF B;  1U6M A;  2XQ9 A;  4C7I A;  4U33 A;  1M44 A;  4YJ2 E;  3D67 A;  4A33 A;  4CGL A;  3FX6 A;  2FJE A;  2F7V A;  5JQG E;  3CX8 B;  1KWM A;  1M62 A;  3AE3 A;  3FZM B;  1QSN A;  4QUS A;  5CB4 E;  2Y8D A;  2DWG A;  4HE8 A;  2D4P A;  3AEG A;  4XNH C;  3KR4 A;  4NGP A;  2VVN A;  3KAS A;  2CNT A;  4H2K A;  4CAV A;  3F31 A;  3SJF A;  2XSA A;  4EXT A;  1AJ3 A;  3CQC B;  5BMV E;  2X51 A;  1DTD A;  1UCU A;  4IE6 A;  4AKL A;  4IE0 A;  5HVF A;  2BDE A;  2NOX A;  4CI1 B;  3O1I A;  4B5O A;  3M65 A;  3C51 A;  4OAD A;  1IBK T;  2Q51 A;  4XPL A;  4KHZ F;  4O23 A;  4A98 A;  4AQF A;  4UIG A;  2HUZ A;  2E5V A;  5LYJ E;  2HC9 A;  5L4H A;  3PZJ A;  2HPJ A;  2VZY A;  4HPS A;  3S9M A;  4C2Z A;  3AAE B;  3D8P A;  3VAR A;  4B3M T;  1AUG A;  4NF1 A;  3IO1 A;  2ARH A;  2XSB A;  2HN1 A;  2J62 A;  4CAF A;  4MBU A;  3P2F A;  2Z3O A;  5J8F A;  1E1H B;  3C50 A;  1WK4 A;  4R8F A;  3BLN A;  3FXD B;  4U7I A;  3IC1 A;  3I9W A;  5FY0 A;  3VWD A;  2POK A;  2KMF A;  2G3A A;  1CHU A;  3FRM A;  4QBJ A;  4DR2 T;  3BI1 A;  3ZN0 B;  2AFU A;  5CPA A;  4TNV A;  4ZI3 D;  2AE6 A;  1A2Z A;  4ZY2 A;  3RQW A;  4RI1 A;  6CPA A;  2ATR A;  4MHD A;  1MIW A;  3CK6 A;  3AXJ A;  4YU9 A;  2YOE A;  4PK6 A;  2ZED A;  4LF6 T;  4AKH A;  3HKD E;  3RF1 A;  4IF5 A;  4QXC B;  1HNZ T;  2CBI A;  1HNW T;  3RHW A;  4OC1 A;  2REE A;  3VKG A;  5L3F B;  4DNC A;  2G3T A;  1BPN A;  1XNQ T;  2ZEO A;  4U3C A;  4EME A;  3A7M A;  1FNO A;  3LK3 B;  4OC5 A;  2MPK A;  4KOX A;  3H3M A;  4OX9 T;  4GKK T;  3WI3 A;  4UIA A;  4EIW A;  2WZN A;  3LDQ B;  4I50 E;  3P4P A;  3MKD A;  4NGS A;  5LG3 A;  1M4I A;  3LMS A;  2CF4 A;  3ZEF B;  3CPZ A;  1ZG8 A;  2LOS A;  3UU3 A;  1UWY A;  4KOU A;  3B2Y A;  2NW9 A;  2BKO A;  5LGU B;  1FJG T;  2KLQ A;  1QQ9 A;  5FMN A;  4L8A A;  2X0H A;  2ZEN A;  3DR8 A;  4X2T A;  4AIU A;  3CDX A;  2XEJ A;  4IDO A;  5IX3 A;  4Q25 A;  2D4O A;  4NXY A;  3S4U A;  4ZX8 A;  4AQF C;  2YDQ A;  4OHF A;  2W2U A;  2NSM A;  1Z2L A;  1MJA A;  4MCS A;  4FJO A;  1LKX A;  1VHE A;  4NGN A;  3ZT5 A;  1N32 T;  3RC8 A;  2W63 A;  4HFD A;  1DE4 C;  4UA3 A;  2W0G A;  4PXD A;  5JRE A;  3UU4 A;  3CX6 B;  4ADZ A;  3BXM A;  4W9Y A;  4H89 A;  2J1D G;  3NE8 A;  5AQV B;  3OYX A;  1ELL P;  4R3K A;  1ZP0 A;  1S94 A;  4TZ4 C;  3R6N A;  4UV8 B;  1B6B A;  3N7Z A;  4XNH B;  4WNK A;  3TTH A;  4GS4 A;  2XQY A;  1BR4 A;  2IL4 A;  1FMW A;  4QH1 A;  4JI0 T;  3ZMS B;  3K1S A;  2PC1 A;  3PB7 X;  4CAW A;  1U4Q A;  4A31 A;  3SS1 A;  3HLP A;  1WYB A;  4IDN A;  3GUX A;  1J5W A;  2PR1 A;  4CI2 B;  1XMQ T;  4YLH A;  3VKH A;  2I6H A;  1IU8 A;  5LHH B;  2XQ3 A;  4KOV A;  2YK0 A;  3L8R A;  4MAL A;  3R9E A;  2QML A;  4DBR A;  3Q5D A;  4A32 A;  4JUY A;  1YW6 A;  2Z0Z A;  5AFU L;  3PUR A;  2GFQ A;  2PJQ A;  4M6G A;  3N5F A;  2X67 A;  4DR3 T;  5HVH A;  2JLM A;  4MLK A;  3V5U A;  4ZI2 C;  1F2P A;  3NKZ A;  2Z6E A;  1BOB A;  4YSZ A;  3LJC A;  4GK0 E;  2OZG A;  3W91 A;  4P6Y A;  3Q9D A;  2NR4 A;  3ZMU B;  4U2Z A;  2J8M A;  3L39 A;  2Q9Q D;  3P4Q A;  3CT9 A;  3B7I A;  3EAB A;  1Z8W A;  2PG8 A;  1HG2 A;  2UUB T;  1CPS A;  1KF6 A;  3MJX A;  4B6Z A;  3PUX F;  5HWX A;  2XAQ B;  3VR9 A;  2RA1 A;  3PUY F;  3X1D A;  3G3S A;  3WAB A;  3PRT A;  4GIW A;  4O8S A;  3ZC1 A;  4NGR A;  3PUQ A;  4WBN E;  2O28 A;  3SI2 A;  2FS5 A;  3PUG A;  4DR5 T;  3LD2 A;  3EC4 A;  5J1G A;  3E08 A;  1OBR A;  5M4Y A;  4JLE A;  3CWZ B;  5JDQ A;  2ZXV A;  5LP6 E;  4PAG A;  3FJU A;  2XQ7 A;  3NFZ A;  2X0Y A;  4UFV A;  2WU5 A;  4X20 E;  3LK2 B;  3QK6 A;  5J0Z A;  4DJL A;  4MY3 A;  2CHO A;  2PRB A;  4YJ3 E;  3AE9 A;  5CGM A;  1Z0P A;  2PJ1 A;  3D7H A;  1I1D A;  4LQG A;  4AVA A;  5CA1 E;  4ILU A;  2ZEF A;  4NXM T;  2BG9 E;  1PCA A;  2I79 A;  2CE7 A;  2HN2 A;  3EDU A;  3C4X A;  3AE2 A;  4MFK A;  1WFD A;  4HN9 A;  2CNS A;  4HWI B;  4R9M A;  3LBX A;  2FXF A;  3KKW A;  3P2H A;  4ILB A;  4MBQ A;  4PFO A;  3EI0 A;  4HWF A;  3UU6 A;  1MMN A;  5HEO A;  3QOF A;  1BO4 A;  4F0X A;  2JMH A;  4H9N C;  5FXV A;  3B3V A;  3N9L A;  2JQ9 A;  3FB3 A;  2WMO A;  4CS0 B;  3OJA A;  1NEN A;  1XE4 A;  4UV9 B;  5KTA A;  4ZXL A;  4IE5 A;  3TLS A;  3FZF B;  1M4G A;  2MOZ A;  4R6T A;  1CM0 A;  4UXN B;  2P9B A;  5JVD E;  1YKH B;  2JRK A;  3DGV A;  4IAV A;  4HFE A;  1F2O A;  1JQG A;  2ZW5 A;  2DPT A;  2B58 A;  2H88 A;  3JCF A;  3P8C D;  4CXW A;  1QUU A;  5AQP B;  1WRD A;  1Y9K A;  4KUA A;  4EV6 A;  2YNE A;  4C2Y A;  1GHE A;  5KTD A;  5L2L A;  4TN7 B;  2BKP A;  2Z3N A;  2WMN A;  3ZN1 B;  1BAV A;  4JLY A;  1YVK A;  2QRX A;  4WWV A;  2K5B B;  3D7G A;  1YK3 A;  2B5G A;  5CNP A;  1VCS A;  3ZCI A;  2QVP A;  4FBE A;  2PJC A;  4K0K T;  5J2T E;  2E2A A;  2GK9 A;  5AQM B;  2CTC A;  4MRI A;  1JNZ A;  1XDP A;  3C64 A;  4P09 A;  4M85 A;  4UCP A;  4X64 T;  2JBK A;  3QB5 K;  3T9Y A;  3D3S A;  2WDV A;  1IYL A;  3RI5 A;  3KQZ A;  3ZJ1 A;  4H63 V;  2G0B A;  1IIC A;  3RIU A;  5AG5 A;  1Z4R A;  2V8H A;  1MMG A;  3PU8 A;  2ZW4 A;  2GLJ A;  4P44 A;  1LOK A;  2ABZ A;  4P4B A;  1TF8 A;  1XZY A;  3KHX A;  5LMN T;  2AFW A;  3I0O A;  4YSY A;  3FED A;  5HCJ A;  5LB7 B;  4ILC A;  3C98 B;  3TO6 A;  1MMA A;  2QJ8 A;  3FZH B;  4UWJ A;  2HB6 A;  1NSL A;  4K3N A;  1M4L A;  4KOS A;  3AB3 B;  4I49 A;  2DI4 A;  1Y0R A;  4OC0 A;  3ZST A;  2YN6 A;  5HXR A;  3JC6 C;  5K8P A;  4JYW A;  2V8V A;  3O1J A;  1UGO A;  2L9Q A;  4ZZB A;  5FVJ A;  3RPU A;  4CAX A;  3AEA A;  1ZLI A;  3KGQ A;  4WBO A;  4DMW A;  4EAH A;  3TC8 A;  1ARM A;  3UTK A;  4CAE A;  4CGO A;  5IWA T;  5IUX A;  4NFR A;  3LSV A;  2WBL A;  5DQV A;  3RYI E;  3GYA A;  2WCA A;  4ISS A;  3PFO A;  3RRC A;  1T8B A;  2V5C A;  1WLX A;  2N1G A;  2C27 A;  2X0L B;  4PJN A;  4QHO A;  1E7P A;  3PB8 X;  2KZ7 B;  4F6A A;  3PB4 X;  4ZI7 E;  2JQQ A;  4B10 A;  4MY0 A;  2Y6X A;  4FAI A;  5L3B B;  3BK9 A;  2YDS A;  2LE8 A;  3AE8 A;  4O2B E;  2QYV A;  2NW7 A;  3FF3 A;  1RXT A;  4FD7 A;  2V8D A;  4LF4 T;  2ACZ A;  2V26 A;  3EXN A;  2W66 A;  1I6Z A;  1XWM A;  2RB7 A;  2YNC C;  3KI9 A;  1CPX A;  4OC4 A;  2IMO A;  4DUZ T;  1KZF A;  4AXV A;  3AXJ B;  3TE4 A;  4TWF A;  1B7T A;  5F3J A;  4KOY A;  2WDQ A;  2W67 A;  3I0Q A;  1SUM B;  3TX8 A;  4E0A A;  1Z8U A;  4DO0 A;  2E9X D;  4KHP T;  3RYF E;  3EHZ A;  3UUN A;  4JI7 T;  1XJO A;  2GLF A;  3QNU A;  4KUB A;  3MK7 C;  4GXH A;  3WC6 A;  5HEH A;  4QX8 B;  5DQW A;  2QGS A;  4JZ0 A;  2M6I A;  2BBJ A;  1OXZ A;  4DR7 T;  2H7O A;  3KIN B;  4PNI A;  3OPC A;  2V6X A;  2WP9 A;  4YTM A;  4H9O C;  2P6E A;  2V77 A;  2UUA T;  3NVO A;  1Y7E A;  2J4G A;  4TWH A;  4R7M A;  2KSR A;  2BKN A;  4M3S A;  4F0Y A;  3ZC0 A;  3QB8 A;  2G9D A;  2H89 A;  5F49 A;  3PV0 F;  5JR9 B;  2EVN A;  3WR7 A;  3K3Q C;  4QX7 B;  5THW A;  1HR0 T;  2IHR 1;  4PXC A;  3CVR A;  2FJA A;  5FKY A;  4EEB A;  1CP6 A;  1YGH A;  4X3R A;  3WAJ A;  1YME A;  1J4J A;  4ZGY B;  4JI5 T;  2CWO A;  5AQT B;  4I4T E;  5KX5 E;  2LOP A;  1OED C;  5FL0 A;  4BAY B;  4MCQ A;  3HL6 A;  3EDV A;  2VQF T;  3P50 A;  4K0U A;  2FJB A;  2UU9 T;  2ODU A;  1KEY A;  3UUL A;  1QST A;  1RO5 A;  4PSW A;  4HNW B;  3OVU A;  4PW8 A;  2VUR A;  2J8N A;  1U5P A;  1TKJ A;  4A37 A;  2PSW A;  3RIU C;  4A5X A;  2AJ6 A;  4AQG A;  4XBF B;  2N2N A;  4AQY T;  4P1N A;  4U9Y A;  3NRX A;  4AIS A;  2XQ4 A;  5JDF A;  1T72 A;  3N5L A;  4YHJ A;  1YQ3 A;  2SPC A;  5AQN B;  2NTY A;  3KV4 A;  4KMC A;  2Q43 A;  5ISV A;  2M67 A;  3TO9 A;  4MFQ A;  2DL1 A;  3E0Z A;  4PJL A;  2PBI A;  3QC9 A;  2PJ0 A;  1XMO T;  5C3J A;  2WWU A;  4A94 A;  2EBJ A;  4EOZ B;  4RUH A;  2F5I A;  5KDM C;  1Z9U A;  4MHC A;  4MHZ A;  3RKG A;  4CQI A;  3SJG A;  2XAF B;  2XJ7 A;  4H6Z A;  3G06 A;  4DYO A;  2XPK A;  3ABV A;  3NRY A;  2CM0 A;  5H6R B;  4ERR A;  4OLL A;  3CXQ A;  5LG4 A;  1KNR A;  4H9R C;  4KOW A;  4FI5 A;  1XDO A;  4RS2 A;  2BO9 A;  3K9U A;  3F0A A;  1Z8T A;  4XPD C;  5IV0 A;  4JI6 T;  4NPP A;  5A27 A;  1MJ9 A;  2X9Y A;  3QUJ A;  4DBQ A;  1DU2 A;  4X1K E;  3HKB E;  4DV7 T;  3RGL A;  4G1P A;  2BG9 B;  5KTC A;  3KFW X;  4P0B A;  3L3P A;  3R1K A;  5CA0 E;  1HDQ A;  1LAM A;  4UIB A;  4B3R T;  5DAB A;  2JEV A;  1TXR A;  2R7H A;  2KXP B;  3CPA A;  5DS0 A;  1VCT A;  4QKN A;  2XAS B;  3C4W A;  2LKH A;  2H3R A;  1TF9 A;  3T8O A;  3CXS A;  2WWV A;  2C6C A;  3DDD A;  3GIU A;  3UUB A;  2VXK A;  5FYM A;  4ZEY A;  3AE7 A;  3D7F A;  2FUP A;  4ZZC A;  3ZJ0 A;  5LHG B;  4UVA B;  3S9L A;  2OH1 A;  2I0M A;  3MA9 A;  2XAG B;  2XQA A;  1PUA A;  3ZLI A;  1Y64 B;  4UEE A;  4PFP A;  3DNS A;  5F47 A;  1S7F A;  2OOT A;  1I21 A;  4DND A;  2DF5 A;  2OB0 A;  5L3D B;  2NWB A;  4M6H A;  2P6F A;  1KUV A;  4YSX A;  1HNX T;  3V7Z A;  2BSW A;  4AKR B;  2XHE B;  4ZS3 A;  4HFB A;  3AEC A;  5AQF B;  4LUA A;  3AA1 B;  2WQY A;  1S60 A;  4B14 A;  1XRY A;  3LOD A;  4YTP A;  1HDU A;  3CQX C;  1MK4 A;  4IGU A;  3ONL C;  5E96 A;  4MFZ A;  5G22 A;  4NUV A;  5I4M A;  4DID B;  4UEF A;  4DV6 T;  3SXN A;  3GA8 A;  4IL9 A;  1R3N A;  2LKG A;  3U3I A;  2A72 A;  2C0S A;  4TX5 A;  5C88 A;  4JWP A;  4H63 H;  4JJX A;  1M4D A;  4B12 A;  2XQ8 A;  2JQH A;  3B8G A;  1SA0 E;  3ZT7 A;  3FHN A;  2Q9Q C;  3RYC E;  1WWZ A;  4XPD B;  2ZEG A;  4AVB A;  5LYF A;  5HEJ A;  3N9Q A;  3P7I A;  2H7V C;  3TOB A;  3IWW A;  2WPW A;  4DV1 T;  3KVB A;  3KV6 A;  5ABE A;  1WYC A;  1D0Z A;  2BG9 C;  4IDP A;  1OED B;  3FNC A;  4WZX A;  3EO4 A;  3NH8 A;  4I0U A;  3NA6 A;  4AXP A;  3F2E A;  2BVM A;  5IB0 A;  5L3C B;  4E2A A;  2AFS A;  3PTR B;  3B3W A;  3ETU A;  2FIW A;  3ANW B;  2DPS A;  1CUN A;  4P4I A;  1YLO A;  3NH5 A;  2EO8 A;  2QA7 A;  3L2N A;  3UY5 A;  4A2Z A;  4U7Y A;  5HXE A;  5CBM A;  4UF4 A;  2ODV A;  2HH7 A;  3PU3 A;  3IGR A;  2OLT A;  2PJ7 A;  5FXZ A;  3AEE A;  2IUB A;  4KVM E;  1J5E T;  1US7 B;  1VIX A;  2IIU A;  3JAE A;  1IOF A;  2LHN A;  2CY2 A;  4ZOL E;  5EK2 A;  1KUX A;  5EBV A;  5LGN B;  5EK4 A;  1QSR A;  3K2K A;  1W09 A;  2X9X A;  3FEC A;  3S6F A;  2L3L A;  3DLJ A;  3FB2 A;  1LFW A;  3D68 A;  3FIX A;  1VOM A;  3SXO A;  3GMI A;  5LYI A;  2N9D A;  2Y0M A;  1YSJ A;  3IWG A;  2CCQ A;  3LFM A;  1S7L A;  4JI3 T;  3TCV A;  2JJ9 A;  3DR6 A;  1WCR A;  4IT4 A;  5H84 A;  4LMJ A;  4PPZ A;  4IDZ A;  2X66 A;  2WY2 A;  5L4E A;  3RIA A;  2WUU A;  3ZSS A;  4NJQ A;  3GLJ A;  2LRK A;  2OZH A;  1IBM T;  3SFE A;  1SQH A;  2E5L T;  2CMR A;  2FJD A;  1ZOY A;  2YNC A;  4TV9 E;  3GY9 A;  2ZM2 A;  5HVG A;  4P4E A;  1QSM A;  5LRG A;  3AE4 A;  3UT5 E;  2VK9 A;  3D7D A;  5LMU T;  4CYP A;  2CBJ A;  3KQX A;  2FCK A;  2Z3K A;  2B5G B;  1RTQ A;  4CYO A;  5C8Y E;  3H8F A;  5AQG B;  5AG7 A;  4LFB T;  2DHR A;  4FD5 A;  2AFZ A;  2BG9 A;  2XQ5 A;  1NMT A;  3W6S A;  4AI6 A;  4DUY T;  2ZM8 A;  2V7M A;  3HKE E;  4B5P A;  5LJM A;  1ZLH A;  2XQ6 A;  4MFJ A;  1IID A;  1N33 T;  5LNK A;  5TAO A;  2PE3 A;  1VHO A;  2G0U A;  2BEI A;  2ZW7 A;  4AKG A;  2I00 A;  5C82 A;  4O4I E;  4EB6 E;  3JAD A;  1OZP A;  5JQ4 A;  2Q0Y A;  4ZI3 C;  1XMT A;  5JDH A;  3WC5 A;  4UFX A;  2X68 A;  2DXQ A;  4ZX9 A;  1I12 A;  4FWU A;  2JPF A;  3ZMZ B;  4YWY A;  1D1A A;  5FL1 A;  4O4H E;  5LA6 E;  3OTO T;  4KLV A;  4JI4 T;  4JD6 A;  4HWD A;  3AVR A;  4Z90 A;  2GE3 A;  1Y01 A;  2GU2 A;  2MYS A;  5LCY A;  2Z3M A;  3WT4 A;  2ACX A;  1F57 A;  4HEA A;  2QIR A;  1NSA A;  1X9B A;  2XM1 A;  4CGN A;  3K3O A;  2H5M A;  2ES0 A;  4KVX A;  1W0B A;  3S9N A;  3HA4 A;  1ON0 A;  2GAN A;  3RYH E;  2VL1 A;  3I9S A;  1IJ6 A;  4X1Y E;  2AE9 A;  2IDO B;  4IUS A;  2QEC A;  4QC6 A;  3TLV A;  3C26 A;  3PJA A;  3FVL A;  2VKO A;  3AA7 B;  1E2A A;  1Z4E A;  1ARL A;  4Q36 A;  4NXN T;  1YXR A;  4O4J E;  1OED E;  2CXF A;  2PRQ A;  3U78 A;  3GWH A;  1IOI A;  2VEZ A;  3CX7 B;  4F8H A;  2C5J A;  1R57 A;  2ZEE A;  1IY7 A;  2MAW A;  3A8Y C;  5LGT B;  3T1Y T;  4QB9 A;  5D8N A;  2Z3L A;  2KWI B;  4ANJ A;  3FMC A;  4OYJ A;  1P0H A;  2XM2 A;  3IHR A;  2VI7 A;  4IE7 A;  1NAF A;  2WYR A;  5JTG A;  2ZLY A;  4BJN A;  2D9D A;  2IAK A;  4P4D A;  5FVK A;  3SFD A;  4L5G A;  3D4U A;  4PK3 A;  4LFA T;  4PXE A;  2F8H A;  1CP7 A;  5JPH A;  2CHN A;  2LHR A;  1K4J A;  1T7S A;  1UK5 A;  3PJA J;  3S6H A;  5CFB A;  1SE7 A;  3UFG A;  5EC4 A;  4ORF A;  4A97 A;  4BJM A;  1GYT A;  3DTO A;  3SOL A;  1CG2 A;  2R8V A;  4ZY0 A;  3PUW F;  4OK0 A;  2UXN B;  8CPA A;  4DR1 T;  2AFM A;  4PK2 A;  4H9P C;  5AQS B;  4NGT A;  4L0R A;  2OV9 A;  4PJJ A;  5K8M A;  1IBL T;  2EWB A;  3ZT6 A;  3N2K E;  4TNU A;  3S6G A;  3TOA A;  1FIO A;  5ETW A;  2K3W A;  3FZL B;  5FVL A;  1XF8 A;  5IB9 A;  5FY1 A;  2HHH T;  3J9X 1;  1YR0 A;  2IJZ A;  1PYT B;  4KVO E;  2CXL A;  3IJ3 A;  1Q7L A;  4MHY A;  2PJB A;  5FP3 A;  4MHN A;  4PV6 A;  5JM6 A;  4N78 D;  2PJ4 A;  5I0C A;  1R8I A;  4LML A;  4HKF A;  4KSI A;  4OIW A;  3H5Z A;  5GCN A;  3RX6 A;  4I55 E;  3MRU A;  5LRK A;  3MAC A;  3EVY A;  3WC7 A;  4OYK A;  4L9I A;  5AQQ B;  3FXE B;  2A3D A;  5F48 A;  1YW0 A;  2CXA A;  2V1D B;  3IF8 B;  1IJ5 A;  3B57 A;  2EUI A;  3W6X A;  4OKO A;  3B3C A;  3PEI A;  4X1I E;  2JEW A;  3VH9 A;  4QWN B;  2ZOF A;  4X62 T;  3H37 A;  1TKH A;  1B87 A;  3KBU A;  2PJ2 A;  5HEG A;  2LLY A;  5HWY A;  2JIW A;  2C6P A;  4KOR A;  3OKQ A;  2WM9 A;  5L47 A;  4MHP A;  1VGY A;  1FY7 A;  5A28 A;  4C91 A;  2K5T A;  2WDR A;  2D0U A;  4OC2 A;  4LFC T;  3W15 B;  3F8K A;  1Q2D A;  4A39 A;  4DR4 T;  4PJM A;  2V7L A;  4UEL A;  4WW0 A;  4X66 T;  5FXW A;  3ZMT B;  2K24 A;  1XIX A;  3K8P C;  1AYE A;  2KND A;  4EVY A;  2BOA A;  3FBU A;  2WAU A;  1SHZ C;  4H9Q C;  3R9G A;  5LBQ B;  4J2C A;  4ONW A;  5BR8 T;  4P4F A;  2V8G A;  2XTL A;  1LAN A;  1PU9 A;  4NCZ A;  2I59 A;  4JXQ A;  3IA3 A;  2VBQ A;  2ZPA A;  3NE7 A;  1MJB A;  1TIQ A;  3JTK A;  1ZG7 A;  4F9V A;  1MIV A;  1O3X A;  4HFH A;  1BR0 A;  2B76 A;  1ZHC A;  4KOT A;  3AAA B;  1YLE A;  3B3T A;  2VWA A;  4EZH A;  2FT0 A;  3IIB A;  2ZEH A;  3BJ8 A;  3MGD A;  4KLW A;  3P4S A;  5AQK B;  3L09 A;  2RC4 A;  1N71 A;  3P4R A;  3I1U A;  3ESL A;  2BUE A;  3B5M A;  2UXB T;  4Z65 A;  4X65 T;  4CN1 A;  1LCP A;  2BS3 A;  3EFA A;  1IZN B;  4TWD A;  1EE3 P;  3TO7 A;  5ABH A;  1QMU A;  2LM9 A;  3RLF F;  4CXX A;  4P10 A;  2Q7S A;  3PE0 A;  2EHO B;  4IHJ E;  3PDY A;  3ZPO A;  5HEU A;  1XMB A;  3RKO A;  1TKF A;  4MI4 A;  3UUM A;  2LT3 A;  1D1B A;  5F8P A;  2PIY A;  3Q5X A;  1X10 A;  2FSR A;  3GN5 A;  3EY5 A;  4ONU A;  3V5S A;  3HKC E;  4MJ8 A;  4E7Z A;  3FBZ A;  2OZU A;  3CPX A;  1M7K A;  2Y48 B;  5F46 A;  4G63 A;  4JBW F;  4LQ6 A;  3H3A A;  2V7K A;  3GB0 A;  3N9N A;  5AQI B;  4GYR A;  2IW5 B;  3N9M A;  1G8X A;  4LF8 T;  2FE7 A;  4DUK A;  2W00 A;  3FXT A;  2J47 A;  5DWN A;  3UQ7 A;  4JV5 T;  2JDC A;  1UUS A;  7CPA A;  3HR0 A;  1MNE A;  3ISZ A;  4JEU B;  3RRW A;  3CZX A;  2W62 A;  1L0V A;  3KVA A;  3CIR A;  2XAJ B;  4A30 A;  1XOV A;  4UEZ A;  3JAF A;  4UR9 A;  1YRE A;  3UUX B;  2EHO D;  2X7B A;  5LBM A;  4R87 A;  2XUE A;  3TLU A;  3DSB A;  4QVT A;  1ELM P;  3D66 A;  2B4D B;  2AXD S;  4UWI A;  1LVK A;  4QXH B;  4GM5 A;  4X5T A;  1LAP A;  4HGA A;  3KV5 A;  4IL4 A;  5H6Q B;  3ONX A;  2LM2 A;  1D0X A;  2IML A;  2CXD A;  2PTF A;  2XAH B;  5EZY E;  3RC3 A;  5J1Q A;  2B3U A;  1W0A A;  1D1C A;  4R57 A;  4HKA A;  5ADX L;  3ETV A;  4HTE A;  1D0Y A;  4YFJ A;  4F9U A;  3IBP A;  2YEV C;  4C2X A;  4R76 A;  1S3Z A;  2EK9 A;  4KI0 F;  3N2O A;  5LYL A;  1XBU A;  4GK5 E;  2MTQ A;  4BD9 A;  4DVD A;  5AQO B;  3AE1 A;  1Z8L A;  4IRE A;  2X9H A;  4KP3 C;  3Q5W A;  4KUM B;  3I1A A;  4U5Y A;  2NYQ A;  4E7S A;  4WJB A;  3SJE A;  2GRE A;  4M6I A;  3ZCJ A;  5EK3 A;  4WYV A;  3MN8 A;  1KNP A;  4LF9 T;  4OAE A;  4OC3 A;  4RN7 A;  2EHO C;  4YFS A;  4ILA A;  4I43 B;  3TT2 A;  1N34 T;  3N9P A;  2BCO A;  4EFD A;  4KZT A;  2LSG A;  2K48 A;  4B11 A;  4OFZ A;  4UBR A;  1N36 T;  3QB5 A;  5JR9 C;  1Q2Y A;  3C4Z A;  4V1A v;  2PVV A;  4G2A A;  1VRB A;  3V8I A;  4BMH A;  4TV8 E;  5JDM A;  4UVC B;  3G8W A;  3AED A;  3VRA A;  3T1H T;  3VU7 H;  4IHM A;  3AE6 A;  3A9L A;  3KR5 A;  2Q4Y A;  4UF0 B;  1I94 T;  4L89 A;  3M3Z B;  2VQE T;  2LEH A;  3RAM A;  4ZHQ E;  5JGF A;  2ZM0 A;  3F57 A;  2ZM6 T;  2P0W A;  4CGM A;  4P0A A;  2OA5 A;  2VQY A;  4H6U A;  4U31 A;  2VKH A;  4F8Z A;  3SWH A;  4UEM A;  2PDO A;  4CYN A;  5AQH B;  4AVC A;  3ZKR A;  2QVA A;  1MMD A;  3PFE A;  4DV3 T;  4DV5 T;  3E22 E;  2B1E A;  2V5D A;  2I3C A;  2FBW A;  5A1L A;  5C2T A;  4U9Z A;  4B3T T;  2NP9 A;  2A4N A;  4QH5 A;  4YGO A;  3V38 A;  4DV4 T;  4HFC A;  1Z8X A;  4OID A;  1QSO A;  4P4J A;  4KSA A;  1BR2 A;  4DV2 T;  1H7C A;  4MXU A;  5JH9 A;  3SRZ A;  4X8I A;  3Q2M A;  4O2A E;  3CML A;  4U72 A;  1IGB A;  3RZA A;  3GKR A;  3B3S A;  4KSF A;  5HH1 A;  2YU2 A;  3JUW A;  4Y49 C;  4LF7 T;  3OBV E;  1S5K A;  2E9X B;  4HWC A;  4M1P A;  1OED A;  2LSI A;  1V9D A;  4HNX B;  1X12 A;  2UXX B;  5LYD A;  2EK8 A;  2Q4Z A;  2WPX A;  1YD8 G;  3GN5 B;  1J1J A;  2RP4 A;  3BI0 A;  2A2F X;  2VL8 A;  2OR4 A;  4YRH A;  3BQK A;  2AFO A;  5J2U E;  5FXX A;  2CNM A;  1AMP A;  3QAY A;  4YXD A;  1LRZ A;  3LAC A;  2PIZ A;  4MMO A;  1KFY A;  2AFX A;  3PB9 X;  1UUR A;  2JBJ A;  2DCF A;  1XNR T;  2WSA A;  2KCW A;  3BQI A;  3NZQ A;  1R43 A;  2YND A;  3FEE A;  3LK4 2;  4YY3 T;  2ZW6 A;  4XAX B;  2HV2 A;  2J9A A;  4A95 A;  2Q44 A;  4EWT A;  2D2S A;  4FD6 A;  3HI2 A;  3DJB A;  1BLL E;  4PXB A;  3PBB A;  5ELY A;  2W4X A;  3OYZ A;  5K8N A;  3IFE A;  4UCM A;  2VZZ A;  3RNZ A;  2PR8 A;  5G20 A;  3VHL A;  1S7N A;  5FNV E;  4DR6 T;  2PJ8 A;  5HXC A;  2XEI A;  2ODF A;  3EAM A;  5IYZ E;  2NMT A;  3ISX A;  4JEH B;  3VWE A;  5HXH A;  1YKE B;  4AB7 A;  2VAS A;  2F4V T;  2BS4 A;  3KL9 A;  4COF A;  1KUY A;  4BBH A;  4FD4 A;  1BPM A;  5BWA B;  2CRB A;  4DMV A;  3N2G E;  2LJL A;  3VRB A;  1JWQ A;  5LRJ A;  4CN4 A;  4IK2 A;  4AG9 A;  3FZK B;  4X5K A;  2ZOG A;  3DP7 A;  3TKL B;  4IIJ E;  5LOV E;  2R98 A;  3H8G A;  4JI1 T;  3T8W A;  3B35 A;  2YKS A;  1YX0 A;  4Q38 A;  2IC6 A;  2V7I A;  4C90 A;  3PBE A;  2X9W A;  4CRZ B;  4PQA A;  5DJQ C;  5JR9 A;  4HNY B;  4OME A;  1W9R A;  2R6G F;  3RIF A;  2Z11 A;  5KXJ A;  1P4N A;  4NGQ A;  4EED A;  1HTJ F;  1NEK A;  2UXD T;  3CQG B;  1HCI A;  2O4H A;  4Z91 A;  1ZEE A;  2PJ6 A;  5ABG A;  4ZBG A;  4NGM A;  3IWE A;  4P45 A;  3ZYL A;  5G21 A;  1X79 A;  4IDQ A;  2C6G A;  2Q7B A;  4PK4 A;  3ZYK A;  2Z10 A;  4ZI6 A;  1ZV4 X;  1S7K A;  3RQU A;  2C5I T;  3I3G A;  2GIV A;  4CXY A;  3EUH A;  4U74 A;  2WZH A;  1H8L A;  3SJX A;  3D2P A;  1HS7 A;  2NW8 A;  2BL1 A;  1YQ4 A;  1XEB A;  2PFV A;  2IC9 A;  3H4Q A;  1Y7R A;  2WSS V;  3IU2 A;  4JI8 T;  2DWK A;  2QYW A;  2ZMA A;  4Y49 B;  2YGW A;  3VR8 A;  3RH3 A;  1IAP A;  2LSJ A;  3A5X A;  3AA6 B;  3H8E A;  1V0C A;  4OP4 A;  4EYU A;  3ZMV B;  3JVN A;  3D2M A;  4TWE A;  4CI3 B;  4XPK A;  4MFR A;  4O4L E;  1QLB A;  4CGP A;  1IB1 E;  3RO0 A;  3RYO A;  2Q9Q A;  4NSQ A;  3MXZ A;  4GOU A;  1LVF A;  3O9X A;  3D0T A;  2XZE A;  2UXC T;  2EHO A;  1VKC A;  5LJN A;  2VKJ A;  3R84 B;  5JH7 E;  2PJ3 A;  5AQR B;  4TUY E;  4DV0 T;  1GQE A;  3FH4 A;  1VHS A;  1JNR A;  4R3L A;  2REF A;  2NTX A;  3CXP A;  2FIA A;  1FT7 A;  5LXT E;  2CEA A;  4Q7A A;  2VVS A;  2JDD A;  1EZ3 A;  3LWU A;  3KDS E;  4E8O A;  2IQ6 A;  5LHI B;  2VL0 A;  4GKJ T;  4KS9 A;  3FBL A;  2ZEP A;  3T90 A;  3B13 A;  2JMK A;  2KT9 A;  4ZI2 D;  4PSX A;  1UFH A;  3IU1 A;  3BQL A;  3KBT A;  2W61 A;  4ZYQ A;  4MFP A;  2A9U A;  1HF8 A;  5E0O A;  2CTB A;  2V7J A;  5L3E B;  2UUC T;  5HYA A;  2YDR A;  2CA5 A;  4B5P B;  3ZYM A;  2LRL A;  2Q4V A;  3PP9 A;  2WB5 A;  3SI0 A;  3P4W A;  5G1Z A;  5HAX A;  3AEB A;  5H86 A;  2ANP A;  2Q9Q B;  4UVB B;  5HXD A;  5AGE A;  4F6R C;  5F09 A;  1BR1 A;  2JQK A;  3UU8 A;  2B3V A;  3OWC A;  5FY7 A;  3F5B A;  3ZJ2 A;  3AEF A;  5JDL A;  4A38 A;  3RBU A;  2CPT A;  3PUZ F;  3ONJ A;  4AKI A;  4HFV A;  5HXS A;  1OWA A;  4MCP A;  2PQ8 A;  4JXR A;  3AVS A;  2XEF A;  2PCU A;  1UX4 A;  1CX8 A;  2BS2 A;  4B13 A;  1HG5 A;  1KK7 A;  2K9A A;  3NBX X;  5KMG P;  3PB6 X;  4MFL A;  4CN6 A;  3KZW A;  4NEX A;  1YVO A;  2L8K A;  1ZKE A;  4CPA A;  2MBG A;  4FUU A;  2VKD A;  1YQE A;  3K9T A;  4KX6 A;  4NUU A;  2D5U A;  3ANW A;  2V8S V;  1QSD A;  5HCM A;  5JDG A;  2CWY A;  1CBX A;  1IYK A;  3HUV A;  3LBX B;  4A56 A;  4JYA T;  5J8C A;  1ZO0 A;  2WU2 A;  2CLY B;  5F5W A;  4JI2 T;  3AAI A;  5GON E;  3O1H A;  3PUS A;  4YT0 A;  3PGP A;  5D29 A;  3R9F A;  4BIN A;  3S6K A;  2DLR A;  2RPA A;  2V6Y A;  5HMN A;  3IEH A;  4B3S T;  5JRC A;  4Z8X A;  2J8R A;  3QAH A;  3WAK A;  3AE5 A;  4ASK A;  4YTN A;  1HX8 A;  1Z5R A;  3Q5E A;  3E0K A;  4H9S E;  4UF0 A;  2KWH A;  4C68 A;  4QH4 A;  2XY8 B;  1FMV A;  4CZZ B;  5AQU B;  3J7Y q;  1Y0Y A;  5AQL B;  2PVW A;  4U2Y A;  4EYY R;  2LSY A;  4NIQ A;  3UFE A;  1HX1 B;  3BJ7 A;  2PJ9 A;  3R95 A;  3NWI A;  2ZEL A;  4CRY B;  4AG7 A;  3ZZI A;  2E9X A;  4HFI A;  2DEA A;  3QNV A;  3JRU A;  1UX5 A;  4J3G A;  2E8I A;  5AQJ B;  4EGW A;  1L0C A;  1Q2C A;  2YU1 A;  2C1C A;  2RFH A;  2ZEM A;  2FL4 A;  2Z3P A;  3SI1 A;  4TNW A;  5JRC B;  1M1D A;  1KNZ A;  1G73 A;  3MZK B;  2P6G A;  4C7H A;  2O53 A;  3SHP A;  5CJ5 A;  2BVL A;  2V6Y B;  4XZC A;  4IST A;  5L3G B;  3BHX A;  2BZB A;  4ZY1 A;  4EZ4 A;  3JC6 D;  3UQ4 A;  4LF5 T;  3N9O A;  4BA9 A;  2B4B A;  2KIN B;  3O4X E;  3AA0 B;  5ABF A;  1T98 A;  1MND A;  3KV9 A;  4QXB B;  3FYN A;  1YW4 A;  1WR0 A;  4ZS2 A;  2BBH A;  3TLW A;  1NWM X;  2FVG A;  4CYQ A;  4KBM B;  3NZP A;  1XFO A;  2OU2 A;  4IE4 A;  3IEE A;  3TFY A;  4YHH T;  5DWM A;  3I9Y A;  3TLT A;  1Y9W A;  1ZG9 A;  2R1I A;  2WS3 A;  2WZI A;  3K3N A;  1CJW A;  2HQY A;  2M6B A;  1MIY A;  2CIJ A;  3UU5 A; 
#chains in the Genus database with same CATH homology
 2D0T A;  5JDN A;  1D1A A;  1FEW A;  3Q2M A;  4O2A E;  4WBO A;  3CML A;  4DMW A;  4EAH A;  4U72 A;  3UTK A;  4O4H E;  5LA6 E;  4CAE A;  2HPL A;  4LX9 A;  3GKR A;  4CGO A;  4GYS A;  1S35 A;  4PK5 A;  4KLV A;  4JD6 A;  4KSF A;  2YU2 A;  3JUW A;  5HH1 A;  3AVR A;  3PUA A;  2WBL A;  5DQV A;  5IHY A;  2YIN A;  3R96 A;  2GE3 A;  2LSK A;  3RYI E;  3OBV E;  2Q04 A;  2MYS A;  5LCY A;  1S5K A;  4ISS A;  2E9X B;  2ACX A;  3CKD A;  4M1P A;  2Z3M A;  3RRC A;  2DNX A;  2B4D A;  4UFW A;  2LSI A;  1V9D A;  1HFA A;  4HEA A;  4HNX B;  2QIR A;  2UXX B;  1WLX A;  2N1G A;  4MI4 A;  2C27 A;  4K30 A;  2X0L B;  4B6X A;  4PJN A;  4QHO A;  2WPX A;  1YD8 G;  3GN5 B;  1NE9 A;  2RP4 A;  5AG4 A;  2VB6 A;  2A2F X;  2KZ7 B;  2VL8 A;  3K3O A;  1WR6 A;  2H5M A;  2ES0 A;  3LG7 A;  4KVX A;  4ZI7 E;  4UCN A;  2JQQ A;  4B10 A;  4MY0 A;  2Y6X A;  4YRH A;  3BQK A;  5L3B B;  3BK9 A;  2CLY C;  3HA4 A;  5FXX A;  5J2U E;  1ON0 A;  2GAN A;  2LE8 A;  2E9X C;  4O2B E;  2CNM A;  3RYH E;  4II9 A;  2NW7 A;  3I9S A;  1RXT A;  1IJ6 A;  3PP9 A;  4FD7 A;  4X1Y E;  5AG6 A;  2C5K T;  2V26 A;  5IV0 A;  1LRZ A;  3EXN A;  3TFY A;  1U6M A;  2QEC A;  4IUS A;  4QC6 A;  3C26 A;  4C7I A;  2YNC C;  1M44 A;  4YJ2 E;  2DCF A;  4A33 A;  1KZF A;  4CGL A;  2VKO A;  3AA7 B;  3TE4 A;  2WSA A;  5JQG E;  1B7T A;  3CX8 B;  1Z4E A;  3BQI A;  3NZQ A;  5F3J A;  2KCW A;  4KOY A;  4Q36 A;  2YND A;  3LK4 2;  3I0Q A;  2CXF A;  4O4J E;  3U78 A;  2ZW6 A;  3GWH A;  4XAX B;  2HV2 A;  1QSN A;  2VEZ A;  3CX7 B;  4A95 A;  4QUS A;  5CB4 E;  2Y8D A;  4E0A A;  2DWG A;  4HE8 A;  2Q44 A;  2C5J A;  4DO0 A;  2E9X D;  2D4P A;  2D2S A;  4FD6 A;  3HI2 A;  1R57 A;  4XNH C;  3DJB A;  3RYF E;  4QB9 A;  3UUN A;  5LGT B;  2CNT A;  4CAV A;  3F31 A;  2Z3L A;  2KWI B;  4ANJ A;  4OYJ A;  3OYZ A;  3MK7 C;  4KUB A;  1P0H A;  2ZW4 A;  4UCM A;  4QX8 B;  5DQW A;  4EXT A;  4ZGY B;  2QGS A;  1AJ3 A;  2VZZ A;  3IHR A;  2PR8 A;  2VI7 A;  5G20 A;  3CQC B;  4IE7 A;  1OXZ A;  3VHL A;  2H7O A;  2X51 A;  3KIN B;  4PNI A;  1UCU A;  1NAF A;  4IE6 A;  5FNV E;  4AKL A;  4IE0 A;  5HXC A;  1S7N A;  2BDE A;  5IYZ E;  2NOX A;  4H9O C;  2ZLY A;  4BJN A;  2IAK A;  4CI1 B;  3O1I A;  2NMT A;  2P6E A;  4B5O A;  3M65 A;  4JEH B;  3C51 A;  3VWE A;  5HXH A;  1YKE B;  4AB7 A;  2VAS A;  4OAD A;  4L5G A;  4XPL A;  4PK3 A;  4AQF A;  4UIG A;  5BMV E;  5JPH A;  2HUZ A;  4M3S A;  1KUY A;  2LHR A;  5LYJ E;  3ZC0 A;  1K4J A;  4FD4 A;  4BBH A;  4F0Y A;  4DMV A;  5BWA B;  3N2G E;  2LJL A;  3QB8 A;  3S6H A;  3PZJ A;  2HPJ A;  5F49 A;  4AG9 A;  4X5K A;  3DP7 A;  2VZY A;  4C2Z A;  5JR9 B;  3TKL B;  4IIJ E;  5LOV E;  2EVN A;  2R98 A;  4ORF A;  5EC4 A;  3AAE B;  4BJM A;  3WR7 A;  3DTO A;  3K3Q C;  3SOL A;  4QX7 B;  3D8P A;  2R8V A;  4OK0 A;  2UXN B;  4NF1 A;  1YX0 A;  2ARH A;  4Q38 A;  2IC6 A;  2V7I A;  3CVR A;  4PK2 A;  4H9P C;  4C90 A;  4Y49 C;  4MBU A;  4CAF A;  1YGH A;  4L0R A;  2X9W A;  3WAJ A;  3P2F A;  4CRZ B;  1J4J A;  4PJJ A;  1E1H B;  2CWO A;  3C50 A;  5DJQ C;  5JR9 A;  1WK4 A;  3N2K E;  2Z3O A;  4HNY B;  3BLN A;  3FXD B;  3S6G A;  3TOA A;  3I9W A;  5FY0 A;  1FIO A;  3VWD A;  4I4T E;  5ETW A;  2KMF A;  2Z11 A;  2G3A A;  3FRM A;  1P4N A;  4QBJ A;  5KX5 E;  2LOP A;  4BAY B;  1XF8 A;  3HL6 A;  3EDV A;  5FY1 A;  4K0U A;  3ZN0 B;  3J9X 1;  1YR0 A;  1HTJ F;  4KVO E;  2CXL A;  4ZI3 D;  3CQG B;  2AE6 A;  5FP3 A;  2ODU A;  1HCI A;  3UUL A;  1QST A;  1ZEE A;  1RO5 A;  2ATR A;  4PV6 A;  4HNW B;  4PSW A;  4RI1 A;  4ZBG A;  4N78 D;  4MHD A;  4PW8 A;  2J8N A;  3IWE A;  5I0C A;  1MIW A;  1U5P A;  4HKF A;  3ZYL A;  2PSW A;  2AJ6 A;  3H5Z A;  5G21 A;  4PK6 A;  4AQG A;  1X79 A;  5GCN A;  4AKH A;  3HKD E;  2N2N A;  4I55 E;  3RX6 A;  4QXC B;  4XBF B;  4IF5 A;  2Q7B A;  4PK4 A;  3ZYK A;  4U9Y A;  3MAC A;  2Z10 A;  2REE A;  3NRX A;  4XPD C;  3VKG A;  1ZV4 X;  3EVY A;  5JDF A;  5L3F B;  2C5I T;  1S7K A;  3I3G A;  3N5L A;  4DNC A;  4OYK A;  4L9I A;  2GIV A;  4YHJ A;  4CXY A;  3FXE B;  2A3D A;  3EUH A;  2SPC A;  2G3T A;  5F48 A;  4U74 A;  2NTY A;  1YW0 A;  2CXA A;  2V1D B;  3IF8 B;  3KV4 A;  4KMC A;  1IJ5 A;  3B57 A;  2EUI A;  2M67 A;  3W6X A;  5ISV A;  3TO9 A;  3LK3 B;  3D2P A;  1HS7 A;  4KOX A;  4MFQ A;  3E0Z A;  4PJL A;  4X1I E;  2NW8 A;  2PBI A;  3QC9 A;  4QWN B;  2BL1 A;  3WI3 A;  3H37 A;  1XEB A;  2PFV A;  2IC9 A;  4EIW A;  3H4Q A;  2WWU A;  1B87 A;  2WSS V;  4I50 E;  1Y7R A;  3IU2 A;  3MKD A;  4EOZ B;  2F5I A;  1M4I A;  5KDM C;  3KBU A;  1Z9U A;  2DWK A;  5HWY A;  4MHC A;  3ZEF B;  4CQI A;  3CPZ A;  2LOS A;  4KOR A;  3OKQ A;  2WM9 A;  4Y49 B;  2ZMA A;  2YGW A;  2XAF B;  4KOU A;  1FY7 A;  2NW9 A;  5LGU B;  4C91 A;  3RH3 A;  2KLQ A;  4H6Z A;  5A28 A;  5FMN A;  2K5T A;  4L8A A;  1IAP A;  2LSJ A;  2D0U A;  3A5X A;  3AA6 B;  3NRY A;  1V0C A;  3DR8 A;  4EYU A;  3W15 B;  3ZMV B;  2CM0 A;  5H6R B;  4ERR A;  1Q2D A;  3F8K A;  3JVN A;  4OLL A;  3D2M A;  3CXQ A;  4PJM A;  2V7L A;  5IX3 A;  4CI3 B;  4UEL A;  4MFR A;  4WW0 A;  4XPK A;  5LG4 A;  5FXW A;  3ZMT B;  2D4O A;  4NXY A;  3S4U A;  2K24 A;  4AQF C;  1XIX A;  3K8P C;  4OHF A;  4H9R C;  2KND A;  4O4L E;  4KOW A;  4FI5 A;  4EVY A;  1MJA A;  4RS2 A;  3FBU A;  4CGP A;  1IB1 E;  2WAU A;  3RYO A;  3K9U A;  4FJO A;  3F0A A;  1LKX A;  1SHZ C;  2Q9Q A;  4NSQ A;  4H9Q C;  3MXZ A;  4GOU A;  1LVF A;  3O9X A;  3RC8 A;  2W63 A;  5LBQ B;  1MJ9 A;  2X9Y A;  3D0T A;  4J2C A;  3R9G A;  3QUJ A;  5A27 A;  2EHO A;  4DBQ A;  4X1K E;  1VKC A;  4UA3 A;  2W0G A;  3HKB E;  5LJN A;  2VKJ A;  3R84 B;  5JH7 E;  5JRE A;  4ADZ A;  3CX6 B;  5KTC A;  2XTL A;  1PU9 A;  3KFW X;  4NCZ A;  4TUY E;  4P0B A;  2I59 A;  1VHS A;  3L3P A;  4H89 A;  4JXQ A;  4R3L A;  2J1D G;  3R1K A;  2REF A;  3OYX A;  4R3K A;  2NTX A;  5CA0 E;  3CXP A;  2FIA A;  1S94 A;  4TZ4 C;  3R6N A;  5LXT E;  2VBQ A;  4UV8 B;  1B6B A;  3N7Z A;  5DAB A;  2ZPA A;  3NE7 A;  1MJB A;  2CEA A;  1TIQ A;  2JEV A;  2R7H A;  3JTK A;  1MIV A;  1O3X A;  1EZ3 A;  2KXP B;  2JDD A;  1BR0 A;  4XNH B;  4WNK A;  3TTH A;  4GS4 A;  2XQY A;  1ZHC A;  3KDS E;  1BR4 A;  4QKN A;  2IL4 A;  4KOT A;  1FMW A;  4E8O A;  2XAS B;  3AAA B;  5LHI B;  3C4W A;  3ZMS B;  1YLE A;  2PC1 A;  2VWA A;  2H3R A;  1U4Q A;  4EZH A;  2FT0 A;  4CAW A;  4KS9 A;  4A31 A;  3SS1 A;  3BJ8 A;  3FBL A;  3T8O A;  3CXS A;  3MGD A;  4KLW A;  1WYB A;  3T90 A;  3B13 A;  2JMK A;  2KT9 A;  3L09 A;  4ZI2 D;  2VXK A;  3DDD A;  1UFH A;  4PSX A;  3IU1 A;  5FYM A;  4CI2 B;  2PR1 A;  4YLH A;  1N71 A;  2RC4 A;  3VKH A;  3ESL A;  3BQL A;  3KBT A;  2BUE A;  5LHH B;  2W61 A;  3ZJ0 A;  3EFA A;  4KOV A;  1IZN B;  4MFP A;  2YK0 A;  1HF8 A;  4MAL A;  5E0O A;  5LHG B;  4UVA B;  2QML A;  3R9E A;  4DBR A;  2OH1 A;  3TO7 A;  3MA9 A;  4A32 A;  4JUY A;  2XAG B;  2V7J A;  5L3E B;  2Z0Z A;  1PUA A;  5HYA A;  2LM9 A;  3ZLI A;  2CA5 A;  3PUR A;  5AFU L;  1Y64 B;  4CXX A;  4B5P B;  4PFP A;  2PJQ A;  3ZYM A;  3DNS A;  5F47 A;  3PE0 A;  1S7F A;  2EHO B;  2X67 A;  3PDY A;  4IHJ E;  3ZPO A;  4DND A;  1I21 A;  2OB0 A;  2JLM A;  4MLK A;  3RKO A;  2NWB A;  3UUM A;  3V5U A;  4ZI2 C;  2LT3 A;  5L3D B;  1KUV A;  2P6F A;  1D1B A;  2Z6E A;  1BOB A;  2BSW A;  4AKR B;  2XHE B;  5F8P A;  5G1Z A;  4ZS3 A;  3LJC A;  3Q5X A;  4GK0 E;  5HAX A;  2OZG A;  3W91 A;  5H86 A;  3Q9D A;  3GN5 A;  2FSR A;  2J8M A;  3ZMU B;  3EY5 A;  4ONU A;  3V5S A;  2Q9Q B;  2Q9Q D;  3AA1 B;  3HKC E;  4UVB B;  1S60 A;  4LUA A;  4MJ8 A;  3LOD A;  4B14 A;  5AGE A;  3CQX C;  4E7Z A;  3FBZ A;  2OZU A;  1MK4 A;  2PG8 A;  4IGU A;  1HG2 A;  4F6R C;  5E96 A;  1BR1 A;  4MFZ A;  2Y48 B;  5G22 A;  2B3V A;  4NUV A;  3OWC A;  5F46 A;  5FY7 A;  3MJX A;  4G63 A;  3F5B A;  3ZJ2 A;  3H3A A;  2V7K A;  5HWX A;  5JDL A;  2XAQ B;  2RA1 A;  4GYR A;  2IW5 B;  4AKI A;  4HFV A;  3GA8 A;  1OWA A;  3N9M A;  5HXS A;  3G3S A;  2PQ8 A;  3SXN A;  4JXR A;  3AVS A;  4GIW A;  1G8X A;  2A72 A;  2C0S A;  4O8S A;  3U3I A;  3ZC1 A;  2FE7 A;  4TX5 A;  1UX4 A;  2W00 A;  3PUQ A;  4WBN E;  2O28 A;  4B13 A;  5C88 A;  2FS5 A;  3PUG A;  3LD2 A;  4JWP A;  4H63 H;  3EC4 A;  3FXT A;  4JJX A;  5J1G A;  3E08 A;  1M4D A;  1HG5 A;  1KK7 A;  5M4Y A;  5DWN A;  4B12 A;  2K9A A;  3NBX X;  5KMG P;  3B8G A;  4JLE A;  2JDC A;  3CWZ B;  5JDQ A;  2ZXV A;  3HR0 A;  4MFL A;  1MNE A;  5LP6 E;  1SA0 E;  4PAG A;  4NEX A;  4JEU B;  2L8K A;  3FHN A;  3RRW A;  1YVO A;  1ZKE A;  2Q9Q C;  2W62 A;  3RYC E;  3KVA A;  1WWZ A;  4UFV A;  2MBG A;  2XAJ B;  4XPD B;  4AVB A;  4A30 A;  3N9Q A;  3P7I A;  2H7V C;  1YRE A;  2VKD A;  3TOB A;  3UUX B;  2EHO D;  2X7B A;  5LBM A;  4R87 A;  2XUE A;  2WPW A;  3DSB A;  4QVT A;  4NUU A;  2D5U A;  3ANW A;  4X20 E;  3KVB A;  3LK2 B;  3KV6 A;  3QK6 A;  1WYC A;  2Q4V A;  1D0Z A;  2B4D B;  4MY3 A;  3FNC A;  1QSD A;  2PRB A;  3EO4 A;  1LVK A;  4QXH B;  4UWI A;  4YJ3 E;  4AXP A;  1Z0P A;  2CWY A;  5JDG A;  1IYK A;  4HGA A;  3KV5 A;  3F2E A;  2BVM A;  3ONX A;  5H6Q B;  5CA1 E;  1I1D A;  4AVA A;  5IB0 A;  3LBX B;  4A56 A;  5L3C B;  5J8C A;  4E2A A;  3PTR B;  4ILU A;  3ETU A;  1D0X A;  1ZO0 A;  2FIW A;  2CLY B;  2CXD A;  3ANW B;  1CUN A;  2DPS A;  2XAH B;  5EZY E;  2QA7 A;  2I79 A;  3AAI A;  5GON E;  3O1H A;  3PUS A;  3PGP A;  2CE7 A;  3RC3 A;  3EDU A;  3C4X A;  3R9F A;  3UY5 A;  2B3U A;  4MFK A;  3S6K A;  4A2Z A;  4HN9 A;  2CNS A;  2DLR A;  1D1C A;  4R57 A;  4HKA A;  5ADX L;  5HXE A;  3LBX A;  4R9M A;  3ETV A;  2FXF A;  3KKW A;  4HTE A;  2ODV A;  5HMN A;  2HH7 A;  3PU3 A;  4MBQ A;  3IGR A;  3P2H A;  4PFO A;  1D0Y A;  5FXZ A;  4YFJ A;  4KVM E;  3IBP A;  1US7 B;  1MMN A;  2YEV C;  5JRC A;  1BO4 A;  4C2X A;  1S3Z A;  2JMH A;  4H9N C;  4F0X A;  3N2O A;  4Z8X A;  5FXV A;  2J8R A;  3QAH A;  2LHN A;  3N9L A;  2CY2 A;  3WAK A;  2WMO A;  4ZOL E;  5EK2 A;  4GK5 E;  2MTQ A;  4ASK A;  3OJA A;  3FB3 A;  4CS0 B;  1HX8 A;  1KUX A;  5EBV A;  1XE4 A;  4UV9 B;  4DVD A;  5LGN B;  3E0K A;  5EK4 A;  1QSR A;  5KTA A;  4H9S E;  4IE5 A;  2X9X A;  4UF0 A;  2KWH A;  4C68 A;  2X9H A;  3S6F A;  1M4G A;  4KP3 C;  2L3L A;  2MOZ A;  3Q5W A;  1FMV A;  3FB2 A;  3I1A A;  4KUM B;  4CZZ B;  1CM0 A;  4UXN B;  2P9B A;  3FIX A;  3J7Y q;  1VOM A;  4U5Y A;  3SXO A;  3GMI A;  5JVD E;  1YKH B;  2JRK A;  2N9D A;  2Y0M A;  4E7S A;  3IWG A;  2ZW5 A;  3ZCJ A;  2CCQ A;  5EK3 A;  4EYY R;  2DPT A;  2LSY A;  3LFM A;  1S7L A;  3TCV A;  2JJ9 A;  4F6A A;  3DR6 A;  2B58 A;  3UFE A;  3BJ7 A;  5H84 A;  4OAE A;  2EHO C;  4IDZ A;  2X66 A;  3P8C D;  4YFS A;  4I43 B;  4CXW A;  3TT2 A;  3R95 A;  1QUU A;  3N9P A;  2WUU A;  1WRD A;  1Y9K A;  4KUA A;  4CRY B;  2YNE A;  3ZZI A;  2E9X A;  4KZT A;  4AG7 A;  1GHE A;  4C2Y A;  4CGN A;  5KTD A;  5L2L A;  2OZH A;  4TN7 B;  2LSG A;  2Z3N A;  2WMN A;  1UX5 A;  4J3G A;  2K48 A;  4B11 A;  2E8I A;  1SQH A;  3ZN1 B;  4OFZ A;  4JLY A;  1YVK A;  1L0C A;  4UBR A;  1Q2C A;  2YU1 A;  2CMR A;  2K5B B;  1YK3 A;  2B5G A;  5CNP A;  2YNC A;  2FL4 A;  4TV9 E;  3GY9 A;  5JR9 C;  1Q2Y A;  3C4Z A;  2ZM2 A;  3ZCI A;  4V1A v;  2Z3P A;  5J8F A;  5J2T E;  4G2A A;  1VRB A;  3V8I A;  2GK9 A;  1QSM A;  4TV8 E;  4BMH A;  3UT5 E;  2VK9 A;  5JRC B;  3C64 A;  4P09 A;  1G73 A;  3MZK B;  1KNZ A;  1M1D A;  2P6G A;  5JDM A;  4M85 A;  4UVC B;  3G8W A;  4UCP A;  4CYP A;  4C7H A;  3SHP A;  3T9Y A;  2FCK A;  2Z3K A;  2BVL A;  2B5G B;  3D3S A;  1IYL A;  3VU7 H;  4XZC A;  4IST A;  5L3G B;  3A9L A;  4CYO A;  5C8Y E;  2Q4Y A;  4UF0 B;  3ZJ1 A;  4L89 A;  2LEH A;  5AG7 A;  4H63 V;  2DHR A;  2BZB A;  2G0B A;  4ZHQ E;  4FD5 A;  1IIC A;  4EZ4 A;  2ZM0 A;  3JC6 D;  5AG5 A;  1Z4R A;  1NMT A;  3W6S A;  1MMG A;  3F57 A;  3PU8 A;  2P0W A;  4CGM A;  4P0A A;  4AI6 A;  3N9O A;  4BA9 A;  2B4B A;  2KIN B;  2OA5 A;  2ZM8 A;  3O4X E;  2V7M A;  3AA0 B;  2VQY A;  4H6U A;  1T98 A;  2VKH A;  3HKE E;  1MND A;  3I0O A;  3SWH A;  4UEM A;  4B5P A;  5LJM A;  3GYA A;  3KV9 A;  4QXB B;  2PDO A;  3FYN A;  4CYN A;  4AVC A;  3C98 B;  4MFJ A;  1MMA A;  1MMD A;  3TO6 A;  4ZS2 A;  1IID A;  4UWJ A;  1NWM X;  5LNK A;  4CYQ A;  3E22 E;  2B1E A;  5TAO A;  4KBM B;  3NZP A;  2OU2 A;  1NSL A;  5A1L A;  2G0U A;  2BEI A;  2ZW7 A;  4AKG A;  4KOS A;  4IE4 A;  3AB3 B;  3IEE A;  2I00 A;  4I49 A;  2DI4 A;  4U9Z A;  2NP9 A;  4O4I E;  5C82 A;  4EB6 E;  3I9Y A;  2A4N A;  5DWM A;  1OZP A;  5HXR A;  5JQ4 A;  3JC6 C;  2Q0Y A;  4YGO A;  4ZI3 C;  1XMT A;  1Y9W A;  5JDH A;  2R1I A;  3O1J A;  3K3N A;  4UFX A;  2L9Q A;  2X68 A;  1QSO A;  3RPU A;  2DXQ A;  1CJW A;  5FVJ A;  1I12 A;  2HQY A;  1BR2 A;  4KSA A;  4CAX A;  1MIY A;  1H7C A;  3SRZ A;  3N9N A;  2JPF A;  3ZMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...