1LRZA

X-ray crystal structure of staphylococcus aureus fema
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
412
structure length
400
Chain Sequence
b'MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords factor essential for expression of methicillin resistance
publication title X-ray crystal structure of Staphylococcus aureus FemA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic inhibitor
total genus 137
structure length 400
sequence length 412
ec nomenclature ec 2.3.2.17: N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N(6)-glycyl)-D-alanyl-D-
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02388 FemAB FemAB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1lrzA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA02
1L0CA 5I0CA 2HV2A 4CQIA 1XE4A 5F48A 2Z10A 1ON0A 2JEVA 5F47A 1UFHA 1M1DA 3FXEB 1MJBA 2C5IT 4L89A 3TE4A 4MI4A 4DNCA 4FD4A 5E96A 4AVCA 1S5KA 2CNSA 2PRBA 2G0BA 3PZJA 4JD6A 3TO7A 3FIXA 5FVJA 5KTAA 3S6KA 2FXFA 4NSQA 5C88A 4BMHA 4CAWA 3V8IA 2J8RA 4R9MA 3GKRA 4KLVA 4F6AA 3R96A 2Q4YA 1M4GA 2FT0A 3MXZA 3R1KA 1J4JA 1S7KA 3EY5A 1Z0PA 3E0KA 3ZJ0A 2OZUA 1LRZA 1YVKA 4KORA 4YRHA 3FB3A 2QECA 2D4PA 5F49A 4AB7A 2B4DA 4MY0A 4Y49C 4E8OA 1I21A 5GCNA 4R57A 4UBRA 5EBVA 2R1IA 4QC6A 2Q0YA 3EFAA 2K48A 4FD7A 2P6GA 4PV6A 5JPHA 4KUAA 2QMLA 3EC4A 2C5KT 5HH1A 1IYLA 4CRZB 2OZHA 4QUSA 2Q7BA 3TOBA 4KOSA 2CNMA 1KZFA 4QBJA 4ORFA 3N5LA 1SQHA 1P0HA 4J2CA 3DR6A 4NF1A 3TTHA 3JVNA 4XPDC 3FBUA 4JXRA 2Z0ZA 4M3SA 1QSMA 2R7HA 2GE3A 3DR8A 1YX0A 2X7BA 3SXOA 3C26A 2IL4A 2HUZA 4CAXA 2VBQA 1YR0A 1PU9A 2D4OA 4EYYR 2B4DB 3DSBA 2K5TA 4B5OA 4ZBGA 2VZZA 4Y49B 3S6GA 1WK4A 2FIWA 2OB0A 3P2HA 3T90A 3S6FA 2AJ6A 1S3ZA 4R3KA 3JUWA 2P0WA 2B5GA 3CXPA 4UA3A 4JWPA 3W91A 1B87A 2CNTA 3FNCA 5J8CA 1KUVA 1N71A 2REFA 1XIXA 2R8VA 4KVXA 1VHSA 1M44A 1YK3A 2ZW4A 4L0RA 3QAHA 4MBUA 4XPKA 3TO9A 2C27A 2ARHA 1I12A 4NXYA 2PR1A 1KUXA 1V0CA 4AVBA 5IB0A 4EVYA 4XPDB 2GANA 2Q44A 5C82A 2OU2A 4HNXB 3LODA 2X9YA 2Y0MA 3MGDA 3TFYA 5DWMA 4PSWA 3S6HA 3CXQA 4X5KA 1MJAA 2P6FA 2EVNA 4FD6A 1Z4EA 2KCWA 3DNSA 2B5GB 1Q2YA 3I3GA 4U9ZA 2ZW6A 3VWEA 1WWZA 2VEZA 2JDCA 4HNWB 1GHEA 2JLMA 2G0UA 1Z9UA 2A4NA 4KVOE 2ZW7A 4DNDA 4KOWA 3EO4A 1RO5A 2F5IA 4AG7A 4I49A 3D8PA 2B58A 2WPWA 1S7LA 2CA5A 1LVFA 1R57A 4PK3A 4KOXA 4KLWA 2KWIB 3UY5A 3FXDB 3B8GA 3TKLB 3L3PA 1M4DA 2WPXA 4F0YA 4MHDA 1S7NA 2BSWA 1XF8A 1MJ9A 2PR8A 4MJ8A 2B4BA 5F46A 1QSRA 2OZGA 3NE7A 4XNHC 4QVTA 4R87A 2J8NA 4H6UA 3BJ7A 4II9A 5HMNA 3R95A 2MBGA 2OH1A 3IWGA 4KOTA 1CJWA 2G3TA 2VZYA 3D2MA 3G3SA 4K30A 1YGHA 4U5YA 1QSNA 1FY7A 4OADA 1Y9WA 3IGRA 1RXTA 3R9GA 2R98A 4E0AA 3R9EA 3OWCA 2B3VA 1IJ5A 4JJXA 1XMTA 1IYKA 3QK6A 2I00A 4YGOA 4UWIA 2FL4A 1ZKEA 1K4JA 2BEIA 2QIRA 4GS4A 3GYAA 1OZPA 1IICA 4R3LA 4OLLA 1H7CA 2VXKA 4CS0B 4IF5A 4KOVA 1CM0A 1BO4A 3DDDA 4RI1A 4PSXA 3FXTA 4U9YA 3N7ZA 4UWJA 3I9SA 5DWNA 1QSDA 1B6BA 2RC4A 3SHPA 5J8FA 3D3SA 3CVRA 3LD2A 1P4NA 4H89A 1YREA 3GY9A 4XNHB 4HNYB 5IV0A 3D2PA 4KZTA 3PGPA 3S4UA 2IC9A 2AE6A 5H86A 1NMTA 3BJ8A 3FYNA 4LX9A 2X9WA 2HQYA 3ZZIA 1NE9A 3T9YA 5CNPA 4RS2A 4FI5A 5EC4A 2Q4VA 1NSLA 2FE7A 1QSTA 4CAVA 1M4IA 3TOAA 4KVME 4J3GA 2JDDA 4MY3A 3SXNA 1IB1E 1PUAA 2FCKA 1IIDA 2PC1A 2Z11A 3F8KA 2IC6A 2PQ8A 2FSRA 1YVOA 4PK2A 4KOYA 4ONUA 1TIQA 3G8WA 2PSWA 4B5PA 2H5MA 3PP9A 4AG9A 2XTLA 4FD5A 4HKFA 1IJ6A 5KTCA 2VI7A 2PDOA 3CXSA 3WR7A 2KWHA 3W6SA 4OAEA 2C5JA 1Q2CA 2FIAA 4JXQA 2B3UA 2BUEA 5KTDA 1Q2DA 2GIVA 3QUJA 2J8MA 4JLYA 2CY2A 4M85A 1KUYA 1XEBA 2NMTA 1U6MA 2ATRA 1Z4RA 4B6XA 3F0AA 3W6XA 2FS5A 3VWDA 2BL1A 2O28A 5H84A 1VKCA 4L8AA 3TT2A 4NCZA 1S60A 2ZPAA 4XPLA 4CRYB 4YFJA 3FRMA 3KKWA 2DXQA 2ZXVA 3K9UA 4E2AA 5JQ4A 2G3AA 3H4QA 2I79A 1QSOA 2P6EA 3CKDA 3TCVA 3TO6A 4H6ZA 4QB9A 4B5PB 3EXNA 3BLNA 3P2FA 5IX3A 3F5BA 3RYOA 2VQYA 1BOBA 4NEXA 5ISVA 4KUBA 2EUIA 2ZW5A 1S7FA 1Y7RA 4KOUA 3P7IA 4LUAA 1Y9KA 2REEA 3QB8A 4IUSA 1I1DA 1YLEA 3R9FA 2X9XA 2Q04A 1MK4A 4AVAA
chains in the Genus database with same CATH superfamily
1JQGA 4I0UA 2HV2A 3RQUA 4X65T 4CQIA 4DR7T 3ZC0A 2ZENA 2Z10A 5F48A 2CE7A 2JEVA 1M1DA 1VHEA 1JNRA 2C5IT 3JRUA 4MI4A 2K5BB 3C98B 4CN6A 5E96A 2H3RA 1CPSA 2LM9A 1LOKA 4AKGA 2JEWA 2XEJA 4G1PA 3C4XA 4JD6A 3FIXA 5FVJA 1HEEA 4CGNA 1X12A 4EWTA 4NSQA 2AFOA 1W09A 4BMHA 4Q36A 3V8IA 2J8RA 2ZLYA 1F57A 5LYJE 2XQ3A 3PUGA 1FEWA 4JI8T 3PDYA 3CX7B 3MXZA 2X9HA 1D1CA 4P09A 1J4JA 1S7KA 3EY5A 4Z8XA 1YVKA 1MIWA 3O1IA 4MCPA 4DR3T 2QECA 3AA1B 4U3CA 1WCRA 4P4EA 4NGNA 4ZYQA 3OPCA 4Y49C 5LHIB 4F9UA 4UBRA 5HCMA 3UU4A 1QLBA 3TLTA 2GLFA 4NUVA 2Q0YA 3EFAA 4FD7A 3ONLC 5JPHA 4MHZA 1WR0A 2QMLA 5IHYA 1D1BA 5HH1A 3OJAA 2DCFA 1IYLA 2G9DA 2VK9A 2R6GF 4FUUA 2X0HA 2QGSA 5DS0A 5AQNB 3ZJ1A 4X66T 2UXNB 5CJ5A 4KOSA 4EB6E 2WBLA 2PJ2A 2Q4ZA 4YTMA 2XQYA 3UU5A 3GWHA 5HEJA 1H8LA 4B3MT 2MOZA 1M4LA 2KNDA 3N5LA 4QWNB 1YQ4A 1SQHA 2UXBT 2PG8A 2CHNA 5G20A 3DR6A 4NF1A 4MMOA 4ZZBA 1F2OA 4E7SA 3JTKA 2B1EA 4CYNA 3S9NA 3JVNA 5HWYA 4UIAA 4XPDC 5LRKA 3FBUA 5HXDA 3ZMZB 5JDNA 2C6GA 1PYTB 1SE7A 4CAXA 2LJLA 2XY8B 4IDQA 2IJZA 1YKHB 3DSBA 3SJXA 2JBKA 2K5TA 1D0XA 3OYXA 2VZZA 4Y49B 3LWUA 2M6BA 3VH9A 3S6GA 2OB0A 3AEDA 2V7LA 3EUHA 2LSIA 2AJ6A 2CTCA 1NSAA 2XM2A 4AI6A 2B5GA 4HE8A 4HEAA 4YXDA 5HVHA 2K3WA 4UA3A 5JDFA 3BQKA 3OYZA 1SUMB 1B87A 4U72A 2X67A 3QAYA 5H6RB 2WQYA 3H3AA 1R8IA 4KVXA 3P4RA 4XPKA 3TO9A 3WC6A 3LG7A 2I0MA 2ARHA 4IAVA 2EHOC 1KUXA 1V0CA 4AVBA 2XQ8A 2VQET 4B3RT 2NTXA 4P4BA 5IB0A 4AQGA 4XPDB 5H6QB 3N9PA 2GANA 5C82A 1WLXA 4JI5T 2E5LT 3AECA 2Y0MA 4YFSA 2PFVA 4ZHQE 3B35A 4ZI3C 2Z3KA 5AQQB 4WYVA 1N33T 2IMLA 1CG2A 4MFQA 3K3NA 3ZLIA 1J5ET 2XEIA 4IDPA 4DV2T 3JC6D 4EIWA 2B5GB 2A72A 4U9ZA 2CXAA 3PUYF 3NE8A 1XBUA 3I0QA 4Q38A 4UFXA 3SJGA 3RYFE 2ZW6A 1WWZA 4HNWB 3AE9A 1TKJA 2A4NA 5E0OA 4DNDA 1CP7A 3RHWA 4AXVA 3NA6A 4CI3B 2AFZA 2FJEA 1VHOA 2BVLA 2WPWA 4NGMA 2CA5A 2O53A 1R57A 2PIYA 2KLQA 2ZOFA 4KOXA 3VATA 2ODUA 4DBQA 1XZYA 3M65A 2CLYB 4A39A 2FVGA 2WPXA 4O4JE 4MLKA 4F0YA 3PTRB 2ZEPA 5J1QA 3F31A 2ES0A 2PR8A 2B4BA 4EZHA 3FZKB 3SJEA 5JH9A 5AQSB 2PVVA 3PJAJ 3RC8A 3FMCA 1YW4A 1LVKA 5LJMA 4II9A 3RGLA 3RZAA 2XJ7A 2MBGA 1OWAA 4PJNA 1FMVA 5ABFA 1Y01A 2JBJA 4CN4A 3G3SA 3P4QA 3ZT7A 2F8HA 4YSYA 2EK8A 3IGRA 4BAYB 4AKRB 4A98A 1Z5RA 3R9EA 4JYWA 2WY2A 3AA6B 5AG4A 3D66A 1UUSA 4JJXA 1IBKT 3L39A 2GFQA 5DQWA 4MFJA 2PJ1A 2C6CA 2CWOA 2I00A 2PIZA 1TXRA 2YEVC 3N2KE 4GS4A 4MRIA 1FMWA 3GYAA 4R3LA 3E08A 3I0OA 3TLUA 5CA1E 2LRKA 1CP6A 2YU2A 4LF9T 4ILAA 4RI1A 4MCRA 3D7GA 4X2TA 1PCAA 3T1YT 4TN7B 4U9YA 4EEDA 4HGAA 4UWJA 3RLFF 1B6BA 5J8FA 4MCQA 1OXZA 4A97A 3GY9A 4UR9A 4KZTA 3CQXC 3PGPA 2NWBA 4R8FA 3S4UA 2E9XC 4N78D 2E9XA 4OC3A 2AFWA 1D1AA 5ABFB 5LBQB 1XRYA 1NMTA 2Q43A 1HR0T 3D68A 3H8GA 5AQIB 4GIWA 3GIUA 2QA7A 2CBIA 2V7KA 2X9WA 2JJ9A 2YOEA 3T9YA 2JQ9A 4RS2A 4FI5A 5EC4A 1WR6A 2FE7A 4AKHA 4CZZB 1LFWA 4KVME 3VU7H 2PJQA 3HL6A 2JDDA 5FVKA 3BK9A 4B11A 3FX6A 3ZYMA 2CCQA 5HVFA 1KFYA 4CXWA 3ZN1B 5LHHB 3AAAB 3QB5K 2CM0A 3CK6A 3N9LA 4MFPA 2LKHA 1IY7A 1IIDA 4O2BE 1D0YA 4MFZA 2IC6A 1V9DA 2PQ8A 2L3LA 4PXDA 5G22A 2JQKA 4KOYA 2XQ7A 2L8KA 3AE4A 2NW8A 3JCFA 4AKLA 3G8WA 2PSWA 5CA0E 5AQPB 4JYAT 4HFCA 5LBMA 3L8RA 3FZMB 2C1CA 2E9XB 3ZC1A 4QXHB 4AQFA 5KTDA 2PJ4A 3UUBA 2FJBA 3UT5E 1Q2DA 2BOAA 2GIVA 3QUJA 2VL1A 2LKGA 5LA6E 4JLYA 2BBJA 5FNVE 4PXBA 4F0XA 4M6IA 4ZI6A 5JM6A 2NYQA 4B6XA 4BINA 4NIQA 5GONE 2EO8A 3NBXX 3EDUA 2DPTA 5H84A 3PFEA 3CX6B 5LXTE 3TT2A 2W62A 4YFJA 4BBHA 5I4MA 4YTPA 2ZXVA 2W00A 5BMVE 5K8OA 2PJ8A 3B2YA 4W9YA 5KX5E 4TV9E 3A5XA 2BZBA 4A30A 5FP3A 4E2AA 2I3CA 2G3AA 2BKOA 4HFVA 5CGMA 3PU8A 3JAEA 2D5UA 3RI5A 4FJOA 3VR8A 4Q25A 2P9BA 2AFMA 4E7ZA 5IX3A 1TF9A 4O4IE 3RYOA 1VOMA 4QX7B 1BOBA 4A33A 5DJQC 5ISVA 1U5PA 2PJ6A 4XBFB 2EBJA 4KUBA 4IE0A 1S7FA 2WDQA 1Y7RA 2ABZA 4KOUA 5LB7B 3KQZA 4UVBB 3WI3A 3PUXF 3UU6A 2REEA 3QB8A 1I1DA 3M3ZB 1HDQA 4YTNA 4B6ZA 2Q04A 2K9AA 1L0CA 4X5TA 2ANPA 5LRGA 1ON0A 2N1GA 3FH4A 3RRWA 3KDSE 1Z8XA 1UK5A 1YQEA 3AE3A 4EXTA 3LSVA 2D2SA 3KINB 3KR5A 4K0UA 4AVCA 4C68A 2WSSV 4I55E 3DGVA 3UUNA 1S5KA 2PRBA 3AXJA 5KDMC 5KTAA 5EK4A 4ZOLE 3NH8A 1VRBA 2E9XD 3GKRA 3CIRA 1YW0A 3H8FA 3PE0A 2BS4A 3PB6X 1AMPA 4PJLA 4IHJE 3SWHA 5ETWA 1LKXA 1T8BA 3R1KA 4DV6T 1Z0PA 4ZX8A 2LM2A 3CMLA 3RQWA 3AE1A 3ZJ0A 3FJUA 2CBJA 4X64T 3D0TA 4A94A 2DWGA 2D4PA 1NEKA 4BA9A 2B4DA 4E8OA 2XAHB 2KT9A 2XZEA 2QVPA 1Y64B 2R1IA 3PUSA 3B5MA 2H89A 5J2TE 4PV6A 4PXEA 4ZX9A 4X1KE 3PUQA 4A95A 4C7HA 3EC4A 4ILUA 2C5KT 4ILCA 1DTDA 2BG9E 1VIXA 2MPKA 1ELMP 1HF8A 2LOSA 2CNMA 3KV4A 1NWMX 5LJNA 4TX5A 3AXJB 3V38A 2PJ0A 3KHZA 3IEEA 1P0HA 3FECA 2VASA 5FY0A 2BBHA 4U7YA 2WS3A 5IUXA 5LYIA 3LK42 1MMGA 1QSMA 3DR8A 4P10A 1YX0A 4A56A 2EK9A 2CXFA 1FT7A 5KXJA 3SXOA 4A2ZA 4HFBA 2HUZA 4QHOA 4U2ZA 3Q9DA 5HYAA 3GLJA 2B4DB 4IREA 2FIWA 2OV9A 1R43A 3S6FA 2RFHA 1KF6A 3JUWA 2NR4A 4TWDA 4NGQA 2V26A 2WDRA 4OYJA 4JWPA 3W91A 3NFZA 4CN1A 2CNTA 1NAFA 4JBWF 4AXPA 3D7HA 3IIBA 5J8CA 3ISXA 3TX8A 1BR1A 5L2LA 5LRJA 4GK0E 3KQXA 1XIXA 3WC7A 1HNXT 1T98A 1ARMA 4L0RA 5LGUB 2IQ6A 3RYCE 5JH7E 5HXHA 3FEEA 2C27A 4MBUA 4CGLA 1VCSA 3PB8X 2WMNA 4NXYA 2HPLA 2PR1A 4O2AE 4PK6A 2PJ7A 2PRQA 3RKOA 2YK0A 1AYEA 4PW8A 2XEFA 2BKPA 2Q44A 2JQQA 2XQ6A 3CQCB 3IWEA 2X9YA 4H9OC 4LMJA 4LQGA 5LMNT 2VVNA 1UX4A 4PSWA 5AGEA 4YHHT 3A8YC 5LYFA 2YN6A 3AE2A 2Z3LA 2MAWA 4UFVA 4C2ZA 3IU1A 4DBRA 2BS3A 1UWYA 3KHXA 4KP3C 3X1DA 1Z4EA 2KCWA 2I59A 3IJ3A 5ADXL 4NFRA 2WB5A 3I3GA 4UIGA 3GUXA 3K3OA 1NENA 4GKKT 5JQGE 3FZHB 2C0SA 1MIYA 5HXCA 3VWEA 2JDCA 4TWFA 4HKAA 2BVMA 4LF8T 2D0TA 3B3CA 3PRTA 3RX6A 2CIJA 5LG3A 4FWUA 2YU1A 2ZW7A 4KOWA 1ZLHA 1M62A 4TNWA 5JDMA 4UVAB 4YJ2E 4OHFA 4X20E 3D8PA 3IA3A 4WW0A 1S7LA 1LVFA 4KLWA 4X3RA 2ZM2A 4IL9A 2KWIB 3UY5A 4A5XA 3TLVA 3B8GA 1M4DA 4BD9A 4YU9A 1EZ3A 5FXVA 2VL0A 4ZY0A 4MHDA 4C2XA 1MJ9A 3MZKB 5F46A 3RC3A 1X10A 1QSRA 2OZGA 3B3SA 2Y6XA 2FJAA 2HN1A 4CYOA 4F6RC 4H6UA 4RN7A 5HMNA 3QOFA 4KOTA 4L9IA 1CJWA 2G3TA 3VRAA 4YSXA 2VZYA 4FAIA 1ZG7A 3D2MA 4K30A 2DWKA 5AFUL 2AFSA 4U5YA 2CEAA 1BR2A 2WZHA 1HX8A 4OADA 2J62A 3H8EA 3JADA 2R98A 4OFZA 4H9PC 1XMOT 3NVOA 3MK7C 3MA9A 4YGOA 4UWIA 2LSKA 1K4JA 2GK9A 2QIRA 2WSAA 4IL4A 2ZEOA 3D4UA 1BLLE 1OZPA 5BWAB 4OLLA 2Q7SA 4P6YA 4DYOA 4OC4A 4JEUB 4IF5A 2PCUA 3LK2B 4PSXA 3P8CD 3ZSSA 3V7ZA 3N7ZA 3RPUA 3ZMSB 2WZIA 3TC8A 2EHOA 2IDOB 1OBRA 4H89A 2V8HA 4NPPA 2E8IA 4JI0T 5AQJB 3J9X1 4OP4A 2ZOGA 2IC9A 2JMKA 4DV5T 4B3TT 2XAQB 3NZPA 4X8IA 1IBLT 3BJ8A 4CAFA 2JPFA 4LX9A 1HFAA 1NE9A 3SJFA 2NOXA 2QJ8A 1M7KA 3I9WA 1ZG9A 2PJAA 3CZXA 3OKQA 3KVBA 3UULA 1QSTA 5LP6E 1M4IA 3TOAA 2JRKA 4J3GA 4H9NC 4XAXB 3KV5A 4MY3A 3VR9A 5IYZE 1PUAA 5L4EA 1BPMA 4YLHA 1HTJF 4HWIB 4H9SE 2PTFA 2Z11A 2D0UA 2VKDA 3MN8A 3KV9A 1YVOA 3E0ZA 4OC2A 1ELLP 3RIUC 2N9DA 3RIUA 4PAGA 3NRYA 3C4ZA 1UX5A 3K3QC 3C64A 4B5PA 3WAKA 2EHOB 4AG9A 2XTLA 5HCJA 4FD5A 5KTCA 5K8PA 2VI7A 2PDOA 4ZXLA 1BAVA 3HKCE 3C4WA 4C90A 3DLJA 2CRBA 2C5JA 1Q2CA 1YXRA 2J1DG 4JXQA 2M67A 2HB6A 2B3UA 2BUEA 4V1Av 1T72A 1FIOA 1B7TA 2J8MA 4FBEA 1A2ZA 3N5FA 2X66A 2F4VT 2BG9C 1IGBA 1XDPA 4DR6T 2BG9A 4YHJA 3ETVA 4CYPA 5ABHA 3ETUA 2FS5A 4C2YA 5AQLB 1JNZA 2YNCC 2OOTA 5EMIA 1YMEA 3VWDA 2YNCA 2BL1A 2O28A 4L8AA 3KVAA 4NCZA 4OK0A 3PUZF 2ZPAA 1TF8A 4TNUA 2XQAA 1G73A 3SI0A 5HEUA 3LACA 3DJBA 2DEAA 4DV0T 4ZI7E 3K9UA 3B13A 1S94A 2IUBA 2I79A 1LAPA 5LYDA 4O4HE 4QB9A 4EOZB 4B5PB 2XAGB 3R6NA 3BLNA 3P2FA 4ZI2C 2LRLA 5HWXA 2PJ3A 4OIDA 4C7IA 3NH4A 4IE6A 1Y0YA 3C50A 3P50A 3AEFA 1OEDE 3PURA 2ZW5A 4U2YA 1XOVA 5G21A 3IEHA 4LUAA 4DUKA 1HS7A 5BR8T 3PFOA 3SFDA 2LHRA 3PBEA 5IB9A 3R9FA 3J7Yq 2X9XA 2F7VA 3H5ZA 1MMAA 2IW5B 2IIUA 4LQ6A 2BG9B 4G2AA 4XZCA 3U3IA 3IHRA 2BCOA 5F09A 4H2KA 4LFBT 4ZZCA 3FXEB 1MJBA 4UFWA 4CXYA 1G8XA 3HKDE 4L89A 3TE4A 2XQ5A 1I94T 4FD4A 2JMHA 3CQGB 1HX1B 1X9BA 2CNSA 2EHOD 5L3CB 2VKHA 5C88A 2B76A 2CXDA 2Z6EA 1J1JA 4CAWA 3IWWA 4B12A 4IIJE 5L3FB 4KLVA 1FJGT 3R96A 2Q4YA 2FT0A 3AVSA 5AQTB 3K8PC 4ZI3D 5JR9C 3Q5EA 3E0KA 5JR9A 2V8VA 4DV3T 4YY3T 4UCMA 4KORA 3ZT5A 4EFDA 4YRHA 2XPKA 4HFHA 4F8HA 5LMUT 3FB3A 5F49A 2BO9A 2Q51A 5AG7A 1I21A 5D8NA 5GCNA 3RH3A 2UXXB 1XWMA 5CBMA 3ZJ2A 4R57A 1SA0E 2K48A 2P6GA 2A9UA 1GQEA 5K8NA 2LHNA 4QXBB 4NGTA 4WZXA 2OZHA 2Y48B 2CHOA 1WRDA 4PFOA 2Q7BA 4MHYA 3O1HA 3CPAA 5A1LA 4P0AA 2MYSA 4QBJA 4ORFA 1T7SA 1ZOYA 4KSIA 2NP9A 1QQ9A 4EEBA 1KEYA 1XFOA 5JVDE 2J9AA 3TTHA 3GB0A 4JXRA 4JUYA 2ZEHA 2Z0ZA 1D0ZA 2R7HA 2GE3A 3O4XE 5AG6A 2FUPA 3OBVE 2V5CA 2W67A 5JR9B 2LE8A 2Q9QC 2X7BA 3KFWX 3C26A 2Q9QA 3AB3B 2PVWA 4COFA 3QC9A 1YR0A 2D4OA 1WYCA 4EYYR 4Z90A 2XAFB 3AVRA 1CPXA 4B5OA 4ZBGA 2WWVA 1FNOA 2ZELA 4IHMA 4PNIA 5LNKA 1CUNA 4DO0A 4EV6A 3HUVA 5HEOA 3T90A 2DNXA 2ODVA 4QXCB 3Q5XA 2X68A 1HG2A 2BDEA 1S3ZA 4R3KA 2P0WA 3BXMA 5CFBA 4ZY1A 1S35A 3LK3B 3PJAA 3TLWA 2WM9A 5AQUB 1X79A 2HPJA 5AQGB 5L47A 4OMEA 4AKIA 2WU2A 1N71A 2REFA 5KMGP 5TAOA 2IHR1 1M44A 1ZG8A 5C3JA 2A3DA 4ZY2A 2ZEDA 4KI0F 4X1YE 5EZYE 4EVYA 5A28A 5DQVA 3EVYA 1W0AA 3SI1A 4CPAA 4HNXB 1IOFA 3MGDA 2Q9QB 3RBUA 3WABA 2RB7A 3BI0A 5DWMA 4KSFA 2ZM0A 3C51A 4MXUA 5AQHB 3CXQA 1HG5A 4DR1T 2RP4A 1MJAA 2W63A 4KUMB 4KX6A 2P6FA 2EVNA 4FD6A 4PXCA 2W2UA 1XDOA 3AA0B 1L0VA 3BI1A 1Q2YA 4CGPA 4H63V 3CWZB 1TKFA 1VGYA 3B3TA 4JI4T 4WNKA 3KASA 4UEFA 2V7JA 2VEZA 3WC5A 3SRZA 1GHEA 2G0UA 3PUWF 3FF3A 4KVOE 3EABA 2D9DA 5FL1A 2X51A 1MMDA 2NTYA 4PQAA 2F5IA 4I49A 3Q5WA 4BJMA 1HDUA 4UELA 3CDXA 4A32A 4MFKA 3AEAA 3TKLB 2ZM6T 3L3PA 2VURA 1IAPA 4L5GA 2CXLA 3TLSA 3P4PA 1XF8A 2EWBA 1UGOA 2DL1A 4MJ8A 3I1UA 4F9VA 5L4HA 5L3EB 3NE7A 4XNHC 4LF6T 4B14A 4QVTA 5JREA 2J8NA 5AQKB 5LGTB 1RTQA 3CT9A 2WDVA 2K24A 5JDQA 5HXRA 3WAJA 2X0LB 2OH1A 3R95A 2PJBA 2I6HA 3ZKRA 1QSNA 2J47A 3ZPOA 4O4LE 2LEHA 1RXTA 5AQVB 2UU9T 4RUHA 2V5DA 5ELYA 3UQ7A 4CXXA 1KWMA 2Z3NA 2B3VA 1WYBA 1IJ5A 3EAMA 1XMTA 2QRXA 1IYKA 5JGFA 3V5UA 4AISA 3QK6A 2SPCA 3PB9X 2AE9A 1ZKEA 2NW7A 2DF5A 2BEIA 1H7CA 2DPSA 1CBXA 2LSYA 1CM0A 4P4IA 5K8MA 3RNZA 1BO4A 4K3NA 2YDRA 5LYLA 3FXTA 1YLOA 5DWNA 1QSDA 5EK2A 3FB2A 1OEDC 3LD2A 1OEDA 1YREA 3GA8A 4XNHB 5IV0A 4IE5A 4MBQA 4ISTA 3GN5A 4LF5T 2AE6A 1J5WA 4U31A 5M4YA 4CGOA 2V8SV 5THWA 5ABGA 5H86A 2N2NA 4HWDA 3FYNA 3VKGA 4OIWA 5HAXA 3W15B 3JC6C 2HQYA 4CYQA 5HXSA 1AJ3A 4R7MA 2Q4VA 4OC1A 4P45A 4CAVA 4OYKA 1GYTA 2UXCT 4YT0A 5FL0A 4X62T 2UUCT 3T8WA 5FVLA 3SXNA 3GMIA 3AAIA 4F8ZA 4ONWA 2RPAA 2V1DB 4QKNA 3N2OA 5JRCA 2PC1A 3AAEB 4HTEA 2WZNA 3HLPA 4P44A 4IDOA 4ASKA 4TNVA 4C91A 4TUYE 2UUBT 3I1AA 3PB7X 4ONUA 3AEGA 1TIQA 3VARA 1KNZA 3CX8B 1HCIA 4TWHA 1LAMA 2H5MA 3WT4A 4R6TA 4MFLA 1OEDB 1BR4A 4OC5A 3ZEFB 2ZEEA 3UFEA 1ZHCA 4X1IE 3GN5B 3WR7A 2KWHA 4IE4A 3PEIA 3W6SA 4OAEA 2FIAA 2ZEGA 2V77A 2Z3PA 3AEBA 1XNRT 4NJQA 3FHNA 3IBPA 4DR2T 2CY2A 3N9QA 4PFPA 4PK5A 4UIBA 1KUYA 1XEBA 3ZYKA 3ABVA 4GXHA 2ATRA 5FMNA 2DLRA 4AIUA 2DHRA 4GM5A 5L3GB 2V8GA 3W6XA 1E1HB 1N36T 2H7OA 6CPAA 2WMOA 4IGUA 4Z91A 4A38A 1VKCA 1W0BA 4DMVA 1S60A 4XPLA 4CRYB 2BKNA 3FRMA 4IDNA 3KKWA 1QUUA 2KZ7B 5JRCB 4O23A 3RKGA 2XUEA 4JLEA 5AQRB 3LMSA 3KR4A 5A27A 5LCYA 2PJ9A 3H4QA 1ZLIA 4NUUA 1YQ3A 2P6EA 3CKDA 3TO6A 1VCTA 4H6ZA 3T8OA 3D7DA 3P4SA 3F5BA 3NZQA 4ZEYA 2V7IA 5L3BB 4ANJA 4HN9A 4DUYT 4LF7T 4WJBA 2Z3OA 4ILBA 1TKHA 3OTOT 3IFEA 3RIFA 4MHPA 4QH5A 4UVCB 5JDGA 4IUSA 1YLEA 4DVDA 5CB4E 4OKOA 4AVAA 3PUAA 3HI2A 2ZM8A 5I0CA 2C6PA 3RIAA 1XE4A 3S9LA 2XEGA 4DV1T 5LGNB 1N34T 5F47A 3LDQB 1UFHA 3HKBE 3VKHA 3H3MA 4DNCA 5ABEA 2CLYC 4P4FA 3UFGA 4PJJA 2HH7A 4WBNE 3A7MA 3AEEA 4IT4A 3F2EA 3PZJA 2QYVA 2G0BA 3B7IA 3TO7A 3N9MA 2VKJA 3S6KA 2FXFA 4WWVA 4AQYT 4JI6T 4GKJT 4P4JA 2CPTA 4R9MA 3HR0A 3ZT6A 1E2AA 4F6AA 1M4GA 3ONXA 4UCNA 3PBBA 3AE7A 5HEHA 2PJ5A 5F5WA 3T1HT 1HNWT 3IC1A 1Z8LA 2ZEMA 2OZUA 1LRZA 4H9QC 2LLYA 1E7PA 4U33A 4NGRA 1R3NA 4AB7A 1Z8WA 4MY0A 3NKZA 4JI2T 1EE3P 3P4WA 4EMEA 4M6HA 2XHEB 3SI2A 3LFMA 5EBVA 4LF4T 3AE5A 3KZWA 4QC6A 4EYUA 4KUAA 1Y0RA 4A37A 4TWEA 1IZNB 3D7FA 4ISSA 4NXMT 4CRZB 5EK3A 4QUSA 3TOBA 5C2TA 3L2NA 2AFUA 4YSZA 1SHZC 2KMFA 2VQFT 4MALA 5HXEA 3UUMA 3N9OA 4JZ0A 3KGQA 3S9MA 1KZFA 3FBZA 1JWQA 5FKYA 4CGMA 1Y7EA 3RF1A 2GU2A 4J2CA 2ODFA 2NW9A 5J0ZA 2CF4A 3MJXA 7CPAA 2FBWA 1ZO0A 4M3SA 3EI0A 4MHCA 4GK5E 4GYSA 2XASB 1IBMT 3JAFA 4UV8B 2IL4A 2JQHA 2QVAA 2VBQA 4HPSA 3ZMTB 3A9LA 1PU9A 3CPZA 5C8YE 4NJRA 2VWAA 1W9RA 4KHZF 2VB6A 5CPAA 3R84B 2XQ9A 3EHZA 1WK4A 3P2HA 3ZYLA 2FJDA 4UEZA 2HC9A 2E5VA 3EDVA 3CXPA 5AQOB 4JI3T 4O8SA 4KMCA 5J1GA 5JTGA 4HWCA 1BPNA 5F8PA 2CWYA 2V6YA 3FNCA 4MCSA 2J4GA 5G1ZA 4IE7A 1KUVA 5FXXA 2XQ4A 4P1NA 5FY7A 2R8VA 2GREA 1VHSA 3O9XA 1YK3A 2ZW4A 3QAHA 2ZEFA 3VRBA 1ZEEA 2W0GA 5JDLA 3O1JA 1I12A 2X0YA 3UTKA 5FY1A 2QYWA 3PB4X 3MKDA 1KNPA 4Q7AA 4Z65A 3ZMUB 3FZLB 4PK4A 3RYIE 2WP9A 2ACXA 3V5SA 2OU2A 3LODA 4DUZT 3MACA 4ADZA 3I9YA 1ZV4X 3TFYA 4EAHA 3S6HA 4X5KA 3NWIA 4H63H 4DIDB 3ANWA 2POKA 3IF8B 2XSBA 4B10A 1US7B 4I4TE 3DNSA 4EGWA 2AXDS 1UURA 2GLJA 4JV5T 3NRXA 3B57A 3ZN0B 5LHGB 3FEDA 3PV0F 2XSAA 3PU3A 3PUVF 5AQFB 2VVSA 2YKSA 1KK7A 4DV7T 2JLMA 4B13A 2V6YB 1Z9UA 3SS1A 4CAEA 1XMBA 1XNQT 2E2AA 3EO4A 4EZ4A 1RO5A 4AG7A 3K2KA 2B58A 3FZFB 2HHHT 1LANA 4PK3A 1LCPA 2YINA 4GOUA 2XAJB 2PJCA 3RO0A 4HWHA 3FXDB 3K1SA 2ACZA 3UQ4A 2OLTA 3RYHE 1MNDA 4AQFC 1S7NA 2BSWA 3L09A 4UF0A 3B3WA 3DTOA 1MMNA 5FXZA 2PBIA 2LOPA 2WU5A 3HKEE 4K0KT 2V8DA 5AQMB 5AG5A 4R76A 4R87A 1DE4C 2LSGA 3BJ7A 3ANWB 3U78A 3IWGA 4YWYA 4H9RC 4HFIA 4ZGYB 4GYRA 1YGHA 5FXWA 3F57A 1FY7A 2IAKA 1Y9WA 3K9TA 3R9GA 4JI7T 3KL9A 4E0AA 2CMRA 1Z2LA 5HEGA 2W66A 3OWCA 2W4XA 1Z8TA 2WWUA 2AFXA 4TZ4C 4NXNT 3IU2A 2W61A 5JDHA 4I43B 3ZCIA 4B3ST 4G63A 4CI1B 2FL4A 4KHPT 3ISZA 3QNVA 2CTBA 2WYRA 1IICA 5HVGA 1N32T 2VKOA 2VXKA 1IOIA 4CS0B 2M6IA 4KOVA 4HWFA 2V6XA 3DDDA 4HFDA 2YGWA 2YNEA 3BQLA 1ZP0A 4ZI2D 2OR4A 4LFAT 3I9SA 4UF0B 3SFEA 2RC4A 3SHPA 4BJNA 4ZS3A 3D3SA 3VHLA 4MFRA 5IWAT 1F2PA 1QMUA 3CVRA 2H88A 1P4NA 2ZMAA 1I6ZA 1ARLA 3AE8A 4UEEA 4HNYB 3D2PA 3ZCJA 2H7VC 3H37A 4QH4A 4NGPA 4YJ3E 4LFCT 1YSJA 2VL8A 4M6GA 2KINB 2UUAT 3CPXA 3BHXA 3BQIA 4JEHB 2OA5A 1U4QA 3B3VA 3LJCA 4DJLA 4QX8B 3ZZIA 2HN2A 2L9QA 4I50E 1WFDA 5CNPA 5LG4A 1NSLA 4PPZA 5FYMA 2JIWA 2BS2A 3RRCA 8CPAA 3ZMVB 3SOLA 4QH1A 3N9NA 2XM1A 5LOVE 4UF4A 1IB1E 1MNEA 3FVLA 4OX9T 2FCKA 5J2UE 1MIVA 4UXNB 3F8KA 3UU8A 3KBTA 1DU2A 2FSRA 3D67A 3OVUA 1BR0A 4PK2A 3UUXB 2WAUA 3N2GE 2YDQA 3AA7B 2YNDA 3G06A 3LBXA 3KI9A 3PP9A 4LMLA 4HKFA 1IJ6A 4DR4T 1O3XA 4CI2B 4LMKA 3CXSA 3RAMA 4HFEA 4IK2A 4KSAA 4IDZA 4ERRA 3QB5A 4A31A 2YDSA 4KBMB 4UEMA 4U74A 2WUUA 3E22E 2O4HA 5D29A 3Q5DA 3ONJA 2PE3A 4PJMA 4M85A 3DP7A 4OC0A 2WCAA 1Z8UA 5L3DB 2NMTA 4M1PA 3ZSTA 1U6MA 1Z4RA 4P4DA 3F0AA 3Q2MA 4DR5T 2LSJA 5DABA 4UCPA 1XJOA 1YD8G 3KV6A 1KNRA 4TV8E 2Y8DA 2NSMA 3UU3A 2A2FX 4KS9A 3ESLA 2LT3A 1AUGA 2KSRA 4P0BA 2RA1A 4DMWA 1YW6A 2DXQA 3QNUA 4DV4T 1UCUA 2DI4A 1XMQT 2UXDT 4UV9B 5JQ4A 3HA4A 2Q9QD 1HNZT 1QSOA 4ZS2A 4MHNA 2KXPB 3TCVA 3AE6A 1YKEB 1CHUA 3EXNA 3LBXB 3KBUA 3IO1A 2VQYA 2MTQA 2IMOA 2V7MA 4NEXA 2Z3MA 2EUIA 4JI1T 1CX8A 1Q7LA 3MRUA 1IU8A 3NH5A 4U7IA 3P7IA 1Y9KA 3FBLA 4WBOA 4NGSA 1MK4A 5F3JA
chains in the Genus database with same CATH topology
2HV2A 4CQIA 3ZC0A 5F48A 2Z10A 2CE7A 2JEVA 1M1DA 2C5IT 4MI4A 2K5BB 3C98B 5E96A 2H3RA 2LM9A 4AKGA 4JD6A 4CGNA 3C4XA 3FIXA 5FVJA 4NSQA 4BMHA 4Q36A 3V8IA 2J8RA 2ZLYA 5LYJE 3PUGA 1FEWA 3PDYA 3CX7B 3MXZA 2X9HA 1D1CA 4P09A 1J4JA 1S7KA 3EY5A 4Z8XA 1YVKA 1MIWA 3O1IA 2QECA 3AA1B 4Y49C 5LHIB 4UBRA 2Q0YA 3EFAA 4NUVA 4FD7A 5JPHA 2QMLA 5IHYA 1D1BA 5HH1A 3OJAA 2DCFA 1IYLA 2VK9A 2QGSA 3ZJ1A 2UXNB 4KOSA 4EB6E 2WBLA 2XQYA 3GWHA 2MOZA 2KNDA 3N5LA 4QWNB 1SQHA 2PG8A 5G20A 3DR6A 4NF1A 3JTKA 4E7SA 2B1EA 4CYNA 3JVNA 5HWYA 4XPDC 3FBUA 3ZMZB 5JDNA 4CAXA 2LJLA 1YKHB 3DSBA 2K5TA 1D0XA 3OYXA 2VZZA 4Y49B 3S6GA 2OB0A 2V7LA 3EUHA 2LSIA 2AJ6A 2B5GA 4AI6A 4HE8A 4HEAA 4UA3A 5JDFA 3BQKA 3OYZA 1B87A 4U72A 2X67A 5H6RB 3H3AA 4KVXA 4XPKA 3TO9A 3LG7A 2ARHA 2EHOC 1KUXA 1V0CA 4AVBA 2NTXA 5IB0A 4AQGA 4XPDB 5H6QB 3N9PA 2GANA 5C82A 1WLXA 2Y0MA 4YFSA 2PFVA 4ZHQE 4ZI3C 2Z3KA 4MFQA 3K3NA 3ZLIA 3JC6D 4EIWA 2B5GB 2A72A 4U9ZA 2CXAA 4UFXA 4Q38A 3I0QA 3RYFE 2ZW6A 1WWZA 4HNWB 2A4NA 5E0OA 4DNDA 4CI3B 2BVLA 2WPWA 2CA5A 1R57A 2KLQA 4KOXA 2ODUA 4DBQA 3M65A 2CLYB 2WPXA 4O4JE 4MLKA 4F0YA 3PTRB 3F31A 2ES0A 2PR8A 2B4BA 4EZHA 3RC8A 1LVKA 5LJMA 4II9A 2MBGA 1OWAA 4PJNA 1FMVA 3G3SA 3IGRA 4BAYB 4AKRB 3R9EA 3AA6B 5AG4A 4JJXA 5DQWA 4MFJA 2CWOA 2I00A 2YEVC 3N2KE 4GS4A 1FMWA 3GYAA 4R3LA 3E08A 3I0OA 5CA1E 2YU2A 4RI1A 4TN7B 4U9YA 4UWJA 4HGAA 1B6BA 5J8FA 1OXZA 3GY9A 4KZTA 3CQXC 3PGPA 2NWBA 3S4UA 2E9XC 4N78D 2E9XA 1D1AA 5LBQB 1NMTA 4GIWA 2QA7A 2V7KA 2X9WA 2JJ9A 3T9YA 4RS2A 4FI5A 5EC4A 1WR6A 2FE7A 4AKHA 4CZZB 4KVME 3VU7H 2PJQA 3HL6A 2JDDA 3BK9A 4B11A 3ZYMA 2CCQA 4CXWA 3ZN1B 5LHHB 3AAAB 2CM0A 3N9LA 4MFPA 1IIDA 4O2BE 1D0YA 4MFZA 2IC6A 1V9DA 2PQ8A 2L3LA 5G22A 4KOYA 2L8KA 2NW8A 4AKLA 3G8WA 2PSWA 5CA0E 5LBMA 2E9XB 3ZC1A 4QXHB 4AQFA 5KTDA 3UT5E 1Q2DA 2GIVA 3QUJA 5LA6E 4JLYA 5FNVE 4F0XA 4B6XA 5GONE 3NBXX 3EDUA 2DPTA 5H84A 3CX6B 5LXTE 3TT2A 2W62A 4YFJA 4BBHA 2ZXVA 2W00A 5BMVE 5KX5E 4TV9E 3A5XA 2BZBA 4A30A 5FP3A 4E2AA 2G3AA 4HFVA 3PU8A 2D5UA 4FJOA 2P9BA 4E7ZA 5IX3A 4O4IE 3RYOA 1VOMA 4QX7B 1BOBA 4A33A 5DJQC 5ISVA 1U5PA 4XBFB 4KUBA 4IE0A 1S7FA 1Y7RA 4KOUA 4UVBB 3WI3A 2REEA 3QB8A 1I1DA 2Q04A 2K9AA 1L0CA 1ON0A 2N1GA 3RRWA 3KDSE 4EXTA 2D2SA 3KINB 4K0UA 4AVCA 4C68A 2WSSV 4I55E 3UUNA 1S5KA 2PRBA 5KDMC 5KTAA 5EK4A 4ZOLE 1VRBA 2E9XD 3GKRA 1YW0A 3PE0A 4PJLA 4IHJE 3SWHA 5ETWA 1LKXA 3R1KA 1Z0PA 3CMLA 3ZJ0A 3D0TA 2DWGA 2D4PA 4BA9A 2B4DA 4E8OA 2XAHB 2KT9A 1Y64B 2R1IA 3PUSA 5J2TE 4PV6A 4X1KE 3PUQA 4A95A 4C7HA 3EC4A 4ILUA 2C5KT 1HF8A 2LOSA 2CNMA 3KV4A 1NWMX 5LJNA 4TX5A 3IEEA 1P0HA 2VASA 5FY0A 3LK42 1MMGA 1QSMA 3DR8A 1YX0A 4A56A 2CXFA 3SXOA 4A2ZA 2HUZA 4QHOA 3Q9DA 5HYAA 2B4DB 2FIWA 3S6FA 3JUWA 2V26A 4OYJA 4JWPA 3W91A 2CNTA 1NAFA 4AXPA 5J8CA 1BR1A 5L2LA 4GK0E 1XIXA 1T98A 4L0RA 5LGUB 4MBUA 3RYCE 5JH7E 5HXHA 4CGLA 2C27A 2WMNA 4NXYA 2HPLA 2PR1A 4O2AE 4PK6A 3RKOA 2YK0A 4PW8A 2Q44A 2JQQA 3CQCB 3IWEA 2X9YA 4H9OC 1UX4A 4PSWA 5AGEA 2Z3LA 4UFVA 4C2ZA 3IU1A 4DBRA 4KP3C 1Z4EA 2KCWA 2I59A 5ADXL 3I3GA 4UIGA 3K3OA 5JQGE 2C0SA 1MIYA 5HXCA 3VWEA 2JDCA 4HKAA 2BVMA 2D0TA 3RX6A 2YU1A 2ZW7A 4KOWA 5JDMA 4UVAB 4YJ2E 4OHFA 4X20E 3D8PA 4WW0A 1S7LA 1LVFA 4KLWA 2ZM2A 2KWIB 3UY5A 3B8GA 1M4DA 1EZ3A 5FXVA 4MHDA 4C2XA 1MJ9A 3MZKB 5F46A 3RC3A 1QSRA 2OZGA 2Y6XA 4CYOA 4F6RC 4H6UA 5HMNA 4KOTA 4L9IA 1CJWA 2G3TA 2VZYA 3D2MA 4K30A 2DWKA 5AFUL 4U5YA 2CEAA 1BR2A 4OADA 1HX8A 2R98A 4OFZA 4H9PC 3MK7C 3MA9A 4YGOA 4UWIA 2LSKA 1K4JA 2GK9A 2QIRA 2WSAA 1OZPA 5BWAB 4OLLA 4JEUB 4IF5A 3LK2B 4PSXA 3P8CD 3N7ZA 3RPUA 3ZMSB 2EHOA 4H89A 2E8IA 3J9X1 2IC9A 2JMKA 2XAQB 3NZPA 3BJ8A 4CAFA 2JPFA 4LX9A 1HFAA 1NE9A 2NOXA 3I9WA 3OKQA 3KVBA 3UULA 1QSTA 5LP6E 1M4IA 3TOAA 2JRKA 4J3GA 4H9NC 4XAXB 3KV5A 4MY3A 5IYZE 1PUAA 4YLHA 1HTJF 4H9SE 2Z11A 2D0UA 2VKDA 3KV9A 1YVOA 3E0ZA 2N9DA 4PAGA 3NRYA 3C4ZA 1UX5A 3K3QC 3C64A 4B5PA 3WAKA 2EHOB 4AG9A 2XTLA 4FD5A 5KTCA 2VI7A 2PDOA 3HKCE 3C4WA 4C90A 2C5JA 1Q2CA 2J1DG 4JXQA 2M67A 2B3UA 2BUEA 4V1Av 1FIOA 1B7TA 2J8MA 2X66A 4YHJA 3ETVA 4CYPA 3ETUA 2FS5A 4C2YA 2YNCC 3VWDA 2YNCA 2BL1A 2O28A 4L8AA 3KVAA 4NCZA 4OK0A 2ZPAA 1G73A 3DJBA 4ZI7E 3K9UA 3B13A 1S94A 2I79A 4O4HE 4QB9A 4EOZB 4B5PB 2XAGB 3R6NA 3BLNA 3P2FA 4ZI2C 5HWXA 4C7IA 4IE6A 3C50A 3PURA 2ZW5A 5G21A 4LUAA 1HS7A 2LHRA 3R9FA 3J7Yq 2X9XA 3H5ZA 1MMAA 2IW5B 4G2AA 4XZCA 3U3IA 3IHRA 3FXEB 1MJBA 4UFWA 4CXYA 1G8XA 3HKDE 4L89A 3TE4A 4FD4A 2JMHA 3CQGB 2CNSA 2EHOD 5L3CB 2VKHA 5C88A 2CXDA 2Z6EA 4CAWA 4B12A 4IIJE 5L3FB 4KLVA 3R96A 2Q4YA 2FT0A 3AVSA 3K8PC 4ZI3D 5JR9C 3E0KA 5JR9A 4UCMA 4KORA 4YRHA 3FB3A 5F49A 5AG7A 1I21A 5GCNA 3RH3A 2UXXB 3ZJ2A 4R57A 1SA0E 2K48A 2P6GA 2LHNA 4QXBB 2OZHA 2Y48B 1WRDA 4PFOA 2Q7BA 3O1HA 5A1LA 4P0AA 2MYSA 4QBJA 4ORFA 2NP9A 5JVDE 3TTHA 4JXRA 4JUYA 2Z0ZA 1D0ZA 2R7HA 2GE3A 3O4XE 5AG6A 3OBVE 5JR9B 2LE8A 2Q9QC 2X7BA 3KFWX 3C26A 2Q9QA 3AB3B 3QC9A 1YR0A 2D4OA 1WYCA 4EYYR 2XAFB 3AVRA 4B5OA 4ZBGA 4PNIA 5LNKA 1CUNA 4DO0A 3T90A 2DNXA 2ODVA 4QXCB 3Q5XA 2X68A 1HG2A 2BDEA 1S3ZA 4R3KA 2P0WA 1S35A 3LK3B 2WM9A 1X79A 2HPJA 4AKIA 1N71A 2REFA 5KMGP 5TAOA 1M44A 2A3DA 4X1YE 5EZYE 4EVYA 5A28A 5DQVA 3EVYA 4HNXB 3MGDA 2Q9QB 5DWMA 4KSFA 2ZM0A 3C51A 3CXQA 1HG5A 2RP4A 1MJAA 2W63A 4KUMB 2P6FA 2EVNA 4FD6A 3AA0B 1Q2YA 4CGPA 4H63V 3CWZB 4WNKA 2V7JA 2VEZA 3SRZA 1GHEA 2G0UA 4KVOE 2X51A 1MMDA 2NTYA 2F5IA 4I49A 3Q5WA 4BJMA 4UELA 4A32A 4MFKA 3TKLB 3L3PA 1IAPA 4L5GA 2CXLA 1XF8A 4MJ8A 5L3EB 3NE7A 4XNHC 4B14A 4QVTA 5JREA 2J8NA 5LGTB 2K24A 5JDQA 3R95A 5HXRA 2X0LB 3WAJA 2OH1A 1QSNA 3ZPOA 4O4LE 2LEHA 1RXTA 4CXXA 2Z3NA 2B3VA 1WYBA 1IJ5A 1XMTA 1IYKA 3V5UA 3QK6A 2SPCA 1ZKEA 2NW7A 2BEIA 1H7CA 2DPSA 2LSYA 1CM0A 1BO4A 3FXTA 5DWNA 1QSDA 5EK2A 3FB2A 3LD2A 1YREA 3GA8A 4XNHB 5IV0A 4IE5A 4MBQA 4ISTA 3GN5A 2AE6A 5M4YA 4CGOA 5H86A 2N2NA 3FYNA 3VKGA 5HAXA 3W15B 3JC6C 2HQYA 4CYQA 5HXSA 1AJ3A 2Q4VA 4CAVA 4OYKA 3SXNA 3GMIA 3AAIA 2V1DB 4QKNA 3N2OA 5JRCA 2PC1A 3AAEB 4HTEA 4ASKA 4TUYE 4C91A 3I1AA 4ONUA 1TIQA 1KNZA 3CX8B 1HCIA 2H5MA 4MFLA 1BR4A 3ZEFB 3UFEA 1ZHCA 4X1IE 3GN5B 3WR7A 2KWHA 4IE4A 3W6SA 4OAEA 2FIAA 2Z3PA 3FHNA 3IBPA 2CY2A 3N9QA 4PFPA 4PK5A 1KUYA 1XEBA 3ZYKA 2ATRA 5FMNA 2DLRA 2DHRA 5L3GB 3W6XA 1E1HB 2H7OA 2WMOA 4IGUA 1VKCA 4DMVA 1S60A 4XPLA 4CRYB 3FRMA 3KKWA 1QUUA 2KZ7B 5JRCB 2XUEA 4JLEA 5A27A 5LCYA 3H4QA 4NUUA 2P6EA 3CKDA 3TO6A 4H6ZA 3T8OA 3F5BA 3NZQA 2V7IA 5L3BB 4ANJA 4HN9A 2Z3OA 4UVCB 5JDGA 4IUSA 1YLEA 4DVDA 5CB4E 4AVAA 3PUAA 3HI2A 2ZM8A 5I0CA 1XE4A 5LGNB 5F47A 1UFHA 3HKBE 3VKHA 4DNCA 2CLYC 4PJJA 2HH7A 4WBNE 3F2EA 3PZJA 2G0BA 3TO7A 3N9MA 2VKJA 3S6KA 2FXFA 4R9MA 3HR0A 4F6AA 1M4GA 3ONXA 4UCNA 2OZUA 1LRZA 4H9QC 4AB7A 4MY0A 2XHEB 3LFMA 5EBVA 4QC6A 4EYUA 4KUAA 1IZNB 4ISSA 4CRZB 5EK3A 4QUSA 3TOBA 1SHZC 2KMFA 4MALA 5HXEA 3UUMA 3N9OA 1KZFA 3FBZA 4CGMA 4J2CA 2NW9A 3MJXA 1ZO0A 4M3SA 4MHCA 4GK5E 4GYSA 2XASB 2IL4A 4UV8B 2VBQA 3ZMTB 3A9LA 1PU9A 3CPZA 5C8YE 2VWAA 2VB6A 3R84B 1WK4A 3P2HA 3ZYLA 3EDVA 3CXPA 4O8SA 4KMCA 5J1GA 5F8PA 2CWYA 3FNCA 5G1ZA 4IE7A 1KUVA 5FXXA 5FY7A 2R8VA 1VHSA 3O9XA 1YK3A 2ZW4A 3QAHA 1ZEEA 2W0GA 5JDLA 3O1JA 1I12A 3UTKA 5FY1A 3MKDA 3ZMUB 4PK4A 3RYIE 2ACXA 3V5SA 2OU2A 3LODA 3MACA 4ADZA 3I9YA 1ZV4X 3TFYA 4EAHA 3S6HA 4X5KA 4H63H 3ANWA 3IF8B 4B10A 1US7B 4I4TE 3DNSA 3NRXA 3B57A 3ZN0B 5LHGB 3PU3A 1KK7A 2JLMA 4B13A 1Z9UA 3SS1A 4CAEA 3EO4A 4EZ4A 1RO5A 4AG7A 2B58A 4PK3A 2YINA 4GOUA 2XAJB 3FXDB 3RYHE 1MNDA 4AQFC 1S7NA 2BSWA 3L09A 4UF0A 3DTOA 1MMNA 5FXZA 2PBIA 2LOPA 3HKEE 5AG5A 4R87A 2LSGA 3BJ7A 3ANWB 3U78A 3IWGA 4H9RC 4ZGYB 4GYRA 1YGHA 5FXWA 3F57A 1FY7A 2IAKA 1Y9WA 3R9GA 4E0AA 2CMRA 3OWCA 2WWUA 4TZ4C 3IU2A 2W61A 5JDHA 4I43B 3ZCIA 4G63A 4CI1B 2FL4A 1IICA 2VKOA 2VXKA 4CS0B 4KOVA 3DDDA 2YGWA 2YNEA 3BQLA 4ZI2D 3I9SA 4UF0B 2RC4A 3SHPA 4BJNA 4ZS3A 3D3SA 3VHLA 4MFRA 3CVRA 1P4NA 2ZMAA 4HNYB 3D2PA 3ZCJA 2H7VC 3H37A 4YJ3E 2VL8A 2KINB 3BQIA 4JEHB 2OA5A 1U4QA 3LJCA 4QX8B 3ZZIA 2L9QA 4I50E 5CNPA 5LG4A 1NSLA 5FYMA 3RRCA 3ZMVB 3SOLA 3N9NA 5LOVE 1IB1E 1MNEA 2FCKA 5J2UE 1MIVA 4UXNB 3F8KA 3KBTA 2FSRA 1BR0A 4PK2A 3UUXB 2WAUA 3N2GE 3AA7B 2YNDA 3LBXA 3PP9A 4HKFA 1IJ6A 1O3XA 4CI2B 3CXSA 4KSAA 4IDZA 4ERRA 4A31A 4KBMB 4UEMA 4U74A 2WUUA 3E22E 4PJMA 4M85A 3DP7A 5L3DB 2NMTA 4M1PA 1U6MA 1Z4RA 3F0AA 3Q2MA 2LSJA 5DABA 4UCPA 1YD8G 3KV6A 4TV8E 2Y8DA 2A2FX 4KS9A 3ESLA 2LT3A 4P0BA 2RA1A 4DMWA 2DXQA 1UCUA 2DI4A 4UV9B 5JQ4A 3HA4A 2Q9QD 1QSOA 4ZS2A 2KXPB 3TCVA 1YKEB 3EXNA 3LBXB 3KBUA 2VQYA 2MTQA 2V7MA 4NEXA 2Z3MA 2EUIA 3P7IA 1Y9KA 3FBLA 4WBOA 1MK4A 5F3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0C A;  5I0C A;  2HV2 A;  4CQI A;  1XE4 A;  5F48 A;  2Z10 A;  1ON0 A;  2JEV A;  5F47 A;  1UFH A;  1M1D A;  3FXE B;  1MJB A;  2C5I T;  4L89 A;  3TE4 A;  4MI4 A;  4DNC A;  4FD4 A;  5E96 A;  4AVC A;  1S5K A;  2CNS A;  2PRB A;  2G0B A;  3PZJ A;  4JD6 A;  3TO7 A;  3FIX A;  5FVJ A;  5KTA A;  3S6K A;  2FXF A;  4NSQ A;  5C88 A;  4BMH A;  4CAW A;  3V8I A;  2J8R A;  4R9M A;  3GKR A;  4KLV A;  4F6A A;  3R96 A;  2Q4Y A;  1M4G A;  2FT0 A;  3MXZ A;  3R1K A;  1J4J A;  1S7K A;  3EY5 A;  1Z0P A;  3E0K A;  3ZJ0 A;  2OZU A;  1LRZ A;  1YVK A;  4KOR A;  4YRH A;  3FB3 A;  2QEC A;  2D4P A;  5F49 A;  4AB7 A;  2B4D A;  4MY0 A;  4Y49 C;  4E8O A;  1I21 A;  5GCN A;  4R57 A;  4UBR A;  5EBV A;  2R1I A;  4QC6 A;  2Q0Y A;  3EFA A;  2K48 A;  4FD7 A;  2P6G A;  4PV6 A;  5JPH A;  4KUA A;  2QML A;  3EC4 A;  2C5K T;  5HH1 A;  1IYL A;  4CRZ B;  2OZH A;  4QUS A;  2Q7B A;  3TOB A;  4KOS A;  2CNM A;  1KZF A;  4QBJ A;  4ORF A;  3N5L A;  1SQH A;  1P0H A;  4J2C A;  3DR6 A;  4NF1 A;  3TTH A;  3JVN A;  4XPD C;  3FBU A;  4JXR A;  2Z0Z A;  4M3S A;  1QSM A;  2R7H A;  2GE3 A;  3DR8 A;  1YX0 A;  2X7B A;  3SXO A;  3C26 A;  2IL4 A;  2HUZ A;  4CAX A;  2VBQ A;  1YR0 A;  1PU9 A;  2D4O A;  4EYY R;  2B4D B;  3DSB A;  2K5T A;  4B5O A;  4ZBG A;  2VZZ A;  4Y49 B;  3S6G A;  1WK4 A;  2FIW A;  2OB0 A;  3P2H A;  3T90 A;  3S6F A;  2AJ6 A;  1S3Z A;  4R3K A;  3JUW A;  2P0W A;  2B5G A;  3CXP A;  4UA3 A;  4JWP A;  3W91 A;  1B87 A;  2CNT A;  3FNC A;  5J8C A;  1KUV A;  1N71 A;  2REF A;  1XIX A;  2R8V A;  4KVX A;  1VHS A;  1M44 A;  1YK3 A;  2ZW4 A;  4L0R A;  3QAH A;  4MBU A;  4XPK A;  3TO9 A;  2C27 A;  2ARH A;  1I12 A;  4NXY A;  2PR1 A;  1KUX A;  1V0C A;  4AVB A;  5IB0 A;  4EVY A;  4XPD B;  2GAN A;  2Q44 A;  5C82 A;  2OU2 A;  4HNX B;  3LOD A;  2X9Y A;  2Y0M A;  3MGD A;  3TFY A;  5DWM A;  4PSW A;  3S6H A;  3CXQ A;  4X5K A;  1MJA A;  2P6F A;  2EVN A;  4FD6 A;  1Z4E A;  2KCW A;  3DNS A;  2B5G B;  1Q2Y A;  3I3G A;  4U9Z A;  2ZW6 A;  3VWE A;  1WWZ A;  2VEZ A;  2JDC A;  4HNW B;  1GHE A;  2JLM A;  2G0U A;  1Z9U A;  2A4N A;  4KVO E;  2ZW7 A;  4DND A;  4KOW A;  3EO4 A;  1RO5 A;  2F5I A;  4AG7 A;  4I49 A;  3D8P A;  2B58 A;  2WPW A;  1S7L A;  2CA5 A;  1LVF A;  1R57 A;  4PK3 A;  4KOX A;  4KLW A;  2KWI B;  3UY5 A;  3FXD B;  3B8G A;  3TKL B;  3L3P A;  1M4D A;  2WPX A;  4F0Y A;  4MHD A;  1S7N A;  2BSW A;  1XF8 A;  1MJ9 A;  2PR8 A;  4MJ8 A;  2B4B A;  5F46 A;  1QSR A;  2OZG A;  3NE7 A;  4XNH C;  4QVT A;  4R87 A;  2J8N A;  4H6U A;  3BJ7 A;  4II9 A;  5HMN A;  3R95 A;  2MBG A;  2OH1 A;  3IWG A;  4KOT A;  1CJW A;  2G3T A;  2VZY A;  3D2M A;  3G3S A;  4K30 A;  1YGH A;  4U5Y A;  1QSN A;  1FY7 A;  4OAD A;  1Y9W A;  3IGR A;  1RXT A;  3R9G A;  2R98 A;  4E0A A;  3R9E A;  3OWC A;  2B3V A;  1IJ5 A;  4JJX A;  1XMT A;  1IYK A;  3QK6 A;  2I00 A;  4YGO A;  4UWI A;  2FL4 A;  1ZKE A;  1K4J A;  2BEI A;  2QIR A;  4GS4 A;  3GYA A;  1OZP A;  1IIC A;  4R3L A;  4OLL A;  1H7C A;  2VXK A;  4CS0 B;  4IF5 A;  4KOV A;  1CM0 A;  1BO4 A;  3DDD A;  4RI1 A;  4PSX A;  3FXT A;  4U9Y A;  3N7Z A;  4UWJ A;  3I9S A;  5DWN A;  1QSD A;  1B6B A;  2RC4 A;  3SHP A;  5J8F A;  3D3S A;  3CVR A;  3LD2 A;  1P4N A;  4H89 A;  1YRE A;  3GY9 A;  4XNH B;  4HNY B;  5IV0 A;  3D2P A;  4KZT A;  3PGP A;  3S4U A;  2IC9 A;  2AE6 A;  5H86 A;  1NMT A;  3BJ8 A;  3FYN A;  4LX9 A;  2X9W A;  2HQY A;  3ZZI A;  1NE9 A;  3T9Y A;  5CNP A;  4RS2 A;  4FI5 A;  5EC4 A;  2Q4V A;  1NSL A;  2FE7 A;  1QST A;  4CAV A;  1M4I A;  3TOA A;  4KVM E;  4J3G A;  2JDD A;  4MY3 A;  3SXN A;  1IB1 E;  1PUA A;  2FCK A;  1IID A;  2PC1 A;  2Z11 A;  3F8K A;  2IC6 A;  2PQ8 A;  2FSR A;  1YVO A;  4PK2 A;  4KOY A;  4ONU A;  1TIQ A;  3G8W A;  2PSW A;  4B5P A;  2H5M A;  3PP9 A;  4AG9 A;  2XTL A;  4FD5 A;  4HKF A;  1IJ6 A;  5KTC A;  2VI7 A;  2PDO A;  3CXS A;  3WR7 A;  2KWH A;  3W6S A;  4OAE A;  2C5J A;  1Q2C A;  2FIA A;  4JXQ A;  2B3U A;  2BUE A;  5KTD A;  1Q2D A;  2GIV A;  3QUJ A;  2J8M A;  4JLY A;  2CY2 A;  4M85 A;  1KUY A;  1XEB A;  2NMT A;  1U6M A;  2ATR A;  1Z4R A;  4B6X A;  3F0A A;  3W6X A;  2FS5 A;  3VWD A;  2BL1 A;  2O28 A;  5H84 A;  1VKC A;  4L8A A;  3TT2 A;  4NCZ A;  1S60 A;  2ZPA A;  4XPL A;  4CRY B;  4YFJ A;  3FRM A;  3KKW A;  2DXQ A;  2ZXV A;  3K9U A;  4E2A A;  5JQ4 A;  2G3A A;  3H4Q A;  2I79 A;  1QSO A;  2P6E A;  3CKD A;  3TCV A;  3TO6 A;  4H6Z A;  4QB9 A;  4B5P B;  3EXN A;  3BLN A;  3P2F A;  5IX3 A;  3F5B A;  3RYO A;  2VQY A;  1BOB A;  4NEX A;  5ISV A;  4KUB A;  2EUI A;  2ZW5 A;  1S7F A;  1Y7R A;  4KOU A;  3P7I A;  4LUA A;  1Y9K A;  2REE A;  3QB8 A;  4IUS A;  1I1D A;  1YLE A;  3R9F A;  2X9X A;  2Q04 A;  1MK4 A;  4AVA A; 
#chains in the Genus database with same CATH topology
 1JQG A;  4I0U A;  2HV2 A;  3RQU A;  4X65 T;  4CQI A;  4DR7 T;  3ZC0 A;  2ZEN A;  2Z10 A;  5F48 A;  2CE7 A;  2JEV A;  1M1D A;  1VHE A;  1JNR A;  2C5I T;  3JRU A;  4MI4 A;  2K5B B;  3C98 B;  4CN6 A;  5E96 A;  2H3R A;  1CPS A;  2LM9 A;  1LOK A;  4AKG A;  2JEW A;  2XEJ A;  4G1P A;  3C4X A;  4JD6 A;  3FIX A;  5FVJ A;  1HEE A;  4CGN A;  1X12 A;  4EWT A;  4NSQ A;  2AFO A;  1W09 A;  4BMH A;  4Q36 A;  3V8I A;  2J8R A;  2ZLY A;  1F57 A;  5LYJ E;  2XQ3 A;  3PUG A;  1FEW A;  4JI8 T;  3PDY A;  3CX7 B;  3MXZ A;  2X9H A;  1D1C A;  4P09 A;  1J4J A;  1S7K A;  3EY5 A;  4Z8X A;  1YVK A;  1MIW A;  3O1I A;  4MCP A;  4DR3 T;  2QEC A;  3AA1 B;  4U3C A;  1WCR A;  4P4E A;  4NGN A;  4ZYQ A;  3OPC A;  4Y49 C;  5LHI B;  4F9U A;  4UBR A;  5HCM A;  3UU4 A;  1QLB A;  3TLT A;  2GLF A;  4NUV A;  2Q0Y A;  3EFA A;  4FD7 A;  3ONL C;  5JPH A;  4MHZ A;  1WR0 A;  2QML A;  5IHY A;  1D1B A;  5HH1 A;  3OJA A;  2DCF A;  1IYL A;  2G9D A;  2VK9 A;  2R6G F;  4FUU A;  2X0H A;  2QGS A;  5DS0 A;  5AQN B;  3ZJ1 A;  4X66 T;  2UXN B;  5CJ5 A;  4KOS A;  4EB6 E;  2WBL A;  2PJ2 A;  2Q4Z A;  4YTM A;  2XQY A;  3UU5 A;  3GWH A;  5HEJ A;  1H8L A;  4B3M T;  2MOZ A;  1M4L A;  2KND A;  3N5L A;  4QWN B;  1YQ4 A;  1SQH A;  2UXB T;  2PG8 A;  2CHN A;  5G20 A;  3DR6 A;  4NF1 A;  4MMO A;  4ZZB A;  1F2O A;  4E7S A;  3JTK A;  2B1E A;  4CYN A;  3S9N A;  3JVN A;  5HWY A;  4UIA A;  4XPD C;  5LRK A;  3FBU A;  5HXD A;  3ZMZ B;  5JDN A;  2C6G A;  1PYT B;  1SE7 A;  4CAX A;  2LJL A;  2XY8 B;  4IDQ A;  2IJZ A;  1YKH B;  3DSB A;  3SJX A;  2JBK A;  2K5T A;  1D0X A;  3OYX A;  2VZZ A;  4Y49 B;  3LWU A;  2M6B A;  3VH9 A;  3S6G A;  2OB0 A;  3AED A;  2V7L A;  3EUH A;  2LSI A;  2AJ6 A;  2CTC A;  1NSA A;  2XM2 A;  4AI6 A;  2B5G A;  4HE8 A;  4HEA A;  4YXD A;  5HVH A;  2K3W A;  4UA3 A;  5JDF A;  3BQK A;  3OYZ A;  1SUM B;  1B87 A;  4U72 A;  2X67 A;  3QAY A;  5H6R B;  2WQY A;  3H3A A;  1R8I A;  4KVX A;  3P4R A;  4XPK A;  3TO9 A;  3WC6 A;  3LG7 A;  2I0M A;  2ARH A;  4IAV A;  2EHO C;  1KUX A;  1V0C A;  4AVB A;  2XQ8 A;  2VQE T;  4B3R T;  2NTX A;  4P4B A;  5IB0 A;  4AQG A;  4XPD B;  5H6Q B;  3N9P A;  2GAN A;  5C82 A;  1WLX A;  4JI5 T;  2E5L T;  3AEC A;  2Y0M A;  4YFS A;  2PFV A;  4ZHQ E;  3B35 A;  4ZI3 C;  2Z3K A;  5AQQ B;  4WYV A;  1N33 T;  2IML A;  1CG2 A;  4MFQ A;  3K3N A;  3ZLI A;  1J5E T;  2XEI A;  4IDP A;  4DV2 T;  3JC6 D;  4EIW A;  2B5G B;  2A72 A;  4U9Z A;  2CXA A;  3PUY F;  3NE8 A;  1XBU A;  3I0Q A;  4Q38 A;  4UFX A;  3SJG A;  3RYF E;  2ZW6 A;  1WWZ A;  4HNW B;  3AE9 A;  1TKJ A;  2A4N A;  5E0O A;  4DND A;  1CP7 A;  3RHW A;  4AXV A;  3NA6 A;  4CI3 B;  2AFZ A;  2FJE A;  1VHO A;  2BVL A;  2WPW A;  4NGM A;  2CA5 A;  2O53 A;  1R57 A;  2PIY A;  2KLQ A;  2ZOF A;  4KOX A;  3VAT A;  2ODU A;  4DBQ A;  1XZY A;  3M65 A;  2CLY B;  4A39 A;  2FVG A;  2WPX A;  4O4J E;  4MLK A;  4F0Y A;  3PTR B;  2ZEP A;  5J1Q A;  3F31 A;  2ES0 A;  2PR8 A;  2B4B A;  4EZH A;  3FZK B;  3SJE A;  5JH9 A;  5AQS B;  2PVV A;  3PJA J;  3RC8 A;  3FMC A;  1YW4 A;  1LVK A;  5LJM A;  4II9 A;  3RGL A;  3RZA A;  2XJ7 A;  2MBG A;  1OWA A;  4PJN A;  1FMV A;  5ABF A;  1Y01 A;  2JBJ A;  4CN4 A;  3G3S A;  3P4Q A;  3ZT7 A;  2F8H A;  4YSY A;  2EK8 A;  3IGR A;  4BAY B;  4AKR B;  4A98 A;  1Z5R A;  3R9E A;  4JYW A;  2WY2 A;  3AA6 B;  5AG4 A;  3D66 A;  1UUS A;  4JJX A;  1IBK T;  3L39 A;  2GFQ A;  5DQW A;  4MFJ A;  2PJ1 A;  2C6C A;  2CWO A;  2I00 A;  2PIZ A;  1TXR A;  2YEV C;  3N2K E;  4GS4 A;  4MRI A;  1FMW A;  3GYA A;  4R3L A;  3E08 A;  3I0O A;  3TLU A;  5CA1 E;  2LRK A;  1CP6 A;  2YU2 A;  4LF9 T;  4ILA A;  4RI1 A;  4MCR A;  3D7G A;  4X2T A;  1PCA A;  3T1Y T;  4TN7 B;  4U9Y A;  4EED A;  4HGA A;  4UWJ A;  3RLF F;  1B6B A;  5J8F A;  4MCQ A;  1OXZ A;  4A97 A;  3GY9 A;  4UR9 A;  4KZT A;  3CQX C;  3PGP A;  2NWB A;  4R8F A;  3S4U A;  2E9X C;  4N78 D;  2E9X A;  4OC3 A;  2AFW A;  1D1A A;  5ABF B;  5LBQ B;  1XRY A;  1NMT A;  2Q43 A;  1HR0 T;  3D68 A;  3H8G A;  5AQI B;  4GIW A;  3GIU A;  2QA7 A;  2CBI A;  2V7K A;  2X9W A;  2JJ9 A;  2YOE A;  3T9Y A;  2JQ9 A;  4RS2 A;  4FI5 A;  5EC4 A;  1WR6 A;  2FE7 A;  4AKH A;  4CZZ B;  1LFW A;  4KVM E;  3VU7 H;  2PJQ A;  3HL6 A;  2JDD A;  5FVK A;  3BK9 A;  4B11 A;  3FX6 A;  3ZYM A;  2CCQ A;  5HVF A;  1KFY A;  4CXW A;  3ZN1 B;  5LHH B;  3AAA B;  3QB5 K;  2CM0 A;  3CK6 A;  3N9L A;  4MFP A;  2LKH A;  1IY7 A;  1IID A;  4O2B E;  1D0Y A;  4MFZ A;  2IC6 A;  1V9D A;  2PQ8 A;  2L3L A;  4PXD A;  5G22 A;  2JQK A;  4KOY A;  2XQ7 A;  2L8K A;  3AE4 A;  2NW8 A;  3JCF A;  4AKL A;  3G8W A;  2PSW A;  5CA0 E;  5AQP B;  4JYA T;  4HFC A;  5LBM A;  3L8R A;  3FZM B;  2C1C A;  2E9X B;  3ZC1 A;  4QXH B;  4AQF A;  5KTD A;  2PJ4 A;  3UUB A;  2FJB A;  3UT5 E;  1Q2D A;  2BOA A;  2GIV A;  3QUJ A;  2VL1 A;  2LKG A;  5LA6 E;  4JLY A;  2BBJ A;  5FNV E;  4PXB A;  4F0X A;  4M6I A;  4ZI6 A;  5JM6 A;  2NYQ A;  4B6X A;  4BIN A;  4NIQ A;  5GON E;  2EO8 A;  3NBX X;  3EDU A;  2DPT A;  5H84 A;  3PFE A;  3CX6 B;  5LXT E;  3TT2 A;  2W62 A;  4YFJ A;  4BBH A;  5I4M A;  4YTP A;  2ZXV A;  2W00 A;  5BMV E;  5K8O A;  2PJ8 A;  3B2Y A;  4W9Y A;  5KX5 E;  4TV9 E;  3A5X A;  2BZB A;  4A30 A;  5FP3 A;  4E2A A;  2I3C A;  2G3A A;  2BKO A;  4HFV A;  5CGM A;  3PU8 A;  3JAE A;  2D5U A;  3RI5 A;  4FJO A;  3VR8 A;  4Q25 A;  2P9B A;  2AFM A;  4E7Z A;  5IX3 A;  1TF9 A;  4O4I E;  3RYO A;  1VOM A;  4QX7 B;  1BOB A;  4A33 A;  5DJQ C;  5ISV A;  1U5P A;  2PJ6 A;  4XBF B;  2EBJ A;  4KUB A;  4IE0 A;  1S7F A;  2WDQ A;  1Y7R A;  2ABZ A;  4KOU A;  5LB7 B;  3KQZ A;  4UVB B;  3WI3 A;  3PUX F;  3UU6 A;  2REE A;  3QB8 A;  1I1D A;  3M3Z B;  1HDQ A;  4YTN A;  4B6Z A;  2Q04 A;  2K9A A;  1L0C A;  4X5T A;  2ANP A;  5LRG A;  1ON0 A;  2N1G A;  3FH4 A;  3RRW A;  3KDS E;  1Z8X A;  1UK5 A;  1YQE A;  3AE3 A;  4EXT A;  3LSV A;  2D2S A;  3KIN B;  3KR5 A;  4K0U A;  4AVC A;  4C68 A;  2WSS V;  4I55 E;  3DGV A;  3UUN A;  1S5K A;  2PRB A;  3AXJ A;  5KDM C;  5KTA A;  5EK4 A;  4ZOL E;  3NH8 A;  1VRB A;  2E9X D;  3GKR A;  3CIR A;  1YW0 A;  3H8F A;  3PE0 A;  2BS4 A;  3PB6 X;  1AMP A;  4PJL A;  4IHJ E;  3SWH A;  5ETW A;  1LKX A;  1T8B A;  3R1K A;  4DV6 T;  1Z0P A;  4ZX8 A;  2LM2 A;  3CML A;  3RQW A;  3AE1 A;  3ZJ0 A;  3FJU A;  2CBJ A;  4X64 T;  3D0T A;  4A94 A;  2DWG A;  2D4P A;  1NEK A;  4BA9 A;  2B4D A;  4E8O A;  2XAH B;  2KT9 A;  2XZE A;  2QVP A;  1Y64 B;  2R1I A;  3PUS A;  3B5M A;  2H89 A;  5J2T E;  4PV6 A;  4PXE A;  4ZX9 A;  4X1K E;  3PUQ A;  4A95 A;  4C7H A;  3EC4 A;  4ILU A;  2C5K T;  4ILC A;  1DTD A;  2BG9 E;  1VIX A;  2MPK A;  1ELM P;  1HF8 A;  2LOS A;  2CNM A;  3KV4 A;  1NWM X;  5LJN A;  4TX5 A;  3AXJ B;  3V38 A;  2PJ0 A;  3KHZ A;  3IEE A;  1P0H A;  3FEC A;  2VAS A;  5FY0 A;  2BBH A;  4U7Y A;  2WS3 A;  5IUX A;  5LYI A;  3LK4 2;  1MMG A;  1QSM A;  3DR8 A;  4P10 A;  1YX0 A;  4A56 A;  2EK9 A;  2CXF A;  1FT7 A;  5KXJ A;  3SXO A;  4A2Z A;  4HFB A;  2HUZ A;  4QHO A;  4U2Z A;  3Q9D A;  5HYA A;  3GLJ A;  2B4D B;  4IRE A;  2FIW A;  2OV9 A;  1R43 A;  3S6F A;  2RFH A;  1KF6 A;  3JUW A;  2NR4 A;  4TWD A;  4NGQ A;  2V26 A;  2WDR A;  4OYJ A;  4JWP A;  3W91 A;  3NFZ A;  4CN1 A;  2CNT A;  1NAF A;  4JBW F;  4AXP A;  3D7H A;  3IIB A;  5J8C A;  3ISX A;  3TX8 A;  1BR1 A;  5L2L A;  5LRJ A;  4GK0 E;  3KQX A;  1XIX A;  3WC7 A;  1HNX T;  1T98 A;  1ARM A;  4L0R A;  5LGU B;  2IQ6 A;  3RYC E;  5JH7 E;  5HXH A;  3FEE A;  2C27 A;  4MBU A;  4CGL A;  1VCS A;  3PB8 X;  2WMN A;  4NXY A;  2HPL A;  2PR1 A;  4O2A E;  4PK6 A;  2PJ7 A;  2PRQ A;  3RKO A;  2YK0 A;  1AYE A;  4PW8 A;  2XEF A;  2BKP A;  2Q44 A;  2JQQ A;  2XQ6 A;  3CQC B;  3IWE A;  2X9Y A;  4H9O C;  4LMJ A;  4LQG A;  5LMN T;  2VVN A;  1UX4 A;  4PSW A;  5AGE A;  4YHH T;  3A8Y C;  5LYF A;  2YN6 A;  3AE2 A;  2Z3L A;  2MAW A;  4UFV A;  4C2Z A;  3IU1 A;  4DBR A;  2BS3 A;  1UWY A;  3KHX A;  4KP3 C;  3X1D A;  1Z4E A;  2KCW A;  2I59 A;  3IJ3 A;  5ADX L;  4NFR A;  2WB5 A;  3I3G A;  4UIG A;  3GUX A;  3K3O A;  1NEN A;  4GKK T;  5JQG E;  3FZH B;  2C0S A;  1MIY A;  5HXC A;  3VWE A;  2JDC A;  4TWF A;  4HKA A;  2BVM A;  4LF8 T;  2D0T A;  3B3C A;  3PRT A;  3RX6 A;  2CIJ A;  5LG3 A;  4FWU A;  2YU1 A;  2ZW7 A;  4KOW A;  1ZLH A;  1M62 A;  4TNW A;  5JDM A;  4UVA B;  4YJ2 E;  4OHF A;  4X20 E;  3D8P A;  3IA3 A;  4WW0 A;  1S7L A;  1LVF A;  4KLW A;  4X3R A;  2ZM2 A;  4IL9 A;  2KWI B;  3UY5 A;  4A5X A;  3TLV A;  3B8G A;  1M4D A;  4BD9 A;  4YU9 A;  1EZ3 A;  5FXV A;  2VL0 A;  4ZY0 A;  4MHD A;  4C2X A;  1MJ9 A;  3MZK B;  5F46 A;  3RC3 A;  1X10 A;  1QSR A;  2OZG A;  3B3S A;  2Y6X A;  2FJA A;  2HN1 A;  4CYO A;  4F6R C;  4H6U A;  4RN7 A;  5HMN A;  3QOF A;  4KOT A;  4L9I A;  1CJW A;  2G3T A;  3VRA A;  4YSX A;  2VZY A;  4FAI A;  1ZG7 A;  3D2M A;  4K30 A;  2DWK A;  5AFU L;  2AFS A;  4U5Y A;  2CEA A;  1BR2 A;  2WZH A;  1HX8 A;  4OAD A;  2J62 A;  3H8E A;  3JAD A;  2R98 A;  4OFZ A;  4H9P C;  1XMO T;  3NVO A;  3MK7 C;  3MA9 A;  4YGO A;  4UWI A;  2LSK A;  1K4J A;  2GK9 A;  2QIR A;  2WSA A;  4IL4 A;  2ZEO A;  3D4U A;  1BLL E;  1OZP A;  5BWA B;  4OLL A;  2Q7S A;  4P6Y A;  4DYO A;  4OC4 A;  4JEU B;  4IF5 A;  2PCU A;  3LK2 B;  4PSX A;  3P8C D;  3ZSS A;  3V7Z A;  3N7Z A;  3RPU A;  3ZMS B;  2WZI A;  3TC8 A;  2EHO A;  2IDO B;  1OBR A;  4H89 A;  2V8H A;  4NPP A;  2E8I A;  4JI0 T;  5AQJ B;  3J9X 1;  4OP4 A;  2ZOG A;  2IC9 A;  2JMK A;  4DV5 T;  4B3T T;  2XAQ B;  3NZP A;  4X8I A;  1IBL T;  3BJ8 A;  4CAF A;  2JPF A;  4LX9 A;  1HFA A;  1NE9 A;  3SJF A;  2NOX A;  2QJ8 A;  1M7K A;  3I9W A;  1ZG9 A;  2PJA A;  3CZX A;  3OKQ A;  3KVB A;  3UUL A;  1QST A;  5LP6 E;  1M4I A;  3TOA A;  2JRK A;  4J3G A;  4H9N C;  4XAX B;  3KV5 A;  4MY3 A;  3VR9 A;  5IYZ E;  1PUA A;  5L4E A;  1BPM A;  4YLH A;  1HTJ F;  4HWI B;  4H9S E;  2PTF A;  2Z11 A;  2D0U A;  2VKD A;  3MN8 A;  3KV9 A;  1YVO A;  3E0Z A;  4OC2 A;  1ELL P;  3RIU C;  2N9D A;  3RIU A;  4PAG A;  3NRY A;  3C4Z A;  1UX5 A;  3K3Q C;  3C64 A;  4B5P A;  3WAK A;  2EHO B;  4AG9 A;  2XTL A;  5HCJ A;  4FD5 A;  5KTC A;  5K8P A;  2VI7 A;  2PDO A;  4ZXL A;  1BAV A;  3HKC E;  3C4W A;  4C90 A;  3DLJ A;  2CRB A;  2C5J A;  1Q2C A;  1YXR A;  2J1D G;  4JXQ A;  2M67 A;  2HB6 A;  2B3U A;  2BUE A;  4V1A v;  1T72 A;  1FIO A;  1B7T A;  2J8M A;  4FBE A;  1A2Z A;  3N5F A;  2X66 A;  2F4V T;  2BG9 C;  1IGB A;  1XDP A;  4DR6 T;  2BG9 A;  4YHJ A;  3ETV A;  4CYP A;  5ABH A;  3ETU A;  2FS5 A;  4C2Y A;  5AQL B;  1JNZ A;  2YNC C;  2OOT A;  5EMI A;  1YME A;  3VWD A;  2YNC A;  2BL1 A;  2O28 A;  4L8A A;  3KVA A;  4NCZ A;  4OK0 A;  3PUZ F;  2ZPA A;  1TF8 A;  4TNU A;  2XQA A;  1G73 A;  3SI0 A;  5HEU A;  3LAC A;  3DJB A;  2DEA A;  4DV0 T;  4ZI7 E;  3K9U A;  3B13 A;  1S94 A;  2IUB A;  2I79 A;  1LAP A;  5LYD A;  4O4H E;  4QB9 A;  4EOZ B;  4B5P B;  2XAG B;  3R6N A;  3BLN A;  3P2F A;  4ZI2 C;  2LRL A;  5HWX A;  2PJ3 A;  4OID A;  4C7I A;  3NH4 A;  4IE6 A;  1Y0Y A;  3C50 A;  3P50 A;  3AEF A;  1OED E;  3PUR A;  2ZW5 A;  4U2Y A;  1XOV A;  5G21 A;  3IEH A;  4LUA A;  4DUK A;  1HS7 A;  5BR8 T;  3PFO A;  3SFD A;  2LHR A;  3PBE A;  5IB9 A;  3R9F A;  3J7Y q;  2X9X A;  2F7V A;  3H5Z A;  1MMA A;  2IW5 B;  2IIU A;  4LQ6 A;  2BG9 B;  4G2A A;  4XZC A;  3U3I A;  3IHR A;  2BCO A;  5F09 A;  4H2K A;  4LFB T;  4ZZC A;  3FXE B;  1MJB A;  4UFW A;  4CXY A;  1G8X A;  3HKD E;  4L89 A;  3TE4 A;  2XQ5 A;  1I94 T;  4FD4 A;  2JMH A;  3CQG B;  1HX1 B;  1X9B A;  2CNS A;  2EHO D;  5L3C B;  2VKH A;  5C88 A;  2B76 A;  2CXD A;  2Z6E A;  1J1J A;  4CAW A;  3IWW A;  4B12 A;  4IIJ E;  5L3F B;  4KLV A;  1FJG T;  3R96 A;  2Q4Y A;  2FT0 A;  3AVS A;  5AQT B;  3K8P C;  4ZI3 D;  5JR9 C;  3Q5E A;  3E0K A;  5JR9 A;  2V8V A;  4DV3 T;  4YY3 T;  4UCM A;  4KOR A;  3ZT5 A;  4EFD A;  4YRH A;  2XPK A;  4HFH A;  4F8H A;  5LMU T;  3FB3 A;  5F49 A;  2BO9 A;  2Q51 A;  5AG7 A;  1I21 A;  5D8N A;  5GCN A;  3RH3 A;  2UXX B;  1XWM A;  5CBM A;  3ZJ2 A;  4R57 A;  1SA0 E;  2K48 A;  2P6G A;  2A9U A;  1GQE A;  5K8N A;  2LHN A;  4QXB B;  4NGT A;  4WZX A;  2OZH A;  2Y48 B;  2CHO A;  1WRD A;  4PFO A;  2Q7B A;  4MHY A;  3O1H A;  3CPA A;  5A1L A;  4P0A A;  2MYS A;  4QBJ A;  4ORF A;  1T7S A;  1ZOY A;  4KSI A;  2NP9 A;  1QQ9 A;  4EEB A;  1KEY A;  1XFO A;  5JVD E;  2J9A A;  3TTH A;  3GB0 A;  4JXR A;  4JUY A;  2ZEH A;  2Z0Z A;  1D0Z A;  2R7H A;  2GE3 A;  3O4X E;  5AG6 A;  2FUP A;  3OBV E;  2V5C A;  2W67 A;  5JR9 B;  2LE8 A;  2Q9Q C;  2X7B A;  3KFW X;  3C26 A;  2Q9Q A;  3AB3 B;  2PVW A;  4COF A;  3QC9 A;  1YR0 A;  2D4O A;  1WYC A;  4EYY R;  4Z90 A;  2XAF B;  3AVR A;  1CPX A;  4B5O A;  4ZBG A;  2WWV A;  1FNO A;  2ZEL A;  4IHM A;  4PNI A;  5LNK A;  1CUN A;  4DO0 A;  4EV6 A;  3HUV A;  5HEO A;  3T90 A;  2DNX A;  2ODV A;  4QXC B;  3Q5X A;  2X68 A;  1HG2 A;  2BDE A;  1S3Z A;  4R3K A;  2P0W A;  3BXM A;  5CFB A;  4ZY1 A;  1S35 A;  3LK3 B;  3PJA A;  3TLW A;  2WM9 A;  5AQU B;  1X79 A;  2HPJ A;  5AQG B;  5L47 A;  4OME A;  4AKI A;  2WU2 A;  1N71 A;  2REF A;  5KMG P;  5TAO A;  2IHR 1;  1M44 A;  1ZG8 A;  5C3J A;  2A3D A;  4ZY2 A;  2ZED A;  4KI0 F;  4X1Y E;  5EZY E;  4EVY A;  5A28 A;  5DQV A;  3EVY A;  1W0A A;  3SI1 A;  4CPA A;  4HNX B;  1IOF A;  3MGD A;  2Q9Q B;  3RBU A;  3WAB A;  2RB7 A;  3BI0 A;  5DWM A;  4KSF A;  2ZM0 A;  3C51 A;  4MXU A;  5AQH B;  3CXQ A;  1HG5 A;  4DR1 T;  2RP4 A;  1MJA A;  2W63 A;  4KUM B;  4KX6 A;  2P6F A;  2EVN A;  4FD6 A;  4PXC A;  2W2U A;  1XDO A;  3AA0 B;  1L0V A;  3BI1 A;  1Q2Y A;  4CGP A;  4H63 V;  3CWZ B;  1TKF A;  1VGY A;  3B3T A;  4JI4 T;  4WNK A;  3KAS A;  4UEF A;  2V7J A;  2VEZ A;  3WC5 A;  3SRZ A;  1GHE A;  2G0U A;  3PUW F;  3FF3 A;  4KVO E;  3EAB A;  2D9D A;  5FL1 A;  2X51 A;  1MMD A;  2NTY A;  4PQA A;  2F5I A;  4I49 A;  3Q5W A;  4BJM A;  1HDU A;  4UEL A;  3CDX A;  4A32 A;  4MFK A;  3AEA A;  3TKL B;  2ZM6 T;  3L3P A;  2VUR A;  1IAP A;  4L5G A;  2CXL A;  3TLS A;  3P4P A;  1XF8 A;  2EWB A;  1UGO A;  2DL1 A;  4MJ8 A;  3I1U A;  4F9V A;  5L4H A;  5L3E B;  3NE7 A;  4XNH C;  4LF6 T;  4B14 A;  4QVT A;  5JRE A;  2J8N A;  5AQK B;  5LGT B;  1RTQ A;  3CT9 A;  2WDV A;  2K24 A;  5JDQ A;  5HXR A;  3WAJ A;  2X0L B;  2OH1 A;  3R95 A;  2PJB A;  2I6H A;  3ZKR A;  1QSN A;  2J47 A;  3ZPO A;  4O4L E;  2LEH A;  1RXT A;  5AQV B;  2UU9 T;  4RUH A;  2V5D A;  5ELY A;  3UQ7 A;  4CXX A;  1KWM A;  2Z3N A;  2B3V A;  1WYB A;  1IJ5 A;  3EAM A;  1XMT A;  2QRX A;  1IYK A;  5JGF A;  3V5U A;  4AIS A;  3QK6 A;  2SPC A;  3PB9 X;  2AE9 A;  1ZKE A;  2NW7 A;  2DF5 A;  2BEI A;  1H7C A;  2DPS A;  1CBX A;  2LSY A;  1CM0 A;  4P4I A;  5K8M A;  3RNZ A;  1BO4 A;  4K3N A;  2YDR A;  5LYL A;  3FXT A;  1YLO A;  5DWN A;  1QSD A;  5EK2 A;  3FB2 A;  1OED C;  3LD2 A;  1OED A;  1YRE A;  3GA8 A;  4XNH B;  5IV0 A;  4IE5 A;  4MBQ A;  4IST A;  3GN5 A;  4LF5 T;  2AE6 A;  1J5W A;  4U31 A;  5M4Y A;  4CGO A;  2V8S V;  5THW A;  5ABG A;  5H86 A;  2N2N A;  4HWD A;  3FYN A;  3VKG A;  4OIW A;  5HAX A;  3W15 B;  3JC6 C;  2HQY A;  4CYQ A;  5HXS A;  1AJ3 A;  4R7M A;  2Q4V A;  4OC1 A;  4P45 A;  4CAV A;  4OYK A;  1GYT A;  2UXC T;  4YT0 A;  5FL0 A;  4X62 T;  2UUC T;  3T8W A;  5FVL A;  3SXN A;  3GMI A;  3AAI A;  4F8Z A;  4ONW A;  2RPA A;  2V1D B;  4QKN A;  3N2O A;  5JRC A;  2PC1 A;  3AAE B;  4HTE A;  2WZN A;  3HLP A;  4P44 A;  4IDO A;  4ASK A;  4TNV A;  4C91 A;  4TUY E;  2UUB T;  3I1A A;  3PB7 X;  4ONU A;  3AEG A;  1TIQ A;  3VAR A;  1KNZ A;  3CX8 B;  1HCI A;  4TWH A;  1LAM A;  2H5M A;  3WT4 A;  4R6T A;  4MFL A;  1OED B;  1BR4 A;  4OC5 A;  3ZEF B;  2ZEE A;  3UFE A;  1ZHC A;  4X1I E;  3GN5 B;  3WR7 A;  2KWH A;  4IE4 A;  3PEI A;  3W6S A;  4OAE A;  2FIA A;  2ZEG A;  2V77 A;  2Z3P A;  3AEB A;  1XNR T;  4NJQ A;  3FHN A;  3IBP A;  4DR2 T;  2CY2 A;  3N9Q A;  4PFP A;  4PK5 A;  4UIB A;  1KUY A;  1XEB A;  3ZYK A;  3ABV A;  4GXH A;  2ATR A;  5FMN A;  2DLR A;  4AIU A;  2DHR A;  4GM5 A;  5L3G B;  2V8G A;  3W6X A;  1E1H B;  1N36 T;  2H7O A;  6CPA A;  2WMO A;  4IGU A;  4Z91 A;  4A38 A;  1VKC A;  1W0B A;  4DMV A;  1S60 A;  4XPL A;  4CRY B;  2BKN A;  3FRM A;  4IDN A;  3KKW A;  1QUU A;  2KZ7 B;  5JRC B;  4O23 A;  3RKG A;  2XUE A;  4JLE A;  5AQR B;  3LMS A;  3KR4 A;  5A27 A;  5LCY A;  2PJ9 A;  3H4Q A;  1ZLI A;  4NUU A;  1YQ3 A;  2P6E A;  3CKD A;  3TO6 A;  1VCT A;  4H6Z A;  3T8O A;  3D7D A;  3P4S A;  3F5B A;  3NZQ A;  4ZEY A;  2V7I A;  5L3B B;  4ANJ A;  4HN9 A;  4DUY T;  4LF7 T;  4WJB A;  2Z3O A;  4ILB A;  1TKH A;  3OTO T;  3IFE A;  3RIF A;  4MHP A;  4QH5 A;  4UVC B;  5JDG A;  4IUS A;  1YLE A;  4DVD A;  5CB4 E;  4OKO A;  4AVA A;  3PUA A;  3HI2 A;  2ZM8 A;  5I0C A;  2C6P A;  3RIA A;  1XE4 A;  3S9L A;  2XEG A;  4DV1 T;  5LGN B;  1N34 T;  5F47 A;  3LDQ B;  1UFH A;  3HKB E;  3VKH A;  3H3M A;  4DNC A;  5ABE A;  2CLY C;  4P4F A;  3UFG A;  4PJJ A;  2HH7 A;  4WBN E;  3A7M A;  3AEE A;  4IT4 A;  3F2E A;  3PZJ A;  2QYV A;  2G0B A;  3B7I A;  3TO7 A;  3N9M A;  2VKJ A;  3S6K A;  2FXF A;  4WWV A;  4AQY T;  4JI6 T;  4GKJ T;  4P4J A;  2CPT A;  4R9M A;  3HR0 A;  3ZT6 A;  1E2A A;  4F6A A;  1M4G A;  3ONX A;  4UCN A;  3PBB A;  3AE7 A;  5HEH A;  2PJ5 A;  5F5W A;  3T1H T;  1HNW T;  3IC1 A;  1Z8L A;  2ZEM A;  2OZU A;  1LRZ A;  4H9Q C;  2LLY A;  1E7P A;  4U33 A;  4NGR A;  1R3N A;  4AB7 A;  1Z8W A;  4MY0 A;  3NKZ A;  4JI2 T;  1EE3 P;  3P4W A;  4EME A;  4M6H A;  2XHE B;  3SI2 A;  3LFM A;  5EBV A;  4LF4 T;  3AE5 A;  3KZW A;  4QC6 A;  4EYU A;  4KUA A;  1Y0R A;  4A37 A;  4TWE A;  1IZN B;  3D7F A;  4ISS A;  4NXM T;  4CRZ B;  5EK3 A;  4QUS A;  3TOB A;  5C2T A;  3L2N A;  2AFU A;  4YSZ A;  1SHZ C;  2KMF A;  2VQF T;  4MAL A;  5HXE A;  3UUM A;  3N9O A;  4JZ0 A;  3KGQ A;  3S9M A;  1KZF A;  3FBZ A;  1JWQ A;  5FKY A;  4CGM A;  1Y7E A;  3RF1 A;  2GU2 A;  4J2C A;  2ODF A;  2NW9 A;  5J0Z A;  2CF4 A;  3MJX A;  7CPA A;  2FBW A;  1ZO0 A;  4M3S A;  3EI0 A;  4MHC A;  4GK5 E;  4GYS A;  2XAS B;  1IBM T;  3JAF A;  4UV8 B;  2IL4 A;  2JQH A;  2QVA A;  2VBQ A;  4HPS A;  3ZMT B;  3A9L A;  1PU9 A;  3CPZ A;  5C8Y E;  4NJR A;  2VWA A;  1W9R A;  4KHZ F;  2VB6 A;  5CPA A;  3R84 B;  2XQ9 A;  3EHZ A;  1WK4 A;  3P2H A;  3ZYL A;  2FJD A;  4UEZ A;  2HC9 A;  2E5V A;  3EDV A;  3CXP A;  5AQO B;  4JI3 T;  4O8S A;  4KMC A;  5J1G A;  5JTG A;  4HWC A;  1BPN A;  5F8P A;  2CWY A;  2V6Y A;  3FNC A;  4MCS A;  2J4G A;  5G1Z A;  4IE7 A;  1KUV A;  5FXX A;  2XQ4 A;  4P1N A;  5FY7 A;  2R8V A;  2GRE A;  1VHS A;  3O9X A;  1YK3 A;  2ZW4 A;  3QAH A;  2ZEF A;  3VRB A;  1ZEE A;  2W0G A;  5JDL A;  3O1J A;  1I12 A;  2X0Y A;  3UTK A;  5FY1 A;  2QYW A;  3PB4 X;  3MKD A;  1KNP A;  4Q7A A;  4Z65 A;  3ZMU B;  3FZL B;  4PK4 A;  3RYI E;  2WP9 A;  2ACX A;  3V5S A;  2OU2 A;  3LOD A;  4DUZ T;  3MAC A;  4ADZ A;  3I9Y A;  1ZV4 X;  3TFY A;  4EAH A;  3S6H A;  4X5K A;  3NWI A;  4H63 H;  4DID B;  3ANW A;  2POK A;  3IF8 B;  2XSB A;  4B10 A;  1US7 B;  4I4T E;  3DNS A;  4EGW A;  2AXD S;  1UUR A;  2GLJ A;  4JV5 T;  3NRX A;  3B57 A;  3ZN0 B;  5LHG B;  3FED A;  3PV0 F;  2XSA A;  3PU3 A;  3PUV F;  5AQF B;  2VVS A;  2YKS A;  1KK7 A;  4DV7 T;  2JLM A;  4B13 A;  2V6Y B;  1Z9U A;  3SS1 A;  4CAE A;  1XMB A;  1XNQ T;  2E2A A;  3EO4 A;  4EZ4 A;  1RO5 A;  4AG7 A;  3K2K A;  2B58 A;  3FZF B;  2HHH T;  1LAN A;  4PK3 A;  1LCP A;  2YIN A;  4GOU A;  2XAJ B;  2PJC A;  3RO0 A;  4HWH A;  3FXD B;  3K1S A;  2ACZ A;  3UQ4 A;  2OLT A;  3RYH E;  1MND A;  4AQF C;  1S7N A;  2BSW A;  3L09 A;  4UF0 A;  3B3W A;  3DTO A;  1MMN A;  5FXZ A;  2PBI A;  2LOP A;  2WU5 A;  3HKE E;  4K0K T;  2V8D A;  5AQM B;  5AG5 A;  4R76 A;  4R87 A;  1DE4 C;  2LSG A;  3BJ7 A;  3ANW B;  3U78 A;  3IWG A;  4YWY A;  4H9R C;  4HFI A;  4ZGY B;  4GYR A;  1YGH A;  5FXW A;  3F57 A;  1FY7 A;  2IAK A;  1Y9W A;  3K9T A;  3R9G A;  4JI7 T;  3KL9 A;  4E0A A;  2CMR A;  1Z2L A;  5HEG A;  2W66 A;  3OWC A;  2W4X A;  1Z8T A;  2WWU A;  2AFX A;  4TZ4 C;  4NXN T;  3IU2 A;  2W61 A;  5JDH A;  4I43 B;  3ZCI A;  4B3S T;  4G63 A;  4CI1 B;  2FL4 A;  4KHP T;  3ISZ A;  3QNV A;  2CTB A;  2WYR A;  1IIC A;  5HVG A;  1N32 T;  2VKO A;  2VXK A;  1IOI A;  4CS0 B;  2M6I A;  4KOV A;  4HWF A;  2V6X A;  3DDD A;  4HFD A;  2YGW A;  2YNE A;  3BQL A;  1ZP0 A;  4ZI2 D;  2OR4 A;  4LFA T;  3I9S A;  4UF0 B;  3SFE A;  2RC4 A;  3SHP A;  4BJN A;  4ZS3 A;  3D3S A;  3VHL A;  4MFR A;  5IWA T;  1F2P A;  1QMU A;  3CVR A;  2H88 A;  1P4N A;  2ZMA A;  1I6Z A;  1ARL A;  3AE8 A;  4UEE A;  4HNY B;  3D2P A;  3ZCJ A;  2H7V C;  3H37 A;  4QH4 A;  4NGP A;  4YJ3 E;  4LFC T;  1YSJ A;  2VL8 A;  4M6G A;  2KIN B;  2UUA T;  3CPX A;  3BHX A;  3BQI A;  4JEH B;  2OA5 A;  1U4Q A;  3B3V A;  3LJC A;  4DJL A;  4QX8 B;  3ZZI A;  2HN2 A;  2L9Q A;  4I50 E;  1WFD A;  5CNP A;  5LG4 A;  1NSL A;  4PPZ A;  5FYM A;  2JIW A;  2BS2 A;  3RRC A;  8CPA A;  3ZMV B;  3SOL A;  4QH1 A;  3N9N A;  2XM1 A;  5LOV E;  4UF4 A;  1IB1 E;  1MNE A;  3FVL A;  4OX9 T;  2FCK A;  5J2U E;  1MIV A;  4UXN B;  3F8K A;  3UU8 A;  3KBT A;  1DU2 A;  2FSR A;  3D67 A;  3OVU A;  1BR0 A;  4PK2 A;  3UUX B;  2WAU A;  3N2G E;  2YDQ A;  3AA7 B;  2YND A;  3G06 A;  3LBX A;  3KI9 A;  3PP9 A;  4LML A;  4HKF A;  1IJ6 A;  4DR4 T;  1O3X A;  4CI2 B;  4LMK A;  3CXS A;  3RAM A;  4HFE A;  4IK2 A;  4KSA A;  4IDZ A;  4ERR A;  3QB5 A;  4A31 A;  2YDS A;  4KBM B;  4UEM A;  4U74 A;  2WUU A;  3E22 E;  2O4H A;  5D29 A;  3Q5D A;  3ONJ A;  2PE3 A;  4PJM A;  4M85 A;  3DP7 A;  4OC0 A;  2WCA A;  1Z8U A;  5L3D B;  2NMT A;  4M1P A;  3ZST A;  1U6M A;  1Z4R A;  4P4D A;  3F0A A;  3Q2M A;  4DR5 T;  2LSJ A;  5DAB A;  4UCP A;  1XJO A;  1YD8 G;  3KV6 A;  1KNR A;  4TV8 E;  2Y8D A;  2NSM A;  3UU3 A;  2A2F X;  4KS9 A;  3ESL A;  2LT3 A;  1AUG A;  2KSR A;  4P0B A;  2RA1 A;  4DMW A;  1YW6 A;  2DXQ A;  3QNU A;  4DV4 T;  1UCU A;  2DI4 A;  1XMQ T;  2UXD T;  4UV9 B;  5JQ4 A;  3HA4 A;  2Q9Q D;  1HNZ T;  1QSO A;  4ZS2 A;  4MHN A;  2KXP B;  3TCV A;  3AE6 A;  1YKE B;  1CHU A;  3EXN A;  3LBX B;  3KBU A;  3IO1 A;  2VQY A;  2MTQ A;  2IMO A;  2V7M A;  4NEX A;  2Z3M A;  2EUI A;  4JI1 T;  1CX8 A;  1Q7L A;  3MRU A;  1IU8 A;  3NH5 A;  4U7I A;  3P7I A;  1Y9K A;  3FBL A;  4WBO A;  4NGS A;  1MK4 A;  5F3J A; 
#chains in the Genus database with same CATH homology
 2HV2 A;  4CQI A;  3ZC0 A;  5F48 A;  2Z10 A;  2CE7 A;  2JEV A;  1M1D A;  2C5I T;  4MI4 A;  2K5B B;  3C98 B;  5E96 A;  2H3R A;  2LM9 A;  4AKG A;  4JD6 A;  4CGN A;  3C4X A;  3FIX A;  5FVJ A;  4NSQ A;  4BMH A;  4Q36 A;  3V8I A;  2J8R A;  2ZLY A;  5LYJ E;  3PUG A;  1FEW A;  3PDY A;  3CX7 B;  3MXZ A;  2X9H A;  1D1C A;  4P09 A;  1J4J A;  1S7K A;  3EY5 A;  4Z8X A;  1YVK A;  1MIW A;  3O1I A;  2QEC A;  3AA1 B;  4Y49 C;  5LHI B;  4UBR A;  2Q0Y A;  3EFA A;  4NUV A;  4FD7 A;  5JPH A;  2QML A;  5IHY A;  1D1B A;  5HH1 A;  3OJA A;  2DCF A;  1IYL A;  2VK9 A;  2QGS A;  3ZJ1 A;  2UXN B;  4KOS A;  4EB6 E;  2WBL A;  2XQY A;  3GWH A;  2MOZ A;  2KND A;  3N5L A;  4QWN B;  1SQH A;  2PG8 A;  5G20 A;  3DR6 A;  4NF1 A;  3JTK A;  4E7S A;  2B1E A;  4CYN A;  3JVN A;  5HWY A;  4XPD C;  3FBU A;  3ZMZ B;  5JDN A;  4CAX A;  2LJL A;  1YKH B;  3DSB A;  2K5T A;  1D0X A;  3OYX A;  2VZZ A;  4Y49 B;  3S6G A;  2OB0 A;  2V7L A;  3EUH A;  2LSI A;  2AJ6 A;  2B5G A;  4AI6 A;  4HE8 A;  4HEA A;  4UA3 A;  5JDF A;  3BQK A;  3OYZ A;  1B87 A;  4U72 A;  2X67 A;  5H6R B;  3H3A A;  4KVX A;  4XPK A;  3TO9 A;  3LG7 A;  2ARH A;  2EHO C;  1KUX A;  1V0C A;  4AVB A;  2NTX A;  5IB0 A;  4AQG A;  4XPD B;  5H6Q B;  3N9P A;  2GAN A;  5C82 A;  1WLX A;  2Y0M A;  4YFS A;  2PFV A;  4ZHQ E;  4ZI3 C;  2Z3K A;  4MFQ A;  3K3N A;  3ZLI A;  3JC6 D;  4EIW A;  2B5G B;  2A72 A;  4U9Z A;  2CXA A;  4UFX A;  4Q38 A;  3I0Q A;  3RYF E;  2ZW6 A;  1WWZ A;  4HNW B;  2A4N A;  5E0O A;  4DND A;  4CI3 B;  2BVL A;  2WPW A;  2CA5 A;  1R57 A;  2KLQ A;  4KOX A;  2ODU A;  4DBQ A;  3M65 A;  2CLY B;  2WPX A;  4O4J E;  4MLK A;  4F0Y A;  3PTR B;  3F31 A;  2ES0 A;  2PR8 A;  2B4B A;  4EZH A;  3RC8 A;  1LVK A;  5LJM A;  4II9 A;  2MBG A;  1OWA A;  4PJN A;  1FMV A;  3G3S A;  3IGR A;  4BAY B;  4AKR B;  3R9E A;  3AA6 B;  5AG4 A;  4JJX A;  5DQW A;  4MFJ A;  2CWO A;  2I00 A;  2YEV C;  3N2K E;  4GS4 A;  1FMW A;  3GYA A;  4R3L A;  3E08 A;  3I0O A;  5CA1 E;  2YU2 A;  4RI1 A;  4TN7 B;  4U9Y A;  4UWJ A;  4HGA A;  1B6B A;  5J8F A;  1OXZ A;  3GY9 A;  4KZT A;  3CQX C;  3PGP A;  2NWB A;  3S4U A;  2E9X C;  4N78 D;  2E9X A;  1D1A A;  5LBQ B;  1NMT A;  4GIW A;  2QA7 A;  2V7K A;  2X9W A;  2JJ9 A;  3T9Y A;  4RS2 A;  4FI5 A;  5EC4 A;  1WR6 A;  2FE7 A;  4AKH A;  4CZZ B;  4KVM E;  3VU7 H;  2PJQ A;  3HL6 A;  2JDD A;  3BK9 A;  4B11 A;  3ZYM A;  2CCQ A;  4CXW A;  3ZN1 B;  5LHH B;  3AAA B;  2CM0 A;  3N9L A;  4MFP A;  1IID A;  4O2B E;  1D0Y A;  4MFZ A;  2IC6 A;  1V9D A;  2PQ8 A;  2L3L A;  5G22 A;  4KOY A;  2L8K A;  2NW8 A;  4AKL A;  3G8W A;  2PSW A;  5CA0 E;  5LBM A;  2E9X B;  3ZC1 A;  4QXH B;  4AQF A;  5KTD A;  3UT5 E;  1Q2D A;  2GIV A;  3QUJ A;  5LA6 E;  4JLY A;  5FNV E;  4F0X A;  4B6X A;  5GON E;  3NBX X;  3EDU A;  2DPT A;  5H84 A;  3CX6 B;  5LXT E;  3TT2 A;  2W62 A;  4YFJ A;  4BBH A;  2ZXV A;  2W00 A;  5BMV E;  5KX5 E;  4TV9 E;  3A5X A;  2BZB A;  4A30 A;  5FP3 A;  4E2A A;  2G3A A;  4HFV A;  3PU8 A;  2D5U A;  4FJO A;  2P9B A;  4E7Z A;  5IX3 A;  4O4I E;  3RYO A;  1VOM A;  4QX7 B;  1BOB A;  4A33 A;  5DJQ C;  5ISV A;  1U5P A;  4XBF B;  4KUB A;  4IE0 A;  1S7F A;  1Y7R A;  4KOU A;  4UVB B;  3WI3 A;  2REE A;  3QB8 A;  1I1D A;  2Q04 A;  2K9A A;  1L0C A;  1ON0 A;  2N1G A;  3RRW A;  3KDS E;  4EXT A;  2D2S A;  3KIN B;  4K0U A;  4AVC A;  4C68 A;  2WSS V;  4I55 E;  3UUN A;  1S5K A;  2PRB A;  5KDM C;  5KTA A;  5EK4 A;  4ZOL E;  1VRB A;  2E9X D;  3GKR A;  1YW0 A;  3PE0 A;  4PJL A;  4IHJ E;  3SWH A;  5ETW A;  1LKX A;  3R1K A;  1Z0P A;  3CML A;  3ZJ0 A;  3D0T A;  2DWG A;  2D4P A;  4BA9 A;  2B4D A;  4E8O A;  2XAH B;  2KT9 A;  1Y64 B;  2R1I A;  3PUS A;  5J2T E;  4PV6 A;  4X1K E;  3PUQ A;  4A95 A;  4C7H A;  3EC4 A;  4ILU A;  2C5K T;  1HF8 A;  2LOS A;  2CNM A;  3KV4 A;  1NWM X;  5LJN A;  4TX5 A;  3IEE A;  1P0H A;  2VAS A;  5FY0 A;  3LK4 2;  1MMG A;  1QSM A;  3DR8 A;  1YX0 A;  4A56 A;  2CXF A;  3SXO A;  4A2Z A;  2HUZ A;  4QHO A;  3Q9D A;  5HYA A;  2B4D B;  2FIW A;  3S6F A;  3JUW A;  2V26 A;  4OYJ A;  4JWP A;  3W91 A;  2CNT A;  1NAF A;  4AXP A;  5J8C A;  1BR1 A;  5L2L A;  4GK0 E;  1XIX A;  1T98 A;  4L0R A;  5LGU B;  4MBU A;  3RYC E;  5JH7 E;  5HXH A;  4CGL A;  2C27 A;  2WMN A;  4NXY A;  2HPL A;  2PR1 A;  4O2A E;  4PK6 A;  3RKO A;  2YK0 A;  4PW8 A;  2Q44 A;  2JQQ A;  3CQC B;  3IWE A;  2X9Y A;  4H9O C;  1UX4 A;  4PSW A;  5AGE A;  2Z3L A;  4UFV A;  4C2Z A;  3IU1 A;  4DBR A;  4KP3 C;  1Z4E A;  2KCW A;  2I59 A;  5ADX L;  3I3G A;  4UIG A;  3K3O A;  5JQG E;  2C0S A;  1MIY A;  5HXC A;  3VWE A;  2JDC A;  4HKA A;  2BVM A;  2D0T A;  3RX6 A;  2YU1 A;  2ZW7 A;  4KOW A;  5JDM A;  4UVA B;  4YJ2 E;  4OHF A;  4X20 E;  3D8P A;  4WW0 A;  1S7L A;  1LVF A;  4KLW A;  2ZM2 A;  2KWI B;  3UY5 A;  3B8G A;  1M4D A;  1EZ3 A;  5FXV A;  4MHD A;  4C2X A;  1MJ9 A;  3MZK B;  5F46 A;  3RC3 A;  1QSR A;  2OZG A;  2Y6X A;  4CYO A;  4F6R C;  4H6U A;  5HMN A;  4KOT A;  4L9I A;  1CJW A;  2G3T A;  2VZY A;  3D2M A;  4K30 A;  2DWK A;  5AFU L;  4U5Y A;  2CEA A;  1BR2 A;  4OAD A;  1HX8 A;  2R98 A;  4OFZ A;  4H9P C;  3MK7 C;  3MA9 A;  4YGO A;  4UWI A;  2LSK A;  1K4J A;  2GK9 A;  2QIR A;  2WSA A;  1OZP A;  5BWA B;  4OLL A;  4JEU B;  4IF5 A;  3LK2 B;  4PSX A;  3P8C D;  3N7Z A;  3RPU A;  3ZMS B;  2EHO A;  4H89 A;  2E8I A;  3J9X 1;  2IC9 A;  2JMK A;  2XAQ B;  3NZP A;  3BJ8 A;  4CAF A;  2JPF A;  4LX9 A;  1HFA A;  1NE9 A;  2NOX A;  3I9W A;  3OKQ A;  3KVB A;  3UUL A;  1QST A;  5LP6 E;  1M4I A;  3TOA A;  2JRK A;  4J3G A;  4H9N C;  4XAX B;  3KV5 A;  4MY3 A;  5IYZ E;  1PUA A;  4YLH A;  1HTJ F;  4H9S E;  2Z11 A;  2D0U A;  2VKD A;  3KV9 A;  1YVO A;  3E0Z A;  2N9D A;  4PAG A;  3NRY A;  3C4Z A;  1UX5 A;  3K3Q C;  3C64 A;  4B5P A;  3WAK A;  2EHO B;  4AG9 A;  2XTL A;  4FD5 A;  5KTC A;  2VI7 A;  2PDO A;  3HKC E;  3C4W A;  4C90 A;  2C5J A;  1Q2C A;  2J1D G;  4JXQ A;  2M67 A;  2B3U A;  2BUE A;  4V1A v;  1FIO A;  1B7T A;  2J8M A;  2X66 A;  4YHJ A;  3ETV A;  4CYP A;  3ETU A;  2FS5 A;  4C2Y A;  2YNC C;  3VWD A;  2YNC A;  2BL1 A;  2O28 A;  4L8A A;  3KVA A;  4NCZ A;  4OK0 A;  2ZPA A;  1G73 A;  3DJB A;  4ZI7 E;  3K9U A;  3B13 A;  1S94 A;  2I79 A;  4O4H E;  4QB9 A;  4EOZ B;  4B5P B;  2XAG B;  3R6N A;  3BLN A;  3P2F A;  4ZI2 C;  5HWX A;  4C7I A;  4IE6 A;  3C50 A;  3PUR A;  2ZW5 A;  5G21 A;  4LUA A;  1HS7 A;  2LHR A;  3R9F A;  3J7Y q;  2X9X A;  3H5Z A;  1MMA A;  2IW5 B;  4G2A A;  4XZC A;  3U3I A;  3IHR A;  3FXE B;  1MJB A;  4UFW A;  4CXY A;  1G8X A;  3HKD E;  4L89 A;  3TE4 A;  4FD4 A;  2JMH A;  3CQG B;  2CNS A;  2EHO D;  5L3C B;  2VKH A;  5C88 A;  2CXD A;  2Z6E A;  4CAW A;  4B12 A;  4IIJ E;  5L3F B;  4KLV A;  3R96 A;  2Q4Y A;  2FT0 A;  3AVS A;  3K8P C;  4ZI3 D;  5JR9 C;  3E0K A;  5JR9 A;  4UCM A;  4KOR A;  4YRH A;  3FB3 A;  5F49 A;  5AG7 A;  1I21 A;  5GCN A;  3RH3 A;  2UXX B;  3ZJ2 A;  4R57 A;  1SA0 E;  2K48 A;  2P6G A;  2LHN A;  4QXB B;  2OZH A;  2Y48 B;  1WRD A;  4PFO A;  2Q7B A;  3O1H A;  5A1L A;  4P0A A;  2MYS A;  4QBJ A;  4ORF A;  2NP9 A;  5JVD E;  3TTH A;  4JXR A;  4JUY A;  2Z0Z A;  1D0Z A;  2R7H A;  2GE3 A;  3O4X E;  5AG6 A;  3OBV E;  5JR9 B;  2LE8 A;  2Q9Q C;  2X7B A;  3KFW X;  3C26 A;  2Q9Q A;  3AB3 B;  3QC9 A;  1YR0 A;  2D4O A;  1WYC A;  4EYY R;  2XAF B;  3AVR A;  4B5O A;  4ZBG A;  4PNI A;  5LNK A;  1CUN A;  4DO0 A;  3T90 A;  2DNX A;  2ODV A;  4QXC B;  3Q5X A;  2X68 A;  1HG2 A;  2BDE A;  1S3Z A;  4R3K A;  2P0W A;  1S35 A;  3LK3 B;  2WM9 A;  1X79 A;  2HPJ A;  4AKI A;  1N71 A;  2REF A;  5KMG P;  5TAO A;  1M44 A;  2A3D A;  4X1Y E;  5EZY E;  4EVY A;  5A28 A;  5DQV A;  3EVY A;  4HNX B;  3MGD A;  2Q9Q B;  5DWM A;  4KSF A;  2ZM0 A;  3C51 A;  3CXQ A;  1HG5 A;  2RP4 A;  1MJA A;  2W63 A;  4KUM B;  2P6F A;  2EVN A;  4FD6 A;  3AA0 B;  1Q2Y A;  4CGP A;  4H63 V;  3CWZ B;  4WNK A;  2V7J A;  2VEZ A;  3SRZ A;  1GHE A;  2G0U A;  4KVO E;  2X51 A;  1MMD A;  2NTY A;  2F5I A;  4I49 A;  3Q5W A;  4BJM A;  4UEL A;  4A32 A;  4MFK A;  3TKL B;  3L3P A;  1IAP A;  4L5G A;  2CXL A;  1XF8 A;  4MJ8 A;  5L3E B;  3NE7 A;  4XNH C;  4B14 A;  4QVT A;  5JRE A;  2J8N A;  5LGT B;  2K24 A;  5JDQ A;  3R95 A;  5HXR A;  2X0L B;  3WAJ A;  2OH1 A;  1QSN A;  3ZPO A;  4O4L E;  2LEH A;  1RXT A;  4CXX A;  2Z3N A;  2B3V A;  1WYB A;  1IJ5 A;  1XMT A;  1IYK A;  3V5U A;  3QK6 A;  2SPC A;  1ZKE A;  2NW7 A;  2BEI A;  1H7C A;  2DPS A;  2LSY A;  1CM0 A;  1BO4 A;  3FXT A;  5DWN A;  1QSD A;  5EK2 A;  3FB2 A;  3LD2 A;  1YRE A;  3GA8 A;  4XNH B;  5IV0 A;  4IE5 A;  4MBQ A;  4IST A;  3GN5 A;  2AE6 A;  5M4Y A;  4CGO A;  5H86 A;  2N2N A;  3FYN A;  3VKG A;  5HAX A;  3W15 B;  3JC6 C;  2HQY A;  4CYQ A;  5HXS A;  1AJ3 A;  2Q4V A;  4CAV A;  4OYK A;  3SXN A;  3GMI A;  3AAI A;  2V1D B;  4QKN A;  3N2O A;  5JRC A;  2PC1 A;  3AAE B;  4HTE A;  4ASK A;  4TUY E;  4C91 A;  3I1A A;  4ONU A;  1TIQ A;  1KNZ A;  3CX8 B;  1HCI A;  2H5M A;  4MFL A;  1BR4 A;  3ZEF B;  3UFE A;  1ZHC A;  4X1I E;  3GN5 B;  3WR7 A;  2KWH A;  4IE4 A;  3W6S A;  4OAE A;  2FIA A;  2Z3P A;  3FHN A;  3IBP A;  2CY2 A;  3N9Q A;  4PFP A;  4PK5 A;  1KUY A;  1XEB A;  3ZYK A;  2ATR A;  5FMN A;  2DLR A;  2DHR A;  5L3G B;  3W6X A;  1E1H B;  2H7O A;  2WMO A;  4IGU A;  1VKC A;  4DMV A;  1S60 A;  4XPL A;  4CRY B;  3FRM A;  3KKW A;  1QUU A;  2KZ7 B;  5JRC B;  2XUE A;  4JLE A;  5A27 A;  5LCY A;  3H4Q A;  4NUU A;  2P6E A;  3CKD A;  3TO6 A;  4H6Z A;  3T8O A;  3F5B A;  3NZQ A;  2V7I A;  5L3B B;  4ANJ A;  4HN9 A;  2Z3O A;  4UVC B;  5JDG A;  4IUS A;  1YLE A;  4DVD A;  5CB4 E;  4AVA A;  3PUA A;  3HI2 A;  2ZM8 A;  5I0C A;  1XE4 A;  5LGN B;  5F47 A;  1UFH A;  3HKB E;  3VKH A;  4DNC A;  2CLY C;  4PJJ A;  2HH7 A;  4WBN E;  3F2E A;  3PZJ A;  2G0B A;  3TO7 A;  3N9M A;  2VKJ A;  3S6K A;  2FXF A;  4R9M A;  3HR0 A;  4F6A A;  1M4G A;  3ONX A;  4UCN A;  2OZU A;  1LRZ A;  4H9Q C;  4AB7 A;  4MY0 A;  2XHE B;  3LFM A;  5EBV A;  4QC6 A;  4EYU A;  4KUA A;  1IZN B;  4ISS A;  4CRZ B;  5EK3 A;  4QUS A;  3TOB A;  1SHZ C;  2KMF A;  4MAL A;  5HXE A;  3UUM A;  3N9O A;  1KZF A;  3FBZ A;  4CGM A;  4J2C A;  2NW9 A;  3MJX A;  1ZO0 A;  4M3S A;  4MHC A;  4GK5 E;  4GYS A;  2XAS B;  2IL4 A;  4UV8 B;  2VBQ A;  3ZMT B;  3A9L A;  1PU9 A;  3CPZ A;  5C8Y E;  2VWA A;  2VB6 A;  3R84 B;  1WK4 A;  3P2H A;  3ZYL A;  3EDV A;  3CXP A;  4O8S A;  4KMC A;  5J1G A;  5F8P A;  2CWY A;  3FNC A;  5G1Z A;  4IE7 A;  1KUV A;  5FXX A;  5FY7 A;  2R8V A;  1VHS A;  3O9X A;  1YK3 A;  2ZW4 A;  3QAH A;  1ZEE A;  2W0G A;  5JDL A;  3O1J A;  1I12 A;  3UTK A;  5FY1 A;  3MKD A;  3ZMU B;  4PK4 A;  3RYI E;  2ACX A;  3V5S A;  2OU2 A;  3LOD A;  3MAC A;  4ADZ A;  3I9Y A;  1ZV4 X;  3TFY A;  4EAH A;  3S6H A;  4X5K A;  4H63 H;  3ANW A;  3IF8 B;  4B10 A;  1US7 B;  4I4T E;  3DNS A;  3NRX A;  3B57 A;  3ZN0 B;  5LHG B;  3PU3 A;  1KK7 A;  2JLM A;  4B13 A;  1Z9U A;  3SS1 A;  4CAE A;  3EO4 A;  4EZ4 A;  1RO5 A;  4AG7 A;  2B58 A;  4PK3 A;  2YIN A;  4GOU A;  2XAJ B;  3FXD B;  3RYH E;  1MND A;  4AQF C;  1S7N A;  2BSW A;  3L09 A;  4UF0 A;  3DTO A;  1MMN A;  5FXZ A;  2PBI A;  2LOP A;  3HKE E;  5AG5 A;  4R87 A;  2LSG A;  3BJ7 A;  3ANW B;  3U78 A;  3IWG A;  4H9R C;  4ZGY B;  4GYR A;  1YGH A;  5FXW A;  3F57 A;  1FY7 A;  2IAK A;  1Y9W A;  3R9G A;  4E0A A;  2CMR A;  3OWC A;  2WWU A;  4TZ4 C;  3IU2 A;  2W61 A;  5JDH A;  4I43 B;  3ZCI A;  4G63 A;  4CI1 B;  2FL4 A;  1IIC A;  2VKO A;  2VXK A;  4CS0 B;  4KOV A;  3DDD A;  2YGW A;  2YNE A;  3BQL A;  4ZI2 D;  3I9S A;  4UF0 B;  2RC4 A;  3SHP A;  4BJN A;  4ZS3 A;  3D3S A;  3VHL A;  4MFR A;  3CVR A;  1P4N A;  2ZMA A;  4HNY B;  3D2P A;  3ZCJ A;  2H7V C;  3H37 A;  4YJ3 E;  2VL8 A;  2KIN B;  3BQI A;  4JEH B;  2OA5 A;  1U4Q A;  3LJC A;  4QX8 B;  3ZZI A;  2L9Q A;  4I50 E;  5CNP A;  5LG4 A;  1NSL A;  5FYM A;  3RRC A;  3ZMV B;  3SOL A;  3N9N A;  5LOV E;  1IB1 E;  1MNE A;  2FCK A;  5J2U E;  1MIV A;  4UXN B;  3F8K A;  3KBT A;  2FSR A;  1BR0 A;  4PK2 A;  3UUX B;  2WAU A;  3N2G E;  3AA7 B;  2YND A;  3LBX A;  3PP9 A;  4HKF A;  1IJ6 A;  1O3X A;  4CI2 B;  3CXS A;  4KSA A;  4IDZ A;  4ERR A;  4A31 A;  4KBM B;  4UEM A;  4U74 A;  2WUU A;  3E22 E;  4PJM A;  4M85 A;  3DP7 A;  5L3D B;  2NMT A;  4M1P A;  1U6M A;  1Z4R A;  3F0A A;  3Q2M A;  2LSJ A;  5DAB A;  4UCP A;  1YD8 G;  3KV6 A;  4TV8 E;  2Y8D A;  2A2F X;  4KS9 A;  3ESL A;  2LT3 A;  4P0B A;  2RA1 A;  4DMW A;  2DXQ A;  1UCU A;  2DI4 A;  4UV9 B;  5JQ4 A;  3HA4 A;  2Q9Q D;  1QSO A;  4ZS2 A;  2KXP B;  3TCV A;  1YKE B;  3EXN A;  3LBX B;  3KBU A;  2VQY A;  2MTQ A;  2V7M A;  4NEX A;  2Z3M A;  2EUI A;  3P7I A;  1Y9K A;  3FBL A;  4WBO A;  1MK4 A;  5F3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...