1LRZA

X-ray crystal structure of staphylococcus aureus fema
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
412
structure length
400
Chain Sequence
MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic inhibitor
molecule keywords factor essential for expression of methicillin resistance
publication title X-ray crystal structure of Staphylococcus aureus FemA.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 137
structure length 400
sequence length 412
ec nomenclature ec 2.3.2.17: N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N(6)-glycyl)-D-alanyl-D-
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02388 FemAB FemAB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1lrzA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA02
3EXNA 4RI1A 2VXKA 3UY5A 2IC6A 4UA3A 1L0CA 4CAWA 3N7ZA 4FD6A 1B6BA 1YVOA 4AVBA 2VBQA 4H6UA 1B87A 2A4NA 2ZPAA 3TOAA 3R9EA 2BUEA 3K9UA 4NF1A 4KLVA 4IF5A 3BJ8A 4QBJA 4CS0B 2K48A 4KLWA 5EC4A 4LX9A 2B3VA 4OLLA 4DNCA 1MJBA 1OZPA 1IJ5A 1R57A 4M85A 5GCNA 3DDDA 4OAEA 2FS5A 2Z10A 3S6GA 5HMNA 4U5YA 2B58A 4XPDC 5ISVA 4ORFA 3C26A 3N5LA 3I3GA 2P6FA 1Z9UA 3W91A 1CJWA 4BMHA 2FL4A 2B5GA 3T9YA 1YGHA 3P2HA 3ZZIA 3S6KA 4B5PB 2G0UA 3S6FA 2ZXVA 2R98A 4R87A 2QMLA 2CNMA 3DSBA 3F0AA 3TTHA 2X7BA 3D2PA 3DR8A 1IJ6A 3R96A 1Q2DA 4U9YA 3P7IA 4JD6A 1S3ZA 4IUSA 3FIXA 2KWHA 4NEXA 1M1DA 3QK6A 1S5KA 2CNTA 2G3AA 2PSWA 3FXTA 1PUAA 1Q2CA 3FBUA 3PP9A 1FY7A 3TFYA 3E0KA 2AJ6A 1M4GA 2WPXA 2Q7BA 1IYLA 1V0CA 4AG9A 1YK3A 3WR7A 2CY2A 4FI5A 2AE6A 4FD5A 2VI7A 4KOYA 4KUBA 4J2CA 2KCWA 4XPLA 4EYYR 1I1DA 3FB3A 3D2MA 3FNCA 4MJ8A 4KOVA 2REFA 5C88A 1P0HA 1WWZA 3GKRA 3RYOA 2IL4A 4XPDB 4PK3A 1M44A 2G3TA 4B5OA 5CNPA 2J8NA 3TE4A 2OZGA 4KVXA 4HKFA 2BSWA 1YREA 2XTLA 1XEBA 2X9XA 3TO6A 3CKDA 4H6ZA 3P2FA 2P0WA 2C5KT 3EO4A 1Z0PA 4F6AA 2PR1A 4QC6A 3GY9A 4KOTA 3QUJA 1QSMA 4U9ZA 3R9GA 1KZFA 4YRHA 2ARHA 1IYKA 2FCKA 3FRMA 3OWCA 1QSNA 3IGRA 4II9A 4MBUA 1KUXA 1Z4RA 4JLYA 2I00A 4QUSA 1S7KA 3QAHA 3JVNA 4XPKA 4R3LA 4AB7A 3I9SA 3IWGA 1GHEA 4OADA 2ZW5A 1LVFA 2ZW4A 3DR6A 2BEIA 5F46A 3VWEA 2HV2A 3G8WA 4QB9A 4B5PA 2R8VA 3EY5A 1RXTA 3TCVA 5C82A 1M4DA 1YLEA 2D4OA 4MHDA 4CRZB 1MJAA 1Y9WA 4AVCA 2CNSA 2R1IA 4H89A 4UWJA 2X9WA 1Y9KA 4PK2A 4YFJA 4KORA 3S6HA 4YGOA 3SXOA 1S60A 2G0BA 1I12A 3VWDA 2PRBA 1Z4EA 4JXRA 1UFHA 2GE3A 2CA5A 4E2AA 3CXPA 3LODA 3W6SA 2NMTA 5F49A 2DXQA 2PR8A 1QSRA 4Y49B 5F48A 3TOBA 2O28A 2JDCA 2VEZA 5KTAA 2JLMA 2P6GA 3D3SA 5KTCA 2P6EA 1XE4A 4ONUA 1BO4A 4CAXA 1QSTA 1YX0A 3R1KA 4B6XA 5DWMA 1P4NA 4EVYA 1Y7RA 4GS4A 4MY0A 4CAVA 2JEVA 2VZYA 3R9FA 2Q0YA 2JDDA 1NSLA 2FE7A 3FXEB 4FD4A 4KOSA 1NMTA 4M3SA 3R95A 4K30A 1IIDA 4FD7A 5JPHA 4NCZA 4RS2A 5E96A 2B4BA 1IB1E 5IX3A 4KOXA 2RC4A 4KZTA 1ON0A 4UBRA 3PGPA 5JQ4A 4CQIA 1PU9A 2QECA 4PSXA 1U6MA 3V8IA 4ZBGA 2Z0ZA 4JJXA 4Y49C 1K4JA 5H86A 2EVNA 5DWNA 3MGDA 4KOUA 4R3KA 1SQHA 1MK4A 3QB8A 1S7FA 4R57A 4R9MA 4PV6A 4L8AA 2B3UA 2FXFA 4I49A 2GIVA 2OH1A 3TKLB 1XF8A 1Q2YA 3JUWA 2H5MA 2OB0A 2FIAA 1M4IA 2B4DB 1LRZA 5HH1A 2REEA 5FVJA 5I0CA 2OZHA 4MI4A 3MXZA 4UWIA 4KVME 1TIQA 2HUZA 4JWPA 3NE7A 3PZJA 3F5BA 3ZJ0A 2VQYA 4CRYB 1S7NA 3B8GA 4PSWA 2HQYA 3D8PA 4E0AA 2R7HA 1YR0A 2F5IA 2EUIA 1KUYA 3TO9A 4NXYA 3L3PA 2D4PA 2OZUA 4KOWA 2X9YA 2FIWA 1QSDA 2PQ8A 1H7CA 2Q44A 1KUVA 1I21A 2PC1A 4F0YA 2I79A 2Y0MA 4L0RA 3W6XA 4JXQA 2FSRA 2ZW7A 5IB0A 1YVKA 5H84A 3SXNA 5J8FA 2MBGA 3CXQA 3G3SA 2ZW6A 1XIXA 4AVAA 2PDOA 5F47A 2C5IT 5KTDA 1NE9A 2FT0A 4HNYB 1BOBA 3F8KA 3S4UA 5IV0A 5J8CA 4XNHB 4DNDA 4KUAA 3CXSA 2Q4VA 1CM0A 1J4JA 2KWIB 4HNXB 4J3GA 2B5GB 3DNSA 4L89A 3FYNA 3EC4A 4HNWB 4NSQA 2QIRA 2GANA 4E8OA 2OU2A 1QSOA 3T90A 4AG7A 2C5JA 3CVRA 3BLNA 3TO7A 3BJ7A 2C27A 2VZZA 1XMTA 2J8RA 2IC9A 3GYAA 2B4DA 4KVOE 3EFAA 3KKWA 2Q4YA 4LUAA 1VHSA 1WK4A 4MY3A 1IICA 4X5KA 3TT2A 2BL1A 2J8MA 4QVTA 1ZKEA 2Z11A 3SHPA 3LD2A 1N71A 1VKCA 3H4QA 2WPWA 2ATRA 3FXDB 2Q04A 1MJ9A 2K5TA 4XNHC 5EBVA 1S7LA 1RO5A
chains in the Genus database with same CATH superfamily
4NGRA 1SHZC 2F4VT 4H63V 2YINA 4G2AA 2W0GA 2YOEA 4IDPA 3KBTA 5AGEA 5IHYA 2FJEA 4LMLA 3B35A 4EIWA 2KSRA 4Q38A 4Q25A 1IU8A 3LWUA 2Q9QB 4ZI2C 4NPPA 4H6UA 4U31A 2QJ8A 4A33A 2JQHA 4IL4A 3PUSA 4CYQA 2XQ5A 3F31A 4NF1A 3ONLC 4NFRA 3BJ8A 3U3IA 5KDMC 2O4HA 2E5VA 3N9OA 2CLYC 4JV5T 1BR0A 5HEUA 4LX9A 2B3VA 2EK9A 1CHUA 2ODFA 2DWKA 4KUMB 3D68A 1YQ3A 2ZELA 1R57A 2HH7A 3GUXA 4X5TA 4OAEA 2PJ7A 4NUUA 4U5YA 4ZY0A 2B58A 5HXRA 4ORFA 4AIUA 4O4LE 2X51A 3KQXA 3FZHB 3SI1A 3I3GA 4N78D 1OEDE 4Z91A 1NWMX 4BMHA 1YW6A 1Z8WA 3T9YA 4R8FA 4MMOA 1YGHA 3ZZIA 4B5PB 4YXDA 4E7ZA 5DQWA 4YHJA 2XJ7A 3NRXA 2QMLA 3DSBA 2W61A 3N9LA 4ADZA 2X7BA 3D2PA 4U3CA 3DR8A 1IJ6A 4UF4A 4EB6E 2J4GA 3CK6A 1Q2DA 3P7IA 1FNOA 4IL9A 4JD6A 1S3ZA 2PG8A 1IZNB 4EZ4A 4Z65A 2KWHA 4CGOA 4NEXA 3ZMSB 1HTJF 1XDOA 5FY7A 4TZ4C 4AISA 1NAFA 4DR4T 4F8HA 2DWGA 5LXTE 4FWUA 3FXTA 2V7IA 4NGTA 3WC5A 5AQIB 3E0KA 3H37A 2AJ6A 1YK3A 4DR3T 1R8IA 5FY0A 1D0YA 2VI7A 4ZX8A 1GYTA 5DJQC 3T1YT 3N2KE 4J2CA 1J5ET 1MNEA 3CIRA 3IC1A 4DBRA 2XQ3A 2PJ8A 4AQFA 2REFA 4HFEA 1WWZA 1UX4A 1BR4A 2IL4A 2CE7A 4W9YA 2KT9A 3PURA 1UURA 5HVGA 5L4HA 2Z3MA 5LYJE 4B3MT 5TAOA 5CNPA 1FMVA 3RPUA 4A98A 2Q9QA 3K9TA 1XZYA 4PJNA 1YMEA 1Z0PA 2LOSA 4F6AA 3BQIA 2PR1A 5LRKA 3FVLA 3PV0F 4AKIA 4KOTA 3QUJA 5JR9B 2WB5A 2YGWA 1D0XA 3PBEA 1I94T 5ABEA 4KI0F 2KMFA 4HFIA 3OWCA 3C4WA 2VQET 2BOAA 2AFUA 3ZMUB 2LHRA 5EK4A 4MBUA 1Z4RA 5DABA 2I00A 2JMHA 3ZMVB 4F8ZA 1UK5A 3QAHA 3JVNA 3KBUA 4TNWA 3OBVE 4CYPA 3J9X1 2VL8A 3O1HA 2ZW5A 4Q7AA 3A7MA 2L9QA 2BCOA 1LVFA 2HHHT 2ZW4A 2XEJA 4UIGA 5L47A 3D7DA 2N2NA 4B5PA 2R8VA 1Y7EA 5LYIA 3SJEA 4CGPA 3TCVA 2ODUA 4F0XA 3VATA 5C82A 4GYSA 2D4OA 3T8OA 2ZM8A 4NGNA 3MK7C 3OYXA 4Z90A 2ZEDA 4H89A 5ADXL 4EYUA 5AQNB 2CEAA 3TLUA 2G0BA 2GLJA 4YT0A 2XQ6A 4E2AA 5AQSB 5JDGA 2PBIA 2WU5A 3H3MA 3HA4A 3W6SA 4YLHA 5F49A 4X65T 4Y49B 3TOBA 4HEAA 5CB4E 3C4ZA 3RIAA 2LM9A 3N2GE 4KSAA 4ONUA 4CAXA 4IE7A 1XBUA 5AG5A 4ZEYA 4B6XA 3CX6B 4WW0A 5CGMA 3VARA 3UU3A 4IIJE 4JUYA 4UELA 5EK2A 4GKJT 2Q0YA 1ELLP 3PUGA 3PB6X 2X0YA 2PVWA 3R95A 3WABA 4K3NA 5JPHA 3H8EA 4LFCT 2WU2A 1F2OA 3I9YA 5E96A 4ZZCA 4ZI3D 2X0LB 2C6PA 3NRYA 4DR1T 3DGVA 4M6HA 3VH9A 2XAHB 2IHR1 4H9SE 3AA0B 4UBRA 4JEUB 5JR9A 4CQIA 4AKHA 1PU9A 4IK2A 3KV6A 2QECA 2IQ6A 2YU1A 1IAPA 5LG4A 2NOXA 3FBLA 4ZBGA 4UFWA 3KQZA 4JJXA 2DCFA 3D66A 3B5MA 1K4JA 3GLJA 2CCQA 2ANPA 3ZYLA 1HEEA 1S7FA 3JC6C 1Z5RA 2NR4A 4R9MA 3BK9A 3CX7B 4L8AA 4I49A 2GIVA 3K1SA 5C3JA 1XF8A 4IE0A 2H5MA 2Q9QD 5LG3A 4LF5T 2FIAA 4R6TA 2Z6EA 3PE0A 1M4IA 3ONXA 2M6BA 2JJ9A 1LRZA 4LF8T 2DF5A 2PFVA 2D0TA 2REEA 4A38A 2M6IA 2OZHA 1HX8A 1LVKA 5LBMA 1ZP0A 3ISZA 1MIYA 2ACXA 5AG7A 1RTQA 3HKEE 1UX5A 4CXYA 2IDOB 3ZYKA 3WC7A 3F5BA 3JTKA 2SPCA 4DMWA 2VQYA 3D67A 2LRLA 3CPXA 4P09A 3MRUA 3ETVA 1YR0A 1KUYA 3TO9A 4I55E 4CN1A 1IBKT 3SFDA 4DV6T 3L3PA 4X3RA 4ILBA 4C2ZA 3Q5WA 4K0UA 2LLYA 2CXFA 3EHZA 4WBNE 2Q44A 2PC1A 5GONE 2I79A 1HG5A 2JBJA 3A9LA 2HPLA 3W6XA 3FEDA 2FSRA 2ZW7A 3B3CA 2XEFA 5HEHA 4JZ0A 5IB0A 3RIUA 2Y8DA 3H3AA 2V77A 5H84A 5G21A 3PU8A 2CRBA 2PJ6A 4JI2T 3CXQA 1PCAA 4JI1T 3ZEFB 1VRBA 2ZW6A 1N33T 2AE9A 2WSSV 2W62A 2C5IT 2E9XC 2CBIA 2QVPA 1WYBA 4GKKT 3C50A 5HYAA 3RH3A 2V7KA 3UUBA 4H63H 3S4UA 5J8CA 1T8BA 3PBBA 1KNPA 1JWQA 2J9AA 4TNUA 5LBQB 4ZYQA 3P50A 3AE9A 1XNQT 1CM0A 1NEKA 1GQEA 3C64A 3NVOA 4HNXB 1OBRA 4YTNA 5JH7E 4ZY1A 2C0SA 3EC4A 4ILUA 1HX1B 4NSQA 1WR6A 1Z8LA 5H6RB 2CTCA 2Z3PA 4C7IA 4EGWA 2OU2A 3RYHE 3T90A 2DPTA 4IHJE 5AG6A 3KVBA 5FMNA 4TV8E 5K8OA 2WAUA 3BJ7A 6CPAA 1AUGA 2CHNA 4XBFB 2C27A 5IB9A 2E2AA 2XM1A 2CLYB 2NYQA 2LSGA 3RRWA 2WMNA 2GREA 2AFOA 4KX6A 5JDMA 3KVAA 4HWHA 3CWZB 5AQOB 5AQMB 2MYSA 3RBUA 5G1ZA 3GN5A 3RYFE 3IEHA 1N71A 3WI3A 4MCPA 3H4QA 2ATRA 3FXDB 3SRZA 8CPAA 1S7LA 1RO5A 2FJAA 2XQYA 4DBQA 3UY5A 2IC6A 4UA3A 2O53A 3KV5A 5JREA 4LMJA 3WT4A 5LYDA 5DS0A 4B13A 4PAGA 2PJ2A 4LF7T 4UFVA 4HFVA 4O4JE 2PJ3A 1B6BA 4LF6T 1YVOA 1ZG8A 2LSYA 5HWXA 3N9QA 1VHEA 2H88A 4P6YA 4IF5A 2LEHA 2BZBA 1IOFA 4P0BA 4QXHB 2QA7A 2VKOA 4LMKA 4KLWA 3I0OA 1KF6A 2LSJA 4MFRA 3RNZA 2CTBA 4OLLA 5LRGA 4DR2T 3O1JA 2NSMA 1OZPA 1IJ5A 1E2AA 3B13A 4M85A 3AA6B 5GCNA 3DDDA 2FS5A 4KSFA 4WBOA 4AKRB 3N5LA 4IT4A 2PJ5A 2WBLA 2FL4A 1Z8XA 5IWAT 2XSBA 1OWAA 2BG9B 2ZMAA 5BMVE 4E7SA 1MMNA 3Q5EA 2Q4ZA 2ZXVA 3S6FA 3ZT5A 3RKGA 2UXCT 2R98A 4R87A 2CNMA 3DJBA 3VKHA 2IW5B 3F0AA 3IIBA 1KNRA 2WP9A 4A32A 3F2EA 1SA0E 3RC3A 2QYVA 2V6YB 4YJ2E 2K5BB 1A2ZA 2L3LA 2V7LA 4AQGA 2VL1A 4IDQA 2RFHA 4I50E 1O3XA 1HNWT 1MIVA 1M1DA 4CN4A 4OC3A 5G22A 1G8XA 3AE2A 4CAFA 1OEDC 2RP4A 1S5KA 2G3AA 4ONWA 1L0VA 3BI0A 3UU6A 1PUAA 3TFYA 3RF1A 4A5XA 1M4GA 1V0CA 1Y0YA 5LHIB 2NW8A 4MFKA 2CY2A 3NH8A 4EAHA 4FD5A 4YSZA 2JMKA 1I6ZA 1US7B 2V8SV 4Q36A 4HPSA 3UFEA 3DTOA 3FB3A 4IREA 3PJAA 5C88A 1P0HA 1B7TA 4OC2A 3RYOA 2PIZA 1Z8UA 4XPDB 4PK3A 1M44A 2KZ7B 2G3TA 3PUXF 4UEZA 4B5OA 5K8MA 2OZGA 4KVXA 2BSWA 2PJ0A 3TO6A 4IDOA 3PUAA 4H6ZA 2VASA 3VR8A 2VVSA 2JEWA 3ZCIA 4CGNA 2RPAA 4BAYB 4QC6A 5HXDA 3S9NA 3WAJA 1QSMA 4U9ZA 2LSIA 4ZS2A 2WZNA 2YNDA 4MHPA 4MALA 1WLXA 4YRHA 2A72A 3MJXA 5D8NA 1IYKA 1QSNA 3CQXC 3VRBA 2PCUA 2H89A 5JDNA 1YSJA 4UEMA 3R6NA 1OXZA 2I59A 4XPKA 4LF9T 2YEVC 5FP3A 2YNCC 1GHEA 3F57A 4A56A 2YDSA 1NSAA 1ZEEA 3RIFA 3O1IA 3PB9X 2D5UA 4WYVA 3SJXA 1IBMT 2BG9A 2E5LT 2ZM6T 2ZM2A 1IY7A 4KHPT 2NW7A 1XJOA 5JM6A 1M4DA 4KHZF 4XAXB 3L09A 2RA1A 1MJAA 2LSKA 4NGQA 4FBEA 2V6YA 3AE1A 3S6HA 4YGOA 3PJAJ 3SXOA 1IOIA 4FJOA 3E22E 4JXRA 2ZEOA 3Q5DA 4EXTA 3JRUA 4JI0T 5K8NA 3L2NA 3IHRA 5CJ5A 1HF8A 4XZCA 5D29A 2ACZA 5EMIA 5AQGB 2N1GA 5A27A 5L3DB 2JDCA 2VEZA 5KTAA 2WCAA 5HXSA 4GXHA 4DUYT 2W66A 4WNKA 2WUUA 2CF4A 4TWDA 1BO4A 5THWA 4PFOA 3UUXB 1QSTA 5JDLA 4ZI2D 3E08A 2XASB 1D1CA 1XMQT 3EI0A 3EDUA 2I0MA 2FVGA 2UU9T 1Y7RA 4A97A 2JEVA 1UUSA 4JYAT 2BS4A 4JI4T 2K9AA 2XQAA 4OHFA 3TLVA 2EWBA 2PJCA 2XUEA 3DP7A 3B2YA 4MHYA 4UEEA 1NSLA 2WWUA 2FE7A 3FXEB 4KOSA 1NMTA 3RQWA 2GFQA 4AXVA 4ASKA 2JRKA 3B7IA 4BJMA 1BPNA 2BS3A 2CBJA 2ZEHA 5JRCB 2B4BA 1IB1E 3CZXA 4EEDA 5IX3A 2M67A 2JPFA 3R84B 1W09A 4BJNA 3LBXB 3O9XA 2RC4A 2ODVA 1TF9A 2AFSA 2PJAA 3PGPA 5JQ4A 1ZO0A 4PSXA 1Q7LA 4DJLA 3V8IA 4MLKA 2Z0ZA 1HDQA 3OPCA 5H86A 2MOZA 1DU2A 4R3KA 4UCNA 1MK4A 4GIWA 1XDPA 4R57A 2ZEEA 5JDFA 2B3UA 4P4FA 3TKLB 3GMIA 2JBKA 2JQKA 5FKYA 4B3TT 3S9LA 2E9XB 3IO1A 4P4IA 3ZSTA 3ZC0A 5FVJA 2JIWA 4OK0A 2CM0A 2AFMA 5LGTB 2JQ9A 3U78A 4IDZA 1LAMA 1N36T 3N2OA 2HUZA 3AE6A 4AQYT 3PZJA 4A2ZA 3ZJ0A 5AQJB 2XHEB 1HDUA 2Q7SA 5AQUB 4CYNA 1XWMA 2H7VC 4QH4A 1WR0A 2HQYA 3T1HT 1ELMP 2R7HA 1YXRA 4MFPA 1AJ3A 1W9RA 1R3NA 3JADA 4NXYA 4F9VA 2Y6XA 2FIWA 4DV4T 4WJBA 1H7CA 4LQGA 1YKEB 2XEGA 4CGLA 2R6GF 1KUVA 3AVRA 4F0YA 5HCJA 2Y0MA 2V8HA 2JQQA 3RZAA 3V5UA 3ZT6A 2POKA 2X68A 3SOLA 5JVDE 1YVKA 4ZI7E 5BR8T 4P4DA 1YLOA 3LK2B 2PDOA 2XZEA 2UUCT 5KTDA 4JI5T 2WS3A 3CQCB 3V7ZA 5K8PA 5LYLA 1N34T 4PNIA 1BOBA 2XQ7A 2HC9A 3F8KA 4IE4A 5IV0A 5JRCA 4PXBA 2HN2A 1X79A 3GA8A 1XFOA 3LBXA 2BKNA 1SUMB 4JI7T 1KNZA 3L8RA 3FZFB 1XMOT 4EFDA 4IE5A 4J3GA 2B5GB 4MFJA 5HAXA 3FYNA 2EHOC 2QIRA 2VKHA 2GANA 4NGPA 3BHXA 3X1DA 2VB6A 3B3VA 5LJNA 2C5JA 3CVRA 1VCSA 1Y01A 3QOFA 1BR2A 2A2FX 3KHZA 2VZZA 5C2TA 1XMTA 3SS1A 1CX8A 3D7GA 1QLBA 3RQUA 1KFYA 4KVOE 2E9XA 3KKWA 3LJCA 3S9MA 3ZLIA 2Q4YA 4HGAA 4LUAA 3RC8A 5A28A 4MRIA 3QC9A 5HCMA 5HXHA 5L3BB 1XNRT 4JLEA 5LGNB 2XSAA 1YQEA 3TT2A 4BA9A 2J8MA 2WZHA 4O8SA 5LRJA 2C6GA 2Z3NA 5HVHA 4P44A 2BKPA 3CT9A 3SWHA 3N9PA 4TUYE 3IU2A 2PJQA 4V1Av 4U72A 5JGFA 4OC1A 4YSXA 4JI6T 2UXXB 4O2AE 4R76A 2BO9A 3UU8A 2CXLA 2FJBA 1ZV4X 3GN5B 3LMSA 1JNRA 3N7ZA 3P4PA 4FD6A 3ZPOA 4GK5E 3AAAB 3OYZA 4UR9A 5IUXA 3ISXA 4AVBA 4PXCA 5L2LA 2IUBA 5AQPB 1B87A 2A4NA 2ZPAA 3TOAA 2EHOD 3R9EA 1OEDB 4KLVA 5JQGE 4X66T 5HEGA 1H8LA 2ZENA 4QBJA 4F6RC 3B57A 4OMEA 4CS0B 4QHOA 2VQFT 2K48A 1AMPA 5EC4A 1HNXT 2WM9A 3SI0A 2YKSA 2WYRA 4TWEA 4B11A 3AEDA 2MTQA 2W4XA 2XEIA 4RUHA 2ZOFA 2Z10A 5HMNA 3N9NA 5ISVA 4ANJA 3C26A 2P6FA 3RO0A 3W91A 3JC6D 3TLTA 1ZLHA 4ZGYB 2BS2A 1JQGA 1M62A 2IAKA 5FL1A 2B5GA 3P2HA 2VURA 1ZHCA 2LJLA 2WSAA 2V8GA 3AE3A 3NKZA 1W0AA 2V5CA 2DEAA 4O4IE 5CA1E 5F8PA 4AKLA 3PTRB 2PRQA 3TTHA 4QH5A 5LOVE 4DR6T 3IWWA 2V7JA 3R96A 4U9YA 3AB3B 5AFUL 1QUUA 5FYMA 4UVAB 4YY3T 3D7FA 4X1IE 4CN6A 3NZPA 1J1JA 2P9BA 2Z3LA 3V38A 4DUKA 4U2YA 4HWCA 2WPXA 1ZG9A 2Q7BA 4AG9A 4UV8B 2LE8A 2CPTA 2H7OA 1XMBA 4FI5A 2AE6A 1Z8TA 3P4WA 2NTYA 4MHNA 5AQHB 4KOYA 4KP3C 4U33A 4TV9E 4KUBA 3MA9A 4XPLA 2W2UA 2YN6A 4KOVA 2C1CA 4H9OC 4YHHT 2EBJA 3GKRA 3K2KA 3GIUA 2V5DA 3V5SA 4F9UA 1CUNA 3CX8B 2J8NA 1LFWA 4HKFA 4TWFA 1YREA 3CDXA 2E9XD 4MHCA 3PUVF 1IBLT 2C5KT 1CBXA 4R7MA 3N9MA 2NW9A 2WMOA 3FHNA 2CWYA 1OEDA 4DR5T 2CXDA 4UV9B 1TKFA 2Z3KA 4JYWA 2YDRA 3KR5A 1BR1A 5A1LA 2ARHA 4PK4A 2I6HA 2FCKA 3HKBE 3PUWF 2XAGB 3FRMA 4HWFA 3NWIA 3FECA 3VKGA 2ZEGA 4JLYA 4K0KT 4HTEA 1S7KA 3HR0A 4R3LA 3I9SA 1QMUA 3IWGA 1M4LA 2LHNA 3KI9A 2KXPB 3UUNA 4ZXLA 1AYEA 4DUZT 5L4EA 2N9DA 3VWEA 1TF8A 2HV2A 5AQQB 4CPAA 4EV6A 1RXTA 3FF3A 4B3ST 3AE7A 1YLEA 3IF8B 2PJ1A 3FEEA 2BVLA 3TC8A 3RKOA 4QH1A 2CNSA 3MKDA 2WDQA 3PB4X 3UFGA 1Y9KA 4PK2A 4YTPA 4X8IA 4CXWA 4YFJA 4TX5A 2AFWA 2J47A 4QX7B 4PJJA 1FJGT 1I12A 2IJZA 3VWDA 4B6ZA 2XQ9A 3CQGB 4GK0E 2LOPA 3TLWA 3WAKA 3CXPA 3LODA 3RYIE 4IHMA 1VGYA 2NMTA 1LOKA 1YQ4A 3PU3A 2LKHA 4P4BA 5F48A 5FVLA 2O28A 4CXXA 3QAYA 3AAIA 4P4EA 2VWAA 4O4HE 5ETWA 5HVFA 3P8CD 4O2BE 3D3SA 2YNCA 5KTCA 2P6EA 1XE4A 4L9IA 5FXXA 3VRAA 3IJ3A 1CPSA 2XQ4A 3AEAA 4UIBA 1V9DA 4KBMB 5FXVA 3K3OA 4JI3T 5HXCA 2QYWA 2UUBT 5FL0A 1YW4A 4M6GA 4P45A 1P4NA 2CXAA 4EVYA 2DNXA 3HKCE 4P1NA 1CPXA 4UFXA 3FH4A 2ZEFA 2JDDA 1E1HB 4C90A 3CPZA 4WWVA 1BLLE 4FD4A 5IYZE 2XAQB 4HE8A 3ZC1A 1IIDA 2X66A 3Q9DA 3C4XA 2DLRA 1XOVA 1QQ9A 4UVCB 5AQVB 4IGUA 4RS2A 4WZXA 5AQLB 4EEBA 2V8VA 3KFWX 1UWYA 2G9DA 5LHGB 4AKGA 5EK3A 1LCPA 3KINB 4OP4A 2F8HA 4KOXA 3MZKB 3VR9A 4KZTA 5JH9A 2V26A 2DI4A 4HFDA 4DR7T 5AG4A 3RX6A 2MAWA 4TN7B 3IU1A 4RN7A 1VIXA 3NZQA 1U6MA 5KXJA 3AA7B 3UQ4A 5J2TE 2BBJA 2IMLA 4FUUA 4OC4A 1U5PA 5DWNA 3MGDA 4KOUA 3ABVA 4H2KA 1SQHA 1TXRA 4C7HA 3J7Yq 2F7VA 3QB8A 4ERRA 5LMNT 4DV7T 4PV6A 3KR4A 2OOTA 2OH1A 1Q2YA 1R43A 3JUWA 1F57A 2ZEPA 2OB0A 2HB6A 4QKNA 1G73A 2YNEA 2ZOGA 3NBXX 4LFAT 4CZZB 2B4DB 3PUYF 2UXDT 5HH1A 1SE7A 2BDEA 4NXMT 1Y64B 5E0OA 1ZG7A 4MI4A 3MXZA 1MMGA 4GYRA 4M6IA 4KVME 2VK9A 4JWPA 4HKAA 2V1DB 3C98B 1S7NA 3ZN0B 4PSWA 5M4YA 4CGMA 4GOUA 3D8PA 4CYOA 2LKGA 5LA6E 3AEEA 3EABA 2F5IA 2AFZA 2EHOB 2Q43A 2PJ4A 5L3FB 4KMCA 3ZKRA 3AAEB 1QSDA 2PQ8A 3FZLB 2V8DA 3LG7A 4A94A 4UCMA 1HFAA 4JEHB 2WZIA 3UU4A 2HPJA 2GLFA 3FMCA 3D7HA 1S94A 2D9DA 4ZOLE 2OA5A 1ARLA 4LFBT 3SXNA 5J8FA 2MBGA 4DV2T 2ZEMA 2XQ8A 4YU9A 4OIDA 4NJQA 3AXJB 4IE6A 3G3SA 1T98A 3KHXA 1XIXA 4PQAA 4AVAA 4MHZA 2FT0A 5AQFB 4P4JA 4PPZA 1EE3P 3PDYA 2W63A 3OVUA 4DNDA 1D1AA 2W67A 2Q4VA 3RAMA 1J4JA 4C2XA 1KEYA 5LHHB 4DV5T 2ABZA 4OX9T 3PEIA 3DNSA 3PB8X 4L89A 4A95A 4ZY2A 3VU7H 5FXWA 3C51A 1HCIA 3L39A 3IEEA 1YW0A 4U2ZA 2Z3OA 3K8PC 4ZI6A 2C6CA 4E8OA 3OJAA 3AEFA 1QSOA 4COFA 5L3EB 3BLNA 2Y48B 1HG2A 4AXPA 2FUPA 3AECA 3TO7A 3RGLA 1CG2A 2WDRA 1BPMA 1FEWA 4P10A 2I3CA 2V6XA 3ZCJA 2IC9A 2VL0A 4C91A 2PIYA 3GYAA 2B4DA 3CPAA 3FBZA 3JCFA 5KX5E 1WK4A 4MY3A 1IICA 4A39A 3ONJA 2FBWA 4QVTA 1ZKEA 2Z11A 2BG9C 2DHRA 4G63A 3SHPA 4B3RT 3AA1B 3PRTA 3LD2A 5G20A 2CHOA 3ZT7A 2K24A 2Q04A 4XNHC 3ZYMA 5EBVA 3HL6A 4HWIB 4PFPA 3NH4A 5F5WA 3LFMA 3EXNA 4RI1A 4I0UA 2VXKA 4TWHA 2EHOA 3GB0A 2CWOA 1L0CA 4CAWA 1FMWA 4DV3T 3D4UA 3BQKA 4NGMA 2QRXA 2XM2A 1WCRA 2VBQA 2IMOA 2BVMA 3EDVA 1LANA 4MBQA 3KGQA 2BUEA 4TNVA 2ES0A 3K9UA 3FJUA 4MFQA 3FZKB 2UUAT 2DPSA 3AXJA 3ZJ2A 4OYJA 5ABGA 5JDQA 3D0TA 2Q51A 4DNCA 2GU2A 4MFLA 1MJBA 4DYOA 4OIWA 4NIQA 3ZJ1A 4ZI3C 3LACA 5FNVE 4P0AA 2X67A 3IA3A 2J1DG 4YWYA 3S6GA 2EO8A 4XPDC 3I9WA 2AFXA 1Z9UA 1CJWA 1MNDA 4Z8XA 4UVBB 1XRYA 5I4MA 2PVVA 2VKJA 3LSVA 4EZHA 2KINB 3I0QA 2YU2A 2W00A 4AQFC 4AI6A 3S6KA 1X12A 4OC0A 1WYCA 4A31A 2G0UA 2WY2A 4HFHA 3HLPA 5ELYA 2PJBA 3H8GA 1TKJA 4YTMA 5LYFA 5CBMA 2V7MA 2Q9QC 4OKOA 3H5ZA 4ZX9A 4IUSA 3FIXA 1MMAA 3OTOT 3EAMA 1CP7A 4H9PC 2YK0A 3QK6A 2BG9E 3B3WA 2CNTA 2PSWA 3HUVA 3DLJA 4QX8B 4G1PA 1Q2CA 3FBUA 3PP9A 1FY7A 5AQRB 5JDHA 2X0HA 7CPAA 3AE5A 1IYLA 4MCQA 3JAEA 1U4QA 3WR7A 5J0ZA 4EOZB 4PXEA 4LQ6A 5LP6E 2CIJA 2KCWA 4U74A 3HI2A 4EYYR 1I1DA 3D2MA 3FNCA 4MJ8A 4U7YA 3H8FA 1IGBA 2FJDA 3KV4A 4OFZA 1T72A 4OYKA 3KZWA 3A5XA 3K3QC 4H9QC 4X1YE 5LGUB 4A30A 3SI2A 4M1PA 3TE4A 3FB2A 3ZMZB 2XTLA 1XEBA 2X9XA 3CKDA 3P2FA 2P0WA 4ZZBA 3EO4A 2KNDA 3B3TA 4YFSA 5LJMA 4IAVA 5ABFB 3ZMTB 4LF4T 4JBWF 3GY9A 3NFZA 2PE3A 5FY1A 3R9GA 1X9BA 1KZFA 3AEBA 5HEJA 1KK7A 1NENA 4H9NC 3BI1A 3IGRA 4UCPA 4NGSA 4II9A 1HNZT 4C2YA 1KUXA 4UF0B 5CPAA 3RYCE 3ANWB 3NE8A 4A37A 2BKOA 3E0ZA 4QUSA 5BWAB 4AB7A 3EUHA 3HKDE 5LB7B 5F3JA 2K3WA 4OADA 5LMUT 4KSIA 5EZYE 3I1AA 3KL9A 2XPKA 3G06A 3DR6A 2BEIA 2E8IA 4BD9A 5F46A 4KS9A 1LAPA 4UXNB 3ESLA 4L5GA 3G8WA 4CI1B 3T8WA 4HFBA 4YSYA 4QB9A 3FZMB 2BBHA 1VCTA 4BBHA 3EY5A 3LK42 2YDQA 4X64T 1KWMA 4MHDA 4IDNA 4CRZB 5J2UE 1Y9WA 4AVCA 2R1IA 4UWJA 4PJMA 2X9WA 4MCRA 3ZSSA 1J5WA 1UCUA 4KORA 1TKHA 3W15B 4X62T 1S60A 2L8KA 2PRBA 1Z4EA 1UFHA 3BXMA 2GE3A 2CA5A 1DTDA 1UGOA 4B12A 2XAJB 2XAFB 4NUVA 2OR4A 3UUMA 4PK5A 3PUZF 3KASA 1Z2LA 5F09A 1T7SA 5JR9C 2DXQA 1QSRA 2PR8A 4NJRA 3PFOA 3SFEA 3NH5A 3OKQA 3LDQB 2JLMA 2P6GA 2ZM0A 3CMLA 4EMEA 1YX0A 4PW8A 3R1KA 3NA6A 2AXDS 4PJLA 4YJ3E 5DWMA 1HS7A 1S35A 3ZN1B 4GS4A 4MY0A 4CAVA 2VZYA 3P4RA 3R9FA 3IBPA 1BAVA 1FIOA 4CI2B 1WRDA 4M3SA 3KV9A 2QVAA 4DV1T 3MACA 3UT5E 4K30A 4FD7A 4HWDA 3UQ7A 2X9HA 4X2TA 4MFZA 1FT7A 2DL1A 5ABHA 1F2PA 4NCZA 2CMRA 5ABFA 2MPKA 2NWBA 3Q2MA 5LCYA 1HR0T 5AQKB 4PXDA 4PK6A 3M65A 2OLTA 1ON0A 3MN8A 2J62A 3PFEA 1LKXA 3O4XE 5AQTB 3N5FA 5LNKA 2UXBT 3ETUA 1VOMA 4UF0A 4ISSA 1D1BA 4JI8T 4Y49C 3ANWA 2EVNA 3RLFF 4CAEA 4I4TE 2A3DA 3QNVA 4B14A 2FXFA 4I43B 4QXCB 3LK3B 4B10A 2PTFA 4ISTA 1M7KA 3RIUC 3VHLA 2HN1A 2LM2A 3AVSA 3B3SA 3GWHA 3SJGA 2A9UA 5I0CA 4ZHQE 1YKHB 1N32T 4OC5A 4UWIA 5J1GA 3AE4A 4HN9A 3RHWA 1TIQA 1YD8G 3P4SA 3NE7A 4C68A 4HFCA 3JAFA 2B76A 4CRYB 3B8GA 3QB5K 2PJ9A 2KLQA 5CA0E 2LT3A 3KDSE 4E0AA 4QWNB 2EUIA 1VHOA 2D2SA 1DE4C 2D4PA 2OZUA 4KOWA 2X9YA 2WQYA 2WDVA 2VKDA 5KMGP 1ZOYA 5HWYA 1I21A 5CFBA 1PYTB 4UEFA 4L0RA 4ZS3A 4FAIA 4JXQA 2IIUA 3UULA 2QGSA 3Q5XA 5H6QB 3IWEA 3QB5A 4DO0A 4DMVA 3AEGA 5C8YE 2VVNA 4ILAA 2H3RA 3QNUA 4U7IA 2RB7A 1MIWA 1WFDA 5HEOA 3IFEA 3SJFA 4QXBB 1JNZA 5F47A 5JTGA 1NE9A 3P4QA 4HNYB 4EWTA 1EZ3A 4XNHB 1D0ZA 3A8YC 4KUAA 1X10A 3CXSA 2NTXA 4ILCA 4DVDA 2KWIB 2ZLYA 2D0UA 5L3CB 3EVYA 1ARMA 3WC6A 3RI5A 3RRCA 2B1EA 2OV9A 3M3ZB 5DQVA 3PB7X 4HNWB 2LRKA 4MCSA 3BQLA 3UU5A 1MMDA 3PUQA 4H9RC 4GM5A 2UXNB 4AG7A 3K3NA 1W0BA 2NP9A 5FXZA 3UTKA 5L3GB 3FX6A 2EK8A 2GK9A 2J8RA 5FVKA 3EFAA 5J1QA 4MXUA 1VHSA 5HXEA 4UIAA 2WWVA 4X5KA 1CP6A 2BL1A 4DIDB 3AE8A 4X20E 4DV0T 4X1KE 3TX8A 1VKCA 3I1UA 1E7PA 3TLSA 2XY8B 1ZLIA 4NXNT 2WPWA 1MJ9A 2K5TA 4BINA 4O23A 4CI3B 1Y0RA
chains in the Genus database with same CATH topology
1SHZC 4H63V 2YINA 4G2AA 2W0GA 3KBTA 5AGEA 5IHYA 4EIWA 4Q38A 2Q9QB 4ZI2C 4H6UA 4A33A 3PUSA 4CYQA 3F31A 4NF1A 3BJ8A 3U3IA 5KDMC 3N9OA 2CLYC 1BR0A 4LX9A 2B3VA 2DWKA 4KUMB 1R57A 2HH7A 4OAEA 4NUUA 4U5YA 2B58A 5HXRA 4ORFA 4O4LE 2X51A 3I3GA 4N78D 1NWMX 4BMHA 3T9YA 1YGHA 3ZZIA 4B5PB 4E7ZA 5DQWA 4YHJA 3NRXA 2QMLA 3DSBA 2W61A 3N9LA 4ADZA 2X7BA 3D2PA 3DR8A 1IJ6A 4EB6E 1Q2DA 3P7IA 4JD6A 1S3ZA 2PG8A 1IZNB 4EZ4A 2KWHA 4CGOA 4NEXA 3ZMSB 1HTJF 5FY7A 4TZ4C 1NAFA 2DWGA 5LXTE 3FXTA 2V7IA 3E0KA 3H37A 2AJ6A 1YK3A 5FY0A 1D0YA 2VI7A 5DJQC 3N2KE 4J2CA 1MNEA 4DBRA 4AQFA 2REFA 1WWZA 1UX4A 1BR4A 2IL4A 2CE7A 2KT9A 3PURA 2Z3MA 5LYJE 5TAOA 5CNPA 1FMVA 3RPUA 2Q9QA 4PJNA 1Z0PA 2LOSA 4F6AA 3BQIA 2PR1A 4AKIA 4KOTA 3QUJA 5JR9B 2YGWA 1D0XA 2KMFA 3OWCA 3C4WA 3ZMUB 2LHRA 5EK4A 4MBUA 1Z4RA 5DABA 2I00A 2JMHA 3ZMVB 3QAHA 3JVNA 3KBUA 3OBVE 4CYPA 3J9X1 2VL8A 3O1HA 2ZW5A 2L9QA 1LVFA 2ZW4A 4UIGA 2N2NA 4B5PA 2R8VA 4CGPA 3TCVA 2ODUA 4F0XA 5C82A 4GYSA 2D4OA 3T8OA 2ZM8A 3MK7C 3OYXA 4H89A 5ADXL 4EYUA 2CEAA 2G0BA 4E2AA 5JDGA 2PBIA 3HA4A 3W6SA 4YLHA 5F49A 4Y49B 3TOBA 4HEAA 5CB4E 3C4ZA 2LM9A 3N2GE 4KSAA 4ONUA 4CAXA 4IE7A 5AG5A 4B6XA 3CX6B 4WW0A 4IIJE 4JUYA 4UELA 5EK2A 2Q0YA 3PUGA 3R95A 5JPHA 3I9YA 5E96A 4ZI3D 2X0LB 3NRYA 2XAHB 4H9SE 3AA0B 4UBRA 4JEUB 5JR9A 4CQIA 4AKHA 1PU9A 3KV6A 2QECA 2YU1A 1IAPA 5LG4A 2NOXA 3FBLA 4ZBGA 4UFWA 4JJXA 2DCFA 1K4JA 2CCQA 3ZYLA 1S7FA 3JC6C 4R9MA 3BK9A 3CX7B 4L8AA 4I49A 2GIVA 1XF8A 4IE0A 2H5MA 2Q9QD 2FIAA 2Z6EA 3PE0A 1M4IA 3ONXA 2JJ9A 1LRZA 2PFVA 2D0TA 2REEA 2OZHA 1HX8A 1LVKA 5LBMA 1MIYA 2ACXA 5AG7A 3HKEE 1UX5A 4CXYA 3ZYKA 3F5BA 3JTKA 2SPCA 4DMWA 2VQYA 4P09A 3ETVA 1YR0A 1KUYA 3TO9A 4I55E 3L3PA 4C2ZA 3Q5WA 4K0UA 2CXFA 4WBNE 2Q44A 2PC1A 5GONE 2I79A 1HG5A 3A9LA 2HPLA 3W6XA 2FSRA 2ZW7A 5IB0A 2Y8DA 3H3AA 5H84A 5G21A 3PU8A 3CXQA 3ZEFB 1VRBA 2ZW6A 2WSSV 2W62A 2C5IT 2E9XC 1WYBA 3C50A 5HYAA 3RH3A 2V7KA 4H63H 3S4UA 5J8CA 5LBQB 1CM0A 3C64A 4HNXB 5JH7E 2C0SA 3EC4A 4ILUA 4NSQA 1WR6A 5H6RB 2Z3PA 4C7IA 2OU2A 3RYHE 3T90A 2DPTA 4IHJE 5AG6A 3KVBA 4TV8E 5FMNA 2WAUA 3BJ7A 4XBFB 2C27A 2CLYB 2LSGA 3RRWA 2WMNA 5JDMA 3KVAA 3CWZB 2MYSA 5G1ZA 3GN5A 3RYFE 1N71A 3WI3A 3H4QA 2ATRA 3FXDB 3SRZA 1S7LA 1RO5A 2XQYA 4DBQA 3UY5A 2IC6A 4UA3A 3KV5A 5JREA 4B13A 4PAGA 4UFVA 4HFVA 4O4JE 1B6BA 1YVOA 2LSYA 5HWXA 3N9QA 4IF5A 2LEHA 2BZBA 4P0BA 4QXHB 2QA7A 2VKOA 4KLWA 3I0OA 2LSJA 4MFRA 4OLLA 3O1JA 1OZPA 1IJ5A 3B13A 4M85A 3AA6B 5GCNA 3DDDA 2FS5A 4KSFA 4WBOA 4AKRB 3N5LA 2WBLA 2FL4A 1OWAA 2ZMAA 5BMVE 4E7SA 1MMNA 3S6FA 2ZXVA 2R98A 4R87A 2CNMA 3DJBA 3VKHA 2IW5B 3F0AA 4A32A 3F2EA 1SA0E 3RC3A 4YJ2E 2K5BB 2L3LA 2V7LA 4AQGA 4I50E 1O3XA 1MIVA 1M1DA 5G22A 1G8XA 4CAFA 2RP4A 1S5KA 2G3AA 1PUAA 3TFYA 1M4GA 1V0CA 5LHIB 2NW8A 4MFKA 2CY2A 4EAHA 4FD5A 2JMKA 1US7B 4Q36A 3UFEA 3DTOA 3FB3A 5C88A 1P0HA 1B7TA 3RYOA 4XPDB 4PK3A 1M44A 2KZ7B 2G3TA 4B5OA 2OZGA 4KVXA 2BSWA 3TO6A 3PUAA 4H6ZA 2VASA 3ZCIA 4CGNA 4BAYB 4QC6A 3WAJA 1QSMA 4U9ZA 2LSIA 4ZS2A 2YNDA 4MALA 1WLXA 4YRHA 2A72A 3MJXA 1IYKA 1QSNA 3CQXC 5JDNA 4UEMA 3R6NA 1OXZA 2I59A 4XPKA 2YEVC 5FP3A 2YNCC 1GHEA 3F57A 4A56A 1ZEEA 3O1IA 2D5UA 2ZM2A 2NW7A 1M4DA 4XAXB 3L09A 2RA1A 1MJAA 2LSKA 3S6HA 4YGOA 3SXOA 4FJOA 3E22E 4JXRA 4EXTA 3IHRA 1HF8A 4XZCA 2N1GA 5A27A 5L3DB 2JDCA 2VEZA 5KTAA 5HXSA 4WNKA 2WUUA 1BO4A 4PFOA 3UUXB 1QSTA 5JDLA 4ZI2D 3E08A 2XASB 1D1CA 3EDUA 1Y7RA 2JEVA 2K9AA 4OHFA 2XUEA 3DP7A 1NSLA 2WWUA 2FE7A 3FXEB 4KOSA 1NMTA 4ASKA 2JRKA 4BJMA 5JRCB 2B4BA 1IB1E 5IX3A 2M67A 2JPFA 3R84B 4BJNA 3LBXB 3O9XA 2RC4A 2ODVA 3PGPA 5JQ4A 1ZO0A 4PSXA 3V8IA 4MLKA 2Z0ZA 5H86A 2MOZA 4R3KA 4UCNA 1MK4A 4GIWA 4R57A 5JDFA 2B3UA 3TKLB 3GMIA 2E9XB 5FVJA 3ZC0A 4OK0A 2CM0A 5LGTB 3U78A 4IDZA 3N2OA 2HUZA 3PZJA 4A2ZA 3ZJ0A 2XHEB 4CYNA 2H7VC 2HQYA 2R7HA 4MFPA 1AJ3A 4NXYA 2Y6XA 2FIWA 1H7CA 1YKEB 4CGLA 1KUVA 3AVRA 4F0YA 2Y0MA 2JQQA 3V5UA 2X68A 3SOLA 5JVDE 1YVKA 4ZI7E 3LK2B 2PDOA 5KTDA 3CQCB 4PNIA 1BOBA 3F8KA 4IE4A 5IV0A 5JRCA 1X79A 3GA8A 3LBXA 1KNZA 4IE5A 4J3GA 2B5GB 4MFJA 5HAXA 3FYNA 2EHOC 2QIRA 2VKHA 2GANA 2VB6A 2C5JA 3CVRA 5LJNA 1BR2A 2A2FX 2VZZA 1XMTA 3SS1A 4KVOE 2E9XA 3KKWA 3LJCA 3ZLIA 2Q4YA 4HGAA 4LUAA 3RC8A 5A28A 3QC9A 5HXHA 5L3BB 4JLEA 5LGNB 3TT2A 4BA9A 2J8MA 4O8SA 2Z3NA 3SWHA 3N9PA 4TUYE 3IU2A 2PJQA 4V1Av 4U72A 2UXXB 4O2AE 2CXLA 1ZV4X 3GN5B 3N7ZA 4FD6A 3ZPOA 4GK5E 3AAAB 3OYZA 4AVBA 5L2LA 1B87A 2A4NA 2ZPAA 3TOAA 2EHOD 3R9EA 4KLVA 5JQGE 4QBJA 4F6RC 3B57A 4CS0B 4QHOA 2K48A 5EC4A 2WM9A 4B11A 2MTQA 2Z10A 5HMNA 3N9NA 5ISVA 4ANJA 3C26A 2P6FA 3W91A 3JC6D 4ZGYB 2IAKA 2B5GA 3P2HA 1ZHCA 2LJLA 2WSAA 4O4IE 5CA1E 5F8PA 4AKLA 3PTRB 3TTHA 5LOVE 2V7JA 3R96A 4U9YA 3AB3B 5AFUL 1QUUA 5FYMA 4UVAB 4X1IE 3NZPA 2P9BA 2Z3LA 2WPXA 2Q7BA 4AG9A 4UV8B 2LE8A 2H7OA 4FI5A 2AE6A 2NTYA 4KOYA 4KP3C 4TV9E 4KUBA 3MA9A 4XPLA 4KOVA 4H9OC 3GKRA 3V5SA 1CUNA 3CX8B 2J8NA 4HKFA 1YREA 2E9XD 4MHCA 2C5KT 3N9MA 2NW9A 2WMOA 3FHNA 2CWYA 2CXDA 4UV9B 2Z3KA 1BR1A 5A1LA 2ARHA 4PK4A 2FCKA 3HKBE 2XAGB 3FRMA 3VKGA 4JLYA 4HTEA 1S7KA 3HR0A 4R3LA 3I9SA 3IWGA 2LHNA 2KXPB 3UUNA 2N9DA 3VWEA 2HV2A 1RXTA 1YLEA 3IF8B 2BVLA 3RKOA 2CNSA 3MKDA 1Y9KA 4PK2A 4CXWA 4YFJA 4TX5A 4QX7B 4PJJA 1I12A 3VWDA 3CQGB 4GK0E 2LOPA 3WAKA 3CXPA 3LODA 3RYIE 2NMTA 3PU3A 5F48A 2O28A 4CXXA 3AAIA 2VWAA 4O4HE 5ETWA 3P8CD 4O2BE 3D3SA 2YNCA 5KTCA 2P6EA 1XE4A 4L9IA 5FXXA 1V9DA 4KBMB 5FXVA 3K3OA 5HXCA 1P4NA 2CXAA 4EVYA 2DNXA 3HKCE 4UFXA 2JDDA 1E1HB 4C90A 3CPZA 4FD4A 5IYZE 2XAQB 4HE8A 3ZC1A 1IIDA 2X66A 3Q9DA 3C4XA 2DLRA 4UVCB 4IGUA 4RS2A 3KFWX 5LHGB 4AKGA 5EK3A 3KINB 4KOXA 3MZKB 4KZTA 2V26A 2DI4A 5AG4A 3RX6A 4TN7B 3IU1A 3NZQA 1U6MA 3AA7B 5J2TE 1U5PA 5DWNA 3MGDA 4KOUA 1SQHA 4C7HA 3J7Yq 3QB8A 4ERRA 4PV6A 2OH1A 1Q2YA 3JUWA 2OB0A 4QKNA 1G73A 2YNEA 3NBXX 2B4DB 4CZZB 5HH1A 2BDEA 1Y64B 5E0OA 4MI4A 3MXZA 1MMGA 4GYRA 4KVME 2VK9A 4JWPA 4HKAA 2V1DB 3C98B 1S7NA 3ZN0B 4PSWA 5M4YA 4CGMA 4GOUA 3D8PA 4CYOA 5LA6E 2F5IA 2EHOB 5L3FB 4KMCA 3AAEB 1QSDA 2PQ8A 3LG7A 4UCMA 1HFAA 4JEHB 2HPJA 1S94A 4ZOLE 2OA5A 3SXNA 5J8FA 2MBGA 4IE6A 3G3SA 1T98A 1XIXA 4AVAA 2FT0A 3PDYA 2W63A 4DNDA 1D1AA 2Q4VA 1J4JA 4C2XA 5LHHB 3DNSA 4L89A 4A95A 3VU7H 5FXWA 3C51A 1HCIA 3IEEA 1YW0A 2Z3OA 3K8PC 4E8OA 3OJAA 1QSOA 5L3EB 3BLNA 2Y48B 1HG2A 4AXPA 3TO7A 1FEWA 3ZCJA 2IC9A 4C91A 3GYAA 2B4DA 3FBZA 5KX5E 1WK4A 4MY3A 1IICA 4QVTA 1ZKEA 2Z11A 2DHRA 4G63A 3SHPA 3AA1B 3LD2A 5G20A 2K24A 2Q04A 4XNHC 3ZYMA 5EBVA 3HL6A 4PFPA 3LFMA 3EXNA 4RI1A 2VXKA 2EHOA 2CWOA 1L0CA 4CAWA 1FMWA 3BQKA 2VBQA 2BVMA 3EDVA 4MBQA 2BUEA 2ES0A 3K9UA 4MFQA 2DPSA 3ZJ2A 4OYJA 5JDQA 3D0TA 4DNCA 4MFLA 1MJBA 3ZJ1A 4ZI3C 5FNVE 4P0AA 2X67A 2J1DG 3S6GA 4XPDC 3I9WA 1Z9UA 1CJWA 1MNDA 4Z8XA 4UVBB 2VKJA 4EZHA 2KINB 3I0QA 2YU2A 2W00A 4AQFC 4AI6A 3S6KA 4A31A 1WYCA 2G0UA 2V7MA 2Q9QC 3H5ZA 4IUSA 3FIXA 1MMAA 4H9PC 2YK0A 3QK6A 2CNTA 2PSWA 4QX8B 1Q2CA 3FBUA 3PP9A 1FY7A 5JDHA 1IYLA 1U4QA 3WR7A 4EOZB 5LP6E 2KCWA 4U74A 3HI2A 4EYYR 1I1DA 3D2MA 3FNCA 4MJ8A 3KV4A 4OFZA 4OYKA 3A5XA 3K3QC 4H9QC 4X1YE 5LGUB 4A30A 4M1PA 3TE4A 3FB2A 3ZMZB 2XTLA 1XEBA 2X9XA 3CKDA 3P2FA 2P0WA 3EO4A 2KNDA 4YFSA 5LJMA 3ZMTB 3GY9A 5FY1A 3R9GA 1KZFA 1KK7A 3IGRA 4H9NC 4UCPA 4II9A 4C2YA 1KUXA 4UF0B 3RYCE 3ANWB 3E0ZA 4QUSA 5BWAB 4AB7A 3EUHA 3HKDE 5F3JA 4OADA 5EZYE 3I1AA 3DR6A 2BEIA 2E8IA 5F46A 4KS9A 4UXNB 3ESLA 4L5GA 3G8WA 4CI1B 4QB9A 4BBHA 3EY5A 3LK42 4MHDA 4CRZB 5J2UE 1Y9WA 4AVCA 2R1IA 4UWJA 4PJMA 2X9WA 1UCUA 4KORA 3W15B 1S60A 2L8KA 2PRBA 1Z4EA 1UFHA 2GE3A 2CA5A 4B12A 2XAJB 2XAFB 4NUVA 3UUMA 4PK5A 2DXQA 5JR9C 2PR8A 1QSRA 3OKQA 2JLMA 2P6GA 2ZM0A 3CMLA 1YX0A 4PW8A 3R1KA 4PJLA 4YJ3E 5DWMA 1HS7A 1S35A 3ZN1B 4GS4A 4MY0A 4CAVA 2VZYA 3R9FA 3IBPA 1FIOA 4CI2B 1WRDA 4M3SA 3KV9A 3MACA 3UT5E 4K30A 4FD7A 2X9HA 4MFZA 4NCZA 2CMRA 2NWBA 3Q2MA 5LCYA 4PK6A 3M65A 1ON0A 1LKXA 3O4XE 5LNKA 3ETUA 1VOMA 4UF0A 4ISSA 1D1BA 4Y49C 3ANWA 2EVNA 4CAEA 4I4TE 2A3DA 4B14A 2FXFA 4I43B 4QXCB 3LK3B 4B10A 4ISTA 3VHLA 3AVSA 3GWHA 5I0CA 4ZHQE 1YKHB 4UWIA 5J1GA 4HN9A 1TIQA 1YD8G 3NE7A 4C68A 4CRYB 3B8GA 2KLQA 5CA0E 2LT3A 3KDSE 4E0AA 4QWNB 2EUIA 2D2SA 2D4PA 2OZUA 4KOWA 2X9YA 5KMGP 2VKDA 5HWYA 1I21A 4L0RA 4ZS3A 4JXQA 3UULA 2QGSA 3Q5XA 5H6QB 3IWEA 4DO0A 4DMVA 5C8YE 2H3RA 1MIWA 4QXBB 5F47A 1NE9A 4HNYB 1EZ3A 4XNHB 1D0ZA 4KUAA 3CXSA 2NTXA 4DVDA 2KWIB 2ZLYA 2D0UA 5L3CB 3EVYA 3RRCA 2B1EA 5DQVA 4HNWB 3BQLA 1MMDA 3PUQA 4H9RC 2UXNB 4AG7A 3K3NA 2NP9A 5FXZA 3UTKA 5L3GB 2GK9A 2J8RA 3EFAA 1VHSA 5HXEA 4X5KA 2BL1A 4X20E 4X1KE 1VKCA 2WPWA 1MJ9A 2K5TA 4CI3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EXN A;  4RI1 A;  2VXK A;  3UY5 A;  2IC6 A;  4UA3 A;  1L0C A;  4CAW A;  3N7Z A;  4FD6 A;  1B6B A;  1YVO A;  4AVB A;  2VBQ A;  4H6U A;  1B87 A;  2A4N A;  2ZPA A;  3TOA A;  3R9E A;  2BUE A;  3K9U A;  4NF1 A;  4KLV A;  4IF5 A;  3BJ8 A;  4QBJ A;  4CS0 B;  2K48 A;  4KLW A;  5EC4 A;  4LX9 A;  2B3V A;  4OLL A;  4DNC A;  1MJB A;  1OZP A;  1IJ5 A;  1R57 A;  4M85 A;  5GCN A;  3DDD A;  4OAE A;  2FS5 A;  2Z10 A;  3S6G A;  5HMN A;  4U5Y A;  2B58 A;  4XPD C;  5ISV A;  4ORF A;  3C26 A;  3N5L A;  3I3G A;  2P6F A;  1Z9U A;  3W91 A;  1CJW A;  4BMH A;  2FL4 A;  2B5G A;  3T9Y A;  1YGH A;  3P2H A;  3ZZI A;  3S6K A;  4B5P B;  2G0U A;  3S6F A;  2ZXV A;  2R98 A;  4R87 A;  2QML A;  2CNM A;  3DSB A;  3F0A A;  3TTH A;  2X7B A;  3D2P A;  3DR8 A;  1IJ6 A;  3R96 A;  1Q2D A;  4U9Y A;  3P7I A;  4JD6 A;  1S3Z A;  4IUS A;  3FIX A;  2KWH A;  4NEX A;  1M1D A;  3QK6 A;  1S5K A;  2CNT A;  2G3A A;  2PSW A;  3FXT A;  1PUA A;  1Q2C A;  3FBU A;  3PP9 A;  1FY7 A;  3TFY A;  3E0K A;  2AJ6 A;  1M4G A;  2WPX A;  2Q7B A;  1IYL A;  1V0C A;  4AG9 A;  1YK3 A;  3WR7 A;  2CY2 A;  4FI5 A;  2AE6 A;  4FD5 A;  2VI7 A;  4KOY A;  4KUB A;  4J2C A;  2KCW A;  4XPL A;  4EYY R;  1I1D A;  3FB3 A;  3D2M A;  3FNC A;  4MJ8 A;  4KOV A;  2REF A;  5C88 A;  1P0H A;  1WWZ A;  3GKR A;  3RYO A;  2IL4 A;  4XPD B;  4PK3 A;  1M44 A;  2G3T A;  4B5O A;  5CNP A;  2J8N A;  3TE4 A;  2OZG A;  4KVX A;  4HKF A;  2BSW A;  1YRE A;  2XTL A;  1XEB A;  2X9X A;  3TO6 A;  3CKD A;  4H6Z A;  3P2F A;  2P0W A;  2C5K T;  3EO4 A;  1Z0P A;  4F6A A;  2PR1 A;  4QC6 A;  3GY9 A;  4KOT A;  3QUJ A;  1QSM A;  4U9Z A;  3R9G A;  1KZF A;  4YRH A;  2ARH A;  1IYK A;  2FCK A;  3FRM A;  3OWC A;  1QSN A;  3IGR A;  4II9 A;  4MBU A;  1KUX A;  1Z4R A;  4JLY A;  2I00 A;  4QUS A;  1S7K A;  3QAH A;  3JVN A;  4XPK A;  4R3L A;  4AB7 A;  3I9S A;  3IWG A;  1GHE A;  4OAD A;  2ZW5 A;  1LVF A;  2ZW4 A;  3DR6 A;  2BEI A;  5F46 A;  3VWE A;  2HV2 A;  3G8W A;  4QB9 A;  4B5P A;  2R8V A;  3EY5 A;  1RXT A;  3TCV A;  5C82 A;  1M4D A;  1YLE A;  2D4O A;  4MHD A;  4CRZ B;  1MJA A;  1Y9W A;  4AVC A;  2CNS A;  2R1I A;  4H89 A;  4UWJ A;  2X9W A;  1Y9K A;  4PK2 A;  4YFJ A;  4KOR A;  3S6H A;  4YGO A;  3SXO A;  1S60 A;  2G0B A;  1I12 A;  3VWD A;  2PRB A;  1Z4E A;  4JXR A;  1UFH A;  2GE3 A;  2CA5 A;  4E2A A;  3CXP A;  3LOD A;  3W6S A;  2NMT A;  5F49 A;  2DXQ A;  2PR8 A;  1QSR A;  4Y49 B;  5F48 A;  3TOB A;  2O28 A;  2JDC A;  2VEZ A;  5KTA A;  2JLM A;  2P6G A;  3D3S A;  5KTC A;  2P6E A;  1XE4 A;  4ONU A;  1BO4 A;  4CAX A;  1QST A;  1YX0 A;  3R1K A;  4B6X A;  5DWM A;  1P4N A;  4EVY A;  1Y7R A;  4GS4 A;  4MY0 A;  4CAV A;  2JEV A;  2VZY A;  3R9F A;  2Q0Y A;  2JDD A;  1NSL A;  2FE7 A;  3FXE B;  4FD4 A;  4KOS A;  1NMT A;  4M3S A;  3R95 A;  4K30 A;  1IID A;  4FD7 A;  5JPH A;  4NCZ A;  4RS2 A;  5E96 A;  2B4B A;  1IB1 E;  5IX3 A;  4KOX A;  2RC4 A;  4KZT A;  1ON0 A;  4UBR A;  3PGP A;  5JQ4 A;  4CQI A;  1PU9 A;  2QEC A;  4PSX A;  1U6M A;  3V8I A;  4ZBG A;  2Z0Z A;  4JJX A;  4Y49 C;  1K4J A;  5H86 A;  2EVN A;  5DWN A;  3MGD A;  4KOU A;  4R3K A;  1SQH A;  1MK4 A;  3QB8 A;  1S7F A;  4R57 A;  4R9M A;  4PV6 A;  4L8A A;  2B3U A;  2FXF A;  4I49 A;  2GIV A;  2OH1 A;  3TKL B;  1XF8 A;  1Q2Y A;  3JUW A;  2H5M A;  2OB0 A;  2FIA A;  1M4I A;  2B4D B;  1LRZ A;  5HH1 A;  2REE A;  5FVJ A;  5I0C A;  2OZH A;  4MI4 A;  3MXZ A;  4UWI A;  4KVM E;  1TIQ A;  2HUZ A;  4JWP A;  3NE7 A;  3PZJ A;  3F5B A;  3ZJ0 A;  2VQY A;  4CRY B;  1S7N A;  3B8G A;  4PSW A;  2HQY A;  3D8P A;  4E0A A;  2R7H A;  1YR0 A;  2F5I A;  2EUI A;  1KUY A;  3TO9 A;  4NXY A;  3L3P A;  2D4P A;  2OZU A;  4KOW A;  2X9Y A;  2FIW A;  1QSD A;  2PQ8 A;  1H7C A;  2Q44 A;  1KUV A;  1I21 A;  2PC1 A;  4F0Y A;  2I79 A;  2Y0M A;  4L0R A;  3W6X A;  4JXQ A;  2FSR A;  2ZW7 A;  5IB0 A;  1YVK A;  5H84 A;  3SXN A;  5J8F A;  2MBG A;  3CXQ A;  3G3S A;  2ZW6 A;  1XIX A;  4AVA A;  2PDO A;  5F47 A;  2C5I T;  5KTD A;  1NE9 A;  2FT0 A;  4HNY B;  1BOB A;  3F8K A;  3S4U A;  5IV0 A;  5J8C A;  4XNH B;  4DND A;  4KUA A;  3CXS A;  2Q4V A;  1CM0 A;  1J4J A;  2KWI B;  4HNX B;  4J3G A;  2B5G B;  3DNS A;  4L89 A;  3FYN A;  3EC4 A;  4HNW B;  4NSQ A;  2QIR A;  2GAN A;  4E8O A;  2OU2 A;  1QSO A;  3T90 A;  4AG7 A;  2C5J A;  3CVR A;  3BLN A;  3TO7 A;  3BJ7 A;  2C27 A;  2VZZ A;  1XMT A;  2J8R A;  2IC9 A;  3GYA A;  2B4D A;  4KVO E;  3EFA A;  3KKW A;  2Q4Y A;  4LUA A;  1VHS A;  1WK4 A;  4MY3 A;  1IIC A;  4X5K A;  3TT2 A;  2BL1 A;  2J8M A;  4QVT A;  1ZKE A;  2Z11 A;  3SHP A;  3LD2 A;  1N71 A;  1VKC A;  3H4Q A;  2WPW A;  2ATR A;  3FXD B;  2Q04 A;  1MJ9 A;  2K5T A;  4XNH C;  5EBV A;  1S7L A;  1RO5 A; 
#chains in the Genus database with same CATH topology
 4NGR A;  1SHZ C;  2F4V T;  4H63 V;  2YIN A;  4G2A A;  2W0G A;  2YOE A;  4IDP A;  3KBT A;  5AGE A;  5IHY A;  2FJE A;  4LML A;  3B35 A;  4EIW A;  2KSR A;  4Q38 A;  4Q25 A;  1IU8 A;  3LWU A;  2Q9Q B;  4ZI2 C;  4NPP A;  4H6U A;  4U31 A;  2QJ8 A;  4A33 A;  2JQH A;  4IL4 A;  3PUS A;  4CYQ A;  2XQ5 A;  3F31 A;  4NF1 A;  3ONL C;  4NFR A;  3BJ8 A;  3U3I A;  5KDM C;  2O4H A;  2E5V A;  3N9O A;  2CLY C;  4JV5 T;  1BR0 A;  5HEU A;  4LX9 A;  2B3V A;  2EK9 A;  1CHU A;  2ODF A;  2DWK A;  4KUM B;  3D68 A;  1YQ3 A;  2ZEL A;  1R57 A;  2HH7 A;  3GUX A;  4X5T A;  4OAE A;  2PJ7 A;  4NUU A;  4U5Y A;  4ZY0 A;  2B58 A;  5HXR A;  4ORF A;  4AIU A;  4O4L E;  2X51 A;  3KQX A;  3FZH B;  3SI1 A;  3I3G A;  4N78 D;  1OED E;  4Z91 A;  1NWM X;  4BMH A;  1YW6 A;  1Z8W A;  3T9Y A;  4R8F A;  4MMO A;  1YGH A;  3ZZI A;  4B5P B;  4YXD A;  4E7Z A;  5DQW A;  4YHJ A;  2XJ7 A;  3NRX A;  2QML A;  3DSB A;  2W61 A;  3N9L A;  4ADZ A;  2X7B A;  3D2P A;  4U3C A;  3DR8 A;  1IJ6 A;  4UF4 A;  4EB6 E;  2J4G A;  3CK6 A;  1Q2D A;  3P7I A;  1FNO A;  4IL9 A;  4JD6 A;  1S3Z A;  2PG8 A;  1IZN B;  4EZ4 A;  4Z65 A;  2KWH A;  4CGO A;  4NEX A;  3ZMS B;  1HTJ F;  1XDO A;  5FY7 A;  4TZ4 C;  4AIS A;  1NAF A;  4DR4 T;  4F8H A;  2DWG A;  5LXT E;  4FWU A;  3FXT A;  2V7I A;  4NGT A;  3WC5 A;  5AQI B;  3E0K A;  3H37 A;  2AJ6 A;  1YK3 A;  4DR3 T;  1R8I A;  5FY0 A;  1D0Y A;  2VI7 A;  4ZX8 A;  1GYT A;  5DJQ C;  3T1Y T;  3N2K E;  4J2C A;  1J5E T;  1MNE A;  3CIR A;  3IC1 A;  4DBR A;  2XQ3 A;  2PJ8 A;  4AQF A;  2REF A;  4HFE A;  1WWZ A;  1UX4 A;  1BR4 A;  2IL4 A;  2CE7 A;  4W9Y A;  2KT9 A;  3PUR A;  1UUR A;  5HVG A;  5L4H A;  2Z3M A;  5LYJ E;  4B3M T;  5TAO A;  5CNP A;  1FMV A;  3RPU A;  4A98 A;  2Q9Q A;  3K9T A;  1XZY A;  4PJN A;  1YME A;  1Z0P A;  2LOS A;  4F6A A;  3BQI A;  2PR1 A;  5LRK A;  3FVL A;  3PV0 F;  4AKI A;  4KOT A;  3QUJ A;  5JR9 B;  2WB5 A;  2YGW A;  1D0X A;  3PBE A;  1I94 T;  5ABE A;  4KI0 F;  2KMF A;  4HFI A;  3OWC A;  3C4W A;  2VQE T;  2BOA A;  2AFU A;  3ZMU B;  2LHR A;  5EK4 A;  4MBU A;  1Z4R A;  5DAB A;  2I00 A;  2JMH A;  3ZMV B;  4F8Z A;  1UK5 A;  3QAH A;  3JVN A;  3KBU A;  4TNW A;  3OBV E;  4CYP A;  3J9X 1;  2VL8 A;  3O1H A;  2ZW5 A;  4Q7A A;  3A7M A;  2L9Q A;  2BCO A;  1LVF A;  2HHH T;  2ZW4 A;  2XEJ A;  4UIG A;  5L47 A;  3D7D A;  2N2N A;  4B5P A;  2R8V A;  1Y7E A;  5LYI A;  3SJE A;  4CGP A;  3TCV A;  2ODU A;  4F0X A;  3VAT A;  5C82 A;  4GYS A;  2D4O A;  3T8O A;  2ZM8 A;  4NGN A;  3MK7 C;  3OYX A;  4Z90 A;  2ZED A;  4H89 A;  5ADX L;  4EYU A;  5AQN B;  2CEA A;  3TLU A;  2G0B A;  2GLJ A;  4YT0 A;  2XQ6 A;  4E2A A;  5AQS B;  5JDG A;  2PBI A;  2WU5 A;  3H3M A;  3HA4 A;  3W6S A;  4YLH A;  5F49 A;  4X65 T;  4Y49 B;  3TOB A;  4HEA A;  5CB4 E;  3C4Z A;  3RIA A;  2LM9 A;  3N2G E;  4KSA A;  4ONU A;  4CAX A;  4IE7 A;  1XBU A;  5AG5 A;  4ZEY A;  4B6X A;  3CX6 B;  4WW0 A;  5CGM A;  3VAR A;  3UU3 A;  4IIJ E;  4JUY A;  4UEL A;  5EK2 A;  4GKJ T;  2Q0Y A;  1ELL P;  3PUG A;  3PB6 X;  2X0Y A;  2PVW A;  3R95 A;  3WAB A;  4K3N A;  5JPH A;  3H8E A;  4LFC T;  2WU2 A;  1F2O A;  3I9Y A;  5E96 A;  4ZZC A;  4ZI3 D;  2X0L B;  2C6P A;  3NRY A;  4DR1 T;  3DGV A;  4M6H A;  3VH9 A;  2XAH B;  2IHR 1;  4H9S E;  3AA0 B;  4UBR A;  4JEU B;  5JR9 A;  4CQI A;  4AKH A;  1PU9 A;  4IK2 A;  3KV6 A;  2QEC A;  2IQ6 A;  2YU1 A;  1IAP A;  5LG4 A;  2NOX A;  3FBL A;  4ZBG A;  4UFW A;  3KQZ A;  4JJX A;  2DCF A;  3D66 A;  3B5M A;  1K4J A;  3GLJ A;  2CCQ A;  2ANP A;  3ZYL A;  1HEE A;  1S7F A;  3JC6 C;  1Z5R A;  2NR4 A;  4R9M A;  3BK9 A;  3CX7 B;  4L8A A;  4I49 A;  2GIV A;  3K1S A;  5C3J A;  1XF8 A;  4IE0 A;  2H5M A;  2Q9Q D;  5LG3 A;  4LF5 T;  2FIA A;  4R6T A;  2Z6E A;  3PE0 A;  1M4I A;  3ONX A;  2M6B A;  2JJ9 A;  1LRZ A;  4LF8 T;  2DF5 A;  2PFV A;  2D0T A;  2REE A;  4A38 A;  2M6I A;  2OZH A;  1HX8 A;  1LVK A;  5LBM A;  1ZP0 A;  3ISZ A;  1MIY A;  2ACX A;  5AG7 A;  1RTQ A;  3HKE E;  1UX5 A;  4CXY A;  2IDO B;  3ZYK A;  3WC7 A;  3F5B A;  3JTK A;  2SPC A;  4DMW A;  2VQY A;  3D67 A;  2LRL A;  3CPX A;  4P09 A;  3MRU A;  3ETV A;  1YR0 A;  1KUY A;  3TO9 A;  4I55 E;  4CN1 A;  1IBK T;  3SFD A;  4DV6 T;  3L3P A;  4X3R A;  4ILB A;  4C2Z A;  3Q5W A;  4K0U A;  2LLY A;  2CXF A;  3EHZ A;  4WBN E;  2Q44 A;  2PC1 A;  5GON E;  2I79 A;  1HG5 A;  2JBJ A;  3A9L A;  2HPL A;  3W6X A;  3FED A;  2FSR A;  2ZW7 A;  3B3C A;  2XEF A;  5HEH A;  4JZ0 A;  5IB0 A;  3RIU A;  2Y8D A;  3H3A A;  2V77 A;  5H84 A;  5G21 A;  3PU8 A;  2CRB A;  2PJ6 A;  4JI2 T;  3CXQ A;  1PCA A;  4JI1 T;  3ZEF B;  1VRB A;  2ZW6 A;  1N33 T;  2AE9 A;  2WSS V;  2W62 A;  2C5I T;  2E9X C;  2CBI A;  2QVP A;  1WYB A;  4GKK T;  3C50 A;  5HYA A;  3RH3 A;  2V7K A;  3UUB A;  4H63 H;  3S4U A;  5J8C A;  1T8B A;  3PBB A;  1KNP A;  1JWQ A;  2J9A A;  4TNU A;  5LBQ B;  4ZYQ A;  3P50 A;  3AE9 A;  1XNQ T;  1CM0 A;  1NEK A;  1GQE A;  3C64 A;  3NVO A;  4HNX B;  1OBR A;  4YTN A;  5JH7 E;  4ZY1 A;  2C0S A;  3EC4 A;  4ILU A;  1HX1 B;  4NSQ A;  1WR6 A;  1Z8L A;  5H6R B;  2CTC A;  2Z3P A;  4C7I A;  4EGW A;  2OU2 A;  3RYH E;  3T90 A;  2DPT A;  4IHJ E;  5AG6 A;  3KVB A;  5FMN A;  4TV8 E;  5K8O A;  2WAU A;  3BJ7 A;  6CPA A;  1AUG A;  2CHN A;  4XBF B;  2C27 A;  5IB9 A;  2E2A A;  2XM1 A;  2CLY B;  2NYQ A;  2LSG A;  3RRW A;  2WMN A;  2GRE A;  2AFO A;  4KX6 A;  5JDM A;  3KVA A;  4HWH A;  3CWZ B;  5AQO B;  5AQM B;  2MYS A;  3RBU A;  5G1Z A;  3GN5 A;  3RYF E;  3IEH A;  1N71 A;  3WI3 A;  4MCP A;  3H4Q A;  2ATR A;  3FXD B;  3SRZ A;  8CPA A;  1S7L A;  1RO5 A;  2FJA A;  2XQY A;  4DBQ A;  3UY5 A;  2IC6 A;  4UA3 A;  2O53 A;  3KV5 A;  5JRE A;  4LMJ A;  3WT4 A;  5LYD A;  5DS0 A;  4B13 A;  4PAG A;  2PJ2 A;  4LF7 T;  4UFV A;  4HFV A;  4O4J E;  2PJ3 A;  1B6B A;  4LF6 T;  1YVO A;  1ZG8 A;  2LSY A;  5HWX A;  3N9Q A;  1VHE A;  2H88 A;  4P6Y A;  4IF5 A;  2LEH A;  2BZB A;  1IOF A;  4P0B A;  4QXH B;  2QA7 A;  2VKO A;  4LMK A;  4KLW A;  3I0O A;  1KF6 A;  2LSJ A;  4MFR A;  3RNZ A;  2CTB A;  4OLL A;  5LRG A;  4DR2 T;  3O1J A;  2NSM A;  1OZP A;  1IJ5 A;  1E2A A;  3B13 A;  4M85 A;  3AA6 B;  5GCN A;  3DDD A;  2FS5 A;  4KSF A;  4WBO A;  4AKR B;  3N5L A;  4IT4 A;  2PJ5 A;  2WBL A;  2FL4 A;  1Z8X A;  5IWA T;  2XSB A;  1OWA A;  2BG9 B;  2ZMA A;  5BMV E;  4E7S A;  1MMN A;  3Q5E A;  2Q4Z A;  2ZXV A;  3S6F A;  3ZT5 A;  3RKG A;  2UXC T;  2R98 A;  4R87 A;  2CNM A;  3DJB A;  3VKH A;  2IW5 B;  3F0A A;  3IIB A;  1KNR A;  2WP9 A;  4A32 A;  3F2E A;  1SA0 E;  3RC3 A;  2QYV A;  2V6Y B;  4YJ2 E;  2K5B B;  1A2Z A;  2L3L A;  2V7L A;  4AQG A;  2VL1 A;  4IDQ A;  2RFH A;  4I50 E;  1O3X A;  1HNW T;  1MIV A;  1M1D A;  4CN4 A;  4OC3 A;  5G22 A;  1G8X A;  3AE2 A;  4CAF A;  1OED C;  2RP4 A;  1S5K A;  2G3A A;  4ONW A;  1L0V A;  3BI0 A;  3UU6 A;  1PUA A;  3TFY A;  3RF1 A;  4A5X A;  1M4G A;  1V0C A;  1Y0Y A;  5LHI B;  2NW8 A;  4MFK A;  2CY2 A;  3NH8 A;  4EAH A;  4FD5 A;  4YSZ A;  2JMK A;  1I6Z A;  1US7 B;  2V8S V;  4Q36 A;  4HPS A;  3UFE A;  3DTO A;  3FB3 A;  4IRE A;  3PJA A;  5C88 A;  1P0H A;  1B7T A;  4OC2 A;  3RYO A;  2PIZ A;  1Z8U A;  4XPD B;  4PK3 A;  1M44 A;  2KZ7 B;  2G3T A;  3PUX F;  4UEZ A;  4B5O A;  5K8M A;  2OZG A;  4KVX A;  2BSW A;  2PJ0 A;  3TO6 A;  4IDO A;  3PUA A;  4H6Z A;  2VAS A;  3VR8 A;  2VVS A;  2JEW A;  3ZCI A;  4CGN A;  2RPA A;  4BAY B;  4QC6 A;  5HXD A;  3S9N A;  3WAJ A;  1QSM A;  4U9Z A;  2LSI A;  4ZS2 A;  2WZN A;  2YND A;  4MHP A;  4MAL A;  1WLX A;  4YRH A;  2A72 A;  3MJX A;  5D8N A;  1IYK A;  1QSN A;  3CQX C;  3VRB A;  2PCU A;  2H89 A;  5JDN A;  1YSJ A;  4UEM A;  3R6N A;  1OXZ A;  2I59 A;  4XPK A;  4LF9 T;  2YEV C;  5FP3 A;  2YNC C;  1GHE A;  3F57 A;  4A56 A;  2YDS A;  1NSA A;  1ZEE A;  3RIF A;  3O1I A;  3PB9 X;  2D5U A;  4WYV A;  3SJX A;  1IBM T;  2BG9 A;  2E5L T;  2ZM6 T;  2ZM2 A;  1IY7 A;  4KHP T;  2NW7 A;  1XJO A;  5JM6 A;  1M4D A;  4KHZ F;  4XAX B;  3L09 A;  2RA1 A;  1MJA A;  2LSK A;  4NGQ A;  4FBE A;  2V6Y A;  3AE1 A;  3S6H A;  4YGO A;  3PJA J;  3SXO A;  1IOI A;  4FJO A;  3E22 E;  4JXR A;  2ZEO A;  3Q5D A;  4EXT A;  3JRU A;  4JI0 T;  5K8N A;  3L2N A;  3IHR A;  5CJ5 A;  1HF8 A;  4XZC A;  5D29 A;  2ACZ A;  5EMI A;  5AQG B;  2N1G A;  5A27 A;  5L3D B;  2JDC A;  2VEZ A;  5KTA A;  2WCA A;  5HXS A;  4GXH A;  4DUY T;  2W66 A;  4WNK A;  2WUU A;  2CF4 A;  4TWD A;  1BO4 A;  5THW A;  4PFO A;  3UUX B;  1QST A;  5JDL A;  4ZI2 D;  3E08 A;  2XAS B;  1D1C A;  1XMQ T;  3EI0 A;  3EDU A;  2I0M A;  2FVG A;  2UU9 T;  1Y7R A;  4A97 A;  2JEV A;  1UUS A;  4JYA T;  2BS4 A;  4JI4 T;  2K9A A;  2XQA A;  4OHF A;  3TLV A;  2EWB A;  2PJC A;  2XUE A;  3DP7 A;  3B2Y A;  4MHY A;  4UEE A;  1NSL A;  2WWU A;  2FE7 A;  3FXE B;  4KOS A;  1NMT A;  3RQW A;  2GFQ A;  4AXV A;  4ASK A;  2JRK A;  3B7I A;  4BJM A;  1BPN A;  2BS3 A;  2CBJ A;  2ZEH A;  5JRC B;  2B4B A;  1IB1 E;  3CZX A;  4EED A;  5IX3 A;  2M67 A;  2JPF A;  3R84 B;  1W09 A;  4BJN A;  3LBX B;  3O9X A;  2RC4 A;  2ODV A;  1TF9 A;  2AFS A;  2PJA A;  3PGP A;  5JQ4 A;  1ZO0 A;  4PSX A;  1Q7L A;  4DJL A;  3V8I A;  4MLK A;  2Z0Z A;  1HDQ A;  3OPC A;  5H86 A;  2MOZ A;  1DU2 A;  4R3K A;  4UCN A;  1MK4 A;  4GIW A;  1XDP A;  4R57 A;  2ZEE A;  5JDF A;  2B3U A;  4P4F A;  3TKL B;  3GMI A;  2JBK A;  2JQK A;  5FKY A;  4B3T T;  3S9L A;  2E9X B;  3IO1 A;  4P4I A;  3ZST A;  3ZC0 A;  5FVJ A;  2JIW A;  4OK0 A;  2CM0 A;  2AFM A;  5LGT B;  2JQ9 A;  3U78 A;  4IDZ A;  1LAM A;  1N36 T;  3N2O A;  2HUZ A;  3AE6 A;  4AQY T;  3PZJ A;  4A2Z A;  3ZJ0 A;  5AQJ B;  2XHE B;  1HDU A;  2Q7S A;  5AQU B;  4CYN A;  1XWM A;  2H7V C;  4QH4 A;  1WR0 A;  2HQY A;  3T1H T;  1ELM P;  2R7H A;  1YXR A;  4MFP A;  1AJ3 A;  1W9R A;  1R3N A;  3JAD A;  4NXY A;  4F9V A;  2Y6X A;  2FIW A;  4DV4 T;  4WJB A;  1H7C A;  4LQG A;  1YKE B;  2XEG A;  4CGL A;  2R6G F;  1KUV A;  3AVR A;  4F0Y A;  5HCJ A;  2Y0M A;  2V8H A;  2JQQ A;  3RZA A;  3V5U A;  3ZT6 A;  2POK A;  2X68 A;  3SOL A;  5JVD E;  1YVK A;  4ZI7 E;  5BR8 T;  4P4D A;  1YLO A;  3LK2 B;  2PDO A;  2XZE A;  2UUC T;  5KTD A;  4JI5 T;  2WS3 A;  3CQC B;  3V7Z A;  5K8P A;  5LYL A;  1N34 T;  4PNI A;  1BOB A;  2XQ7 A;  2HC9 A;  3F8K A;  4IE4 A;  5IV0 A;  5JRC A;  4PXB A;  2HN2 A;  1X79 A;  3GA8 A;  1XFO A;  3LBX A;  2BKN A;  1SUM B;  4JI7 T;  1KNZ A;  3L8R A;  3FZF B;  1XMO T;  4EFD A;  4IE5 A;  4J3G A;  2B5G B;  4MFJ A;  5HAX A;  3FYN A;  2EHO C;  2QIR A;  2VKH A;  2GAN A;  4NGP A;  3BHX A;  3X1D A;  2VB6 A;  3B3V A;  5LJN A;  2C5J A;  3CVR A;  1VCS A;  1Y01 A;  3QOF A;  1BR2 A;  2A2F X;  3KHZ A;  2VZZ A;  5C2T A;  1XMT A;  3SS1 A;  1CX8 A;  3D7G A;  1QLB A;  3RQU A;  1KFY A;  4KVO E;  2E9X A;  3KKW A;  3LJC A;  3S9M A;  3ZLI A;  2Q4Y A;  4HGA A;  4LUA A;  3RC8 A;  5A28 A;  4MRI A;  3QC9 A;  5HCM A;  5HXH A;  5L3B B;  1XNR T;  4JLE A;  5LGN B;  2XSA A;  1YQE A;  3TT2 A;  4BA9 A;  2J8M A;  2WZH A;  4O8S A;  5LRJ A;  2C6G A;  2Z3N A;  5HVH A;  4P44 A;  2BKP A;  3CT9 A;  3SWH A;  3N9P A;  4TUY E;  3IU2 A;  2PJQ A;  4V1A v;  4U72 A;  5JGF A;  4OC1 A;  4YSX A;  4JI6 T;  2UXX B;  4O2A E;  4R76 A;  2BO9 A;  3UU8 A;  2CXL A;  2FJB A;  1ZV4 X;  3GN5 B;  3LMS A;  1JNR A;  3N7Z A;  3P4P A;  4FD6 A;  3ZPO A;  4GK5 E;  3AAA B;  3OYZ A;  4UR9 A;  5IUX A;  3ISX A;  4AVB A;  4PXC A;  5L2L A;  2IUB A;  5AQP B;  1B87 A;  2A4N A;  2ZPA A;  3TOA A;  2EHO D;  3R9E A;  1OED B;  4KLV A;  5JQG E;  4X66 T;  5HEG A;  1H8L A;  2ZEN A;  4QBJ A;  4F6R C;  3B57 A;  4OME A;  4CS0 B;  4QHO A;  2VQF T;  2K48 A;  1AMP A;  5EC4 A;  1HNX T;  2WM9 A;  3SI0 A;  2YKS A;  2WYR A;  4TWE A;  4B11 A;  3AED A;  2MTQ A;  2W4X A;  2XEI A;  4RUH A;  2ZOF A;  2Z10 A;  5HMN A;  3N9N A;  5ISV A;  4ANJ A;  3C26 A;  2P6F A;  3RO0 A;  3W91 A;  3JC6 D;  3TLT A;  1ZLH A;  4ZGY B;  2BS2 A;  1JQG A;  1M62 A;  2IAK A;  5FL1 A;  2B5G A;  3P2H A;  2VUR A;  1ZHC A;  2LJL A;  2WSA A;  2V8G A;  3AE3 A;  3NKZ A;  1W0A A;  2V5C A;  2DEA A;  4O4I E;  5CA1 E;  5F8P A;  4AKL A;  3PTR B;  2PRQ A;  3TTH A;  4QH5 A;  5LOV E;  4DR6 T;  3IWW A;  2V7J A;  3R96 A;  4U9Y A;  3AB3 B;  5AFU L;  1QUU A;  5FYM A;  4UVA B;  4YY3 T;  3D7F A;  4X1I E;  4CN6 A;  3NZP A;  1J1J A;  2P9B A;  2Z3L A;  3V38 A;  4DUK A;  4U2Y A;  4HWC A;  2WPX A;  1ZG9 A;  2Q7B A;  4AG9 A;  4UV8 B;  2LE8 A;  2CPT A;  2H7O A;  1XMB A;  4FI5 A;  2AE6 A;  1Z8T A;  3P4W A;  2NTY A;  4MHN A;  5AQH B;  4KOY A;  4KP3 C;  4U33 A;  4TV9 E;  4KUB A;  3MA9 A;  4XPL A;  2W2U A;  2YN6 A;  4KOV A;  2C1C A;  4H9O C;  4YHH T;  2EBJ A;  3GKR A;  3K2K A;  3GIU A;  2V5D A;  3V5S A;  4F9U A;  1CUN A;  3CX8 B;  2J8N A;  1LFW A;  4HKF A;  4TWF A;  1YRE A;  3CDX A;  2E9X D;  4MHC A;  3PUV F;  1IBL T;  2C5K T;  1CBX A;  4R7M A;  3N9M A;  2NW9 A;  2WMO A;  3FHN A;  2CWY A;  1OED A;  4DR5 T;  2CXD A;  4UV9 B;  1TKF A;  2Z3K A;  4JYW A;  2YDR A;  3KR5 A;  1BR1 A;  5A1L A;  2ARH A;  4PK4 A;  2I6H A;  2FCK A;  3HKB E;  3PUW F;  2XAG B;  3FRM A;  4HWF A;  3NWI A;  3FEC A;  3VKG A;  2ZEG A;  4JLY A;  4K0K T;  4HTE A;  1S7K A;  3HR0 A;  4R3L A;  3I9S A;  1QMU A;  3IWG A;  1M4L A;  2LHN A;  3KI9 A;  2KXP B;  3UUN A;  4ZXL A;  1AYE A;  4DUZ T;  5L4E A;  2N9D A;  3VWE A;  1TF8 A;  2HV2 A;  5AQQ B;  4CPA A;  4EV6 A;  1RXT A;  3FF3 A;  4B3S T;  3AE7 A;  1YLE A;  3IF8 B;  2PJ1 A;  3FEE A;  2BVL A;  3TC8 A;  3RKO A;  4QH1 A;  2CNS A;  3MKD A;  2WDQ A;  3PB4 X;  3UFG A;  1Y9K A;  4PK2 A;  4YTP A;  4X8I A;  4CXW A;  4YFJ A;  4TX5 A;  2AFW A;  2J47 A;  4QX7 B;  4PJJ A;  1FJG T;  1I12 A;  2IJZ A;  3VWD A;  4B6Z A;  2XQ9 A;  3CQG B;  4GK0 E;  2LOP A;  3TLW A;  3WAK A;  3CXP A;  3LOD A;  3RYI E;  4IHM A;  1VGY A;  2NMT A;  1LOK A;  1YQ4 A;  3PU3 A;  2LKH A;  4P4B A;  5F48 A;  5FVL A;  2O28 A;  4CXX A;  3QAY A;  3AAI A;  4P4E A;  2VWA A;  4O4H E;  5ETW A;  5HVF A;  3P8C D;  4O2B E;  3D3S A;  2YNC A;  5KTC A;  2P6E A;  1XE4 A;  4L9I A;  5FXX A;  3VRA A;  3IJ3 A;  1CPS A;  2XQ4 A;  3AEA A;  4UIB A;  1V9D A;  4KBM B;  5FXV A;  3K3O A;  4JI3 T;  5HXC A;  2QYW A;  2UUB T;  5FL0 A;  1YW4 A;  4M6G A;  4P45 A;  1P4N A;  2CXA A;  4EVY A;  2DNX A;  3HKC E;  4P1N A;  1CPX A;  4UFX A;  3FH4 A;  2ZEF A;  2JDD A;  1E1H B;  4C90 A;  3CPZ A;  4WWV A;  1BLL E;  4FD4 A;  5IYZ E;  2XAQ B;  4HE8 A;  3ZC1 A;  1IID A;  2X66 A;  3Q9D A;  3C4X A;  2DLR A;  1XOV A;  1QQ9 A;  4UVC B;  5AQV B;  4IGU A;  4RS2 A;  4WZX A;  5AQL B;  4EEB A;  2V8V A;  3KFW X;  1UWY A;  2G9D A;  5LHG B;  4AKG A;  5EK3 A;  1LCP A;  3KIN B;  4OP4 A;  2F8H A;  4KOX A;  3MZK B;  3VR9 A;  4KZT A;  5JH9 A;  2V26 A;  2DI4 A;  4HFD A;  4DR7 T;  5AG4 A;  3RX6 A;  2MAW A;  4TN7 B;  3IU1 A;  4RN7 A;  1VIX A;  3NZQ A;  1U6M A;  5KXJ A;  3AA7 B;  3UQ4 A;  5J2T E;  2BBJ A;  2IML A;  4FUU A;  4OC4 A;  1U5P A;  5DWN A;  3MGD A;  4KOU A;  3ABV A;  4H2K A;  1SQH A;  1TXR A;  4C7H A;  3J7Y q;  2F7V A;  3QB8 A;  4ERR A;  5LMN T;  4DV7 T;  4PV6 A;  3KR4 A;  2OOT A;  2OH1 A;  1Q2Y A;  1R43 A;  3JUW A;  1F57 A;  2ZEP A;  2OB0 A;  2HB6 A;  4QKN A;  1G73 A;  2YNE A;  2ZOG A;  3NBX X;  4LFA T;  4CZZ B;  2B4D B;  3PUY F;  2UXD T;  5HH1 A;  1SE7 A;  2BDE A;  4NXM T;  1Y64 B;  5E0O A;  1ZG7 A;  4MI4 A;  3MXZ A;  1MMG A;  4GYR A;  4M6I A;  4KVM E;  2VK9 A;  4JWP A;  4HKA A;  2V1D B;  3C98 B;  1S7N A;  3ZN0 B;  4PSW A;  5M4Y A;  4CGM A;  4GOU A;  3D8P A;  4CYO A;  2LKG A;  5LA6 E;  3AEE A;  3EAB A;  2F5I A;  2AFZ A;  2EHO B;  2Q43 A;  2PJ4 A;  5L3F B;  4KMC A;  3ZKR A;  3AAE B;  1QSD A;  2PQ8 A;  3FZL B;  2V8D A;  3LG7 A;  4A94 A;  4UCM A;  1HFA A;  4JEH B;  2WZI A;  3UU4 A;  2HPJ A;  2GLF A;  3FMC A;  3D7H A;  1S94 A;  2D9D A;  4ZOL E;  2OA5 A;  1ARL A;  4LFB T;  3SXN A;  5J8F A;  2MBG A;  4DV2 T;  2ZEM A;  2XQ8 A;  4YU9 A;  4OID A;  4NJQ A;  3AXJ B;  4IE6 A;  3G3S A;  1T98 A;  3KHX A;  1XIX A;  4PQA A;  4AVA A;  4MHZ A;  2FT0 A;  5AQF B;  4P4J A;  4PPZ A;  1EE3 P;  3PDY A;  2W63 A;  3OVU A;  4DND A;  1D1A A;  2W67 A;  2Q4V A;  3RAM A;  1J4J A;  4C2X A;  1KEY A;  5LHH B;  4DV5 T;  2ABZ A;  4OX9 T;  3PEI A;  3DNS A;  3PB8 X;  4L89 A;  4A95 A;  4ZY2 A;  3VU7 H;  5FXW A;  3C51 A;  1HCI A;  3L39 A;  3IEE A;  1YW0 A;  4U2Z A;  2Z3O A;  3K8P C;  4ZI6 A;  2C6C A;  4E8O A;  3OJA A;  3AEF A;  1QSO A;  4COF A;  5L3E B;  3BLN A;  2Y48 B;  1HG2 A;  4AXP A;  2FUP A;  3AEC A;  3TO7 A;  3RGL A;  1CG2 A;  2WDR A;  1BPM A;  1FEW A;  4P10 A;  2I3C A;  2V6X A;  3ZCJ A;  2IC9 A;  2VL0 A;  4C91 A;  2PIY A;  3GYA A;  2B4D A;  3CPA A;  3FBZ A;  3JCF A;  5KX5 E;  1WK4 A;  4MY3 A;  1IIC A;  4A39 A;  3ONJ A;  2FBW A;  4QVT A;  1ZKE A;  2Z11 A;  2BG9 C;  2DHR A;  4G63 A;  3SHP A;  4B3R T;  3AA1 B;  3PRT A;  3LD2 A;  5G20 A;  2CHO A;  3ZT7 A;  2K24 A;  2Q04 A;  4XNH C;  3ZYM A;  5EBV A;  3HL6 A;  4HWI B;  4PFP A;  3NH4 A;  5F5W A;  3LFM A;  3EXN A;  4RI1 A;  4I0U A;  2VXK A;  4TWH A;  2EHO A;  3GB0 A;  2CWO A;  1L0C A;  4CAW A;  1FMW A;  4DV3 T;  3D4U A;  3BQK A;  4NGM A;  2QRX A;  2XM2 A;  1WCR A;  2VBQ A;  2IMO A;  2BVM A;  3EDV A;  1LAN A;  4MBQ A;  3KGQ A;  2BUE A;  4TNV A;  2ES0 A;  3K9U A;  3FJU A;  4MFQ A;  3FZK B;  2UUA T;  2DPS A;  3AXJ A;  3ZJ2 A;  4OYJ A;  5ABG A;  5JDQ A;  3D0T A;  2Q51 A;  4DNC A;  2GU2 A;  4MFL A;  1MJB A;  4DYO A;  4OIW A;  4NIQ A;  3ZJ1 A;  4ZI3 C;  3LAC A;  5FNV E;  4P0A A;  2X67 A;  3IA3 A;  2J1D G;  4YWY A;  3S6G A;  2EO8 A;  4XPD C;  3I9W A;  2AFX A;  1Z9U A;  1CJW A;  1MND A;  4Z8X A;  4UVB B;  1XRY A;  5I4M A;  2PVV A;  2VKJ A;  3LSV A;  4EZH A;  2KIN B;  3I0Q A;  2YU2 A;  2W00 A;  4AQF C;  4AI6 A;  3S6K A;  1X12 A;  4OC0 A;  1WYC A;  4A31 A;  2G0U A;  2WY2 A;  4HFH A;  3HLP A;  5ELY A;  2PJB A;  3H8G A;  1TKJ A;  4YTM A;  5LYF A;  5CBM A;  2V7M A;  2Q9Q C;  4OKO A;  3H5Z A;  4ZX9 A;  4IUS A;  3FIX A;  1MMA A;  3OTO T;  3EAM A;  1CP7 A;  4H9P C;  2YK0 A;  3QK6 A;  2BG9 E;  3B3W A;  2CNT A;  2PSW A;  3HUV A;  3DLJ A;  4QX8 B;  4G1P A;  1Q2C A;  3FBU A;  3PP9 A;  1FY7 A;  5AQR B;  5JDH A;  2X0H A;  7CPA A;  3AE5 A;  1IYL A;  4MCQ A;  3JAE A;  1U4Q A;  3WR7 A;  5J0Z A;  4EOZ B;  4PXE A;  4LQ6 A;  5LP6 E;  2CIJ A;  2KCW A;  4U74 A;  3HI2 A;  4EYY R;  1I1D A;  3D2M A;  3FNC A;  4MJ8 A;  4U7Y A;  3H8F A;  1IGB A;  2FJD A;  3KV4 A;  4OFZ A;  1T72 A;  4OYK A;  3KZW A;  3A5X A;  3K3Q C;  4H9Q C;  4X1Y E;  5LGU B;  4A30 A;  3SI2 A;  4M1P A;  3TE4 A;  3FB2 A;  3ZMZ B;  2XTL A;  1XEB A;  2X9X A;  3CKD A;  3P2F A;  2P0W A;  4ZZB A;  3EO4 A;  2KND A;  3B3T A;  4YFS A;  5LJM A;  4IAV A;  5ABF B;  3ZMT B;  4LF4 T;  4JBW F;  3GY9 A;  3NFZ A;  2PE3 A;  5FY1 A;  3R9G A;  1X9B A;  1KZF A;  3AEB A;  5HEJ A;  1KK7 A;  1NEN A;  4H9N C;  3BI1 A;  3IGR A;  4UCP A;  4NGS A;  4II9 A;  1HNZ T;  4C2Y A;  1KUX A;  4UF0 B;  5CPA A;  3RYC E;  3ANW B;  3NE8 A;  4A37 A;  2BKO A;  3E0Z A;  4QUS A;  5BWA B;  4AB7 A;  3EUH A;  3HKD E;  5LB7 B;  5F3J A;  2K3W A;  4OAD A;  5LMU T;  4KSI A;  5EZY E;  3I1A A;  3KL9 A;  2XPK A;  3G06 A;  3DR6 A;  2BEI A;  2E8I A;  4BD9 A;  5F46 A;  4KS9 A;  1LAP A;  4UXN B;  3ESL A;  4L5G A;  3G8W A;  4CI1 B;  3T8W A;  4HFB A;  4YSY A;  4QB9 A;  3FZM B;  2BBH A;  1VCT A;  4BBH A;  3EY5 A;  3LK4 2;  2YDQ A;  4X64 T;  1KWM A;  4MHD A;  4IDN A;  4CRZ B;  5J2U E;  1Y9W A;  4AVC A;  2R1I A;  4UWJ A;  4PJM A;  2X9W A;  4MCR A;  3ZSS A;  1J5W A;  1UCU A;  4KOR A;  1TKH A;  3W15 B;  4X62 T;  1S60 A;  2L8K A;  2PRB A;  1Z4E A;  1UFH A;  3BXM A;  2GE3 A;  2CA5 A;  1DTD A;  1UGO A;  4B12 A;  2XAJ B;  2XAF B;  4NUV A;  2OR4 A;  3UUM A;  4PK5 A;  3PUZ F;  3KAS A;  1Z2L A;  5F09 A;  1T7S A;  5JR9 C;  2DXQ A;  1QSR A;  2PR8 A;  4NJR A;  3PFO A;  3SFE A;  3NH5 A;  3OKQ A;  3LDQ B;  2JLM A;  2P6G A;  2ZM0 A;  3CML A;  4EME A;  1YX0 A;  4PW8 A;  3R1K A;  3NA6 A;  2AXD S;  4PJL A;  4YJ3 E;  5DWM A;  1HS7 A;  1S35 A;  3ZN1 B;  4GS4 A;  4MY0 A;  4CAV A;  2VZY A;  3P4R A;  3R9F A;  3IBP A;  1BAV A;  1FIO A;  4CI2 B;  1WRD A;  4M3S A;  3KV9 A;  2QVA A;  4DV1 T;  3MAC A;  3UT5 E;  4K30 A;  4FD7 A;  4HWD A;  3UQ7 A;  2X9H A;  4X2T A;  4MFZ A;  1FT7 A;  2DL1 A;  5ABH A;  1F2P A;  4NCZ A;  2CMR A;  5ABF A;  2MPK A;  2NWB A;  3Q2M A;  5LCY A;  1HR0 T;  5AQK B;  4PXD A;  4PK6 A;  3M65 A;  2OLT A;  1ON0 A;  3MN8 A;  2J62 A;  3PFE A;  1LKX A;  3O4X E;  5AQT B;  3N5F A;  5LNK A;  2UXB T;  3ETU A;  1VOM A;  4UF0 A;  4ISS A;  1D1B A;  4JI8 T;  4Y49 C;  3ANW A;  2EVN A;  3RLF F;  4CAE A;  4I4T E;  2A3D A;  3QNV A;  4B14 A;  2FXF A;  4I43 B;  4QXC B;  3LK3 B;  4B10 A;  2PTF A;  4IST A;  1M7K A;  3RIU C;  3VHL A;  2HN1 A;  2LM2 A;  3AVS A;  3B3S A;  3GWH A;  3SJG A;  2A9U A;  5I0C A;  4ZHQ E;  1YKH B;  1N32 T;  4OC5 A;  4UWI A;  5J1G A;  3AE4 A;  4HN9 A;  3RHW A;  1TIQ A;  1YD8 G;  3P4S A;  3NE7 A;  4C68 A;  4HFC A;  3JAF A;  2B76 A;  4CRY B;  3B8G A;  3QB5 K;  2PJ9 A;  2KLQ A;  5CA0 E;  2LT3 A;  3KDS E;  4E0A A;  4QWN B;  2EUI A;  1VHO A;  2D2S A;  1DE4 C;  2D4P A;  2OZU A;  4KOW A;  2X9Y A;  2WQY A;  2WDV A;  2VKD A;  5KMG P;  1ZOY A;  5HWY A;  1I21 A;  5CFB A;  1PYT B;  4UEF A;  4L0R A;  4ZS3 A;  4FAI A;  4JXQ A;  2IIU A;  3UUL A;  2QGS A;  3Q5X A;  5H6Q B;  3IWE A;  3QB5 A;  4DO0 A;  4DMV A;  3AEG A;  5C8Y E;  2VVN A;  4ILA A;  2H3R A;  3QNU A;  4U7I A;  2RB7 A;  1MIW A;  1WFD A;  5HEO A;  3IFE A;  3SJF A;  4QXB B;  1JNZ A;  5F47 A;  5JTG A;  1NE9 A;  3P4Q A;  4HNY B;  4EWT A;  1EZ3 A;  4XNH B;  1D0Z A;  3A8Y C;  4KUA A;  1X10 A;  3CXS A;  2NTX A;  4ILC A;  4DVD A;  2KWI B;  2ZLY A;  2D0U A;  5L3C B;  3EVY A;  1ARM A;  3WC6 A;  3RI5 A;  3RRC A;  2B1E A;  2OV9 A;  3M3Z B;  5DQV A;  3PB7 X;  4HNW B;  2LRK A;  4MCS A;  3BQL A;  3UU5 A;  1MMD A;  3PUQ A;  4H9R C;  4GM5 A;  2UXN B;  4AG7 A;  3K3N A;  1W0B A;  2NP9 A;  5FXZ A;  3UTK A;  5L3G B;  3FX6 A;  2EK8 A;  2GK9 A;  2J8R A;  5FVK A;  3EFA A;  5J1Q A;  4MXU A;  1VHS A;  5HXE A;  4UIA A;  2WWV A;  4X5K A;  1CP6 A;  2BL1 A;  4DID B;  3AE8 A;  4X20 E;  4DV0 T;  4X1K E;  3TX8 A;  1VKC A;  3I1U A;  1E7P A;  3TLS A;  2XY8 B;  1ZLI A;  4NXN T;  2WPW A;  1MJ9 A;  2K5T A;  4BIN A;  4O23 A;  4CI3 B;  1Y0R A; 
#chains in the Genus database with same CATH homology
 1SHZ C;  4H63 V;  2YIN A;  4G2A A;  2W0G A;  3KBT A;  5AGE A;  5IHY A;  4EIW A;  4Q38 A;  2Q9Q B;  4ZI2 C;  4H6U A;  4A33 A;  3PUS A;  4CYQ A;  3F31 A;  4NF1 A;  3BJ8 A;  3U3I A;  5KDM C;  3N9O A;  2CLY C;  1BR0 A;  4LX9 A;  2B3V A;  2DWK A;  4KUM B;  1R57 A;  2HH7 A;  4OAE A;  4NUU A;  4U5Y A;  2B58 A;  5HXR A;  4ORF A;  4O4L E;  2X51 A;  3I3G A;  4N78 D;  1NWM X;  4BMH A;  3T9Y A;  1YGH A;  3ZZI A;  4B5P B;  4E7Z A;  5DQW A;  4YHJ A;  3NRX A;  2QML A;  3DSB A;  2W61 A;  3N9L A;  4ADZ A;  2X7B A;  3D2P A;  3DR8 A;  1IJ6 A;  4EB6 E;  1Q2D A;  3P7I A;  4JD6 A;  1S3Z A;  2PG8 A;  1IZN B;  4EZ4 A;  2KWH A;  4CGO A;  4NEX A;  3ZMS B;  1HTJ F;  5FY7 A;  4TZ4 C;  1NAF A;  2DWG A;  5LXT E;  3FXT A;  2V7I A;  3E0K A;  3H37 A;  2AJ6 A;  1YK3 A;  5FY0 A;  1D0Y A;  2VI7 A;  5DJQ C;  3N2K E;  4J2C A;  1MNE A;  4DBR A;  4AQF A;  2REF A;  1WWZ A;  1UX4 A;  1BR4 A;  2IL4 A;  2CE7 A;  2KT9 A;  3PUR A;  2Z3M A;  5LYJ E;  5TAO A;  5CNP A;  1FMV A;  3RPU A;  2Q9Q A;  4PJN A;  1Z0P A;  2LOS A;  4F6A A;  3BQI A;  2PR1 A;  4AKI A;  4KOT A;  3QUJ A;  5JR9 B;  2YGW A;  1D0X A;  2KMF A;  3OWC A;  3C4W A;  3ZMU B;  2LHR A;  5EK4 A;  4MBU A;  1Z4R A;  5DAB A;  2I00 A;  2JMH A;  3ZMV B;  3QAH A;  3JVN A;  3KBU A;  3OBV E;  4CYP A;  3J9X 1;  2VL8 A;  3O1H A;  2ZW5 A;  2L9Q A;  1LVF A;  2ZW4 A;  4UIG A;  2N2N A;  4B5P A;  2R8V A;  4CGP A;  3TCV A;  2ODU A;  4F0X A;  5C82 A;  4GYS A;  2D4O A;  3T8O A;  2ZM8 A;  3MK7 C;  3OYX A;  4H89 A;  5ADX L;  4EYU A;  2CEA A;  2G0B A;  4E2A A;  5JDG A;  2PBI A;  3HA4 A;  3W6S A;  4YLH A;  5F49 A;  4Y49 B;  3TOB A;  4HEA A;  5CB4 E;  3C4Z A;  2LM9 A;  3N2G E;  4KSA A;  4ONU A;  4CAX A;  4IE7 A;  5AG5 A;  4B6X A;  3CX6 B;  4WW0 A;  4IIJ E;  4JUY A;  4UEL A;  5EK2 A;  2Q0Y A;  3PUG A;  3R95 A;  5JPH A;  3I9Y A;  5E96 A;  4ZI3 D;  2X0L B;  3NRY A;  2XAH B;  4H9S E;  3AA0 B;  4UBR A;  4JEU B;  5JR9 A;  4CQI A;  4AKH A;  1PU9 A;  3KV6 A;  2QEC A;  2YU1 A;  1IAP A;  5LG4 A;  2NOX A;  3FBL A;  4ZBG A;  4UFW A;  4JJX A;  2DCF A;  1K4J A;  2CCQ A;  3ZYL A;  1S7F A;  3JC6 C;  4R9M A;  3BK9 A;  3CX7 B;  4L8A A;  4I49 A;  2GIV A;  1XF8 A;  4IE0 A;  2H5M A;  2Q9Q D;  2FIA A;  2Z6E A;  3PE0 A;  1M4I A;  3ONX A;  2JJ9 A;  1LRZ A;  2PFV A;  2D0T A;  2REE A;  2OZH A;  1HX8 A;  1LVK A;  5LBM A;  1MIY A;  2ACX A;  5AG7 A;  3HKE E;  1UX5 A;  4CXY A;  3ZYK A;  3F5B A;  3JTK A;  2SPC A;  4DMW A;  2VQY A;  4P09 A;  3ETV A;  1YR0 A;  1KUY A;  3TO9 A;  4I55 E;  3L3P A;  4C2Z A;  3Q5W A;  4K0U A;  2CXF A;  4WBN E;  2Q44 A;  2PC1 A;  5GON E;  2I79 A;  1HG5 A;  3A9L A;  2HPL A;  3W6X A;  2FSR A;  2ZW7 A;  5IB0 A;  2Y8D A;  3H3A A;  5H84 A;  5G21 A;  3PU8 A;  3CXQ A;  3ZEF B;  1VRB A;  2ZW6 A;  2WSS V;  2W62 A;  2C5I T;  2E9X C;  1WYB A;  3C50 A;  5HYA A;  3RH3 A;  2V7K A;  4H63 H;  3S4U A;  5J8C A;  5LBQ B;  1CM0 A;  3C64 A;  4HNX B;  5JH7 E;  2C0S A;  3EC4 A;  4ILU A;  4NSQ A;  1WR6 A;  5H6R B;  2Z3P A;  4C7I A;  2OU2 A;  3RYH E;  3T90 A;  2DPT A;  4IHJ E;  5AG6 A;  3KVB A;  4TV8 E;  5FMN A;  2WAU A;  3BJ7 A;  4XBF B;  2C27 A;  2CLY B;  2LSG A;  3RRW A;  2WMN A;  5JDM A;  3KVA A;  3CWZ B;  2MYS A;  5G1Z A;  3GN5 A;  3RYF E;  1N71 A;  3WI3 A;  3H4Q A;  2ATR A;  3FXD B;  3SRZ A;  1S7L A;  1RO5 A;  2XQY A;  4DBQ A;  3UY5 A;  2IC6 A;  4UA3 A;  3KV5 A;  5JRE A;  4B13 A;  4PAG A;  4UFV A;  4HFV A;  4O4J E;  1B6B A;  1YVO A;  2LSY A;  5HWX A;  3N9Q A;  4IF5 A;  2LEH A;  2BZB A;  4P0B A;  4QXH B;  2QA7 A;  2VKO A;  4KLW A;  3I0O A;  2LSJ A;  4MFR A;  4OLL A;  3O1J A;  1OZP A;  1IJ5 A;  3B13 A;  4M85 A;  3AA6 B;  5GCN A;  3DDD A;  2FS5 A;  4KSF A;  4WBO A;  4AKR B;  3N5L A;  2WBL A;  2FL4 A;  1OWA A;  2ZMA A;  5BMV E;  4E7S A;  1MMN A;  3S6F A;  2ZXV A;  2R98 A;  4R87 A;  2CNM A;  3DJB A;  3VKH A;  2IW5 B;  3F0A A;  4A32 A;  3F2E A;  1SA0 E;  3RC3 A;  4YJ2 E;  2K5B B;  2L3L A;  2V7L A;  4AQG A;  4I50 E;  1O3X A;  1MIV A;  1M1D A;  5G22 A;  1G8X A;  4CAF A;  2RP4 A;  1S5K A;  2G3A A;  1PUA A;  3TFY A;  1M4G A;  1V0C A;  5LHI B;  2NW8 A;  4MFK A;  2CY2 A;  4EAH A;  4FD5 A;  2JMK A;  1US7 B;  4Q36 A;  3UFE A;  3DTO A;  3FB3 A;  5C88 A;  1P0H A;  1B7T A;  3RYO A;  4XPD B;  4PK3 A;  1M44 A;  2KZ7 B;  2G3T A;  4B5O A;  2OZG A;  4KVX A;  2BSW A;  3TO6 A;  3PUA A;  4H6Z A;  2VAS A;  3ZCI A;  4CGN A;  4BAY B;  4QC6 A;  3WAJ A;  1QSM A;  4U9Z A;  2LSI A;  4ZS2 A;  2YND A;  4MAL A;  1WLX A;  4YRH A;  2A72 A;  3MJX A;  1IYK A;  1QSN A;  3CQX C;  5JDN A;  4UEM A;  3R6N A;  1OXZ A;  2I59 A;  4XPK A;  2YEV C;  5FP3 A;  2YNC C;  1GHE A;  3F57 A;  4A56 A;  1ZEE A;  3O1I A;  2D5U A;  2ZM2 A;  2NW7 A;  1M4D A;  4XAX B;  3L09 A;  2RA1 A;  1MJA A;  2LSK A;  3S6H A;  4YGO A;  3SXO A;  4FJO A;  3E22 E;  4JXR A;  4EXT A;  3IHR A;  1HF8 A;  4XZC A;  2N1G A;  5A27 A;  5L3D B;  2JDC A;  2VEZ A;  5KTA A;  5HXS A;  4WNK A;  2WUU A;  1BO4 A;  4PFO A;  3UUX B;  1QST A;  5JDL A;  4ZI2 D;  3E08 A;  2XAS B;  1D1C A;  3EDU A;  1Y7R A;  2JEV A;  2K9A A;  4OHF A;  2XUE A;  3DP7 A;  1NSL A;  2WWU A;  2FE7 A;  3FXE B;  4KOS A;  1NMT A;  4ASK A;  2JRK A;  4BJM A;  5JRC B;  2B4B A;  1IB1 E;  5IX3 A;  2M67 A;  2JPF A;  3R84 B;  4BJN A;  3LBX B;  3O9X A;  2RC4 A;  2ODV A;  3PGP A;  5JQ4 A;  1ZO0 A;  4PSX A;  3V8I A;  4MLK A;  2Z0Z A;  5H86 A;  2MOZ A;  4R3K A;  4UCN A;  1MK4 A;  4GIW A;  4R57 A;  5JDF A;  2B3U A;  3TKL B;  3GMI A;  2E9X B;  5FVJ A;  3ZC0 A;  4OK0 A;  2CM0 A;  5LGT B;  3U78 A;  4IDZ A;  3N2O A;  2HUZ A;  3PZJ A;  4A2Z A;  3ZJ0 A;  2XHE B;  4CYN A;  2H7V C;  2HQY A;  2R7H A;  4MFP A;  1AJ3 A;  4NXY A;  2Y6X A;  2FIW A;  1H7C A;  1YKE B;  4CGL A;  1KUV A;  3AVR A;  4F0Y A;  2Y0M A;  2JQQ A;  3V5U A;  2X68 A;  3SOL A;  5JVD E;  1YVK A;  4ZI7 E;  3LK2 B;  2PDO A;  5KTD A;  3CQC B;  4PNI A;  1BOB A;  3F8K A;  4IE4 A;  5IV0 A;  5JRC A;  1X79 A;  3GA8 A;  3LBX A;  1KNZ A;  4IE5 A;  4J3G A;  2B5G B;  4MFJ A;  5HAX A;  3FYN A;  2EHO C;  2QIR A;  2VKH A;  2GAN A;  2VB6 A;  2C5J A;  3CVR A;  5LJN A;  1BR2 A;  2A2F X;  2VZZ A;  1XMT A;  3SS1 A;  4KVO E;  2E9X A;  3KKW A;  3LJC A;  3ZLI A;  2Q4Y A;  4HGA A;  4LUA A;  3RC8 A;  5A28 A;  3QC9 A;  5HXH A;  5L3B B;  4JLE A;  5LGN B;  3TT2 A;  4BA9 A;  2J8M A;  4O8S A;  2Z3N A;  3SWH A;  3N9P A;  4TUY E;  3IU2 A;  2PJQ A;  4V1A v;  4U72 A;  2UXX B;  4O2A E;  2CXL A;  1ZV4 X;  3GN5 B;  3N7Z A;  4FD6 A;  3ZPO A;  4GK5 E;  3AAA B;  3OYZ A;  4AVB A;  5L2L A;  1B87 A;  2A4N A;  2ZPA A;  3TOA A;  2EHO D;  3R9E A;  4KLV A;  5JQG E;  4QBJ A;  4F6R C;  3B57 A;  4CS0 B;  4QHO A;  2K48 A;  5EC4 A;  2WM9 A;  4B11 A;  2MTQ A;  2Z10 A;  5HMN A;  3N9N A;  5ISV A;  4ANJ A;  3C26 A;  2P6F A;  3W91 A;  3JC6 D;  4ZGY B;  2IAK A;  2B5G A;  3P2H A;  1ZHC A;  2LJL A;  2WSA A;  4O4I E;  5CA1 E;  5F8P A;  4AKL A;  3PTR B;  3TTH A;  5LOV E;  2V7J A;  3R96 A;  4U9Y A;  3AB3 B;  5AFU L;  1QUU A;  5FYM A;  4UVA B;  4X1I E;  3NZP A;  2P9B A;  2Z3L A;  2WPX A;  2Q7B A;  4AG9 A;  4UV8 B;  2LE8 A;  2H7O A;  4FI5 A;  2AE6 A;  2NTY A;  4KOY A;  4KP3 C;  4TV9 E;  4KUB A;  3MA9 A;  4XPL A;  4KOV A;  4H9O C;  3GKR A;  3V5S A;  1CUN A;  3CX8 B;  2J8N A;  4HKF A;  1YRE A;  2E9X D;  4MHC A;  2C5K T;  3N9M A;  2NW9 A;  2WMO A;  3FHN A;  2CWY A;  2CXD A;  4UV9 B;  2Z3K A;  1BR1 A;  5A1L A;  2ARH A;  4PK4 A;  2FCK A;  3HKB E;  2XAG B;  3FRM A;  3VKG A;  4JLY A;  4HTE A;  1S7K A;  3HR0 A;  4R3L A;  3I9S A;  3IWG A;  2LHN A;  2KXP B;  3UUN A;  2N9D A;  3VWE A;  2HV2 A;  1RXT A;  1YLE A;  3IF8 B;  2BVL A;  3RKO A;  2CNS A;  3MKD A;  1Y9K A;  4PK2 A;  4CXW A;  4YFJ A;  4TX5 A;  4QX7 B;  4PJJ A;  1I12 A;  3VWD A;  3CQG B;  4GK0 E;  2LOP A;  3WAK A;  3CXP A;  3LOD A;  3RYI E;  2NMT A;  3PU3 A;  5F48 A;  2O28 A;  4CXX A;  3AAI A;  2VWA A;  4O4H E;  5ETW A;  3P8C D;  4O2B E;  3D3S A;  2YNC A;  5KTC A;  2P6E A;  1XE4 A;  4L9I A;  5FXX A;  1V9D A;  4KBM B;  5FXV A;  3K3O A;  5HXC A;  1P4N A;  2CXA A;  4EVY A;  2DNX A;  3HKC E;  4UFX A;  2JDD A;  1E1H B;  4C90 A;  3CPZ A;  4FD4 A;  5IYZ E;  2XAQ B;  4HE8 A;  3ZC1 A;  1IID A;  2X66 A;  3Q9D A;  3C4X A;  2DLR A;  4UVC B;  4IGU A;  4RS2 A;  3KFW X;  5LHG B;  4AKG A;  5EK3 A;  3KIN B;  4KOX A;  3MZK B;  4KZT A;  2V26 A;  2DI4 A;  5AG4 A;  3RX6 A;  4TN7 B;  3IU1 A;  3NZQ A;  1U6M A;  3AA7 B;  5J2T E;  1U5P A;  5DWN A;  3MGD A;  4KOU A;  1SQH A;  4C7H A;  3J7Y q;  3QB8 A;  4ERR A;  4PV6 A;  2OH1 A;  1Q2Y A;  3JUW A;  2OB0 A;  4QKN A;  1G73 A;  2YNE A;  3NBX X;  2B4D B;  4CZZ B;  5HH1 A;  2BDE A;  1Y64 B;  5E0O A;  4MI4 A;  3MXZ A;  1MMG A;  4GYR A;  4KVM E;  2VK9 A;  4JWP A;  4HKA A;  2V1D B;  3C98 B;  1S7N A;  3ZN0 B;  4PSW A;  5M4Y A;  4CGM A;  4GOU A;  3D8P A;  4CYO A;  5LA6 E;  2F5I A;  2EHO B;  5L3F B;  4KMC A;  3AAE B;  1QSD A;  2PQ8 A;  3LG7 A;  4UCM A;  1HFA A;  4JEH B;  2HPJ A;  1S94 A;  4ZOL E;  2OA5 A;  3SXN A;  5J8F A;  2MBG A;  4IE6 A;  3G3S A;  1T98 A;  1XIX A;  4AVA A;  2FT0 A;  3PDY A;  2W63 A;  4DND A;  1D1A A;  2Q4V A;  1J4J A;  4C2X A;  5LHH B;  3DNS A;  4L89 A;  4A95 A;  3VU7 H;  5FXW A;  3C51 A;  1HCI A;  3IEE A;  1YW0 A;  2Z3O A;  3K8P C;  4E8O A;  3OJA A;  1QSO A;  5L3E B;  3BLN A;  2Y48 B;  1HG2 A;  4AXP A;  3TO7 A;  1FEW A;  3ZCJ A;  2IC9 A;  4C91 A;  3GYA A;  2B4D A;  3FBZ A;  5KX5 E;  1WK4 A;  4MY3 A;  1IIC A;  4QVT A;  1ZKE A;  2Z11 A;  2DHR A;  4G63 A;  3SHP A;  3AA1 B;  3LD2 A;  5G20 A;  2K24 A;  2Q04 A;  4XNH C;  3ZYM A;  5EBV A;  3HL6 A;  4PFP A;  3LFM A;  3EXN A;  4RI1 A;  2VXK A;  2EHO A;  2CWO A;  1L0C A;  4CAW A;  1FMW A;  3BQK A;  2VBQ A;  2BVM A;  3EDV A;  4MBQ A;  2BUE A;  2ES0 A;  3K9U A;  4MFQ A;  2DPS A;  3ZJ2 A;  4OYJ A;  5JDQ A;  3D0T A;  4DNC A;  4MFL A;  1MJB A;  3ZJ1 A;  4ZI3 C;  5FNV E;  4P0A A;  2X67 A;  2J1D G;  3S6G A;  4XPD C;  3I9W A;  1Z9U A;  1CJW A;  1MND A;  4Z8X A;  4UVB B;  2VKJ A;  4EZH A;  2KIN B;  3I0Q A;  2YU2 A;  2W00 A;  4AQF C;  4AI6 A;  3S6K A;  4A31 A;  1WYC A;  2G0U A;  2V7M A;  2Q9Q C;  3H5Z A;  4IUS A;  3FIX A;  1MMA A;  4H9P C;  2YK0 A;  3QK6 A;  2CNT A;  2PSW A;  4QX8 B;  1Q2C A;  3FBU A;  3PP9 A;  1FY7 A;  5JDH A;  1IYL A;  1U4Q A;  3WR7 A;  4EOZ B;  5LP6 E;  2KCW A;  4U74 A;  3HI2 A;  4EYY R;  1I1D A;  3D2M A;  3FNC A;  4MJ8 A;  3KV4 A;  4OFZ A;  4OYK A;  3A5X A;  3K3Q C;  4H9Q C;  4X1Y E;  5LGU B;  4A30 A;  4M1P A;  3TE4 A;  3FB2 A;  3ZMZ B;  2XTL A;  1XEB A;  2X9X A;  3CKD A;  3P2F A;  2P0W A;  3EO4 A;  2KND A;  4YFS A;  5LJM A;  3ZMT B;  3GY9 A;  5FY1 A;  3R9G A;  1KZF A;  1KK7 A;  3IGR A;  4H9N C;  4UCP A;  4II9 A;  4C2Y A;  1KUX A;  4UF0 B;  3RYC E;  3ANW B;  3E0Z A;  4QUS A;  5BWA B;  4AB7 A;  3EUH A;  3HKD E;  5F3J A;  4OAD A;  5EZY E;  3I1A A;  3DR6 A;  2BEI A;  2E8I A;  5F46 A;  4KS9 A;  4UXN B;  3ESL A;  4L5G A;  3G8W A;  4CI1 B;  4QB9 A;  4BBH A;  3EY5 A;  3LK4 2;  4MHD A;  4CRZ B;  5J2U E;  1Y9W A;  4AVC A;  2R1I A;  4UWJ A;  4PJM A;  2X9W A;  1UCU A;  4KOR A;  3W15 B;  1S60 A;  2L8K A;  2PRB A;  1Z4E A;  1UFH A;  2GE3 A;  2CA5 A;  4B12 A;  2XAJ B;  2XAF B;  4NUV A;  3UUM A;  4PK5 A;  2DXQ A;  5JR9 C;  2PR8 A;  1QSR A;  3OKQ A;  2JLM A;  2P6G A;  2ZM0 A;  3CML A;  1YX0 A;  4PW8 A;  3R1K A;  4PJL A;  4YJ3 E;  5DWM A;  1HS7 A;  1S35 A;  3ZN1 B;  4GS4 A;  4MY0 A;  4CAV A;  2VZY A;  3R9F A;  3IBP A;  1FIO A;  4CI2 B;  1WRD A;  4M3S A;  3KV9 A;  3MAC A;  3UT5 E;  4K30 A;  4FD7 A;  2X9H A;  4MFZ A;  4NCZ A;  2CMR A;  2NWB A;  3Q2M A;  5LCY A;  4PK6 A;  3M65 A;  1ON0 A;  1LKX A;  3O4X E;  5LNK A;  3ETU A;  1VOM A;  4UF0 A;  4ISS A;  1D1B A;  4Y49 C;  3ANW A;  2EVN A;  4CAE A;  4I4T E;  2A3D A;  4B14 A;  2FXF A;  4I43 B;  4QXC B;  3LK3 B;  4B10 A;  4IST A;  3VHL A;  3AVS A;  3GWH A;  5I0C A;  4ZHQ E;  1YKH B;  4UWI A;  5J1G A;  4HN9 A;  1TIQ A;  1YD8 G;  3NE7 A;  4C68 A;  4CRY B;  3B8G A;  2KLQ A;  5CA0 E;  2LT3 A;  3KDS E;  4E0A A;  4QWN B;  2EUI A;  2D2S A;  2D4P A;  2OZU A;  4KOW A;  2X9Y A;  5KMG P;  2VKD A;  5HWY A;  1I21 A;  4L0R A;  4ZS3 A;  4JXQ A;  3UUL A;  2QGS A;  3Q5X A;  5H6Q B;  3IWE A;  4DO0 A;  4DMV A;  5C8Y E;  2H3R A;  1MIW A;  4QXB B;  5F47 A;  1NE9 A;  4HNY B;  1EZ3 A;  4XNH B;  1D0Z A;  4KUA A;  3CXS A;  2NTX A;  4DVD A;  2KWI B;  2ZLY A;  2D0U A;  5L3C B;  3EVY A;  3RRC A;  2B1E A;  5DQV A;  4HNW B;  3BQL A;  1MMD A;  3PUQ A;  4H9R C;  2UXN B;  4AG7 A;  3K3N A;  2NP9 A;  5FXZ A;  3UTK A;  5L3G B;  2GK9 A;  2J8R A;  3EFA A;  1VHS A;  5HXE A;  4X5K A;  2BL1 A;  4X20 E;  4X1K E;  1VKC A;  2WPW A;  1MJ9 A;  2K5T A;  4CI3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...