1LRZA

X-ray crystal structure of staphylococcus aureus fema
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
412
structure length
400
Chain Sequence
MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Staphylococcus aureus FemA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic inhibitor
molecule keywords factor essential for expression of methicillin resistance
total genus 137
structure length 400
sequence length 412
ec nomenclature ec 2.3.2.17: N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N(6)-glycyl)-D-alanyl-D-
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02388 FemAB FemAB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1lrzA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA02
1BO4A 2REFA 3R9GA 4F6AA 3DR6A 4XPDB 2FT0A 2VBQA 3G3SA 5KTCA 3S4UA 5F46A 2ZW4A 1Z0PA 4KLWA 5JQ4A 1YLEA 1MJAA 1XE4A 3DNSA 2B58A 1KUVA 4UWIA 2QECA 1P0HA 2X7BA 5JPHA 4KOWA 2EUIA 4XPLA 4EVYA 4JXRA 3S6GA 3FBUA 2PQ8A 1S60A 3MXZA 4J2CA 2Z0ZA 3QAHA 4XPKA 3CXPA 4DNCA 2K48A 3OWCA 4KUAA 3TO7A 1H7CA 4KOYA 3H4QA 4RS2A 1IJ6A 3N7ZA 2B3UA 2B5GA 1YK3A 4JXQA 2P0WA 3F8KA 1IYKA 1UFHA 1XIXA 2IC6A 2JEVA 4NSQA 3BJ7A 4BMHA 4QC6A 1M44A 2G0UA 4UBRA 3I9SA 4FD6A 1RO5A 2FIAA 3D8PA 1QSRA 1P4NA 1TIQA 4KVXA 3N5LA 1U6MA 2PSWA 2CY2A 4NXYA 1WWZA 2VXKA 5IV0A 1NMTA 1YVOA 4KOTA 3CKDA 3LODA 4U5YA 4FD4A 2QMLA 1Z9UA 3IWGA 4OADA 4KZTA 2B5GB 4M85A 3RYOA 4CAWA 3I3GA 3TOBA 4CRZB 2JDDA 2B4BA 5HH1A 3D2MA 4KOSA 1R57A 4E0AA 2PRBA 1GHEA 4PV6A 3G8WA 3FYNA 1MK4A 4U9ZA 3R95A 4B5OA 5KTDA 2FXFA 3F0AA 4ORFA 1NSLA 3S6HA 1IJ5A 4NEXA 2FIWA 3FXDB 1YGHA 5KTAA 2IL4A 3EO4A 2XTLA 2ZW7A 2FS5A 2OB0A 1IICA 3R96A 3DSBA 3SHPA 3EXNA 1Z4EA 2JLMA 1XMTA 3FXEB 3PZJA 1LVFA 1S7NA 5I0CA 1CM0A 4AVCA 1M1DA 3TCVA 3UY5A 4J3GA 4KUBA 1QSMA 3R1KA 1M4DA 1OZPA 1VKCA 4YRHA 4ONUA 5DWNA 4R3LA 4H89A 5CNPA 4XNHB 2BL1A 4CQIA 2KWHA 2C27A 3FNCA 4L0RA 4U9YA 2R98A 1Q2DA 2ZPAA 3ZZIA 1QSDA 2GIVA 4X5KA 2C5KT 5F49A 2I00A 3VWEA 4JLYA 5F48A 2OZHA 2PR8A 3DR8A 2VZYA 1QSOA 2O28A 2B3VA 1VHSA 3FIXA 3FRMA 2VI7A 2NMTA 4IUSA 4EYYR 2BEIA 1IB1E 2B4DA 4B5PB 5EBVA 3QK6A 2H5MA 4YGOA 1IIDA 2AJ6A 1N71A 2WPXA 4LUAA 1ZKEA 4R3KA 4XNHC 1Q2CA 2R8VA 4HNYB 1S7KA 3BLNA 5C82A 3WR7A 3TT2A 1IYLA 3P2FA 1PUAA 5HMNA 4PSXA 3GYAA 2ARHA 2Q0YA 4AVBA 3NE7A 4KOXA 5DWMA 1Y9WA 2J8RA 2D4PA 4JJXA 5J8FA 2Q7BA 1KZFA 4Y49C 4QB9A 1SQHA 2Q44A 4JD6A 4OLLA 4GS4A 2CNSA 2PDOA 3B8GA 3EY5A 2J8NA 5EC4A 4K30A 3S6KA 3F5BA 3CXSA 4QBJA 2C5IT 2Q4VA 2Z10A 4F0YA 5FVJA 2I79A 4KOVA 4MHDA 2GANA 4H6UA 3PP9A 4RI1A 4MY3A 4KVME 2DXQA 2B4DB 1I12A 3P7IA 3EFAA 4MBUA 3TE4A 3GKRA 1Y7RA 2FCKA 4PSWA 2MBGA 2G3AA 1S7LA 3W6XA 4MJ8A 4AG7A 1S7FA 4KLVA 2VQYA 4HKFA 3TTHA 5E96A 4UA3A 4B6XA 2VZZA 1PU9A 3W6SA 1M4IA 4ZBGA 4I49A 5J8CA 2KCWA 3TO6A 3FB3A 2R7HA 2RC4A 2GE3A 2OH1A 4E2AA 4B5PA 2Z11A 3P2HA 4E8OA 4CRYB 4JWPA 4CS0B 1RXTA 1M4GA 1MJ9A 4AB7A 2G3TA 4QUSA 2X9YA 2A4NA 1LRZA 1KUYA 1S3ZA 2HQYA 3CXQA 3DDDA 4PK3A 1FY7A 2PR1A 2ATRA 4KORA 2FSRA 4M3SA 1WK4A 3VWDA 3BJ8A 1Y9KA 3JUWA 1V0CA 4R9MA 3CVRA 1B87A 1YR0A 2REEA 3SXOA 2Y0MA 3QUJA 4H6ZA 5IX3A 4QVTA 4HNWB 1Z4RA 4OAEA 5F47A 2HV2A 4NCZA 2KWIB 5ISVA 1Q2YA 2WPWA 4FD7A 2X9XA 1QSTA 4HNXB 2CA5A 2OZGA 4MI4A 2C5JA 3TKLB 2CNMA 3R9EA 1XEBA 4FI5A 2D4OA 2OU2A 4R57A 1I1DA 3SXNA 4LX9A 4NF1A 2Q04A 2OZUA 2AE6A 3V8IA 4R87A 1YVKA 3D3SA 3R9FA 2FE7A 3ZJ0A 3QB8A 4CAXA 2BUEA 4AVAA 2P6EA 3FXTA 3EC4A 2G0BA 3KKWA 1XF8A 2X9WA 2ZW6A 3JVNA 3LD2A 2ZW5A 2P6GA 1I21A 2HUZA 4MY0A 3W91A 4FD5A 1CJWA 2VEZA 3T9YA 2F5IA 2K5TA 1L0CA 4UWJA 3L3PA 4XPDC 2IC9A 5GCNA 4II9A 1YX0A 1MJBA 5IB0A 2R1IA 2QIRA 2BSWA 4YFJA 3GY9A 4L8AA 3TO9A 3S6FA 2CNTA 2PC1A 1J4JA 2JDCA 3IGRA 1S5KA 2FL4A 2P6FA 4CAVA 1B6BA 5C88A 3K9UA 1ON0A 1QSNA 4Y49B 3T90A 3D2PA 4IF5A 1BOBA 4PK2A 3MGDA 4KVOE 3C26A 5H84A 4DNDA 4L89A 2ZXVA 1KUXA 3E0KA 4KOUA 3TOAA 1K4JA 2EVNA 2J8MA 3TFYA 4AG9A 3PGPA 1NE9A 1YREA 5H86A 2Q4YA
chains in the Genus database with same CATH superfamily
2V6YB 4C91A 4P4IA 3R9GA 4F6AA 4ISSA 4UVAB 3CZXA 3S4UA 2ZW4A 4KLWA 3IA3A 1WYBA 1YLEA 3DNSA 1G73A 4X1YE 2J4GA 3UULA 4BD9A 2NSMA 4JXRA 3GUXA 3S6GA 1OEDB 1U5PA 3GIUA 5JDMA 4LFCT 4J2CA 3QAHA 3A7MA 4OX9T 4XPKA 2VVSA 2NR4A 2K48A 4HFIA 1H7CA 5L3GB 4KOYA 3H4QA 5AG7A 4B14A 1MIYA 2PFVA 1OXZA 4UF0A 5FKYA 2PJAA 3ZCIA 2P0WA 1HG2A 1UFHA 5ABEA 2JEVA 3BJ7A 2Q4ZA 4AKRB 2RA1A 1M44A 3I9SA 1I94T 3AE7A 2PJ3A 5HCMA 2GFQA 3D8PA 2L3LA 5HYAA 3KL9A 2OA5A 2DHRA 2XAHB 2JPFA 5CJ5A 3R84B 2PSWA 4NXYA 3SJXA 5F5WA 2V8DA 3SWHA 1YVOA 3ONJA 3N9QA 4YTMA 3J9X1 2K24A 3UFGA 5L4HA 1FMWA 4HWHA 2V8HA 4FD4A 5LHIB 4DJLA 2V1DB 3UQ7A 1F57A 2KINB 3TOBA 2PJ5A 3RQUA 2JDDA 1WYCA 1GHEA 5E0OA 2DWGA 3L2NA 5L3CB 3CX8B 2Y6XA 4CYOA 3ZMVB 5LP6E 4P4EA 4N78D 3T1HT 5HXCA 3FEEA 3F0AA 4CYNA 4P4BA 4AQYT 4EEBA 4EOZB 2FIWA 3B3TA 4P10A 2BG9B 4MXUA 3AE4A 4QX7B 2ZW7A 5AQTB 4YSYA 4FAIA 4O2BE 4U2YA 4A31A 1OEDA 2L9QA 4CI1B 2H88A 2I0MA 2LSKA 4ZS2A 5AQHB 4IL9A 1Z4EA 4NIQA 3LG7A 1ZO0A 3BI0A 4KSAA 3FXEB 5HEUA 1YQ3A 3PU8A 4DR4T 4AVCA 3K8PC 3ZT5A 1M1DA 4NXNT 2VQFT 1N32T 2I6HA 5M4YA 2AFMA 1CBXA 3UY5A 4YHHT 4YXDA 3NBXX 1VKCA 2LRLA 4X8IA 4R3LA 1VOMA 2WMOA 2FJEA 4XNHB 4CN1A 3LSVA 2F4VT 3PUZF 4CQIA 5JVDE 1HX8A 1WR0A 2FBWA 2LEHA 4LMJA 2KWHA 5AG4A 4K3NA 2C27A 3PJAJ 4L0RA 4IDOA 4L9IA 4X1KE 3I0QA 2ZM6T 5C3JA 4U33A 2LM9A 3A8YC 2W63A 4UEMA 3OBVE 4B11A 4A5XA 3B2YA 3VWEA 1NSAA 2V26A 4JLYA 2WCAA 2OZHA 4EB6E 4KHZF 2PJ8A 1U4QA 2KXPB 2V7IA 4OHFA 1S35A 2WDRA 4HWFA 2ZM8A 5HXSA 1YXRA 4H2KA 2CEAA 1IZNB 1AYEA 3CMLA 1YD8G 3LBXB 1Q7LA 3ZC0A 3S9LA 4B5PB 4IE0A 4PPZA 3VHLA 1N71A 1NENA 1ZP0A 5IUXA 3CQXC 3AE1A 4NGQA 4WYVA 3CX6B 2IMOA 2AFWA 4R6TA 1BR0A 3IEHA 4NJQA 4PNIA 4TN7B 3WAJA 3MJXA 3TLVA 5C82A 3WR7A 4X5TA 3LWUA 4WWVA 1O3XA 3TLWA 4CPAA 1PUAA 3HR0A 1CP6A 4IK2A 3I0OA 5EK4A 4P6YA 2PIYA 2Z3OA 1YKEB 5JRCA 4KOXA 1Y9WA 1ZLIA 4AQFC 1VCTA 1HNZT 4JJXA 4IIJE 4QB9A 1AMPA 2VVNA 4HFEA 1KNPA 3N9MA 4KI0F 4JD6A 3NZPA 2AFSA 3H8FA 2CNSA 2CWYA 3EY5A 4NGTA 1MNEA 5ELYA 3QNUA 4K30A 4QBJA 4KHPT 3B3VA 2WP9A 4EYUA 4KOVA 4RI1A 2BS3A 5FYMA 1N36T 1KFYA 3CIRA 4ZX8A 1US7B 4P4JA 3UU4A 4PSWA 4H9NC 4DV6T 4A97A 3IJ3A 1S7LA 4AG7A 2VL8A 4IE4A 1Y7EA 3TTHA 3S9NA 2LHRA 3OYXA 1UCUA 4B6XA 2VZZA 2IDOB 5K8MA 1M4IA 4ZBGA 2XHEB 3UTKA 3ANWA 2PJ6A 4OMEA 4A2ZA 5LRKA 4DO0A 4U7IA 3RYCE 4MLKA 5FL0A 2LLYA 4X1IE 4DMWA 2IHR1 1Z8LA 2VQET 4JZ0A 3EVYA 4E2AA 3ZC1A 4IHJE 3ZKRA 2E5LT 4X64T 3KQZA 5HAXA 2Z11A 2O4HA 4ZS3A 3IU1A 2QRXA 1QQ9A 1RXTA 1MMAA 4X2TA 2WY2A 4U2ZA 1MJ9A 1D1BA 2G3TA 2E9XB 4DYOA 5I4MA 3SI2A 4H9QC 2X0HA 4Z91A 3ZYMA 3FZKB 2UUAT 2A4NA 4OC1A 2GLJA 4DV4T 5LGNB 5LHHB 4JEUB 2K3WA 4BJMA 2PR1A 4OK0A 4M3SA 1WK4A 2ZM2A 3D66A 3JUWA 3RGLA 1Z5RA 3ZJ1A 4MHPA 1V0CA 2YDQA 2JQHA 3H8EA 1YR0A 4YTPA 4QXCB 2Y0MA 1IOIA 3DLJA 4NFRA 3SJGA 1RTQA 3Q5DA 2GLFA 2YU1A 3KASA 1XJOA 2HV2A 2W0GA 1Y01A 4NCZA 1M7KA 2FVGA 4WBNE 3LK42 4PAGA 4MALA 5AQMB 2EHOD 2WPWA 4HGAA 3L39A 4PJNA 3JAFA 3N9NA 1UWYA 4EAHA 3TKLB 3R9EA 4R57A 4UEEA 2XEJA 3AXJA 4DUYT 4EIWA 4U7YA 4MFQA 4ZYQA 2Q04A 3KQXA 1Z8TA 4LMKA 5DABA 1X79A 2HB6A 3RIUA 4R87A 4DIDB 2BDEA 4YT0A 4OIDA 1M62A 3R9FA 5AQGB 1DE4C 5ABFA 5CPAA 2BUEA 2Q51A 1JNRA 2P6EA 2QVAA 2JRKA 2X9WA 5AG5A 2E9XD 3LBXA 2XEFA 2P6GA 2ZELA 3MKDA 3W91A 1CJWA 3T9YA 2F5IA 2R6GF 3L09A 1L0CA 4UWJA 3CWZB 4KUMB 2H89A 4A39A 2AE9A 5IB0A 4GXHA 2E8IA 1W0BA 2WYRA 4IE7A 3IF8B 3UUMA 2ANPA 3T8WA 3S6FA 2XQ5A 4PK5A 2JDCA 3VKHA 3ISXA 4CXXA 4RUHA 2FL4A 5JDHA 4MFJA 4CAVA 3BXMA 2V7LA 2WB5A 4DR3T 1ON0A 1CP7A 3NH8A 4OC5A 3IEEA 5AQIB 4UIGA 5AFUL 3CQCB 3ONLC 3PBBA 4JYWA 4QXBB 4L89A 2SPCA 5HWXA 3E0KA 1UUSA 3PE0A 4DR5T 5AQRB 3TOAA 2HPLA 2EVNA 5GONE 2BOAA 2JMKA 3F57A 4X20E 3PB6X 5CBMA 4C90A 2Z3KA 3KI9A 1D0XA 3PB8X 2Q7SA 4UFVA 3KGQA 3ZLIA 1VRBA 3DR6A 4XPDB 2PCUA 3KR4A 5LCYA 2PVWA 2WZIA 1MNDA 3AE8A 1F2OA 3C64A 4ZY2A 3NZQA 1KUVA 4NXMT 1P0HA 4ZXLA 4HFCA 2X7BA 1ELLP 2X67A 4XPLA 4P1NA 2Q9QA 2PQ8A 1S60A 1VHOA 5AQNB 3PEIA 2VKOA 3P4PA 5L3DB 2Z0ZA 1FT7A 4UIBA 3CT9A 4QWNB 5AQSB 2RB7A 4DNCA 2KNDA 3OWCA 4KUAA 3N9PA 1X10A 4X3RA 1CX8A 2WS3A 3TX8A 4V1Av 5DS0A 2C6GA 2CRBA 4CAFA 2FJAA 1YW4A 2V7JA 1CUNA 3MA9A 4I55E 3F8KA 5JDLA 1IYKA 3B3SA 3AA1B 3MZKB 2UXBT 1UK5A 4QC6A 3PJAA 4UBRA 3UU6A 4GYRA 3QNVA 4NGMA 5DQVA 2J47A 2FIAA 3K9TA 4JI5T 3NFZA 1BR2A 4YY3T 4C7HA 4JV5T 3C4XA 1QSRA 1P4NA 3KBUA 4KVXA 3N5LA 4Z8XA 2AXDS 2HHHT 4G2AA 5FL1A 5D8NA 1LVKA 3PUQA 4F9VA 4PJMA 1Y0YA 5IV0A 4O4HE 3D68A 5F8PA 5LA6E 3LODA 4UIAA 4KZTA 3ZJ2A 5KDMC 3I3GA 4LFAT 4CRZB 2ES0A 2JBKA 2B4BA 3D2MA 2EHOA 2JQKA 4KOSA 4ZI2D 3PURA 4JI4T 2QJ8A 1SE7A 2RFHA 1MK4A 4U9ZA 2O53A 3EI0A 4CGOA 5LG4A 3JADA 3R95A 3GMIA 4B5OA 5KTDA 2FXFA 3HKEE 2DL1A 3FEDA 4ORFA 3Q5XA 4E7SA 1NSLA 4I43B 4NPPA 4AXVA 4HFBA 3AAIA 4ZI6A 4DV7T 2V7KA 2CM0A 2WU5A 2IL4A 3EO4A 2XTLA 4HFVA 5FVLA 2Q43A 3B7IA 2OB0A 5AQLB 1IICA 1N34T 3FZLB 3DSBA 2LM2A 4U3CA 3LK2B 3UFEA 2BKPA 2YNEA 3Q2MA 2E2AA 3AA0B 5LJNA 1IOFA 4DV2T 4CXYA 3U78A 2C0SA 3O1IA 1DU2A 4KUBA 1QSMA 1OZPA 4YRHA 5DWNA 2BG9E 4B3RT 3H37A 4IDNA 1YSJA 2XQ4A 1Z2LA 3D7FA 4ISTA 5L4EA 1XDPA 2XM2A 3FNCA 3SFEA 2F7VA 4U9YA 4B6ZA 4DV5T 3D7GA 1Q2DA 3ZZIA 1QSDA 1LAPA 1IU8A 1HNXT 3ZMSB 2ZEGA 3VU7H 4QHOA 4PW8A 2PR8A 1JWQA 2XAQB 2EK8A 1J1JA 5AQFB 4E7ZA 3Q5WA 1T72A 1XMQT 3EUHA 1QSOA 3T8OA 2O28A 1JQGA 2BCOA 3LMSA 3KV5A 2VI7A 4Q38A 2PBIA 1V9DA 5ADXL 2NMTA 3ZSSA 2BEIA 2XSAA 4H9OC 4TWEA 2WMNA 5BMVE 2WSSV 3O9XA 3OTOT 4H63V 4YGOA 3TLUA 4TUYE 3RYFE 1IIDA 1WCRA 4UCNA 1UX5A 1LKXA 2AJ6A 2ZEHA 4AIUA 3E0ZA 1ZKEA 3HUVA 2CBIA 1Q2CA 4HNYB 4X66T 1W0AA 3HKCE 3RPUA 1HX1B 5IWAT 5F09A 1IYLA 3VRAA 4ZGYB 2V5CA 3UUXB 4P4DA 3P2FA 5HMNA 2GK9A 3GYAA 2Q0YA 5LGTB 2V7MA 3RF1A 5DWMA 1FNOA 2PJ2A 5J1QA 3B35A 2UXCT 2Q7BA 2A3DA 4Y49C 4JI0T 2ZM0A 2OV9A 3SS1A 3QB5A 2Q44A 2IAKA 2EHOB 4GS4A 4R8FA 2J8NA 1SHZC 3V5UA 2QGSA 3ZEFB 5EC4A 3F5BA 5JDFA 3PRTA 3DJBA 4ANJA 4UF0B 4H6UA 4H63H 1IGBA 2ZOFA 2ZEOA 5EMIA 2H7OA 3AEEA 3RYIE 2W2UA 3DP7A 3EDUA 3EFAA 3M65A 2Z3PA 3GKRA 4YJ2E 5LYJE 2FCKA 1L0VA 3IWEA 2MBGA 2BS2A 3ZMZB 2AFZA 3W6XA 4MJ8A 2WZHA 3Q5EA 4JI2T 3N9LA 5E96A 2X0LB 4UA3A 1QMUA 2KSRA 1ZHCA 2VURA 2Z3LA 4I49A 1YQEA 4Z65A 3FMCA 4Q7AA 5J8CA 2J62A 4YSXA 2WUUA 3FB3A 2R7HA 2CHNA 3RRWA 3QB5K 4B5PA 3JTKA 2YNCC 2XQ8A 4QXHB 2UXNB 2XAFB 4ADZA 4CI2B 2D5UA 4EXTA 3P2HA 2N1GA 1TKJA 4JWPA 5EK2A 4RN7A 5HWYA 3RC8A 3ZT7A 4A37A 5J2TE 3AB3B 4QX8B 2CTCA 2IJZA 1MIVA 2A9UA 4IT4A 5L2LA 5IHYA 4DV3T 2JEWA 3A9LA 3VRBA 1ARLA 1YKHB 2CXFA 4DR2T 4JI8T 3ANWB 2AFXA 3DDDA 3RKGA 4TNVA 3KBTA 2MOZA 4KORA 4UV8B 3CDXA 4ZEYA 4UELA 2WWVA 4JI6T 4LF9T 3BJ8A 5A27A 3ZMTB 1D0YA 4ZI3C 2ZEDA 2OOTA 2MPKA 4BJNA 2J9AA 3NA6A 4O2AE 3HL6A 3QUJA 2LSJA 1I6ZA 2C1CA 3HKDE 1M4LA 4OAEA 2KLQA 3WABA 1WRDA 4F9UA 4EFDA 2KWIB 2PJCA 5IB9A 4P09A 1TF9A 2YDSA 1ZOYA 4ILUA 2VKJA 3VATA 4FD7A 1R8IA 4HNXB 2CA5A 3AEBA 2PE3A 1WFDA 1YW0A 2LSYA 2GREA 3C51A 3RAMA 4DUKA 1Z8XA 2D4OA 2OU2A 2PVVA 1XZYA 4COFA 3PB7X 4LX9A 2W61A 4NF1A 4ILAA 3P4WA 4JLEA 2VL1A 1H8LA 3KV4A 4WJBA 4HFDA 3BQKA 2AE6A 2HC9A 3V8IA 1NAFA 1YVKA 3C4WA 3D3SA 4TWDA 4G1PA 3QB8A 3FXTA 3EC4A 1LAMA 1R3NA 1XF8A 4GYSA 3LD2A 3OVUA 2HUZA 1IAPA 3RYHE 2BS4A 3WC5A 2K5TA 1G8XA 3FHNA 4XPDC 2IC9A 2A2FX 1YX0A 2WM9A 3H5ZA 4KBMB 4GK5E 4ZHQE 4KSIA 4JI7T 2YU2A 2QIRA 2DWKA 5HEOA 3C98B 4ZX9A 3ETVA 4HPSA 3N5FA 3TO9A 1X9BA 4AKGA 2PC1A 5DQWA 4CGPA 5HXDA 5C88A 3K9UA 2UU9T 3T90A 4IF5A 1CPSA 4PK2A 2CWOA 4KS9A 5H84A 5FMNA 2E9XC 2ZENA 4XZCA 1KUXA 2ACZA 2XQ3A 4HWCA 3PUXF 1J5WA 3F31A 3TLSA 2M6BA 4OFZA 2WZNA 3K3NA 4LF4T 5H86A 2Q4YA 5G20A 4HWDA 1BO4A 1J5ET 4M6HA 4ASKA 2D9DA 5ETWA 2FT0A 4YWYA 2YN6A 4IDQA 4JI3T 5F46A 5AQUB 1Z0PA 5JQ4A 1MJAA 1XE4A 4UEFA 3ISZA 4B13A 4NUUA 4UWIA 2QECA 2L8KA 2VKHA 3AEFA 1T8BA 1EE3P 3T1YT 2NWBA 3WT4A 5JPHA 2BVMA 4I4TE 4EVYA 1FEWA 3S9MA 3P4SA 2MAWA 4ERRA 2WWUA 3FECA 4P0AA 4IAVA 4FBEA 4OKOA 2XPKA 5C8YE 3WI3A 4ZZBA 5HVGA 3O4XE 5LYLA 4F0XA 5LNKA 3CXPA 2BBJA 3UQ4A 3BQIA 2FJDA 4A95A 4MMOA 3SI0A 4RS2A 3NVOA 2B5GA 2V6YA 3SJEA 1ZG8A 4JXQA 5K8PA 1UX4A 3B3WA 2PJ4A 3MN8A 2YK0A 4X62T 1XIXA 4NSQA 4BMHA 2CF4A 3EABA 1Z8WA 4MFZA 5K8NA 5LYIA 1E7PA 4GKJT 1FIOA 3P8CD 4R7MA 3P4RA 3EHZA 1D1AA 4Q36A 1MIWA 3D7DA 4KP3C 3VH9A 1U6MA 3ZYKA 4C2XA 2CY2A 4MFPA 1WWZA 2VXKA 4UFWA 1XNRT 2W66A 2CPTA 3CKDA 3HI2A 3VR8A 5L3FB 4A94A 1SA0E 2ODFA 2QMLA 1Z9UA 3AAEB 4OADA 3PUAA 3W15B 5JRCB 4M85A 3RYOA 4KX6A 4YTNA 2QVPA 2JJ9A 2RP4A 2LKGA 2PRBA 4PV6A 5A1LA 3G8WA 2X9HA 4AKLA 3FYNA 2IUBA 5HCJA 2PRQA 4OP4A 2IIUA 2Y8DA 2F8HA 4C68A 3PDYA 4AQGA 2BKNA 4NEXA 5AQVB 5JGFA 3GA8A 2RPAA 1IBLT 2DEAA 2V8GA 3WC6A 3RNZA 2VL0A 1QLBA 2DLRA 2FJBA 4WW0A 2JLMA 1XNQT 4M1PA 5H6QB 4O4IE 1LVFA 1S7NA 2D0TA 2E5VA 2ACXA 4ZI2C 3TCVA 1XMBA 4TNUA 4TNWA 3K3OA 1B7TA 4ONUA 6CPAA 3L8RA 3ZYLA 1PCAA 4H89A 3WC7A 2BG9A 4BA9A 4O4JE 2BL1A 5K8OA 4B12A 1T98A 3I1AA 2YNDA 2M6IA 4AISA 3DTOA 4NJRA 2ZPAA 3BHXA 3GB0A 3FZHB 3FB2A 2GIVA 4X5KA 2W00A 2C5KT 4U72A 5F49A 5JR9A 2WQYA 4U74A 2IQ6A 4PXBA 5BR8T 3F2EA 4AKHA 2VZYA 3J7Yq 5AGEA 4TV8E 5ABFB 2B3VA 1MMNA 5LGUB 2WAUA 5FVKA 2EBJA 3RIAA 1VHEA 1IB1E 4DV0T 2JBJA 4IE6A 5TAOA 2EWBA 3QK6A 2H5MA 4OC0A 2YKSA 2WU2A 4PXDA 3FZMB 2LJLA 4LUAA 2LT3A 5HVFA 2NTXA 3V5SA 3EDVA 4ONWA 3KFWX 2X66A 2XQAA 5FXXA 2NW7A 1XRYA 3JCFA 2XQ9A 4P0BA 1MMGA 5JDGA 2J8RA 5EK3A 1Y64B 5LB7B 5J8FA 3D0TA 1KZFA 3A5XA 1UURA 3ZSTA 2X68A 2C6CA 1SQHA 5HXEA 3V7ZA 5A28A 3PFOA 2ZEEA 2X51A 4UCPA 4DUZT 4OLLA 3B8GA 3FZFB 1IBMT 3S6KA 2Q4VA 4F0YA 3FH4A 4K0UA 5FVJA 2CXAA 2KZ7B 2I79A 3RC3A 5J2UE 4IDZA 4EZ4A 4MY3A 4KVME 1UGOA 3KDSE 2ABZA 3BQLA 2DXQA 3ZMUB 1I12A 2CTBA 4MBUA 2M67A 4AXPA 2W4XA 3GLJA 3AEDA 3SJFA 5LMUT 2KMFA 2VQYA 2XQ7A 3M3ZB 3IWWA 3FBZA 3W6SA 3GN5B 1R43A 1ARMA 4EZHA 3PU3A 4HWIB 5THWA 8CPAA 4MHCA 3TO6A 2Q9QC 3RH3A 4KSFA 5ABHA 1HS7A 5KX5E 5LOVE 2GU2A 1HF8A 4LF5T 1QUUA 1HCIA 4ILBA 5FY7A 2DF5A 4W9YA 2HPJA 4DBQA 2V8SV 1JNZA 2LHNA 4YSZA 5JR9B 4JBWF 3UU3A 4P44A 2OR4A 4AQFA 5G21A 1M4GA 1TF8A 4A33A 2X9YA 1XDOA 2NW9A 5JH7E 1XBUA 3CXQA 1Y0RA 4MFRA 2MTQA 3IC1A 3U3IA 4CYQA 5LRGA 2ATRA 4DVDA 2FSRA 2CLYB 4MFKA 2NTYA 4H9PC 3VWDA 1Y9KA 3UUNA 3I1UA 3RBUA 3SOLA 4R9MA 4F8ZA 4ZI3D 4GKKT 1ELMP 4C7IA 3SXOA 3MACA 1HG5A 4H6ZA 1D0ZA 4DR7T 5HEGA 3CPZA 2V77A 3DGVA 2BG9C 1PYTB 5F47A 4ZY0A 2VK9A 4R76A 5ISVA 3MRUA 2AFUA 3CQGB 1Q2YA 5J0ZA 4JI1T 4CGLA 2I3CA 2X9XA 1QSTA 3AEAA 5LRJA 2Q9QD 2OZGA 4UV9B 4UR9A 1HFAA 3UU8A 2LOPA 3ZCJA 2C5JA 2BZBA 3KV6A 4MBQA 4MCQA 2UUBT 3SXNA 4NGNA 4H9RC 2ZMAA 4A32A 3C4ZA 4Z90A 4A98A 3UT5E 4IGUA 3AE2A 3LJCA 4YU9A 3RKOA 2XEIA 2PJ0A 3K2KA 2FE7A 3NH5A 3N2OA 3X1DA 4WZXA 1KK7A 3JC6C 3IFEA 2IMLA 4NGPA 5JTGA 3KZWA 1NEKA 3KKWA 3ZPOA 1CPXA 4FUUA 3JVNA 1KF6A 1I21A 4O4LE 4TZ4C 4CGNA 4MHZA 2BKOA 2XASB 5GCNA 2R1IA 3PUSA 2BSWA 3QAYA 4L8AA 2E9XA 3ESLA 2ZEFA 3PUWF 2LKHA 5L3BB 2XAJB 2CNTA 1J4JA 3GN5A 3IIBA 3IGRA 3AEGA 4XAXB 3LDQB 1T7SA 4XBFB 4UF4A 3RQWA 3UU5A 4MHNA 4GIWA 4PK6A 5EZYE 1B6BA 4GM5A 2P9BA 1TXRA 3TLTA 5CFBA 5JR9C 1QSNA 3D2PA 1VGYA 2V6XA 4G63A 3MGDA 2QA7A 4DNDA 2ZXVA 3AVSA 5L3EB 4LF7T 4O8SA 4I50E 2J8MA 4QKNA 2Q9QB 3TFYA 4AG9A 3WAKA 3PGPA 1YREA 3RZAA 4OC4A 1S94A 3PUGA 3O1HA 2REFA 3K3QC 1XFOA 1N33T 4BINA 4UXNB 3E08A 4YHJA 1KEYA 1KWMA 2VBQA 3G3SA 5KTCA 5G1ZA 1WR6A 2K9AA 4IDPA 2WDQA 2KT9A 2EHOC 1Z8UA 5LBMA 2CBJA 2B58A 3KV9A 4WBOA 5ABGA 4OC3A 3RIFA 4CZZB 3RIUC 4LQGA 3OJAA 5CA1E 4CXWA 4KOWA 2EUIA 3IO1A 3FBUA 2CE7A 3MXZA 2CLYC 2YOEA 5HXHA 2PJBA 5IYZE 3BI1A 1GQEA 2HH7A 3JC6D 3NE8A 3VKGA 3TO7A 2CMRA 5AQOB 3JAEA 4B3MT 1IJ6A 3N7ZA 2B3UA 2YDRA 5FP3A 4AI6A 1OEDC 5HEHA 1YK3A 5KMGP 2K5BB 4EGWA 4NGRA 1E1HB 4PK4A 5LYFA 2DI4A 2IC6A 3D4UA 3AA7B 2B76A 4DMVA 3ZT6A 2G0UA 2Z3MA 2YEVC 1ZV4X 4FD6A 3Q9DA 4UCMA 1RO5A 2PG8A 3JRUA 4C2YA 4DBRA 3CPXA 2UXXB 2V5DA 1TIQA 1KNZA 4GK0E 2XQ6A 2VWAA 3VR9A 1DTDA 3RRCA 1NMTA 2EK9A 4KOTA 4U5YA 1WLXA 3N2GE 1LCPA 1IBKT 2HN2A 3IWGA 3B57A 3OKQA 5CA0E 3KHXA 2B5GB 4CAWA 1EZ3A 5HH1A 1HTJF 4MCRA 2CXDA 5LG3A 1NWMX 3AE9A 1R57A 3MK7C 2V8VA 4ILCA 4CYPA 4E0AA 3SRZA 4A30A 4LF8T 4JEHB 3H8GA 1ZEEA 3ABVA 4B3TT 1A2ZA 5CB4E 2LSGA 3OPCA 2N9DA 4HEAA 2W67A 1XMOT 4I0UA 2C6PA 3AAAB 4HE8A 1YW6A 1LFWA 5HVHA 2PIZA 1LANA 3S6HA 1IJ5A 5AQJB 3FXDB 3RI5A 1YGHA 4CN6A 5KTAA 1LOKA 3KHZA 1BR4A 2NP9A 2JMHA 4EEDA 2DPTA 3B5MA 2FS5A 2FUPA 3I9YA 3LFMA 3N2KE 3PUVF 3N9OA 3R96A 4EMEA 4A38A 3SHPA 5JH9A 3PUYF 3EXNA 3D67A 5G22A 5JM6A 4FJOA 4HTEA 1XMTA 2CXLA 4O23A 4PQAA 3PZJA 3NWIA 2XUEA 5I0CA 1CM0A 5FXVA 3ETUA 2EO8A 2XZEA 4J3GA 4M6IA 4HKAA 2XEGA 2JQ9A 1M4DA 3R1KA 3C50A 4QH1A 1YLOA 5CNPA 3FBLA 1TKFA 2ODUA 5AQQB 3PBEA 4TV9E 5DJQC 2BBHA 3AXJB 1CG2A 4PJJA 3IBPA 4GOUA 5AQPB 4UEZA 5F3JA 2LRKA 4B10A 1BR1A 2YGWA 2R98A 2Y48B 3QC9A 3BK9A 3FVLA 4B3ST 2LOSA 3KR5A 2I00A 4MCPA 1SUMB 4LQ6A 5F48A 2UXDT 4CAEA 3DR8A 3FJUA 5D29A 4QH5A 5KXJA 2ZOGA 2QYWA 2PJ1A 2AFOA 4YFSA 1VHSA 3FIXA 4PXCA 4AKIA 3FRMA 3ONXA 3E22E 3NRXA 4IUSA 3AE5A 2OLTA 3NRYA 4EYYR 1HDQA 3B3CA 4LFBT 2B4DA 5EBVA 4M6GA 3AE3A 2POKA 2JQQA 2WPXA 5BWAB 5C2TA 4R3KA 2XAGB 4XNHC 2R8VA 4HN9A 1S7KA 4TX5A 3BLNA 4IE5A 2D0UA 1IY7A 3TT2A 5LBQB 1AUGA 3PFEA 4P45A 2H3RA 2YINA 2PTFA 5AQKB 4PSXA 2ARHA 3LK3B 3FX6A 3O1JA 4AVBA 3NE7A 2PJ7A 5FXWA 1BAVA 2D4PA 3AE6A 5LXTE 3AECA 3IHRA 2Z6EA 3G06A 2WDVA 5FNVE 2LE8A 4IL4A 5LMNT 2PDOA 1CHUA 4OC2A 2NW8A 1KNRA 3NKZA 1BLLE 3CXSA 3D7HA 2C5IT 2Z10A 4ZZCA 5HXRA 1FMVA 4MHDA 5L47A 2GANA 3OYZA 3R6NA 1YMEA 3AA6B 7CPAA 3PP9A 5JQGE 3HA4A 4BAYB 5FY0A 2WSAA 4PFOA 4MRIA 1OWAA 1D1CA 2B4DB 4DV1T 2XQYA 2VASA 3EAMA 3P7IA 5H6RB 1HDUA 2Z3NA 3TE4A 3V38A 4UFXA 2CIJA 1Y7RA 3RHWA 3PV0F 4X65T 4TWFA 3SFDA 1YQ4A 5HEJA 2G3AA 2H7VC 4EV6A 2B1EA 4YLHA 1S7FA 4KLVA 4HKFA 5LYDA 3P4QA 1FJGT 1HEEA 1PU9A 4UVBB 2CCQA 3PB4X 3CK6A 2KCWA 4F6RC 3CX7B 2I59A 4IREA 1XOVA 3RLFF 2RC4A 2GE3A 2OH1A 3LACA 3HLPA 4OIWA 1ZLHA 4OYJA 4E8OA 2D2SA 2UUCT 4CRYB 4L5GA 4EWTA 2XY8B 2VB6A 4CS0B 3RX6A 2ZEMA 4AB7A 4QUSA 3SI1A 1LRZA 1KUYA 3P50A 1S3ZA 2HQYA 5FY1A 5JREA 4LF6T 1HNWT 4PK3A 3HKBE 2BVLA 4NGSA 2CHOA 1FY7A 4QH4A 2N2NA 1W9RA 3FF3A 4MCSA 4K0KT 3GWHA 2DNXA 3H3AA 4YJ3E 4JYAT 1VIXA 2XSBA 4IHMA 4DR1T 3CVRA 4DR6T 1BPNA 1B87A 2REEA 3H3MA 4C2ZA 5IX3A 4QVTA 4HNWB 4CI3B 1Z4RA 3PTRB 5LHGB 2DCFA 3ZN0B 4Q25A 1AJ3A 3NH4A 1XWMA 3CPAA 3KVAA 2ZEPA 1X12A 4MI4A 2CNMA 2NYQA 1XEBA 2LSIA 3KINB 4FI5A 4UVCB 1I1DA 1MMDA 2MYSA 2G9DA 4ZY1A 4PXEA 4F8HA 3RO0A 2OZUA 5J1GA 2A72A 2WBLA 2X0YA 5JDQA 2HN1A 3ZJ0A 2IW5B 1VCSA 4BBHA 3I9WA 4CAXA 4AVAA 2J1DG 2G0BA 2YNCA 5FXZA 4PFPA 4CN4A 2ZW6A 2ZW5A 4FWUA 4MY0A 4FD5A 2VEZA 1ZG7A 3AVRA 3QOFA 3ZN1B 3KVBA 3L3PA 3UUBA 1OEDE 1BPMA 4II9A 5JDNA 1MJBA 1F2PA 4MHYA 2VKDA 4ZOLE 2XM1A 5LJMA 4YFJA 3GY9A 4PJLA 2PJ9A 3TC8A 4TWHA 1TKHA 3K1SA 2JIWA 2DPSA 2BO9A 1E2AA 4KMCA 1S5KA 2NOXA 2P6FA 4ZI7E 4H9SE 4NUVA 4JUYA 4CGMA 1GYTA 5CGMA 1HR0T 2XJ7A 3PB9X 4Y49B 2ODVA 3VARA 1BOBA 4LMLA 4KVOE 1OBRA 1W09A 4U31A 3IU2A 3C26A 2PJQA 4KOUA 1K4JA 4A56A 3B13A 1ZG9A 2W62A 4MFLA 1NE9A 5AG6A 4HFHA 4WNKA 4P4FA 2ZLYA 4OYKA 2QYVA
chains in the Genus database with same CATH topology
3PUGA 3O1HA 4C91A 3K3QC 1BO4A 2REFA 1D0XA 4UFVA 4UXNB 3ZLIA 4ASKA 3R9GA 4F6AA 4ISSA 3E08A 5ETWA 1VRBA 4YHJA 4UVAB 2FT0A 3DR6A 4XPDB 2VBQA 3G3SA 5KTCA 5LCYA 3S4UA 1WR6A 5G1ZA 2K9AA 1MNDA 5F46A 2ZW4A 1Z0PA 4KLWA 5JQ4A 3C64A 3NZQA 1WYBA 1MJAA 1XE4A 1YLEA 1G73A 2EHOC 2KT9A 4X1YE 5LBMA 3DNSA 2B58A 4NUUA 1KUVA 4UWIA 4B13A 3KV9A 4WBOA 2QECA 2L8KA 4CZZB 1P0HA 2VKHA 2X7BA 5JPHA 3OJAA 2NWBA 3UULA 4CXWA 2X67A 2BVMA 5CA1E 4KOWA 4I4TE 2EUIA 4XPLA 4EVYA 1FEWA 4JXRA 4ERRA 3S6GA 2WWUA 3FBUA 1U5PA 2Q9QA 2CE7A 5JDMA 1S60A 2PQ8A 4P0AA 3MXZA 2CLYC 2VKOA 4J2CA 5C8YE 3WI3A 5L3DB 5HXHA 2Z0ZA 3QAHA 3O4XE 4F0XA 4QWNB 4XPKA 5IYZE 5LNKA 3CXPA 4DNCA 2HH7A 3JC6D 2K48A 2KNDA 3BQIA 3VKGA 3OWCA 4KUAA 4A95A 3N9PA 3TO7A 1H7CA 2CMRA 5L3GB 4KOYA 3H4QA 4V1Av 4RS2A 1IJ6A 3N7ZA 2B3UA 5FP3A 2B5GA 4AI6A 5AG7A 4B14A 1MIYA 1YK3A 4CAFA 2PFVA 1OXZA 4JXQA 5KMGP 1UX4A 4UF0A 2K5BB 2V7JA 1CUNA 3MA9A 4I55E 3ZCIA 1E1HB 1HG2A 4PK4A 5JDLA 2P0WA 1IYKA 1UFHA 2DI4A 2IC6A 2YK0A 1XIXA 2JEVA 3AA7B 3AA1B 3BJ7A 3MZKB 4NSQA 4AKRB 4QC6A 4DMVA 2RA1A 1M44A 2G0UA 4MFZA 3I9SA 2Z3MA 4UBRA 4GYRA 2YEVC 1FIOA 1ZV4X 5DQVA 4FD6A 3Q9DA 4UCMA 3P8CD 1RO5A 2FIAA 2L3LA 3D8PA 2PG8A 1D1AA 5HYAA 4Q36A 1MIWA 4C2YA 1BR2A 4DBRA 2OA5A 3C4XA 1QSRA 2DHRA 2XAHB 4C7HA 2JPFA 2UXXB 4KP3C 1P4NA 3KBUA 1TIQA 4KVXA 3N5LA 3R84B 1KNZA 4GK0E 4Z8XA 1U6MA 4G2AA 3ZYKA 2PSWA 2VWAA 2CY2A 4C2XA 1LVKA 4NXYA 3RRCA 3PUQA 4MFPA 1WWZA 2VXKA 4PJMA 4UFWA 5IV0A 3SWHA 1NMTA 4O4HE 1YVOA 5F8PA 5LA6E 3N9QA 3J9X1 4KOTA 3CKDA 3HI2A 2K24A 3LODA 5L3FB 1SA0E 1WLXA 1FMWA 3N2GE 4U5YA 4FD4A 5LHIB 2QMLA 2V1DB 1Z9UA 3AAEB 3IWGA 3B57A 3OKQA 5CA0E 4KZTA 3PUAA 3W15B 3ZJ2A 5KDMC 2KINB 5JRCB 2B5GB 4M85A 3I3GA 3RYOA 3TOBA 4CAWA 2ES0A 4CRZB 1EZ3A 2JDDA 2B4BA 1WYCA 3D2MA 5HH1A 2EHOA 1HTJF 4KOSA 2JJ9A 2CXDA 2RP4A 1NWMX 1R57A 3MK7C 4E0AA 4ZI2D 1GHEA 5E0OA 3SRZA 2DWGA 3PURA 2PRBA 4PV6A 4A30A 5L3CB 3CX8B 2Y6XA 4JEHB 5A1LA 2X9HA 3G8WA 4CYOA 4AKLA 1ZEEA 1MK4A 3FYNA 4U9ZA 5CB4E 3ZMVB 5LP6E 2LSGA 2N9DA 4N78D 4CGOA 4HEAA 5LG4A 3R95A 3GMIA 5HXCA 4B5OA 5KTDA 2FXFA 3HKEE 2Y8DA 3AAAB 4HE8A 3F0AA 4C68A 4ORFA 4CYNA 4EOZB 3PDYA 3Q5XA 4AQGA 4E7SA 4MBUA 1NSLA 1IJ5A 4I43B 4NEXA 3S6HA 2FIWA 4Q38A 3FXDB 1YGHA 3AAIA 5KTAA 2V7KA 2CM0A 3GA8A 2IL4A 1BR4A 2NP9A 4QX7B 2JMHA 3EO4A 2XTLA 2DPTA 4HFVA 2ZW7A 2FS5A 3I9YA 4O2BE 2OB0A 2DLRA 1IICA 4A31A 3LFMA 3N2KE 3N9OA 3R96A 2L9QA 4CI1B 3DSBA 3SHPA 3EXNA 3LK2B 4WW0A 3UFEA 2LSKA 5G22A 2YNEA 4ZS2A 3Q2MA 1Z4EA 5LJNA 3AA0B 2JLMA 4FJOA 3LG7A 4HTEA 1XMTA 2CXLA 1ZO0A 4KSAA 4M1PA 3FXEB 5H6QB 4O4IE 1LVFA 4CXYA 2XUEA 1S7NA 3PZJA 3U78A 2C0SA 2D0TA 5I0CA 1CM0A 3PU8A 4AVCA 5FXVA 2ACXA 3ETUA 3K8PC 4ZI2C 1M1DA 3TCVA 5M4YA 3UY5A 3O1IA 4J3GA 3NBXX 4HKAA 4KUBA 1QSMA 3R1KA 3K3OA 1M4DA 1OZPA 1VKCA 1B7TA 3C50A 4ONUA 4YRHA 4R3LA 1VOMA 2WMOA 3ZYLA 5DWNA 3H37A 4H89A 5CNPA 3FBLA 4XNHB 2ODUA 4BA9A 4O4JE 2BL1A 4TV9E 5DJQC 4ISTA 4PJJA 5JVDE 4CQIA 1HX8A 3IBPA 2LEHA 4GOUA 2KWHA 5F3JA 1T98A 4B12A 5AG4A 3I1AA 2C27A 2YNDA 4B10A 3FNCA 1BR1A 4L0RA 2YGWA 4U9YA 4L9IA 4X1KE 2Y48B 3DTOA 3I0QA 3QC9A 2R98A 1Q2DA 2ZPAA 2LM9A 3BK9A 3ZZIA 3FB2A 1QSDA 2GIVA 4X5KA 2W63A 2C5KT 2LOSA 2W00A 4U72A 4UEMA 3OBVE 5JR9A 2I00A 3ZMSB 5F49A 4JLYA 2V26A 3VU7H 5F48A 4QHOA 3VWEA 4PW8A 2OZHA 4CAEA 2PR8A 2XAQB 4EB6E 4U74A 5EBVA 3DR8A 1U4QA 2KXPB 2V7IA 4E7ZA 3F2EA 3Q5WA 4AKHA 2VZYA 3J7Yq 3EUHA 5AGEA 4OHFA 1S35A 4TV8E 1QSOA 3T8OA 2O28A 2B3VA 1MMNA 2ZM8A 4YFSA 5HXSA 5LGUB 2WAUA 1VHSA 3FIXA 3KV5A 4AKIA 2CEAA 3ONXA 2VI7A 1IZNB 2PBIA 3CMLA 1V9DA 1YD8G 3E22E 5ADXL 3NRXA 2NMTA 4IUSA 3LBXB 3NRYA 4EYYR 2BEIA 4H9OC 1IB1E 2WMNA 2B4DA 3ZC0A 5BMVE 2WSSV 4IE6A 5TAOA 3O9XA 3QK6A 4H63V 4IE0A 2H5MA 2JQQA 3VHLA 1IIDA 4TUYE 3RYFE 4YGOA 4UCNA 1UX5A 1LKXA 2AJ6A 2LJLA 1N71A 2WPXA 5BWAB 4LUAA 3CQXC 3E0ZA 2LT3A 1ZKEA 2NTXA 2XAGB 4R3KA 4XNHC 3V5SA 3CX6B 3EDVA 1Q2CA 2R8VA 4HN9A 4HNYB 3KFWX 1BR0A 1S7KA 4TX5A 4PNIA 3HKCE 3BLNA 4TN7B 4IE5A 3MJXA 3WAJA 3F8KA 2D0UA 3WR7A 5C82A 2X66A 3RPUA 3TT2A 5LBQB 5FXXA 2NW7A 1IYLA 1O3XA 4ZGYB 3UUXB 3P2FA 2H3RA 2YINA 1PUAA 5HMNA 2GK9A 3HR0A 4PSXA 3GYAA 3I0OA 5EK4A 3LK3B 4P0BA 1MMGA 2ARHA 2Q0YA 3O1JA 2Z3OA 1YKEB 3NE7A 5JRCA 4AVBA 4KOXA 5LGTB 2V7MA 5JDGA 5FXWA 1Y9WA 5DWMA 4AQFC 2J8RA 2D4PA 5EK3A 5LXTE 1Y64B 2Z6EA 3IHRA 4JJXA 5J8FA 3D0TA 2Q7BA 2A3DA 3A5XA 4IIJE 5FNVE 1KZFA 4QB9A 4Y49C 2X68A 1SQHA 2ZM0A 5HXEA 3SS1A 3N9MA 5A28A 2LE8A 2Q44A 4JD6A 2IAKA 2X51A 4UCPA 3NZPA 4OLLA 2EHOB 4GS4A 2CNSA 2CWYA 2PDOA 3B8GA 3EY5A 2J8NA 1SHZC 3V5UA 2QGSA 3ZEFB 5EC4A 1MNEA 2NW8A 4K30A 3S6KA 3F5BA 3CXSA 4QBJA 2C5IT 5JDFA 2Q4VA 2Z10A 4F0YA 5HXRA 1FMVA 3DJBA 4K0UA 4ANJA 2KZ7B 2CXAA 4EYUA 2I79A 4KOVA 4UF0B 2GANA 3OYZA 3R6NA 3RC3A 4H6UA 4H63H 4MHDA 3AA6B 3PP9A 5JQGE 3HA4A 5J2UE 4RI1A 4BAYB 2H7OA 5FY0A 5FYMA 4IDZA 4PFOA 4EZ4A 2WSAA 3RYIE 4MY3A 4KVME 1OWAA 3KDSE 3BQLA 3DP7A 3EDUA 2DXQA 1D1CA 3ZMUB 2B4DB 1I12A 2XQYA 1US7B 2VASA 2M67A 3P7IA 3M65A 5H6RB 4AXPA 2Z3NA 2Z3PA 3EFAA 3GKRA 4YJ2E 1Y7RA 5LYJE 2FCKA 4UFXA 3IWEA 4PSWA 2MBGA 4H9NC 2G3AA 3ZMZB 2H7VC 1S7LA 4MJ8A 3W6XA 4AG7A 2VL8A 4IE4A 2B1EA 4YLHA 3N9LA 1S7FA 4KLVA 2KMFA 2VQYA 4HKFA 3TTHA 2LHRA 3OYXA 2X0LB 1UCUA 4UA3A 5E96A 4B6XA 2VZZA 1PU9A 4UVBB 1ZHCA 3FBZA 3GN5B 3W6SA 2CCQA 1M4IA 4ZBGA 2XHEB 3UTKA 2Z3LA 3ANWA 4I49A 4A2ZA 4DO0A 3PU3A 4EZHA 2KCWA 4F6RC 2WUUA 5J8CA 3RYCE 3CX7B 4MHCA 3TO6A 2I59A 4MLKA 2Q9QC 4X1IE 4DMWA 3RH3A 4KSFA 1HS7A 3FB3A 2R7HA 2RC4A 3EVYA 2GE3A 2OH1A 3RRWA 5KX5E 4E2AA 4B5PA 3JTKA 3ZC1A 5LOVE 1HF8A 4IHJE 2YNCC 4QXHB 4OADA 2UXNB 4B5PB 1QUUA 1HCIA 2XAFB 5FY7A 4OYJA 5HAXA 2D5UA 2HPJA 4ADZA 4CI2B 4DBQA 4EXTA 3P2HA 2N1GA 4E8OA 2D2SA 4ZS3A 4CRYB 2LHNA 4L5GA 3IU1A 5EK2A 5JR9B 5HWYA 2VB6A 4JWPA 4CS0B 3RX6A 3RC8A 1RXTA 5J2TE 3AB3B 4QX8B 1MIVA 4AQFA 5G21A 1M4GA 1MMAA 5L2LA 5IHYA 1MJ9A 4AB7A 1D1BA 2G3TA 2E9XB 3A9LA 4A33A 4H9QC 3ZYMA 4QUSA 2X9YA 2A4NA 1LRZA 1KUYA 2NW9A 1YKHB 5JH7E 1S3ZA 2CXFA 5FY1A 5LGNB 5LHHB 3ANWB 5JREA 2HQYA 3CXQA 4JEUB 4MFRA 2MTQA 3DDDA 4PK3A 3HKBE 3U3IA 2BVLA 4BJMA 4CYQA 1FY7A 2PR1A 2ATRA 4DVDA 3KBTA 2MOZA 2N2NA 4OK0A 4KORA 4UV8B 2FSRA 4M3SA 2CLYB 4UELA 4MFKA 1WK4A 2NTYA 4H9PC 2ZM2A 3VWDA 3BJ8A 5A27A 1Y9KA 3GWHA 3UUNA 2DNXA 3H3AA 4YJ3E 3JUWA 3ZJ1A 1V0CA 3SOLA 4R9MA 3ZMTB 3CVRA 1D0YA 4ZI3C 4ZI3D 1B87A 4BJNA 1YR0A 2REEA 3SXOA 3MACA 4C7IA 1HG5A 4QXCB 4O2AE 2Y0MA 3HL6A 4C2ZA 3QUJA 4H6ZA 5IX3A 1D0ZA 2LSJA 4QVTA 4HNWB 3CPZA 4CI3B 4B11A 3HKDE 1Z4RA 4OAEA 3PTRB 2KLQA 2YU1A 4BMHA 5LHGB 2DCFA 3ZN0B 2HV2A 1WRDA 2VK9A 2W0GA 4NCZA 2KWIB 5F47A 5ISVA 4WBNE 3LK42 4P09A 4PAGA 3CQGB 4MALA 4ILUA 1Q2YA 2VKJA 2EHOD 2WPWA 1AJ3A 4HGAA 4FD7A 4CGLA 4PJNA 2X9XA 3KVAA 1QSTA 3N9NA 4HNXB 2CA5A 2Q9QD 2OZGA 3TE4A 4UV9B 4MI4A 4EAHA 1HFAA 1YW0A 2LSYA 2LOPA 3ZCJA 2C5JA 3C51A 3TKLB 2CNMA 2BZBA 3R9EA 1XEBA 2LSIA 3KINB 4FI5A 4UVCB 2D4OA 2OU2A 3KV6A 1I1DA 4R57A 4MBQA 3SXNA 4LX9A 2W61A 4NF1A 1MMDA 4H9RC 2ZMAA 2MYSA 4A32A 4JLEA 4EIWA 4MFQA 3C4ZA 2Q04A 3UT5E 3KV4A 2OZUA 5J1GA 5DABA 4IGUA 1X79A 2A72A 3LJCA 2WBLA 5FVJA 3BQKA 2AE6A 3V8IA 1NAFA 4R87A 3RKOA 1YVKA 3C4WA 2BDEA 5JDQA 3D3SA 3R9FA 2FE7A 3ZJ0A 2IW5B 3N2OA 3QB8A 4BBHA 3I9WA 1KK7A 4CAXA 3JC6C 2BUEA 4AVAA 2P6EA 3FXTA 2J1DG 3EC4A 2JRKA 2G0BA 2YNCA 3KKWA 5FXZA 3ZPOA 4PFPA 1XF8A 4GYSA 2X9WA 2ZW6A 3JVNA 3LD2A 2ZW5A 5AG5A 2E9XD 3LBXA 2P6GA 1I21A 3MKDA 2HUZA 4MY0A 1IAPA 3W91A 4O4LE 4TZ4C 3RYHE 4FD5A 4CGNA 1CJWA 2VEZA 3T9YA 2F5IA 2K5TA 1G8XA 3L09A 1L0CA 3AVRA 3ZN1B 4UWJA 3KVBA 3CWZB 3FHNA 2XASB 3L3PA 4KUMB 4XPDC 2IC9A 2A2FX 5GCNA 1YX0A 4II9A 5JDNA 1MJBA 5IB0A 2WM9A 3H5ZA 2VKDA 4GK5E 4KBMB 4ZOLE 4ZHQE 2R1IA 3PUSA 2YU2A 2QIRA 2DWKA 5LJMA 2E8IA 2BSWA 4YFJA 3C98B 3GY9A 3ETVA 4PJLA 4CYPA 4IE7A 2E9XA 3ESLA 3IF8B 4L8AA 3UUMA 3TO9A 2DPSA 3S6FA 5L3BB 2XAJB 4AKGA 4PK5A 2CNTA 2PC1A 1J4JA 3GN5A 2JDCA 3VKHA 3IGRA 4XAXB 4CXXA 4KMCA 4XBFB 5DQWA 1S5KA 2FL4A 2NOXA 5JDHA 2P6FA 4CGPA 4ZI7E 3FRMA 4H9SE 4MFJA 4CAVA 4GIWA 4JUYA 2V7LA 4NUVA 4PK6A 5EZYE 1B6BA 4CGMA 5C88A 2P9BA 3K9UA 5JR9C 1ON0A 1QSNA 4Y49B 2ODVA 3T90A 3D2PA 3IEEA 5AFUL 4UIGA 4IF5A 3CQCB 1BOBA 4G63A 4PK2A 3MGDA 4KVOE 2CWOA 3IU2A 2QA7A 4QXBB 3C26A 4KS9A 4DNDA 5H84A 4L89A 5FMNA 2ZXVA 2E9XC 2SPCA 3AVSA 5L3EB 4XZCA 5HWXA 2Z11A 1KUXA 3E0KA 3PE0A 4O8SA 2PJQA 4KOUA 3TOAA 1K4JA 2HPLA 4I50E 3F31A 4A56A 2EVNA 2J8MA 3B13A 2Q9QB 4QKNA 5GONE 4AG9A 3WAKA 3TFYA 2W62A 3PGPA 4MFLA 1NE9A 5AG6A 2JMKA 3F57A 4OFZA 4X20E 1YREA 3K3NA 4WNKA 5H86A 2Q4YA 1S94A 5G20A 4C90A 2ZLYA 4OYKA 2Z3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BO4 A;  2REF A;  3R9G A;  4F6A A;  3DR6 A;  4XPD B;  2FT0 A;  2VBQ A;  3G3S A;  5KTC A;  3S4U A;  5F46 A;  2ZW4 A;  1Z0P A;  4KLW A;  5JQ4 A;  1YLE A;  1MJA A;  1XE4 A;  3DNS A;  2B58 A;  1KUV A;  4UWI A;  2QEC A;  1P0H A;  2X7B A;  5JPH A;  4KOW A;  2EUI A;  4XPL A;  4EVY A;  4JXR A;  3S6G A;  3FBU A;  2PQ8 A;  1S60 A;  3MXZ A;  4J2C A;  2Z0Z A;  3QAH A;  4XPK A;  3CXP A;  4DNC A;  2K48 A;  3OWC A;  4KUA A;  3TO7 A;  1H7C A;  4KOY A;  3H4Q A;  4RS2 A;  1IJ6 A;  3N7Z A;  2B3U A;  2B5G A;  1YK3 A;  4JXQ A;  2P0W A;  3F8K A;  1IYK A;  1UFH A;  1XIX A;  2IC6 A;  2JEV A;  4NSQ A;  3BJ7 A;  4BMH A;  4QC6 A;  1M44 A;  2G0U A;  4UBR A;  3I9S A;  4FD6 A;  1RO5 A;  2FIA A;  3D8P A;  1QSR A;  1P4N A;  1TIQ A;  4KVX A;  3N5L A;  1U6M A;  2PSW A;  2CY2 A;  4NXY A;  1WWZ A;  2VXK A;  5IV0 A;  1NMT A;  1YVO A;  4KOT A;  3CKD A;  3LOD A;  4U5Y A;  4FD4 A;  2QML A;  1Z9U A;  3IWG A;  4OAD A;  4KZT A;  2B5G B;  4M85 A;  3RYO A;  4CAW A;  3I3G A;  3TOB A;  4CRZ B;  2JDD A;  2B4B A;  5HH1 A;  3D2M A;  4KOS A;  1R57 A;  4E0A A;  2PRB A;  1GHE A;  4PV6 A;  3G8W A;  3FYN A;  1MK4 A;  4U9Z A;  3R95 A;  4B5O A;  5KTD A;  2FXF A;  3F0A A;  4ORF A;  1NSL A;  3S6H A;  1IJ5 A;  4NEX A;  2FIW A;  3FXD B;  1YGH A;  5KTA A;  2IL4 A;  3EO4 A;  2XTL A;  2ZW7 A;  2FS5 A;  2OB0 A;  1IIC A;  3R96 A;  3DSB A;  3SHP A;  3EXN A;  1Z4E A;  2JLM A;  1XMT A;  3FXE B;  3PZJ A;  1LVF A;  1S7N A;  5I0C A;  1CM0 A;  4AVC A;  1M1D A;  3TCV A;  3UY5 A;  4J3G A;  4KUB A;  1QSM A;  3R1K A;  1M4D A;  1OZP A;  1VKC A;  4YRH A;  4ONU A;  5DWN A;  4R3L A;  4H89 A;  5CNP A;  4XNH B;  2BL1 A;  4CQI A;  2KWH A;  2C27 A;  3FNC A;  4L0R A;  4U9Y A;  2R98 A;  1Q2D A;  2ZPA A;  3ZZI A;  1QSD A;  2GIV A;  4X5K A;  2C5K T;  5F49 A;  2I00 A;  3VWE A;  4JLY A;  5F48 A;  2OZH A;  2PR8 A;  3DR8 A;  2VZY A;  1QSO A;  2O28 A;  2B3V A;  1VHS A;  3FIX A;  3FRM A;  2VI7 A;  2NMT A;  4IUS A;  4EYY R;  2BEI A;  1IB1 E;  2B4D A;  4B5P B;  5EBV A;  3QK6 A;  2H5M A;  4YGO A;  1IID A;  2AJ6 A;  1N71 A;  2WPX A;  4LUA A;  1ZKE A;  4R3K A;  4XNH C;  1Q2C A;  2R8V A;  4HNY B;  1S7K A;  3BLN A;  5C82 A;  3WR7 A;  3TT2 A;  1IYL A;  3P2F A;  1PUA A;  5HMN A;  4PSX A;  3GYA A;  2ARH A;  2Q0Y A;  4AVB A;  3NE7 A;  4KOX A;  5DWM A;  1Y9W A;  2J8R A;  2D4P A;  4JJX A;  5J8F A;  2Q7B A;  1KZF A;  4Y49 C;  4QB9 A;  1SQH A;  2Q44 A;  4JD6 A;  4OLL A;  4GS4 A;  2CNS A;  2PDO A;  3B8G A;  3EY5 A;  2J8N A;  5EC4 A;  4K30 A;  3S6K A;  3F5B A;  3CXS A;  4QBJ A;  2C5I T;  2Q4V A;  2Z10 A;  4F0Y A;  5FVJ A;  2I79 A;  4KOV A;  4MHD A;  2GAN A;  4H6U A;  3PP9 A;  4RI1 A;  4MY3 A;  4KVM E;  2DXQ A;  2B4D B;  1I12 A;  3P7I A;  3EFA A;  4MBU A;  3TE4 A;  3GKR A;  1Y7R A;  2FCK A;  4PSW A;  2MBG A;  2G3A A;  1S7L A;  3W6X A;  4MJ8 A;  4AG7 A;  1S7F A;  4KLV A;  2VQY A;  4HKF A;  3TTH A;  5E96 A;  4UA3 A;  4B6X A;  2VZZ A;  1PU9 A;  3W6S A;  1M4I A;  4ZBG A;  4I49 A;  5J8C A;  2KCW A;  3TO6 A;  3FB3 A;  2R7H A;  2RC4 A;  2GE3 A;  2OH1 A;  4E2A A;  4B5P A;  2Z11 A;  3P2H A;  4E8O A;  4CRY B;  4JWP A;  4CS0 B;  1RXT A;  1M4G A;  1MJ9 A;  4AB7 A;  2G3T A;  4QUS A;  2X9Y A;  2A4N A;  1LRZ A;  1KUY A;  1S3Z A;  2HQY A;  3CXQ A;  3DDD A;  4PK3 A;  1FY7 A;  2PR1 A;  2ATR A;  4KOR A;  2FSR A;  4M3S A;  1WK4 A;  3VWD A;  3BJ8 A;  1Y9K A;  3JUW A;  1V0C A;  4R9M A;  3CVR A;  1B87 A;  1YR0 A;  2REE A;  3SXO A;  2Y0M A;  3QUJ A;  4H6Z A;  5IX3 A;  4QVT A;  4HNW B;  1Z4R A;  4OAE A;  5F47 A;  2HV2 A;  4NCZ A;  2KWI B;  5ISV A;  1Q2Y A;  2WPW A;  4FD7 A;  2X9X A;  1QST A;  4HNX B;  2CA5 A;  2OZG A;  4MI4 A;  2C5J A;  3TKL B;  2CNM A;  3R9E A;  1XEB A;  4FI5 A;  2D4O A;  2OU2 A;  4R57 A;  1I1D A;  3SXN A;  4LX9 A;  4NF1 A;  2Q04 A;  2OZU A;  2AE6 A;  3V8I A;  4R87 A;  1YVK A;  3D3S A;  3R9F A;  2FE7 A;  3ZJ0 A;  3QB8 A;  4CAX A;  2BUE A;  4AVA A;  2P6E A;  3FXT A;  3EC4 A;  2G0B A;  3KKW A;  1XF8 A;  2X9W A;  2ZW6 A;  3JVN A;  3LD2 A;  2ZW5 A;  2P6G A;  1I21 A;  2HUZ A;  4MY0 A;  3W91 A;  4FD5 A;  1CJW A;  2VEZ A;  3T9Y A;  2F5I A;  2K5T A;  1L0C A;  4UWJ A;  3L3P A;  4XPD C;  2IC9 A;  5GCN A;  4II9 A;  1YX0 A;  1MJB A;  5IB0 A;  2R1I A;  2QIR A;  2BSW A;  4YFJ A;  3GY9 A;  4L8A A;  3TO9 A;  3S6F A;  2CNT A;  2PC1 A;  1J4J A;  2JDC A;  3IGR A;  1S5K A;  2FL4 A;  2P6F A;  4CAV A;  1B6B A;  5C88 A;  3K9U A;  1ON0 A;  1QSN A;  4Y49 B;  3T90 A;  3D2P A;  4IF5 A;  1BOB A;  4PK2 A;  3MGD A;  4KVO E;  3C26 A;  5H84 A;  4DND A;  4L89 A;  2ZXV A;  1KUX A;  3E0K A;  4KOU A;  3TOA A;  1K4J A;  2EVN A;  2J8M A;  3TFY A;  4AG9 A;  3PGP A;  1NE9 A;  1YRE A;  5H86 A;  2Q4Y A; 
#chains in the Genus database with same CATH topology
 2V6Y B;  4C91 A;  4P4I A;  3R9G A;  4F6A A;  4ISS A;  4UVA B;  3CZX A;  3S4U A;  2ZW4 A;  4KLW A;  3IA3 A;  1WYB A;  1YLE A;  3DNS A;  1G73 A;  4X1Y E;  2J4G A;  3UUL A;  4BD9 A;  2NSM A;  4JXR A;  3GUX A;  3S6G A;  1OED B;  1U5P A;  3GIU A;  5JDM A;  4LFC T;  4J2C A;  3QAH A;  3A7M A;  4OX9 T;  4XPK A;  2VVS A;  2NR4 A;  2K48 A;  4HFI A;  1H7C A;  5L3G B;  4KOY A;  3H4Q A;  5AG7 A;  4B14 A;  1MIY A;  2PFV A;  1OXZ A;  4UF0 A;  5FKY A;  2PJA A;  3ZCI A;  2P0W A;  1HG2 A;  1UFH A;  5ABE A;  2JEV A;  3BJ7 A;  2Q4Z A;  4AKR B;  2RA1 A;  1M44 A;  3I9S A;  1I94 T;  3AE7 A;  2PJ3 A;  5HCM A;  2GFQ A;  3D8P A;  2L3L A;  5HYA A;  3KL9 A;  2OA5 A;  2DHR A;  2XAH B;  2JPF A;  5CJ5 A;  3R84 B;  2PSW A;  4NXY A;  3SJX A;  5F5W A;  2V8D A;  3SWH A;  1YVO A;  3ONJ A;  3N9Q A;  4YTM A;  3J9X 1;  2K24 A;  3UFG A;  5L4H A;  1FMW A;  4HWH A;  2V8H A;  4FD4 A;  5LHI B;  4DJL A;  2V1D B;  3UQ7 A;  1F57 A;  2KIN B;  3TOB A;  2PJ5 A;  3RQU A;  2JDD A;  1WYC A;  1GHE A;  5E0O A;  2DWG A;  3L2N A;  5L3C B;  3CX8 B;  2Y6X A;  4CYO A;  3ZMV B;  5LP6 E;  4P4E A;  4N78 D;  3T1H T;  5HXC A;  3FEE A;  3F0A A;  4CYN A;  4P4B A;  4AQY T;  4EEB A;  4EOZ B;  2FIW A;  3B3T A;  4P10 A;  2BG9 B;  4MXU A;  3AE4 A;  4QX7 B;  2ZW7 A;  5AQT B;  4YSY A;  4FAI A;  4O2B E;  4U2Y A;  4A31 A;  1OED A;  2L9Q A;  4CI1 B;  2H88 A;  2I0M A;  2LSK A;  4ZS2 A;  5AQH B;  4IL9 A;  1Z4E A;  4NIQ A;  3LG7 A;  1ZO0 A;  3BI0 A;  4KSA A;  3FXE B;  5HEU A;  1YQ3 A;  3PU8 A;  4DR4 T;  4AVC A;  3K8P C;  3ZT5 A;  1M1D A;  4NXN T;  2VQF T;  1N32 T;  2I6H A;  5M4Y A;  2AFM A;  1CBX A;  3UY5 A;  4YHH T;  4YXD A;  3NBX X;  1VKC A;  2LRL A;  4X8I A;  4R3L A;  1VOM A;  2WMO A;  2FJE A;  4XNH B;  4CN1 A;  3LSV A;  2F4V T;  3PUZ F;  4CQI A;  5JVD E;  1HX8 A;  1WR0 A;  2FBW A;  2LEH A;  4LMJ A;  2KWH A;  5AG4 A;  4K3N A;  2C27 A;  3PJA J;  4L0R A;  4IDO A;  4L9I A;  4X1K E;  3I0Q A;  2ZM6 T;  5C3J A;  4U33 A;  2LM9 A;  3A8Y C;  2W63 A;  4UEM A;  3OBV E;  4B11 A;  4A5X A;  3B2Y A;  3VWE A;  1NSA A;  2V26 A;  4JLY A;  2WCA A;  2OZH A;  4EB6 E;  4KHZ F;  2PJ8 A;  1U4Q A;  2KXP B;  2V7I A;  4OHF A;  1S35 A;  2WDR A;  4HWF A;  2ZM8 A;  5HXS A;  1YXR A;  4H2K A;  2CEA A;  1IZN B;  1AYE A;  3CML A;  1YD8 G;  3LBX B;  1Q7L A;  3ZC0 A;  3S9L A;  4B5P B;  4IE0 A;  4PPZ A;  3VHL A;  1N71 A;  1NEN A;  1ZP0 A;  5IUX A;  3CQX C;  3AE1 A;  4NGQ A;  4WYV A;  3CX6 B;  2IMO A;  2AFW A;  4R6T A;  1BR0 A;  3IEH A;  4NJQ A;  4PNI A;  4TN7 B;  3WAJ A;  3MJX A;  3TLV A;  5C82 A;  3WR7 A;  4X5T A;  3LWU A;  4WWV A;  1O3X A;  3TLW A;  4CPA A;  1PUA A;  3HR0 A;  1CP6 A;  4IK2 A;  3I0O A;  5EK4 A;  4P6Y A;  2PIY A;  2Z3O A;  1YKE B;  5JRC A;  4KOX A;  1Y9W A;  1ZLI A;  4AQF C;  1VCT A;  1HNZ T;  4JJX A;  4IIJ E;  4QB9 A;  1AMP A;  2VVN A;  4HFE A;  1KNP A;  3N9M A;  4KI0 F;  4JD6 A;  3NZP A;  2AFS A;  3H8F A;  2CNS A;  2CWY A;  3EY5 A;  4NGT A;  1MNE A;  5ELY A;  3QNU A;  4K30 A;  4QBJ A;  4KHP T;  3B3V A;  2WP9 A;  4EYU A;  4KOV A;  4RI1 A;  2BS3 A;  5FYM A;  1N36 T;  1KFY A;  3CIR A;  4ZX8 A;  1US7 B;  4P4J A;  3UU4 A;  4PSW A;  4H9N C;  4DV6 T;  4A97 A;  3IJ3 A;  1S7L A;  4AG7 A;  2VL8 A;  4IE4 A;  1Y7E A;  3TTH A;  3S9N A;  2LHR A;  3OYX A;  1UCU A;  4B6X A;  2VZZ A;  2IDO B;  5K8M A;  1M4I A;  4ZBG A;  2XHE B;  3UTK A;  3ANW A;  2PJ6 A;  4OME A;  4A2Z A;  5LRK A;  4DO0 A;  4U7I A;  3RYC E;  4MLK A;  5FL0 A;  2LLY A;  4X1I E;  4DMW A;  2IHR 1;  1Z8L A;  2VQE T;  4JZ0 A;  3EVY A;  4E2A A;  3ZC1 A;  4IHJ E;  3ZKR A;  2E5L T;  4X64 T;  3KQZ A;  5HAX A;  2Z11 A;  2O4H A;  4ZS3 A;  3IU1 A;  2QRX A;  1QQ9 A;  1RXT A;  1MMA A;  4X2T A;  2WY2 A;  4U2Z A;  1MJ9 A;  1D1B A;  2G3T A;  2E9X B;  4DYO A;  5I4M A;  3SI2 A;  4H9Q C;  2X0H A;  4Z91 A;  3ZYM A;  3FZK B;  2UUA T;  2A4N A;  4OC1 A;  2GLJ A;  4DV4 T;  5LGN B;  5LHH B;  4JEU B;  2K3W A;  4BJM A;  2PR1 A;  4OK0 A;  4M3S A;  1WK4 A;  2ZM2 A;  3D66 A;  3JUW A;  3RGL A;  1Z5R A;  3ZJ1 A;  4MHP A;  1V0C A;  2YDQ A;  2JQH A;  3H8E A;  1YR0 A;  4YTP A;  4QXC B;  2Y0M A;  1IOI A;  3DLJ A;  4NFR A;  3SJG A;  1RTQ A;  3Q5D A;  2GLF A;  2YU1 A;  3KAS A;  1XJO A;  2HV2 A;  2W0G A;  1Y01 A;  4NCZ A;  1M7K A;  2FVG A;  4WBN E;  3LK4 2;  4PAG A;  4MAL A;  5AQM B;  2EHO D;  2WPW A;  4HGA A;  3L39 A;  4PJN A;  3JAF A;  3N9N A;  1UWY A;  4EAH A;  3TKL B;  3R9E A;  4R57 A;  4UEE A;  2XEJ A;  3AXJ A;  4DUY T;  4EIW A;  4U7Y A;  4MFQ A;  4ZYQ A;  2Q04 A;  3KQX A;  1Z8T A;  4LMK A;  5DAB A;  1X79 A;  2HB6 A;  3RIU A;  4R87 A;  4DID B;  2BDE A;  4YT0 A;  4OID A;  1M62 A;  3R9F A;  5AQG B;  1DE4 C;  5ABF A;  5CPA A;  2BUE A;  2Q51 A;  1JNR A;  2P6E A;  2QVA A;  2JRK A;  2X9W A;  5AG5 A;  2E9X D;  3LBX A;  2XEF A;  2P6G A;  2ZEL A;  3MKD A;  3W91 A;  1CJW A;  3T9Y A;  2F5I A;  2R6G F;  3L09 A;  1L0C A;  4UWJ A;  3CWZ B;  4KUM B;  2H89 A;  4A39 A;  2AE9 A;  5IB0 A;  4GXH A;  2E8I A;  1W0B A;  2WYR A;  4IE7 A;  3IF8 B;  3UUM A;  2ANP A;  3T8W A;  3S6F A;  2XQ5 A;  4PK5 A;  2JDC A;  3VKH A;  3ISX A;  4CXX A;  4RUH A;  2FL4 A;  5JDH A;  4MFJ A;  4CAV A;  3BXM A;  2V7L A;  2WB5 A;  4DR3 T;  1ON0 A;  1CP7 A;  3NH8 A;  4OC5 A;  3IEE A;  5AQI B;  4UIG A;  5AFU L;  3CQC B;  3ONL C;  3PBB A;  4JYW A;  4QXB B;  4L89 A;  2SPC A;  5HWX A;  3E0K A;  1UUS A;  3PE0 A;  4DR5 T;  5AQR B;  3TOA A;  2HPL A;  2EVN A;  5GON E;  2BOA A;  2JMK A;  3F57 A;  4X20 E;  3PB6 X;  5CBM A;  4C90 A;  2Z3K A;  3KI9 A;  1D0X A;  3PB8 X;  2Q7S A;  4UFV A;  3KGQ A;  3ZLI A;  1VRB A;  3DR6 A;  4XPD B;  2PCU A;  3KR4 A;  5LCY A;  2PVW A;  2WZI A;  1MND A;  3AE8 A;  1F2O A;  3C64 A;  4ZY2 A;  3NZQ A;  1KUV A;  4NXM T;  1P0H A;  4ZXL A;  4HFC A;  2X7B A;  1ELL P;  2X67 A;  4XPL A;  4P1N A;  2Q9Q A;  2PQ8 A;  1S60 A;  1VHO A;  5AQN B;  3PEI A;  2VKO A;  3P4P A;  5L3D B;  2Z0Z A;  1FT7 A;  4UIB A;  3CT9 A;  4QWN B;  5AQS B;  2RB7 A;  4DNC A;  2KND A;  3OWC A;  4KUA A;  3N9P A;  1X10 A;  4X3R A;  1CX8 A;  2WS3 A;  3TX8 A;  4V1A v;  5DS0 A;  2C6G A;  2CRB A;  4CAF A;  2FJA A;  1YW4 A;  2V7J A;  1CUN A;  3MA9 A;  4I55 E;  3F8K A;  5JDL A;  1IYK A;  3B3S A;  3AA1 B;  3MZK B;  2UXB T;  1UK5 A;  4QC6 A;  3PJA A;  4UBR A;  3UU6 A;  4GYR A;  3QNV A;  4NGM A;  5DQV A;  2J47 A;  2FIA A;  3K9T A;  4JI5 T;  3NFZ A;  1BR2 A;  4YY3 T;  4C7H A;  4JV5 T;  3C4X A;  1QSR A;  1P4N A;  3KBU A;  4KVX A;  3N5L A;  4Z8X A;  2AXD S;  2HHH T;  4G2A A;  5FL1 A;  5D8N A;  1LVK A;  3PUQ A;  4F9V A;  4PJM A;  1Y0Y A;  5IV0 A;  4O4H E;  3D68 A;  5F8P A;  5LA6 E;  3LOD A;  4UIA A;  4KZT A;  3ZJ2 A;  5KDM C;  3I3G A;  4LFA T;  4CRZ B;  2ES0 A;  2JBK A;  2B4B A;  3D2M A;  2EHO A;  2JQK A;  4KOS A;  4ZI2 D;  3PUR A;  4JI4 T;  2QJ8 A;  1SE7 A;  2RFH A;  1MK4 A;  4U9Z A;  2O53 A;  3EI0 A;  4CGO A;  5LG4 A;  3JAD A;  3R95 A;  3GMI A;  4B5O A;  5KTD A;  2FXF A;  3HKE E;  2DL1 A;  3FED A;  4ORF A;  3Q5X A;  4E7S A;  1NSL A;  4I43 B;  4NPP A;  4AXV A;  4HFB A;  3AAI A;  4ZI6 A;  4DV7 T;  2V7K A;  2CM0 A;  2WU5 A;  2IL4 A;  3EO4 A;  2XTL A;  4HFV A;  5FVL A;  2Q43 A;  3B7I A;  2OB0 A;  5AQL B;  1IIC A;  1N34 T;  3FZL B;  3DSB A;  2LM2 A;  4U3C A;  3LK2 B;  3UFE A;  2BKP A;  2YNE A;  3Q2M A;  2E2A A;  3AA0 B;  5LJN A;  1IOF A;  4DV2 T;  4CXY A;  3U78 A;  2C0S A;  3O1I A;  1DU2 A;  4KUB A;  1QSM A;  1OZP A;  4YRH A;  5DWN A;  2BG9 E;  4B3R T;  3H37 A;  4IDN A;  1YSJ A;  2XQ4 A;  1Z2L A;  3D7F A;  4IST A;  5L4E A;  1XDP A;  2XM2 A;  3FNC A;  3SFE A;  2F7V A;  4U9Y A;  4B6Z A;  4DV5 T;  3D7G A;  1Q2D A;  3ZZI A;  1QSD A;  1LAP A;  1IU8 A;  1HNX T;  3ZMS B;  2ZEG A;  3VU7 H;  4QHO A;  4PW8 A;  2PR8 A;  1JWQ A;  2XAQ B;  2EK8 A;  1J1J A;  5AQF B;  4E7Z A;  3Q5W A;  1T72 A;  1XMQ T;  3EUH A;  1QSO A;  3T8O A;  2O28 A;  1JQG A;  2BCO A;  3LMS A;  3KV5 A;  2VI7 A;  4Q38 A;  2PBI A;  1V9D A;  5ADX L;  2NMT A;  3ZSS A;  2BEI A;  2XSA A;  4H9O C;  4TWE A;  2WMN A;  5BMV E;  2WSS V;  3O9X A;  3OTO T;  4H63 V;  4YGO A;  3TLU A;  4TUY E;  3RYF E;  1IID A;  1WCR A;  4UCN A;  1UX5 A;  1LKX A;  2AJ6 A;  2ZEH A;  4AIU A;  3E0Z A;  1ZKE A;  3HUV A;  2CBI A;  1Q2C A;  4HNY B;  4X66 T;  1W0A A;  3HKC E;  3RPU A;  1HX1 B;  5IWA T;  5F09 A;  1IYL A;  3VRA A;  4ZGY B;  2V5C A;  3UUX B;  4P4D A;  3P2F A;  5HMN A;  2GK9 A;  3GYA A;  2Q0Y A;  5LGT B;  2V7M A;  3RF1 A;  5DWM A;  1FNO A;  2PJ2 A;  5J1Q A;  3B35 A;  2UXC T;  2Q7B A;  2A3D A;  4Y49 C;  4JI0 T;  2ZM0 A;  2OV9 A;  3SS1 A;  3QB5 A;  2Q44 A;  2IAK A;  2EHO B;  4GS4 A;  4R8F A;  2J8N A;  1SHZ C;  3V5U A;  2QGS A;  3ZEF B;  5EC4 A;  3F5B A;  5JDF A;  3PRT A;  3DJB A;  4ANJ A;  4UF0 B;  4H6U A;  4H63 H;  1IGB A;  2ZOF A;  2ZEO A;  5EMI A;  2H7O A;  3AEE A;  3RYI E;  2W2U A;  3DP7 A;  3EDU A;  3EFA A;  3M65 A;  2Z3P A;  3GKR A;  4YJ2 E;  5LYJ E;  2FCK A;  1L0V A;  3IWE A;  2MBG A;  2BS2 A;  3ZMZ B;  2AFZ A;  3W6X A;  4MJ8 A;  2WZH A;  3Q5E A;  4JI2 T;  3N9L A;  5E96 A;  2X0L B;  4UA3 A;  1QMU A;  2KSR A;  1ZHC A;  2VUR A;  2Z3L A;  4I49 A;  1YQE A;  4Z65 A;  3FMC A;  4Q7A A;  5J8C A;  2J62 A;  4YSX A;  2WUU A;  3FB3 A;  2R7H A;  2CHN A;  3RRW A;  3QB5 K;  4B5P A;  3JTK A;  2YNC C;  2XQ8 A;  4QXH B;  2UXN B;  2XAF B;  4ADZ A;  4CI2 B;  2D5U A;  4EXT A;  3P2H A;  2N1G A;  1TKJ A;  4JWP A;  5EK2 A;  4RN7 A;  5HWY A;  3RC8 A;  3ZT7 A;  4A37 A;  5J2T E;  3AB3 B;  4QX8 B;  2CTC A;  2IJZ A;  1MIV A;  2A9U A;  4IT4 A;  5L2L A;  5IHY A;  4DV3 T;  2JEW A;  3A9L A;  3VRB A;  1ARL A;  1YKH B;  2CXF A;  4DR2 T;  4JI8 T;  3ANW B;  2AFX A;  3DDD A;  3RKG A;  4TNV A;  3KBT A;  2MOZ A;  4KOR A;  4UV8 B;  3CDX A;  4ZEY A;  4UEL A;  2WWV A;  4JI6 T;  4LF9 T;  3BJ8 A;  5A27 A;  3ZMT B;  1D0Y A;  4ZI3 C;  2ZED A;  2OOT A;  2MPK A;  4BJN A;  2J9A A;  3NA6 A;  4O2A E;  3HL6 A;  3QUJ A;  2LSJ A;  1I6Z A;  2C1C A;  3HKD E;  1M4L A;  4OAE A;  2KLQ A;  3WAB A;  1WRD A;  4F9U A;  4EFD A;  2KWI B;  2PJC A;  5IB9 A;  4P09 A;  1TF9 A;  2YDS A;  1ZOY A;  4ILU A;  2VKJ A;  3VAT A;  4FD7 A;  1R8I A;  4HNX B;  2CA5 A;  3AEB A;  2PE3 A;  1WFD A;  1YW0 A;  2LSY A;  2GRE A;  3C51 A;  3RAM A;  4DUK A;  1Z8X A;  2D4O A;  2OU2 A;  2PVV A;  1XZY A;  4COF A;  3PB7 X;  4LX9 A;  2W61 A;  4NF1 A;  4ILA A;  3P4W A;  4JLE A;  2VL1 A;  1H8L A;  3KV4 A;  4WJB A;  4HFD A;  3BQK A;  2AE6 A;  2HC9 A;  3V8I A;  1NAF A;  1YVK A;  3C4W A;  3D3S A;  4TWD A;  4G1P A;  3QB8 A;  3FXT A;  3EC4 A;  1LAM A;  1R3N A;  1XF8 A;  4GYS A;  3LD2 A;  3OVU A;  2HUZ A;  1IAP A;  3RYH E;  2BS4 A;  3WC5 A;  2K5T A;  1G8X A;  3FHN A;  4XPD C;  2IC9 A;  2A2F X;  1YX0 A;  2WM9 A;  3H5Z A;  4KBM B;  4GK5 E;  4ZHQ E;  4KSI A;  4JI7 T;  2YU2 A;  2QIR A;  2DWK A;  5HEO A;  3C98 B;  4ZX9 A;  3ETV A;  4HPS A;  3N5F A;  3TO9 A;  1X9B A;  4AKG A;  2PC1 A;  5DQW A;  4CGP A;  5HXD A;  5C88 A;  3K9U A;  2UU9 T;  3T90 A;  4IF5 A;  1CPS A;  4PK2 A;  2CWO A;  4KS9 A;  5H84 A;  5FMN A;  2E9X C;  2ZEN A;  4XZC A;  1KUX A;  2ACZ A;  2XQ3 A;  4HWC A;  3PUX F;  1J5W A;  3F31 A;  3TLS A;  2M6B A;  4OFZ A;  2WZN A;  3K3N A;  4LF4 T;  5H86 A;  2Q4Y A;  5G20 A;  4HWD A;  1BO4 A;  1J5E T;  4M6H A;  4ASK A;  2D9D A;  5ETW A;  2FT0 A;  4YWY A;  2YN6 A;  4IDQ A;  4JI3 T;  5F46 A;  5AQU B;  1Z0P A;  5JQ4 A;  1MJA A;  1XE4 A;  4UEF A;  3ISZ A;  4B13 A;  4NUU A;  4UWI A;  2QEC A;  2L8K A;  2VKH A;  3AEF A;  1T8B A;  1EE3 P;  3T1Y T;  2NWB A;  3WT4 A;  5JPH A;  2BVM A;  4I4T E;  4EVY A;  1FEW A;  3S9M A;  3P4S A;  2MAW A;  4ERR A;  2WWU A;  3FEC A;  4P0A A;  4IAV A;  4FBE A;  4OKO A;  2XPK A;  5C8Y E;  3WI3 A;  4ZZB A;  5HVG A;  3O4X E;  5LYL A;  4F0X A;  5LNK A;  3CXP A;  2BBJ A;  3UQ4 A;  3BQI A;  2FJD A;  4A95 A;  4MMO A;  3SI0 A;  4RS2 A;  3NVO A;  2B5G A;  2V6Y A;  3SJE A;  1ZG8 A;  4JXQ A;  5K8P A;  1UX4 A;  3B3W A;  2PJ4 A;  3MN8 A;  2YK0 A;  4X62 T;  1XIX A;  4NSQ A;  4BMH A;  2CF4 A;  3EAB A;  1Z8W A;  4MFZ A;  5K8N A;  5LYI A;  1E7P A;  4GKJ T;  1FIO A;  3P8C D;  4R7M A;  3P4R A;  3EHZ A;  1D1A A;  4Q36 A;  1MIW A;  3D7D A;  4KP3 C;  3VH9 A;  1U6M A;  3ZYK A;  4C2X A;  2CY2 A;  4MFP A;  1WWZ A;  2VXK A;  4UFW A;  1XNR T;  2W66 A;  2CPT A;  3CKD A;  3HI2 A;  3VR8 A;  5L3F B;  4A94 A;  1SA0 E;  2ODF A;  2QML A;  1Z9U A;  3AAE B;  4OAD A;  3PUA A;  3W15 B;  5JRC B;  4M85 A;  3RYO A;  4KX6 A;  4YTN A;  2QVP A;  2JJ9 A;  2RP4 A;  2LKG A;  2PRB A;  4PV6 A;  5A1L A;  3G8W A;  2X9H A;  4AKL A;  3FYN A;  2IUB A;  5HCJ A;  2PRQ A;  4OP4 A;  2IIU A;  2Y8D A;  2F8H A;  4C68 A;  3PDY A;  4AQG A;  2BKN A;  4NEX A;  5AQV B;  5JGF A;  3GA8 A;  2RPA A;  1IBL T;  2DEA A;  2V8G A;  3WC6 A;  3RNZ A;  2VL0 A;  1QLB A;  2DLR A;  2FJB A;  4WW0 A;  2JLM A;  1XNQ T;  4M1P A;  5H6Q B;  4O4I E;  1LVF A;  1S7N A;  2D0T A;  2E5V A;  2ACX A;  4ZI2 C;  3TCV A;  1XMB A;  4TNU A;  4TNW A;  3K3O A;  1B7T A;  4ONU A;  6CPA A;  3L8R A;  3ZYL A;  1PCA A;  4H89 A;  3WC7 A;  2BG9 A;  4BA9 A;  4O4J E;  2BL1 A;  5K8O A;  4B12 A;  1T98 A;  3I1A A;  2YND A;  2M6I A;  4AIS A;  3DTO A;  4NJR A;  2ZPA A;  3BHX A;  3GB0 A;  3FZH B;  3FB2 A;  2GIV A;  4X5K A;  2W00 A;  2C5K T;  4U72 A;  5F49 A;  5JR9 A;  2WQY A;  4U74 A;  2IQ6 A;  4PXB A;  5BR8 T;  3F2E A;  4AKH A;  2VZY A;  3J7Y q;  5AGE A;  4TV8 E;  5ABF B;  2B3V A;  1MMN A;  5LGU B;  2WAU A;  5FVK A;  2EBJ A;  3RIA A;  1VHE A;  1IB1 E;  4DV0 T;  2JBJ A;  4IE6 A;  5TAO A;  2EWB A;  3QK6 A;  2H5M A;  4OC0 A;  2YKS A;  2WU2 A;  4PXD A;  3FZM B;  2LJL A;  4LUA A;  2LT3 A;  5HVF A;  2NTX A;  3V5S A;  3EDV A;  4ONW A;  3KFW X;  2X66 A;  2XQA A;  5FXX A;  2NW7 A;  1XRY A;  3JCF A;  2XQ9 A;  4P0B A;  1MMG A;  5JDG A;  2J8R A;  5EK3 A;  1Y64 B;  5LB7 B;  5J8F A;  3D0T A;  1KZF A;  3A5X A;  1UUR A;  3ZST A;  2X68 A;  2C6C A;  1SQH A;  5HXE A;  3V7Z A;  5A28 A;  3PFO A;  2ZEE A;  2X51 A;  4UCP A;  4DUZ T;  4OLL A;  3B8G A;  3FZF B;  1IBM T;  3S6K A;  2Q4V A;  4F0Y A;  3FH4 A;  4K0U A;  5FVJ A;  2CXA A;  2KZ7 B;  2I79 A;  3RC3 A;  5J2U E;  4IDZ A;  4EZ4 A;  4MY3 A;  4KVM E;  1UGO A;  3KDS E;  2ABZ A;  3BQL A;  2DXQ A;  3ZMU B;  1I12 A;  2CTB A;  4MBU A;  2M67 A;  4AXP A;  2W4X A;  3GLJ A;  3AED A;  3SJF A;  5LMU T;  2KMF A;  2VQY A;  2XQ7 A;  3M3Z B;  3IWW A;  3FBZ A;  3W6S A;  3GN5 B;  1R43 A;  1ARM A;  4EZH A;  3PU3 A;  4HWI B;  5THW A;  8CPA A;  4MHC A;  3TO6 A;  2Q9Q C;  3RH3 A;  4KSF A;  5ABH A;  1HS7 A;  5KX5 E;  5LOV E;  2GU2 A;  1HF8 A;  4LF5 T;  1QUU A;  1HCI A;  4ILB A;  5FY7 A;  2DF5 A;  4W9Y A;  2HPJ A;  4DBQ A;  2V8S V;  1JNZ A;  2LHN A;  4YSZ A;  5JR9 B;  4JBW F;  3UU3 A;  4P44 A;  2OR4 A;  4AQF A;  5G21 A;  1M4G A;  1TF8 A;  4A33 A;  2X9Y A;  1XDO A;  2NW9 A;  5JH7 E;  1XBU A;  3CXQ A;  1Y0R A;  4MFR A;  2MTQ A;  3IC1 A;  3U3I A;  4CYQ A;  5LRG A;  2ATR A;  4DVD A;  2FSR A;  2CLY B;  4MFK A;  2NTY A;  4H9P C;  3VWD A;  1Y9K A;  3UUN A;  3I1U A;  3RBU A;  3SOL A;  4R9M A;  4F8Z A;  4ZI3 D;  4GKK T;  1ELM P;  4C7I A;  3SXO A;  3MAC A;  1HG5 A;  4H6Z A;  1D0Z A;  4DR7 T;  5HEG A;  3CPZ A;  2V77 A;  3DGV A;  2BG9 C;  1PYT B;  5F47 A;  4ZY0 A;  2VK9 A;  4R76 A;  5ISV A;  3MRU A;  2AFU A;  3CQG B;  1Q2Y A;  5J0Z A;  4JI1 T;  4CGL A;  2I3C A;  2X9X A;  1QST A;  3AEA A;  5LRJ A;  2Q9Q D;  2OZG A;  4UV9 B;  4UR9 A;  1HFA A;  3UU8 A;  2LOP A;  3ZCJ A;  2C5J A;  2BZB A;  3KV6 A;  4MBQ A;  4MCQ A;  2UUB T;  3SXN A;  4NGN A;  4H9R C;  2ZMA A;  4A32 A;  3C4Z A;  4Z90 A;  4A98 A;  3UT5 E;  4IGU A;  3AE2 A;  3LJC A;  4YU9 A;  3RKO A;  2XEI A;  2PJ0 A;  3K2K A;  2FE7 A;  3NH5 A;  3N2O A;  3X1D A;  4WZX A;  1KK7 A;  3JC6 C;  3IFE A;  2IML A;  4NGP A;  5JTG A;  3KZW A;  1NEK A;  3KKW A;  3ZPO A;  1CPX A;  4FUU A;  3JVN A;  1KF6 A;  1I21 A;  4O4L E;  4TZ4 C;  4CGN A;  4MHZ A;  2BKO A;  2XAS B;  5GCN A;  2R1I A;  3PUS A;  2BSW A;  3QAY A;  4L8A A;  2E9X A;  3ESL A;  2ZEF A;  3PUW F;  2LKH A;  5L3B B;  2XAJ B;  2CNT A;  1J4J A;  3GN5 A;  3IIB A;  3IGR A;  3AEG A;  4XAX B;  3LDQ B;  1T7S A;  4XBF B;  4UF4 A;  3RQW A;  3UU5 A;  4MHN A;  4GIW A;  4PK6 A;  5EZY E;  1B6B A;  4GM5 A;  2P9B A;  1TXR A;  3TLT A;  5CFB A;  5JR9 C;  1QSN A;  3D2P A;  1VGY A;  2V6X A;  4G63 A;  3MGD A;  2QA7 A;  4DND A;  2ZXV A;  3AVS A;  5L3E B;  4LF7 T;  4O8S A;  4I50 E;  2J8M A;  4QKN A;  2Q9Q B;  3TFY A;  4AG9 A;  3WAK A;  3PGP A;  1YRE A;  3RZA A;  4OC4 A;  1S94 A;  3PUG A;  3O1H A;  2REF A;  3K3Q C;  1XFO A;  1N33 T;  4BIN A;  4UXN B;  3E08 A;  4YHJ A;  1KEY A;  1KWM A;  2VBQ A;  3G3S A;  5KTC A;  5G1Z A;  1WR6 A;  2K9A A;  4IDP A;  2WDQ A;  2KT9 A;  2EHO C;  1Z8U A;  5LBM A;  2CBJ A;  2B58 A;  3KV9 A;  4WBO A;  5ABG A;  4OC3 A;  3RIF A;  4CZZ B;  3RIU C;  4LQG A;  3OJA A;  5CA1 E;  4CXW A;  4KOW A;  2EUI A;  3IO1 A;  3FBU A;  2CE7 A;  3MXZ A;  2CLY C;  2YOE A;  5HXH A;  2PJB A;  5IYZ E;  3BI1 A;  1GQE A;  2HH7 A;  3JC6 D;  3NE8 A;  3VKG A;  3TO7 A;  2CMR A;  5AQO B;  3JAE A;  4B3M T;  1IJ6 A;  3N7Z A;  2B3U A;  2YDR A;  5FP3 A;  4AI6 A;  1OED C;  5HEH A;  1YK3 A;  5KMG P;  2K5B B;  4EGW A;  4NGR A;  1E1H B;  4PK4 A;  5LYF A;  2DI4 A;  2IC6 A;  3D4U A;  3AA7 B;  2B76 A;  4DMV A;  3ZT6 A;  2G0U A;  2Z3M A;  2YEV C;  1ZV4 X;  4FD6 A;  3Q9D A;  4UCM A;  1RO5 A;  2PG8 A;  3JRU A;  4C2Y A;  4DBR A;  3CPX A;  2UXX B;  2V5D A;  1TIQ A;  1KNZ A;  4GK0 E;  2XQ6 A;  2VWA A;  3VR9 A;  1DTD A;  3RRC A;  1NMT A;  2EK9 A;  4KOT A;  4U5Y A;  1WLX A;  3N2G E;  1LCP A;  1IBK T;  2HN2 A;  3IWG A;  3B57 A;  3OKQ A;  5CA0 E;  3KHX A;  2B5G B;  4CAW A;  1EZ3 A;  5HH1 A;  1HTJ F;  4MCR A;  2CXD A;  5LG3 A;  1NWM X;  3AE9 A;  1R57 A;  3MK7 C;  2V8V A;  4ILC A;  4CYP A;  4E0A A;  3SRZ A;  4A30 A;  4LF8 T;  4JEH B;  3H8G A;  1ZEE A;  3ABV A;  4B3T T;  1A2Z A;  5CB4 E;  2LSG A;  3OPC A;  2N9D A;  4HEA A;  2W67 A;  1XMO T;  4I0U A;  2C6P A;  3AAA B;  4HE8 A;  1YW6 A;  1LFW A;  5HVH A;  2PIZ A;  1LAN A;  3S6H A;  1IJ5 A;  5AQJ B;  3FXD B;  3RI5 A;  1YGH A;  4CN6 A;  5KTA A;  1LOK A;  3KHZ A;  1BR4 A;  2NP9 A;  2JMH A;  4EED A;  2DPT A;  3B5M A;  2FS5 A;  2FUP A;  3I9Y A;  3LFM A;  3N2K E;  3PUV F;  3N9O A;  3R96 A;  4EME A;  4A38 A;  3SHP A;  5JH9 A;  3PUY F;  3EXN A;  3D67 A;  5G22 A;  5JM6 A;  4FJO A;  4HTE A;  1XMT A;  2CXL A;  4O23 A;  4PQA A;  3PZJ A;  3NWI A;  2XUE A;  5I0C A;  1CM0 A;  5FXV A;  3ETU A;  2EO8 A;  2XZE A;  4J3G A;  4M6I A;  4HKA A;  2XEG A;  2JQ9 A;  1M4D A;  3R1K A;  3C50 A;  4QH1 A;  1YLO A;  5CNP A;  3FBL A;  1TKF A;  2ODU A;  5AQQ B;  3PBE A;  4TV9 E;  5DJQ C;  2BBH A;  3AXJ B;  1CG2 A;  4PJJ A;  3IBP A;  4GOU A;  5AQP B;  4UEZ A;  5F3J A;  2LRK A;  4B10 A;  1BR1 A;  2YGW A;  2R98 A;  2Y48 B;  3QC9 A;  3BK9 A;  3FVL A;  4B3S T;  2LOS A;  3KR5 A;  2I00 A;  4MCP A;  1SUM B;  4LQ6 A;  5F48 A;  2UXD T;  4CAE A;  3DR8 A;  3FJU A;  5D29 A;  4QH5 A;  5KXJ A;  2ZOG A;  2QYW A;  2PJ1 A;  2AFO A;  4YFS A;  1VHS A;  3FIX A;  4PXC A;  4AKI A;  3FRM A;  3ONX A;  3E22 E;  3NRX A;  4IUS A;  3AE5 A;  2OLT A;  3NRY A;  4EYY R;  1HDQ A;  3B3C A;  4LFB T;  2B4D A;  5EBV A;  4M6G A;  3AE3 A;  2POK A;  2JQQ A;  2WPX A;  5BWA B;  5C2T A;  4R3K A;  2XAG B;  4XNH C;  2R8V A;  4HN9 A;  1S7K A;  4TX5 A;  3BLN A;  4IE5 A;  2D0U A;  1IY7 A;  3TT2 A;  5LBQ B;  1AUG A;  3PFE A;  4P45 A;  2H3R A;  2YIN A;  2PTF A;  5AQK B;  4PSX A;  2ARH A;  3LK3 B;  3FX6 A;  3O1J A;  4AVB A;  3NE7 A;  2PJ7 A;  5FXW A;  1BAV A;  2D4P A;  3AE6 A;  5LXT E;  3AEC A;  3IHR A;  2Z6E A;  3G06 A;  2WDV A;  5FNV E;  2LE8 A;  4IL4 A;  5LMN T;  2PDO A;  1CHU A;  4OC2 A;  2NW8 A;  1KNR A;  3NKZ A;  1BLL E;  3CXS A;  3D7H A;  2C5I T;  2Z10 A;  4ZZC A;  5HXR A;  1FMV A;  4MHD A;  5L47 A;  2GAN A;  3OYZ A;  3R6N A;  1YME A;  3AA6 B;  7CPA A;  3PP9 A;  5JQG E;  3HA4 A;  4BAY B;  5FY0 A;  2WSA A;  4PFO A;  4MRI A;  1OWA A;  1D1C A;  2B4D B;  4DV1 T;  2XQY A;  2VAS A;  3EAM A;  3P7I A;  5H6R B;  1HDU A;  2Z3N A;  3TE4 A;  3V38 A;  4UFX A;  2CIJ A;  1Y7R A;  3RHW A;  3PV0 F;  4X65 T;  4TWF A;  3SFD A;  1YQ4 A;  5HEJ A;  2G3A A;  2H7V C;  4EV6 A;  2B1E A;  4YLH A;  1S7F A;  4KLV A;  4HKF A;  5LYD A;  3P4Q A;  1FJG T;  1HEE A;  1PU9 A;  4UVB B;  2CCQ A;  3PB4 X;  3CK6 A;  2KCW A;  4F6R C;  3CX7 B;  2I59 A;  4IRE A;  1XOV A;  3RLF F;  2RC4 A;  2GE3 A;  2OH1 A;  3LAC A;  3HLP A;  4OIW A;  1ZLH A;  4OYJ A;  4E8O A;  2D2S A;  2UUC T;  4CRY B;  4L5G A;  4EWT A;  2XY8 B;  2VB6 A;  4CS0 B;  3RX6 A;  2ZEM A;  4AB7 A;  4QUS A;  3SI1 A;  1LRZ A;  1KUY A;  3P50 A;  1S3Z A;  2HQY A;  5FY1 A;  5JRE A;  4LF6 T;  1HNW T;  4PK3 A;  3HKB E;  2BVL A;  4NGS A;  2CHO A;  1FY7 A;  4QH4 A;  2N2N A;  1W9R A;  3FF3 A;  4MCS A;  4K0K T;  3GWH A;  2DNX A;  3H3A A;  4YJ3 E;  4JYA T;  1VIX A;  2XSB A;  4IHM A;  4DR1 T;  3CVR A;  4DR6 T;  1BPN A;  1B87 A;  2REE A;  3H3M A;  4C2Z A;  5IX3 A;  4QVT A;  4HNW B;  4CI3 B;  1Z4R A;  3PTR B;  5LHG B;  2DCF A;  3ZN0 B;  4Q25 A;  1AJ3 A;  3NH4 A;  1XWM A;  3CPA A;  3KVA A;  2ZEP A;  1X12 A;  4MI4 A;  2CNM A;  2NYQ A;  1XEB A;  2LSI A;  3KIN B;  4FI5 A;  4UVC B;  1I1D A;  1MMD A;  2MYS A;  2G9D A;  4ZY1 A;  4PXE A;  4F8H A;  3RO0 A;  2OZU A;  5J1G A;  2A72 A;  2WBL A;  2X0Y A;  5JDQ A;  2HN1 A;  3ZJ0 A;  2IW5 B;  1VCS A;  4BBH A;  3I9W A;  4CAX A;  4AVA A;  2J1D G;  2G0B A;  2YNC A;  5FXZ A;  4PFP A;  4CN4 A;  2ZW6 A;  2ZW5 A;  4FWU A;  4MY0 A;  4FD5 A;  2VEZ A;  1ZG7 A;  3AVR A;  3QOF A;  3ZN1 B;  3KVB A;  3L3P A;  3UUB A;  1OED E;  1BPM A;  4II9 A;  5JDN A;  1MJB A;  1F2P A;  4MHY A;  2VKD A;  4ZOL E;  2XM1 A;  5LJM A;  4YFJ A;  3GY9 A;  4PJL A;  2PJ9 A;  3TC8 A;  4TWH A;  1TKH A;  3K1S A;  2JIW A;  2DPS A;  2BO9 A;  1E2A A;  4KMC A;  1S5K A;  2NOX A;  2P6F A;  4ZI7 E;  4H9S E;  4NUV A;  4JUY A;  4CGM A;  1GYT A;  5CGM A;  1HR0 T;  2XJ7 A;  3PB9 X;  4Y49 B;  2ODV A;  3VAR A;  1BOB A;  4LML A;  4KVO E;  1OBR A;  1W09 A;  4U31 A;  3IU2 A;  3C26 A;  2PJQ A;  4KOU A;  1K4J A;  4A56 A;  3B13 A;  1ZG9 A;  2W62 A;  4MFL A;  1NE9 A;  5AG6 A;  4HFH A;  4WNK A;  4P4F A;  2ZLY A;  4OYK A;  2QYV A; 
#chains in the Genus database with same CATH homology
 3PUG A;  3O1H A;  4C91 A;  3K3Q C;  1BO4 A;  2REF A;  1D0X A;  4UFV A;  4UXN B;  3ZLI A;  4ASK A;  3R9G A;  4F6A A;  4ISS A;  3E08 A;  5ETW A;  1VRB A;  4YHJ A;  4UVA B;  2FT0 A;  3DR6 A;  4XPD B;  2VBQ A;  3G3S A;  5KTC A;  5LCY A;  3S4U A;  1WR6 A;  5G1Z A;  2K9A A;  1MND A;  5F46 A;  2ZW4 A;  1Z0P A;  4KLW A;  5JQ4 A;  3C64 A;  3NZQ A;  1WYB A;  1MJA A;  1XE4 A;  1YLE A;  1G73 A;  2EHO C;  2KT9 A;  4X1Y E;  5LBM A;  3DNS A;  2B58 A;  4NUU A;  1KUV A;  4UWI A;  4B13 A;  3KV9 A;  4WBO A;  2QEC A;  2L8K A;  4CZZ B;  1P0H A;  2VKH A;  2X7B A;  5JPH A;  3OJA A;  2NWB A;  3UUL A;  4CXW A;  2X67 A;  2BVM A;  5CA1 E;  4KOW A;  4I4T E;  2EUI A;  4XPL A;  4EVY A;  1FEW A;  4JXR A;  4ERR A;  3S6G A;  2WWU A;  3FBU A;  1U5P A;  2Q9Q A;  2CE7 A;  5JDM A;  1S60 A;  2PQ8 A;  4P0A A;  3MXZ A;  2CLY C;  2VKO A;  4J2C A;  5C8Y E;  3WI3 A;  5L3D B;  5HXH A;  2Z0Z A;  3QAH A;  3O4X E;  4F0X A;  4QWN B;  4XPK A;  5IYZ E;  5LNK A;  3CXP A;  4DNC A;  2HH7 A;  3JC6 D;  2K48 A;  2KND A;  3BQI A;  3VKG A;  3OWC A;  4KUA A;  4A95 A;  3N9P A;  3TO7 A;  1H7C A;  2CMR A;  5L3G B;  4KOY A;  3H4Q A;  4V1A v;  4RS2 A;  1IJ6 A;  3N7Z A;  2B3U A;  5FP3 A;  2B5G A;  4AI6 A;  5AG7 A;  4B14 A;  1MIY A;  1YK3 A;  4CAF A;  2PFV A;  1OXZ A;  4JXQ A;  5KMG P;  1UX4 A;  4UF0 A;  2K5B B;  2V7J A;  1CUN A;  3MA9 A;  4I55 E;  3ZCI A;  1E1H B;  1HG2 A;  4PK4 A;  5JDL A;  2P0W A;  1IYK A;  1UFH A;  2DI4 A;  2IC6 A;  2YK0 A;  1XIX A;  2JEV A;  3AA7 B;  3AA1 B;  3BJ7 A;  3MZK B;  4NSQ A;  4AKR B;  4QC6 A;  4DMV A;  2RA1 A;  1M44 A;  2G0U A;  4MFZ A;  3I9S A;  2Z3M A;  4UBR A;  4GYR A;  2YEV C;  1FIO A;  1ZV4 X;  5DQV A;  4FD6 A;  3Q9D A;  4UCM A;  3P8C D;  1RO5 A;  2FIA A;  2L3L A;  3D8P A;  2PG8 A;  1D1A A;  5HYA A;  4Q36 A;  1MIW A;  4C2Y A;  1BR2 A;  4DBR A;  2OA5 A;  3C4X A;  1QSR A;  2DHR A;  2XAH B;  4C7H A;  2JPF A;  2UXX B;  4KP3 C;  1P4N A;  3KBU A;  1TIQ A;  4KVX A;  3N5L A;  3R84 B;  1KNZ A;  4GK0 E;  4Z8X A;  1U6M A;  4G2A A;  3ZYK A;  2PSW A;  2VWA A;  2CY2 A;  4C2X A;  1LVK A;  4NXY A;  3RRC A;  3PUQ A;  4MFP A;  1WWZ A;  2VXK A;  4PJM A;  4UFW A;  5IV0 A;  3SWH A;  1NMT A;  4O4H E;  1YVO A;  5F8P A;  5LA6 E;  3N9Q A;  3J9X 1;  4KOT A;  3CKD A;  3HI2 A;  2K24 A;  3LOD A;  5L3F B;  1SA0 E;  1WLX A;  1FMW A;  3N2G E;  4U5Y A;  4FD4 A;  5LHI B;  2QML A;  2V1D B;  1Z9U A;  3AAE B;  3IWG A;  3B57 A;  3OKQ A;  5CA0 E;  4KZT A;  3PUA A;  3W15 B;  3ZJ2 A;  5KDM C;  2KIN B;  5JRC B;  2B5G B;  4M85 A;  3I3G A;  3RYO A;  3TOB A;  4CAW A;  2ES0 A;  4CRZ B;  1EZ3 A;  2JDD A;  2B4B A;  1WYC A;  3D2M A;  5HH1 A;  2EHO A;  1HTJ F;  4KOS A;  2JJ9 A;  2CXD A;  2RP4 A;  1NWM X;  1R57 A;  3MK7 C;  4E0A A;  4ZI2 D;  1GHE A;  5E0O A;  3SRZ A;  2DWG A;  3PUR A;  2PRB A;  4PV6 A;  4A30 A;  5L3C B;  3CX8 B;  2Y6X A;  4JEH B;  5A1L A;  2X9H A;  3G8W A;  4CYO A;  4AKL A;  1ZEE A;  1MK4 A;  3FYN A;  4U9Z A;  5CB4 E;  3ZMV B;  5LP6 E;  2LSG A;  2N9D A;  4N78 D;  4CGO A;  4HEA A;  5LG4 A;  3R95 A;  3GMI A;  5HXC A;  4B5O A;  5KTD A;  2FXF A;  3HKE E;  2Y8D A;  3AAA B;  4HE8 A;  3F0A A;  4C68 A;  4ORF A;  4CYN A;  4EOZ B;  3PDY A;  3Q5X A;  4AQG A;  4E7S A;  4MBU A;  1NSL A;  1IJ5 A;  4I43 B;  4NEX A;  3S6H A;  2FIW A;  4Q38 A;  3FXD B;  1YGH A;  3AAI A;  5KTA A;  2V7K A;  2CM0 A;  3GA8 A;  2IL4 A;  1BR4 A;  2NP9 A;  4QX7 B;  2JMH A;  3EO4 A;  2XTL A;  2DPT A;  4HFV A;  2ZW7 A;  2FS5 A;  3I9Y A;  4O2B E;  2OB0 A;  2DLR A;  1IIC A;  4A31 A;  3LFM A;  3N2K E;  3N9O A;  3R96 A;  2L9Q A;  4CI1 B;  3DSB A;  3SHP A;  3EXN A;  3LK2 B;  4WW0 A;  3UFE A;  2LSK A;  5G22 A;  2YNE A;  4ZS2 A;  3Q2M A;  1Z4E A;  5LJN A;  3AA0 B;  2JLM A;  4FJO A;  3LG7 A;  4HTE A;  1XMT A;  2CXL A;  1ZO0 A;  4KSA A;  4M1P A;  3FXE B;  5H6Q B;  4O4I E;  1LVF A;  4CXY A;  2XUE A;  1S7N A;  3PZJ A;  3U78 A;  2C0S A;  2D0T A;  5I0C A;  1CM0 A;  3PU8 A;  4AVC A;  5FXV A;  2ACX A;  3ETU A;  3K8P C;  4ZI2 C;  1M1D A;  3TCV A;  5M4Y A;  3UY5 A;  3O1I A;  4J3G A;  3NBX X;  4HKA A;  4KUB A;  1QSM A;  3R1K A;  3K3O A;  1M4D A;  1OZP A;  1VKC A;  1B7T A;  3C50 A;  4ONU A;  4YRH A;  4R3L A;  1VOM A;  2WMO A;  3ZYL A;  5DWN A;  3H37 A;  4H89 A;  5CNP A;  3FBL A;  4XNH B;  2ODU A;  4BA9 A;  4O4J E;  2BL1 A;  4TV9 E;  5DJQ C;  4IST A;  4PJJ A;  5JVD E;  4CQI A;  1HX8 A;  3IBP A;  2LEH A;  4GOU A;  2KWH A;  5F3J A;  1T98 A;  4B12 A;  5AG4 A;  3I1A A;  2C27 A;  2YND A;  4B10 A;  3FNC A;  1BR1 A;  4L0R A;  2YGW A;  4U9Y A;  4L9I A;  4X1K E;  2Y48 B;  3DTO A;  3I0Q A;  3QC9 A;  2R98 A;  1Q2D A;  2ZPA A;  2LM9 A;  3BK9 A;  3ZZI A;  3FB2 A;  1QSD A;  2GIV A;  4X5K A;  2W63 A;  2C5K T;  2LOS A;  2W00 A;  4U72 A;  4UEM A;  3OBV E;  5JR9 A;  2I00 A;  3ZMS B;  5F49 A;  4JLY A;  2V26 A;  3VU7 H;  5F48 A;  4QHO A;  3VWE A;  4PW8 A;  2OZH A;  4CAE A;  2PR8 A;  2XAQ B;  4EB6 E;  4U74 A;  5EBV A;  3DR8 A;  1U4Q A;  2KXP B;  2V7I A;  4E7Z A;  3F2E A;  3Q5W A;  4AKH A;  2VZY A;  3J7Y q;  3EUH A;  5AGE A;  4OHF A;  1S35 A;  4TV8 E;  1QSO A;  3T8O A;  2O28 A;  2B3V A;  1MMN A;  2ZM8 A;  4YFS A;  5HXS A;  5LGU B;  2WAU A;  1VHS A;  3FIX A;  3KV5 A;  4AKI A;  2CEA A;  3ONX A;  2VI7 A;  1IZN B;  2PBI A;  3CML A;  1V9D A;  1YD8 G;  3E22 E;  5ADX L;  3NRX A;  2NMT A;  4IUS A;  3LBX B;  3NRY A;  4EYY R;  2BEI A;  4H9O C;  1IB1 E;  2WMN A;  2B4D A;  3ZC0 A;  5BMV E;  2WSS V;  4IE6 A;  5TAO A;  3O9X A;  3QK6 A;  4H63 V;  4IE0 A;  2H5M A;  2JQQ A;  3VHL A;  1IID A;  4TUY E;  3RYF E;  4YGO A;  4UCN A;  1UX5 A;  1LKX A;  2AJ6 A;  2LJL A;  1N71 A;  2WPX A;  5BWA B;  4LUA A;  3CQX C;  3E0Z A;  2LT3 A;  1ZKE A;  2NTX A;  2XAG B;  4R3K A;  4XNH C;  3V5S A;  3CX6 B;  3EDV A;  1Q2C A;  2R8V A;  4HN9 A;  4HNY B;  3KFW X;  1BR0 A;  1S7K A;  4TX5 A;  4PNI A;  3HKC E;  3BLN A;  4TN7 B;  4IE5 A;  3MJX A;  3WAJ A;  3F8K A;  2D0U A;  3WR7 A;  5C82 A;  2X66 A;  3RPU A;  3TT2 A;  5LBQ B;  5FXX A;  2NW7 A;  1IYL A;  1O3X A;  4ZGY B;  3UUX B;  3P2F A;  2H3R A;  2YIN A;  1PUA A;  5HMN A;  2GK9 A;  3HR0 A;  4PSX A;  3GYA A;  3I0O A;  5EK4 A;  3LK3 B;  4P0B A;  1MMG A;  2ARH A;  2Q0Y A;  3O1J A;  2Z3O A;  1YKE B;  3NE7 A;  5JRC A;  4AVB A;  4KOX A;  5LGT B;  2V7M A;  5JDG A;  5FXW A;  1Y9W A;  5DWM A;  4AQF C;  2J8R A;  2D4P A;  5EK3 A;  5LXT E;  1Y64 B;  2Z6E A;  3IHR A;  4JJX A;  5J8F A;  3D0T A;  2Q7B A;  2A3D A;  3A5X A;  4IIJ E;  5FNV E;  1KZF A;  4QB9 A;  4Y49 C;  2X68 A;  1SQH A;  2ZM0 A;  5HXE A;  3SS1 A;  3N9M A;  5A28 A;  2LE8 A;  2Q44 A;  4JD6 A;  2IAK A;  2X51 A;  4UCP A;  3NZP A;  4OLL A;  2EHO B;  4GS4 A;  2CNS A;  2CWY A;  2PDO A;  3B8G A;  3EY5 A;  2J8N A;  1SHZ C;  3V5U A;  2QGS A;  3ZEF B;  5EC4 A;  1MNE A;  2NW8 A;  4K30 A;  3S6K A;  3F5B A;  3CXS A;  4QBJ A;  2C5I T;  5JDF A;  2Q4V A;  2Z10 A;  4F0Y A;  5HXR A;  1FMV A;  3DJB A;  4K0U A;  4ANJ A;  2KZ7 B;  2CXA A;  4EYU A;  2I79 A;  4KOV A;  4UF0 B;  2GAN A;  3OYZ A;  3R6N A;  3RC3 A;  4H6U A;  4H63 H;  4MHD A;  3AA6 B;  3PP9 A;  5JQG E;  3HA4 A;  5J2U E;  4RI1 A;  4BAY B;  2H7O A;  5FY0 A;  5FYM A;  4IDZ A;  4PFO A;  4EZ4 A;  2WSA A;  3RYI E;  4MY3 A;  4KVM E;  1OWA A;  3KDS E;  3BQL A;  3DP7 A;  3EDU A;  2DXQ A;  1D1C A;  3ZMU B;  2B4D B;  1I12 A;  2XQY A;  1US7 B;  2VAS A;  2M67 A;  3P7I A;  3M65 A;  5H6R B;  4AXP A;  2Z3N A;  2Z3P A;  3EFA A;  3GKR A;  4YJ2 E;  1Y7R A;  5LYJ E;  2FCK A;  4UFX A;  3IWE A;  4PSW A;  2MBG A;  4H9N C;  2G3A A;  3ZMZ B;  2H7V C;  1S7L A;  4MJ8 A;  3W6X A;  4AG7 A;  2VL8 A;  4IE4 A;  2B1E A;  4YLH A;  3N9L A;  1S7F A;  4KLV A;  2KMF A;  2VQY A;  4HKF A;  3TTH A;  2LHR A;  3OYX A;  2X0L B;  1UCU A;  4UA3 A;  5E96 A;  4B6X A;  2VZZ A;  1PU9 A;  4UVB B;  1ZHC A;  3FBZ A;  3GN5 B;  3W6S A;  2CCQ A;  1M4I A;  4ZBG A;  2XHE B;  3UTK A;  2Z3L A;  3ANW A;  4I49 A;  4A2Z A;  4DO0 A;  3PU3 A;  4EZH A;  2KCW A;  4F6R C;  2WUU A;  5J8C A;  3RYC E;  3CX7 B;  4MHC A;  3TO6 A;  2I59 A;  4MLK A;  2Q9Q C;  4X1I E;  4DMW A;  3RH3 A;  4KSF A;  1HS7 A;  3FB3 A;  2R7H A;  2RC4 A;  3EVY A;  2GE3 A;  2OH1 A;  3RRW A;  5KX5 E;  4E2A A;  4B5P A;  3JTK A;  3ZC1 A;  5LOV E;  1HF8 A;  4IHJ E;  2YNC C;  4QXH B;  4OAD A;  2UXN B;  4B5P B;  1QUU A;  1HCI A;  2XAF B;  5FY7 A;  4OYJ A;  5HAX A;  2D5U A;  2HPJ A;  4ADZ A;  4CI2 B;  4DBQ A;  4EXT A;  3P2H A;  2N1G A;  4E8O A;  2D2S A;  4ZS3 A;  4CRY B;  2LHN A;  4L5G A;  3IU1 A;  5EK2 A;  5JR9 B;  5HWY A;  2VB6 A;  4JWP A;  4CS0 B;  3RX6 A;  3RC8 A;  1RXT A;  5J2T E;  3AB3 B;  4QX8 B;  1MIV A;  4AQF A;  5G21 A;  1M4G A;  1MMA A;  5L2L A;  5IHY A;  1MJ9 A;  4AB7 A;  1D1B A;  2G3T A;  2E9X B;  3A9L A;  4A33 A;  4H9Q C;  3ZYM A;  4QUS A;  2X9Y A;  2A4N A;  1LRZ A;  1KUY A;  2NW9 A;  1YKH B;  5JH7 E;  1S3Z A;  2CXF A;  5FY1 A;  5LGN B;  5LHH B;  3ANW B;  5JRE A;  2HQY A;  3CXQ A;  4JEU B;  4MFR A;  2MTQ A;  3DDD A;  4PK3 A;  3HKB E;  3U3I A;  2BVL A;  4BJM A;  4CYQ A;  1FY7 A;  2PR1 A;  2ATR A;  4DVD A;  3KBT A;  2MOZ A;  2N2N A;  4OK0 A;  4KOR A;  4UV8 B;  2FSR A;  4M3S A;  2CLY B;  4UEL A;  4MFK A;  1WK4 A;  2NTY A;  4H9P C;  2ZM2 A;  3VWD A;  3BJ8 A;  5A27 A;  1Y9K A;  3GWH A;  3UUN A;  2DNX A;  3H3A A;  4YJ3 E;  3JUW A;  3ZJ1 A;  1V0C A;  3SOL A;  4R9M A;  3ZMT B;  3CVR A;  1D0Y A;  4ZI3 C;  4ZI3 D;  1B87 A;  4BJN A;  1YR0 A;  2REE A;  3SXO A;  3MAC A;  4C7I A;  1HG5 A;  4QXC B;  4O2A E;  2Y0M A;  3HL6 A;  4C2Z A;  3QUJ A;  4H6Z A;  5IX3 A;  1D0Z A;  2LSJ A;  4QVT A;  4HNW B;  3CPZ A;  4CI3 B;  4B11 A;  3HKD E;  1Z4R A;  4OAE A;  3PTR B;  2KLQ A;  2YU1 A;  4BMH A;  5LHG B;  2DCF A;  3ZN0 B;  2HV2 A;  1WRD A;  2VK9 A;  2W0G A;  4NCZ A;  2KWI B;  5F47 A;  5ISV A;  4WBN E;  3LK4 2;  4P09 A;  4PAG A;  3CQG B;  4MAL A;  4ILU A;  1Q2Y A;  2VKJ A;  2EHO D;  2WPW A;  1AJ3 A;  4HGA A;  4FD7 A;  4CGL A;  4PJN A;  2X9X A;  3KVA A;  1QST A;  3N9N A;  4HNX B;  2CA5 A;  2Q9Q D;  2OZG A;  3TE4 A;  4UV9 B;  4MI4 A;  4EAH A;  1HFA A;  1YW0 A;  2LSY A;  2LOP A;  3ZCJ A;  2C5J A;  3C51 A;  3TKL B;  2CNM A;  2BZB A;  3R9E A;  1XEB A;  2LSI A;  3KIN B;  4FI5 A;  4UVC B;  2D4O A;  2OU2 A;  3KV6 A;  1I1D A;  4R57 A;  4MBQ A;  3SXN A;  4LX9 A;  2W61 A;  4NF1 A;  1MMD A;  4H9R C;  2ZMA A;  2MYS A;  4A32 A;  4JLE A;  4EIW A;  4MFQ A;  3C4Z A;  2Q04 A;  3UT5 E;  3KV4 A;  2OZU A;  5J1G A;  5DAB A;  4IGU A;  1X79 A;  2A72 A;  3LJC A;  2WBL A;  5FVJ A;  3BQK A;  2AE6 A;  3V8I A;  1NAF A;  4R87 A;  3RKO A;  1YVK A;  3C4W A;  2BDE A;  5JDQ A;  3D3S A;  3R9F A;  2FE7 A;  3ZJ0 A;  2IW5 B;  3N2O A;  3QB8 A;  4BBH A;  3I9W A;  1KK7 A;  4CAX A;  3JC6 C;  2BUE A;  4AVA A;  2P6E A;  3FXT A;  2J1D G;  3EC4 A;  2JRK A;  2G0B A;  2YNC A;  3KKW A;  5FXZ A;  3ZPO A;  4PFP A;  1XF8 A;  4GYS A;  2X9W A;  2ZW6 A;  3JVN A;  3LD2 A;  2ZW5 A;  5AG5 A;  2E9X D;  3LBX A;  2P6G A;  1I21 A;  3MKD A;  2HUZ A;  4MY0 A;  1IAP A;  3W91 A;  4O4L E;  4TZ4 C;  3RYH E;  4FD5 A;  4CGN A;  1CJW A;  2VEZ A;  3T9Y A;  2F5I A;  2K5T A;  1G8X A;  3L09 A;  1L0C A;  3AVR A;  3ZN1 B;  4UWJ A;  3KVB A;  3CWZ B;  3FHN A;  2XAS B;  3L3P A;  4KUM B;  4XPD C;  2IC9 A;  2A2F X;  5GCN A;  1YX0 A;  4II9 A;  5JDN A;  1MJB A;  5IB0 A;  2WM9 A;  3H5Z A;  2VKD A;  4GK5 E;  4KBM B;  4ZOL E;  4ZHQ E;  2R1I A;  3PUS A;  2YU2 A;  2QIR A;  2DWK A;  5LJM A;  2E8I A;  2BSW A;  4YFJ A;  3C98 B;  3GY9 A;  3ETV A;  4PJL A;  4CYP A;  4IE7 A;  2E9X A;  3ESL A;  3IF8 B;  4L8A A;  3UUM A;  3TO9 A;  2DPS A;  3S6F A;  5L3B B;  2XAJ B;  4AKG A;  4PK5 A;  2CNT A;  2PC1 A;  1J4J A;  3GN5 A;  2JDC A;  3VKH A;  3IGR A;  4XAX B;  4CXX A;  4KMC A;  4XBF B;  5DQW A;  1S5K A;  2FL4 A;  2NOX A;  5JDH A;  2P6F A;  4CGP A;  4ZI7 E;  3FRM A;  4H9S E;  4MFJ A;  4CAV A;  4GIW A;  4JUY A;  2V7L A;  4NUV A;  4PK6 A;  5EZY E;  1B6B A;  4CGM A;  5C88 A;  2P9B A;  3K9U A;  5JR9 C;  1ON0 A;  1QSN A;  4Y49 B;  2ODV A;  3T90 A;  3D2P A;  3IEE A;  5AFU L;  4UIG A;  4IF5 A;  3CQC B;  1BOB A;  4G63 A;  4PK2 A;  3MGD A;  4KVO E;  2CWO A;  3IU2 A;  2QA7 A;  4QXB B;  3C26 A;  4KS9 A;  4DND A;  5H84 A;  4L89 A;  5FMN A;  2ZXV A;  2E9X C;  2SPC A;  3AVS A;  5L3E B;  4XZC A;  5HWX A;  2Z11 A;  1KUX A;  3E0K A;  3PE0 A;  4O8S A;  2PJQ A;  4KOU A;  3TOA A;  1K4J A;  2HPL A;  4I50 E;  3F31 A;  4A56 A;  2EVN A;  2J8M A;  3B13 A;  2Q9Q B;  4QKN A;  5GON E;  4AG9 A;  3WAK A;  3TFY A;  2W62 A;  3PGP A;  4MFL A;  1NE9 A;  5AG6 A;  2JMK A;  3F57 A;  4OFZ A;  4X20 E;  1YRE A;  3K3N A;  4WNK A;  5H86 A;  2Q4Y A;  1S94 A;  5G20 A;  4C90 A;  2ZLY A;  4OYK A;  2Z3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...