1LRZA

X-ray crystal structure of staphylococcus aureus fema
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
412
structure length
400
Chain Sequence
MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords factor essential for expression of methicillin resistance
publication title X-ray crystal structure of Staphylococcus aureus FemA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic inhibitor
total genus 137
structure length 400
sequence length 412
ec nomenclature ec 2.3.2.17: N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N(6)-glycyl)-D-alanyl-D-
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02388 FemAB FemAB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1lrzA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA02
4FD7A 4KVME 1I1DA 5IX3A 2JDCA 2ZW5A 1H7CA 4JXQA 4FD6A 3D2PA 4OAEA 4HNXB 4KUBA 4ZBGA 2J8MA 2Q4YA 1Y7RA 4CRYB 2ARHA 2ATRA 4MBUA 2IL4A 4II9A 3EO4A 3BJ7A 4UWIA 5IB0A 4KOYA 1S5KA 1M4GA 3SHPA 2MBGA 5KTDA 5F49A 2G0BA 2OZHA 4U9ZA 1S7LA 2CA5A 1YGHA 1GHEA 4HNWB 2R98A 1B87A 3R96A 3FNCA 3JUWA 4H6UA 2X7BA 2P6GA 3TT2A 3H4QA 4OLLA 1QSNA 5EC4A 5FVJA 5GCNA 4JD6A 5H84A 2AJ6A 4UWJA 4CAXA 1XIXA 2C5JA 2NMTA 3NE7A 4KZTA 4KOUA 1MJ9A 1YREA 1NE9A 1Z0PA 2IC6A 2ZW4A 1BOBA 4MHDA 3R9GA 4CRZB 4JWPA 1Q2YA 3DSBA 3QB8A 2KCWA 4Y49B 4F6AA 3SXOA 1Z9UA 1PU9A 4R3KA 2R1IA 5F48A 2FT0A 2X9WA 2JEVA 1KZFA 3CXPA 5E96A 1P0HA 2HUZA 4ORFA 5DWNA 3GYAA 4XNHC 5J8CA 5J8FA 1M4IA 2XTLA 1IYLA 5CNPA 1Q2DA 3LD2A 2Q44A 3CXQA 3ZZIA 2Y0MA 5H86A 1YLEA 4UA3A 1M1DA 3GY9A 1XEBA 2CNMA 3OWCA 4XPLA 4J2CA 2B3VA 3TOBA 1BO4A 1RXTA 2KWIB 3D8PA 3DR6A 3P2FA 4FD4A 3MGDA 2CNTA 2OZUA 3VWDA 4QBJA 1YR0A 2G0UA 1MK4A 1QSMA 4KLWA 3FXEB 3R95A 2P6FA 3TO7A 5JQ4A 2G3AA 2EVNA 4E8OA 2C5KT 1B6BA 2BSWA 3I3GA 3S4UA 3FBUA 4L89A 3CXSA 5HMNA 4NSQA 4MY0A 4L8AA 4B5OA 3TOAA 2HQYA 4YFJA 2QECA 1Y9WA 4MJ8A 4PSXA 5IV0A 2CNSA 2J8RA 2PC1A 3S6KA 4AG7A 3FYNA 2Q7BA 1FY7A 5EBVA 2BL1A 5ISVA 4EVYA 1IYKA 4RI1A 4E2AA 3PZJA 2B5GB 2FL4A 1LRZA 5DWMA 4KOXA 2PR1A 2K5TA 1S7NA 2PDOA 2WPXA 2DXQA 2Z0ZA 3FRMA 3FXDB 3TTHA 2WPWA 2C27A 1MJAA 3D2MA 3TKLB 3PP9A 3EFAA 3K9UA 4NEXA 4Y49C 1NSLA 3R1KA 4DNDA 3DNSA 4AVAA 3G8WA 4E0AA 2BEIA 2PRBA 2Z10A 4AB7A 2ZW7A 3ZJ0A 2X9XA 2Q0YA 4CAWA 4F0YA 4M85A 2O28A 3TO6A 4NF1A 2Z11A 3IWGA 2B4BA 3RYOA 1QSOA 5F46A 3CKDA 2VQYA 3R9EA 3JVNA 1N71A 3FXTA 1PUAA 1LVFA 2REEA 1S60A 1YVOA 4KUAA 3C26A 4KLVA 1S3ZA 1IICA 1KUVA 1WWZA 2QMLA 5KTCA 4R9MA 1J4JA 1MJBA 4L0RA 1IIDA 2OH1A 2KWHA 4K30A 3BJ8A 4KORA 2R7HA 3TO9A 4KOTA 3T90A 1VKCA 2OU2A 2RC4A 1WK4A 3TFYA 1I21A 3FIXA 3I9SA 5KTAA 2VXKA 3F0AA 3DR8A 1L0CA 4AG9A 4H6ZA 2G3TA 4ONUA 2B5GA 3IGRA 4R87A 1I12A 5F47A 3N5LA 4M3SA 3UY5A 2HV2A 1OZPA 2FIAA 2K48A 3WR7A 1IB1E 3MXZA 4PSWA 2I00A 4XPKA 1M44A 2Q4VA 4RS2A 3SXNA 4KOWA 3EXNA 4AVCA 4LX9A 4CQIA 4PK2A 2D4OA 2A4NA 2OZGA 4JXRA 1YX0A 2FCKA 4B6XA 4X5KA 2ZPAA 1ZKEA 4JJXA 2BUEA 5C82A 1UFHA 2FS5A 4MI4A 3QAHA 3B8GA 2J8NA 1CJWA 1ON0A 2FE7A 2JLMA 2PR8A 3S6HA 5I0CA 3TCVA 4I49A 4B5PB 3V8IA 2VZYA 3P7IA 3D3SA 2P6EA 2PSWA 4IF5A 4U9YA 1NMTA 1S7FA 1R57A 1YVKA 4FI5A 2B4DB 4YRHA 3FB3A 4CAVA 2OB0A 4KOSA 2GE3A 4LUAA 4KOVA 3VWEA 2IC9A 3F8KA 3N7ZA 2REFA 3W6XA 1RO5A 3CVRA 3S6FA 4IUSA 3L3PA 1QSRA 3W91A 1TIQA 2R8VA 3F5BA 4JLYA 3LODA 3S6GA 4GS4A 4NXYA 2GANA 2FXFA 5C88A 4QVTA 2GIVA 2VEZA 4R3LA 3BLNA 1YK3A 3TE4A 2Q04A 3T9YA 1QSTA 1XF8A 2FSRA 4OADA 2C5IT 1Z4EA 4EYYR 1CM0A 2H5MA 4R57A 2VI7A 4HNYB 3QK6A 4QB9A 5JPHA 2FIWA 2EUIA 3GKRA 4NCZA 3P2HA 2B3UA 1VHSA 1Q2CA 2B58A 3E0KA 3EY5A 1XMTA 2F5IA 4KVXA 3EC4A 1KUXA 2VZZA 1P4NA 2ZW6A 2VBQA 4QC6A 4KVOE 2X9YA 1Z4RA 3QUJA 4J3GA 1M4DA 1KUYA 4B5PA 4DNCA 1Y9KA 1XE4A 3KKWA 4XPDC 4AVBA 1V0CA 3W6SA 4QUSA 1IJ5A 2JDDA 2D4PA 3DDDA 4HKFA 2AE6A 4YGOA 3PGPA 1SQHA 4MY3A 4UBRA 4H89A 3R9FA 2I79A 2ZXVA 4PK3A 4FD5A 2QIRA 4XNHB 3G3SA 1QSDA 2B4DA 4U5YA 2PQ8A 1IJ6A 1K4JA 1U6MA 1S7KA 2P0WA 4BMHA 4PV6A 4XPDB 5HH1A 2CY2A 4CS0B
chains in the Genus database with same CATH superfamily
3WC5A 1JNZA 1OEDC 3FB2A 3B57A 5FVKA 4RN7A 4JI4T 3IIBA 1R3NA 2ZW5A 4JXQA 4HWCA 4HE8A 4FD6A 3LSVA 3K3OA 4KUBA 2Q9QB 3IWWA 4EEBA 4DV4T 3BK9A 2XASB 2ARHA 4V1Av 5HEUA 4MBUA 3H3AA 2XQYA 3DP7A 3FH4A 3KR4A 5IB0A 2Q7SA 4KOYA 1S5KA 1M4GA 2C1CA 2MBGA 5KTDA 5F49A 1O3XA 3PUZF 4EGWA 4JI7T 2R6GF 4IDNA 1CP6A 1YGHA 4ZY2A 5EK4A 1OBRA 3R96A 3VKGA 3X1DA 2YDRA 2I0MA 2P9BA 2CHOA 3QNVA 3TT2A 3P4QA 2FJDA 4JYWA 3RKGA 4DUYT 1IBLT 1Z8XA 1QSNA 5JM6A 5LYFA 5H84A 4E7SA 2AJ6A 2N9DA 2JPFA 1VIXA 2E9XC 4ZX9A 2UUBT 5JRCA 4KZTA 4A97A 4BJMA 1MMDA 4LQGA 3KVBA 3N9LA 2IMOA 4BBHA 5LA6E 5HXSA 5JH9A 2WDVA 3RYIE 5HXDA 4F8ZA 4DO0A 5J1QA 3AECA 3DSBA 5FL1A 3QB8A 4P4JA 5E0OA 4CPAA 1ARLA 4U7YA 3Q5EA 2PIYA 1ZLHA 2GLJA 3CXPA 2WU5A 2V5DA 5DWNA 3N5FA 3TX8A 3AA0B 5J8FA 1M4IA 5CNPA 1Q2DA 1MIYA 3PUGA 2Q9QA 1RTQA 2PBIA 5H86A 1WR0A 2L9QA 1T98A 4CYOA 2CNMA 3OWCA 4J2CA 3H37A 2B3VA 1OEDA 4GOUA 3TOBA 1HFAA 3D68A 3KV4A 5LYJE 5JGFA 3D8PA 2XEGA 2AFWA 4Q25A 1VGYA 3P2FA 1VHOA 2VVSA 2B1EA 4TWEA 4WW0A 1TF8A 1YR0A 1CPXA 3C98B 4A37A 3B3SA 1IU8A 4ILCA 4NPPA 3R6NA 1CX8A 2W63A 3TLVA 1B6BA 2BSWA 4F6RC 4AKGA 3BXMA 5AQNB 4U33A 3NA6A 3S4UA 1N32T 1YQ4A 2KXPB 2XM1A 3CXSA 1X9BA 2EHOC 3LBXA 1GQEA 4NSQA 1D0XA 3SFEA 5LCYA 3AVSA 3NKZA 3AE6A 3WC7A 2VQET 3WABA 4CI1B 5HXEA 4X65T 3O1JA 4LF7T 3GN5B 4PSXA 2ZLYA 3S6KA 4MFKA 5ISVA 4O23A 2EHOB 1CBXA 1WR6A 2E9XA 3HKDE 2B5GB 2BBHA 5DWMA 1SUMB 3KV9A 4NGSA 3CPXA 1D0YA 3UUNA 2Z0ZA 4UVBB 2CF4A 4IGUA 3EDVA 4X1IE 2WPWA 2Z3LA 2N1GA 1UUSA 2WM9A 3KFWX 3PP9A 4EIWA 3L09A 2E5VA 5LYDA 3UU8A 2XQ8A 3R1KA 3PU3A 2M6BA 4DNDA 1I6ZA 4A95A 4ZZBA 2PRBA 1NEKA 4P4BA 2RPAA 4ADZA 2YNDA 1XDPA 4YY3T 4EEDA 2JQQA 1F2PA 2EBJA 3ZJ0A 2X9XA 3QAYA 1Y01A 1VCTA 4X62T 4AISA 4M85A 4YXDA 4KSFA 3RHWA 3RO0A 2D2SA 1WCRA 2BZBA 3IWEA 1XFOA 3HLPA 1FIOA 2PJ5A 3UU3A 3ZYMA 4DJLA 4LFBT 3JVNA 3ZT6A 3C4XA 2V6YB 5HCJA 4ANJA 1LVFA 5K8MA 2ZEHA 3PE0A 5JDHA 3JADA 3EHZA 5FL0A 4X66T 5LGTB 4CGPA 5G20A 3SOLA 4P6YA 4F9VA 1HX1B 5FP3A 2X0HA 2WCAA 3JRUA 3PEIA 4H2KA 4ONWA 4R9MA 5IB9A 1J4JA 2VVNA 4O4JE 1MJBA 2C6GA 1BR4A 2KWHA 3FMCA 3ZMZB 3TO9A 2LLYA 2ZEPA 3QOFA 2BOAA 5LRKA 4TNUA 4ZZCA 4OFZA 3TFYA 5HWYA 5JDNA 3FIXA 2X68A 1BLLE 4NUUA 3UTKA 3DGVA 2VL8A 3DR8A 2EHOA 1UX5A 4AG9A 1MMAA 4A2ZA 3NBXX 3ZYKA 2B5GA 3B2YA 3IGRA 4R87A 1I12A 3H8EA 4IE7A 4EFDA 2LOPA 2FIAA 3FBLA 5KMGP 4XPKA 2CBJA 5A28A 2UXCT 4B3RT 3MRUA 4RS2A 1JQGA 1V9DA 3Q5DA 1WFDA 2ODVA 2W00A 4OK0A 4NGMA 2W62A 3JCFA 2MTQA 4JBWF 4OC2A 4DR4T 4B6XA 3EABA 4P1NA 3IU1A 2JQ9A 4HFCA 2AFOA 3H8GA 3WT4A 1CJWA 3S6HA 4R6TA 4MCSA 4EWTA 3K3QC 3N2KE 5ETWA 4C2ZA 3KZWA 5GONE 4AI6A 3KR5A 2VZYA 3P7IA 4MHZA 2KNDA 1NMTA 4KUMB 2NTXA 3PUSA 5FXWA 4TUYE 4B3ST 1R57A 2V6YA 3AE4A 1QQ9A 4HWFA 3VATA 2WU2A 3FB3A 3Q5XA 4KOSA 4W9YA 2BG9B 2IC9A 3CX6B 3KINB 3LK42 4MRIA 2ZEMA 3F8KA 3SI1A 2YINA 2LT3A 3UU5A 4UV8B 3ZMUB 1SA0E 5FXZA 4X5TA 1N34T 3SI2A 3CVRA 5LBMA 2DWKA 4KI0F 2Z3KA 4GYRA 3FX6A 3O1IA 4UEZA 2UXNB 4JLYA 3PDYA 4NGQA 2C0SA 3RYCE 4NXYA 1ZV4X 3Q5WA 1J5ET 2KMFA 4JI8T 3CWZB 2Q9QD 4QH4A 4LMKA 2J62A 4AIUA 1EE3P 3AEEA 3ZC1A 2KLQA 1XF8A 2FSRA 4LQ6A 2C5IT 1UX4A 5LJNA 5AQGB 3N9OA 4EYYR 2BS4A 3CPZA 2AFUA 1HF8A 5AQHB 4ERRA 4OIDA 3QK6A 4GK0E 2EO8A 5JPHA 4AQFC 2FIWA 3PUWF 1AUGA 3VARA 3ESLA 4NCZA 4A32A 1WRDA 2PJ1A 4CN6A 1M7KA 2CXDA 1KF6A 3FZLB 1VHSA 2F5IA 2XSAA 1KK7A 1YKHB 2D9DA 2Q43A 1DE4C 4IDOA 1E7PA 5DJQC 4B12A 5JDQA 1P4NA 3SJEA 2VBQA 4CYQA 4KHZF 2X9YA 2X66A 2W4XA 3QUJA 4YSXA 1KUYA 1D1CA 3WI3A 3E0ZA 1FJGT 1XE4A 4I0UA 4KMCA 4EZHA 3KKWA 4AVBA 5JR9B 1WYCA 4HPSA 1IJ5A 4R8FA 2XSBA 3PGPA 3U78A 5KX5E 4UBRA 4PK3A 3BQKA 3FVLA 4XNHB 2PCUA 3G3SA 4CI2B 5IWAT 4O8SA 2VURA 2PQ8A 2WP9A 1U6MA 4Z8XA 2P0WA 4FAIA 2D0TA 4B11A 3RF1A 2MAWA 5HH1A 4PJJA 3B7IA 5LMUT 5AG5A 3RAMA 2CHNA 5IX3A 4JYAT 4K0KT 5LHHB 3K9TA 2JDCA 2KZ7B 5A27A 2B76A 1F2OA 1U5PA 4X20E 5ABEA 2WZIA 2PVWA 2ZEGA 2CLYC 1Y7RA 2O53A 4CRYB 1W0AA 2IL4A 3IEHA 3EO4A 3BJ7A 4UWIA 3T8OA 5J0ZA 5AQUB 1HS7A 3PUAA 5AQOB 4XBFB 1E2AA 4UVAB 1HG5A 1OXZA 4U9ZA 2CA5A 1YSJA 1GHEA 1B87A 2PIZA 4I50E 2YU1A 4YTMA 4IREA 2CLYB 1LAPA 3UUMA 1HEEA 3KQXA 2SPCA 4IK2A 1LFWA 4IE6A 3UQ4A 2V26A 3G06A 2DF5A 4H6UA 3MK7C 4CXWA 4EAHA 1IOIA 3C51A 4C2XA 2WUUA 3IHRA 4CYNA 2XPKA 3H4QA 2DPSA 4OLLA 2KT9A 5HEJA 1YQEA 5LB7B 1TKFA 2PJCA 2Z3MA 5DS0A 1VCSA 3ZSSA 4QKNA 3FZKB 2VL0A 3T1HT 5L4EA 2NMTA 3CQCB 2BVMA 4AQFA 1MJ9A 1YREA 1NE9A 1Z0PA 2RA1A 1YXRA 1N36T 4MHDA 5LP6E 4NUVA 2YGWA 1KFYA 3ZJ2A 4CN4A 4NGRA 4ZS2A 2XHEB 1Q2YA 3UT5E 5BWAB 2WMNA 5K8OA 2LKGA 4F6AA 2LSIA 4O4HE 1KNRA 3SXOA 1Z9UA 5HVHA 4P09A 1PU9A 4R3KA 4YTNA 2EHOD 3AEBA 1E1HB 2AFSA 2XQ4A 3ABVA 1FNOA 1KZFA 3ONLC 4QHOA 2UUCT 5JQGE 1P0HA 2HUZA 4UFXA 5E96A 4EXTA 4ZI3D 2WB5A 2XTLA 2Q44A 4DVDA 4UXNB 3PJAJ 4HTEA 1LAMA 1XEBA 2QYWA 2J47A 1ELMP 3P50A 1Z8TA 3C4ZA 3EDUA 2CXLA 3JAEA 1WYBA 3I9YA 3J9X1 3E08A 3UU4A 3I1UA 4AQYT 1LKXA 1WLXA 4P45A 3F31A 2Q9QC 3B35A 4QBJA 1XBUA 2NR4A 2G0UA 4KLWA 2JQKA 4K0UA 3FXEB 1XDOA 1HDQA 3R95A 2NOXA 1Z8LA 2ODFA 2G3AA 4MFJA 5FXXA 2WSSV 3UULA 1YW4A 5J1GA 4MFQA 3D4UA 3FBUA 4RUHA 2WS3A 3AE9A 5HMNA 4PJMA 4PPZA 3RC8A 2IW5B 2X0LB 4MY0A 1M62A 3BQIA 4UEFA 5K8PA 4QX8B 3D7FA 4DV0T 3TOAA 3QC9A 2HQYA 3ZPOA 5J2TE 3PTRB 4TNVA 4MJ8A 1Y9WA 4YFJA 4XAXB 2YK0A 4BD9A 1XNQT 1F57A 2PC1A 3FYNA 2Q7BA 4M6IA 3D67A 1SE7A 2ODUA 2XQ7A 4RI1A 4E2AA 4A31A 5IYZE 2HN2A 2QGSA 2ZELA 3ZCIA 2AE9A 3PZJA 4P4EA 2CM0A 3J7Yq 4KOXA 3VU7H 2POKA 3V5SA 2MYSA 1YW0A 2PDOA 4TV9E 4MBQA 4O2BE 2JBKA 3FRMA 4IAVA 4HWIB 4HFHA 5JTGA 4QXCB 2WBLA 3L8RA 5DABA 4PK5A 4PW8A 3TLTA 1ZG8A 4JV5T 2GLFA 3EFAA 4UFVA 3K9UA 1NSLA 1Z2LA 4ZOLE 2J9AA 4AVAA 2ES0A 4E0AA 2XAGB 3RYFE 2ZM0A 3D66A 2XAQB 3RYHE 2ACZA 3NZPA 3LJCA 5LOVE 5FKYA 2HHHT 2Z10A 4AB7A 5M4YA 1G73A 4B13A 4YJ3E 4UIGA 4OX9T 3LWUA 2CTBA 4NXNT 4LMLA 4NF1A 5LNKA 3FECA 5G21A 4IDQA 1QSOA 3S9LA 3CKDA 3HKEE 3K2KA 5AQSB 1QMUA 1EZ3A 1PUAA 2X67A 3PB8X 2XAFB 5DQVA 5L2LA 3ZN0B 4UF4A 4KLVA 5LYIA 2ZM8A 4A94A 3C4WA 3RPUA 4KHPT 1IICA 4ZGYB 1KUVA 2IMLA 5F8PA 4NGPA 3PB7X 1FMVA 5L3GB 4UELA 4H63H 1IIDA 4K30A 4KORA 2UUAT 2ZENA 3FEDA 4KOTA 3V5UA 2CXAA 4JI1T 3H8FA 2LJLA 2RC4A 2W66A 3SJGA 2CCQA 3ZEFB 2LSJA 3F0AA 2LM9A 1FEWA 3ZCJA 5TAOA 4WBNE 2BBJA 2WQYA 4G63A 2G3TA 4DV5T 4DMVA 3U3IA 3M3ZB 3UY5A 1T7SA 4PXBA 5ABFB 1OZPA 4OIWA 2K48A 3WR7A 4NJRA 4PSWA 3RKOA 3ISZA 2VKDA 2C6PA 4A98A 3BI1A 3EVYA 2Z3NA 4UEMA 3SXNA 1AYEA 4KOWA 4MFLA 5FMNA 4AVCA 3PBBA 4LX9A 1ZHCA 2BKNA 4YLHA 2H3RA 4EB6E 4EZ4A 3N9MA 2OZGA 1HNZT 4PNIA 1YX0A 4HWDA 5HXHA 3GB0A 5EZYE 4ZI3C 2VB6A 4BAYB 2FS5A 4B6ZA 2DNXA 3QAHA 4TN7B 4AXPA 2J8NA 4ZHQE 1ON0A 2FE7A 1J1JA 2JLMA 2PR8A 4X1KE 5EK2A 2IUBA 3TCVA 3WAKA 4ZY1A 5KDMC 4B5PB 3NH4A 1BAVA 1Z5RA 2PSWA 3ZMVB 5HXCA 1S7FA 5CFBA 5AQPB 2OV9A 2LSYA 2YU2A 3PJAA 3AE1A 4QXBB 3AE5A 4IE5A 4AKIA 5AQRB 3Q9DA 2B4DB 2DLRA 4R7MA 2OB0A 2XAJB 1YQ3A 4C7IA 2CTCA 5FNVE 3O4XE 2CE7A 3W6XA 3RX6A 1AMPA 2K3WA 2V1DB 3ZT5A 4FJOA 4KS9A 4IUSA 4P4FA 1XMOT 3IBPA 4Z91A 4C68A 4HFBA 1MIVA 3S6GA 5JDMA 2GANA 4H9NC 3CQXC 5C88A 1CP7A 4QVTA 1M4LA 2XQAA 4P44A 1XJOA 1ZO0A 3P4SA 4G2AA 3QNUA 4OADA 1T8BA 1YMEA 4HFVA 1X12A 4WJBA 1VHEA 1HX8A 1VOMA 2VI7A 5AQKB 4HNYB 2EUIA 4CXYA 3PB6X 3LK2B 5AQJB 5HWXA 1Q2CA 5D29A 3E0KA 4I43B 3EC4A 2WWVA 4DBRA 4JZ0A 4ILBA 4Q7AA 3I1AA 1HNXT 3GN5A 3IU2A 4GKJT 4QC6A 1Z4RA 3SFDA 4KSIA 4B5PA 4UR9A 3W6SA 4DV6T 2ZMAA 2JDDA 3DDDA 4HKFA 4GM5A 3KASA 2PJ6A 3KHXA 3C50A 4PJLA 4ZYQA 3R9FA 4FD5A 3W15B 3LACA 2IIUA 1UURA 2GU2A 3UUXB 4YU9A 2B4DA 4O2AE 4DR5T 1IJ6A 4BMHA 3AE7A 4HFIA 4QWNB 4KVME 2W0GA 3OJAA 5AQQB 2QA7A 2LRLA 4LF5T 3D2PA 4HWHA 2NYQA 1MIWA 3A8YC 2C6CA 5ADXL 3DLJA 3MZKB 1KNPA 2PJ3A 2Q4YA 4F9UA 2BG9C 2ZEOA 2ATRA 2CXFA 4II9A 2FJEA 3GA8A 1YKEB 2W2UA 4IL4A 3D7GA 3I0QA 5KXJA 3NFZA 3NRYA 2G0BA 5CGMA 5BMVE 2JJ9A 4HNWB 2R98A 4F8HA 4O4LE 4WNKA 2D5UA 4PQAA 5L3DB 1PYTB 3PB9X 2RFHA 3JUWA 2ACXA 2OLTA 5JH7E 3WC6A 4IT4A 4KP3C 2DHRA 3S9NA 5F3JA 4LF8T 2YNCC 5EC4A 3OYZA 5FVJA 3K8PC 4JD6A 4ZI2D 2LHRA 4CAXA 2C5JA 2IQ6A 5HXRA 2EK8A 2XJ7A 2WSAA 4FWUA 4IL9A 2K5BB 1OEDE 3A7MA 2IC6A 5AG7A 5JDLA 2O4HA 3H5ZA 4TV8E 4TX5A 4CRZB 5AQTB 2JQHA 2CIJA 4WZXA 3RBUA 2ZEFA 4Y49B 4PK4A 4LF6T 6CPAA 2A9UA 1D0ZA 5JR9C 5H6RB 3RIAA 5F48A 2BCOA 2CEAA 3KL9A 2FT0A 2UXDT 2AFZA 3ZC0A 2X9WA 3N2GE 2ZEEA 3GYAA 4H9RC 4XNHC 3FJUA 1IYLA 5D8NA 1AJ3A 2PJ2A 1XMQT 4MXUA 3F2EA 2A72A 2Y0MA 3ZZIA 3KHZA 4EYUA 1YLEA 4YFSA 4COFA 3ZT7A 4CGOA 3GIUA 4XPLA 4UCPA 3GLJA 4MHPA 2J1DG 2QYVA 4OMEA 5CA0E 2BKPA 7CPAA 4OHFA 3RNZA 2KWIB 4EMEA 3ZKRA 3DR6A 3ONJA 3VR8A 3RIFA 1L0VA 3K1SA 3MGDA 2CNTA 2BO9A 2BKOA 5G22A 3VWDA 2X0YA 2X9HA 2BG9A 1QSMA 2PJ8A 2LM2A 4ZY0A 4DR6T 5HEOA 4LFCT 2Z3OA 3V38A 2DPTA 3MJXA 3MA9A 4MCQA 4YSZA 2EVNA 4E8OA 4M6GA 1W9RA 4EV6A 1IOFA 4OC3A 4BJNA 3VRAA 2V8VA 1OWAA 1HG2A 2VWAA 3WAJA 4JI0T 2V5CA 4BA9A 4L89A 5L3EB 4UCMA 4A38A 5IUXA 3NH8A 1XNRT 3NWIA 2IAKA 4B5OA 4LMJA 2JMHA 3CIRA 4DMWA 3IC1A 2LHNA 5LG4A 2QECA 1ZP0A 5IV0A 4IE0A 2CNSA 2YNCA 2J8RA 1DTDA 4AG7A 4GKKT 1FY7A 4A33A 2BL1A 2CBIA 1IYKA 5HEHA 4MHYA 2FL4A 2K5TA 1S7NA 2LSKA 4L9IA 2JRKA 2WYRA 3SS1A 1MJAA 3D2MA 4H9QC 4IHMA 1B7TA 3N9QA 3EUHA 2ZOFA 3A5XA 2PJ4A 3HKBE 2XAHB 3UQ7A 4NEXA 2VKHA 4MCRA 3AXJB 3AVRA 3AE3A 4P0AA 4CZZB 3DNSA 2E2AA 5L4HA 2YN6A 1I94T 5JR9A 3FF3A 3ZN1B 3HKCE 3AA1B 4ASKA 5DQWA 3NZQA 4CAWA 4NJQA 4OC5A 3CX7B 3RYOA 1LANA 4U2ZA 4KBMB 4OYKA 1N71A 2HN1A 3ONXA 4NGTA 2PJAA 5J2UE 3EI0A 2NW9A 3D7DA 1S60A 1YVOA 1UCUA 2NWBA 4MHCA 1HCIA 2WDRA 3AA6B 5LHGB 3P4PA 5AQLB 1WWZA 3BI0A 1ZG7A 2QMLA 4DR7T 4I4TE 4Q36A 4L0RA 4NIQA 4CXXA 2OH1A 2GFQA 5F09A 1ELLP 1TKJA 2I6HA 3KDSE 3BJ8A 2UXXB 3N9NA 2XQ6A 1BR1A 4ZI2C 4GXHA 2OU2A 1KWMA 1I21A 1CHUA 5JRCB 5KTAA 2VXKA 1R8IA 3CK6A 2FVGA 1L0CA 5EMIA 2LSGA 4H6ZA 2F8HA 2PG8A 4M3SA 1CUNA 1IB1E 3MXZA 3AE2A 5A1LA 3ZYLA 5AQIB 4DV2T 2Q4VA 2V7MA 1TKHA 3KBUA 4HFEA 3P4RA 4C91A 2IJZA 4AKRB 2H89A 4CQIA 4PK2A 3RQUA 2D4OA 1YD8G 4JXRA 3AXJA 2V7KA 2ANPA 2CRBA 2DI4A 2FCKA 3RIUC 4X5KA 3KQZA 1ZKEA 4JJXA 2BUEA 3N2OA 1UFHA 1Z8WA 2BS2A 4H9SE 3B8GA 1IGBA 1BR2A 1HTJF 2KINB 2FUPA 2XEIA 1HNWT 4QXHB 3FZHB 2M67A 2QVAA 5FYMA 4C90A 2WDQA 1OEDB 3TLWA 3LDQB 1MMNA 2F4VT 2LKHA 4DUKA 1YVKA 3PBEA 5HVFA 5LXTE 4FI5A 3SRZA 3SWHA 2VK9A 3OYXA 2GE3A 4LUAA 2Z6EA 4F0XA 2Q4ZA 3VWEA 4UEEA 4GYSA 2EK9A 3SJFA 4M6HA 2MOZA 2REFA 2N2NA 3SJXA 3DTOA 4YHJA 2PJ9A 2V6XA 3PURA 5HYAA 5AGEA 3AAEB 5LGNB 2XQ3A 3IEEA 3L3PA 3W91A 3F5BA 1NSAA 2K24A 3OPCA 3IJ3A 2YKSA 5IHYA 3LBXB 1MMGA 4EOZB 1GYTA 2XM2A 4MFRA 3OBVE 2DEAA 1IY7A 2G9DA 2GIVA 5I4MA 2VEZA 2QRXA 3BLNA 1YK3A 4QX7B 2Q04A 4HFDA 2HB6A 3RRWA 2VL1A 1Z4EA 3ZJ1A 3LMSA 3FEEA 3H3MA 4X3RA 2AFXA 1CM0A 2E9XB 2H5MA 4R57A 4P4IA 4UIAA 2BG9E 3FZMB 2HPLA 3NRXA 3KI9A 1Q7LA 4AKHA 3AEFA 5LMNT 5FY7A 4IE4A 5CB4E 2B3UA 2XY8B 2B58A 2WZNA 3PFEA 3D7HA 3OKQA 3KGQA 1XMTA 4C2YA 4TWFA 4KVXA 2DL1A 1KUXA 5FXVA 2VZZA 1FT7A 4L5GA 4P10A 3ETVA 4J3GA 4DR1T 4CAFA 1M4DA 5F5WA 5JREA 3FBZA 4N78D 4U31A 1Y9KA 3CX8B 3JTKA 4XPDC 1UK5A 4QUSA 4U2YA 2Q51A 3ANWB 4AQGA 4YGOA 3RIUA 2PVVA 1JNRA 1SQHA 1TF9A 2ZXVA 5AQMB 4CAEA 5CBMA 2CPTA 3LFMA 5FY0A 2LRKA 2CWYA 3IFEA 1K4JA 1A2ZA 1S7KA 2PE3A 4XPDB 3RQWA 2CY2A 5LHIB 4FD7A 4CS0B 1I1DA 1T72A 3GMIA 3CZXA 4X8IA 3PRTA 1H7CA 3PUVF 4OAEA 3PFOA 4HNXB 4ZBGA 2J8MA 1CPSA 4K3NA 3CPAA 3PU8A 3NH5A 3ZLIA 2DWGA 2NW8A 4B14A 2FJAA 3SHPA 1ZLIA 2OZHA 2V8DA 1S7LA 3LG7A 4OC4A 1KNZA 2V7JA 5THWA 1XZYA 2LOSA 2WZHA 2BVLA 4DR2T 3FNCA 1H8LA 1IBKT 5LYLA 4UIBA 4YT0A 3VH9A 4JI3T 3B13A 2XQ9A 3LK3B 2X7BA 2P6GA 3N9PA 2V8SV 4IHJE 4U72A 3IF8B 3TC8A 1UGOA 2YDQA 4U7IA 5GCNA 1QUUA 2QJ8A 2MPKA 4UWJA 2YDSA 5LRJA 4TWHA 1XIXA 3B3VA 3NE7A 1FMWA 1BR0A 2ZM6T 4OC0A 4KOUA 2WAUA 1U4QA 4HEAA 4WBOA 4WWVA 2Y48B 4IIJE 2ZW4A 1BOBA 3ANWA 3AEGA 5ABFA 3GWHA 5AFUL 3R9GA 3BHXA 4CGNA 4OKOA 3O1HA 4JWPA 3PB4X 5AQVB 5LBQB 4HGAA 2KCWA 1DU2A 1IZNB 3B3CA 2JIWA 2VKOA 4DV1T 1D1AA 4BINA 3S9MA 5AG4A 4AKLA 2F7VA 2R1IA 5LJMA 2V7IA 4YSYA 3E22E 2BDEA 5H6QB 8CPAA 2JEVA 1NAFA 3M65A 4ORFA 4AXVA 4Z90A 1Z8UA 5J8CA 1CG2A 3ZSTA 2EWBA 3LD2A 3CXQA 3AEDA 4UA3A 1ZEEA 4FBEA 1M1DA 3GY9A 4R76A 1UWYA 4U74A 4KX6A 4ILAA 4ZI7E 2VKJA 1BO4A 3BQLA 4H63V 4UFWA 2V77A 2XEJA 4TZ4C 4ILUA 1RXTA 3CT9A 4HN9A 4ZI6A 1KEYA 1BPMA 4FD4A 4ISSA 2VASA 4OP4A 2OZUA 5K8NA 3AB3B 2L3LA 1MK4A 2ABZA 4P0BA 1Y64B 1W09A 4UCNA 4IDZA 2P6FA 3TO7A 3VR9A 2YEVC 5JQ4A 4JUYA 2C5KT 2A2FX 3I3GA 2NW7A 4JI5T 5HAXA 4GK5E 3FHNA 3QB5K 2ZOGA 3V7ZA 2DCFA 4PXCA 1MNEA 4MLKA 2H7VC 4L8AA 4UVCB 4MFPA 3ZMTB 3K3NA 3NVOA 4YHHT 3RZAA 1G8XA 5JDFA 1XMBA 4MHNA 4DIDB 3RLFF 2K9AA 4DBQA 3B5MA 2GK9A 2V7LA 1S35A 1YW6A 5EBVA 4JI6T 4EVYA 5ABHA 2KSRA 4QH1A 4X2TA 1LRZA 2Y6XA 2UU9T 2PR1A 4KSAA 1HR0T 2WPXA 1MNDA 2XUEA 2DXQA 3QB5A 2FBWA 3FXDB 2NSMA 3TTHA 3MKDA 2C27A 3TKLB 2PJBA 1BPNA 2IDOB 2I3CA 2QVPA 4Y49C 3Q2MA 3JC6D 2JBJA 3I0OA 4B3MT 3KVAA 5L3CB 3G8WA 3CQGB 2I59A 2PFVA 2BEIA 3VRBA 5HVGA 4LF4T 4YJ2E 2XEFA 3PUQA 3RI5A 3NE8A 2PRQA 3L2NA 3PV0F 2ZW7A 1Y0RA 3B3TA 4PXDA 2OOTA 5LRGA 3ETUA 4I55E 2AFMA 3MACA 2Q0YA 4F0YA 3A9LA 4MCPA 3VHLA 5C8YE 2HC9A 2O28A 2BS3A 3TO6A 5ABGA 2Z11A 3IWGA 2LEHA 3PUYF 2B4BA 5F46A 1PCAA 2VQYA 4CGMA 4TWDA 3OVUA 3R9EA 3EAMA 3FXTA 1LOKA 4JEUB 4NFRA 2REEA 2WWUA 2M6IA 4KUAA 3IA3A 2HH7A 3C26A 2UXBT 3UUBA 2A3DA 2HPJA 5G1ZA 1S3ZA 2CMRA 2JMKA 1XOVA 1QLBA 5KTCA 3FZFB 3RGLA 4MMOA 2R7HA 3T90A 1VKCA 1WK4A 4GIWA 4ZXLA 4A5XA 2CWOA 2PJ0A 2FJBA 2V8HA 4OC1A 1SHZC 2NP9A 3I9SA 2PJ7A 5JDGA 4YTPA 3B3WA 4ONUA 4UV9B 1NWMX 1Y7EA 5F47A 3N5LA 3ISXA 4ZEYA 4JI2T 2HV2A 1XRYA 4H9PC 3AE8A 2J4GA 3AA7B 4PAGA 2I00A 3AEAA 1YLOA 4G1PA 1M44A 1HDUA 4O4IE 4CN1A 3EXNA 4MALA 1ARMA 3TLUA 5HCMA 5BR8T 4XZCA 2A4NA 2E9XD 4C7HA 4H9OC 2ZPAA 1X79A 5AQFB 5C82A 4UF0B 5AG6A 4CYPA 4MI4A 4PFOA 5I0CA 5FVLA 2Y8DA 4I49A 1VRBA 2H7OA 3KBTA 4DYOA 4JLEA 3V8IA 5CJ5A 3JAFA 3O9XA 3D3SA 4TNWA 2ZM2A 2P6EA 4IF5A 3RRCA 1NENA 3HA4A 4OYJA 4X1YE 5HEGA 4U9YA 2X51A 3R84B 3HL6A 3VKHA 2D0UA 3UU6A 2LE8A 5L3FB 3T8WA 3F57A 2WMOA 2YOEA 1JWQA 4B3TT 4LF9T 3D0TA 4YRHA 4Q38A 4CAVA 4KOVA 5LG3A 4U3CA 5EK3A 4NXMT 4DV3T 1Y0YA 3N7ZA 2GREA 1IAPA 1XWMA 3IO1A 3L39A 1RO5A 2H88A 4QH5A 3RC3A 3TLSA 4CI3B 2OR4A 1X10A 3PUXF 3S6FA 3KV5A 1QSRA 1TIQA 5FY1A 2R8VA 5CA1E 3LODA 3P8CD 4WYVA 4GS4A 4E7ZA 2Z3PA 2XQ5A 2FXFA 1ZOYA 2RP4A 2PJQA 4M1PA 3UFEA 4A30A 3I9WA 4R3LA 3KV6A 3GUXA 4ZX8A 3TE4A 2L8KA 5C2TA 4DV7T 3CMLA 3T9YA 4A56A 4ISTA 1QSTA 4ZS3A 4B10A 1IBMT 1ZG9A 4DUZT 2V8GA 2E5LT 1R43A 2W67A 3C64A 4MFZA 5C3JA 5LGUB 2OA5A 4QB9A 5CPAA 4PJNA 3HI2A 3GKRA 1LCPA 3P2HA 4JEHB 1W0BA 2RB7A 3EY5A 3HUVA 3AAAB 4UF0A 1D1BA 4P4DA 5ELYA 5L3BB 1US7B 2XZEA 4LFAT 4HKAA 3JC6C 3UFGA 4YWYA 2ZW6A 4KVOE 1N33T 3SI0A 2IHR1 3ZMSB 3P4WA 2AXDS 4DNCA 4CGLA 5JVDE 3HR0A 3RH3A 4FUUA 1V0CA 4X64T 2E8IA 1TXRA 2D4PA 2YNEA 2AE6A 3MN8A 5L47A 4PFPA 4A39A 4MY3A 4H89A 2ZEDA 4Z65A 2WY2A 4NGNA 2I79A 3CDXA 1S94A 1J5WA 2QIRA 1LVKA 4IDPA 3DJBA 3AAIA 1QSDA 2NTYA 4DR3T 2PTFA 3OTOT 2W61A 2JEWA 4U5YA 3T1YT 2VQFT 4PK6A 4PV6A 4PXEA
chains in the Genus database with same CATH topology
3FB2A 3B57A 2ZW5A 4JXQA 4HE8A 4FD6A 3K3OA 4KUBA 2Q9QB 3BK9A 2XASB 2ARHA 4V1Av 4MBUA 3H3AA 2XQYA 3DP7A 5IB0A 4KOYA 1S5KA 1M4GA 2MBGA 5KTDA 5F49A 1O3XA 1YGHA 5EK4A 3R96A 3VKGA 2P9BA 3TT2A 1QSNA 5H84A 4E7SA 2AJ6A 2N9DA 2JPFA 2E9XC 5JRCA 4KZTA 4BJMA 1MMDA 3KVBA 3N9LA 4BBHA 5LA6E 5HXSA 3RYIE 4DO0A 3DSBA 3QB8A 5E0OA 3CXPA 5DWNA 3AA0B 5J8FA 1M4IA 5CNPA 1Q2DA 1MIYA 3PUGA 2Q9QA 2PBIA 5H86A 2L9QA 1T98A 4CYOA 2CNMA 3OWCA 4J2CA 3H37A 2B3VA 4GOUA 3TOBA 1HFAA 3KV4A 5LYJE 3D8PA 3P2FA 2B1EA 4WW0A 1YR0A 3C98B 3R6NA 2W63A 1B6BA 2BSWA 4F6RC 4AKGA 3S4UA 2KXPB 3CXSA 2EHOC 3LBXA 4NSQA 1D0XA 5LCYA 3AVSA 4CI1B 5HXEA 3O1JA 3GN5B 4PSXA 2ZLYA 3S6KA 4MFKA 5ISVA 2EHOB 1WR6A 2E9XA 3HKDE 2B5GB 5DWMA 3KV9A 1D0YA 3UUNA 2Z0ZA 4UVBB 4IGUA 3EDVA 4X1IE 2WPWA 2Z3LA 2N1GA 2WM9A 3KFWX 3PP9A 4EIWA 3L09A 3R1KA 3PU3A 4DNDA 4A95A 2PRBA 4ADZA 2YNDA 2JQQA 3ZJ0A 2X9XA 4M85A 4KSFA 2D2SA 3IWEA 2BZBA 1FIOA 3ZYMA 3JVNA 3C4XA 4ANJA 1LVFA 3PE0A 5JDHA 5LGTB 4CGPA 5G20A 3SOLA 5FP3A 4R9MA 1J4JA 4O4JE 1MJBA 1BR4A 2KWHA 3ZMZB 3TO9A 4OFZA 3TFYA 5HWYA 5JDNA 3FIXA 2X68A 4NUUA 3UTKA 3DR8A 2VL8A 2EHOA 1UX5A 4AG9A 1MMAA 4A2ZA 3NBXX 3ZYKA 2B5GA 3IGRA 4R87A 1I12A 4IE7A 2LOPA 2FIAA 3FBLA 5KMGP 4XPKA 5A28A 4RS2A 1V9DA 2ODVA 2W00A 4OK0A 2W62A 2MTQA 4B6XA 3IU1A 1CJWA 3S6HA 3K3QC 3N2KE 5ETWA 4C2ZA 5GONE 4AI6A 2VZYA 3P7IA 2KNDA 1NMTA 4KUMB 2NTXA 3PUSA 5FXWA 4TUYE 1R57A 3FB3A 3Q5XA 4KOSA 2IC9A 3CX6B 3KINB 3LK42 3F8KA 2YINA 2LT3A 4UV8B 3ZMUB 1SA0E 5FXZA 3CVRA 5LBMA 2DWKA 2Z3KA 4GYRA 3O1IA 2UXNB 4JLYA 3PDYA 2C0SA 3RYCE 4NXYA 1ZV4X 3Q5WA 2KMFA 3CWZB 2Q9QD 3ZC1A 2KLQA 1XF8A 2FSRA 2C5IT 1UX4A 5LJNA 3N9OA 4EYYR 3CPZA 1HF8A 4ERRA 3QK6A 4GK0E 5JPHA 4AQFC 2FIWA 3ESLA 4NCZA 4A32A 1WRDA 2CXDA 1VHSA 2F5IA 1KK7A 1YKHB 5DJQC 4B12A 5JDQA 1P4NA 2VBQA 4CYQA 2X9YA 2X66A 3QUJA 1KUYA 1D1CA 3WI3A 3E0ZA 1XE4A 3KKWA 4KMCA 4EZHA 4AVBA 5JR9B 1WYCA 1IJ5A 3PGPA 3U78A 5KX5E 4UBRA 4PK3A 3BQKA 4XNHB 3G3SA 4CI2B 4O8SA 2PQ8A 1U6MA 4Z8XA 2P0WA 2D0TA 4B11A 5HH1A 4PJJA 5AG5A 5IX3A 5LHHB 2JDCA 2KZ7B 5A27A 1U5PA 4X20E 2CLYC 1Y7RA 4CRYB 2IL4A 3EO4A 3BJ7A 4UWIA 3T8OA 1HS7A 3PUAA 4XBFB 4UVAB 1HG5A 1OXZA 4U9ZA 2CA5A 1GHEA 1B87A 4I50E 2YU1A 2CLYB 3UUMA 2SPCA 4IE6A 2V26A 4H6UA 3MK7C 4CXWA 4EAHA 3C51A 4C2XA 2WUUA 3IHRA 4CYNA 3H4QA 2DPSA 4OLLA 2KT9A 2Z3MA 4QKNA 2NMTA 3CQCB 2BVMA 4AQFA 1MJ9A 1YREA 1NE9A 1Z0PA 2RA1A 4MHDA 5LP6E 4NUVA 2YGWA 3ZJ2A 4ZS2A 2XHEB 1Q2YA 3UT5E 5BWAB 2WMNA 4F6AA 2LSIA 4O4HE 3SXOA 1Z9UA 4P09A 1PU9A 4R3KA 2EHOD 1E1HB 1KZFA 4QHOA 4UFXA 5JQGE 1P0HA 2HUZA 5E96A 4EXTA 4ZI3D 2XTLA 2Q44A 4DVDA 4UXNB 4HTEA 1XEBA 3C4ZA 3EDUA 2CXLA 1WYBA 3I9YA 3J9X1 3E08A 1LKXA 1WLXA 3F31A 2Q9QC 4QBJA 2G0UA 4KLWA 4K0UA 3FXEB 3R95A 2NOXA 2G3AA 4MFJA 5FXXA 2WSSV 3UULA 4MFQA 5J1GA 3FBUA 5HMNA 4PJMA 3RC8A 2IW5B 2X0LB 4MY0A 3BQIA 4QX8B 3TOAA 3QC9A 2HQYA 3ZPOA 5J2TE 3PTRB 4YFJA 4MJ8A 1Y9WA 4XAXB 2YK0A 2PC1A 3FYNA 2Q7BA 2ODUA 4RI1A 4E2AA 4A31A 5IYZE 2QGSA 3ZCIA 3PZJA 2CM0A 3J7Yq 4KOXA 3VU7H 3V5SA 2PDOA 2MYSA 1YW0A 4TV9E 4MBQA 4O2BE 3FRMA 4QXCB 2WBLA 5DABA 4PK5A 4PW8A 3EFAA 4UFVA 3K9UA 1NSLA 4ZOLE 4AVAA 2ES0A 4E0AA 2XAGB 3RYFE 2ZM0A 2XAQB 3RYHE 3NZPA 3LJCA 5LOVE 2Z10A 4AB7A 5M4YA 1G73A 4B13A 4YJ3E 4UIGA 4NF1A 5LNKA 5G21A 1QSOA 3CKDA 3HKEE 1EZ3A 1PUAA 2X67A 2XAFB 5DQVA 5L2LA 3ZN0B 4KLVA 2ZM8A 3C4WA 3RPUA 1IICA 4ZGYB 1KUVA 5F8PA 1FMVA 5L3GB 4UELA 4H63H 1IIDA 4K30A 4KORA 4KOTA 3V5UA 2CXAA 2LJLA 2RC4A 2CCQA 3ZEFB 2LSJA 3F0AA 2LM9A 1FEWA 3ZCJA 5TAOA 4WBNE 4G63A 2G3TA 4DMVA 3U3IA 3UY5A 1OZPA 3WR7A 2K48A 4PSWA 3RKOA 2VKDA 3EVYA 2Z3NA 4UEMA 3SXNA 4KOWA 4AVCA 4MFLA 5FMNA 4LX9A 1ZHCA 4YLHA 2H3RA 4EB6E 4EZ4A 3N9MA 2OZGA 4PNIA 1YX0A 5HXHA 5EZYE 4ZI3C 2VB6A 4BAYB 2FS5A 2DNXA 3QAHA 4TN7B 4AXPA 2J8NA 4ZHQE 1ON0A 2FE7A 2JLMA 2PR8A 4X1KE 5EK2A 3TCVA 3WAKA 5KDMC 4B5PB 2PSWA 3ZMVB 5HXCA 1S7FA 2YU2A 2LSYA 4QXBB 4IE5A 4AKIA 3Q9DA 2B4DB 2DLRA 2OB0A 2XAJB 4C7IA 5FNVE 3O4XE 2CE7A 3W6XA 3RX6A 2V1DB 4FJOA 4KS9A 4IUSA 3IBPA 4C68A 1MIVA 3S6GA 5JDMA 2GANA 4H9NC 3CQXC 5C88A 4QVTA 1ZO0A 4G2AA 4OADA 4HFVA 1HX8A 1VOMA 2VI7A 4HNYB 2EUIA 4CXYA 3LK2B 5HWXA 1Q2CA 3E0KA 4I43B 3EC4A 4DBRA 3I1AA 3GN5A 3IU2A 4QC6A 1Z4RA 4B5PA 3W6SA 2ZMAA 2JDDA 3DDDA 4HKFA 3C50A 4PJLA 3R9FA 4FD5A 3W15B 3UUXB 2B4DA 4O2AE 1IJ6A 4BMHA 4QWNB 4KVME 2W0GA 3OJAA 2QA7A 3D2PA 1MIWA 5ADXL 3MZKB 2Q4YA 2ATRA 2CXFA 4II9A 3GA8A 1YKEB 3I0QA 3NRYA 2G0BA 5BMVE 2JJ9A 4HNWB 2R98A 4O4LE 4WNKA 2D5UA 5L3DB 3JUWA 2ACXA 5JH7E 4KP3C 2DHRA 5F3JA 2YNCC 5EC4A 3OYZA 5FVJA 3K8PC 4JD6A 4ZI2D 2LHRA 4CAXA 2C5JA 5HXRA 2WSAA 2K5BB 2IC6A 5AG7A 5JDLA 3H5ZA 4TV8E 4TX5A 4CRZB 4Y49B 4PK4A 1D0ZA 5JR9C 5H6RB 5F48A 2CEAA 2FT0A 3ZC0A 2X9WA 3N2GE 3GYAA 4H9RC 4XNHC 1IYLA 1AJ3A 3ZZIA 3F2EA 2A72A 2Y0MA 4EYUA 1YLEA 4YFSA 4CGOA 4XPLA 4UCPA 2J1DG 5CA0E 4OHFA 2KWIB 3DR6A 3MGDA 2CNTA 5G22A 3VWDA 2X9HA 1QSMA 2Z3OA 2DPTA 3MJXA 3MA9A 2EVNA 4E8OA 4BJNA 1OWAA 1HG2A 2VWAA 3WAJA 4L89A 4BA9A 5L3EB 4UCMA 2IAKA 4B5OA 2JMHA 4DMWA 2LHNA 5LG4A 2QECA 5IV0A 4IE0A 2CNSA 2YNCA 2J8RA 4AG7A 1FY7A 4A33A 2BL1A 1IYKA 2FL4A 2K5TA 1S7NA 2LSKA 4L9IA 2JRKA 3SS1A 1MJAA 3D2MA 4H9QC 1B7TA 3N9QA 3EUHA 3A5XA 3HKBE 2XAHB 4NEXA 2VKHA 3AVRA 4P0AA 4CZZB 3DNSA 5JR9A 3ZN1B 3HKCE 3AA1B 4ASKA 5DQWA 3NZQA 4CAWA 3CX7B 3RYOA 4KBMB 4OYKA 1N71A 3ONXA 5J2UE 2NW9A 1S60A 1YVOA 1UCUA 2NWBA 4MHCA 1HCIA 3AA6B 5LHGB 1WWZA 2QMLA 4I4TE 4Q36A 4L0RA 4CXXA 2OH1A 3KDSE 3BJ8A 2UXXB 3N9NA 1BR1A 4ZI2C 2OU2A 1I21A 5JRCB 5KTAA 2VXKA 1L0CA 2LSGA 4H6ZA 2PG8A 4M3SA 1CUNA 1IB1E 3MXZA 5A1LA 3ZYLA 2Q4VA 2V7MA 3KBUA 4C91A 4AKRB 4CQIA 4PK2A 2D4OA 1YD8G 4JXRA 2V7KA 2DI4A 2FCKA 4X5KA 1ZKEA 4JJXA 2BUEA 3N2OA 1UFHA 4H9SE 3B8GA 1BR2A 1HTJF 2KINB 4QXHB 2M67A 5FYMA 4C90A 1MMNA 1YVKA 5LXTE 4FI5A 3SRZA 3SWHA 2VK9A 3OYXA 2GE3A 4LUAA 2Z6EA 4F0XA 3VWEA 4GYSA 2MOZA 2REFA 2N2NA 3DTOA 4YHJA 3PURA 5HYAA 5AGEA 3AAEB 5LGNB 3IEEA 3L3PA 3W91A 3F5BA 2K24A 5IHYA 3LBXB 1MMGA 4EOZB 4MFRA 3OBVE 2GIVA 2VEZA 3BLNA 1YK3A 4QX7B 2Q04A 3RRWA 1Z4EA 3ZJ1A 1CM0A 2E9XB 2H5MA 4R57A 2HPLA 3NRXA 4AKHA 5FY7A 4IE4A 5CB4E 2B3UA 2B58A 3OKQA 1XMTA 4C2YA 4KVXA 1KUXA 2VZZA 5FXVA 4L5GA 3ETVA 4J3GA 4CAFA 1M4DA 3FBZA 1Y9KA 4N78D 5JREA 3CX8B 3JTKA 4XPDC 4QUSA 3ANWB 4AQGA 4YGOA 1SQHA 2ZXVA 4CAEA 3LFMA 5FY0A 2CWYA 1K4JA 1S7KA 4XPDB 2CY2A 5LHIB 4FD7A 4CS0B 1I1DA 3GMIA 1H7CA 4OAEA 4HNXB 4ZBGA 2J8MA 3PU8A 3ZLIA 2DWGA 2NW8A 4B14A 3SHPA 2OZHA 1S7LA 3LG7A 1KNZA 2V7JA 2LOSA 2BVLA 3FNCA 3B13A 3LK3B 2X7BA 2P6GA 3N9PA 4IHJE 4U72A 3IF8B 5GCNA 1QUUA 4UWJA 1XIXA 3NE7A 1FMWA 1BR0A 4KOUA 2WAUA 1U4QA 4HEAA 4WBOA 2Y48B 4IIJE 2ZW4A 1BOBA 3ANWA 3GWHA 5AFUL 3R9GA 4CGNA 3O1HA 4JWPA 5LBQB 4HGAA 2KCWA 1IZNB 2VKOA 1D1AA 5AG4A 4AKLA 2R1IA 5LJMA 2V7IA 3E22E 2BDEA 5H6QB 2JEVA 1NAFA 3M65A 4ORFA 5J8CA 3LD2A 3CXQA 4UA3A 1ZEEA 1M1DA 3GY9A 4U74A 4ZI7E 2VKJA 1BO4A 3BQLA 4H63V 4UFWA 4TZ4C 4ILUA 1RXTA 4HN9A 4FD4A 4ISSA 2VASA 2OZUA 3AB3B 2L3LA 1MK4A 4P0BA 1Y64B 4UCNA 4IDZA 2P6FA 3TO7A 2YEVC 5JQ4A 4JUYA 2C5KT 2A2FX 3I3GA 2NW7A 5HAXA 4GK5E 3FHNA 2DCFA 1MNEA 4MLKA 2H7VC 4L8AA 4UVCB 4MFPA 3ZMTB 3K3NA 1G8XA 5JDFA 2K9AA 4DBQA 2GK9A 2V7LA 1S35A 5EBVA 4EVYA 1LRZA 2Y6XA 4KSAA 2PR1A 2WPXA 1MNDA 2XUEA 2DXQA 3FXDB 3TTHA 3MKDA 2C27A 3TKLB 4Y49C 3Q2MA 3JC6D 3I0OA 3KVAA 5L3CB 3G8WA 3CQGB 2I59A 2PFVA 2BEIA 4YJ2E 3PUQA 2ZW7A 3ETUA 4I55E 3MACA 2Q0YA 4F0YA 3A9LA 3VHLA 5C8YE 2O28A 3TO6A 2Z11A 3IWGA 2LEHA 2B4BA 5F46A 2VQYA 4CGMA 3R9EA 3FXTA 4JEUB 2REEA 2WWUA 4KUAA 2HH7A 3C26A 5G1ZA 2A3DA 2HPJA 1S3ZA 2CMRA 2JMKA 5KTCA 2R7HA 3T90A 1VKCA 1WK4A 4GIWA 2CWOA 1SHZC 2NP9A 3I9SA 5JDGA 4ONUA 4UV9B 1NWMX 5F47A 3N5LA 2HV2A 4H9PC 3AA7B 4PAGA 2I00A 1M44A 4O4IE 3EXNA 4MALA 4XZCA 2A4NA 2E9XD 4C7HA 4H9OC 2ZPAA 1X79A 5C82A 4UF0B 5AG6A 4CYPA 4MI4A 4PFOA 5I0CA 2Y8DA 4I49A 1VRBA 2H7OA 3KBTA 4JLEA 3V8IA 3O9XA 3D3SA 2ZM2A 2P6EA 4IF5A 3RRCA 4U9YA 4X1YE 3HA4A 4OYJA 2X51A 3R84B 3HL6A 3VKHA 2D0UA 2LE8A 5L3FB 3F57A 2WMOA 3D0TA 4YRHA 4Q38A 4CAVA 4KOVA 5EK3A 3N7ZA 1IAPA 1RO5A 3RC3A 4CI3B 3S6FA 3KV5A 1QSRA 1TIQA 5FY1A 2R8VA 5CA1E 3LODA 3P8CD 4GS4A 4E7ZA 2Z3PA 2FXFA 2RP4A 2PJQA 4M1PA 3UFEA 4A30A 3I9WA 4R3LA 3KV6A 3TE4A 2L8KA 3CMLA 3T9YA 4A56A 4ISTA 1QSTA 4ZS3A 4B10A 3C64A 4MFZA 5LGUB 2OA5A 4QB9A 4PJNA 3HI2A 3GKRA 3P2HA 4JEHB 3EY5A 3AAAB 4UF0A 1D1BA 5L3BB 1US7B 4HKAA 3JC6C 2ZW6A 4KVOE 3ZMSB 4DNCA 4CGLA 5JVDE 3HR0A 3RH3A 1V0CA 2E8IA 2D4PA 2YNEA 2AE6A 4PFPA 4MY3A 4H89A 2I79A 1S94A 2QIRA 1LVKA 3DJBA 3AAIA 1QSDA 2NTYA 2W61A 4U5YA 4PK6A 4PV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FD7 A;  4KVM E;  1I1D A;  5IX3 A;  2JDC A;  2ZW5 A;  1H7C A;  4JXQ A;  4FD6 A;  3D2P A;  4OAE A;  4HNX B;  4KUB A;  4ZBG A;  2J8M A;  2Q4Y A;  1Y7R A;  4CRY B;  2ARH A;  2ATR A;  4MBU A;  2IL4 A;  4II9 A;  3EO4 A;  3BJ7 A;  4UWI A;  5IB0 A;  4KOY A;  1S5K A;  1M4G A;  3SHP A;  2MBG A;  5KTD A;  5F49 A;  2G0B A;  2OZH A;  4U9Z A;  1S7L A;  2CA5 A;  1YGH A;  1GHE A;  4HNW B;  2R98 A;  1B87 A;  3R96 A;  3FNC A;  3JUW A;  4H6U A;  2X7B A;  2P6G A;  3TT2 A;  3H4Q A;  4OLL A;  1QSN A;  5EC4 A;  5FVJ A;  5GCN A;  4JD6 A;  5H84 A;  2AJ6 A;  4UWJ A;  4CAX A;  1XIX A;  2C5J A;  2NMT A;  3NE7 A;  4KZT A;  4KOU A;  1MJ9 A;  1YRE A;  1NE9 A;  1Z0P A;  2IC6 A;  2ZW4 A;  1BOB A;  4MHD A;  3R9G A;  4CRZ B;  4JWP A;  1Q2Y A;  3DSB A;  3QB8 A;  2KCW A;  4Y49 B;  4F6A A;  3SXO A;  1Z9U A;  1PU9 A;  4R3K A;  2R1I A;  5F48 A;  2FT0 A;  2X9W A;  2JEV A;  1KZF A;  3CXP A;  5E96 A;  1P0H A;  2HUZ A;  4ORF A;  5DWN A;  3GYA A;  4XNH C;  5J8C A;  5J8F A;  1M4I A;  2XTL A;  1IYL A;  5CNP A;  1Q2D A;  3LD2 A;  2Q44 A;  3CXQ A;  3ZZI A;  2Y0M A;  5H86 A;  1YLE A;  4UA3 A;  1M1D A;  3GY9 A;  1XEB A;  2CNM A;  3OWC A;  4XPL A;  4J2C A;  2B3V A;  3TOB A;  1BO4 A;  1RXT A;  2KWI B;  3D8P A;  3DR6 A;  3P2F A;  4FD4 A;  3MGD A;  2CNT A;  2OZU A;  3VWD A;  4QBJ A;  1YR0 A;  2G0U A;  1MK4 A;  1QSM A;  4KLW A;  3FXE B;  3R95 A;  2P6F A;  3TO7 A;  5JQ4 A;  2G3A A;  2EVN A;  4E8O A;  2C5K T;  1B6B A;  2BSW A;  3I3G A;  3S4U A;  3FBU A;  4L89 A;  3CXS A;  5HMN A;  4NSQ A;  4MY0 A;  4L8A A;  4B5O A;  3TOA A;  2HQY A;  4YFJ A;  2QEC A;  1Y9W A;  4MJ8 A;  4PSX A;  5IV0 A;  2CNS A;  2J8R A;  2PC1 A;  3S6K A;  4AG7 A;  3FYN A;  2Q7B A;  1FY7 A;  5EBV A;  2BL1 A;  5ISV A;  4EVY A;  1IYK A;  4RI1 A;  4E2A A;  3PZJ A;  2B5G B;  2FL4 A;  1LRZ A;  5DWM A;  4KOX A;  2PR1 A;  2K5T A;  1S7N A;  2PDO A;  2WPX A;  2DXQ A;  2Z0Z A;  3FRM A;  3FXD B;  3TTH A;  2WPW A;  2C27 A;  1MJA A;  3D2M A;  3TKL B;  3PP9 A;  3EFA A;  3K9U A;  4NEX A;  4Y49 C;  1NSL A;  3R1K A;  4DND A;  3DNS A;  4AVA A;  3G8W A;  4E0A A;  2BEI A;  2PRB A;  2Z10 A;  4AB7 A;  2ZW7 A;  3ZJ0 A;  2X9X A;  2Q0Y A;  4CAW A;  4F0Y A;  4M85 A;  2O28 A;  3TO6 A;  4NF1 A;  2Z11 A;  3IWG A;  2B4B A;  3RYO A;  1QSO A;  5F46 A;  3CKD A;  2VQY A;  3R9E A;  3JVN A;  1N71 A;  3FXT A;  1PUA A;  1LVF A;  2REE A;  1S60 A;  1YVO A;  4KUA A;  3C26 A;  4KLV A;  1S3Z A;  1IIC A;  1KUV A;  1WWZ A;  2QML A;  5KTC A;  4R9M A;  1J4J A;  1MJB A;  4L0R A;  1IID A;  2OH1 A;  2KWH A;  4K30 A;  3BJ8 A;  4KOR A;  2R7H A;  3TO9 A;  4KOT A;  3T90 A;  1VKC A;  2OU2 A;  2RC4 A;  1WK4 A;  3TFY A;  1I21 A;  3FIX A;  3I9S A;  5KTA A;  2VXK A;  3F0A A;  3DR8 A;  1L0C A;  4AG9 A;  4H6Z A;  2G3T A;  4ONU A;  2B5G A;  3IGR A;  4R87 A;  1I12 A;  5F47 A;  3N5L A;  4M3S A;  3UY5 A;  2HV2 A;  1OZP A;  2FIA A;  2K48 A;  3WR7 A;  1IB1 E;  3MXZ A;  4PSW A;  2I00 A;  4XPK A;  1M44 A;  2Q4V A;  4RS2 A;  3SXN A;  4KOW A;  3EXN A;  4AVC A;  4LX9 A;  4CQI A;  4PK2 A;  2D4O A;  2A4N A;  2OZG A;  4JXR A;  1YX0 A;  2FCK A;  4B6X A;  4X5K A;  2ZPA A;  1ZKE A;  4JJX A;  2BUE A;  5C82 A;  1UFH A;  2FS5 A;  4MI4 A;  3QAH A;  3B8G A;  2J8N A;  1CJW A;  1ON0 A;  2FE7 A;  2JLM A;  2PR8 A;  3S6H A;  5I0C A;  3TCV A;  4I49 A;  4B5P B;  3V8I A;  2VZY A;  3P7I A;  3D3S A;  2P6E A;  2PSW A;  4IF5 A;  4U9Y A;  1NMT A;  1S7F A;  1R57 A;  1YVK A;  4FI5 A;  2B4D B;  4YRH A;  3FB3 A;  4CAV A;  2OB0 A;  4KOS A;  2GE3 A;  4LUA A;  4KOV A;  3VWE A;  2IC9 A;  3F8K A;  3N7Z A;  2REF A;  3W6X A;  1RO5 A;  3CVR A;  3S6F A;  4IUS A;  3L3P A;  1QSR A;  3W91 A;  1TIQ A;  2R8V A;  3F5B A;  4JLY A;  3LOD A;  3S6G A;  4GS4 A;  4NXY A;  2GAN A;  2FXF A;  5C88 A;  4QVT A;  2GIV A;  2VEZ A;  4R3L A;  3BLN A;  1YK3 A;  3TE4 A;  2Q04 A;  3T9Y A;  1QST A;  1XF8 A;  2FSR A;  4OAD A;  2C5I T;  1Z4E A;  4EYY R;  1CM0 A;  2H5M A;  4R57 A;  2VI7 A;  4HNY B;  3QK6 A;  4QB9 A;  5JPH A;  2FIW A;  2EUI A;  3GKR A;  4NCZ A;  3P2H A;  2B3U A;  1VHS A;  1Q2C A;  2B58 A;  3E0K A;  3EY5 A;  1XMT A;  2F5I A;  4KVX A;  3EC4 A;  1KUX A;  2VZZ A;  1P4N A;  2ZW6 A;  2VBQ A;  4QC6 A;  4KVO E;  2X9Y A;  1Z4R A;  3QUJ A;  4J3G A;  1M4D A;  1KUY A;  4B5P A;  4DNC A;  1Y9K A;  1XE4 A;  3KKW A;  4XPD C;  4AVB A;  1V0C A;  3W6S A;  4QUS A;  1IJ5 A;  2JDD A;  2D4P A;  3DDD A;  4HKF A;  2AE6 A;  4YGO A;  3PGP A;  1SQH A;  4MY3 A;  4UBR A;  4H89 A;  3R9F A;  2I79 A;  2ZXV A;  4PK3 A;  4FD5 A;  2QIR A;  4XNH B;  3G3S A;  1QSD A;  2B4D A;  4U5Y A;  2PQ8 A;  1IJ6 A;  1K4J A;  1U6M A;  1S7K A;  2P0W A;  4BMH A;  4PV6 A;  4XPD B;  5HH1 A;  2CY2 A;  4CS0 B; 
#chains in the Genus database with same CATH topology
 3WC5 A;  1JNZ A;  1OED C;  3FB2 A;  3B57 A;  5FVK A;  4RN7 A;  4JI4 T;  3IIB A;  1R3N A;  2ZW5 A;  4JXQ A;  4HWC A;  4HE8 A;  4FD6 A;  3LSV A;  3K3O A;  4KUB A;  2Q9Q B;  3IWW A;  4EEB A;  4DV4 T;  3BK9 A;  2XAS B;  2ARH A;  4V1A v;  5HEU A;  4MBU A;  3H3A A;  2XQY A;  3DP7 A;  3FH4 A;  3KR4 A;  5IB0 A;  2Q7S A;  4KOY A;  1S5K A;  1M4G A;  2C1C A;  2MBG A;  5KTD A;  5F49 A;  1O3X A;  3PUZ F;  4EGW A;  4JI7 T;  2R6G F;  4IDN A;  1CP6 A;  1YGH A;  4ZY2 A;  5EK4 A;  1OBR A;  3R96 A;  3VKG A;  3X1D A;  2YDR A;  2I0M A;  2P9B A;  2CHO A;  3QNV A;  3TT2 A;  3P4Q A;  2FJD A;  4JYW A;  3RKG A;  4DUY T;  1IBL T;  1Z8X A;  1QSN A;  5JM6 A;  5LYF A;  5H84 A;  4E7S A;  2AJ6 A;  2N9D A;  2JPF A;  1VIX A;  2E9X C;  4ZX9 A;  2UUB T;  5JRC A;  4KZT A;  4A97 A;  4BJM A;  1MMD A;  4LQG A;  3KVB A;  3N9L A;  2IMO A;  4BBH A;  5LA6 E;  5HXS A;  5JH9 A;  2WDV A;  3RYI E;  5HXD A;  4F8Z A;  4DO0 A;  5J1Q A;  3AEC A;  3DSB A;  5FL1 A;  3QB8 A;  4P4J A;  5E0O A;  4CPA A;  1ARL A;  4U7Y A;  3Q5E A;  2PIY A;  1ZLH A;  2GLJ A;  3CXP A;  2WU5 A;  2V5D A;  5DWN A;  3N5F A;  3TX8 A;  3AA0 B;  5J8F A;  1M4I A;  5CNP A;  1Q2D A;  1MIY A;  3PUG A;  2Q9Q A;  1RTQ A;  2PBI A;  5H86 A;  1WR0 A;  2L9Q A;  1T98 A;  4CYO A;  2CNM A;  3OWC A;  4J2C A;  3H37 A;  2B3V A;  1OED A;  4GOU A;  3TOB A;  1HFA A;  3D68 A;  3KV4 A;  5LYJ E;  5JGF A;  3D8P A;  2XEG A;  2AFW A;  4Q25 A;  1VGY A;  3P2F A;  1VHO A;  2VVS A;  2B1E A;  4TWE A;  4WW0 A;  1TF8 A;  1YR0 A;  1CPX A;  3C98 B;  4A37 A;  3B3S A;  1IU8 A;  4ILC A;  4NPP A;  3R6N A;  1CX8 A;  2W63 A;  3TLV A;  1B6B A;  2BSW A;  4F6R C;  4AKG A;  3BXM A;  5AQN B;  4U33 A;  3NA6 A;  3S4U A;  1N32 T;  1YQ4 A;  2KXP B;  2XM1 A;  3CXS A;  1X9B A;  2EHO C;  3LBX A;  1GQE A;  4NSQ A;  1D0X A;  3SFE A;  5LCY A;  3AVS A;  3NKZ A;  3AE6 A;  3WC7 A;  2VQE T;  3WAB A;  4CI1 B;  5HXE A;  4X65 T;  3O1J A;  4LF7 T;  3GN5 B;  4PSX A;  2ZLY A;  3S6K A;  4MFK A;  5ISV A;  4O23 A;  2EHO B;  1CBX A;  1WR6 A;  2E9X A;  3HKD E;  2B5G B;  2BBH A;  5DWM A;  1SUM B;  3KV9 A;  4NGS A;  3CPX A;  1D0Y A;  3UUN A;  2Z0Z A;  4UVB B;  2CF4 A;  4IGU A;  3EDV A;  4X1I E;  2WPW A;  2Z3L A;  2N1G A;  1UUS A;  2WM9 A;  3KFW X;  3PP9 A;  4EIW A;  3L09 A;  2E5V A;  5LYD A;  3UU8 A;  2XQ8 A;  3R1K A;  3PU3 A;  2M6B A;  4DND A;  1I6Z A;  4A95 A;  4ZZB A;  2PRB A;  1NEK A;  4P4B A;  2RPA A;  4ADZ A;  2YND A;  1XDP A;  4YY3 T;  4EED A;  2JQQ A;  1F2P A;  2EBJ A;  3ZJ0 A;  2X9X A;  3QAY A;  1Y01 A;  1VCT A;  4X62 T;  4AIS A;  4M85 A;  4YXD A;  4KSF A;  3RHW A;  3RO0 A;  2D2S A;  1WCR A;  2BZB A;  3IWE A;  1XFO A;  3HLP A;  1FIO A;  2PJ5 A;  3UU3 A;  3ZYM A;  4DJL A;  4LFB T;  3JVN A;  3ZT6 A;  3C4X A;  2V6Y B;  5HCJ A;  4ANJ A;  1LVF A;  5K8M A;  2ZEH A;  3PE0 A;  5JDH A;  3JAD A;  3EHZ A;  5FL0 A;  4X66 T;  5LGT B;  4CGP A;  5G20 A;  3SOL A;  4P6Y A;  4F9V A;  1HX1 B;  5FP3 A;  2X0H A;  2WCA A;  3JRU A;  3PEI A;  4H2K A;  4ONW A;  4R9M A;  5IB9 A;  1J4J A;  2VVN A;  4O4J E;  1MJB A;  2C6G A;  1BR4 A;  2KWH A;  3FMC A;  3ZMZ B;  3TO9 A;  2LLY A;  2ZEP A;  3QOF A;  2BOA A;  5LRK A;  4TNU A;  4ZZC A;  4OFZ A;  3TFY A;  5HWY A;  5JDN A;  3FIX A;  2X68 A;  1BLL E;  4NUU A;  3UTK A;  3DGV A;  2VL8 A;  3DR8 A;  2EHO A;  1UX5 A;  4AG9 A;  1MMA A;  4A2Z A;  3NBX X;  3ZYK A;  2B5G A;  3B2Y A;  3IGR A;  4R87 A;  1I12 A;  3H8E A;  4IE7 A;  4EFD A;  2LOP A;  2FIA A;  3FBL A;  5KMG P;  4XPK A;  2CBJ A;  5A28 A;  2UXC T;  4B3R T;  3MRU A;  4RS2 A;  1JQG A;  1V9D A;  3Q5D A;  1WFD A;  2ODV A;  2W00 A;  4OK0 A;  4NGM A;  2W62 A;  3JCF A;  2MTQ A;  4JBW F;  4OC2 A;  4DR4 T;  4B6X A;  3EAB A;  4P1N A;  3IU1 A;  2JQ9 A;  4HFC A;  2AFO A;  3H8G A;  3WT4 A;  1CJW A;  3S6H A;  4R6T A;  4MCS A;  4EWT A;  3K3Q C;  3N2K E;  5ETW A;  4C2Z A;  3KZW A;  5GON E;  4AI6 A;  3KR5 A;  2VZY A;  3P7I A;  4MHZ A;  2KND A;  1NMT A;  4KUM B;  2NTX A;  3PUS A;  5FXW A;  4TUY E;  4B3S T;  1R57 A;  2V6Y A;  3AE4 A;  1QQ9 A;  4HWF A;  3VAT A;  2WU2 A;  3FB3 A;  3Q5X A;  4KOS A;  4W9Y A;  2BG9 B;  2IC9 A;  3CX6 B;  3KIN B;  3LK4 2;  4MRI A;  2ZEM A;  3F8K A;  3SI1 A;  2YIN A;  2LT3 A;  3UU5 A;  4UV8 B;  3ZMU B;  1SA0 E;  5FXZ A;  4X5T A;  1N34 T;  3SI2 A;  3CVR A;  5LBM A;  2DWK A;  4KI0 F;  2Z3K A;  4GYR A;  3FX6 A;  3O1I A;  4UEZ A;  2UXN B;  4JLY A;  3PDY A;  4NGQ A;  2C0S A;  3RYC E;  4NXY A;  1ZV4 X;  3Q5W A;  1J5E T;  2KMF A;  4JI8 T;  3CWZ B;  2Q9Q D;  4QH4 A;  4LMK A;  2J62 A;  4AIU A;  1EE3 P;  3AEE A;  3ZC1 A;  2KLQ A;  1XF8 A;  2FSR A;  4LQ6 A;  2C5I T;  1UX4 A;  5LJN A;  5AQG B;  3N9O A;  4EYY R;  2BS4 A;  3CPZ A;  2AFU A;  1HF8 A;  5AQH B;  4ERR A;  4OID A;  3QK6 A;  4GK0 E;  2EO8 A;  5JPH A;  4AQF C;  2FIW A;  3PUW F;  1AUG A;  3VAR A;  3ESL A;  4NCZ A;  4A32 A;  1WRD A;  2PJ1 A;  4CN6 A;  1M7K A;  2CXD A;  1KF6 A;  3FZL B;  1VHS A;  2F5I A;  2XSA A;  1KK7 A;  1YKH B;  2D9D A;  2Q43 A;  1DE4 C;  4IDO A;  1E7P A;  5DJQ C;  4B12 A;  5JDQ A;  1P4N A;  3SJE A;  2VBQ A;  4CYQ A;  4KHZ F;  2X9Y A;  2X66 A;  2W4X A;  3QUJ A;  4YSX A;  1KUY A;  1D1C A;  3WI3 A;  3E0Z A;  1FJG T;  1XE4 A;  4I0U A;  4KMC A;  4EZH A;  3KKW A;  4AVB A;  5JR9 B;  1WYC A;  4HPS A;  1IJ5 A;  4R8F A;  2XSB A;  3PGP A;  3U78 A;  5KX5 E;  4UBR A;  4PK3 A;  3BQK A;  3FVL A;  4XNH B;  2PCU A;  3G3S A;  4CI2 B;  5IWA T;  4O8S A;  2VUR A;  2PQ8 A;  2WP9 A;  1U6M A;  4Z8X A;  2P0W A;  4FAI A;  2D0T A;  4B11 A;  3RF1 A;  2MAW A;  5HH1 A;  4PJJ A;  3B7I A;  5LMU T;  5AG5 A;  3RAM A;  2CHN A;  5IX3 A;  4JYA T;  4K0K T;  5LHH B;  3K9T A;  2JDC A;  2KZ7 B;  5A27 A;  2B76 A;  1F2O A;  1U5P A;  4X20 E;  5ABE A;  2WZI A;  2PVW A;  2ZEG A;  2CLY C;  1Y7R A;  2O53 A;  4CRY B;  1W0A A;  2IL4 A;  3IEH A;  3EO4 A;  3BJ7 A;  4UWI A;  3T8O A;  5J0Z A;  5AQU B;  1HS7 A;  3PUA A;  5AQO B;  4XBF B;  1E2A A;  4UVA B;  1HG5 A;  1OXZ A;  4U9Z A;  2CA5 A;  1YSJ A;  1GHE A;  1B87 A;  2PIZ A;  4I50 E;  2YU1 A;  4YTM A;  4IRE A;  2CLY B;  1LAP A;  3UUM A;  1HEE A;  3KQX A;  2SPC A;  4IK2 A;  1LFW A;  4IE6 A;  3UQ4 A;  2V26 A;  3G06 A;  2DF5 A;  4H6U A;  3MK7 C;  4CXW A;  4EAH A;  1IOI A;  3C51 A;  4C2X A;  2WUU A;  3IHR A;  4CYN A;  2XPK A;  3H4Q A;  2DPS A;  4OLL A;  2KT9 A;  5HEJ A;  1YQE A;  5LB7 B;  1TKF A;  2PJC A;  2Z3M A;  5DS0 A;  1VCS A;  3ZSS A;  4QKN A;  3FZK B;  2VL0 A;  3T1H T;  5L4E A;  2NMT A;  3CQC B;  2BVM A;  4AQF A;  1MJ9 A;  1YRE A;  1NE9 A;  1Z0P A;  2RA1 A;  1YXR A;  1N36 T;  4MHD A;  5LP6 E;  4NUV A;  2YGW A;  1KFY A;  3ZJ2 A;  4CN4 A;  4NGR A;  4ZS2 A;  2XHE B;  1Q2Y A;  3UT5 E;  5BWA B;  2WMN A;  5K8O A;  2LKG A;  4F6A A;  2LSI A;  4O4H E;  1KNR A;  3SXO A;  1Z9U A;  5HVH A;  4P09 A;  1PU9 A;  4R3K A;  4YTN A;  2EHO D;  3AEB A;  1E1H B;  2AFS A;  2XQ4 A;  3ABV A;  1FNO A;  1KZF A;  3ONL C;  4QHO A;  2UUC T;  5JQG E;  1P0H A;  2HUZ A;  4UFX A;  5E96 A;  4EXT A;  4ZI3 D;  2WB5 A;  2XTL A;  2Q44 A;  4DVD A;  4UXN B;  3PJA J;  4HTE A;  1LAM A;  1XEB A;  2QYW A;  2J47 A;  1ELM P;  3P50 A;  1Z8T A;  3C4Z A;  3EDU A;  2CXL A;  3JAE A;  1WYB A;  3I9Y A;  3J9X 1;  3E08 A;  3UU4 A;  3I1U A;  4AQY T;  1LKX A;  1WLX A;  4P45 A;  3F31 A;  2Q9Q C;  3B35 A;  4QBJ A;  1XBU A;  2NR4 A;  2G0U A;  4KLW A;  2JQK A;  4K0U A;  3FXE B;  1XDO A;  1HDQ A;  3R95 A;  2NOX A;  1Z8L A;  2ODF A;  2G3A A;  4MFJ A;  5FXX A;  2WSS V;  3UUL A;  1YW4 A;  5J1G A;  4MFQ A;  3D4U A;  3FBU A;  4RUH A;  2WS3 A;  3AE9 A;  5HMN A;  4PJM A;  4PPZ A;  3RC8 A;  2IW5 B;  2X0L B;  4MY0 A;  1M62 A;  3BQI A;  4UEF A;  5K8P A;  4QX8 B;  3D7F A;  4DV0 T;  3TOA A;  3QC9 A;  2HQY A;  3ZPO A;  5J2T E;  3PTR B;  4TNV A;  4MJ8 A;  1Y9W A;  4YFJ A;  4XAX B;  2YK0 A;  4BD9 A;  1XNQ T;  1F57 A;  2PC1 A;  3FYN A;  2Q7B A;  4M6I A;  3D67 A;  1SE7 A;  2ODU A;  2XQ7 A;  4RI1 A;  4E2A A;  4A31 A;  5IYZ E;  2HN2 A;  2QGS A;  2ZEL A;  3ZCI A;  2AE9 A;  3PZJ A;  4P4E A;  2CM0 A;  3J7Y q;  4KOX A;  3VU7 H;  2POK A;  3V5S A;  2MYS A;  1YW0 A;  2PDO A;  4TV9 E;  4MBQ A;  4O2B E;  2JBK A;  3FRM A;  4IAV A;  4HWI B;  4HFH A;  5JTG A;  4QXC B;  2WBL A;  3L8R A;  5DAB A;  4PK5 A;  4PW8 A;  3TLT A;  1ZG8 A;  4JV5 T;  2GLF A;  3EFA A;  4UFV A;  3K9U A;  1NSL A;  1Z2L A;  4ZOL E;  2J9A A;  4AVA A;  2ES0 A;  4E0A A;  2XAG B;  3RYF E;  2ZM0 A;  3D66 A;  2XAQ B;  3RYH E;  2ACZ A;  3NZP A;  3LJC A;  5LOV E;  5FKY A;  2HHH T;  2Z10 A;  4AB7 A;  5M4Y A;  1G73 A;  4B13 A;  4YJ3 E;  4UIG A;  4OX9 T;  3LWU A;  2CTB A;  4NXN T;  4LML A;  4NF1 A;  5LNK A;  3FEC A;  5G21 A;  4IDQ A;  1QSO A;  3S9L A;  3CKD A;  3HKE E;  3K2K A;  5AQS B;  1QMU A;  1EZ3 A;  1PUA A;  2X67 A;  3PB8 X;  2XAF B;  5DQV A;  5L2L A;  3ZN0 B;  4UF4 A;  4KLV A;  5LYI A;  2ZM8 A;  4A94 A;  3C4W A;  3RPU A;  4KHP T;  1IIC A;  4ZGY B;  1KUV A;  2IML A;  5F8P A;  4NGP A;  3PB7 X;  1FMV A;  5L3G B;  4UEL A;  4H63 H;  1IID A;  4K30 A;  4KOR A;  2UUA T;  2ZEN A;  3FED A;  4KOT A;  3V5U A;  2CXA A;  4JI1 T;  3H8F A;  2LJL A;  2RC4 A;  2W66 A;  3SJG A;  2CCQ A;  3ZEF B;  2LSJ A;  3F0A A;  2LM9 A;  1FEW A;  3ZCJ A;  5TAO A;  4WBN E;  2BBJ A;  2WQY A;  4G63 A;  2G3T A;  4DV5 T;  4DMV A;  3U3I A;  3M3Z B;  3UY5 A;  1T7S A;  4PXB A;  5ABF B;  1OZP A;  4OIW A;  2K48 A;  3WR7 A;  4NJR A;  4PSW A;  3RKO A;  3ISZ A;  2VKD A;  2C6P A;  4A98 A;  3BI1 A;  3EVY A;  2Z3N A;  4UEM A;  3SXN A;  1AYE A;  4KOW A;  4MFL A;  5FMN A;  4AVC A;  3PBB A;  4LX9 A;  1ZHC A;  2BKN A;  4YLH A;  2H3R A;  4EB6 E;  4EZ4 A;  3N9M A;  2OZG A;  1HNZ T;  4PNI A;  1YX0 A;  4HWD A;  5HXH A;  3GB0 A;  5EZY E;  4ZI3 C;  2VB6 A;  4BAY B;  2FS5 A;  4B6Z A;  2DNX A;  3QAH A;  4TN7 B;  4AXP A;  2J8N A;  4ZHQ E;  1ON0 A;  2FE7 A;  1J1J A;  2JLM A;  2PR8 A;  4X1K E;  5EK2 A;  2IUB A;  3TCV A;  3WAK A;  4ZY1 A;  5KDM C;  4B5P B;  3NH4 A;  1BAV A;  1Z5R A;  2PSW A;  3ZMV B;  5HXC A;  1S7F A;  5CFB A;  5AQP B;  2OV9 A;  2LSY A;  2YU2 A;  3PJA A;  3AE1 A;  4QXB B;  3AE5 A;  4IE5 A;  4AKI A;  5AQR B;  3Q9D A;  2B4D B;  2DLR A;  4R7M A;  2OB0 A;  2XAJ B;  1YQ3 A;  4C7I A;  2CTC A;  5FNV E;  3O4X E;  2CE7 A;  3W6X A;  3RX6 A;  1AMP A;  2K3W A;  2V1D B;  3ZT5 A;  4FJO A;  4KS9 A;  4IUS A;  4P4F A;  1XMO T;  3IBP A;  4Z91 A;  4C68 A;  4HFB A;  1MIV A;  3S6G A;  5JDM A;  2GAN A;  4H9N C;  3CQX C;  5C88 A;  1CP7 A;  4QVT A;  1M4L A;  2XQA A;  4P44 A;  1XJO A;  1ZO0 A;  3P4S A;  4G2A A;  3QNU A;  4OAD A;  1T8B A;  1YME A;  4HFV A;  1X12 A;  4WJB A;  1VHE A;  1HX8 A;  1VOM A;  2VI7 A;  5AQK B;  4HNY B;  2EUI A;  4CXY A;  3PB6 X;  3LK2 B;  5AQJ B;  5HWX A;  1Q2C A;  5D29 A;  3E0K A;  4I43 B;  3EC4 A;  2WWV A;  4DBR A;  4JZ0 A;  4ILB A;  4Q7A A;  3I1A A;  1HNX T;  3GN5 A;  3IU2 A;  4GKJ T;  4QC6 A;  1Z4R A;  3SFD A;  4KSI A;  4B5P A;  4UR9 A;  3W6S A;  4DV6 T;  2ZMA A;  2JDD A;  3DDD A;  4HKF A;  4GM5 A;  3KAS A;  2PJ6 A;  3KHX A;  3C50 A;  4PJL A;  4ZYQ A;  3R9F A;  4FD5 A;  3W15 B;  3LAC A;  2IIU A;  1UUR A;  2GU2 A;  3UUX B;  4YU9 A;  2B4D A;  4O2A E;  4DR5 T;  1IJ6 A;  4BMH A;  3AE7 A;  4HFI A;  4QWN B;  4KVM E;  2W0G A;  3OJA A;  5AQQ B;  2QA7 A;  2LRL A;  4LF5 T;  3D2P A;  4HWH A;  2NYQ A;  1MIW A;  3A8Y C;  2C6C A;  5ADX L;  3DLJ A;  3MZK B;  1KNP A;  2PJ3 A;  2Q4Y A;  4F9U A;  2BG9 C;  2ZEO A;  2ATR A;  2CXF A;  4II9 A;  2FJE A;  3GA8 A;  1YKE B;  2W2U A;  4IL4 A;  3D7G A;  3I0Q A;  5KXJ A;  3NFZ A;  3NRY A;  2G0B A;  5CGM A;  5BMV E;  2JJ9 A;  4HNW B;  2R98 A;  4F8H A;  4O4L E;  4WNK A;  2D5U A;  4PQA A;  5L3D B;  1PYT B;  3PB9 X;  2RFH A;  3JUW A;  2ACX A;  2OLT A;  5JH7 E;  3WC6 A;  4IT4 A;  4KP3 C;  2DHR A;  3S9N A;  5F3J A;  4LF8 T;  2YNC C;  5EC4 A;  3OYZ A;  5FVJ A;  3K8P C;  4JD6 A;  4ZI2 D;  2LHR A;  4CAX A;  2C5J A;  2IQ6 A;  5HXR A;  2EK8 A;  2XJ7 A;  2WSA A;  4FWU A;  4IL9 A;  2K5B B;  1OED E;  3A7M A;  2IC6 A;  5AG7 A;  5JDL A;  2O4H A;  3H5Z A;  4TV8 E;  4TX5 A;  4CRZ B;  5AQT B;  2JQH A;  2CIJ A;  4WZX A;  3RBU A;  2ZEF A;  4Y49 B;  4PK4 A;  4LF6 T;  6CPA A;  2A9U A;  1D0Z A;  5JR9 C;  5H6R B;  3RIA A;  5F48 A;  2BCO A;  2CEA A;  3KL9 A;  2FT0 A;  2UXD T;  2AFZ A;  3ZC0 A;  2X9W A;  3N2G E;  2ZEE A;  3GYA A;  4H9R C;  4XNH C;  3FJU A;  1IYL A;  5D8N A;  1AJ3 A;  2PJ2 A;  1XMQ T;  4MXU A;  3F2E A;  2A72 A;  2Y0M A;  3ZZI A;  3KHZ A;  4EYU A;  1YLE A;  4YFS A;  4COF A;  3ZT7 A;  4CGO A;  3GIU A;  4XPL A;  4UCP A;  3GLJ A;  4MHP A;  2J1D G;  2QYV A;  4OME A;  5CA0 E;  2BKP A;  7CPA A;  4OHF A;  3RNZ A;  2KWI B;  4EME A;  3ZKR A;  3DR6 A;  3ONJ A;  3VR8 A;  3RIF A;  1L0V A;  3K1S A;  3MGD A;  2CNT A;  2BO9 A;  2BKO A;  5G22 A;  3VWD A;  2X0Y A;  2X9H A;  2BG9 A;  1QSM A;  2PJ8 A;  2LM2 A;  4ZY0 A;  4DR6 T;  5HEO A;  4LFC T;  2Z3O A;  3V38 A;  2DPT A;  3MJX A;  3MA9 A;  4MCQ A;  4YSZ A;  2EVN A;  4E8O A;  4M6G A;  1W9R A;  4EV6 A;  1IOF A;  4OC3 A;  4BJN A;  3VRA A;  2V8V A;  1OWA A;  1HG2 A;  2VWA A;  3WAJ A;  4JI0 T;  2V5C A;  4BA9 A;  4L89 A;  5L3E B;  4UCM A;  4A38 A;  5IUX A;  3NH8 A;  1XNR T;  3NWI A;  2IAK A;  4B5O A;  4LMJ A;  2JMH A;  3CIR A;  4DMW A;  3IC1 A;  2LHN A;  5LG4 A;  2QEC A;  1ZP0 A;  5IV0 A;  4IE0 A;  2CNS A;  2YNC A;  2J8R A;  1DTD A;  4AG7 A;  4GKK T;  1FY7 A;  4A33 A;  2BL1 A;  2CBI A;  1IYK A;  5HEH A;  4MHY A;  2FL4 A;  2K5T A;  1S7N A;  2LSK A;  4L9I A;  2JRK A;  2WYR A;  3SS1 A;  1MJA A;  3D2M A;  4H9Q C;  4IHM A;  1B7T A;  3N9Q A;  3EUH A;  2ZOF A;  3A5X A;  2PJ4 A;  3HKB E;  2XAH B;  3UQ7 A;  4NEX A;  2VKH A;  4MCR A;  3AXJ B;  3AVR A;  3AE3 A;  4P0A A;  4CZZ B;  3DNS A;  2E2A A;  5L4H A;  2YN6 A;  1I94 T;  5JR9 A;  3FF3 A;  3ZN1 B;  3HKC E;  3AA1 B;  4ASK A;  5DQW A;  3NZQ A;  4CAW A;  4NJQ A;  4OC5 A;  3CX7 B;  3RYO A;  1LAN A;  4U2Z A;  4KBM B;  4OYK A;  1N71 A;  2HN1 A;  3ONX A;  4NGT A;  2PJA A;  5J2U E;  3EI0 A;  2NW9 A;  3D7D A;  1S60 A;  1YVO A;  1UCU A;  2NWB A;  4MHC A;  1HCI A;  2WDR A;  3AA6 B;  5LHG B;  3P4P A;  5AQL B;  1WWZ A;  3BI0 A;  1ZG7 A;  2QML A;  4DR7 T;  4I4T E;  4Q36 A;  4L0R A;  4NIQ A;  4CXX A;  2OH1 A;  2GFQ A;  5F09 A;  1ELL P;  1TKJ A;  2I6H A;  3KDS E;  3BJ8 A;  2UXX B;  3N9N A;  2XQ6 A;  1BR1 A;  4ZI2 C;  4GXH A;  2OU2 A;  1KWM A;  1I21 A;  1CHU A;  5JRC B;  5KTA A;  2VXK A;  1R8I A;  3CK6 A;  2FVG A;  1L0C A;  5EMI A;  2LSG A;  4H6Z A;  2F8H A;  2PG8 A;  4M3S A;  1CUN A;  1IB1 E;  3MXZ A;  3AE2 A;  5A1L A;  3ZYL A;  5AQI B;  4DV2 T;  2Q4V A;  2V7M A;  1TKH A;  3KBU A;  4HFE A;  3P4R A;  4C91 A;  2IJZ A;  4AKR B;  2H89 A;  4CQI A;  4PK2 A;  3RQU A;  2D4O A;  1YD8 G;  4JXR A;  3AXJ A;  2V7K A;  2ANP A;  2CRB A;  2DI4 A;  2FCK A;  3RIU C;  4X5K A;  3KQZ A;  1ZKE A;  4JJX A;  2BUE A;  3N2O A;  1UFH A;  1Z8W A;  2BS2 A;  4H9S E;  3B8G A;  1IGB A;  1BR2 A;  1HTJ F;  2KIN B;  2FUP A;  2XEI A;  1HNW T;  4QXH B;  3FZH B;  2M67 A;  2QVA A;  5FYM A;  4C90 A;  2WDQ A;  1OED B;  3TLW A;  3LDQ B;  1MMN A;  2F4V T;  2LKH A;  4DUK A;  1YVK A;  3PBE A;  5HVF A;  5LXT E;  4FI5 A;  3SRZ A;  3SWH A;  2VK9 A;  3OYX A;  2GE3 A;  4LUA A;  2Z6E A;  4F0X A;  2Q4Z A;  3VWE A;  4UEE A;  4GYS A;  2EK9 A;  3SJF A;  4M6H A;  2MOZ A;  2REF A;  2N2N A;  3SJX A;  3DTO A;  4YHJ A;  2PJ9 A;  2V6X A;  3PUR A;  5HYA A;  5AGE A;  3AAE B;  5LGN B;  2XQ3 A;  3IEE A;  3L3P A;  3W91 A;  3F5B A;  1NSA A;  2K24 A;  3OPC A;  3IJ3 A;  2YKS A;  5IHY A;  3LBX B;  1MMG A;  4EOZ B;  1GYT A;  2XM2 A;  4MFR A;  3OBV E;  2DEA A;  1IY7 A;  2G9D A;  2GIV A;  5I4M A;  2VEZ A;  2QRX A;  3BLN A;  1YK3 A;  4QX7 B;  2Q04 A;  4HFD A;  2HB6 A;  3RRW A;  2VL1 A;  1Z4E A;  3ZJ1 A;  3LMS A;  3FEE A;  3H3M A;  4X3R A;  2AFX A;  1CM0 A;  2E9X B;  2H5M A;  4R57 A;  4P4I A;  4UIA A;  2BG9 E;  3FZM B;  2HPL A;  3NRX A;  3KI9 A;  1Q7L A;  4AKH A;  3AEF A;  5LMN T;  5FY7 A;  4IE4 A;  5CB4 E;  2B3U A;  2XY8 B;  2B58 A;  2WZN A;  3PFE A;  3D7H A;  3OKQ A;  3KGQ A;  1XMT A;  4C2Y A;  4TWF A;  4KVX A;  2DL1 A;  1KUX A;  5FXV A;  2VZZ A;  1FT7 A;  4L5G A;  4P10 A;  3ETV A;  4J3G A;  4DR1 T;  4CAF A;  1M4D A;  5F5W A;  5JRE A;  3FBZ A;  4N78 D;  4U31 A;  1Y9K A;  3CX8 B;  3JTK A;  4XPD C;  1UK5 A;  4QUS A;  4U2Y A;  2Q51 A;  3ANW B;  4AQG A;  4YGO A;  3RIU A;  2PVV A;  1JNR A;  1SQH A;  1TF9 A;  2ZXV A;  5AQM B;  4CAE A;  5CBM A;  2CPT A;  3LFM A;  5FY0 A;  2LRK A;  2CWY A;  3IFE A;  1K4J A;  1A2Z A;  1S7K A;  2PE3 A;  4XPD B;  3RQW A;  2CY2 A;  5LHI B;  4FD7 A;  4CS0 B;  1I1D A;  1T72 A;  3GMI A;  3CZX A;  4X8I A;  3PRT A;  1H7C A;  3PUV F;  4OAE A;  3PFO A;  4HNX B;  4ZBG A;  2J8M A;  1CPS A;  4K3N A;  3CPA A;  3PU8 A;  3NH5 A;  3ZLI A;  2DWG A;  2NW8 A;  4B14 A;  2FJA A;  3SHP A;  1ZLI A;  2OZH A;  2V8D A;  1S7L A;  3LG7 A;  4OC4 A;  1KNZ A;  2V7J A;  5THW A;  1XZY A;  2LOS A;  2WZH A;  2BVL A;  4DR2 T;  3FNC A;  1H8L A;  1IBK T;  5LYL A;  4UIB A;  4YT0 A;  3VH9 A;  4JI3 T;  3B13 A;  2XQ9 A;  3LK3 B;  2X7B A;  2P6G A;  3N9P A;  2V8S V;  4IHJ E;  4U72 A;  3IF8 B;  3TC8 A;  1UGO A;  2YDQ A;  4U7I A;  5GCN A;  1QUU A;  2QJ8 A;  2MPK A;  4UWJ A;  2YDS A;  5LRJ A;  4TWH A;  1XIX A;  3B3V A;  3NE7 A;  1FMW A;  1BR0 A;  2ZM6 T;  4OC0 A;  4KOU A;  2WAU A;  1U4Q A;  4HEA A;  4WBO A;  4WWV A;  2Y48 B;  4IIJ E;  2ZW4 A;  1BOB A;  3ANW A;  3AEG A;  5ABF A;  3GWH A;  5AFU L;  3R9G A;  3BHX A;  4CGN A;  4OKO A;  3O1H A;  4JWP A;  3PB4 X;  5AQV B;  5LBQ B;  4HGA A;  2KCW A;  1DU2 A;  1IZN B;  3B3C A;  2JIW A;  2VKO A;  4DV1 T;  1D1A A;  4BIN A;  3S9M A;  5AG4 A;  4AKL A;  2F7V A;  2R1I A;  5LJM A;  2V7I A;  4YSY A;  3E22 E;  2BDE A;  5H6Q B;  8CPA A;  2JEV A;  1NAF A;  3M65 A;  4ORF A;  4AXV A;  4Z90 A;  1Z8U A;  5J8C A;  1CG2 A;  3ZST A;  2EWB A;  3LD2 A;  3CXQ A;  3AED A;  4UA3 A;  1ZEE A;  4FBE A;  1M1D A;  3GY9 A;  4R76 A;  1UWY A;  4U74 A;  4KX6 A;  4ILA A;  4ZI7 E;  2VKJ A;  1BO4 A;  3BQL A;  4H63 V;  4UFW A;  2V77 A;  2XEJ A;  4TZ4 C;  4ILU A;  1RXT A;  3CT9 A;  4HN9 A;  4ZI6 A;  1KEY A;  1BPM A;  4FD4 A;  4ISS A;  2VAS A;  4OP4 A;  2OZU A;  5K8N A;  3AB3 B;  2L3L A;  1MK4 A;  2ABZ A;  4P0B A;  1Y64 B;  1W09 A;  4UCN A;  4IDZ A;  2P6F A;  3TO7 A;  3VR9 A;  2YEV C;  5JQ4 A;  4JUY A;  2C5K T;  2A2F X;  3I3G A;  2NW7 A;  4JI5 T;  5HAX A;  4GK5 E;  3FHN A;  3QB5 K;  2ZOG A;  3V7Z A;  2DCF A;  4PXC A;  1MNE A;  4MLK A;  2H7V C;  4L8A A;  4UVC B;  4MFP A;  3ZMT B;  3K3N A;  3NVO A;  4YHH T;  3RZA A;  1G8X A;  5JDF A;  1XMB A;  4MHN A;  4DID B;  3RLF F;  2K9A A;  4DBQ A;  3B5M A;  2GK9 A;  2V7L A;  1S35 A;  1YW6 A;  5EBV A;  4JI6 T;  4EVY A;  5ABH A;  2KSR A;  4QH1 A;  4X2T A;  1LRZ A;  2Y6X A;  2UU9 T;  2PR1 A;  4KSA A;  1HR0 T;  2WPX A;  1MND A;  2XUE A;  2DXQ A;  3QB5 A;  2FBW A;  3FXD B;  2NSM A;  3TTH A;  3MKD A;  2C27 A;  3TKL B;  2PJB A;  1BPN A;  2IDO B;  2I3C A;  2QVP A;  4Y49 C;  3Q2M A;  3JC6 D;  2JBJ A;  3I0O A;  4B3M T;  3KVA A;  5L3C B;  3G8W A;  3CQG B;  2I59 A;  2PFV A;  2BEI A;  3VRB A;  5HVG A;  4LF4 T;  4YJ2 E;  2XEF A;  3PUQ A;  3RI5 A;  3NE8 A;  2PRQ A;  3L2N A;  3PV0 F;  2ZW7 A;  1Y0R A;  3B3T A;  4PXD A;  2OOT A;  5LRG A;  3ETU A;  4I55 E;  2AFM A;  3MAC A;  2Q0Y A;  4F0Y A;  3A9L A;  4MCP A;  3VHL A;  5C8Y E;  2HC9 A;  2O28 A;  2BS3 A;  3TO6 A;  5ABG A;  2Z11 A;  3IWG A;  2LEH A;  3PUY F;  2B4B A;  5F46 A;  1PCA A;  2VQY A;  4CGM A;  4TWD A;  3OVU A;  3R9E A;  3EAM A;  3FXT A;  1LOK A;  4JEU B;  4NFR A;  2REE A;  2WWU A;  2M6I A;  4KUA A;  3IA3 A;  2HH7 A;  3C26 A;  2UXB T;  3UUB A;  2A3D A;  2HPJ A;  5G1Z A;  1S3Z A;  2CMR A;  2JMK A;  1XOV A;  1QLB A;  5KTC A;  3FZF B;  3RGL A;  4MMO A;  2R7H A;  3T90 A;  1VKC A;  1WK4 A;  4GIW A;  4ZXL A;  4A5X A;  2CWO A;  2PJ0 A;  2FJB A;  2V8H A;  4OC1 A;  1SHZ C;  2NP9 A;  3I9S A;  2PJ7 A;  5JDG A;  4YTP A;  3B3W A;  4ONU A;  4UV9 B;  1NWM X;  1Y7E A;  5F47 A;  3N5L A;  3ISX A;  4ZEY A;  4JI2 T;  2HV2 A;  1XRY A;  4H9P C;  3AE8 A;  2J4G A;  3AA7 B;  4PAG A;  2I00 A;  3AEA A;  1YLO A;  4G1P A;  1M44 A;  1HDU A;  4O4I E;  4CN1 A;  3EXN A;  4MAL A;  1ARM A;  3TLU A;  5HCM A;  5BR8 T;  4XZC A;  2A4N A;  2E9X D;  4C7H A;  4H9O C;  2ZPA A;  1X79 A;  5AQF B;  5C82 A;  4UF0 B;  5AG6 A;  4CYP A;  4MI4 A;  4PFO A;  5I0C A;  5FVL A;  2Y8D A;  4I49 A;  1VRB A;  2H7O A;  3KBT A;  4DYO A;  4JLE A;  3V8I A;  5CJ5 A;  3JAF A;  3O9X A;  3D3S A;  4TNW A;  2ZM2 A;  2P6E A;  4IF5 A;  3RRC A;  1NEN A;  3HA4 A;  4OYJ A;  4X1Y E;  5HEG A;  4U9Y A;  2X51 A;  3R84 B;  3HL6 A;  3VKH A;  2D0U A;  3UU6 A;  2LE8 A;  5L3F B;  3T8W A;  3F57 A;  2WMO A;  2YOE A;  1JWQ A;  4B3T T;  4LF9 T;  3D0T A;  4YRH A;  4Q38 A;  4CAV A;  4KOV A;  5LG3 A;  4U3C A;  5EK3 A;  4NXM T;  4DV3 T;  1Y0Y A;  3N7Z A;  2GRE A;  1IAP A;  1XWM A;  3IO1 A;  3L39 A;  1RO5 A;  2H88 A;  4QH5 A;  3RC3 A;  3TLS A;  4CI3 B;  2OR4 A;  1X10 A;  3PUX F;  3S6F A;  3KV5 A;  1QSR A;  1TIQ A;  5FY1 A;  2R8V A;  5CA1 E;  3LOD A;  3P8C D;  4WYV A;  4GS4 A;  4E7Z A;  2Z3P A;  2XQ5 A;  2FXF A;  1ZOY A;  2RP4 A;  2PJQ A;  4M1P A;  3UFE A;  4A30 A;  3I9W A;  4R3L A;  3KV6 A;  3GUX A;  4ZX8 A;  3TE4 A;  2L8K A;  5C2T A;  4DV7 T;  3CML A;  3T9Y A;  4A56 A;  4IST A;  1QST A;  4ZS3 A;  4B10 A;  1IBM T;  1ZG9 A;  4DUZ T;  2V8G A;  2E5L T;  1R43 A;  2W67 A;  3C64 A;  4MFZ A;  5C3J A;  5LGU B;  2OA5 A;  4QB9 A;  5CPA A;  4PJN A;  3HI2 A;  3GKR A;  1LCP A;  3P2H A;  4JEH B;  1W0B A;  2RB7 A;  3EY5 A;  3HUV A;  3AAA B;  4UF0 A;  1D1B A;  4P4D A;  5ELY A;  5L3B B;  1US7 B;  2XZE A;  4LFA T;  4HKA A;  3JC6 C;  3UFG A;  4YWY A;  2ZW6 A;  4KVO E;  1N33 T;  3SI0 A;  2IHR 1;  3ZMS B;  3P4W A;  2AXD S;  4DNC A;  4CGL A;  5JVD E;  3HR0 A;  3RH3 A;  4FUU A;  1V0C A;  4X64 T;  2E8I A;  1TXR A;  2D4P A;  2YNE A;  2AE6 A;  3MN8 A;  5L47 A;  4PFP A;  4A39 A;  4MY3 A;  4H89 A;  2ZED A;  4Z65 A;  2WY2 A;  4NGN A;  2I79 A;  3CDX A;  1S94 A;  1J5W A;  2QIR A;  1LVK A;  4IDP A;  3DJB A;  3AAI A;  1QSD A;  2NTY A;  4DR3 T;  2PTF A;  3OTO T;  2W61 A;  2JEW A;  4U5Y A;  3T1Y T;  2VQF T;  4PK6 A;  4PV6 A;  4PXE A; 
#chains in the Genus database with same CATH homology
 3FB2 A;  3B57 A;  2ZW5 A;  4JXQ A;  4HE8 A;  4FD6 A;  3K3O A;  4KUB A;  2Q9Q B;  3BK9 A;  2XAS B;  2ARH A;  4V1A v;  4MBU A;  3H3A A;  2XQY A;  3DP7 A;  5IB0 A;  4KOY A;  1S5K A;  1M4G A;  2MBG A;  5KTD A;  5F49 A;  1O3X A;  1YGH A;  5EK4 A;  3R96 A;  3VKG A;  2P9B A;  3TT2 A;  1QSN A;  5H84 A;  4E7S A;  2AJ6 A;  2N9D A;  2JPF A;  2E9X C;  5JRC A;  4KZT A;  4BJM A;  1MMD A;  3KVB A;  3N9L A;  4BBH A;  5LA6 E;  5HXS A;  3RYI E;  4DO0 A;  3DSB A;  3QB8 A;  5E0O A;  3CXP A;  5DWN A;  3AA0 B;  5J8F A;  1M4I A;  5CNP A;  1Q2D A;  1MIY A;  3PUG A;  2Q9Q A;  2PBI A;  5H86 A;  2L9Q A;  1T98 A;  4CYO A;  2CNM A;  3OWC A;  4J2C A;  3H37 A;  2B3V A;  4GOU A;  3TOB A;  1HFA A;  3KV4 A;  5LYJ E;  3D8P A;  3P2F A;  2B1E A;  4WW0 A;  1YR0 A;  3C98 B;  3R6N A;  2W63 A;  1B6B A;  2BSW A;  4F6R C;  4AKG A;  3S4U A;  2KXP B;  3CXS A;  2EHO C;  3LBX A;  4NSQ A;  1D0X A;  5LCY A;  3AVS A;  4CI1 B;  5HXE A;  3O1J A;  3GN5 B;  4PSX A;  2ZLY A;  3S6K A;  4MFK A;  5ISV A;  2EHO B;  1WR6 A;  2E9X A;  3HKD E;  2B5G B;  5DWM A;  3KV9 A;  1D0Y A;  3UUN A;  2Z0Z A;  4UVB B;  4IGU A;  3EDV A;  4X1I E;  2WPW A;  2Z3L A;  2N1G A;  2WM9 A;  3KFW X;  3PP9 A;  4EIW A;  3L09 A;  3R1K A;  3PU3 A;  4DND A;  4A95 A;  2PRB A;  4ADZ A;  2YND A;  2JQQ A;  3ZJ0 A;  2X9X A;  4M85 A;  4KSF A;  2D2S A;  3IWE A;  2BZB A;  1FIO A;  3ZYM A;  3JVN A;  3C4X A;  4ANJ A;  1LVF A;  3PE0 A;  5JDH A;  5LGT B;  4CGP A;  5G20 A;  3SOL A;  5FP3 A;  4R9M A;  1J4J A;  4O4J E;  1MJB A;  1BR4 A;  2KWH A;  3ZMZ B;  3TO9 A;  4OFZ A;  3TFY A;  5HWY A;  5JDN A;  3FIX A;  2X68 A;  4NUU A;  3UTK A;  3DR8 A;  2VL8 A;  2EHO A;  1UX5 A;  4AG9 A;  1MMA A;  4A2Z A;  3NBX X;  3ZYK A;  2B5G A;  3IGR A;  4R87 A;  1I12 A;  4IE7 A;  2LOP A;  2FIA A;  3FBL A;  5KMG P;  4XPK A;  5A28 A;  4RS2 A;  1V9D A;  2ODV A;  2W00 A;  4OK0 A;  2W62 A;  2MTQ A;  4B6X A;  3IU1 A;  1CJW A;  3S6H A;  3K3Q C;  3N2K E;  5ETW A;  4C2Z A;  5GON E;  4AI6 A;  2VZY A;  3P7I A;  2KND A;  1NMT A;  4KUM B;  2NTX A;  3PUS A;  5FXW A;  4TUY E;  1R57 A;  3FB3 A;  3Q5X A;  4KOS A;  2IC9 A;  3CX6 B;  3KIN B;  3LK4 2;  3F8K A;  2YIN A;  2LT3 A;  4UV8 B;  3ZMU B;  1SA0 E;  5FXZ A;  3CVR A;  5LBM A;  2DWK A;  2Z3K A;  4GYR A;  3O1I A;  2UXN B;  4JLY A;  3PDY A;  2C0S A;  3RYC E;  4NXY A;  1ZV4 X;  3Q5W A;  2KMF A;  3CWZ B;  2Q9Q D;  3ZC1 A;  2KLQ A;  1XF8 A;  2FSR A;  2C5I T;  1UX4 A;  5LJN A;  3N9O A;  4EYY R;  3CPZ A;  1HF8 A;  4ERR A;  3QK6 A;  4GK0 E;  5JPH A;  4AQF C;  2FIW A;  3ESL A;  4NCZ A;  4A32 A;  1WRD A;  2CXD A;  1VHS A;  2F5I A;  1KK7 A;  1YKH B;  5DJQ C;  4B12 A;  5JDQ A;  1P4N A;  2VBQ A;  4CYQ A;  2X9Y A;  2X66 A;  3QUJ A;  1KUY A;  1D1C A;  3WI3 A;  3E0Z A;  1XE4 A;  3KKW A;  4KMC A;  4EZH A;  4AVB A;  5JR9 B;  1WYC A;  1IJ5 A;  3PGP A;  3U78 A;  5KX5 E;  4UBR A;  4PK3 A;  3BQK A;  4XNH B;  3G3S A;  4CI2 B;  4O8S A;  2PQ8 A;  1U6M A;  4Z8X A;  2P0W A;  2D0T A;  4B11 A;  5HH1 A;  4PJJ A;  5AG5 A;  5IX3 A;  5LHH B;  2JDC A;  2KZ7 B;  5A27 A;  1U5P A;  4X20 E;  2CLY C;  1Y7R A;  4CRY B;  2IL4 A;  3EO4 A;  3BJ7 A;  4UWI A;  3T8O A;  1HS7 A;  3PUA A;  4XBF B;  4UVA B;  1HG5 A;  1OXZ A;  4U9Z A;  2CA5 A;  1GHE A;  1B87 A;  4I50 E;  2YU1 A;  2CLY B;  3UUM A;  2SPC A;  4IE6 A;  2V26 A;  4H6U A;  3MK7 C;  4CXW A;  4EAH A;  3C51 A;  4C2X A;  2WUU A;  3IHR A;  4CYN A;  3H4Q A;  2DPS A;  4OLL A;  2KT9 A;  2Z3M A;  4QKN A;  2NMT A;  3CQC B;  2BVM A;  4AQF A;  1MJ9 A;  1YRE A;  1NE9 A;  1Z0P A;  2RA1 A;  4MHD A;  5LP6 E;  4NUV A;  2YGW A;  3ZJ2 A;  4ZS2 A;  2XHE B;  1Q2Y A;  3UT5 E;  5BWA B;  2WMN A;  4F6A A;  2LSI A;  4O4H E;  3SXO A;  1Z9U A;  4P09 A;  1PU9 A;  4R3K A;  2EHO D;  1E1H B;  1KZF A;  4QHO A;  4UFX A;  5JQG E;  1P0H A;  2HUZ A;  5E96 A;  4EXT A;  4ZI3 D;  2XTL A;  2Q44 A;  4DVD A;  4UXN B;  4HTE A;  1XEB A;  3C4Z A;  3EDU A;  2CXL A;  1WYB A;  3I9Y A;  3J9X 1;  3E08 A;  1LKX A;  1WLX A;  3F31 A;  2Q9Q C;  4QBJ A;  2G0U A;  4KLW A;  4K0U A;  3FXE B;  3R95 A;  2NOX A;  2G3A A;  4MFJ A;  5FXX A;  2WSS V;  3UUL A;  4MFQ A;  5J1G A;  3FBU A;  5HMN A;  4PJM A;  3RC8 A;  2IW5 B;  2X0L B;  4MY0 A;  3BQI A;  4QX8 B;  3TOA A;  3QC9 A;  2HQY A;  3ZPO A;  5J2T E;  3PTR B;  4YFJ A;  4MJ8 A;  1Y9W A;  4XAX B;  2YK0 A;  2PC1 A;  3FYN A;  2Q7B A;  2ODU A;  4RI1 A;  4E2A A;  4A31 A;  5IYZ E;  2QGS A;  3ZCI A;  3PZJ A;  2CM0 A;  3J7Y q;  4KOX A;  3VU7 H;  3V5S A;  2PDO A;  2MYS A;  1YW0 A;  4TV9 E;  4MBQ A;  4O2B E;  3FRM A;  4QXC B;  2WBL A;  5DAB A;  4PK5 A;  4PW8 A;  3EFA A;  4UFV A;  3K9U A;  1NSL A;  4ZOL E;  4AVA A;  2ES0 A;  4E0A A;  2XAG B;  3RYF E;  2ZM0 A;  2XAQ B;  3RYH E;  3NZP A;  3LJC A;  5LOV E;  2Z10 A;  4AB7 A;  5M4Y A;  1G73 A;  4B13 A;  4YJ3 E;  4UIG A;  4NF1 A;  5LNK A;  5G21 A;  1QSO A;  3CKD A;  3HKE E;  1EZ3 A;  1PUA A;  2X67 A;  2XAF B;  5DQV A;  5L2L A;  3ZN0 B;  4KLV A;  2ZM8 A;  3C4W A;  3RPU A;  1IIC A;  4ZGY B;  1KUV A;  5F8P A;  1FMV A;  5L3G B;  4UEL A;  4H63 H;  1IID A;  4K30 A;  4KOR A;  4KOT A;  3V5U A;  2CXA A;  2LJL A;  2RC4 A;  2CCQ A;  3ZEF B;  2LSJ A;  3F0A A;  2LM9 A;  1FEW A;  3ZCJ A;  5TAO A;  4WBN E;  4G63 A;  2G3T A;  4DMV A;  3U3I A;  3UY5 A;  1OZP A;  3WR7 A;  2K48 A;  4PSW A;  3RKO A;  2VKD A;  3EVY A;  2Z3N A;  4UEM A;  3SXN A;  4KOW A;  4AVC A;  4MFL A;  5FMN A;  4LX9 A;  1ZHC A;  4YLH A;  2H3R A;  4EB6 E;  4EZ4 A;  3N9M A;  2OZG A;  4PNI A;  1YX0 A;  5HXH A;  5EZY E;  4ZI3 C;  2VB6 A;  4BAY B;  2FS5 A;  2DNX A;  3QAH A;  4TN7 B;  4AXP A;  2J8N A;  4ZHQ E;  1ON0 A;  2FE7 A;  2JLM A;  2PR8 A;  4X1K E;  5EK2 A;  3TCV A;  3WAK A;  5KDM C;  4B5P B;  2PSW A;  3ZMV B;  5HXC A;  1S7F A;  2YU2 A;  2LSY A;  4QXB B;  4IE5 A;  4AKI A;  3Q9D A;  2B4D B;  2DLR A;  2OB0 A;  2XAJ B;  4C7I A;  5FNV E;  3O4X E;  2CE7 A;  3W6X A;  3RX6 A;  2V1D B;  4FJO A;  4KS9 A;  4IUS A;  3IBP A;  4C68 A;  1MIV A;  3S6G A;  5JDM A;  2GAN A;  4H9N C;  3CQX C;  5C88 A;  4QVT A;  1ZO0 A;  4G2A A;  4OAD A;  4HFV A;  1HX8 A;  1VOM A;  2VI7 A;  4HNY B;  2EUI A;  4CXY A;  3LK2 B;  5HWX A;  1Q2C A;  3E0K A;  4I43 B;  3EC4 A;  4DBR A;  3I1A A;  3GN5 A;  3IU2 A;  4QC6 A;  1Z4R A;  4B5P A;  3W6S A;  2ZMA A;  2JDD A;  3DDD A;  4HKF A;  3C50 A;  4PJL A;  3R9F A;  4FD5 A;  3W15 B;  3UUX B;  2B4D A;  4O2A E;  1IJ6 A;  4BMH A;  4QWN B;  4KVM E;  2W0G A;  3OJA A;  2QA7 A;  3D2P A;  1MIW A;  5ADX L;  3MZK B;  2Q4Y A;  2ATR A;  2CXF A;  4II9 A;  3GA8 A;  1YKE B;  3I0Q A;  3NRY A;  2G0B A;  5BMV E;  2JJ9 A;  4HNW B;  2R98 A;  4O4L E;  4WNK A;  2D5U A;  5L3D B;  3JUW A;  2ACX A;  5JH7 E;  4KP3 C;  2DHR A;  5F3J A;  2YNC C;  5EC4 A;  3OYZ A;  5FVJ A;  3K8P C;  4JD6 A;  4ZI2 D;  2LHR A;  4CAX A;  2C5J A;  5HXR A;  2WSA A;  2K5B B;  2IC6 A;  5AG7 A;  5JDL A;  3H5Z A;  4TV8 E;  4TX5 A;  4CRZ B;  4Y49 B;  4PK4 A;  1D0Z A;  5JR9 C;  5H6R B;  5F48 A;  2CEA A;  2FT0 A;  3ZC0 A;  2X9W A;  3N2G E;  3GYA A;  4H9R C;  4XNH C;  1IYL A;  1AJ3 A;  3ZZI A;  3F2E A;  2A72 A;  2Y0M A;  4EYU A;  1YLE A;  4YFS A;  4CGO A;  4XPL A;  4UCP A;  2J1D G;  5CA0 E;  4OHF A;  2KWI B;  3DR6 A;  3MGD A;  2CNT A;  5G22 A;  3VWD A;  2X9H A;  1QSM A;  2Z3O A;  2DPT A;  3MJX A;  3MA9 A;  2EVN A;  4E8O A;  4BJN A;  1OWA A;  1HG2 A;  2VWA A;  3WAJ A;  4L89 A;  4BA9 A;  5L3E B;  4UCM A;  2IAK A;  4B5O A;  2JMH A;  4DMW A;  2LHN A;  5LG4 A;  2QEC A;  5IV0 A;  4IE0 A;  2CNS A;  2YNC A;  2J8R A;  4AG7 A;  1FY7 A;  4A33 A;  2BL1 A;  1IYK A;  2FL4 A;  2K5T A;  1S7N A;  2LSK A;  4L9I A;  2JRK A;  3SS1 A;  1MJA A;  3D2M A;  4H9Q C;  1B7T A;  3N9Q A;  3EUH A;  3A5X A;  3HKB E;  2XAH B;  4NEX A;  2VKH A;  3AVR A;  4P0A A;  4CZZ B;  3DNS A;  5JR9 A;  3ZN1 B;  3HKC E;  3AA1 B;  4ASK A;  5DQW A;  3NZQ A;  4CAW A;  3CX7 B;  3RYO A;  4KBM B;  4OYK A;  1N71 A;  3ONX A;  5J2U E;  2NW9 A;  1S60 A;  1YVO A;  1UCU A;  2NWB A;  4MHC A;  1HCI A;  3AA6 B;  5LHG B;  1WWZ A;  2QML A;  4I4T E;  4Q36 A;  4L0R A;  4CXX A;  2OH1 A;  3KDS E;  3BJ8 A;  2UXX B;  3N9N A;  1BR1 A;  4ZI2 C;  2OU2 A;  1I21 A;  5JRC B;  5KTA A;  2VXK A;  1L0C A;  2LSG A;  4H6Z A;  2PG8 A;  4M3S A;  1CUN A;  1IB1 E;  3MXZ A;  5A1L A;  3ZYL A;  2Q4V A;  2V7M A;  3KBU A;  4C91 A;  4AKR B;  4CQI A;  4PK2 A;  2D4O A;  1YD8 G;  4JXR A;  2V7K A;  2DI4 A;  2FCK A;  4X5K A;  1ZKE A;  4JJX A;  2BUE A;  3N2O A;  1UFH A;  4H9S E;  3B8G A;  1BR2 A;  1HTJ F;  2KIN B;  4QXH B;  2M67 A;  5FYM A;  4C90 A;  1MMN A;  1YVK A;  5LXT E;  4FI5 A;  3SRZ A;  3SWH A;  2VK9 A;  3OYX A;  2GE3 A;  4LUA A;  2Z6E A;  4F0X A;  3VWE A;  4GYS A;  2MOZ A;  2REF A;  2N2N A;  3DTO A;  4YHJ A;  3PUR A;  5HYA A;  5AGE A;  3AAE B;  5LGN B;  3IEE A;  3L3P A;  3W91 A;  3F5B A;  2K24 A;  5IHY A;  3LBX B;  1MMG A;  4EOZ B;  4MFR A;  3OBV E;  2GIV A;  2VEZ A;  3BLN A;  1YK3 A;  4QX7 B;  2Q04 A;  3RRW A;  1Z4E A;  3ZJ1 A;  1CM0 A;  2E9X B;  2H5M A;  4R57 A;  2HPL A;  3NRX A;  4AKH A;  5FY7 A;  4IE4 A;  5CB4 E;  2B3U A;  2B58 A;  3OKQ A;  1XMT A;  4C2Y A;  4KVX A;  1KUX A;  2VZZ A;  5FXV A;  4L5G A;  3ETV A;  4J3G A;  4CAF A;  1M4D A;  3FBZ A;  1Y9K A;  4N78 D;  5JRE A;  3CX8 B;  3JTK A;  4XPD C;  4QUS A;  3ANW B;  4AQG A;  4YGO A;  1SQH A;  2ZXV A;  4CAE A;  3LFM A;  5FY0 A;  2CWY A;  1K4J A;  1S7K A;  4XPD B;  2CY2 A;  5LHI B;  4FD7 A;  4CS0 B;  1I1D A;  3GMI A;  1H7C A;  4OAE A;  4HNX B;  4ZBG A;  2J8M A;  3PU8 A;  3ZLI A;  2DWG A;  2NW8 A;  4B14 A;  3SHP A;  2OZH A;  1S7L A;  3LG7 A;  1KNZ A;  2V7J A;  2LOS A;  2BVL A;  3FNC A;  3B13 A;  3LK3 B;  2X7B A;  2P6G A;  3N9P A;  4IHJ E;  4U72 A;  3IF8 B;  5GCN A;  1QUU A;  4UWJ A;  1XIX A;  3NE7 A;  1FMW A;  1BR0 A;  4KOU A;  2WAU A;  1U4Q A;  4HEA A;  4WBO A;  2Y48 B;  4IIJ E;  2ZW4 A;  1BOB A;  3ANW A;  3GWH A;  5AFU L;  3R9G A;  4CGN A;  3O1H A;  4JWP A;  5LBQ B;  4HGA A;  2KCW A;  1IZN B;  2VKO A;  1D1A A;  5AG4 A;  4AKL A;  2R1I A;  5LJM A;  2V7I A;  3E22 E;  2BDE A;  5H6Q B;  2JEV A;  1NAF A;  3M65 A;  4ORF A;  5J8C A;  3LD2 A;  3CXQ A;  4UA3 A;  1ZEE A;  1M1D A;  3GY9 A;  4U74 A;  4ZI7 E;  2VKJ A;  1BO4 A;  3BQL A;  4H63 V;  4UFW A;  4TZ4 C;  4ILU A;  1RXT A;  4HN9 A;  4FD4 A;  4ISS A;  2VAS A;  2OZU A;  3AB3 B;  2L3L A;  1MK4 A;  4P0B A;  1Y64 B;  4UCN A;  4IDZ A;  2P6F A;  3TO7 A;  2YEV C;  5JQ4 A;  4JUY A;  2C5K T;  2A2F X;  3I3G A;  2NW7 A;  5HAX A;  4GK5 E;  3FHN A;  2DCF A;  1MNE A;  4MLK A;  2H7V C;  4L8A A;  4UVC B;  4MFP A;  3ZMT B;  3K3N A;  1G8X A;  5JDF A;  2K9A A;  4DBQ A;  2GK9 A;  2V7L A;  1S35 A;  5EBV A;  4EVY A;  1LRZ A;  2Y6X A;  4KSA A;  2PR1 A;  2WPX A;  1MND A;  2XUE A;  2DXQ A;  3FXD B;  3TTH A;  3MKD A;  2C27 A;  3TKL B;  4Y49 C;  3Q2M A;  3JC6 D;  3I0O A;  3KVA A;  5L3C B;  3G8W A;  3CQG B;  2I59 A;  2PFV A;  2BEI A;  4YJ2 E;  3PUQ A;  2ZW7 A;  3ETU A;  4I55 E;  3MAC A;  2Q0Y A;  4F0Y A;  3A9L A;  3VHL A;  5C8Y E;  2O28 A;  3TO6 A;  2Z11 A;  3IWG A;  2LEH A;  2B4B A;  5F46 A;  2VQY A;  4CGM A;  3R9E A;  3FXT A;  4JEU B;  2REE A;  2WWU A;  4KUA A;  2HH7 A;  3C26 A;  5G1Z A;  2A3D A;  2HPJ A;  1S3Z A;  2CMR A;  2JMK A;  5KTC A;  2R7H A;  3T90 A;  1VKC A;  1WK4 A;  4GIW A;  2CWO A;  1SHZ C;  2NP9 A;  3I9S A;  5JDG A;  4ONU A;  4UV9 B;  1NWM X;  5F47 A;  3N5L A;  2HV2 A;  4H9P C;  3AA7 B;  4PAG A;  2I00 A;  1M44 A;  4O4I E;  3EXN A;  4MAL A;  4XZC A;  2A4N A;  2E9X D;  4C7H A;  4H9O C;  2ZPA A;  1X79 A;  5C82 A;  4UF0 B;  5AG6 A;  4CYP A;  4MI4 A;  4PFO A;  5I0C A;  2Y8D A;  4I49 A;  1VRB A;  2H7O A;  3KBT A;  4JLE A;  3V8I A;  3O9X A;  3D3S A;  2ZM2 A;  2P6E A;  4IF5 A;  3RRC A;  4U9Y A;  4X1Y E;  3HA4 A;  4OYJ A;  2X51 A;  3R84 B;  3HL6 A;  3VKH A;  2D0U A;  2LE8 A;  5L3F B;  3F57 A;  2WMO A;  3D0T A;  4YRH A;  4Q38 A;  4CAV A;  4KOV A;  5EK3 A;  3N7Z A;  1IAP A;  1RO5 A;  3RC3 A;  4CI3 B;  3S6F A;  3KV5 A;  1QSR A;  1TIQ A;  5FY1 A;  2R8V A;  5CA1 E;  3LOD A;  3P8C D;  4GS4 A;  4E7Z A;  2Z3P A;  2FXF A;  2RP4 A;  2PJQ A;  4M1P A;  3UFE A;  4A30 A;  3I9W A;  4R3L A;  3KV6 A;  3TE4 A;  2L8K A;  3CML A;  3T9Y A;  4A56 A;  4IST A;  1QST A;  4ZS3 A;  4B10 A;  3C64 A;  4MFZ A;  5LGU B;  2OA5 A;  4QB9 A;  4PJN A;  3HI2 A;  3GKR A;  3P2H A;  4JEH B;  3EY5 A;  3AAA B;  4UF0 A;  1D1B A;  5L3B B;  1US7 B;  4HKA A;  3JC6 C;  2ZW6 A;  4KVO E;  3ZMS B;  4DNC A;  4CGL A;  5JVD E;  3HR0 A;  3RH3 A;  1V0C A;  2E8I A;  2D4P A;  2YNE A;  2AE6 A;  4PFP A;  4MY3 A;  4H89 A;  2I79 A;  1S94 A;  2QIR A;  1LVK A;  3DJB A;  3AAI A;  1QSD A;  2NTY A;  2W61 A;  4U5Y A;  4PK6 A;  4PV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...