1LRZA

X-ray crystal structure of staphylococcus aureus fema
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
412
structure length
400
Chain Sequence
MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Staphylococcus aureus FemA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic inhibitor
molecule keywords factor essential for expression of methicillin resistance
total genus 137
structure length 400
sequence length 412
ec nomenclature ec 2.3.2.17: N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N(6)-glycyl)-D-alanyl-D-
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02388 FemAB FemAB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1lrzA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA02
1QSRA 4QUSA 2PDOA 3I9SA 1S7LA 1IJ5A 3FXEB 1XIXA 1S7KA 2ZW4A 4B5PB 5F47A 5C82A 3FYNA 3CVRA 1S7NA 5IB0A 1UFHA 2X7BA 4U5YA 3RYOA 2X9YA 3ZJ0A 1YREA 2D4PA 2FS5A 1WWZA 2BUEA 3S6FA 4MI4A 3P2HA 3BLNA 3D8PA 3DNSA 4UA3A 2GIVA 4ONUA 4KLVA 1CM0A 1ZKEA 2HUZA 1I1DA 2X9XA 4LUAA 1M4GA 2CY2A 4XPLA 4CAWA 4OLLA 4J2CA 5HH1A 2OB0A 2Q44A 4I49A 3FNCA 3SXNA 4DNCA 1Y7RA 3EXNA 4H6UA 4QC6A 3MGDA 3GY9A 1KUYA 2CNMA 4NXYA 4MJ8A 4DNDA 4UWIA 5GCNA 1P0HA 5F48A 2FIAA 4CAXA 2FCKA 3BJ7A 5E96A 5EBVA 4MY3A 1YVKA 2FT0A 2IL4A 3W6SA 2Q04A 3L3PA 1S3ZA 2OH1A 4U9YA 1I12A 4NCZA 2PC1A 1BO4A 4FD6A 3FBUA 4KVME 4R57A 2QMLA 5KTAA 2Q4YA 3R9FA 2X9WA 2G0BA 4KOTA 2IC6A 5CNPA 2OU2A 4JXQA 2JLMA 1B6BA 2R8VA 1TIQA 4H89A 1S60A 3N7ZA 3TO6A 2REFA 4F6AA 5IX3A 2B5GB 3TKLB 3B8GA 4NEXA 5JPHA 5H84A 3S4UA 4KLWA 1IICA 4XNHB 2ZPAA 2OZGA 3SHPA 2REEA 2I79A 4XPKA 4PV6A 5IV0A 4AVAA 3R95A 1P4NA 1QSMA 2R1IA 3MXZA 3EC4A 3F8KA 2VXKA 3NE7A 4Y49C 1QSDA 2G3TA 1LVFA 5FVJA 1MJBA 1BOBA 2VI7A 1FY7A 3QUJA 4MBUA 1KUXA 4U9ZA 4UWJA 4OAEA 3JVNA 1YX0A 1RXTA 3R1KA 3DR8A 4HKFA 2J8MA 3T9YA 3ZZIA 1LRZA 3G3SA 2FXFA 1Q2CA 4GS4A 4JWPA 2PR1A 4YFJA 3LODA 2I00A 1S7FA 2GANA 3P7IA 4AVBA 1U6MA 2C5JA 3TCVA 3S6GA 1WK4A 2ZW5A 3PZJA 1S5KA 2KWIB 1IYKA 2P6GA 2WPXA 5DWNA 4L0RA 2H5MA 2R7HA 2DXQA 4MY0A 1YGHA 2CA5A 3TO7A 5I0CA 3R96A 4KOSA 4J3GA 5F46A 4II9A 2P6EA 4PK2A 4JLYA 2A4NA 2C27A 4R3LA 2G0UA 2VBQA 1MJ9A 2KCWA 4L8AA 3IGRA 1RO5A 4FD5A 4XPDC 3FIXA 3QAHA 4AB7A 4H6ZA 4HNWB 4JJXA 4B6XA 2R98A 1Q2DA 4JXRA 4YGOA 3SXOA 4KOVA 5KTCA 3GKRA 4YRHA 4R9MA 4IF5A 2JDCA 1VKCA 3TFYA 1ON0A 4FD4A 1M44A 3FRMA 3CXQA 1MK4A 3P2FA 1M1DA 4QVTA 5KTDA 2G3AA 2ZW7A 2ARHA 2PRBA 4NF1A 5ISVA 1KUVA 2EVNA 2ZXVA 1K4JA 2J8RA 3CKDA 4HNXB 3E0KA 3S6HA 2J8NA 2FIWA 4KOWA 4NSQA 2VQYA 2HQYA 3DDDA 4KZTA 2MBGA 1YR0A 4PK3A 1Z0PA 2O28A 3PGPA 4QB9A 4JD6A 5DWMA 2Y0MA 4XPDB 4R87A 3T90A 3QK6A 3DR6A 1Z4EA 4ZBGA 4E0AA 4KUAA 4F0YA 1QSOA 4IUSA 2Z0ZA 4PSWA 1M4DA 2K5TA 2PR8A 1IB1E 2QECA 3FXTA 2OZHA 3I3GA 2GE3A 4AVCA 3F5BA 4CQIA 3G8WA 2F5IA 2P6FA 4LX9A 2K48A 1YLEA 3D2MA 1YK3A 2B4BA 3UY5A 1KZFA 1M4IA 2FSRA 1R57A 1H7CA 4RS2A 2XTLA 1OZPA 3K9UA 4MHDA 1XE4A 3GYAA 3CXPA 1J4JA 1QSNA 4OADA 3WR7A 2RC4A 1GHEA 4QBJA 3R9GA 3DSBA 2C5IT 5JQ4A 5H86A 4KVOE 3H4QA 4PSXA 4B5PA 2Q7BA 2VEZA 4L89A 2WPWA 3EFAA 4AG9A 4CRYB 3IWGA 4FD7A 5EC4A 4EVYA 3V8IA 2B58A 2QIRA 3PP9A 4KOUA 2JDDA 1Z9UA 4M3SA 3N5LA 3TO9A 1V0CA 2CNTA 4M85A 1YVOA 4RI1A 2B4DA 3QB8A 3BJ8A 3FB3A 2B3UA 2P0WA 3KKWA 1CJWA 1Y9KA 2B3VA 2B4DB 5HMNA 2IC9A 3TT2A 1XMTA 5F49A 1NMTA 4CRZB 4AG7A 1B87A 2EUIA 1XEBA 2ZW6A 1IIDA 4CS0B 2PSWA 2NMTA 1IYLA 4EYYR 3D2PA 3D3SA 2Q4VA 5C88A 1VHSA 1QSTA 2PQ8A 2OZUA 2Z10A 3VWEA 3OWCA 2ATRA 4KVXA 4KOYA 4HNYB 2B5GA 2JEVA 1Q2YA 1SQHA 3C26A 3EO4A 3FXDB 2BSWA 4XNHC 3VWDA 2FL4A 2CNSA 5J8FA 4ORFA 2AE6A 2FE7A 4B5OA 2VZZA 1IJ6A 4K30A 4CAVA 1XF8A 1NE9A 2BEIA 4UBRA 3TTHA 1MJAA 2D4OA 3TOBA 4R3KA 2VZYA 2C5KT 1Y9WA 4KORA 4Y49B 2Q0YA 4X5KA 2KWHA 4E2AA 3CXSA 2BL1A 1L0CA 3LD2A 3TOAA 1N71A 3W6XA 4KUBA 4E8OA 1NSLA 2Z11A 3EY5A 4FI5A 2AJ6A 3F0AA 4BMHA 1PU9A 3R9EA 3S6KA 1I21A 3W91A 2HV2A 3JUWA 1PUAA 5J8CA 4KOXA 3TE4A 1Z4RA
chains in the Genus database with same CATH superfamily
4YY3T 3H37A 4AIUA 3F57A 2HPJA 2GLFA 2OR4A 1TKFA 3GA8A 4IHJE 3X1DA 2IW5B 3UUXB 3EI0A 4H9NC 2NW8A 3BQLA 4PJLA 2BS3A 3TLUA 3UFGA 3GB0A 5KXJA 1CUNA 2X7BA 4H9QC 3ZJ0A 3D7GA 1YREA 2FS5A 3IJ3A 3DGVA 4MFZA 1IAPA 2CRBA 4UA3A 2WB5A 2KT9A 1G73A 1UCUA 2VKOA 5AQHB 2WCAA 3IWEA 3UU4A 4NPPA 4BJNA 2DEAA 2W2UA 4ZI7E 4O8SA 3MKDA 1I1DA 4LUAA 1M4GA 4PK6A 3MACA 4YSZA 4JI8T 2Q44A 4I49A 1YSJA 3ZYLA 3BHXA 4BAYB 3B5MA 2ZEGA 4I4TE 2F4VT 5G21A 2Q9QD 1IOIA 1HX8A 3MGDA 3TLWA 2Z3NA 3GY9A 2CXFA 4ZGYB 1N34T 2PTFA 2XEGA 2ZEPA 4X8IA 2E5LT 1D1AA 4JI4T 1CP6A 4UWIA 3I0QA 3H8GA 3N9NA 3B3CA 2SPCA 2FIAA 4CAXA 5FVKA 2VKHA 2YNEA 5AG5A 1U5PA 4F8HA 4DBQA 2CWOA 4LF9T 3PB9X 4ZY2A 1YVKA 3IEEA 2FT0A 3GLJA 2Z3MA 2I3CA 3W6SA 2Q04A 2OA5A 2CXLA 3OYZA 5ABGA 4NCZA 4OK0A 2W00A 4TUYE 2JQQA 2Z3PA 3RIUC 4KVME 4R57A 4RN7A 3D7DA 2QMLA 1WRDA 2V8GA 3AE1A 2VQFT 2X9WA 2AFUA 2IC6A 2J4GA 3B3SA 3GMIA 3SOLA 4JXQA 3BQKA 2JLMA 2R8VA 1XJOA 2HB6A 2PJBA 4GOUA 3N7ZA 4X2TA 3TO6A 4F9VA 2C6CA 1YXRA 1KK7A 4TV8E 2AFZA 4ILAA 3EVYA 3VRBA 2E9XB 2I79A 5CBMA 3KV9A 2LT3A 3P8CD 4WBOA 5KDMC 2V8HA 2WBLA 5HWXA 5IV0A 4AVAA 5JREA 4AQGA 3R95A 2ACZA 4P4DA 3PUVF 4ZY1A 3EC4A 4EEBA 4IK2A 4GM5A 1MJBA 1BOBA 1TKJA 2BG9E 2XQ6A 4K0KT 4TWFA 1W0AA 1DU2A 1GQEA 3IF8B 4HN9A 3JVNA 1YX0A 5CPAA 4HKFA 2Z6EA 3ZZIA 4LF8T 4PXDA 3G3SA 4NGTA 2PR1A 2YDSA 5EK4A 5LRJA 4NJRA 1D1BA 2KNDA 2AFSA 4UR9A 3ZYKA 1IY7A 4X20E 4Q7AA 4AVBA 1DE4C 3WC6A 5IHYA 4YTNA 3PU8A 3E22E 5LHGB 4LMKA 2ZW5A 2YEVC 1HEEA 2KWIB 5DABA 2PJ7A 4PJMA 2PE3A 4MMOA 3RI5A 2IUBA 4CI1B 4UIBA 3I9YA 2WPXA 1Y0RA 4HPSA 4PPZA 3CZXA 2PVVA 2PBIA 1H8LA 3GIUA 4WZXA 3PUAA 4ERRA 3QOFA 4X1IE 2P6EA 3IIBA 5J1GA 4EWTA 4ZXLA 2NR4A 2RB7A 2XQ5A 2C27A 2G0UA 2WZIA 1LAPA 2BVMA 3LFMA 4JYAT 3EABA 1FIOA 3AB3B 4CGMA 4R76A 4OC5A 1VIXA 5AQMB 4X66T 3T8WA 3KQXA 5EMIA 3IFEA 1Y64B 2VQET 2ZEDA 3PU3A 4PAGA 1AYEA 2CXDA 3WC7A 4N78D 5LOVE 1DTDA 4ZZCA 4YRHA 4IF5A 5HCJA 2JDCA 1VKCA 4JBWF 4FD4A 4IT4A 3HUVA 5H6RB 2WQYA 3FRMA 1XNRT 2FJAA 1LAMA 1QLBA 3OKQA 3CXQA 1BR4A 2YOEA 2D2SA 4WNKA 1WLXA 1X79A 5HXRA 3KVBA 3P2FA 4QVTA 4YSYA 2ZEOA 2CHOA 1GYTA 3IU1A 2HHHT 2PRBA 2M6IA 4NF1A 1KUVA 7CPAA 3LK42 2J8RA 4UCNA 3CKDA 2A9UA 3HI2A 3S6HA 5FMNA 1D1CA 2XAJB 2QA7A 2BKPA 2GK9A 2VQYA 4KOWA 2D5UA 3FHNA 3CPAA 1YR0A 2XQ7A 2CIJA 5K8NA 3FECA 4QKNA 5LNKA 5FKYA 4P6YA 4ZBGA 5EK2A 4EB6E 2CLYB 5LYIA 2L8KA 3N2GE 4HTEA 1N36T 2XQ8A 4ZY0A 4IL4A 2V6YA 3I3GA 2WZNA 4LX9A 4IAVA 1YLEA 3O1JA 5LYJE 1YK3A 8CPAA 1KZFA 2FSRA 3QAYA 1R57A 2XTLA 4DVDA 2PJQA 5AQKB 1OZPA 3K9UA 4MHDA 4OYJA 3RZAA 4OADA 3WR7A 2LHNA 3L2NA 4KMCA 4Z90A 2MOZA 5FXZA 1GHEA 2LKHA 4NJQA 4B3RT 3A9LA 5THWA 5JQ4A 3AE6A 3H4QA 2ZM2A 5EK3A 3P4SA 4B5PA 2F7VA 5AGEA 3EFAA 1D0XA 4AG9A 4TZ4C 4F9UA 5LYDA 4FD7A 5EC4A 3CIRA 3V8IA 2QIRA 5AQIB 3D7FA 1SHZC 5LHIB 1X10A 3S9LA 3HA4A 2I59A 2DLRA 1XZYA 3VRAA 3AEGA 3VARA 4AISA 3QB8A 4ZI6A 4JI7T 2VL8A 5TAOA 4O4HE 4AKLA 3KKWA 1CJWA 1IBKT 2UUBT 5IB9A 3N9LA 3ZJ1A 5HXCA 5F49A 5GONE 5HXDA 4LMLA 4A32A 4OC2A 1IIDA 3RYIE 1AMPA 5FXWA 3D3SA 3VH9A 5HAXA 2DNXA 3SJEA 1ZO0A 3UULA 4DUZT 3VWEA 2IIUA 3OWCA 2LM9A 2ATRA 3MRUA 2UXXB 4KVXA 4ZI2C 4KOYA 4PK4A 2XAFB 5A27A 2ZM0A 4DMWA 2JEVA 2J62A 2VL0A 3EO4A 3ONJA 5LBMA 3VWDA 3SI1A 4HFEA 5J8FA 4F8ZA 4U2YA 2HN2A 3ZCIA 3KBUA 4H9OC 3ZSSA 2LRKA 5JDMA 3NH8A 3RF1A 4B5OA 4HGAA 4LQ6A 2VZZA 1IJ6A 4NIQA 4GKJT 5HYAA 1E7PA 4CAVA 4Q36A 1XF8A 1CPXA 3RYCE 2H89A 1NE9A 1EE3P 2LRLA 4UBRA 3AA6B 4AKGA 2D4OA 4R3KA 4K0UA 4C2ZA 3WT4A 4X65T 4H9RC 2V5CA 4CGPA 4X5KA 1MNDA 4QHOA 4E2AA 1IGBA 1L0CA 2X67A 3WAJA 3DJBA 3TOAA 5HVFA 2YNCC 1N71A 3FH4A 4KUBA 1S35A 2V7MA 2RA1A 4L9IA 5JDGA 2YINA 2J9AA 1BPNA 3AVSA 4G1PA 3RX6A 4WBNE 3BK9A 4EAHA 3R9EA 3S6KA 4TNWA 2V8SV 1XMQT 5K8MA 3RYHE 1G8XA 4PFOA 3NH5A 4PXEA 3FZKB 2GFQA 2ZENA 5J8CA 3TE4A 1FMVA 4P45A 1KNRA 1MIVA 4QUSA 4QH1A 3OJAA 1YQEA 1WR6A 1YKHB 1IJ5A 3FXEB 1XIXA 2PJ5A 3EAMA 3BXMA 5C82A 4CN1A 5CA1E 5J1QA 5IB0A 3O1IA 1FNOA 3FEEA 3RYOA 4MCPA 5DS0A 1BLLE 3BLNA 3D8PA 5FNVE 5HXHA 4DJLA 4KLVA 4IHMA 1CM0A 1ZKEA 2XHEB 3H5ZA 2X9XA 2WDVA 3CWZB 4M6IA 4A5XA 3CX6B 4OC0A 4CAWA 4J2CA 5HH1A 2WS3A 3SXNA 3FNCA 2ANPA 3ZMVB 3PURA 5JH9A 4U31A 4UEZA 4H6UA 4AQFA 3N2KE 2LHRA 1KWMA 4B3ST 3ZMTB 3N9OA 5AQPB 4WWVA 3JAFA 2EO8A 4MHNA 2NYQA 4PXBA 3RLFF 3U3IA 4MJ8A 4HFVA 3LDQB 3RPUA 1P0HA 3TLSA 4X1YE 2XPKA 5E96A 3D67A 4EOZB 2PIZA 3B7IA 3L3PA 5JDLA 2UXNB 2V6YB 3KHXA 3PDYA 4DR5T 1QQ9A 3PBEA 3IHRA 1BO4A 2Z3LA 1NENA 5KTAA 4PW8A 1KNZA 2Q4YA 5JM6A 2G0BA 3C4XA 5CNPA 4A39A 2LSYA 5FVLA 5A28A 2NWBA 1R8IA 4MALA 3R6NA 1QUUA 1Y7EA 5ETWA 3DTOA 4MCSA 4F6AA 1JWQA 4NGNA 3TKLB 4NEXA 5JPHA 1BAVA 3ZN1B 2JQ9A 4QWNB 5H84A 4IE5A 2ZPAA 3IO1A 2OZGA 3SHPA 2REEA 1MMAA 3OYXA 2C1CA 4MFRA 1UGOA 5LA6E 4O2AE 4YLHA 3UQ7A 4TWDA 3RQUA 3LSVA 3MJXA 4HFDA 1P4NA 3H3AA 1OEDC 2AE9A 1QSMA 4Y49C 3JADA 4CYOA 2G3TA 4P4FA 4O2BE 4NXNT 2PJAA 3P4PA 2WAUA 3RHWA 2VI7A 4TN7B 4IDNA 1I94T 1HF8A 2K3WA 4P0AA 4PXCA 2V26A 2DCFA 5C3JA 4OAEA 2PJ4A 3LACA 3UU6A 4U7YA 1X9BA 2E9XD 1OEDA 5ABFA 2FUPA 2CTCA 3LMSA 4GS4A 1HX1B 1ZG7A 3AVRA 4YFJA 4NGMA 4KSIA 4UFXA 2R6GF 1MMNA 2KSRA 3C51A 2GANA 3N9QA 4E7ZA 3IU2A 4JI0T 2IJZA 4X3RA 1XOVA 2NSMA 3TCVA 3RAMA 4DO0A 2X0LB 2JRKA 2BBJA 1WR0A 5JRCA 1VRBA 4ZI3D 1LCPA 4QXHB 3AXJB 2AFMA 2DWGA 4O23A 2W66A 2YU1A 5IUXA 2R7HA 2DXQA 1YGHA 2XJ7A 5FY0A 2V7IA 3A8YC 3R96A 2O4HA 3C98B 4II9A 4MHZA 1LANA 2E9XC 2QVAA 2YDRA 1ZG8A 2EHOA 3LJCA 4DMVA 3CK6A 4XZCA 3UT5E 2D0TA 1RO5A 3N5FA 4DUKA 3SI0A 4NGPA 3FIXA 3QAHA 3K8PC 3CQXC 4O4IE 5DQWA 4ANJA 2V8VA 4JJXA 1SE7A 4NGRA 1Q2DA 4QH5A 2XQ9A 5KTCA 1YMEA 1R43A 4R9MA 3TFYA 2ABZA 5C8YE 2LLYA 3SFEA 2ZEHA 3FBLA 1LVKA 3Q9DA 2BG9A 5KTDA 2G3AA 4CN4A 4JZ0A 4F6RC 4DV6T 1YW6A 2ARHA 1XNQT 3K9TA 2IQ6A 5LHHB 2EWBA 2ZXVA 3PUGA 1HDQA 1K4JA 4UCPA 4X62T 5HCMA 4NGQA 2HQYA 2WMOA 2XUEA 3DDDA 4KZTA 4QB9A 1Z0PA 3PGPA 2PJ2A 2BZBA 5DWMA 1IZNB 5JDNA 4MCQA 4XPDB 3ZC1A 4R87A 3DR6A 4BA9A 2XQ3A 4E0AA 2N2NA 5IWAT 4KUAA 4CGNA 1KNPA 4F0YA 2Z0ZA 2WDQA 3FXTA 4EZHA 2GE3A 3F5BA 4UELA 4DV4T 5L3DB 3G8WA 4A37A 4A2ZA 4AKIA 2K48A 5KX5E 2C0SA 4JEUB 4LQGA 3ABVA 1M4IA 3K1SA 4MHCA 3PE0A 3CT9A 2IMOA 1QSNA 1ZOYA 3FZLB 2BCOA 2WUUA 1TKHA 4P0BA 3B3VA 3VU7H 4TWEA 1JQGA 3DSBA 4RUHA 5FL0A 4ZX9A 3AA7B 2BS2A 4PSXA 4K3NA 5AQJB 2V77A 1FT7A 3KR4A 5JDQA 2CMRA 4HWHA 4CRYB 3IWGA 1VCTA 4JEHB 1Z5RA 4TX5A 2OLTA 5L3BB 4OYKA 1ELMP 5LCYA 2V7KA 4KOUA 1Z9UA 4A30A 4OC3A 2VK9A 4M85A 1YVOA 4L5GA 2A72A 3FB2A 2UXCT 2LKGA 3KDSE 2B3UA 5JRCB 5K8OA 3NA6A 1CX8A 2WSSV 4DR3T 3TT2A 4ZEYA 1XMTA 1F2PA 4AG7A 1A2ZA 2FVGA 2EUIA 2VL1A 1XEBA 2ZW6A 4HE8A 4CS0B 4AXPA 2NMTA 2V8DA 1IYLA 3JTKA 5JGFA 2Q4VA 2WU2A 2W63A 3T1HT 2OV9A 3QB5K 3TC8A 3PUSA 5FYMA 2EHOC 2Z10A 5L3FB 1LKXA 5K8PA 1XDPA 2CE7A 2BBHA 5AQFB 4HEAA 4H9PC 2GLJA 2KLQA 4FJOA 3C26A 3RKGA 3PUYF 2ZMAA 4XNHC 2MPKA 2CNSA 2YGWA 3LWUA 2BS4A 4ORFA 5HEGA 4WYVA 2AE6A 3FZFB 3AEDA 3GWHA 2UXBT 4I0UA 3L09A 2ZEFA 3RKOA 3V5SA 4EXTA 3KINB 4IE0A 4YTMA 3FVLA 4BJMA 4OIDA 5CA0E 2Q9QB 4B14A 4IE4A 3D68A 5AG7A 2ZOGA 2QGSA 3MK7C 4COFA 3FX6A 4GYRA 2Q9QA 5LGNB 4P10A 3MN8A 3HKCE 4U72A 2BL1A 3J7Yq 5EZYE 3D66A 3PB7X 4MFLA 5LYFA 3W6XA 3VKGA 2LJLA 3JAEA 2Q7SA 2AJ6A 3O9XA 3UUMA 3KHZA 1I21A 3WI3A 3W91A 3MA9A 4A95A 4HFBA 4KOXA 1QSRA 4EIWA 1KFYA 5L3EB 2PDOA 3I9SA 4UFWA 3RGLA 1S7LA 5G20A 3PUZF 1Z8UA 5J0ZA 4KSAA 3KVAA 4B5PB 1EZ3A 1E2AA 2BG9C 3OVUA 3I1AA 3LK2B 1S7NA 2HH7A 5DJQC 2KZ7B 4KX6A 5G1ZA 4E7SA 4R6TA 1BR1A 4P09A 3N2OA 1UFHA 4DUYT 3C64A 2IHR1 3D0TA 4CYPA 2JMKA 1WWZA 3ZT7A 2BUEA 4MI4A 4Z8XA 4DBRA 4CYNA 1NEKA 4AI6A 2DF5A 4O4LE 3DNSA 4CAEA 3ONXA 4ONUA 3NWIA 2Q43A 4A33A 4KP3C 3ZMSB 2XZEA 2HUZA 3A7MA 1Y01A 1XWMA 2BKOA 4HFHA 1OEDE 4XPLA 5D29A 5BMVE 5CFBA 4JUYA 4LFAT 3KV5A 3DLJA 2J47A 2PVWA 1ARMA 2YU2A 3KZWA 2JQHA 2MYSA 4TV9E 4QC6A 4DV0T 2UUAT 4IE6A 2OOTA 5AG4A 4B6ZA 4H63V 2WWUA 3ZEFB 2CNMA 3E0ZA 4X5TA 3RIAA 4NXYA 3HR0A 2QYVA 4JV5T 5GCNA 3AEAA 2KXPB 2CF4A 3S9NA 3CQCB 1ARLA 4MFQA 5F09A 4HWDA 3UUBA 3E08A 4MY3A 2NOXA 3LG7A 3C4WA 1US7B 4HFIA 4LMJA 4CI3B 4AQFC 3JC6C 1S3ZA 2JBJA 4UF4A 4U9YA 2RP4A 3N9MA 4W9YA 1UUSA 4FD6A 4B3MT 1VCSA 4HKAA 4KHZF 4YT0A 3FBUA 2MAWA 2HC9A 4OFZA 4FBEA 4KOTA 4YJ3E 1N33T 3D4UA 2LE8A 3GN5A 5I4MA 3Q5WA 1TIQA 5LP6E 1UWYA 3F31A 2CBIA 1WYCA 1S60A 3P4QA 3KFWX 3B8GA 1TXRA 2BDEA 3B2YA 2CTBA 3KQZA 1OWAA 1FJGT 5J2TE 4CXWA 2M67A 3AEFA 2PJ8A 3NH4A 1KF6A 2FBWA 3ZMZB 4KS9A 2JPFA 3EHZA 2R1IA 3MXZA 4YSXA 2VXKA 3NE7A 2UU9T 3AEBA 2CCQA 2PCUA 3IA3A 1HFAA 1T72A 2JMHA 3SJXA 1OXZA 2IMLA 4LF7T 3K2KA 5ADXL 1VGYA 3ZT5A 2W61A 1WCRA 3AXJA 3V7ZA 2AFXA 3QUJA 4MBUA 4B12A 4C90A 1KUXA 4U9ZA 3ZMUB 1VOMA 2YDQA 2W0GA 4X1KE 4ZI2D 3DR8A 2JJ9A 3T9YA 1ZLIA 2YKSA 2W67A 3L39A 4MFJA 1LRZA 3ETUA 3J9X1 3ZYMA 2FJBA 2FXFA 4UV8B 2LM2A 1XDOA 4U74A 2Q4ZA 1HCIA 3LODA 1HG5A 2I00A 4A56A 3Q5DA 3A5XA 3P7IA 2X68A 5LXTE 3K3QC 1Z8WA 4P4IA 3V5UA 1SUMB 3EUHA 4GK5E 2C5JA 5JR9B 3TLTA 5L4EA 2XAHB 5JH7E 4JYWA 2WM9A 1WK4A 3KL9A 2WYRA 3PZJA 3K3OA 2QYWA 3BQIA 4EGWA 2ZEMA 1IYKA 2UUCT 2P6GA 3O1HA 4Z91A 5DWNA 4L0RA 4G2AA 1W9RA 1R3NA 4LF6T 3PUXF 2CA5A 4OX9T 4B3TT 3AAAB 3PJAA 2PJ6A 3SFDA 2H7OA 4KOSA 1YQ3A 3L8RA 5F46A 4JLYA 5L4HA 4A94A 5AQLB 2NP9A 2A4NA 3JC6D 4CGLA 2PRQA 4LF5T 2KCWA 3KV4A 2BKNA 2WZHA 5J2UE 5AQTB 3WAKA 3N9PA 4I50E 4UFVA 2H88A 4AB7A 4V1Av 2H7VC 5CB4E 3RH3A 4H6ZA 2KINB 5AQNB 3PB6X 4P4EA 3AE3A 4GKKT 4YJ2E 2BOAA 4YGOA 2PJCA 1TF8A 4KOVA 4QH4A 3KGQA 4P1NA 2WU5A 1AJ3A 2HPLA 1T7SA 1ON0A 3FF3A 4PJNA 3SI2A 3KV6A 3ZC0A 3VR8A 4YFSA 4DV5T 1M1DA 2ZW7A 4DV2T 4EMEA 4UV9B 4HWFA 4AKRB 2Y6XA 2BG9B 1MIYA 4B10A 1YW0A 5LG3A 4IDQA 1IBLT 1LOKA 4HNXB 3E0KA 2E8IA 2WDRA 2XSBA 4U2ZA 2J8NA 3OBVE 3CX8B 2FIWA 2MBGA 4WW0A 4JD6A 2J1DG 3NRXA 1QMUA 3T90A 2ZOFA 1Z4EA 3NZQA 2O53A 1D0YA 4IUSA 4CI2B 2V5DA 2ZLYA 3CMLA 3W15B 1M4DA 2QECA 5AQUB 5KMGP 4G63A 1ZEEA 4AVCA 4CQIA 4FAIA 3P4RA 2F5IA 2P6FA 2FJDA 3AE2A 4CN6A 3PBBA 1VHOA 3S9MA 4GK0E 2B4BA 4A97A 1H7CA 3ANWB 4CYQA 3GYAA 4ZS3A 1J4JA 3CXPA 2JEWA 3Q5EA 1UK5A 4YXDA 3KBTA 2BO9A 4MFPA 3R9GA 5F5WA 1Z8XA 2C5IT 2WSAA 5H86A 3EDUA 1ZLHA 2X0HA 4TWHA 4C2XA 4UVCB 2Z3OA 4L89A 4UCMA 2WPWA 3BI1A 1HNXT 4YTPA 3SS1A 2E9XA 3NE8A 3AE8A 1CPSA 2CBJA 2JDDA 3B13A 4M3SA 3RNZA 3N5LA 3VKHA 5HEJA 2CNTA 3LBXB 4RI1A 2B4DA 4LF4T 3CQGB 5DQVA 2JBKA 3BJ8A 3FB3A 2V6XA 3C4ZA 4OHFA 2P0WA 4EEDA 2EHOB 4ASKA 2IC9A 1NMTA 4CRZB 1YW4A 3RC8A 2Z3KA 5ABFB 4CXYA 4MHYA 3NVOA 2PSWA 4UXNB 4EYYR 5BWAB 1UX5A 2UXDT 3B35A 5AQOB 2G9DA 1VHSA 1QSTA 5HEOA 4Z65A 3I0OA 3BI0A 5FXVA 1X12A 4EFDA 1XMOT 4UF0B 4ILUA 2X0YA 4NFRA 4HNYB 5AQRB 3SRZA 1Q2YA 3PB4X 3FXDB 1HNZT 4FWUA 2FL4A 4QX8B 5F3JA 3JRUA 3GN5B 3ISZA 2PFVA 2Q51A 2FE7A 2LOPA 5E0OA 2IAKA 3RO0A 2XM1A 5LGUB 3PB8X 3B3TA 1J5WA 5LMNT 2XEFA 5JQGE 2AXDS 2Y8DA 3HL6A 1PCAA 4K30A 5L2LA 2EK8A 3P4WA 2E5VA 4M6HA 1S94A 4C68A 2VZYA 2C5KT 2K5BB 3T1YT 3FMCA 4KORA 2POKA 5AG6A 4Y49B 2RPAA 3QB5A 4QX7B 3FEDA 4MLKA 1TF9A 1CBXA 6CPAA 3LD2A 4GYSA 3VATA 5JDHA 4DR7T 1B7TA 2VVNA 1BR2A 4MFKA 5AQQB 4A98A 3ZSTA 4DIDB 3KASA 1NSLA 4E8OA 3EY5A 4MBQA 4FI5A 4WJBA 3F0AA 2YNDA 5ABHA 4BMHA 2PG8A 1PU9A 4GXHA 4ZS2A 3RC3A 3QNVA 3AA0B 4KSFA 4O4JE 5C2TA 4FUUA 5G22A 4OC4A 4KI0F 2CEAA 3D7HA 3ETVA 2XEIA 4ZHQE 3JUWA 3NFZA 1SA0E 4EV6A 3TO7A 4J3GA 2KMFA 3UQ4A 3PV0F 2ACXA 3JCFA 1F57A 1CHUA 3CPXA 2LSJA 5LMUT 3KI9A 3RYFE 4JI3T 2D0UA 1FEWA 2ZW4A 1S7KA 2JIWA 5F47A 3FYNA 3CVRA 4DR1T 4YWYA 3PTRB 4UIGA 2I0MA 5HWYA 3ISXA 4IL9A 4U5YA 2X9YA 1IOFA 2V7LA 2VKDA 2D4PA 5HEUA 4H9SE 3S6FA 3P2HA 2XM2A 5FL1A 2D9DA 3SJGA 3UTKA 4HWIB 2ODVA 1PYTB 2GIVA 3PJAJ 2QJ8A 3AECA 1HR0T 2CWYA 3CPZA 2W4XA 2CY2A 1XFOA 3RIUA 4OLLA 2OB0A 1XRYA 5LB7B 4DNCA 4R7MA 4YHHT 3ZKRA 1Y7RA 3Q2MA 3CX7B 2NW7A 3G06A 4UVBB 4A38A 4IDOA 1J5ET 2XAGB 4IREA 2Y48B 3FZMB 3M3ZB 3ZN0B 2PJ1A 1IBMT 1KUYA 4EYUA 1MIWA 4NGSA 5AQGB 3R84B 4DNDA 2MTQA 4ONWA 2WWVA 5IYZE 5F48A 4IE7A 4CPAA 3HLPA 2FCKA 4XBFB 3BJ7A 4P4BA 5EBVA 5BR8T 2CPTA 5LYLA 1NSAA 4JI2T 2IL4A 3OTOT 2OH1A 1UX4A 1I12A 1HNWT 4I55E 2PC1A 1D0ZA 3ANWA 4TNUA 1YKEB 1YLOA 3I9WA 4U7IA 1YD8G 5JVDE 2PJ3A 3R9FA 4PNIA 5LRGA 2OU2A 4ILBA 4JI5T 3ESLA 2K24A 4JI6T 1B6BA 5HVGA 4H89A 2XY8B 4IGUA 2RFHA 2DPSA 2DI4A 4UF0A 2NW9A 2REFA 3PUQA 5IX3A 2B5GB 2CXAA 4XAXB 3DP7A 3NBXX 1V9DA 1E1HB 3S4UA 3EDVA 5FP3A 2YNCA 1IICA 4KLWA 4DR6T 4XNHB 3C50A 1XBUA 5D8NA 4YHJA 5AFUL 2N9DA 2QVPA 4XPKA 4ISSA 4R8FA 3AEEA 3MZKB 4IDPA 4PV6A 3CDXA 2VURA 3ZPOA 1NWMX 2XQ4A 3H8FA 4DR2T 4OKOA 3F8KA 3V38A 1QSDA 4DV1T 4B11A 4BINA 1LVFA 5FVJA 3IBPA 4ZI3C 1ELLP 2VB6A 1VHEA 5HVHA 5JR9C 1F2OA 3WABA 1FY7A 3Q5XA 4UWJA 4DYOA 4UVAB 3AE4A 3HKDE 5LJMA 1WYBA 1RXTA 4DR4T 3R1KA 2IDOB 2VASA 3SJFA 5JR9A 2J8MA 1J1JA 1Z2LA 4ADZA 3UUNA 2GREA 2X66A 3AA1B 5FXXA 1T8BA 2PIYA 3M65A 1Q2CA 2DWKA 4CZZB 3F2EA 4JWPA 3RRWA 2DHRA 4DV7T 4LFBT 1HDUA 2EBJA 3SWHA 1S7FA 1M4LA 2LSKA 4P4JA 3ONLC 1U6MA 3S6GA 3IEHA 3FBZA 1CP7A 1S5KA 4PK5A 4ZYQA 2C6PA 2HN1A 2P9BA 3NRYA 1OEDB 3AAEB 1L0VA 2H5MA 5F8PA 5CGMA 3P50A 4MY0A 4CXXA 5I0CA 4HWCA 1HS7A 4UEEA 4ZZBA 4PK2A 2F8HA 3NZPA 2WMNA 2K9AA 3UFEA 2A3DA 3UU5A 5L47A 2ODUA 4R3LA 4ZOLE 2VBQA 5M4YA 1MJ9A 4L8AA 3IGRA 1FMWA 2L9QA 4PJJA 4NXMT 4FD5A 2XEJA 4MHPA 4XPDC 1YQ4A 5LJNA 4U33A 4UIAA 1ZP0A 1T98A 2CHNA 2ZM6T 1U4QA 2ODFA 2PJ9A 5JDFA 4HNWB 2A2FX 4QXBB 5JTGA 3IC1A 5L3CB 4B6XA 2R98A 3I1UA 4JXRA 1UURA 3SXOA 2EHOD 5HEHA 3GKRA 3WC5A 5LBQB 2V7JA 4AQYT 2ZM8A 1I6ZA 1M44A 3ZJ2A 1ZHCA 3T8OA 1W0BA 4GIWA 4M6GA 2JQKA 1MK4A 2NTXA 5FY7A 4NUVA 1Z8TA 2VVSA 3OPCA 5ISVA 2XSAA 2EVNA 4PFPA 3GUXA 2H3RA 4QXCB 3AE5A 4MCRA 4PQAA 4NSQA 2CLYC 3RIFA 2XASB 5FY1A 4I43B 5LG4A 2N1GA 4PK3A 2O28A 4ILCA 5ABEA 3TLVA 3ZT6A 2C6GA 2Y0MA 3QK6A 4ZX8A 1QSOA 4CAFA 3RBUA 4C7IA 4M1PA 1N32T 4PSWA 2K5TA 2PR8A 1IB1E 2OZHA 4KUMB 4U3CA 1JNRA 1XMBA 3D2MA 2YK0A 3UY5A 2LSGA 2E2AA 4RS2A 3LBXA 4KHPT 3QC9A 2B76A 4F0XA 1XE4A 2YN6A 4NUUA 1M7KA 3H8EA 4H2KA 2RC4A 2I6HA 3VR9A 4C7HA 4UEFA 2QRXA 5LRKA 4QBJA 4H63H 4KBMB 4HFCA 4C91A 4KVOE 1JNZA 2CM0A 5A1LA 2AFWA 3B57A 4JI1T 1BPMA 3NKZA 2Q7BA 2VEZA 1MNEA 2FJEA 3PRTA 4MXUA 2V1DB 5H6QB 3AE9A 2DL1A 2ZELA 3FJUA 1ZV4X 5HXSA 4AXVA 4EVYA 2B58A 2XAQB 3PP9A 2BVLA 4ISTA 4DV3T 2LSIA 2M6BA 3TO9A 1V0CA 2EK9A 1HTJF 2PJ0A 1MMDA 2XQAA 2X9HA 4OIWA 3AAIA 1Y9KA 2B3VA 2B4DB 5HMNA 3UU8A 4B13A 1AUGA 2LEHA 5AQVB 1B87A 1HG2A 4IIJE 4LFCT 4IDZA 1Q7LA 1BR0A 3PEIA 3D2PA 1WFDA 4OP4A 5C88A 1IU8A 1Y0YA 1MMGA 2PQ8A 2Q9QC 3QNUA 2L3LA 2OZUA 4Q38A 5ELYA 1O3XA 2XQYA 3H3MA 2B5GA 1OBRA 1LFWA 3KR5A 1SQHA 2BSWA 3ZCJA 5LGTB 3O4XE 3FZHB 3K3NA 2X51A 4Q25A 1M62A 3VHLA 3RQWA 3LK3B 2W62A 2AFOA 3IWWA 4JLEA 3UU3A 4TNVA 5CJ5A 2ZEEA 3AE7A 2BEIA 4YU9A 2VKJA 1NAFA 4OMEA 1Z8LA 3TTHA 1MJAA 3HKBE 3TOBA 4AKHA 3B3WA 1Y9WA 4UEMA 2ES0A 5HXEA 2DPTA 2Q0YA 2LOSA 2WP9A 2KWHA 2WY2A 3CXSA 2VWAA 4BBHA 1CG2A 3HKEE 3PUWF 4CGOA 2NTYA 3TX8A 2Z11A 4BD9A 4EZ4A 3PFOA 2B1EA 4A31A 1KEYA 3ZLIA 4P44A 1RTQA 4OC1A 3PFEA 4MRIA 3U78A 2HV2A 3RRCA 5L3GB 5AQSB 1ZG9A 4X64T 1W09A 1PUAA 4C2YA 3EXNA 1Z4RA 2GU2A
chains in the Genus database with same CATH topology
3H37A 1QSRA 4EIWA 1MIVA 4QUSA 2ACXA 3F57A 2HPJA 2LSJA 5L3EB 2PDOA 3I9SA 3OJAA 4UFWA 3RYFE 1S7LA 1WR6A 1YKHB 5G20A 2D0UA 1FEWA 1IJ5A 3FXEB 3GA8A 3KVAA 4IHJE 1S7KA 1XIXA 2ZW4A 4KSAA 2IW5B 1EZ3A 5F47A 3UUXB 4B5PB 4H9NC 5C82A 3I1AA 3LK2B 3FYNA 3CVRA 1S7NA 2NW8A 2HH7A 3BQLA 2KZ7B 4PJLA 3PTRB 5DJQC 4E7SA 1BR1A 4UIGA 4P09A 3O1IA 3N2OA 1UFHA 5IB0A 1CUNA 5HWYA 2X7BA 4U5YA 3C64A 2X9YA 4H9QC 3RYOA 2V7LA 2VKDA 3D0TA 3ZJ0A 1YREA 2D4PA 2FS5A 2JMKA 1WWZA 2BUEA 4CYPA 4H9SE 3S6FA 4MI4A 4Z8XA 3P2HA 4DBRA 4MFZA 1IAPA 3BLNA 4CYNA 3UTKA 3D8PA 5FNVE 5HXHA 4O4LE 2ODVA 4AI6A 3DNSA 3ONXA 2KT9A 2GIVA 4UA3A 1G73A 1UCUA 2VKOA 4ONUA 4KLVA 1CM0A 4A33A 4KP3C 2CWYA 1ZKEA 2XHEB 3IWEA 3ZMSB 4BJNA 3H5ZA 3CPZA 4ZI7E 4O8SA 2HUZA 3MKDA 1I1DA 2X9XA 3CWZB 4LUAA 1M4GA 3CX6B 2CY2A 4XPLA 4CAWA 5BMVE 4JUYA 4J2CA 4PK6A 3MACA 4OLLA 5HH1A 2OB0A 2Q44A 4I49A 3FNCA 3KV5A 3SXNA 3ZMVB 3ZYLA 4DNCA 3PURA 4BAYB 2YU2A 1Y7RA 3Q2MA 4I4TE 4Q38A 5G21A 2Q9QD 4H6UA 1HX8A 4AQFA 1Z4RA 2MYSA 4TV9E 4QC6A 3N2KE 3MGDA 3CX7B 2LHRA 2NW7A 4UVBB 3ZMTB 3N9OA 2CXFA 4IE6A 2Z3NA 3GY9A 4ZGYB 2XAGB 2Y48B 5AG4A 3ZN0B 4H63V 1KUYA 2WWUA 4EYUA 1MIWA 1D1AA 3U3IA 3ZEFB 2CNMA 3E0ZA 4NXYA 4MJ8A 3R84B 4DNDA 4HFVA 3HR0A 2MTQA 4UWIA 3I0QA 3RPUA 1P0HA 3N9NA 5IYZE 5GCNA 2KXPB 2SPCA 5F48A 2FIAA 4IE7A 4X1YE 3CQCB 4MFQA 4CAXA 2FCKA 4XBFB 3BJ7A 3FRMA 5E96A 2VKHA 2YNEA 5AG5A 1U5PA 5EBVA 4DBQA 2CWOA 3E08A 5J8CA 4MY3A 1YVKA 3IEEA 4EOZB 2NOXA 3LG7A 2FT0A 2Z3MA 2IL4A 3C4WA 3W6SA 1US7B 4CI3B 3L3PA 5JDLA 4AQFC 3JC6C 2OA5A 1S3ZA 2OH1A 2Q04A 1UX4A 2CXLA 3OYZA 1I12A 4U9YA 4NCZA 2UXNB 2RP4A 4I55E 3N9MA 3PDYA 1D0ZA 3ANWA 4OK0A 2PC1A 3IHRA 2W00A 4TUYE 1YKEB 2JQQA 4HKAA 1BO4A 2Z3LA 2Z3PA 3I9WA 3FBUA 4FD6A 4KVME 4R57A 2QMLA 5KTAA 4PW8A 1KNZA 1WRDA 2Q4YA 4OFZA 1YD8G 5JVDE 3R9FA 2X9WA 4PNIA 2G0BA 4KOTA 2IC6A 3C4XA 4YJ3E 5CNPA 3GMIA 2OU2A 2LSYA 3SOLA 3ESLA 3BQKA 4JXQA 2LE8A 5A28A 2K24A 3GN5A 2JLMA 1B6BA 2R8VA 3Q5WA 2NWBA 4MALA 5LP6E 3R6NA 1TIQA 1QUUA 3F31A 4IGUA 2DPSA 1WYCA 4H89A 2DI4A 4GOUA 1S60A 5ETWA 3DTOA 4UF0A 2NW9A 3N7ZA 3TO6A 2REFA 4F6AA 3KFWX 3PUQA 5IX3A 4NSQA 2B5GB 3TKLB 2CXAA 3B8GA 4NEXA 1KK7A 3ZN1B 4TV8E 5JPHA 4XAXB 3DP7A 3NBXX 2BDEA 1V9DA 1E1HB 4QWNB 5H84A 4IE5A 3S4UA 3EDVA 5FP3A 2YNCA 1IICA 4KLWA 4XNHB 3C50A 1OWAA 2ZPAA 5J2TE 2OZGA 4CXWA 3SHPA 3EVYA 4YHJA 2REEA 1MMAA 2E9XB 2M67A 5AFUL 2N9DA 3OYXA 2I79A 4XPKA 4MFRA 4ISSA 3KV9A 2LT3A 3P8CD 4WBOA 5KDMC 3MZKB 2WBLA 4PV6A 5HWXA 5LA6E 4O2AE 3ZMZB 4KS9A 2JPFA 4YLHA 4AVAA 3ZPOA 5JREA 5IV0A 4AQGA 3R95A 3MJXA 1NWMX 1P4NA 3H3AA 1QSMA 2R1IA 3MXZA 3EC4A 3F8KA 2VXKA 3NE7A 4Y49C 1QSDA 4B11A 4CYOA 2G3TA 4O2BE 2CCQA 1LVFA 1HFAA 2JMHA 2WAUA 3IBPA 4ZI3C 5FVJA 1OXZA 1BOBA 1MJBA 2VB6A 5ADXL 2VI7A 4TN7B 5JR9C 2W61A 1HF8A 1FY7A 3QUJA 3Q5XA 4MBUA 4B12A 4C90A 4P0AA 1KUXA 4U9ZA 4UWJA 4UVAB 2V26A 3IF8B 2DCFA 4HN9A 1VOMA 3ZMUB 1YX0A 3JVNA 3HKDE 5LJMA 1WYBA 1RXTA 2W0GA 2VASA 4X1KE 4ZI2D 3R1KA 5JR9A 3DR8A 4HKFA 2JJ9A 2Z6EA 2J8MA 2E9XD 3T9YA 3ZZIA 4MFJA 4ADZA 1LRZA 3ETUA 3J9X1 3UUNA 2X66A 3G3SA 3ZYMA 3AA1B 5FXXA 2FXFA 3M65A 4UV8B 1Q2CA 2DWKA 4GS4A 4CZZB 3AVRA 3F2EA 4JWPA 3RRWA 4U74A 2PR1A 4YFJA 2DHRA 4UFXA 5EK4A 4CAEA 1HCIA 1D1BA 1HG5A 2I00A 1MMNA 2KNDA 3LODA 3SWHA 3C51A 1S7FA 2GANA 4A56A 3N9QA 3A5XA 3P7IA 2X68A 3ZYKA 3K3QC 5LXTE 2LSKA 3V5UA 4E7ZA 3IU2A 4X20E 1U6MA 4AVBA 3EUHA 4GK5E 2C5JA 5JR9B 5IHYA 3TCVA 3PU8A 2XAHB 3E22E 5JH7E 2WM9A 4DO0A 3S6GA 5LHGB 1WK4A 2X0LB 2JRKA 3FBZA 2ZW5A 1S5KA 4PK5A 2YEVC 3K3OA 3PZJA 2KWIB 5DABA 3BQIA 1VRBA 4PJMA 5JRCA 4ZI3D 1IYKA 4QXHB 4CI1B 2P6GA 3I9YA 2DWGA 3O1HA 2WPXA 2P9BA 3NRYA 5DWNA 3AAEB 4L0RA 2PBIA 4G2AA 2YU1A 2H5MA 2R7HA 5F8PA 2DXQA 4MY0A 1YGHA 4CXXA 2CA5A 3TO7A 5FY0A 2V7IA 5I0CA 3AAAB 3PUAA 3R96A 2H7OA 4ERRA 1HS7A 4J3GA 3C98B 4X1IE 4KOSA 2P6EA 4PK2A 5F46A 4II9A 2E9XC 4JLYA 5J1GA 3NZPA 2WMNA 2NP9A 2K9AA 3UFEA 2A4NA 2A3DA 3JC6D 2EHOA 2ODUA 3LJCA 2C27A 4ZOLE 2G0UA 4DMVA 4R3LA 4CGLA 2VBQA 4CS0B 4XZCA 3UT5E 2D0TA 5M4YA 1MJ9A 2KCWA 2BVMA 3KV4A 3LFMA 1RO5A 1FMWA 2L9QA 1FIOA 2PQ8A 4PJJA 3IGRA 3AB3B 4CGMA 4FD5A 5J2UE 4XPDC 3WAKA 5LJNA 3N9PA 4I50E 4UFVA 3FIXA 1T98A 3QAHA 3K8PC 4V1Av 4AB7A 1U4QA 2H7VC 3CQXC 4O4IE 1Y64B 5JDFA 5DQWA 5CB4E 3RH3A 4ANJA 4L8AA 4H6ZA 4HNWB 2A2FX 2KINB 4QXBB 3PU3A 4PAGA 2CXDA 4JJXA 4YJ2E 4N78D 4B6XA 1FMVA 5LOVE 5L3CB 2R98A 1Q2DA 4JXRA 4YGOA 3SXOA 4KOVA 2EHOD 5KTCA 3GKRA 5LBQB 4YRHA 1AJ3A 2V7JA 2HPLA 4IF5A 4R9MA 2JDCA 1VKCA 4CGPA 3TFYA 2ZM8A 1ON0A 4FD4A 4PJNA 5C8YE 1M44A 5H6RB 3ZJ2A 1ZHCA 3KV6A 3T8OA 3FBLA 3CXQA 3OKQA 1LVKA 1BR4A 4GIWA 2D2SA 4WNKA 1WLXA 3Q9DA 3ZC0A 1X79A 5HXRA 1MK4A 2NTXA 3KVBA 4YFSA 1M1DA 5FY7A 3P2FA 4NUVA 2G3AA 2ZW7A 4QVTA 5KTDA 4UV9B 4AKRB 2Y6XA 4F6RC 5CA1E 2ARHA 3IU1A 2PRBA 4NF1A 1MIYA 4B10A 5LHHB 5ISVA 1KUVA 1YW0A 4PFPA 2EVNA 2ZXVA 3PUGA 3LK42 1K4JA 2J8RA 2H3RA 3CKDA 4QXCB 3E0KA 4HNXB 4UCPA 4UCNA 3HI2A 2E8IA 3S6HA 5FMNA 2J8NA 3OBVE 3CX8B 1D1CA 2XAJB 2QA7A 2GK9A 2FIWA 2CLYC 2VQYA 2HQYA 2WMOA 2XASB 2XUEA 4I43B 5FY1A 5LG4A 2D5UA 3FHNA 3DDDA 2MBGA 4WW0A 2N1GA 1Z0PA 1YR0A 2O28A 3PGPA 4PK3A 4QB9A 4JD6A 2BZBA 2J1DG 5DWMA 1IZNB 3NRXA 5JDNA 2Y0MA 3ZC1A 4XPDB 4R87A 4QKNA 3T90A 3QK6A 4BA9A 5LNKA 3DR6A 1Z4EA 3NZQA 5EK2A 2N2NA 4EB6E 4KUAA 1QSOA 4ZBGA 4CAFA 4CGNA 1D0YA 2CLYB 4F0YA 4IUSA 4C7IA 4CI2B 2Z0ZA 2ZLYA 2L8KA 3CMLA 4M1PA 3W15B 3N2GE 1M4DA 2K5TA 4HTEA 1IB1E 2PR8A 2QECA 5KMGP 2OZHA 3FXTA 4G63A 1ZEEA 4EZHA 4KUMB 2GE3A 3I3GA 3F5BA 4UELA 4CQIA 5L3DB 3G8WA 4OAEA 4AVCA 2F5IA 2P6FA 4LX9A 4AKIA 2K48A 4A2ZA 1YLEA 3O1JA 2YK0A 3D2MA 5KX5E 2C0SA 4JEUB 5LYJE 4GK0E 1YK3A 2B4BA 3UY5A 2LSGA 1KZFA 1M4IA 2FSRA 4MHCA 1H7CA 1R57A 4RS2A 3ANWB 3LBXA 2XTLA 3QC9A 4DVDA 4CYQA 2PJQA 3PE0A 1OZPA 3K9UA 4MHDA 4F0XA 1XE4A 3GYAA 4OYJA 4ZS3A 4NUUA 1J4JA 1QSNA 3CXPA 4OADA 3WR7A 2LHNA 4KMCA 2MOZA 5FXZA 2RC4A 1GHEA 4C7HA 3KBTA 2WUUA 4P0BA 4MFPA 4QBJA 4H63H 4KBMB 3VU7H 3R9GA 3DSBA 3A9LA 2C5IT 5JQ4A 4C91A 2WSAA 3AA7B 5H86A 4KVOE 3H4QA 2CM0A 2ZM2A 3EDUA 4PSXA 5EK3A 5A1LA 4B5PA 4C2XA 3B57A 5AGEA 4UVCB 5JDQA 2Q7BA 2VEZA 1MNEA 2Z3OA 4L89A 2V1DB 5H6QB 2WPWA 3EFAA 4UCMA 5G1ZA 1D0XA 2CMRA 4AG9A 4TZ4C 4CRYB 3IWGA 4FD7A 4JEHB 5EC4A 1ZV4X 5HXSA 4TX5A 3SS1A 4EVYA 3V8IA 5L3BB 2B58A 2QIRA 2E9XA 2XAQB 4OYKA 1SHZC 5LCYA 5LHIB 3PP9A 2BVLA 2V7KA 4KOUA 2JDDA 3HA4A 3B13A 1Z9UA 4M3SA 4A30A 2I59A 2DLRA 3N5LA 4ISTA 2LSIA 2VK9A 3VKHA 3TO9A 1V0CA 2CNTA 3LBXB 4M85A 1YVOA 4RI1A 2B4DA 1HTJF 4L5GA 3CQGB 3QB8A 2A72A 3FB2A 5DQVA 3BJ8A 3FB3A 1MMDA 2VL8A 3C4ZA 3KDSE 4O4HE 2X9HA 5TAOA 4AKLA 2B3UA 3AAIA 4OHFA 5JRCB 2P0WA 1CJWA 3KKWA 1Y9KA 2B3VA 2B4DB 2EHOB 4ASKA 3N9LA 5HMNA 2WSSV 2IC9A 3ZJ1A 5HXCA 1XMTA 5GONE 2LEHA 1NMTA 5F49A 3TT2A 4B13A 4CRZB 4AG7A 4A32A 3RC8A 1B87A 2Z3KA 1HG2A 2EUIA 4E0AA 1XEBA 2ZW6A 4IIJE 3RYIE 4CXYA 1IIDA 4HE8A 4IDZA 2PSWA 4AXPA 2NMTA 1BR0A 1IYLA 4UXNB 5FXWA 4EYYR 3JTKA 3D2PA 5BWAB 3D3SA 1UX5A 5HAXA 2DNXA 2Q4VA 2W63A 1ZO0A 5C88A 3UULA 1VHSA 1MMGA 1QSTA 3PUSA 2Q9QC 2EHOC 2L3LA 3I0OA 5FYMA 1LKXA 5FXVA 5L3FB 2OZUA 1O3XA 2Z10A 3OWCA 2LM9A 2ATRA 3VWEA 2UXXB 2XQYA 4UF0B 4ILUA 4ZI2C 4KOYA 2CE7A 4KVXA 4HNYB 4HEAA 4H9PC 2XAFB 4PK4A 3SRZA 2ZM0A 4DMWA 2B5GA 2JEVA 5A27A 2KLQA 1Q2YA 1SQHA 4FJOA 3C26A 3EO4A 3FXDB 2ZMAA 5LBMA 3ZCJA 5LGTB 2BSWA 3O4XE 4XNHC 3VWDA 2FL4A 4QX8B 5F3JA 2CNSA 3K3NA 2YGWA 5J8FA 3ZCIA 4ORFA 2X51A 3KBUA 3GN5B 4H9OC 2AE6A 2PFVA 2FE7A 3VHLA 2LOPA 5E0OA 2IAKA 3GWHA 5JDMA 4B5OA 3LK3B 2W62A 5LGUB 4HGAA 2VZZA 1IJ6A 2Y8DA 3HL6A 4JLEA 5JQGE 4K30A 3L09A 5HYAA 4CAVA 3RKOA 3V5SA 4EXTA 1XF8A 3KINB 4Q36A 3RYCE 5L2LA 4IE0A 1NE9A 4KOWA 2BEIA 4UBRA 2VKJA 4BJMA 3AA6B 1S94A 1NAFA 4AKGA 3TTHA 4C68A 1MJAA 5CA0E 2D4OA 3HKBE 2Q9QB 3TOBA 4B14A 4AKHA 4R3KA 4K0UA 2VZYA 4C2ZA 2C5KT 4IE4A 1Y9WA 2K5BB 4PSWA 4UEMA 5AG7A 2ES0A 5HXEA 2DPTA 4H9RC 2QGSA 3MK7C 4KORA 5AG6A 4Y49B 4GYRA 2Q9QA 5LGNB 2Q0YA 4KOXA 2LOSA 4X5KA 4QX7B 1MNDA 2KWHA 3HKCE 4MLKA 4QHOA 4U72A 3CXSA 2BL1A 4E2AA 3J7Yq 2VWAA 1L0CA 2X67A 4BBHA 3LD2A 3WAJA 3DJBA 4GYSA 3HKEE 5EZYE 5JDHA 3TOAA 2YNCC 4MFLA 1N71A 1B7TA 4CGOA 1BR2A 2NTYA 4MFKA 3VKGA 4KUBA 3W6XA 1S35A 4E8OA 2V7MA 1NSLA 4KZTA 2Z11A 3EY5A 2LJLA 4MBQA 4FI5A 2AJ6A 2RA1A 4L9IA 4EZ4A 2YINA 5JDGA 3F0AA 2B1EA 2YNDA 3AVSA 4A31A 4BMHA 2PG8A 1PU9A 4ZS2A 3RX6A 4WBNE 3BK9A 4EAHA 3O9XA 3UUMA 3ZLIA 3RC3A 3R9EA 3S6KA 3AA0B 4KSFA 3RYHE 4O4JE 1I21A 5G22A 1G8XA 4PFOA 3WI3A 2CEAA 3U78A 3W91A 3ETVA 2HV2A 3RRCA 3MA9A 5L3GB 4A95A 4ZHQE 3JUWA 1SA0E 1PUAA 4C2YA 3EXNA 3TE4A 2KMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSR A;  4QUS A;  2PDO A;  3I9S A;  1S7L A;  1IJ5 A;  3FXE B;  1XIX A;  1S7K A;  2ZW4 A;  4B5P B;  5F47 A;  5C82 A;  3FYN A;  3CVR A;  1S7N A;  5IB0 A;  1UFH A;  2X7B A;  4U5Y A;  3RYO A;  2X9Y A;  3ZJ0 A;  1YRE A;  2D4P A;  2FS5 A;  1WWZ A;  2BUE A;  3S6F A;  4MI4 A;  3P2H A;  3BLN A;  3D8P A;  3DNS A;  4UA3 A;  2GIV A;  4ONU A;  4KLV A;  1CM0 A;  1ZKE A;  2HUZ A;  1I1D A;  2X9X A;  4LUA A;  1M4G A;  2CY2 A;  4XPL A;  4CAW A;  4OLL A;  4J2C A;  5HH1 A;  2OB0 A;  2Q44 A;  4I49 A;  3FNC A;  3SXN A;  4DNC A;  1Y7R A;  3EXN A;  4H6U A;  4QC6 A;  3MGD A;  3GY9 A;  1KUY A;  2CNM A;  4NXY A;  4MJ8 A;  4DND A;  4UWI A;  5GCN A;  1P0H A;  5F48 A;  2FIA A;  4CAX A;  2FCK A;  3BJ7 A;  5E96 A;  5EBV A;  4MY3 A;  1YVK A;  2FT0 A;  2IL4 A;  3W6S A;  2Q04 A;  3L3P A;  1S3Z A;  2OH1 A;  4U9Y A;  1I12 A;  4NCZ A;  2PC1 A;  1BO4 A;  4FD6 A;  3FBU A;  4KVM E;  4R57 A;  2QML A;  5KTA A;  2Q4Y A;  3R9F A;  2X9W A;  2G0B A;  4KOT A;  2IC6 A;  5CNP A;  2OU2 A;  4JXQ A;  2JLM A;  1B6B A;  2R8V A;  1TIQ A;  4H89 A;  1S60 A;  3N7Z A;  3TO6 A;  2REF A;  4F6A A;  5IX3 A;  2B5G B;  3TKL B;  3B8G A;  4NEX A;  5JPH A;  5H84 A;  3S4U A;  4KLW A;  1IIC A;  4XNH B;  2ZPA A;  2OZG A;  3SHP A;  2REE A;  2I79 A;  4XPK A;  4PV6 A;  5IV0 A;  4AVA A;  3R95 A;  1P4N A;  1QSM A;  2R1I A;  3MXZ A;  3EC4 A;  3F8K A;  2VXK A;  3NE7 A;  4Y49 C;  1QSD A;  2G3T A;  1LVF A;  5FVJ A;  1MJB A;  1BOB A;  2VI7 A;  1FY7 A;  3QUJ A;  4MBU A;  1KUX A;  4U9Z A;  4UWJ A;  4OAE A;  3JVN A;  1YX0 A;  1RXT A;  3R1K A;  3DR8 A;  4HKF A;  2J8M A;  3T9Y A;  3ZZI A;  1LRZ A;  3G3S A;  2FXF A;  1Q2C A;  4GS4 A;  4JWP A;  2PR1 A;  4YFJ A;  3LOD A;  2I00 A;  1S7F A;  2GAN A;  3P7I A;  4AVB A;  1U6M A;  2C5J A;  3TCV A;  3S6G A;  1WK4 A;  2ZW5 A;  3PZJ A;  1S5K A;  2KWI B;  1IYK A;  2P6G A;  2WPX A;  5DWN A;  4L0R A;  2H5M A;  2R7H A;  2DXQ A;  4MY0 A;  1YGH A;  2CA5 A;  3TO7 A;  5I0C A;  3R96 A;  4KOS A;  4J3G A;  5F46 A;  4II9 A;  2P6E A;  4PK2 A;  4JLY A;  2A4N A;  2C27 A;  4R3L A;  2G0U A;  2VBQ A;  1MJ9 A;  2KCW A;  4L8A A;  3IGR A;  1RO5 A;  4FD5 A;  4XPD C;  3FIX A;  3QAH A;  4AB7 A;  4H6Z A;  4HNW B;  4JJX A;  4B6X A;  2R98 A;  1Q2D A;  4JXR A;  4YGO A;  3SXO A;  4KOV A;  5KTC A;  3GKR A;  4YRH A;  4R9M A;  4IF5 A;  2JDC A;  1VKC A;  3TFY A;  1ON0 A;  4FD4 A;  1M44 A;  3FRM A;  3CXQ A;  1MK4 A;  3P2F A;  1M1D A;  4QVT A;  5KTD A;  2G3A A;  2ZW7 A;  2ARH A;  2PRB A;  4NF1 A;  5ISV A;  1KUV A;  2EVN A;  2ZXV A;  1K4J A;  2J8R A;  3CKD A;  4HNX B;  3E0K A;  3S6H A;  2J8N A;  2FIW A;  4KOW A;  4NSQ A;  2VQY A;  2HQY A;  3DDD A;  4KZT A;  2MBG A;  1YR0 A;  4PK3 A;  1Z0P A;  2O28 A;  3PGP A;  4QB9 A;  4JD6 A;  5DWM A;  2Y0M A;  4XPD B;  4R87 A;  3T90 A;  3QK6 A;  3DR6 A;  1Z4E A;  4ZBG A;  4E0A A;  4KUA A;  4F0Y A;  1QSO A;  4IUS A;  2Z0Z A;  4PSW A;  1M4D A;  2K5T A;  2PR8 A;  1IB1 E;  2QEC A;  3FXT A;  2OZH A;  3I3G A;  2GE3 A;  4AVC A;  3F5B A;  4CQI A;  3G8W A;  2F5I A;  2P6F A;  4LX9 A;  2K48 A;  1YLE A;  3D2M A;  1YK3 A;  2B4B A;  3UY5 A;  1KZF A;  1M4I A;  2FSR A;  1R57 A;  1H7C A;  4RS2 A;  2XTL A;  1OZP A;  3K9U A;  4MHD A;  1XE4 A;  3GYA A;  3CXP A;  1J4J A;  1QSN A;  4OAD A;  3WR7 A;  2RC4 A;  1GHE A;  4QBJ A;  3R9G A;  3DSB A;  2C5I T;  5JQ4 A;  5H86 A;  4KVO E;  3H4Q A;  4PSX A;  4B5P A;  2Q7B A;  2VEZ A;  4L89 A;  2WPW A;  3EFA A;  4AG9 A;  4CRY B;  3IWG A;  4FD7 A;  5EC4 A;  4EVY A;  3V8I A;  2B58 A;  2QIR A;  3PP9 A;  4KOU A;  2JDD A;  1Z9U A;  4M3S A;  3N5L A;  3TO9 A;  1V0C A;  2CNT A;  4M85 A;  1YVO A;  4RI1 A;  2B4D A;  3QB8 A;  3BJ8 A;  3FB3 A;  2B3U A;  2P0W A;  3KKW A;  1CJW A;  1Y9K A;  2B3V A;  2B4D B;  5HMN A;  2IC9 A;  3TT2 A;  1XMT A;  5F49 A;  1NMT A;  4CRZ B;  4AG7 A;  1B87 A;  2EUI A;  1XEB A;  2ZW6 A;  1IID A;  4CS0 B;  2PSW A;  2NMT A;  1IYL A;  4EYY R;  3D2P A;  3D3S A;  2Q4V A;  5C88 A;  1VHS A;  1QST A;  2PQ8 A;  2OZU A;  2Z10 A;  3VWE A;  3OWC A;  2ATR A;  4KVX A;  4KOY A;  4HNY B;  2B5G A;  2JEV A;  1Q2Y A;  1SQH A;  3C26 A;  3EO4 A;  3FXD B;  2BSW A;  4XNH C;  3VWD A;  2FL4 A;  2CNS A;  5J8F A;  4ORF A;  2AE6 A;  2FE7 A;  4B5O A;  2VZZ A;  1IJ6 A;  4K30 A;  4CAV A;  1XF8 A;  1NE9 A;  2BEI A;  4UBR A;  3TTH A;  1MJA A;  2D4O A;  3TOB A;  4R3K A;  2VZY A;  2C5K T;  1Y9W A;  4KOR A;  4Y49 B;  2Q0Y A;  4X5K A;  2KWH A;  4E2A A;  3CXS A;  2BL1 A;  1L0C A;  3LD2 A;  3TOA A;  1N71 A;  3W6X A;  4KUB A;  4E8O A;  1NSL A;  2Z11 A;  3EY5 A;  4FI5 A;  2AJ6 A;  3F0A A;  4BMH A;  1PU9 A;  3R9E A;  3S6K A;  1I21 A;  3W91 A;  2HV2 A;  3JUW A;  1PUA A;  5J8C A;  4KOX A;  3TE4 A;  1Z4R A; 
#chains in the Genus database with same CATH topology
 4YY3 T;  3H37 A;  4AIU A;  3F57 A;  2HPJ A;  2GLF A;  2OR4 A;  1TKF A;  3GA8 A;  4IHJ E;  3X1D A;  2IW5 B;  3UUX B;  3EI0 A;  4H9N C;  2NW8 A;  3BQL A;  4PJL A;  2BS3 A;  3TLU A;  3UFG A;  3GB0 A;  5KXJ A;  1CUN A;  2X7B A;  4H9Q C;  3ZJ0 A;  3D7G A;  1YRE A;  2FS5 A;  3IJ3 A;  3DGV A;  4MFZ A;  1IAP A;  2CRB A;  4UA3 A;  2WB5 A;  2KT9 A;  1G73 A;  1UCU A;  2VKO A;  5AQH B;  2WCA A;  3IWE A;  3UU4 A;  4NPP A;  4BJN A;  2DEA A;  2W2U A;  4ZI7 E;  4O8S A;  3MKD A;  1I1D A;  4LUA A;  1M4G A;  4PK6 A;  3MAC A;  4YSZ A;  4JI8 T;  2Q44 A;  4I49 A;  1YSJ A;  3ZYL A;  3BHX A;  4BAY B;  3B5M A;  2ZEG A;  4I4T E;  2F4V T;  5G21 A;  2Q9Q D;  1IOI A;  1HX8 A;  3MGD A;  3TLW A;  2Z3N A;  3GY9 A;  2CXF A;  4ZGY B;  1N34 T;  2PTF A;  2XEG A;  2ZEP A;  4X8I A;  2E5L T;  1D1A A;  4JI4 T;  1CP6 A;  4UWI A;  3I0Q A;  3H8G A;  3N9N A;  3B3C A;  2SPC A;  2FIA A;  4CAX A;  5FVK A;  2VKH A;  2YNE A;  5AG5 A;  1U5P A;  4F8H A;  4DBQ A;  2CWO A;  4LF9 T;  3PB9 X;  4ZY2 A;  1YVK A;  3IEE A;  2FT0 A;  3GLJ A;  2Z3M A;  2I3C A;  3W6S A;  2Q04 A;  2OA5 A;  2CXL A;  3OYZ A;  5ABG A;  4NCZ A;  4OK0 A;  2W00 A;  4TUY E;  2JQQ A;  2Z3P A;  3RIU C;  4KVM E;  4R57 A;  4RN7 A;  3D7D A;  2QML A;  1WRD A;  2V8G A;  3AE1 A;  2VQF T;  2X9W A;  2AFU A;  2IC6 A;  2J4G A;  3B3S A;  3GMI A;  3SOL A;  4JXQ A;  3BQK A;  2JLM A;  2R8V A;  1XJO A;  2HB6 A;  2PJB A;  4GOU A;  3N7Z A;  4X2T A;  3TO6 A;  4F9V A;  2C6C A;  1YXR A;  1KK7 A;  4TV8 E;  2AFZ A;  4ILA A;  3EVY A;  3VRB A;  2E9X B;  2I79 A;  5CBM A;  3KV9 A;  2LT3 A;  3P8C D;  4WBO A;  5KDM C;  2V8H A;  2WBL A;  5HWX A;  5IV0 A;  4AVA A;  5JRE A;  4AQG A;  3R95 A;  2ACZ A;  4P4D A;  3PUV F;  4ZY1 A;  3EC4 A;  4EEB A;  4IK2 A;  4GM5 A;  1MJB A;  1BOB A;  1TKJ A;  2BG9 E;  2XQ6 A;  4K0K T;  4TWF A;  1W0A A;  1DU2 A;  1GQE A;  3IF8 B;  4HN9 A;  3JVN A;  1YX0 A;  5CPA A;  4HKF A;  2Z6E A;  3ZZI A;  4LF8 T;  4PXD A;  3G3S A;  4NGT A;  2PR1 A;  2YDS A;  5EK4 A;  5LRJ A;  4NJR A;  1D1B A;  2KND A;  2AFS A;  4UR9 A;  3ZYK A;  1IY7 A;  4X20 E;  4Q7A A;  4AVB A;  1DE4 C;  3WC6 A;  5IHY A;  4YTN A;  3PU8 A;  3E22 E;  5LHG B;  4LMK A;  2ZW5 A;  2YEV C;  1HEE A;  2KWI B;  5DAB A;  2PJ7 A;  4PJM A;  2PE3 A;  4MMO A;  3RI5 A;  2IUB A;  4CI1 B;  4UIB A;  3I9Y A;  2WPX A;  1Y0R A;  4HPS A;  4PPZ A;  3CZX A;  2PVV A;  2PBI A;  1H8L A;  3GIU A;  4WZX A;  3PUA A;  4ERR A;  3QOF A;  4X1I E;  2P6E A;  3IIB A;  5J1G A;  4EWT A;  4ZXL A;  2NR4 A;  2RB7 A;  2XQ5 A;  2C27 A;  2G0U A;  2WZI A;  1LAP A;  2BVM A;  3LFM A;  4JYA T;  3EAB A;  1FIO A;  3AB3 B;  4CGM A;  4R76 A;  4OC5 A;  1VIX A;  5AQM B;  4X66 T;  3T8W A;  3KQX A;  5EMI A;  3IFE A;  1Y64 B;  2VQE T;  2ZED A;  3PU3 A;  4PAG A;  1AYE A;  2CXD A;  3WC7 A;  4N78 D;  5LOV E;  1DTD A;  4ZZC A;  4YRH A;  4IF5 A;  5HCJ A;  2JDC A;  1VKC A;  4JBW F;  4FD4 A;  4IT4 A;  3HUV A;  5H6R B;  2WQY A;  3FRM A;  1XNR T;  2FJA A;  1LAM A;  1QLB A;  3OKQ A;  3CXQ A;  1BR4 A;  2YOE A;  2D2S A;  4WNK A;  1WLX A;  1X79 A;  5HXR A;  3KVB A;  3P2F A;  4QVT A;  4YSY A;  2ZEO A;  2CHO A;  1GYT A;  3IU1 A;  2HHH T;  2PRB A;  2M6I A;  4NF1 A;  1KUV A;  7CPA A;  3LK4 2;  2J8R A;  4UCN A;  3CKD A;  2A9U A;  3HI2 A;  3S6H A;  5FMN A;  1D1C A;  2XAJ B;  2QA7 A;  2BKP A;  2GK9 A;  2VQY A;  4KOW A;  2D5U A;  3FHN A;  3CPA A;  1YR0 A;  2XQ7 A;  2CIJ A;  5K8N A;  3FEC A;  4QKN A;  5LNK A;  5FKY A;  4P6Y A;  4ZBG A;  5EK2 A;  4EB6 E;  2CLY B;  5LYI A;  2L8K A;  3N2G E;  4HTE A;  1N36 T;  2XQ8 A;  4ZY0 A;  4IL4 A;  2V6Y A;  3I3G A;  2WZN A;  4LX9 A;  4IAV A;  1YLE A;  3O1J A;  5LYJ E;  1YK3 A;  8CPA A;  1KZF A;  2FSR A;  3QAY A;  1R57 A;  2XTL A;  4DVD A;  2PJQ A;  5AQK B;  1OZP A;  3K9U A;  4MHD A;  4OYJ A;  3RZA A;  4OAD A;  3WR7 A;  2LHN A;  3L2N A;  4KMC A;  4Z90 A;  2MOZ A;  5FXZ A;  1GHE A;  2LKH A;  4NJQ A;  4B3R T;  3A9L A;  5THW A;  5JQ4 A;  3AE6 A;  3H4Q A;  2ZM2 A;  5EK3 A;  3P4S A;  4B5P A;  2F7V A;  5AGE A;  3EFA A;  1D0X A;  4AG9 A;  4TZ4 C;  4F9U A;  5LYD A;  4FD7 A;  5EC4 A;  3CIR A;  3V8I A;  2QIR A;  5AQI B;  3D7F A;  1SHZ C;  5LHI B;  1X10 A;  3S9L A;  3HA4 A;  2I59 A;  2DLR A;  1XZY A;  3VRA A;  3AEG A;  3VAR A;  4AIS A;  3QB8 A;  4ZI6 A;  4JI7 T;  2VL8 A;  5TAO A;  4O4H E;  4AKL A;  3KKW A;  1CJW A;  1IBK T;  2UUB T;  5IB9 A;  3N9L A;  3ZJ1 A;  5HXC A;  5F49 A;  5GON E;  5HXD A;  4LML A;  4A32 A;  4OC2 A;  1IID A;  3RYI E;  1AMP A;  5FXW A;  3D3S A;  3VH9 A;  5HAX A;  2DNX A;  3SJE A;  1ZO0 A;  3UUL A;  4DUZ T;  3VWE A;  2IIU A;  3OWC A;  2LM9 A;  2ATR A;  3MRU A;  2UXX B;  4KVX A;  4ZI2 C;  4KOY A;  4PK4 A;  2XAF B;  5A27 A;  2ZM0 A;  4DMW A;  2JEV A;  2J62 A;  2VL0 A;  3EO4 A;  3ONJ A;  5LBM A;  3VWD A;  3SI1 A;  4HFE A;  5J8F A;  4F8Z A;  4U2Y A;  2HN2 A;  3ZCI A;  3KBU A;  4H9O C;  3ZSS A;  2LRK A;  5JDM A;  3NH8 A;  3RF1 A;  4B5O A;  4HGA A;  4LQ6 A;  2VZZ A;  1IJ6 A;  4NIQ A;  4GKJ T;  5HYA A;  1E7P A;  4CAV A;  4Q36 A;  1XF8 A;  1CPX A;  3RYC E;  2H89 A;  1NE9 A;  1EE3 P;  2LRL A;  4UBR A;  3AA6 B;  4AKG A;  2D4O A;  4R3K A;  4K0U A;  4C2Z A;  3WT4 A;  4X65 T;  4H9R C;  2V5C A;  4CGP A;  4X5K A;  1MND A;  4QHO A;  4E2A A;  1IGB A;  1L0C A;  2X67 A;  3WAJ A;  3DJB A;  3TOA A;  5HVF A;  2YNC C;  1N71 A;  3FH4 A;  4KUB A;  1S35 A;  2V7M A;  2RA1 A;  4L9I A;  5JDG A;  2YIN A;  2J9A A;  1BPN A;  3AVS A;  4G1P A;  3RX6 A;  4WBN E;  3BK9 A;  4EAH A;  3R9E A;  3S6K A;  4TNW A;  2V8S V;  1XMQ T;  5K8M A;  3RYH E;  1G8X A;  4PFO A;  3NH5 A;  4PXE A;  3FZK B;  2GFQ A;  2ZEN A;  5J8C A;  3TE4 A;  1FMV A;  4P45 A;  1KNR A;  1MIV A;  4QUS A;  4QH1 A;  3OJA A;  1YQE A;  1WR6 A;  1YKH B;  1IJ5 A;  3FXE B;  1XIX A;  2PJ5 A;  3EAM A;  3BXM A;  5C82 A;  4CN1 A;  5CA1 E;  5J1Q A;  5IB0 A;  3O1I A;  1FNO A;  3FEE A;  3RYO A;  4MCP A;  5DS0 A;  1BLL E;  3BLN A;  3D8P A;  5FNV E;  5HXH A;  4DJL A;  4KLV A;  4IHM A;  1CM0 A;  1ZKE A;  2XHE B;  3H5Z A;  2X9X A;  2WDV A;  3CWZ B;  4M6I A;  4A5X A;  3CX6 B;  4OC0 A;  4CAW A;  4J2C A;  5HH1 A;  2WS3 A;  3SXN A;  3FNC A;  2ANP A;  3ZMV B;  3PUR A;  5JH9 A;  4U31 A;  4UEZ A;  4H6U A;  4AQF A;  3N2K E;  2LHR A;  1KWM A;  4B3S T;  3ZMT B;  3N9O A;  5AQP B;  4WWV A;  3JAF A;  2EO8 A;  4MHN A;  2NYQ A;  4PXB A;  3RLF F;  3U3I A;  4MJ8 A;  4HFV A;  3LDQ B;  3RPU A;  1P0H A;  3TLS A;  4X1Y E;  2XPK A;  5E96 A;  3D67 A;  4EOZ B;  2PIZ A;  3B7I A;  3L3P A;  5JDL A;  2UXN B;  2V6Y B;  3KHX A;  3PDY A;  4DR5 T;  1QQ9 A;  3PBE A;  3IHR A;  1BO4 A;  2Z3L A;  1NEN A;  5KTA A;  4PW8 A;  1KNZ A;  2Q4Y A;  5JM6 A;  2G0B A;  3C4X A;  5CNP A;  4A39 A;  2LSY A;  5FVL A;  5A28 A;  2NWB A;  1R8I A;  4MAL A;  3R6N A;  1QUU A;  1Y7E A;  5ETW A;  3DTO A;  4MCS A;  4F6A A;  1JWQ A;  4NGN A;  3TKL B;  4NEX A;  5JPH A;  1BAV A;  3ZN1 B;  2JQ9 A;  4QWN B;  5H84 A;  4IE5 A;  2ZPA A;  3IO1 A;  2OZG A;  3SHP A;  2REE A;  1MMA A;  3OYX A;  2C1C A;  4MFR A;  1UGO A;  5LA6 E;  4O2A E;  4YLH A;  3UQ7 A;  4TWD A;  3RQU A;  3LSV A;  3MJX A;  4HFD A;  1P4N A;  3H3A A;  1OED C;  2AE9 A;  1QSM A;  4Y49 C;  3JAD A;  4CYO A;  2G3T A;  4P4F A;  4O2B E;  4NXN T;  2PJA A;  3P4P A;  2WAU A;  3RHW A;  2VI7 A;  4TN7 B;  4IDN A;  1I94 T;  1HF8 A;  2K3W A;  4P0A A;  4PXC A;  2V26 A;  2DCF A;  5C3J A;  4OAE A;  2PJ4 A;  3LAC A;  3UU6 A;  4U7Y A;  1X9B A;  2E9X D;  1OED A;  5ABF A;  2FUP A;  2CTC A;  3LMS A;  4GS4 A;  1HX1 B;  1ZG7 A;  3AVR A;  4YFJ A;  4NGM A;  4KSI A;  4UFX A;  2R6G F;  1MMN A;  2KSR A;  3C51 A;  2GAN A;  3N9Q A;  4E7Z A;  3IU2 A;  4JI0 T;  2IJZ A;  4X3R A;  1XOV A;  2NSM A;  3TCV A;  3RAM A;  4DO0 A;  2X0L B;  2JRK A;  2BBJ A;  1WR0 A;  5JRC A;  1VRB A;  4ZI3 D;  1LCP A;  4QXH B;  3AXJ B;  2AFM A;  2DWG A;  4O23 A;  2W66 A;  2YU1 A;  5IUX A;  2R7H A;  2DXQ A;  1YGH A;  2XJ7 A;  5FY0 A;  2V7I A;  3A8Y C;  3R96 A;  2O4H A;  3C98 B;  4II9 A;  4MHZ A;  1LAN A;  2E9X C;  2QVA A;  2YDR A;  1ZG8 A;  2EHO A;  3LJC A;  4DMV A;  3CK6 A;  4XZC A;  3UT5 E;  2D0T A;  1RO5 A;  3N5F A;  4DUK A;  3SI0 A;  4NGP A;  3FIX A;  3QAH A;  3K8P C;  3CQX C;  4O4I E;  5DQW A;  4ANJ A;  2V8V A;  4JJX A;  1SE7 A;  4NGR A;  1Q2D A;  4QH5 A;  2XQ9 A;  5KTC A;  1YME A;  1R43 A;  4R9M A;  3TFY A;  2ABZ A;  5C8Y E;  2LLY A;  3SFE A;  2ZEH A;  3FBL A;  1LVK A;  3Q9D A;  2BG9 A;  5KTD A;  2G3A A;  4CN4 A;  4JZ0 A;  4F6R C;  4DV6 T;  1YW6 A;  2ARH A;  1XNQ T;  3K9T A;  2IQ6 A;  5LHH B;  2EWB A;  2ZXV A;  3PUG A;  1HDQ A;  1K4J A;  4UCP A;  4X62 T;  5HCM A;  4NGQ A;  2HQY A;  2WMO A;  2XUE A;  3DDD A;  4KZT A;  4QB9 A;  1Z0P A;  3PGP A;  2PJ2 A;  2BZB A;  5DWM A;  1IZN B;  5JDN A;  4MCQ A;  4XPD B;  3ZC1 A;  4R87 A;  3DR6 A;  4BA9 A;  2XQ3 A;  4E0A A;  2N2N A;  5IWA T;  4KUA A;  4CGN A;  1KNP A;  4F0Y A;  2Z0Z A;  2WDQ A;  3FXT A;  4EZH A;  2GE3 A;  3F5B A;  4UEL A;  4DV4 T;  5L3D B;  3G8W A;  4A37 A;  4A2Z A;  4AKI A;  2K48 A;  5KX5 E;  2C0S A;  4JEU B;  4LQG A;  3ABV A;  1M4I A;  3K1S A;  4MHC A;  3PE0 A;  3CT9 A;  2IMO A;  1QSN A;  1ZOY A;  3FZL B;  2BCO A;  2WUU A;  1TKH A;  4P0B A;  3B3V A;  3VU7 H;  4TWE A;  1JQG A;  3DSB A;  4RUH A;  5FL0 A;  4ZX9 A;  3AA7 B;  2BS2 A;  4PSX A;  4K3N A;  5AQJ B;  2V77 A;  1FT7 A;  3KR4 A;  5JDQ A;  2CMR A;  4HWH A;  4CRY B;  3IWG A;  1VCT A;  4JEH B;  1Z5R A;  4TX5 A;  2OLT A;  5L3B B;  4OYK A;  1ELM P;  5LCY A;  2V7K A;  4KOU A;  1Z9U A;  4A30 A;  4OC3 A;  2VK9 A;  4M85 A;  1YVO A;  4L5G A;  2A72 A;  3FB2 A;  2UXC T;  2LKG A;  3KDS E;  2B3U A;  5JRC B;  5K8O A;  3NA6 A;  1CX8 A;  2WSS V;  4DR3 T;  3TT2 A;  4ZEY A;  1XMT A;  1F2P A;  4AG7 A;  1A2Z A;  2FVG A;  2EUI A;  2VL1 A;  1XEB A;  2ZW6 A;  4HE8 A;  4CS0 B;  4AXP A;  2NMT A;  2V8D A;  1IYL A;  3JTK A;  5JGF A;  2Q4V A;  2WU2 A;  2W63 A;  3T1H T;  2OV9 A;  3QB5 K;  3TC8 A;  3PUS A;  5FYM A;  2EHO C;  2Z10 A;  5L3F B;  1LKX A;  5K8P A;  1XDP A;  2CE7 A;  2BBH A;  5AQF B;  4HEA A;  4H9P C;  2GLJ A;  2KLQ A;  4FJO A;  3C26 A;  3RKG A;  3PUY F;  2ZMA A;  4XNH C;  2MPK A;  2CNS A;  2YGW A;  3LWU A;  2BS4 A;  4ORF A;  5HEG A;  4WYV A;  2AE6 A;  3FZF B;  3AED A;  3GWH A;  2UXB T;  4I0U A;  3L09 A;  2ZEF A;  3RKO A;  3V5S A;  4EXT A;  3KIN B;  4IE0 A;  4YTM A;  3FVL A;  4BJM A;  4OID A;  5CA0 E;  2Q9Q B;  4B14 A;  4IE4 A;  3D68 A;  5AG7 A;  2ZOG A;  2QGS A;  3MK7 C;  4COF A;  3FX6 A;  4GYR A;  2Q9Q A;  5LGN B;  4P10 A;  3MN8 A;  3HKC E;  4U72 A;  2BL1 A;  3J7Y q;  5EZY E;  3D66 A;  3PB7 X;  4MFL A;  5LYF A;  3W6X A;  3VKG A;  2LJL A;  3JAE A;  2Q7S A;  2AJ6 A;  3O9X A;  3UUM A;  3KHZ A;  1I21 A;  3WI3 A;  3W91 A;  3MA9 A;  4A95 A;  4HFB A;  4KOX A;  1QSR A;  4EIW A;  1KFY A;  5L3E B;  2PDO A;  3I9S A;  4UFW A;  3RGL A;  1S7L A;  5G20 A;  3PUZ F;  1Z8U A;  5J0Z A;  4KSA A;  3KVA A;  4B5P B;  1EZ3 A;  1E2A A;  2BG9 C;  3OVU A;  3I1A A;  3LK2 B;  1S7N A;  2HH7 A;  5DJQ C;  2KZ7 B;  4KX6 A;  5G1Z A;  4E7S A;  4R6T A;  1BR1 A;  4P09 A;  3N2O A;  1UFH A;  4DUY T;  3C64 A;  2IHR 1;  3D0T A;  4CYP A;  2JMK A;  1WWZ A;  3ZT7 A;  2BUE A;  4MI4 A;  4Z8X A;  4DBR A;  4CYN A;  1NEK A;  4AI6 A;  2DF5 A;  4O4L E;  3DNS A;  4CAE A;  3ONX A;  4ONU A;  3NWI A;  2Q43 A;  4A33 A;  4KP3 C;  3ZMS B;  2XZE A;  2HUZ A;  3A7M A;  1Y01 A;  1XWM A;  2BKO A;  4HFH A;  1OED E;  4XPL A;  5D29 A;  5BMV E;  5CFB A;  4JUY A;  4LFA T;  3KV5 A;  3DLJ A;  2J47 A;  2PVW A;  1ARM A;  2YU2 A;  3KZW A;  2JQH A;  2MYS A;  4TV9 E;  4QC6 A;  4DV0 T;  2UUA T;  4IE6 A;  2OOT A;  5AG4 A;  4B6Z A;  4H63 V;  2WWU A;  3ZEF B;  2CNM A;  3E0Z A;  4X5T A;  3RIA A;  4NXY A;  3HR0 A;  2QYV A;  4JV5 T;  5GCN A;  3AEA A;  2KXP B;  2CF4 A;  3S9N A;  3CQC B;  1ARL A;  4MFQ A;  5F09 A;  4HWD A;  3UUB A;  3E08 A;  4MY3 A;  2NOX A;  3LG7 A;  3C4W A;  1US7 B;  4HFI A;  4LMJ A;  4CI3 B;  4AQF C;  3JC6 C;  1S3Z A;  2JBJ A;  4UF4 A;  4U9Y A;  2RP4 A;  3N9M A;  4W9Y A;  1UUS A;  4FD6 A;  4B3M T;  1VCS A;  4HKA A;  4KHZ F;  4YT0 A;  3FBU A;  2MAW A;  2HC9 A;  4OFZ A;  4FBE A;  4KOT A;  4YJ3 E;  1N33 T;  3D4U A;  2LE8 A;  3GN5 A;  5I4M A;  3Q5W A;  1TIQ A;  5LP6 E;  1UWY A;  3F31 A;  2CBI A;  1WYC A;  1S60 A;  3P4Q A;  3KFW X;  3B8G A;  1TXR A;  2BDE A;  3B2Y A;  2CTB A;  3KQZ A;  1OWA A;  1FJG T;  5J2T E;  4CXW A;  2M67 A;  3AEF A;  2PJ8 A;  3NH4 A;  1KF6 A;  2FBW A;  3ZMZ B;  4KS9 A;  2JPF A;  3EHZ A;  2R1I A;  3MXZ A;  4YSX A;  2VXK A;  3NE7 A;  2UU9 T;  3AEB A;  2CCQ A;  2PCU A;  3IA3 A;  1HFA A;  1T72 A;  2JMH A;  3SJX A;  1OXZ A;  2IML A;  4LF7 T;  3K2K A;  5ADX L;  1VGY A;  3ZT5 A;  2W61 A;  1WCR A;  3AXJ A;  3V7Z A;  2AFX A;  3QUJ A;  4MBU A;  4B12 A;  4C90 A;  1KUX A;  4U9Z A;  3ZMU B;  1VOM A;  2YDQ A;  2W0G A;  4X1K E;  4ZI2 D;  3DR8 A;  2JJ9 A;  3T9Y A;  1ZLI A;  2YKS A;  2W67 A;  3L39 A;  4MFJ A;  1LRZ A;  3ETU A;  3J9X 1;  3ZYM A;  2FJB A;  2FXF A;  4UV8 B;  2LM2 A;  1XDO A;  4U74 A;  2Q4Z A;  1HCI A;  3LOD A;  1HG5 A;  2I00 A;  4A56 A;  3Q5D A;  3A5X A;  3P7I A;  2X68 A;  5LXT E;  3K3Q C;  1Z8W A;  4P4I A;  3V5U A;  1SUM B;  3EUH A;  4GK5 E;  2C5J A;  5JR9 B;  3TLT A;  5L4E A;  2XAH B;  5JH7 E;  4JYW A;  2WM9 A;  1WK4 A;  3KL9 A;  2WYR A;  3PZJ A;  3K3O A;  2QYW A;  3BQI A;  4EGW A;  2ZEM A;  1IYK A;  2UUC T;  2P6G A;  3O1H A;  4Z91 A;  5DWN A;  4L0R A;  4G2A A;  1W9R A;  1R3N A;  4LF6 T;  3PUX F;  2CA5 A;  4OX9 T;  4B3T T;  3AAA B;  3PJA A;  2PJ6 A;  3SFD A;  2H7O A;  4KOS A;  1YQ3 A;  3L8R A;  5F46 A;  4JLY A;  5L4H A;  4A94 A;  5AQL B;  2NP9 A;  2A4N A;  3JC6 D;  4CGL A;  2PRQ A;  4LF5 T;  2KCW A;  3KV4 A;  2BKN A;  2WZH A;  5J2U E;  5AQT B;  3WAK A;  3N9P A;  4I50 E;  4UFV A;  2H88 A;  4AB7 A;  4V1A v;  2H7V C;  5CB4 E;  3RH3 A;  4H6Z A;  2KIN B;  5AQN B;  3PB6 X;  4P4E A;  3AE3 A;  4GKK T;  4YJ2 E;  2BOA A;  4YGO A;  2PJC A;  1TF8 A;  4KOV A;  4QH4 A;  3KGQ A;  4P1N A;  2WU5 A;  1AJ3 A;  2HPL A;  1T7S A;  1ON0 A;  3FF3 A;  4PJN A;  3SI2 A;  3KV6 A;  3ZC0 A;  3VR8 A;  4YFS A;  4DV5 T;  1M1D A;  2ZW7 A;  4DV2 T;  4EME A;  4UV9 B;  4HWF A;  4AKR B;  2Y6X A;  2BG9 B;  1MIY A;  4B10 A;  1YW0 A;  5LG3 A;  4IDQ A;  1IBL T;  1LOK A;  4HNX B;  3E0K A;  2E8I A;  2WDR A;  2XSB A;  4U2Z A;  2J8N A;  3OBV E;  3CX8 B;  2FIW A;  2MBG A;  4WW0 A;  4JD6 A;  2J1D G;  3NRX A;  1QMU A;  3T90 A;  2ZOF A;  1Z4E A;  3NZQ A;  2O53 A;  1D0Y A;  4IUS A;  4CI2 B;  2V5D A;  2ZLY A;  3CML A;  3W15 B;  1M4D A;  2QEC A;  5AQU B;  5KMG P;  4G63 A;  1ZEE A;  4AVC A;  4CQI A;  4FAI A;  3P4R A;  2F5I A;  2P6F A;  2FJD A;  3AE2 A;  4CN6 A;  3PBB A;  1VHO A;  3S9M A;  4GK0 E;  2B4B A;  4A97 A;  1H7C A;  3ANW B;  4CYQ A;  3GYA A;  4ZS3 A;  1J4J A;  3CXP A;  2JEW A;  3Q5E A;  1UK5 A;  4YXD A;  3KBT A;  2BO9 A;  4MFP A;  3R9G A;  5F5W A;  1Z8X A;  2C5I T;  2WSA A;  5H86 A;  3EDU A;  1ZLH A;  2X0H A;  4TWH A;  4C2X A;  4UVC B;  2Z3O A;  4L89 A;  4UCM A;  2WPW A;  3BI1 A;  1HNX T;  4YTP A;  3SS1 A;  2E9X A;  3NE8 A;  3AE8 A;  1CPS A;  2CBJ A;  2JDD A;  3B13 A;  4M3S A;  3RNZ A;  3N5L A;  3VKH A;  5HEJ A;  2CNT A;  3LBX B;  4RI1 A;  2B4D A;  4LF4 T;  3CQG B;  5DQV A;  2JBK A;  3BJ8 A;  3FB3 A;  2V6X A;  3C4Z A;  4OHF A;  2P0W A;  4EED A;  2EHO B;  4ASK A;  2IC9 A;  1NMT A;  4CRZ B;  1YW4 A;  3RC8 A;  2Z3K A;  5ABF B;  4CXY A;  4MHY A;  3NVO A;  2PSW A;  4UXN B;  4EYY R;  5BWA B;  1UX5 A;  2UXD T;  3B35 A;  5AQO B;  2G9D A;  1VHS A;  1QST A;  5HEO A;  4Z65 A;  3I0O A;  3BI0 A;  5FXV A;  1X12 A;  4EFD A;  1XMO T;  4UF0 B;  4ILU A;  2X0Y A;  4NFR A;  4HNY B;  5AQR B;  3SRZ A;  1Q2Y A;  3PB4 X;  3FXD B;  1HNZ T;  4FWU A;  2FL4 A;  4QX8 B;  5F3J A;  3JRU A;  3GN5 B;  3ISZ A;  2PFV A;  2Q51 A;  2FE7 A;  2LOP A;  5E0O A;  2IAK A;  3RO0 A;  2XM1 A;  5LGU B;  3PB8 X;  3B3T A;  1J5W A;  5LMN T;  2XEF A;  5JQG E;  2AXD S;  2Y8D A;  3HL6 A;  1PCA A;  4K30 A;  5L2L A;  2EK8 A;  3P4W A;  2E5V A;  4M6H A;  1S94 A;  4C68 A;  2VZY A;  2C5K T;  2K5B B;  3T1Y T;  3FMC A;  4KOR A;  2POK A;  5AG6 A;  4Y49 B;  2RPA A;  3QB5 A;  4QX7 B;  3FED A;  4MLK A;  1TF9 A;  1CBX A;  6CPA A;  3LD2 A;  4GYS A;  3VAT A;  5JDH A;  4DR7 T;  1B7T A;  2VVN A;  1BR2 A;  4MFK A;  5AQQ B;  4A98 A;  3ZST A;  4DID B;  3KAS A;  1NSL A;  4E8O A;  3EY5 A;  4MBQ A;  4FI5 A;  4WJB A;  3F0A A;  2YND A;  5ABH A;  4BMH A;  2PG8 A;  1PU9 A;  4GXH A;  4ZS2 A;  3RC3 A;  3QNV A;  3AA0 B;  4KSF A;  4O4J E;  5C2T A;  4FUU A;  5G22 A;  4OC4 A;  4KI0 F;  2CEA A;  3D7H A;  3ETV A;  2XEI A;  4ZHQ E;  3JUW A;  3NFZ A;  1SA0 E;  4EV6 A;  3TO7 A;  4J3G A;  2KMF A;  3UQ4 A;  3PV0 F;  2ACX A;  3JCF A;  1F57 A;  1CHU A;  3CPX A;  2LSJ A;  5LMU T;  3KI9 A;  3RYF E;  4JI3 T;  2D0U A;  1FEW A;  2ZW4 A;  1S7K A;  2JIW A;  5F47 A;  3FYN A;  3CVR A;  4DR1 T;  4YWY A;  3PTR B;  4UIG A;  2I0M A;  5HWY A;  3ISX A;  4IL9 A;  4U5Y A;  2X9Y A;  1IOF A;  2V7L A;  2VKD A;  2D4P A;  5HEU A;  4H9S E;  3S6F A;  3P2H A;  2XM2 A;  5FL1 A;  2D9D A;  3SJG A;  3UTK A;  4HWI B;  2ODV A;  1PYT B;  2GIV A;  3PJA J;  2QJ8 A;  3AEC A;  1HR0 T;  2CWY A;  3CPZ A;  2W4X A;  2CY2 A;  1XFO A;  3RIU A;  4OLL A;  2OB0 A;  1XRY A;  5LB7 B;  4DNC A;  4R7M A;  4YHH T;  3ZKR A;  1Y7R A;  3Q2M A;  3CX7 B;  2NW7 A;  3G06 A;  4UVB B;  4A38 A;  4IDO A;  1J5E T;  2XAG B;  4IRE A;  2Y48 B;  3FZM B;  3M3Z B;  3ZN0 B;  2PJ1 A;  1IBM T;  1KUY A;  4EYU A;  1MIW A;  4NGS A;  5AQG B;  3R84 B;  4DND A;  2MTQ A;  4ONW A;  2WWV A;  5IYZ E;  5F48 A;  4IE7 A;  4CPA A;  3HLP A;  2FCK A;  4XBF B;  3BJ7 A;  4P4B A;  5EBV A;  5BR8 T;  2CPT A;  5LYL A;  1NSA A;  4JI2 T;  2IL4 A;  3OTO T;  2OH1 A;  1UX4 A;  1I12 A;  1HNW T;  4I55 E;  2PC1 A;  1D0Z A;  3ANW A;  4TNU A;  1YKE B;  1YLO A;  3I9W A;  4U7I A;  1YD8 G;  5JVD E;  2PJ3 A;  3R9F A;  4PNI A;  5LRG A;  2OU2 A;  4ILB A;  4JI5 T;  3ESL A;  2K24 A;  4JI6 T;  1B6B A;  5HVG A;  4H89 A;  2XY8 B;  4IGU A;  2RFH A;  2DPS A;  2DI4 A;  4UF0 A;  2NW9 A;  2REF A;  3PUQ A;  5IX3 A;  2B5G B;  2CXA A;  4XAX B;  3DP7 A;  3NBX X;  1V9D A;  1E1H B;  3S4U A;  3EDV A;  5FP3 A;  2YNC A;  1IIC A;  4KLW A;  4DR6 T;  4XNH B;  3C50 A;  1XBU A;  5D8N A;  4YHJ A;  5AFU L;  2N9D A;  2QVP A;  4XPK A;  4ISS A;  4R8F A;  3AEE A;  3MZK B;  4IDP A;  4PV6 A;  3CDX A;  2VUR A;  3ZPO A;  1NWM X;  2XQ4 A;  3H8F A;  4DR2 T;  4OKO A;  3F8K A;  3V38 A;  1QSD A;  4DV1 T;  4B11 A;  4BIN A;  1LVF A;  5FVJ A;  3IBP A;  4ZI3 C;  1ELL P;  2VB6 A;  1VHE A;  5HVH A;  5JR9 C;  1F2O A;  3WAB A;  1FY7 A;  3Q5X A;  4UWJ A;  4DYO A;  4UVA B;  3AE4 A;  3HKD E;  5LJM A;  1WYB A;  1RXT A;  4DR4 T;  3R1K A;  2IDO B;  2VAS A;  3SJF A;  5JR9 A;  2J8M A;  1J1J A;  1Z2L A;  4ADZ A;  3UUN A;  2GRE A;  2X66 A;  3AA1 B;  5FXX A;  1T8B A;  2PIY A;  3M65 A;  1Q2C A;  2DWK A;  4CZZ B;  3F2E A;  4JWP A;  3RRW A;  2DHR A;  4DV7 T;  4LFB T;  1HDU A;  2EBJ A;  3SWH A;  1S7F A;  1M4L A;  2LSK A;  4P4J A;  3ONL C;  1U6M A;  3S6G A;  3IEH A;  3FBZ A;  1CP7 A;  1S5K A;  4PK5 A;  4ZYQ A;  2C6P A;  2HN1 A;  2P9B A;  3NRY A;  1OED B;  3AAE B;  1L0V A;  2H5M A;  5F8P A;  5CGM A;  3P50 A;  4MY0 A;  4CXX A;  5I0C A;  4HWC A;  1HS7 A;  4UEE A;  4ZZB A;  4PK2 A;  2F8H A;  3NZP A;  2WMN A;  2K9A A;  3UFE A;  2A3D A;  3UU5 A;  5L47 A;  2ODU A;  4R3L A;  4ZOL E;  2VBQ A;  5M4Y A;  1MJ9 A;  4L8A A;  3IGR A;  1FMW A;  2L9Q A;  4PJJ A;  4NXM T;  4FD5 A;  2XEJ A;  4MHP A;  4XPD C;  1YQ4 A;  5LJN A;  4U33 A;  4UIA A;  1ZP0 A;  1T98 A;  2CHN A;  2ZM6 T;  1U4Q A;  2ODF A;  2PJ9 A;  5JDF A;  4HNW B;  2A2F X;  4QXB B;  5JTG A;  3IC1 A;  5L3C B;  4B6X A;  2R98 A;  3I1U A;  4JXR A;  1UUR A;  3SXO A;  2EHO D;  5HEH A;  3GKR A;  3WC5 A;  5LBQ B;  2V7J A;  4AQY T;  2ZM8 A;  1I6Z A;  1M44 A;  3ZJ2 A;  1ZHC A;  3T8O A;  1W0B A;  4GIW A;  4M6G A;  2JQK A;  1MK4 A;  2NTX A;  5FY7 A;  4NUV A;  1Z8T A;  2VVS A;  3OPC A;  5ISV A;  2XSA A;  2EVN A;  4PFP A;  3GUX A;  2H3R A;  4QXC B;  3AE5 A;  4MCR A;  4PQA A;  4NSQ A;  2CLY C;  3RIF A;  2XAS B;  5FY1 A;  4I43 B;  5LG4 A;  2N1G A;  4PK3 A;  2O28 A;  4ILC A;  5ABE A;  3TLV A;  3ZT6 A;  2C6G A;  2Y0M A;  3QK6 A;  4ZX8 A;  1QSO A;  4CAF A;  3RBU A;  4C7I A;  4M1P A;  1N32 T;  4PSW A;  2K5T A;  2PR8 A;  1IB1 E;  2OZH A;  4KUM B;  4U3C A;  1JNR A;  1XMB A;  3D2M A;  2YK0 A;  3UY5 A;  2LSG A;  2E2A A;  4RS2 A;  3LBX A;  4KHP T;  3QC9 A;  2B76 A;  4F0X A;  1XE4 A;  2YN6 A;  4NUU A;  1M7K A;  3H8E A;  4H2K A;  2RC4 A;  2I6H A;  3VR9 A;  4C7H A;  4UEF A;  2QRX A;  5LRK A;  4QBJ A;  4H63 H;  4KBM B;  4HFC A;  4C91 A;  4KVO E;  1JNZ A;  2CM0 A;  5A1L A;  2AFW A;  3B57 A;  4JI1 T;  1BPM A;  3NKZ A;  2Q7B A;  2VEZ A;  1MNE A;  2FJE A;  3PRT A;  4MXU A;  2V1D B;  5H6Q B;  3AE9 A;  2DL1 A;  2ZEL A;  3FJU A;  1ZV4 X;  5HXS A;  4AXV A;  4EVY A;  2B58 A;  2XAQ B;  3PP9 A;  2BVL A;  4IST A;  4DV3 T;  2LSI A;  2M6B A;  3TO9 A;  1V0C A;  2EK9 A;  1HTJ F;  2PJ0 A;  1MMD A;  2XQA A;  2X9H A;  4OIW A;  3AAI A;  1Y9K A;  2B3V A;  2B4D B;  5HMN A;  3UU8 A;  4B13 A;  1AUG A;  2LEH A;  5AQV B;  1B87 A;  1HG2 A;  4IIJ E;  4LFC T;  4IDZ A;  1Q7L A;  1BR0 A;  3PEI A;  3D2P A;  1WFD A;  4OP4 A;  5C88 A;  1IU8 A;  1Y0Y A;  1MMG A;  2PQ8 A;  2Q9Q C;  3QNU A;  2L3L A;  2OZU A;  4Q38 A;  5ELY A;  1O3X A;  2XQY A;  3H3M A;  2B5G A;  1OBR A;  1LFW A;  3KR5 A;  1SQH A;  2BSW A;  3ZCJ A;  5LGT B;  3O4X E;  3FZH B;  3K3N A;  2X51 A;  4Q25 A;  1M62 A;  3VHL A;  3RQW A;  3LK3 B;  2W62 A;  2AFO A;  3IWW A;  4JLE A;  3UU3 A;  4TNV A;  5CJ5 A;  2ZEE A;  3AE7 A;  2BEI A;  4YU9 A;  2VKJ A;  1NAF A;  4OME A;  1Z8L A;  3TTH A;  1MJA A;  3HKB E;  3TOB A;  4AKH A;  3B3W A;  1Y9W A;  4UEM A;  2ES0 A;  5HXE A;  2DPT A;  2Q0Y A;  2LOS A;  2WP9 A;  2KWH A;  2WY2 A;  3CXS A;  2VWA A;  4BBH A;  1CG2 A;  3HKE E;  3PUW F;  4CGO A;  2NTY A;  3TX8 A;  2Z11 A;  4BD9 A;  4EZ4 A;  3PFO A;  2B1E A;  4A31 A;  1KEY A;  3ZLI A;  4P44 A;  1RTQ A;  4OC1 A;  3PFE A;  4MRI A;  3U78 A;  2HV2 A;  3RRC A;  5L3G B;  5AQS B;  1ZG9 A;  4X64 T;  1W09 A;  1PUA A;  4C2Y A;  3EXN A;  1Z4R A;  2GU2 A; 
#chains in the Genus database with same CATH homology
 3H37 A;  1QSR A;  4EIW A;  1MIV A;  4QUS A;  2ACX A;  3F57 A;  2HPJ A;  2LSJ A;  5L3E B;  2PDO A;  3I9S A;  3OJA A;  4UFW A;  3RYF E;  1S7L A;  1WR6 A;  1YKH B;  5G20 A;  2D0U A;  1FEW A;  1IJ5 A;  3FXE B;  3GA8 A;  3KVA A;  4IHJ E;  1S7K A;  1XIX A;  2ZW4 A;  4KSA A;  2IW5 B;  1EZ3 A;  5F47 A;  3UUX B;  4B5P B;  4H9N C;  5C82 A;  3I1A A;  3LK2 B;  3FYN A;  3CVR A;  1S7N A;  2NW8 A;  2HH7 A;  3BQL A;  2KZ7 B;  4PJL A;  3PTR B;  5DJQ C;  4E7S A;  1BR1 A;  4UIG A;  4P09 A;  3O1I A;  3N2O A;  1UFH A;  5IB0 A;  1CUN A;  5HWY A;  2X7B A;  4U5Y A;  3C64 A;  2X9Y A;  4H9Q C;  3RYO A;  2V7L A;  2VKD A;  3D0T A;  3ZJ0 A;  1YRE A;  2D4P A;  2FS5 A;  2JMK A;  1WWZ A;  2BUE A;  4CYP A;  4H9S E;  3S6F A;  4MI4 A;  4Z8X A;  3P2H A;  4DBR A;  4MFZ A;  1IAP A;  3BLN A;  4CYN A;  3UTK A;  3D8P A;  5FNV E;  5HXH A;  4O4L E;  2ODV A;  4AI6 A;  3DNS A;  3ONX A;  2KT9 A;  2GIV A;  4UA3 A;  1G73 A;  1UCU A;  2VKO A;  4ONU A;  4KLV A;  1CM0 A;  4A33 A;  4KP3 C;  2CWY A;  1ZKE A;  2XHE B;  3IWE A;  3ZMS B;  4BJN A;  3H5Z A;  3CPZ A;  4ZI7 E;  4O8S A;  2HUZ A;  3MKD A;  1I1D A;  2X9X A;  3CWZ B;  4LUA A;  1M4G A;  3CX6 B;  2CY2 A;  4XPL A;  4CAW A;  5BMV E;  4JUY A;  4J2C A;  4PK6 A;  3MAC A;  4OLL A;  5HH1 A;  2OB0 A;  2Q44 A;  4I49 A;  3FNC A;  3KV5 A;  3SXN A;  3ZMV B;  3ZYL A;  4DNC A;  3PUR A;  4BAY B;  2YU2 A;  1Y7R A;  3Q2M A;  4I4T E;  4Q38 A;  5G21 A;  2Q9Q D;  4H6U A;  1HX8 A;  4AQF A;  1Z4R A;  2MYS A;  4TV9 E;  4QC6 A;  3N2K E;  3MGD A;  3CX7 B;  2LHR A;  2NW7 A;  4UVB B;  3ZMT B;  3N9O A;  2CXF A;  4IE6 A;  2Z3N A;  3GY9 A;  4ZGY B;  2XAG B;  2Y48 B;  5AG4 A;  3ZN0 B;  4H63 V;  1KUY A;  2WWU A;  4EYU A;  1MIW A;  1D1A A;  3U3I A;  3ZEF B;  2CNM A;  3E0Z A;  4NXY A;  4MJ8 A;  3R84 B;  4DND A;  4HFV A;  3HR0 A;  2MTQ A;  4UWI A;  3I0Q A;  3RPU A;  1P0H A;  3N9N A;  5IYZ E;  5GCN A;  2KXP B;  2SPC A;  5F48 A;  2FIA A;  4IE7 A;  4X1Y E;  3CQC B;  4MFQ A;  4CAX A;  2FCK A;  4XBF B;  3BJ7 A;  3FRM A;  5E96 A;  2VKH A;  2YNE A;  5AG5 A;  1U5P A;  5EBV A;  4DBQ A;  2CWO A;  3E08 A;  5J8C A;  4MY3 A;  1YVK A;  3IEE A;  4EOZ B;  2NOX A;  3LG7 A;  2FT0 A;  2Z3M A;  2IL4 A;  3C4W A;  3W6S A;  1US7 B;  4CI3 B;  3L3P A;  5JDL A;  4AQF C;  3JC6 C;  2OA5 A;  1S3Z A;  2OH1 A;  2Q04 A;  1UX4 A;  2CXL A;  3OYZ A;  1I12 A;  4U9Y A;  4NCZ A;  2UXN B;  2RP4 A;  4I55 E;  3N9M A;  3PDY A;  1D0Z A;  3ANW A;  4OK0 A;  2PC1 A;  3IHR A;  2W00 A;  4TUY E;  1YKE B;  2JQQ A;  4HKA A;  1BO4 A;  2Z3L A;  2Z3P A;  3I9W A;  3FBU A;  4FD6 A;  4KVM E;  4R57 A;  2QML A;  5KTA A;  4PW8 A;  1KNZ A;  1WRD A;  2Q4Y A;  4OFZ A;  1YD8 G;  5JVD E;  3R9F A;  2X9W A;  4PNI A;  2G0B A;  4KOT A;  2IC6 A;  3C4X A;  4YJ3 E;  5CNP A;  3GMI A;  2OU2 A;  2LSY A;  3SOL A;  3ESL A;  3BQK A;  4JXQ A;  2LE8 A;  5A28 A;  2K24 A;  3GN5 A;  2JLM A;  1B6B A;  2R8V A;  3Q5W A;  2NWB A;  4MAL A;  5LP6 E;  3R6N A;  1TIQ A;  1QUU A;  3F31 A;  4IGU A;  2DPS A;  1WYC A;  4H89 A;  2DI4 A;  4GOU A;  1S60 A;  5ETW A;  3DTO A;  4UF0 A;  2NW9 A;  3N7Z A;  3TO6 A;  2REF A;  4F6A A;  3KFW X;  3PUQ A;  5IX3 A;  4NSQ A;  2B5G B;  3TKL B;  2CXA A;  3B8G A;  4NEX A;  1KK7 A;  3ZN1 B;  4TV8 E;  5JPH A;  4XAX B;  3DP7 A;  3NBX X;  2BDE A;  1V9D A;  1E1H B;  4QWN B;  5H84 A;  4IE5 A;  3S4U A;  3EDV A;  5FP3 A;  2YNC A;  1IIC A;  4KLW A;  4XNH B;  3C50 A;  1OWA A;  2ZPA A;  5J2T E;  2OZG A;  4CXW A;  3SHP A;  3EVY A;  4YHJ A;  2REE A;  1MMA A;  2E9X B;  2M67 A;  5AFU L;  2N9D A;  3OYX A;  2I79 A;  4XPK A;  4MFR A;  4ISS A;  3KV9 A;  2LT3 A;  3P8C D;  4WBO A;  5KDM C;  3MZK B;  2WBL A;  4PV6 A;  5HWX A;  5LA6 E;  4O2A E;  3ZMZ B;  4KS9 A;  2JPF A;  4YLH A;  4AVA A;  3ZPO A;  5JRE A;  5IV0 A;  4AQG A;  3R95 A;  3MJX A;  1NWM X;  1P4N A;  3H3A A;  1QSM A;  2R1I A;  3MXZ A;  3EC4 A;  3F8K A;  2VXK A;  3NE7 A;  4Y49 C;  1QSD A;  4B11 A;  4CYO A;  2G3T A;  4O2B E;  2CCQ A;  1LVF A;  1HFA A;  2JMH A;  2WAU A;  3IBP A;  4ZI3 C;  5FVJ A;  1OXZ A;  1BOB A;  1MJB A;  2VB6 A;  5ADX L;  2VI7 A;  4TN7 B;  5JR9 C;  2W61 A;  1HF8 A;  1FY7 A;  3QUJ A;  3Q5X A;  4MBU A;  4B12 A;  4C90 A;  4P0A A;  1KUX A;  4U9Z A;  4UWJ A;  4UVA B;  2V26 A;  3IF8 B;  2DCF A;  4HN9 A;  1VOM A;  3ZMU B;  1YX0 A;  3JVN A;  3HKD E;  5LJM A;  1WYB A;  1RXT A;  2W0G A;  2VAS A;  4X1K E;  4ZI2 D;  3R1K A;  5JR9 A;  3DR8 A;  4HKF A;  2JJ9 A;  2Z6E A;  2J8M A;  2E9X D;  3T9Y A;  3ZZI A;  4MFJ A;  4ADZ A;  1LRZ A;  3ETU A;  3J9X 1;  3UUN A;  2X66 A;  3G3S A;  3ZYM A;  3AA1 B;  5FXX A;  2FXF A;  3M65 A;  4UV8 B;  1Q2C A;  2DWK A;  4GS4 A;  4CZZ B;  3AVR A;  3F2E A;  4JWP A;  3RRW A;  4U74 A;  2PR1 A;  4YFJ A;  2DHR A;  4UFX A;  5EK4 A;  4CAE A;  1HCI A;  1D1B A;  1HG5 A;  2I00 A;  1MMN A;  2KND A;  3LOD A;  3SWH A;  3C51 A;  1S7F A;  2GAN A;  4A56 A;  3N9Q A;  3A5X A;  3P7I A;  2X68 A;  3ZYK A;  3K3Q C;  5LXT E;  2LSK A;  3V5U A;  4E7Z A;  3IU2 A;  4X20 E;  1U6M A;  4AVB A;  3EUH A;  4GK5 E;  2C5J A;  5JR9 B;  5IHY A;  3TCV A;  3PU8 A;  2XAH B;  3E22 E;  5JH7 E;  2WM9 A;  4DO0 A;  3S6G A;  5LHG B;  1WK4 A;  2X0L B;  2JRK A;  3FBZ A;  2ZW5 A;  1S5K A;  4PK5 A;  2YEV C;  3K3O A;  3PZJ A;  2KWI B;  5DAB A;  3BQI A;  1VRB A;  4PJM A;  5JRC A;  4ZI3 D;  1IYK A;  4QXH B;  4CI1 B;  2P6G A;  3I9Y A;  2DWG A;  3O1H A;  2WPX A;  2P9B A;  3NRY A;  5DWN A;  3AAE B;  4L0R A;  2PBI A;  4G2A A;  2YU1 A;  2H5M A;  2R7H A;  5F8P A;  2DXQ A;  4MY0 A;  1YGH A;  4CXX A;  2CA5 A;  3TO7 A;  5FY0 A;  2V7I A;  5I0C A;  3AAA B;  3PUA A;  3R96 A;  2H7O A;  4ERR A;  1HS7 A;  4J3G A;  3C98 B;  4X1I E;  4KOS A;  2P6E A;  4PK2 A;  5F46 A;  4II9 A;  2E9X C;  4JLY A;  5J1G A;  3NZP A;  2WMN A;  2NP9 A;  2K9A A;  3UFE A;  2A4N A;  2A3D A;  3JC6 D;  2EHO A;  2ODU A;  3LJC A;  2C27 A;  4ZOL E;  2G0U A;  4DMV A;  4R3L A;  4CGL A;  2VBQ A;  4CS0 B;  4XZC A;  3UT5 E;  2D0T A;  5M4Y A;  1MJ9 A;  2KCW A;  2BVM A;  3KV4 A;  3LFM A;  1RO5 A;  1FMW A;  2L9Q A;  1FIO A;  2PQ8 A;  4PJJ A;  3IGR A;  3AB3 B;  4CGM A;  4FD5 A;  5J2U E;  4XPD C;  3WAK A;  5LJN A;  3N9P A;  4I50 E;  4UFV A;  3FIX A;  1T98 A;  3QAH A;  3K8P C;  4V1A v;  4AB7 A;  1U4Q A;  2H7V C;  3CQX C;  4O4I E;  1Y64 B;  5JDF A;  5DQW A;  5CB4 E;  3RH3 A;  4ANJ A;  4L8A A;  4H6Z A;  4HNW B;  2A2F X;  2KIN B;  4QXB B;  3PU3 A;  4PAG A;  2CXD A;  4JJX A;  4YJ2 E;  4N78 D;  4B6X A;  1FMV A;  5LOV E;  5L3C B;  2R98 A;  1Q2D A;  4JXR A;  4YGO A;  3SXO A;  4KOV A;  2EHO D;  5KTC A;  3GKR A;  5LBQ B;  4YRH A;  1AJ3 A;  2V7J A;  2HPL A;  4IF5 A;  4R9M A;  2JDC A;  1VKC A;  4CGP A;  3TFY A;  2ZM8 A;  1ON0 A;  4FD4 A;  4PJN A;  5C8Y E;  1M44 A;  5H6R B;  3ZJ2 A;  1ZHC A;  3KV6 A;  3T8O A;  3FBL A;  3CXQ A;  3OKQ A;  1LVK A;  1BR4 A;  4GIW A;  2D2S A;  4WNK A;  1WLX A;  3Q9D A;  3ZC0 A;  1X79 A;  5HXR A;  1MK4 A;  2NTX A;  3KVB A;  4YFS A;  1M1D A;  5FY7 A;  3P2F A;  4NUV A;  2G3A A;  2ZW7 A;  4QVT A;  5KTD A;  4UV9 B;  4AKR B;  2Y6X A;  4F6R C;  5CA1 E;  2ARH A;  3IU1 A;  2PRB A;  4NF1 A;  1MIY A;  4B10 A;  5LHH B;  5ISV A;  1KUV A;  1YW0 A;  4PFP A;  2EVN A;  2ZXV A;  3PUG A;  3LK4 2;  1K4J A;  2J8R A;  2H3R A;  3CKD A;  4QXC B;  3E0K A;  4HNX B;  4UCP A;  4UCN A;  3HI2 A;  2E8I A;  3S6H A;  5FMN A;  2J8N A;  3OBV E;  3CX8 B;  1D1C A;  2XAJ B;  2QA7 A;  2GK9 A;  2FIW A;  2CLY C;  2VQY A;  2HQY A;  2WMO A;  2XAS B;  2XUE A;  4I43 B;  5FY1 A;  5LG4 A;  2D5U A;  3FHN A;  3DDD A;  2MBG A;  4WW0 A;  2N1G A;  1Z0P A;  1YR0 A;  2O28 A;  3PGP A;  4PK3 A;  4QB9 A;  4JD6 A;  2BZB A;  2J1D G;  5DWM A;  1IZN B;  3NRX A;  5JDN A;  2Y0M A;  3ZC1 A;  4XPD B;  4R87 A;  4QKN A;  3T90 A;  3QK6 A;  4BA9 A;  5LNK A;  3DR6 A;  1Z4E A;  3NZQ A;  5EK2 A;  2N2N A;  4EB6 E;  4KUA A;  1QSO A;  4ZBG A;  4CAF A;  4CGN A;  1D0Y A;  2CLY B;  4F0Y A;  4IUS A;  4C7I A;  4CI2 B;  2Z0Z A;  2ZLY A;  2L8K A;  3CML A;  4M1P A;  3W15 B;  3N2G E;  1M4D A;  2K5T A;  4HTE A;  1IB1 E;  2PR8 A;  2QEC A;  5KMG P;  2OZH A;  3FXT A;  4G63 A;  1ZEE A;  4EZH A;  4KUM B;  2GE3 A;  3I3G A;  3F5B A;  4UEL A;  4CQI A;  5L3D B;  3G8W A;  4OAE A;  4AVC A;  2F5I A;  2P6F A;  4LX9 A;  4AKI A;  2K48 A;  4A2Z A;  1YLE A;  3O1J A;  2YK0 A;  3D2M A;  5KX5 E;  2C0S A;  4JEU B;  5LYJ E;  4GK0 E;  1YK3 A;  2B4B A;  3UY5 A;  2LSG A;  1KZF A;  1M4I A;  2FSR A;  4MHC A;  1H7C A;  1R57 A;  4RS2 A;  3ANW B;  3LBX A;  2XTL A;  3QC9 A;  4DVD A;  4CYQ A;  2PJQ A;  3PE0 A;  1OZP A;  3K9U A;  4MHD A;  4F0X A;  1XE4 A;  3GYA A;  4OYJ A;  4ZS3 A;  4NUU A;  1J4J A;  1QSN A;  3CXP A;  4OAD A;  3WR7 A;  2LHN A;  4KMC A;  2MOZ A;  5FXZ A;  2RC4 A;  1GHE A;  4C7H A;  3KBT A;  2WUU A;  4P0B A;  4MFP A;  4QBJ A;  4H63 H;  4KBM B;  3VU7 H;  3R9G A;  3DSB A;  3A9L A;  2C5I T;  5JQ4 A;  4C91 A;  2WSA A;  3AA7 B;  5H86 A;  4KVO E;  3H4Q A;  2CM0 A;  2ZM2 A;  3EDU A;  4PSX A;  5EK3 A;  5A1L A;  4B5P A;  4C2X A;  3B57 A;  5AGE A;  4UVC B;  5JDQ A;  2Q7B A;  2VEZ A;  1MNE A;  2Z3O A;  4L89 A;  2V1D B;  5H6Q B;  2WPW A;  3EFA A;  4UCM A;  5G1Z A;  1D0X A;  2CMR A;  4AG9 A;  4TZ4 C;  4CRY B;  3IWG A;  4FD7 A;  4JEH B;  5EC4 A;  1ZV4 X;  5HXS A;  4TX5 A;  3SS1 A;  4EVY A;  3V8I A;  5L3B B;  2B58 A;  2QIR A;  2E9X A;  2XAQ B;  4OYK A;  1SHZ C;  5LCY A;  5LHI B;  3PP9 A;  2BVL A;  2V7K A;  4KOU A;  2JDD A;  3HA4 A;  3B13 A;  1Z9U A;  4M3S A;  4A30 A;  2I59 A;  2DLR A;  3N5L A;  4IST A;  2LSI A;  2VK9 A;  3VKH A;  3TO9 A;  1V0C A;  2CNT A;  3LBX B;  4M85 A;  1YVO A;  4RI1 A;  2B4D A;  1HTJ F;  4L5G A;  3CQG B;  3QB8 A;  2A72 A;  3FB2 A;  5DQV A;  3BJ8 A;  3FB3 A;  1MMD A;  2VL8 A;  3C4Z A;  3KDS E;  4O4H E;  2X9H A;  5TAO A;  4AKL A;  2B3U A;  3AAI A;  4OHF A;  5JRC B;  2P0W A;  1CJW A;  3KKW A;  1Y9K A;  2B3V A;  2B4D B;  2EHO B;  4ASK A;  3N9L A;  5HMN A;  2WSS V;  2IC9 A;  3ZJ1 A;  5HXC A;  1XMT A;  5GON E;  2LEH A;  1NMT A;  5F49 A;  3TT2 A;  4B13 A;  4CRZ B;  4AG7 A;  4A32 A;  3RC8 A;  1B87 A;  2Z3K A;  1HG2 A;  2EUI A;  4E0A A;  1XEB A;  2ZW6 A;  4IIJ E;  3RYI E;  4CXY A;  1IID A;  4HE8 A;  4IDZ A;  2PSW A;  4AXP A;  2NMT A;  1BR0 A;  1IYL A;  4UXN B;  5FXW A;  4EYY R;  3JTK A;  3D2P A;  5BWA B;  3D3S A;  1UX5 A;  5HAX A;  2DNX A;  2Q4V A;  2W63 A;  1ZO0 A;  5C88 A;  3UUL A;  1VHS A;  1MMG A;  1QST A;  3PUS A;  2Q9Q C;  2EHO C;  2L3L A;  3I0O A;  5FYM A;  1LKX A;  5FXV A;  5L3F B;  2OZU A;  1O3X A;  2Z10 A;  3OWC A;  2LM9 A;  2ATR A;  3VWE A;  2UXX B;  2XQY A;  4UF0 B;  4ILU A;  4ZI2 C;  4KOY A;  2CE7 A;  4KVX A;  4HNY B;  4HEA A;  4H9P C;  2XAF B;  4PK4 A;  3SRZ A;  2ZM0 A;  4DMW A;  2B5G A;  2JEV A;  5A27 A;  2KLQ A;  1Q2Y A;  1SQH A;  4FJO A;  3C26 A;  3EO4 A;  3FXD B;  2ZMA A;  5LBM A;  3ZCJ A;  5LGT B;  2BSW A;  3O4X E;  4XNH C;  3VWD A;  2FL4 A;  4QX8 B;  5F3J A;  2CNS A;  3K3N A;  2YGW A;  5J8F A;  3ZCI A;  4ORF A;  2X51 A;  3KBU A;  3GN5 B;  4H9O C;  2AE6 A;  2PFV A;  2FE7 A;  3VHL A;  2LOP A;  5E0O A;  2IAK A;  3GWH A;  5JDM A;  4B5O A;  3LK3 B;  2W62 A;  5LGU B;  4HGA A;  2VZZ A;  1IJ6 A;  2Y8D A;  3HL6 A;  4JLE A;  5JQG E;  4K30 A;  3L09 A;  5HYA A;  4CAV A;  3RKO A;  3V5S A;  4EXT A;  1XF8 A;  3KIN B;  4Q36 A;  3RYC E;  5L2L A;  4IE0 A;  1NE9 A;  4KOW A;  2BEI A;  4UBR A;  2VKJ A;  4BJM A;  3AA6 B;  1S94 A;  1NAF A;  4AKG A;  3TTH A;  4C68 A;  1MJA A;  5CA0 E;  2D4O A;  3HKB E;  2Q9Q B;  3TOB A;  4B14 A;  4AKH A;  4R3K A;  4K0U A;  2VZY A;  4C2Z A;  2C5K T;  4IE4 A;  1Y9W A;  2K5B B;  4PSW A;  4UEM A;  5AG7 A;  2ES0 A;  5HXE A;  2DPT A;  4H9R C;  2QGS A;  3MK7 C;  4KOR A;  5AG6 A;  4Y49 B;  4GYR A;  2Q9Q A;  5LGN B;  2Q0Y A;  4KOX A;  2LOS A;  4X5K A;  4QX7 B;  1MND A;  2KWH A;  3HKC E;  4MLK A;  4QHO A;  4U72 A;  3CXS A;  2BL1 A;  4E2A A;  3J7Y q;  2VWA A;  1L0C A;  2X67 A;  4BBH A;  3LD2 A;  3WAJ A;  3DJB A;  4GYS A;  3HKE E;  5EZY E;  5JDH A;  3TOA A;  2YNC C;  4MFL A;  1N71 A;  1B7T A;  4CGO A;  1BR2 A;  2NTY A;  4MFK A;  3VKG A;  4KUB A;  3W6X A;  1S35 A;  4E8O A;  2V7M A;  1NSL A;  4KZT A;  2Z11 A;  3EY5 A;  2LJL A;  4MBQ A;  4FI5 A;  2AJ6 A;  2RA1 A;  4L9I A;  4EZ4 A;  2YIN A;  5JDG A;  3F0A A;  2B1E A;  2YND A;  3AVS A;  4A31 A;  4BMH A;  2PG8 A;  1PU9 A;  4ZS2 A;  3RX6 A;  4WBN E;  3BK9 A;  4EAH A;  3O9X A;  3UUM A;  3ZLI A;  3RC3 A;  3R9E A;  3S6K A;  3AA0 B;  4KSF A;  3RYH E;  4O4J E;  1I21 A;  5G22 A;  1G8X A;  4PFO A;  3WI3 A;  2CEA A;  3U78 A;  3W91 A;  3ETV A;  2HV2 A;  3RRC A;  3MA9 A;  5L3G B;  4A95 A;  4ZHQ E;  3JUW A;  1SA0 E;  1PUA A;  4C2Y A;  3EXN A;  3TE4 A;  2KMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...