1LRZA

X-ray crystal structure of staphylococcus aureus fema
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
412
structure length
400
Chain Sequence
MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords factor essential for expression of methicillin resistance
publication title X-ray crystal structure of Staphylococcus aureus FemA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic inhibitor
total genus 137
structure length 400
sequence length 412
ec nomenclature ec 2.3.2.17: N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N(6)-glycyl)-D-alanyl-D-
pdb deposition date 2002-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02388 FemAB FemAB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1lrzA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1lrzA02
5F47A 5H86A 2G0BA 2R8VA 1I12A 4PK2A 4FD7A 3UY5A 3PP9A 2ZW5A 3W91A 3SXOA 2AE6A 1B87A 1MK4A 3T9YA 1FY7A 2OH1A 4IUSA 4H6ZA 1TIQA 3FXEB 4JLYA 4PSWA 4JWPA 3R95A 2REFA 3LODA 1LVFA 2I79A 1Z4EA 3C26A 2B4DB 5DWMA 2X7BA 4KUAA 5HH1A 2Z0ZA 2MBGA 4EVYA 1XF8A 3ZZIA 4AVAA 4U9ZA 5KTAA 4CAVA 2HQYA 1CM0A 2DXQA 4CS0B 4MI4A 4KOVA 5JPHA 4H89A 5JQ4A 1GHEA 1S7NA 2PR1A 5F46A 4B5PA 3FBUA 2X9WA 2B58A 2FXFA 3FXDB 4KOSA 3CXSA 3TO6A 2Z10A 2CNTA 3P7IA 1K4JA 4J2CA 1BO4A 4NXYA 2R1IA 2HUZA 3FRMA 3S6FA 4JXRA 3D3SA 3TFYA 1BOBA 1IIDA 1B6BA 1J4JA 5IX3A 2G3AA 1SQHA 2VI7A 4GS4A 3R9FA 4KOYA 2FSRA 4RI1A 4AVBA 3BLNA 2BUEA 3CXQA 1KUXA 4M3SA 4ZBGA 4UWJA 4JD6A 1Z0PA 2ATRA 3BJ7A 4Y49B 3W6XA 2EUIA 1M4IA 3TOBA 4H6UA 4LUAA 4CRYB 3SXNA 4ONUA 2A4NA 2AJ6A 1S5KA 4RS2A 4XPDB 2IC9A 1IYKA 2GE3A 3G8WA 3JVNA 4KOWA 3GKRA 1KUVA 3RYOA 3TO9A 1Q2DA 4XPLA 1YREA 4MHDA 3TTHA 3E0KA 4OLLA 5I0CA 4J3GA 4UA3A 1Y7RA 4KVOE 3D8PA 1H7CA 4HNYB 1L0CA 3CVRA 3S6KA 4KLWA 4B5PB 4FI5A 3JUWA 2Q4YA 4U9YA 3EC4A 1XE4A 4JJXA 1YR0A 2FT0A 1Z4RA 3FB3A 2K48A 2PRBA 1RO5A 2VXKA 4BMHA 4MY3A 4KVME 3R96A 1YVOA 2FCKA 2VZYA 4YGOA 2KCWA 3FNCA 3I3GA 2IC6A 1IYLA 4R3LA 4FD6A 3F8KA 2OU2A 4KOTA 4KORA 2CNMA 4NCZA 5FVJA 1S3ZA 4B5OA 2OZUA 1M1DA 2O28A 3F0AA 2JEVA 3IWGA 2REEA 1M4DA 4QBJA 1PUAA 2ZW7A 1PU9A 2EVNA 3IGRA 4KLVA 1YK3A 1UFHA 2XTLA 1VHSA 3D2MA 5IV0A 4L89A 4FD5A 4AB7A 1LRZA 1MJAA 5C82A 1ZKEA 4F0YA 1P0HA 1S7FA 3LD2A 3F5BA 3PZJA 4R9MA 1MJBA 3DNSA 3T90A 5F49A 4OAEA 2B3UA 1IJ6A 2B4BA 4KUBA 1N71A 5EBVA 2OZHA 2QECA 2FS5A 1NMTA 4YRHA 4EYYR 4QB9A 2I00A 2Z11A 2BL1A 4II9A 3G3SA 4CQIA 3TKLB 4AG9A 3W6SA 2WPWA 2R7HA 1Y9WA 4F6AA 2G0UA 5C88A 1OZPA 1NE9A 2IL4A 2FIAA 2X9XA 1Z9UA 4M85A 4L8AA 4AG7A 2OZGA 2WPXA 4XPKA 3R9EA 3P2HA 3TT2A 2B3VA 2Y0MA 4HKFA 4MJ8A 3KKWA 2PQ8A 2J8RA 4XNHC 2FL4A 4U5YA 3QB8A 3EFAA 5H84A 3MGDA 5ISVA 3DR8A 1MJ9A 2QIRA 2GANA 4PK3A 3QK6A 4KOXA 4L0RA 4YFJA 1Q2CA 5E96A 2FIWA 3EO4A 5GCNA 2H5MA 4QVTA 3ZJ0A 4QUSA 5J8FA 1XMTA 2VQYA 3DSBA 3TOAA 3DR6A 3SHPA 2P6FA 3R1KA 5CNPA 3FXTA 2KWIB 2R98A 5HMNA 1WK4A 4PV6A 1RXTA 3CKDA 4K30A 5EC4A 3K9UA 3MXZA 2BEIA 3GY9A 2JDDA 2C5IT 2P6EA 1R57A 2VBQA 4MBUA 1M4GA 3D2PA 2PC1A 4JXQA 2C5KT 2Q44A 4DNDA 4E8OA 1KUYA 2J8MA 3H4QA 1P4NA 4R3KA 5J8CA 1S7KA 5KTCA 4UWIA 4HNWB 4KOUA 1M44A 2JDCA 1I21A 1VKCA 4R57A 3VWDA 3NE7A 1QSMA 1QSTA 4HNXB 2C5JA 2F5IA 1Y9KA 2B5GA 4IF5A 2CY2A 4X5KA 3FIXA 1XIXA 1QSRA 5KTDA 4CAWA 3QUJA 4ORFA 1QSDA 3I9SA 3EY5A 1CJWA 3FYNA 2OB0A 1YX0A 4KVXA 2CNSA 1V0CA 4I49A 1XEBA 1S7LA 2P0WA 3DDDA 4NEXA 2D4PA 2K5TA 2PR8A 5DWNA 2ARHA 3OWCA 3PGPA 2KWHA 1IJ5A 3N5LA 1KZFA 4OADA 3QAHA 3TO7A 1NSLA 4XNHB 4R87A 3WR7A 3EXNA 1QSNA 1ON0A 3S6GA 1YLEA 4NSQA 2CA5A 1U6MA 2D4OA 2JLMA 1I1DA 4DNCA 2ZXVA 1WWZA 2J8NA 4MY0A 4B6XA 3CXPA 3V8IA 2VZZA 2Q7BA 4PSXA 2PSWA 2FE7A 5IB0A 3N7ZA 3TCVA 4UBRA 2B4DA 2VEZA 2Q0YA 2C27A 1YGHA 4QC6A 3VWEA 4AVCA 5F48A 1IB1E 4NF1A 2BSWA 3TE4A 2RC4A 3S6HA 2B5GB 4CAXA 2P6GA 4LX9A 2ZPAA 1QSOA 2NMTA 4KZTA 1Q2YA 3B8GA 2GIVA 2PDOA 3GYAA 2X9YA 2ZW6A 3P2FA 1IICA 3S4UA 3L3PA 3BJ8A 4FD4A 4E2AA 2ZW4A 4Y49C 1YVKA 2QMLA 2Q04A 1S60A 4CRZB 2G3TA 4E0AA 3R9GA 2HV2A 2Q4VA 4XPDC
chains in the Genus database with same CATH superfamily
5LGTB 3KFWX 5FKYA 2YDQA 3PUWF 2UXCT 4PXCA 2R8VA 4PK2A 3UY5A 3CPZA 2ZW5A 2WCAA 3LFMA 5LYJE 4XAXB 2PJ8A 3W91A 2VQFT 2XM1A 2NWBA 4NGTA 5THWA 3B5MA 3ZLIA 1FY7A 4A38A 4OC3A 4IDPA 2OH1A 3L09A 4WYVA 2VURA 4IUSA 5AQMB 3UU6A 4H6ZA 3PEIA 2Q9QD 4UV9B 2W63A 5JM6A 1FNOA 3SFEA 2CE7A 4HWHA 2ZEMA 3C26A 4TWDA 1YW4A 2B4DB 5DWMA 2LSJA 3PFOA 4ZI3D 4UIGA 2VVSA 2W62A 2CRBA 4GM5A 4HKAA 3ZZIA 4AVAA 4AKGA 2MPKA 4HFCA 4C2ZA 2AE9A 2HQYA 4CAVA 2Z3OA 5FXVA 2NTXA 2RA1A 2PCUA 1S7NA 4UVCB 3I1AA 4C7IA 3IO1A 1G73A 5LJNA 3CQGB 3EABA 2BDEA 4MHNA 3QNUA 2B58A 2PIZA 3ZJ2A 4KOSA 4IREA 3RIFA 2Z10A 4JI7T 2CPTA 2O53A 1BO4A 1FJGT 2YKSA 1HF8A 2C6GA 3S6FA 5LG3A 4JXRA 3WAKA 5CBMA 2WY2A 2ES0A 2XM2A 4JLEA 3CK6A 3ZMUB 4WBOA 4KSAA 3VH9A 2VI7A 4GS4A 3R9FA 4KOYA 3KL9A 4HFEA 3BLNA 2JMHA 1KUXA 3C64A 2AFXA 4IE4A 3ZN0B 4X65T 2ATRA 5FXZA 4Y49B 5G1ZA 4YXDA 1HNWT 2EUIA 3TOBA 2YU1A 4CRYB 2PFVA 3JTKA 5K8NA 3KBTA 4KBMB 4FUUA 4LF8T 3CX6B 1IYKA 2IUBA 2V8SV 3PU3A 2VQET 4U72A 2ZLYA 2M6IA 4XPLA 4MHDA 3TTHA 4YT0A 5AQLB 1T8BA 5I0CA 3U3IA 3KDSE 4UA3A 4YLHA 4JI3T 5FL1A 4KVOE 2W4XA 4HFIA 4IHJE 4MFQA 1Y7EA 4GIWA 3AA1B 4AQFC 3HLPA 4OKOA 3D66A 4KLWA 4M6GA 4B5PB 2YU2A 2L8KA 2LSYA 3F2EA 4H9NC 3WC7A 5E0OA 3PBBA 5L4EA 1HS7A 4IL4A 2W67A 2FT0A 3S9LA 2XAGB 3FB3A 2K48A 5LRGA 5FY1A 2LKHA 5AG7A 5LHGB 2VXKA 3LBXB 4MCPA 1YVOA 2MAWA 2FCKA 2VZYA 4YGOA 3PBEA 2KCWA 2CXLA 2K3WA 5DABA 3H5ZA 3C4WA 2LE8A 3F8KA 4NXNT 3IEEA 1J5ET 5HWXA 2OU2A 4P4FA 4KORA 4NUUA 4Z90A 3OKQA 3G06A 4KP3C 2JRKA 3L39A 3F0AA 5LCYA 2WS3A 1CHUA 2NTYA 4F9UA 3M3ZB 5AG5A 1OEDB 1Z8TA 3MKDA 3T8OA 3PB7X 1DTDA 3ZN1B 4KLVA 5JREA 1UFHA 4MALA 3UU5A 2VK9A 4GXHA 3B3CA 1R3NA 4A2ZA 5IV0A 5ABGA 2VKHA 4L89A 5JH9A 3AECA 3PB8X 4C2YA 3V38A 2GLJA 4F0YA 4JYAT 2AFMA 3T8WA 1P0HA 3LD2A 4OYKA 2BKPA 3PZJA 3RC3A 1NSAA 5DQVA 4OIWA 3DNSA 3AE5A 5FYMA 4EYUA 5AG4A 3T90A 3QB5K 5JRCB 4H2KA 3HI2A 4OP4A 2B76A 4Q36A 2B3UA 3CWZB 2B4BA 3K8PC 2CBIA 3S9MA 1BLLE 3ZSSA 2D9DA 1IGBA 2FS5A 3I0QA 4X1KE 2Q9QB 3KV6A 2DNXA 2I00A 4XBFB 4II9A 5ABFA 4N78D 5JDMA 3R6NA 5HXDA 4AG9A 4B12A 1ZG9A 1Y9WA 4F6AA 2CMRA 2Z6EA 1NE9A 4ZHQE 3PU8A 4A97A 2FJAA 4L8AA 4ZX8A 3I9WA 4PFPA 4LMJA 2RB7A 3PB4X 1LAPA 1R43A 4ONWA 3P2HA 3TT2A 5J2UE 4ILAA 4EWTA 1Z8LA 1F2PA 4MJ8A 1WYCA 1AMPA 3AE8A 5LA6E 4C7HA 4U5YA 3IA3A 2I3CA 2WP9A 1XWMA 4O8SA 3MGDA 5AQGB 4TV8E 4MMOA 2ODUA 3N9OA 2GANA 4PK3A 2BG9A 3LMSA 2KMFA 4NFRA 5HVFA 1XBUA 4A39A 2H5MA 1ZLHA 1IY7A 1CPXA 8CPAA 2CCQA 2VQYA 5J0ZA 3O1HA 4B13A 4H63H 1YKHB 4DR1T 2LM2A 4YTMA 2PRQA 1GYTA 3FXTA 4X64T 5AG6A 4U3CA 5HMNA 4PXBA 3AEFA 4ILUA 5J1QA 1RXTA 5EC4A 1D0YA 2XY8B 2YN6A 2IMOA 5ELYA 2P6EA 4LF9T 1M4GA 3NA6A 4PXEA 3FZMB 3HR0A 2ZEEA 3WT4A 4H9RC 3PDYA 3IWWA 4E8OA 2Q44A 4DNDA 3WC5A 3KI9A 1KEYA 4OC4A 3ZPOA 3AEGA 4ADZA 2DEAA 2G9DA 4AI6A 2ZM0A 2O4HA 4P4BA 2KINB 4EZHA 1BPNA 1YQEA 1BR1A 2JDCA 2I0MA 3IU1A 4HNXB 2F5IA 3B2YA 1CG2A 2BG9E 2CY2A 2FJEA 4NIQA 1XIXA 1NAFA 3D68A 4CGLA 4EOZB 2QJ8A 3TLSA 3AA0B 3I9SA 4E7SA 3EY5A 3FYNA 2UUBT 4DJLA 3X1DA 2XQ6A 4QXHB 2XHEB 2CNSA 4I49A 3S9NA 2PVVA 2V7KA 5L3FB 4MHPA 1BAVA 4DUKA 4ZY1A 2P0WA 2WU5A 3RAMA 3VR9A 3EAMA 2HN2A 4QH1A 1WRDA 1VIXA 4L9IA 3UUXB 4O4IE 3FECA 3PUQA 4HEAA 1IJ5A 4OADA 4NGNA 3TO7A 1S94A 4PK4A 3RI5A 4XNHB 3EVYA 3S6GA 5JR9C 2GREA 4MRIA 4FWUA 4WBNE 1I1DA 3MK7C 3RHWA 5HVGA 5L3DB 5CPAA 3K9TA 4MFKA 4MXUA 4P4EA 2CEAA 4CYNA 4MY0A 2E5VA 3GMIA 4PSXA 2FE7A 5IB0A 4YWYA 3C4ZA 4QX8B 3FX6A 2B4DA 2WB5A 2EHOA 2Z3MA 2EK8A 3VWEA 3D4UA 4JI1T 3HKCE 4NF1A 2C6PA 1MIWA 3LSVA 3DGVA 3TE4A 2B5GB 4CAXA 1D1AA 1QQ9A 3ANWB 2X68A 2IIUA 1VCSA 2ZPAA 4NGQA 4IGUA 4BJMA 3JCFA 2X0YA 3ZC0A 1QSOA 3ZSTA 2NMTA 4KZTA 5FY0A 3P2FA 4UEFA 3S4UA 3L3PA 4FD4A 4NGRA 2ZW4A 3PUXF 4GOUA 2KLQA 4O2BE 1FIOA 4YHJA 3RRCA 3PURA 1VRBA 4YY3T 2R6GF 4UF0B 3SJGA 4XPDC 2GLFA 2BKOA 4YJ2E 3VKHA 4JI2T 1I12A 4FD7A 1ZP0A 3PUGA 2CF4A 3FEDA 5TAOA 3PP9A 1YQ3A 4F8ZA 3C51A 3FEEA 4ZZCA 1MK4A 1E2AA 2LRKA 2ZEHA 1BR0A 5HYAA 1YSJA 3V5UA 2PJ3A 4CYPA 3RO0A 4CN6A 5LNKA 1E7PA 4JZ0A 2E5LT 4MLKA 4DO0A 4OIDA 1QLBA 4BA9A 5EK3A 2NW9A 3HKDE 3R95A 2REFA 3LODA 3FZLB 4ZXLA 4P4DA 2CXDA 4B3MT 2Q43A 2JBJA 2OR4A 2ZM8A 4IE6A 2Z0ZA 4HN9A 4CZZB 3P4SA 3K3QC 4DV1T 5KTAA 5HWYA 3HUVA 2DI4A 4AKHA 2DXQA 5LG4A 4H89A 4PJJA 5GONE 1A2ZA 1VCTA 4B5PA 3TLUA 2WDVA 3I1UA 1LKXA 2QA7A 3BI1A 3TO6A 5IHYA 2DCFA 3D7DA 2Q51A 6CPAA 2POKA 3FZHB 4J2CA 2DPTA 2R1IA 2HPLA 2HB6A 1LANA 3WI3A 3OYXA 3J9X1 4EEBA 1EZ3A 3NBXX 3D3SA 1M7KA 2HHHT 1BOBA 3SFDA 1X9BA 3EI0A 3QAYA 5IX3A 2YINA 4DMWA 5EK4A 4PJNA 5DJQC 1SQHA 3CZXA 1WFDA 2VWAA 3JAEA 4RI1A 2CLYB 2V8GA 4AXVA 1XDOA 4M3SA 4ZBGA 4C90A 1U4QA 3E08A 2Q7SA 3ZMVB 3W6XA 3FZKB 1OXZA 3B3WA 1M4IA 4H6UA 3HL6A 4X8IA 4ONUA 1OEDA 2KZ7B 2IC9A 2CM0A 3AE6A 3G8WA 3JVNA 2PJ0A 3NH5A 3AE4A 3A8YC 1WR6A 1D0XA 3Q9DA 1N34T 1Y7RA 2JQQA 4NJQA 2NW8A 5AQSB 1QUUA 5H6RB 4OFZA 2OV9A 4CGMA 4R6TA 2X67A 3CVRA 1ZOYA 3S6KA 4FI5A 5JRCA 4A5XA 3JUWA 4UEEA 3H3AA 1ELLP 3LK42 4JJXA 2PJ6A 4UVAB 3UFGA 4LMLA 1XMQT 2PRBA 2Q9QA 2VL8A 1RO5A 2PJ2A 4MY3A 3SRZA 2E9XA 5AQOB 3R96A 2XAHB 1JQGA 3FNCA 4P0AA 3RNZA 4B14A 4F0XA 4R3LA 4UCMA 4CPAA 3O1JA 5LGNB 2PJAA 1XMOT 5AQTB 3PTRB 1LAMA 4GKKT 4FAIA 1NEKA 4AQGA 2H7OA 1OEDE 3P4RA 1Y0YA 2OLTA 4B5OA 3OBVE 5JTGA 4ERRA 1M1DA 2OZUA 2O28A 3OYZA 3IWGA 2JEVA 1XZYA 4DV3T 3ZMTB 2LKGA 2DHRA 2REEA 2XSBA 4H9SE 2ZOGA 4QBJA 1PUAA 1XRYA 3DTOA 2ZW7A 4MHYA 2W00A 4ZS2A 4RUHA 5EZYE 3AXJA 3D2MA 3RQWA 4PNIA 1LRZA 4KX6A 4DR3T 3PFEA 4M6IA 5FY7A 5C82A 2NOXA 2QYWA 5LYLA 1DU2A 2VL0A 3A5XA 4A30A 2OOTA 3RLFF 3NFZA 1UX5A 4UELA 4X20E 4JBWF 3RF1A 2W0GA 4CN1A 3FZFB 2H88A 2D0UA 4U7YA 1N71A 2N9DA 3QOFA 3ONLC 2QECA 1MIVA 1US7B 4DV0T 2V8HA 2AFUA 4LQGA 3H3MA 2V1DB 3ISZA 4AQYT 3G3SA 2IHR1 4CN4A 4CI3B 3N9PA 3AE1A 4CQIA 4QKNA 4HWDA 2BG9C 3K3NA 1SHZC 4B3ST 2LSIA 3W6SA 4YFSA 2PJ7A 2YDSA 2WPWA 4O4LE 2A9UA 4JI6T 2PJ5A 2CXFA 2G0UA 3AE3A 5HCMA 2IL4A 2FIAA 3BQLA 3ISXA 4AG7A 2NSMA 2WPXA 3R9EA 4F6RC 3ZCIA 4MBQA 2B3VA 3KV9A 4O23A 1UK5A 2E2AA 5LRKA 3H8FA 2JMKA 4ZZBA 2BS2A 3QB8A 4GK5E 1LFWA 5JDGA 2PBIA 2IDOB 3DR8A 3KQZA 2QIRA 3K2KA 4ZY0A 3QK6A 3RRWA 4KOXA 4YFJA 1R8IA 2UUAT 4LFCT 4CI2B 1Q2CA 5CA1E 4P09A 4QVTA 2D5UA 3ZJ0A 4QXCB 3B3TA 1IOFA 4JUYA 4JI5T 3LJCA 1HNZT 3DSBA 3TOAA 3NZQA 2XZEA 2P6FA 4OC5A 1D0ZA 3AVSA 4DR6T 1MIYA 3R1KA 3KV4A 3Q2MA 4DBQA 2CXAA 5HXEA 4GK0E 1BR2A 1HX1B 2MYSA 4H63V 2W66A 2ODFA 4K30A 5AQRB 2XJ7A 2VKJA 1R57A 4I55E 3E0ZA 4X3RA 1BR4A 3D2PA 4WJBA 4WW0A 1KUYA 1VHOA 2LHRA 2M67A 2J8MA 3UQ7A 1UX4A 4IE7A 1AJ3A 3B3SA 4PXDA 1WYBA 5J8CA 5CB4E 4MCRA 2E8IA 4UFWA 4UWIA 3F57A 4TWEA 5FNVE 3B35A 5AQQB 1I21A 4R57A 3VWDA 3IBPA 1F57A 5HXCA 1QSTA 4LFBT 5K8PA 1HDQA 4ZS3A 1M4LA 4UR9A 2B5GA 3VARA 3ANWA 1UGOA 3RIUA 4LF7T 1NENA 1X12A 3D7FA 3L8RA 1CJWA 1PYTB 2H7VC 3PB9X 1YX0A 4HWCA 5DS0A 1CBXA 4OYJA 3CX8B 2WUUA 3AEAA 4M6HA 3RYCE 1HFAA 4UF0A 4B11A 1WCRA 3R84B 3OWCA 4KS9A 2KWHA 2CHNA 3N5LA 5JDFA 4A33A 5J1GA 2EHOC 3QAHA 4QXBB 3EDUA 2JQKA 4WNKA 5BMVE 4I43B 4CAEA 1HG2A 2CA5A 5ABEA 2LJLA 4UCPA 4YU9A 3FBZA 3EDVA 4CGOA 3PJAA 4B6XA 5BR8T 2BBHA 2VZZA 2Q7BA 2PSWA 5F3JA 3SI2A 1HTJF 3UU4A 3N7ZA 3FMCA 2XQ5A 3VRBA 3DP7A 4K0UA 1KWMA 5LRJA 3KASA 4QC6A 2J4GA 5FVLA 3UU3A 3EHZA 2JPFA 1Z8WA 2PJ9A 3ESLA 1CP6A 2BSWA 4P10A 4EGWA 3RYFE 3UU8A 2RC4A 1FT7A 1OWAA 1TF9A 4LX9A 3KHXA 4YSXA 4P44A 5JDLA 2GIVA 3SWHA 1RTQA 2IAKA 4LMKA 1ARMA 2X9HA 3BJ8A 4E2AA 4UFXA 4Y49C 2YNCA 2BKNA 2QMLA 3P4QA 2Q04A 4FBEA 1N32T 2P9BA 3KHZA 4E0AA 3RC8A 5IB9A 3MA9A 3R9GA 3SJEA 4TV9E 2Q4VA 5LHIB 2HN1A 4UIAA 4HFDA 1Z8UA 3C4XA 4UIBA 3ZYLA 3CQCB 3JAFA 3AEDA 2AE6A 4TN7B 3UUMA 2HC9A 3KINB 3B13A 3FBLA 3T9YA 4CXYA 1VOMA 4F8HA 2WWUA 2BVMA 3K3OA 1IAPA 3MN8A 3FXEB 2ZEOA 3TLVA 2F4VT 4PSWA 4R8FA 1YLOA 4JWPA 1O3XA 2VB6A 3JRUA 3HKEE 3UTKA 5A1LA 2LSGA 3ZMSB 4L5GA 2X7BA 5HH1A 3NH4A 2FUPA 3AEBA 3A9LA 4PFOA 4IAVA 2MBGA 4EVYA 1XF8A 2WZNA 4U9ZA 4IDOA 4DV5T 4A37A 1LCPA 3ZC1A 1CM0A 4MI4A 5JPHA 2I6HA 2X51A 4OMEA 5KX5E 1GHEA 3AE9A 5F46A 3GWHA 3FBUA 2X0LB 1J1JA 2HPJA 1JNRA 3N9MA 5LXTE 3FXDB 2UXDT 2N1GA 3Q5WA 2ZM6T 5FP3A 4JI0T 4Q7AA 3NRXA 2RPAA 4U2ZA 4EB6E 1OEDC 4IE5A 2CNTA 3E22E 4I4TE 2UXBT 2OA5A 1N33T 2XEJA 3FVLA 5LHHB 2CWOA 2HUZA 3FRMA 3KGQA 3LDQB 2LRLA 3TFYA 5J2TE 5HEUA 1B6BA 3IC1A 3CPXA 2G3AA 3QNVA 3H8EA 5FXXA 2ABZA 1CP7A 2XQ3A 4LQ6A 5LYIA 4YSZA 5F8PA 2BUEA 4UWJA 4JD6A 1Z0PA 3M65A 3BJ7A 3T1YT 3IEHA 4U74A 2XQAA 2ACXA 2AFZA 4H9QC 2WMNA 2A4NA 3TX8A 2AJ6A 2YGWA 2VASA 4ZI2C 1S5KA 3LG7A 4NPPA 5L3BB 4DV6T 4KOWA 3GKRA 1KUVA 3RYOA 2FJDA 2Q9QC 1KF6A 4EV6A 1Q2DA 2E9XC 3GB0A 1Y0RA 3E0KA 2DPSA 4OLLA 5FVKA 3SI1A 3BXMA 2SPCA 2Z3LA 1N36T 2QGSA 2V5DA 2PVWA 1PCAA 4EIWA 3RX6A 2PJ4A 4ZEYA 4MFPA 2RP4A 1IU8A 3WABA 4H9PC 4P45A 4U9YA 2QVAA 2AFSA 2ZOFA 2AFWA 3PUZF 4MCQA 4ISTA 3EC4A 5LBQB 1YR0A 1U5PA 1Z4RA 3N9QA 2K9AA 2PJBA 1LVKA 1GQEA 4BMHA 1D1CA 2FJBA 4NGMA 3I3GA 2CTCA 2WQYA 1NWMX 2IC6A 2PIYA 2CTBA 1IYLA 5L3EB 1XFOA 1Z5RA 3MZKB 4OX9T 1W0BA 4NCZA 4MHCA 2XASB 2AXDS 3PRTA 5FVJA 1MMAA 2VL1A 1FMWA 2BZBA 1S3ZA 4DVDA 1B7TA 4AISA 3LK3B 5LP6E 1HDUA 1CPSA 3LK2B 4TWHA 5IYZE 5AQIB 3RKOA 4DR4T 1XDPA 3IGRA 1YK3A 3UQ4A 2K24A 3ETVA 2XTLA 3PJAJ 2DWKA 2F7VA 2XEIA 3N5FA 3NH8A 3RYHE 1V9DA 1MJAA 4FJOA 4MFJA 4ILCA 4RN7A 1S7FA 5KMGP 1HNXT 4DV7T 2JQ9A 1KK7A 2BG9B 1YMEA 1UCUA 3ZMZB 4AKLA 2LHNA 1IJ6A 3LBXA 2VKDA 3V5SA 4AXPA 4KUBA 4W9YA 5HEJA 5CGMA 5EBVA 3CIRA 4B3RT 5EK2A 4P1NA 3C50A 4EYYR 4KUMB 3O1IA 2KXPB 4B6ZA 4DYOA 4GKJT 5HXHA 5ABHA 2RFHA 3N2GE 1TXRA 4R7MA 2XAQB 2WAUA 4K0KT 2R7HA 2NYQA 3BK9A 2LSKA 4BJNA 5C88A 1OZPA 2WDRA 3VR8A 1Z9UA 5D8NA 4EXTA 4M85A 5AQFB 1QMUA 3ZYMA 5HVHA 5K8OA 1UUSA 1KNPA 5L4HA 4R76A 2WBLA 4O4JE 4XPKA 2A3DA 3CX7B 3GN5B 5LJMA 4MCSA 4DR5T 2Y0MA 4HKFA 3KKWA 4X62T 1M62A 2PQ8A 2YOEA 1ZO0A 4XNHC 3P8CD 5G21A 3AB3B 1T7SA 4BAYB 4UEZA 5LMUT 5HEHA 1HEEA 3EFAA 5H84A 4A31A 1MJ9A 2CWYA 2D0TA 3CDXA 1TKJA 2C0SA 3WC6A 4QH5A 5LYFA 2FIWA 5F5WA 3BQIA 5HXSA 3EO4A 1YXRA 5FL0A 5LBMA 4QUSA 1Q7LA 4COFA 3GA8A 4EZ4A 1XMTA 5JGFA 1IZNB 3OTOT 2J62A 4P0BA 3DR6A 2W61A 2KSRA 4LF6T 3NRYA 3RYIE 5HCJA 4DBRA 2N2NA 2R98A 1FMVA 3VHLA 3CPAA 3KV5A 3T1HT 2Z3NA 4CXWA 4TNWA 4UV8B 3ZEFB 3K9UA 4OK0A 2BEIA 4HFHA 3JC6C 2WZIA 3GY9A 3RIUC 3FJUA 2VBQA 2V26A 4MBUA 3AEEA 2PC1A 1Y01A 5JH7E 4QWNB 4JXQA 3IF8B 1YQ4A 3VRAA 3Q5XA 1F2OA 2IJZA 4PK6A 3H4QA 4HTEA 2V7MA 2C1CA 4ZI2D 1S7KA 5KTCA 5K8MA 5IUXA 4HNWB 2BVLA 4KOUA 1M44A 4K3NA 2E9XD 3GUXA 2JJ9A 3MACA 1MNEA 1HG5A 2C5JA 1Y9KA 4PPZA 4EAHA 2XQ8A 2C6CA 3LWUA 3KBUA 2QRXA 4IF5A 4X5KA 5A27A 2DLRA 1QSRA 2EHOB 2XEGA 4CAWA 3QUJA 5ADXL 1YW6A 2LEHA 3KVBA 5JVDE 4IE0A 2M6BA 2OB0A 4KVXA 3N2KE 4I50E 5AQPB 2V6YB 4IT4A 1L0VA 1HR0T 5HEOA 2KT9A 3J7Yq 4NEXA 4AKIA 2Y48B 3NZPA 3PUAA 1UURA 1TKFA 3NVOA 3P4PA 2ARHA 2XSAA 3RPUA 2IMLA 2LLYA 5AQVB 1JNZA 4B3TT 1NSLA 2XAJB 4R87A 1S35A 3WR7A 3EXNA 3C98B 2VKOA 1QSNA 1ON0A 2BS3A 1YLEA 4NSQA 4NUVA 5JDHA 5EMIA 4NGSA 3O9XA 2UUCT 2PJ1A 2ZXVA 1UWYA 3PUSA 2PE3A 5DQWA 3D0TA 1X79A 1ZG7A 1H8LA 3GIUA 3ZCJA 4U33A 2YNCC 3TCVA 1YW0A 3VU7H 3Q5DA 2ZEDA 2EO8A 4X2TA 4UBRA 3IFEA 2Q0YA 5KDMC 2UXNB 1YGHA 2J47A 4AVCA 4TNUA 2ZELA 2X66A 3I9YA 3AAAB 4X1IE 4Q38A 4GYRA 4TZ4C 3S6HA 4UFVA 2WDQA 4AIUA 2MTQA 1Q2YA 2PJQA 2CLYC 3VKGA 2L9QA 3GYAA 1IICA 2K5BB 4ILBA 4GYSA 2V7IA 1YVKA 1Y64B 3W15B 5C2TA 2V8DA 2L3LA 3MRUA 4BD9A 4Z91A 3UUBA 3U78A 2G3TA 3KZWA 2HV2A 3KR4A 2ZEFA 1JWQA 2PTFA 2B1EA 2PJCA 5F47A 5H86A 4BINA 2G0BA 5LB7B 2NW7A 3B57A 1IBKT 2X0HA 5JDQA 2YK0A 3HKBE 3UFEA 3SXOA 1XJOA 1B87A 4A98A 2IW5B 5D29A 2XPKA 5I4MA 4DUZT 1ZHCA 3ONXA 4KHPT 2ACZA 3JADA 4JEUB 1MNDA 4YTNA 1TIQA 3AA7B 2WU2A 5C3JA 3IWEA 4JLYA 1T98A 3GLJA 2YNEA 5BWAB 3TLWA 3NWIA 1LVFA 4E7ZA 1Z4EA 2I79A 2JQHA 4UXNB 3AVRA 3A7MA 5LYDA 4JEHB 4KUAA 5CJ5A 2A72A 3H8GA 3FB2A 4IDNA 2JBKA 4A32A 5JR9B 3RH3A 1XNQT 3ABVA 3TC8A 2XQYA 3IJ3A 2A2FX 4CS0B 1TKHA 3FH4A 4KOVA 4A95A 5JQ4A 2IQ6A 2XUEA 2WZHA 2DL1A 1ELMP 2PR1A 1W9RA 4TWFA 3OPCA 4JI8T 2LM9A 4PW8A 3WAJA 3ZT7A 2X9WA 3RGLA 3F31A 2FXFA 2I59A 1MMDA 4HE8A 2V7LA 3CXSA 4WZXA 3ONJA 2BO9A 5G22A 2Y8DA 3P7IA 1K4JA 4PAGA 1J5WA 4CI1B 4NXYA 4IDZA 2UXXB 5C8YE 3AAIA 4QHOA 2DWGA 2Y6XA 3JC6D 2D2SA 4HFVA 1I6ZA 1YKEB 1IIDA 1E1HB 4CGPA 1J4JA 1ZV4X 3RBUA 3MJXA 4LFAT 2WSSV 1D1BA 2V77A 2E9XB 4KHZF 2FSRA 4AVBA 3CXQA 1G8XA 5KXJA 4YTPA 4ZOLE 4CGNA 5ETWA 7CPAA 4LUAA 1MMNA 3SXNA 3IU2A 2FVGA 4JYWA 3N9LA 1MMGA 4QH4A 1AYEA 4RS2A 4XPDB 4Z65A 3CQXC 2GE3A 4A94A 2J9AA 4CAFA 4IL9A 3PUYF 3ZYKA 3TO9A 4CYQA 1T72A 3PUVF 1YREA 3D7HA 4OC1A 4KSIA 1CUNA 4J3GA 4P6YA 1ARLA 2YNDA 3AXJB 3D8PA 4C2XA 1H7CA 2H89A 2GU2A 2LT3A 5A28A 2BBJA 4HNYB 1OBRA 3UT5E 1L0CA 3K1SA 4YJ3E 5JDNA 4ZI7E 2Q4YA 2V6XA 4P4JA 2W2UA 2ZENA 4PK5A 3UULA 4ANJA 1XE4A 4OC0A 1VGYA 3ZKRA 2EWBA 3P50A 3KQXA 4KVME 1Z2LA 3AA6B 4JV5T 4MFZA 4X1YE 1ZLIA 4FD6A 3B7IA 2WMOA 4XZCA 4AQFA 5JQGE 3B3VA 1VHEA 4KOTA 2CNMA 2CHOA 5FXWA 3RKGA 1LOKA 3OVUA 5HAXA 2KNDA 2V5CA 4Z8XA 2PG8A 3GN5A 2CBJA 1M4DA 4IIJE 3RQUA 2NR4A 4PQAA 1PU9A 4LF4T 2EVNA 3FHNA 1VHSA 5AGEA 4FD5A 4AB7A 4M1PA 3SJFA 4TX5A 2DF5A 1ZKEA 4YHHT 3IIBA 4UCNA 2YEVC 4HPSA 2HH7A 2GFQA 3N2OA 1AUGA 4I0UA 1W09A 4V1Av 3F5BA 4R9MA 1MJBA 1YD8G 1Z8XA 3VATA 4KI0F 2WSAA 2H3RA 5F49A 4OAEA 1BPMA 3QC9A 2V8VA 2Q4ZA 3DJBA 2YDRA 1KFYA 1EE3P 1WLXA 1WR0A 4NXMT 3TLTA 2OZHA 4X66T 4ZYQA 1NMTA 4YRHA 2ZMAA 4HGAA 3HA4A 1W0AA 4QB9A 2Z11A 2BL1A 4HFBA 4UF4A 2XEFA 2Z3KA 3TKLB 2MOZA 5AQJB 2BS4A 3OJAA 3SI0A 4Q25A 2X9XA 2J1DG 1CX8A 3V7ZA 3RIAA 2OZGA 4MHZA 4G1PA 4X5TA 4DV4T 2EBJA 4BBHA 5M4YA 5AFUL 3NKZA 4ISSA 1ZG8A 2J8RA 4ZY2A 2FL4A 2XQ4A 4UVBB 4AKRB 3SS1A 4ZI3C 4EFDA 5ISVA 3ETUA 3L2NA 4G63A 2UU9T 4L0RA 5LOVE 5L3GB 5E96A 4U2YA 5GCNA 2V6YA 4O2AE 5J8FA 2EHOD 2XQ9A 3RZAA 4YSYA 3SHPA 3AE7A 3ZJ1A 5CNPA 4IHMA 1IBLT 4C68A 2KWIB 2QVPA 3O4XE 1IOIA 1HX8A 2Z3PA 2V7JA 1WK4A 4PV6A 3I0OA 4HWFA 5AQKB 3CKDA 3MXZA 3AE2A 2BOAA 5L3CB 2VVNA 4HWIB 5ABFB 4MFLA 4ZI6A 1I94T 4CXXA 2C5IT 2ZM2A 3EUHA 4DMVA 2JDDA 4DR7T 2GK9A 4F9VA 4KMCA 5LMNT 2C5KT 3P4WA 3QB5A 5AQNB 1P4NA 4R3KA 4QX7B 4DV2T 3LACA 1KNZA 4TUYE 4C91A 3IHRA 3AAEB 1ZEEA 2WM9A 1VKCA 4PJLA 3NE7A 1QSMA 5AQHB 5IWAT 3BI0A 5HEGA 3FIXA 3D7GA 5KTDA 4ORFA 2XAFB 1QSDA 3Q5EA 2F8HA 3ZT5A 3ZT6A 4O4HE 4ZX9A 3PV0F 4LF5T 3BHXA 1V0CA 2AFOA 1X10A 4U31A 1XEBA 1S7LA 2LOPA 2WWVA 3DDDA 1HCIA 2JIWA 4EMEA 2D4PA 4ASKA 4UEMA 2K5TA 2PR8A 5DWNA 4NGPA 3KVAA 4KSFA 5H6QB 4TNVA 3PGPA 1KZFA 3SOLA 1XNRT 1SA0E 2JEWA 4ZGYB 1IBMT 4JI4T 1FEWA 5AQUB 3DLJA 4OC2A 5HXRA 1U6MA 3H37A 2D4OA 5G20A 1SE7A 2JLMA 2QYVA 5CA0E 4A56A 4DNCA 1SUMB 4MFRA 1WWZA 2ODVA 2J8NA 3CXPA 3V8IA 3CT9A 3FF3A 3SJXA 3BQKA 2ANPA 1XMBA 2BCOA 4IK2A 2CIJA 2FBWA 4B10A 2VEZA 2C27A 3N9NA 3NE8A 4DIDB 5CFBA 5F48A 1IB1E 4DUYT 1TF8A 4G2AA 5JR9A 1XOVA 4H9OC 4OHFA 2LOSA 5FMNA 2P6GA 3PE0A 2ZEPA 3KR5A 3D67A 4P4IA 1KNRA 4WWVA 1DE4C 4EEDA 2NP9A 2EK9A 4CYOA 4IDQA 3B8GA 2PDOA 2X9YA 2XQ7A 2ZW6A 3PB6X 5L47A 1S60A 5LGUB 5F09A 4CRZB 4PJMA 2WYRA 3UUNA 4NJRA 3CMLA 5L2LA 2ZEGA 4U7IA 4DR2T
chains in the Genus database with same CATH topology
5LGTB 3KFWX 2R8VA 4PK2A 3UY5A 3CPZA 2ZW5A 3LFMA 5LYJE 3W91A 4XAXB 2NWBA 3ZLIA 1FY7A 2OH1A 3L09A 4IUSA 4H6ZA 2Q9QD 4UV9B 2W63A 2CE7A 3C26A 2B4DB 5DWMA 2LSJA 4ZI3D 4UIGA 2W62A 4HKAA 3ZZIA 4AVAA 4AKGA 4C2ZA 4CAVA 2HQYA 2Z3OA 5FXVA 2NTXA 2RA1A 1S7NA 4UVCB 3I1AA 4C7IA 1G73A 5LJNA 3CQGB 2BDEA 2B58A 3ZJ2A 4KOSA 2Z10A 1BO4A 1HF8A 3S6FA 4JXRA 3WAKA 2ES0A 4JLEA 3ZMUB 4WBOA 4KSAA 2VI7A 4GS4A 3R9FA 4KOYA 3BLNA 2JMHA 1KUXA 3C64A 4IE4A 3ZN0B 2ATRA 5FXZA 4Y49B 5G1ZA 2EUIA 3TOBA 2YU1A 4CRYB 2PFVA 3JTKA 3KBTA 4KBMB 3CX6B 1IYKA 3PU3A 4U72A 2ZLYA 4XPLA 4MHDA 3TTHA 5I0CA 3U3IA 3KDSE 4UA3A 4YLHA 4KVOE 4IHJE 4MFQA 4GIWA 3AA1B 4AQFC 4KLWA 4B5PB 2YU2A 2L8KA 2LSYA 3F2EA 4H9NC 5E0OA 1HS7A 2FT0A 2XAGB 3FB3A 2K48A 5FY1A 5AG7A 5LHGB 2VXKA 3LBXB 1YVOA 2FCKA 2VZYA 4YGOA 2KCWA 2CXLA 5DABA 3H5ZA 3C4WA 2LE8A 3F8KA 3IEEA 5HWXA 2OU2A 4KORA 4NUUA 3OKQA 4KP3C 2JRKA 3F0AA 5LCYA 2NTYA 5AG5A 3MKDA 3T8OA 3ZN1B 4KLVA 5JREA 1UFHA 4MALA 2VK9A 4A2ZA 5IV0A 2VKHA 4L89A 4C2YA 4F0YA 1P0HA 3LD2A 4OYKA 3PZJA 3RC3A 5DQVA 3DNSA 5FYMA 4EYUA 5AG4A 3T90A 5JRCB 4Q36A 3HI2A 2B3UA 3CWZB 2B4BA 3K8PC 2FS5A 3I0QA 4X1KE 2Q9QB 3KV6A 2DNXA 2I00A 4XBFB 4II9A 4N78D 5JDMA 3R6NA 4AG9A 4B12A 1Y9WA 4F6AA 2CMRA 2Z6EA 1NE9A 4ZHQE 3PU8A 4L8AA 3I9WA 4PFPA 3P2HA 3TT2A 5J2UE 4MJ8A 1WYCA 5LA6E 4C7HA 4U5YA 4O8SA 3MGDA 4TV8E 2ODUA 3N9OA 2GANA 4PK3A 2KMFA 2H5MA 2CCQA 2VQYA 3O1HA 4B13A 4H63H 1YKHB 3FXTA 5AG6A 5HMNA 4ILUA 1RXTA 5EC4A 1D0YA 2P6EA 1M4GA 3HR0A 4H9RC 3PDYA 4E8OA 2Q44A 4DNDA 3ZPOA 4ADZA 4AI6A 2ZM0A 2KINB 4EZHA 1BR1A 2JDCA 3IU1A 4HNXB 2F5IA 2CY2A 1XIXA 1NAFA 4CGLA 4EOZB 3AA0B 3I9SA 4E7SA 3EY5A 3FYNA 4QXHB 2XHEB 2CNSA 4I49A 2V7KA 5L3FB 2P0WA 1WRDA 4L9IA 3UUXB 4O4IE 3PUQA 4HEAA 1IJ5A 4OADA 3TO7A 1S94A 4PK4A 4XNHB 3EVYA 3S6GA 5JR9C 4WBNE 1I1DA 3MK7C 5L3DB 4MFKA 2CEAA 4CYNA 4MY0A 3GMIA 4PSXA 2FE7A 5IB0A 3C4ZA 4QX8B 2B4DA 2EHOA 2Z3MA 3VWEA 3HKCE 4NF1A 1MIWA 3TE4A 2B5GB 4CAXA 1D1AA 3ANWB 2X68A 2ZPAA 4IGUA 4BJMA 3ZC0A 1QSOA 2NMTA 4KZTA 5FY0A 3P2FA 3S4UA 3L3PA 4FD4A 2ZW4A 4GOUA 2KLQA 4O2BE 1FIOA 4YHJA 3RRCA 3PURA 1VRBA 4UF0B 4XPDC 4YJ2E 3VKHA 1I12A 4FD7A 3PUGA 3PP9A 5TAOA 3C51A 1MK4A 1BR0A 5HYAA 3V5UA 4CYPA 5LNKA 4MLKA 4DO0A 4BA9A 5EK3A 2NW9A 3HKDE 3R95A 2REFA 3LODA 2CXDA 2ZM8A 4IE6A 2Z0ZA 4HN9A 4CZZB 3K3QC 5KTAA 5HWYA 2DI4A 4AKHA 2DXQA 5LG4A 4H89A 4PJJA 5GONE 4B5PA 1LKXA 2QA7A 3TO6A 5IHYA 2DCFA 4J2CA 2DPTA 2R1IA 2HPLA 3WI3A 3OYXA 3J9X1 1EZ3A 3NBXX 3D3SA 1BOBA 5IX3A 2YINA 4DMWA 5EK4A 4PJNA 5DJQC 1SQHA 2VWAA 4RI1A 2CLYB 4M3SA 4ZBGA 4C90A 1U4QA 3E08A 3ZMVB 3W6XA 1OXZA 1M4IA 4H6UA 3HL6A 4ONUA 2KZ7B 2IC9A 2CM0A 3G8WA 3JVNA 1WR6A 1D0XA 3Q9DA 1Y7RA 2JQQA 2NW8A 1QUUA 5H6RB 4OFZA 4CGMA 2X67A 3CVRA 3S6KA 4FI5A 5JRCA 3JUWA 3H3AA 3LK42 4JJXA 4UVAB 2PRBA 2Q9QA 2VL8A 1RO5A 4MY3A 3SRZA 2E9XA 3R96A 2XAHB 3FNCA 4P0AA 4B14A 4F0XA 4R3LA 4UCMA 3O1JA 5LGNB 3PTRB 4AQGA 2H7OA 4B5OA 3OBVE 4ERRA 1M1DA 2OZUA 2O28A 3OYZA 3IWGA 2JEVA 3ZMTB 2DHRA 2REEA 4H9SE 4QBJA 1PUAA 2ZW7A 3DTOA 2W00A 4ZS2A 5EZYE 3D2MA 4PNIA 1LRZA 5C82A 5FY7A 2NOXA 3A5XA 4A30A 1UX5A 4UELA 4X20E 2W0GA 2D0UA 1N71A 2N9DA 2QECA 1MIVA 1US7B 2V1DB 3G3SA 4CI3B 3N9PA 4CQIA 4QKNA 3K3NA 1SHZC 2LSIA 3W6SA 4YFSA 2WPWA 4O4LE 2CXFA 2G0UA 2IL4A 2FIAA 3BQLA 4AG7A 2WPXA 3R9EA 4F6RC 3ZCIA 4MBQA 2B3VA 3KV9A 2JMKA 3QB8A 4GK5E 5JDGA 2PBIA 3DR8A 2QIRA 3QK6A 3RRWA 4KOXA 4YFJA 1Q2CA 4CI2B 5CA1E 4P09A 4QVTA 2D5UA 3ZJ0A 4QXCB 4JUYA 3LJCA 3DSBA 3TOAA 3NZQA 2P6FA 1D0ZA 3AVSA 1MIYA 3R1KA 3KV4A 3Q2MA 4DBQA 2CXAA 5HXEA 4GK0E 1BR2A 2MYSA 4H63V 4K30A 2VKJA 1R57A 4I55E 3E0ZA 1BR4A 3D2PA 4WW0A 1KUYA 2LHRA 2M67A 2J8MA 1UX4A 4IE7A 1AJ3A 1WYBA 5J8CA 5CB4E 2E8IA 4UFWA 4UWIA 3F57A 5FNVE 1I21A 4R57A 3VWDA 3IBPA 5HXCA 1QSTA 4ZS3A 2B5GA 3ANWA 1CJWA 2H7VC 1YX0A 4OYJA 3CX8B 2WUUA 3RYCE 1HFAA 4UF0A 4B11A 3R84B 3OWCA 4KS9A 2KWHA 3N5LA 5JDFA 4A33A 5J1GA 2EHOC 3QAHA 4QXBB 3EDUA 4WNKA 5BMVE 4I43B 4CAEA 1HG2A 2CA5A 2LJLA 4UCPA 3FBZA 3EDVA 4CGOA 4B6XA 2VZZA 2Q7BA 2PSWA 5F3JA 1HTJF 3N7ZA 3DP7A 4K0UA 4QC6A 2JPFA 3ESLA 2BSWA 3RYFE 2RC4A 1OWAA 4LX9A 5JDLA 2GIVA 3SWHA 2IAKA 2X9HA 3BJ8A 4E2AA 4UFXA 4Y49C 2YNCA 2QMLA 2Q04A 2P9BA 4E0AA 3RC8A 3MA9A 3R9GA 4TV9E 2Q4VA 5LHIB 3C4XA 3ZYLA 3CQCB 2AE6A 4TN7B 3UUMA 3KINB 3B13A 3FBLA 3T9YA 4CXYA 1VOMA 2WWUA 2BVMA 3K3OA 1IAPA 3FXEB 4PSWA 4JWPA 1O3XA 2VB6A 3HKEE 3UTKA 5A1LA 2LSGA 3ZMSB 4L5GA 2X7BA 5HH1A 3A9LA 4PFOA 2MBGA 4EVYA 1XF8A 4U9ZA 3ZC1A 1CM0A 4MI4A 5JPHA 2X51A 5KX5E 1GHEA 5F46A 3GWHA 3FBUA 2X0LB 2HPJA 3N9MA 5LXTE 3FXDB 2N1GA 3Q5WA 5FP3A 3NRXA 2CNTA 4EB6E 4IE5A 3E22E 4I4TE 2OA5A 5LHHB 2CWOA 2HUZA 3FRMA 3TFYA 5J2TE 1B6BA 2G3AA 5FXXA 5F8PA 2BUEA 4UWJA 4JD6A 1Z0PA 3M65A 3BJ7A 4U74A 2ACXA 4H9QC 2WMNA 2A4NA 2AJ6A 2YGWA 2VASA 4ZI2C 1S5KA 3LG7A 5L3BB 4KOWA 3GKRA 1KUVA 3RYOA 2Q9QC 1Q2DA 2E9XC 3E0KA 4OLLA 2DPSA 2SPCA 2Z3LA 2QGSA 4EIWA 3RX6A 4MFPA 2RP4A 4H9PC 4U9YA 4ISTA 3EC4A 5LBQB 1YR0A 1U5PA 1Z4RA 3N9QA 2K9AA 1LVKA 4BMHA 1D1CA 3I3GA 1NWMX 2IC6A 1IYLA 5L3EB 3MZKB 4NCZA 4MHCA 2XASB 5FVJA 1MMAA 1FMWA 2BZBA 1S3ZA 4DVDA 1B7TA 3LK3B 5LP6E 3LK2B 5IYZE 3RKOA 3IGRA 1YK3A 2K24A 3ETVA 2XTLA 2DWKA 3RYHE 1V9DA 1MJAA 4FJOA 4MFJA 1S7FA 5KMGP 1KK7A 1UCUA 3ZMZB 4AKLA 2LHNA 1IJ6A 3LBXA 2VKDA 3V5SA 4AXPA 4KUBA 5EBVA 5EK2A 3C50A 4EYYR 4KUMB 3O1IA 2KXPB 5HXHA 3N2GE 2XAQB 2WAUA 2R7HA 3BK9A 2LSKA 4BJNA 5C88A 1OZPA 1Z9UA 4EXTA 4M85A 3ZYMA 2WBLA 4O4JE 4XPKA 2A3DA 3CX7B 3GN5B 5LJMA 2Y0MA 4HKFA 3KKWA 2PQ8A 1ZO0A 4XNHC 3P8CD 5G21A 3AB3B 4BAYB 3EFAA 5H84A 4A31A 1MJ9A 2CWYA 2D0TA 2C0SA 2FIWA 5HXSA 3BQIA 3EO4A 5LBMA 4QUSA 3GA8A 4EZ4A 1XMTA 1IZNB 4P0BA 3DR6A 2W61A 3NRYA 3RYIE 4DBRA 2R98A 2N2NA 1FMVA 3VHLA 3KV5A 2Z3NA 4CXWA 4UV8B 3ZEFB 3K9UA 4OK0A 2BEIA 3JC6C 3GY9A 2VBQA 2V26A 4MBUA 2PC1A 5JH7E 4JXQA 4QWNB 3IF8B 3Q5XA 4PK6A 3H4QA 4HTEA 2V7MA 4ZI2D 1S7KA 5KTCA 4HNWB 2BVLA 4KOUA 1M44A 2E9XD 2JJ9A 3MACA 1MNEA 1HG5A 2C5JA 1Y9KA 4EAHA 3KBUA 4IF5A 4X5KA 5A27A 2DLRA 1QSRA 2EHOB 4CAWA 3QUJA 5ADXL 2LEHA 3KVBA 5JVDE 4IE0A 2OB0A 4KVXA 3N2KE 4I50E 2KT9A 3J7Yq 4NEXA 4AKIA 2Y48B 3NZPA 3PUAA 2ARHA 3RPUA 1NSLA 2XAJB 4R87A 1S35A 3WR7A 3EXNA 3C98B 2VKOA 1QSNA 1ON0A 1YLEA 4NSQA 4NUVA 5JDHA 3O9XA 2ZXVA 3PUSA 5DQWA 3D0TA 1X79A 3ZCJA 2YNCC 3TCVA 1YW0A 3VU7H 4UBRA 2Q0YA 5KDMC 2UXNB 1YGHA 4AVCA 2X66A 3I9YA 3AAAB 4X1IE 4Q38A 4GYRA 4TZ4C 3S6HA 4UFVA 2MTQA 1Q2YA 2PJQA 2CLYC 3VKGA 2L9QA 3GYAA 1IICA 2K5BB 4GYSA 2V7IA 1YVKA 1Y64B 3W15B 2L3LA 2G3TA 3U78A 2HV2A 2B1EA 5F47A 5H86A 2G0BA 2NW7A 3B57A 5JDQA 2YK0A 3HKBE 3UFEA 3SXOA 1B87A 2IW5B 1ZHCA 3ONXA 4JEUB 1MNDA 1TIQA 3AA7B 3IWEA 4JLYA 1T98A 2YNEA 5BWAB 1LVFA 4E7ZA 1Z4EA 2I79A 4UXNB 3AVRA 4JEHB 4KUAA 2A72A 3FB2A 4A32A 5JR9B 3RH3A 2XQYA 2A2FX 4CS0B 4KOVA 4A95A 5JQ4A 2XUEA 2PR1A 2LM9A 4PW8A 3WAJA 2X9WA 3F31A 2FXFA 2I59A 1MMDA 4HE8A 2V7LA 3CXSA 5G22A 2Y8DA 3P7IA 1K4JA 4PAGA 4CI1B 4NXYA 4IDZA 2UXXB 5C8YE 3AAIA 4QHOA 2DWGA 2Y6XA 3JC6D 2D2SA 4HFVA 1YKEB 1IIDA 1E1HB 4CGPA 1J4JA 1ZV4X 3MJXA 2WSSV 1D1BA 2E9XB 2FSRA 4AVBA 3CXQA 1G8XA 4ZOLE 4CGNA 5ETWA 4LUAA 1MMNA 3SXNA 3IU2A 3N9LA 1MMGA 4RS2A 4XPDB 3CQXC 2GE3A 4CAFA 3ZYKA 3TO9A 4CYQA 1YREA 1CUNA 4J3GA 2YNDA 3D8PA 4C2XA 1H7CA 2LT3A 5A28A 4HNYB 3UT5E 1L0CA 4YJ3E 5JDNA 4ZI7E 2Q4YA 4PK5A 3UULA 4ANJA 1XE4A 4KVME 3AA6B 4MFZA 4X1YE 4FD6A 2WMOA 4XZCA 4AQFA 5JQGE 4KOTA 2CNMA 5FXWA 5HAXA 2KNDA 4Z8XA 2PG8A 3GN5A 1M4DA 4IIJE 1PU9A 2EVNA 3FHNA 1VHSA 5AGEA 4FD5A 4AB7A 4M1PA 4TX5A 1ZKEA 4UCNA 2YEVC 2HH7A 3N2OA 4V1Av 3F5BA 4R9MA 1MJBA 1YD8G 2WSAA 2H3RA 5F49A 4OAEA 3QC9A 3DJBA 1WLXA 2OZHA 1NMTA 4YRHA 2ZMAA 4HGAA 3HA4A 4QB9A 2Z11A 2BL1A 2Z3KA 3TKLB 2MOZA 3OJAA 2X9XA 2J1DG 2OZGA 4BBHA 5M4YA 5AFUL 4ISSA 2J8RA 2FL4A 4UVBB 4AKRB 3SS1A 4ZI3C 5ISVA 3ETUA 4G63A 4L0RA 5LOVE 5L3GB 5E96A 5GCNA 4O2AE 5J8FA 2EHOD 3SHPA 3ZJ1A 5CNPA 4C68A 2KWIB 3O4XE 1HX8A 2Z3PA 2V7JA 1WK4A 4PV6A 3I0OA 3CKDA 3MXZA 5L3CB 4MFLA 4CXXA 2C5IT 2ZM2A 3EUHA 4DMVA 2JDDA 2GK9A 4KMCA 2C5KT 1P4NA 4R3KA 4QX7B 1KNZA 4TUYE 4C91A 3IHRA 3AAEB 1ZEEA 2WM9A 1VKCA 4PJLA 3NE7A 1QSMA 3FIXA 5KTDA 4ORFA 2XAFB 1QSDA 4O4HE 1V0CA 1XEBA 1S7LA 2LOPA 3DDDA 1HCIA 2D4PA 4ASKA 4UEMA 2K5TA 2PR8A 5DWNA 3KVAA 4KSFA 5H6QB 3PGPA 1KZFA 3SOLA 1SA0E 4ZGYB 1FEWA 5HXRA 1U6MA 3H37A 2D4OA 5G20A 2JLMA 5CA0E 4A56A 4DNCA 4MFRA 1WWZA 2ODVA 2J8NA 3CXPA 3V8IA 3BQKA 4B10A 2VEZA 2C27A 3N9NA 5F48A 1IB1E 4G2AA 5JR9A 4H9OC 4OHFA 2LOSA 5FMNA 2P6GA 3PE0A 4CYOA 2NP9A 3B8GA 2PDOA 2X9YA 2ZW6A 1S60A 5LGUB 4CRZB 4PJMA 3UUNA 3CMLA 5L2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F47 A;  5H86 A;  2G0B A;  2R8V A;  1I12 A;  4PK2 A;  4FD7 A;  3UY5 A;  3PP9 A;  2ZW5 A;  3W91 A;  3SXO A;  2AE6 A;  1B87 A;  1MK4 A;  3T9Y A;  1FY7 A;  2OH1 A;  4IUS A;  4H6Z A;  1TIQ A;  3FXE B;  4JLY A;  4PSW A;  4JWP A;  3R95 A;  2REF A;  3LOD A;  1LVF A;  2I79 A;  1Z4E A;  3C26 A;  2B4D B;  5DWM A;  2X7B A;  4KUA A;  5HH1 A;  2Z0Z A;  2MBG A;  4EVY A;  1XF8 A;  3ZZI A;  4AVA A;  4U9Z A;  5KTA A;  4CAV A;  2HQY A;  1CM0 A;  2DXQ A;  4CS0 B;  4MI4 A;  4KOV A;  5JPH A;  4H89 A;  5JQ4 A;  1GHE A;  1S7N A;  2PR1 A;  5F46 A;  4B5P A;  3FBU A;  2X9W A;  2B58 A;  2FXF A;  3FXD B;  4KOS A;  3CXS A;  3TO6 A;  2Z10 A;  2CNT A;  3P7I A;  1K4J A;  4J2C A;  1BO4 A;  4NXY A;  2R1I A;  2HUZ A;  3FRM A;  3S6F A;  4JXR A;  3D3S A;  3TFY A;  1BOB A;  1IID A;  1B6B A;  1J4J A;  5IX3 A;  2G3A A;  1SQH A;  2VI7 A;  4GS4 A;  3R9F A;  4KOY A;  2FSR A;  4RI1 A;  4AVB A;  3BLN A;  2BUE A;  3CXQ A;  1KUX A;  4M3S A;  4ZBG A;  4UWJ A;  4JD6 A;  1Z0P A;  2ATR A;  3BJ7 A;  4Y49 B;  3W6X A;  2EUI A;  1M4I A;  3TOB A;  4H6U A;  4LUA A;  4CRY B;  3SXN A;  4ONU A;  2A4N A;  2AJ6 A;  1S5K A;  4RS2 A;  4XPD B;  2IC9 A;  1IYK A;  2GE3 A;  3G8W A;  3JVN A;  4KOW A;  3GKR A;  1KUV A;  3RYO A;  3TO9 A;  1Q2D A;  4XPL A;  1YRE A;  4MHD A;  3TTH A;  3E0K A;  4OLL A;  5I0C A;  4J3G A;  4UA3 A;  1Y7R A;  4KVO E;  3D8P A;  1H7C A;  4HNY B;  1L0C A;  3CVR A;  3S6K A;  4KLW A;  4B5P B;  4FI5 A;  3JUW A;  2Q4Y A;  4U9Y A;  3EC4 A;  1XE4 A;  4JJX A;  1YR0 A;  2FT0 A;  1Z4R A;  3FB3 A;  2K48 A;  2PRB A;  1RO5 A;  2VXK A;  4BMH A;  4MY3 A;  4KVM E;  3R96 A;  1YVO A;  2FCK A;  2VZY A;  4YGO A;  2KCW A;  3FNC A;  3I3G A;  2IC6 A;  1IYL A;  4R3L A;  4FD6 A;  3F8K A;  2OU2 A;  4KOT A;  4KOR A;  2CNM A;  4NCZ A;  5FVJ A;  1S3Z A;  4B5O A;  2OZU A;  1M1D A;  2O28 A;  3F0A A;  2JEV A;  3IWG A;  2REE A;  1M4D A;  4QBJ A;  1PUA A;  2ZW7 A;  1PU9 A;  2EVN A;  3IGR A;  4KLV A;  1YK3 A;  1UFH A;  2XTL A;  1VHS A;  3D2M A;  5IV0 A;  4L89 A;  4FD5 A;  4AB7 A;  1LRZ A;  1MJA A;  5C82 A;  1ZKE A;  4F0Y A;  1P0H A;  1S7F A;  3LD2 A;  3F5B A;  3PZJ A;  4R9M A;  1MJB A;  3DNS A;  3T90 A;  5F49 A;  4OAE A;  2B3U A;  1IJ6 A;  2B4B A;  4KUB A;  1N71 A;  5EBV A;  2OZH A;  2QEC A;  2FS5 A;  1NMT A;  4YRH A;  4EYY R;  4QB9 A;  2I00 A;  2Z11 A;  2BL1 A;  4II9 A;  3G3S A;  4CQI A;  3TKL B;  4AG9 A;  3W6S A;  2WPW A;  2R7H A;  1Y9W A;  4F6A A;  2G0U A;  5C88 A;  1OZP A;  1NE9 A;  2IL4 A;  2FIA A;  2X9X A;  1Z9U A;  4M85 A;  4L8A A;  4AG7 A;  2OZG A;  2WPX A;  4XPK A;  3R9E A;  3P2H A;  3TT2 A;  2B3V A;  2Y0M A;  4HKF A;  4MJ8 A;  3KKW A;  2PQ8 A;  2J8R A;  4XNH C;  2FL4 A;  4U5Y A;  3QB8 A;  3EFA A;  5H84 A;  3MGD A;  5ISV A;  3DR8 A;  1MJ9 A;  2QIR A;  2GAN A;  4PK3 A;  3QK6 A;  4KOX A;  4L0R A;  4YFJ A;  1Q2C A;  5E96 A;  2FIW A;  3EO4 A;  5GCN A;  2H5M A;  4QVT A;  3ZJ0 A;  4QUS A;  5J8F A;  1XMT A;  2VQY A;  3DSB A;  3TOA A;  3DR6 A;  3SHP A;  2P6F A;  3R1K A;  5CNP A;  3FXT A;  2KWI B;  2R98 A;  5HMN A;  1WK4 A;  4PV6 A;  1RXT A;  3CKD A;  4K30 A;  5EC4 A;  3K9U A;  3MXZ A;  2BEI A;  3GY9 A;  2JDD A;  2C5I T;  2P6E A;  1R57 A;  2VBQ A;  4MBU A;  1M4G A;  3D2P A;  2PC1 A;  4JXQ A;  2C5K T;  2Q44 A;  4DND A;  4E8O A;  1KUY A;  2J8M A;  3H4Q A;  1P4N A;  4R3K A;  5J8C A;  1S7K A;  5KTC A;  4UWI A;  4HNW B;  4KOU A;  1M44 A;  2JDC A;  1I21 A;  1VKC A;  4R57 A;  3VWD A;  3NE7 A;  1QSM A;  1QST A;  4HNX B;  2C5J A;  2F5I A;  1Y9K A;  2B5G A;  4IF5 A;  2CY2 A;  4X5K A;  3FIX A;  1XIX A;  1QSR A;  5KTD A;  4CAW A;  3QUJ A;  4ORF A;  1QSD A;  3I9S A;  3EY5 A;  1CJW A;  3FYN A;  2OB0 A;  1YX0 A;  4KVX A;  2CNS A;  1V0C A;  4I49 A;  1XEB A;  1S7L A;  2P0W A;  3DDD A;  4NEX A;  2D4P A;  2K5T A;  2PR8 A;  5DWN A;  2ARH A;  3OWC A;  3PGP A;  2KWH A;  1IJ5 A;  3N5L A;  1KZF A;  4OAD A;  3QAH A;  3TO7 A;  1NSL A;  4XNH B;  4R87 A;  3WR7 A;  3EXN A;  1QSN A;  1ON0 A;  3S6G A;  1YLE A;  4NSQ A;  2CA5 A;  1U6M A;  2D4O A;  2JLM A;  1I1D A;  4DNC A;  2ZXV A;  1WWZ A;  2J8N A;  4MY0 A;  4B6X A;  3CXP A;  3V8I A;  2VZZ A;  2Q7B A;  4PSX A;  2PSW A;  2FE7 A;  5IB0 A;  3N7Z A;  3TCV A;  4UBR A;  2B4D A;  2VEZ A;  2Q0Y A;  2C27 A;  1YGH A;  4QC6 A;  3VWE A;  4AVC A;  5F48 A;  1IB1 E;  4NF1 A;  2BSW A;  3TE4 A;  2RC4 A;  3S6H A;  2B5G B;  4CAX A;  2P6G A;  4LX9 A;  2ZPA A;  1QSO A;  2NMT A;  4KZT A;  1Q2Y A;  3B8G A;  2GIV A;  2PDO A;  3GYA A;  2X9Y A;  2ZW6 A;  3P2F A;  1IIC A;  3S4U A;  3L3P A;  3BJ8 A;  4FD4 A;  4E2A A;  2ZW4 A;  4Y49 C;  1YVK A;  2QML A;  2Q04 A;  1S60 A;  4CRZ B;  2G3T A;  4E0A A;  3R9G A;  2HV2 A;  2Q4V A;  4XPD C; 
#chains in the Genus database with same CATH topology
 5LGT B;  3KFW X;  5FKY A;  2YDQ A;  3PUW F;  2UXC T;  4PXC A;  2R8V A;  4PK2 A;  3UY5 A;  3CPZ A;  2ZW5 A;  2WCA A;  3LFM A;  5LYJ E;  4XAX B;  2PJ8 A;  3W91 A;  2VQF T;  2XM1 A;  2NWB A;  4NGT A;  5THW A;  3B5M A;  3ZLI A;  1FY7 A;  4A38 A;  4OC3 A;  4IDP A;  2OH1 A;  3L09 A;  4WYV A;  2VUR A;  4IUS A;  5AQM B;  3UU6 A;  4H6Z A;  3PEI A;  2Q9Q D;  4UV9 B;  2W63 A;  5JM6 A;  1FNO A;  3SFE A;  2CE7 A;  4HWH A;  2ZEM A;  3C26 A;  4TWD A;  1YW4 A;  2B4D B;  5DWM A;  2LSJ A;  3PFO A;  4ZI3 D;  4UIG A;  2VVS A;  2W62 A;  2CRB A;  4GM5 A;  4HKA A;  3ZZI A;  4AVA A;  4AKG A;  2MPK A;  4HFC A;  4C2Z A;  2AE9 A;  2HQY A;  4CAV A;  2Z3O A;  5FXV A;  2NTX A;  2RA1 A;  2PCU A;  1S7N A;  4UVC B;  3I1A A;  4C7I A;  3IO1 A;  1G73 A;  5LJN A;  3CQG B;  3EAB A;  2BDE A;  4MHN A;  3QNU A;  2B58 A;  2PIZ A;  3ZJ2 A;  4KOS A;  4IRE A;  3RIF A;  2Z10 A;  4JI7 T;  2CPT A;  2O53 A;  1BO4 A;  1FJG T;  2YKS A;  1HF8 A;  2C6G A;  3S6F A;  5LG3 A;  4JXR A;  3WAK A;  5CBM A;  2WY2 A;  2ES0 A;  2XM2 A;  4JLE A;  3CK6 A;  3ZMU B;  4WBO A;  4KSA A;  3VH9 A;  2VI7 A;  4GS4 A;  3R9F A;  4KOY A;  3KL9 A;  4HFE A;  3BLN A;  2JMH A;  1KUX A;  3C64 A;  2AFX A;  4IE4 A;  3ZN0 B;  4X65 T;  2ATR A;  5FXZ A;  4Y49 B;  5G1Z A;  4YXD A;  1HNW T;  2EUI A;  3TOB A;  2YU1 A;  4CRY B;  2PFV A;  3JTK A;  5K8N A;  3KBT A;  4KBM B;  4FUU A;  4LF8 T;  3CX6 B;  1IYK A;  2IUB A;  2V8S V;  3PU3 A;  2VQE T;  4U72 A;  2ZLY A;  2M6I A;  4XPL A;  4MHD A;  3TTH A;  4YT0 A;  5AQL B;  1T8B A;  5I0C A;  3U3I A;  3KDS E;  4UA3 A;  4YLH A;  4JI3 T;  5FL1 A;  4KVO E;  2W4X A;  4HFI A;  4IHJ E;  4MFQ A;  1Y7E A;  4GIW A;  3AA1 B;  4AQF C;  3HLP A;  4OKO A;  3D66 A;  4KLW A;  4M6G A;  4B5P B;  2YU2 A;  2L8K A;  2LSY A;  3F2E A;  4H9N C;  3WC7 A;  5E0O A;  3PBB A;  5L4E A;  1HS7 A;  4IL4 A;  2W67 A;  2FT0 A;  3S9L A;  2XAG B;  3FB3 A;  2K48 A;  5LRG A;  5FY1 A;  2LKH A;  5AG7 A;  5LHG B;  2VXK A;  3LBX B;  4MCP A;  1YVO A;  2MAW A;  2FCK A;  2VZY A;  4YGO A;  3PBE A;  2KCW A;  2CXL A;  2K3W A;  5DAB A;  3H5Z A;  3C4W A;  2LE8 A;  3F8K A;  4NXN T;  3IEE A;  1J5E T;  5HWX A;  2OU2 A;  4P4F A;  4KOR A;  4NUU A;  4Z90 A;  3OKQ A;  3G06 A;  4KP3 C;  2JRK A;  3L39 A;  3F0A A;  5LCY A;  2WS3 A;  1CHU A;  2NTY A;  4F9U A;  3M3Z B;  5AG5 A;  1OED B;  1Z8T A;  3MKD A;  3T8O A;  3PB7 X;  1DTD A;  3ZN1 B;  4KLV A;  5JRE A;  1UFH A;  4MAL A;  3UU5 A;  2VK9 A;  4GXH A;  3B3C A;  1R3N A;  4A2Z A;  5IV0 A;  5ABG A;  2VKH A;  4L89 A;  5JH9 A;  3AEC A;  3PB8 X;  4C2Y A;  3V38 A;  2GLJ A;  4F0Y A;  4JYA T;  2AFM A;  3T8W A;  1P0H A;  3LD2 A;  4OYK A;  2BKP A;  3PZJ A;  3RC3 A;  1NSA A;  5DQV A;  4OIW A;  3DNS A;  3AE5 A;  5FYM A;  4EYU A;  5AG4 A;  3T90 A;  3QB5 K;  5JRC B;  4H2K A;  3HI2 A;  4OP4 A;  2B76 A;  4Q36 A;  2B3U A;  3CWZ B;  2B4B A;  3K8P C;  2CBI A;  3S9M A;  1BLL E;  3ZSS A;  2D9D A;  1IGB A;  2FS5 A;  3I0Q A;  4X1K E;  2Q9Q B;  3KV6 A;  2DNX A;  2I00 A;  4XBF B;  4II9 A;  5ABF A;  4N78 D;  5JDM A;  3R6N A;  5HXD A;  4AG9 A;  4B12 A;  1ZG9 A;  1Y9W A;  4F6A A;  2CMR A;  2Z6E A;  1NE9 A;  4ZHQ E;  3PU8 A;  4A97 A;  2FJA A;  4L8A A;  4ZX8 A;  3I9W A;  4PFP A;  4LMJ A;  2RB7 A;  3PB4 X;  1LAP A;  1R43 A;  4ONW A;  3P2H A;  3TT2 A;  5J2U E;  4ILA A;  4EWT A;  1Z8L A;  1F2P A;  4MJ8 A;  1WYC A;  1AMP A;  3AE8 A;  5LA6 E;  4C7H A;  4U5Y A;  3IA3 A;  2I3C A;  2WP9 A;  1XWM A;  4O8S A;  3MGD A;  5AQG B;  4TV8 E;  4MMO A;  2ODU A;  3N9O A;  2GAN A;  4PK3 A;  2BG9 A;  3LMS A;  2KMF A;  4NFR A;  5HVF A;  1XBU A;  4A39 A;  2H5M A;  1ZLH A;  1IY7 A;  1CPX A;  8CPA A;  2CCQ A;  2VQY A;  5J0Z A;  3O1H A;  4B13 A;  4H63 H;  1YKH B;  4DR1 T;  2LM2 A;  4YTM A;  2PRQ A;  1GYT A;  3FXT A;  4X64 T;  5AG6 A;  4U3C A;  5HMN A;  4PXB A;  3AEF A;  4ILU A;  5J1Q A;  1RXT A;  5EC4 A;  1D0Y A;  2XY8 B;  2YN6 A;  2IMO A;  5ELY A;  2P6E A;  4LF9 T;  1M4G A;  3NA6 A;  4PXE A;  3FZM B;  3HR0 A;  2ZEE A;  3WT4 A;  4H9R C;  3PDY A;  3IWW A;  4E8O A;  2Q44 A;  4DND A;  3WC5 A;  3KI9 A;  1KEY A;  4OC4 A;  3ZPO A;  3AEG A;  4ADZ A;  2DEA A;  2G9D A;  4AI6 A;  2ZM0 A;  2O4H A;  4P4B A;  2KIN B;  4EZH A;  1BPN A;  1YQE A;  1BR1 A;  2JDC A;  2I0M A;  3IU1 A;  4HNX B;  2F5I A;  3B2Y A;  1CG2 A;  2BG9 E;  2CY2 A;  2FJE A;  4NIQ A;  1XIX A;  1NAF A;  3D68 A;  4CGL A;  4EOZ B;  2QJ8 A;  3TLS A;  3AA0 B;  3I9S A;  4E7S A;  3EY5 A;  3FYN A;  2UUB T;  4DJL A;  3X1D A;  2XQ6 A;  4QXH B;  2XHE B;  2CNS A;  4I49 A;  3S9N A;  2PVV A;  2V7K A;  5L3F B;  4MHP A;  1BAV A;  4DUK A;  4ZY1 A;  2P0W A;  2WU5 A;  3RAM A;  3VR9 A;  3EAM A;  2HN2 A;  4QH1 A;  1WRD A;  1VIX A;  4L9I A;  3UUX B;  4O4I E;  3FEC A;  3PUQ A;  4HEA A;  1IJ5 A;  4OAD A;  4NGN A;  3TO7 A;  1S94 A;  4PK4 A;  3RI5 A;  4XNH B;  3EVY A;  3S6G A;  5JR9 C;  2GRE A;  4MRI A;  4FWU A;  4WBN E;  1I1D A;  3MK7 C;  3RHW A;  5HVG A;  5L3D B;  5CPA A;  3K9T A;  4MFK A;  4MXU A;  4P4E A;  2CEA A;  4CYN A;  4MY0 A;  2E5V A;  3GMI A;  4PSX A;  2FE7 A;  5IB0 A;  4YWY A;  3C4Z A;  4QX8 B;  3FX6 A;  2B4D A;  2WB5 A;  2EHO A;  2Z3M A;  2EK8 A;  3VWE A;  3D4U A;  4JI1 T;  3HKC E;  4NF1 A;  2C6P A;  1MIW A;  3LSV A;  3DGV A;  3TE4 A;  2B5G B;  4CAX A;  1D1A A;  1QQ9 A;  3ANW B;  2X68 A;  2IIU A;  1VCS A;  2ZPA A;  4NGQ A;  4IGU A;  4BJM A;  3JCF A;  2X0Y A;  3ZC0 A;  1QSO A;  3ZST A;  2NMT A;  4KZT A;  5FY0 A;  3P2F A;  4UEF A;  3S4U A;  3L3P A;  4FD4 A;  4NGR A;  2ZW4 A;  3PUX F;  4GOU A;  2KLQ A;  4O2B E;  1FIO A;  4YHJ A;  3RRC A;  3PUR A;  1VRB A;  4YY3 T;  2R6G F;  4UF0 B;  3SJG A;  4XPD C;  2GLF A;  2BKO A;  4YJ2 E;  3VKH A;  4JI2 T;  1I12 A;  4FD7 A;  1ZP0 A;  3PUG A;  2CF4 A;  3FED A;  5TAO A;  3PP9 A;  1YQ3 A;  4F8Z A;  3C51 A;  3FEE A;  4ZZC A;  1MK4 A;  1E2A A;  2LRK A;  2ZEH A;  1BR0 A;  5HYA A;  1YSJ A;  3V5U A;  2PJ3 A;  4CYP A;  3RO0 A;  4CN6 A;  5LNK A;  1E7P A;  4JZ0 A;  2E5L T;  4MLK A;  4DO0 A;  4OID A;  1QLB A;  4BA9 A;  5EK3 A;  2NW9 A;  3HKD E;  3R95 A;  2REF A;  3LOD A;  3FZL B;  4ZXL A;  4P4D A;  2CXD A;  4B3M T;  2Q43 A;  2JBJ A;  2OR4 A;  2ZM8 A;  4IE6 A;  2Z0Z A;  4HN9 A;  4CZZ B;  3P4S A;  3K3Q C;  4DV1 T;  5KTA A;  5HWY A;  3HUV A;  2DI4 A;  4AKH A;  2DXQ A;  5LG4 A;  4H89 A;  4PJJ A;  5GON E;  1A2Z A;  1VCT A;  4B5P A;  3TLU A;  2WDV A;  3I1U A;  1LKX A;  2QA7 A;  3BI1 A;  3TO6 A;  5IHY A;  2DCF A;  3D7D A;  2Q51 A;  6CPA A;  2POK A;  3FZH B;  4J2C A;  2DPT A;  2R1I A;  2HPL A;  2HB6 A;  1LAN A;  3WI3 A;  3OYX A;  3J9X 1;  4EEB A;  1EZ3 A;  3NBX X;  3D3S A;  1M7K A;  2HHH T;  1BOB A;  3SFD A;  1X9B A;  3EI0 A;  3QAY A;  5IX3 A;  2YIN A;  4DMW A;  5EK4 A;  4PJN A;  5DJQ C;  1SQH A;  3CZX A;  1WFD A;  2VWA A;  3JAE A;  4RI1 A;  2CLY B;  2V8G A;  4AXV A;  1XDO A;  4M3S A;  4ZBG A;  4C90 A;  1U4Q A;  3E08 A;  2Q7S A;  3ZMV B;  3W6X A;  3FZK B;  1OXZ A;  3B3W A;  1M4I A;  4H6U A;  3HL6 A;  4X8I A;  4ONU A;  1OED A;  2KZ7 B;  2IC9 A;  2CM0 A;  3AE6 A;  3G8W A;  3JVN A;  2PJ0 A;  3NH5 A;  3AE4 A;  3A8Y C;  1WR6 A;  1D0X A;  3Q9D A;  1N34 T;  1Y7R A;  2JQQ A;  4NJQ A;  2NW8 A;  5AQS B;  1QUU A;  5H6R B;  4OFZ A;  2OV9 A;  4CGM A;  4R6T A;  2X67 A;  3CVR A;  1ZOY A;  3S6K A;  4FI5 A;  5JRC A;  4A5X A;  3JUW A;  4UEE A;  3H3A A;  1ELL P;  3LK4 2;  4JJX A;  2PJ6 A;  4UVA B;  3UFG A;  4LML A;  1XMQ T;  2PRB A;  2Q9Q A;  2VL8 A;  1RO5 A;  2PJ2 A;  4MY3 A;  3SRZ A;  2E9X A;  5AQO B;  3R96 A;  2XAH B;  1JQG A;  3FNC A;  4P0A A;  3RNZ A;  4B14 A;  4F0X A;  4R3L A;  4UCM A;  4CPA A;  3O1J A;  5LGN B;  2PJA A;  1XMO T;  5AQT B;  3PTR B;  1LAM A;  4GKK T;  4FAI A;  1NEK A;  4AQG A;  2H7O A;  1OED E;  3P4R A;  1Y0Y A;  2OLT A;  4B5O A;  3OBV E;  5JTG A;  4ERR A;  1M1D A;  2OZU A;  2O28 A;  3OYZ A;  3IWG A;  2JEV A;  1XZY A;  4DV3 T;  3ZMT B;  2LKG A;  2DHR A;  2REE A;  2XSB A;  4H9S E;  2ZOG A;  4QBJ A;  1PUA A;  1XRY A;  3DTO A;  2ZW7 A;  4MHY A;  2W00 A;  4ZS2 A;  4RUH A;  5EZY E;  3AXJ A;  3D2M A;  3RQW A;  4PNI A;  1LRZ A;  4KX6 A;  4DR3 T;  3PFE A;  4M6I A;  5FY7 A;  5C82 A;  2NOX A;  2QYW A;  5LYL A;  1DU2 A;  2VL0 A;  3A5X A;  4A30 A;  2OOT A;  3RLF F;  3NFZ A;  1UX5 A;  4UEL A;  4X20 E;  4JBW F;  3RF1 A;  2W0G A;  4CN1 A;  3FZF B;  2H88 A;  2D0U A;  4U7Y A;  1N71 A;  2N9D A;  3QOF A;  3ONL C;  2QEC A;  1MIV A;  1US7 B;  4DV0 T;  2V8H A;  2AFU A;  4LQG A;  3H3M A;  2V1D B;  3ISZ A;  4AQY T;  3G3S A;  2IHR 1;  4CN4 A;  4CI3 B;  3N9P A;  3AE1 A;  4CQI A;  4QKN A;  4HWD A;  2BG9 C;  3K3N A;  1SHZ C;  4B3S T;  2LSI A;  3W6S A;  4YFS A;  2PJ7 A;  2YDS A;  2WPW A;  4O4L E;  2A9U A;  4JI6 T;  2PJ5 A;  2CXF A;  2G0U A;  3AE3 A;  5HCM A;  2IL4 A;  2FIA A;  3BQL A;  3ISX A;  4AG7 A;  2NSM A;  2WPX A;  3R9E A;  4F6R C;  3ZCI A;  4MBQ A;  2B3V A;  3KV9 A;  4O23 A;  1UK5 A;  2E2A A;  5LRK A;  3H8F A;  2JMK A;  4ZZB A;  2BS2 A;  3QB8 A;  4GK5 E;  1LFW A;  5JDG A;  2PBI A;  2IDO B;  3DR8 A;  3KQZ A;  2QIR A;  3K2K A;  4ZY0 A;  3QK6 A;  3RRW A;  4KOX A;  4YFJ A;  1R8I A;  2UUA T;  4LFC T;  4CI2 B;  1Q2C A;  5CA1 E;  4P09 A;  4QVT A;  2D5U A;  3ZJ0 A;  4QXC B;  3B3T A;  1IOF A;  4JUY A;  4JI5 T;  3LJC A;  1HNZ T;  3DSB A;  3TOA A;  3NZQ A;  2XZE A;  2P6F A;  4OC5 A;  1D0Z A;  3AVS A;  4DR6 T;  1MIY A;  3R1K A;  3KV4 A;  3Q2M A;  4DBQ A;  2CXA A;  5HXE A;  4GK0 E;  1BR2 A;  1HX1 B;  2MYS A;  4H63 V;  2W66 A;  2ODF A;  4K30 A;  5AQR B;  2XJ7 A;  2VKJ A;  1R57 A;  4I55 E;  3E0Z A;  4X3R A;  1BR4 A;  3D2P A;  4WJB A;  4WW0 A;  1KUY A;  1VHO A;  2LHR A;  2M67 A;  2J8M A;  3UQ7 A;  1UX4 A;  4IE7 A;  1AJ3 A;  3B3S A;  4PXD A;  1WYB A;  5J8C A;  5CB4 E;  4MCR A;  2E8I A;  4UFW A;  4UWI A;  3F57 A;  4TWE A;  5FNV E;  3B35 A;  5AQQ B;  1I21 A;  4R57 A;  3VWD A;  3IBP A;  1F57 A;  5HXC A;  1QST A;  4LFB T;  5K8P A;  1HDQ A;  4ZS3 A;  1M4L A;  4UR9 A;  2B5G A;  3VAR A;  3ANW A;  1UGO A;  3RIU A;  4LF7 T;  1NEN A;  1X12 A;  3D7F A;  3L8R A;  1CJW A;  1PYT B;  2H7V C;  3PB9 X;  1YX0 A;  4HWC A;  5DS0 A;  1CBX A;  4OYJ A;  3CX8 B;  2WUU A;  3AEA A;  4M6H A;  3RYC E;  1HFA A;  4UF0 A;  4B11 A;  1WCR A;  3R84 B;  3OWC A;  4KS9 A;  2KWH A;  2CHN A;  3N5L A;  5JDF A;  4A33 A;  5J1G A;  2EHO C;  3QAH A;  4QXB B;  3EDU A;  2JQK A;  4WNK A;  5BMV E;  4I43 B;  4CAE A;  1HG2 A;  2CA5 A;  5ABE A;  2LJL A;  4UCP A;  4YU9 A;  3FBZ A;  3EDV A;  4CGO A;  3PJA A;  4B6X A;  5BR8 T;  2BBH A;  2VZZ A;  2Q7B A;  2PSW A;  5F3J A;  3SI2 A;  1HTJ F;  3UU4 A;  3N7Z A;  3FMC A;  2XQ5 A;  3VRB A;  3DP7 A;  4K0U A;  1KWM A;  5LRJ A;  3KAS A;  4QC6 A;  2J4G A;  5FVL A;  3UU3 A;  3EHZ A;  2JPF A;  1Z8W A;  2PJ9 A;  3ESL A;  1CP6 A;  2BSW A;  4P10 A;  4EGW A;  3RYF E;  3UU8 A;  2RC4 A;  1FT7 A;  1OWA A;  1TF9 A;  4LX9 A;  3KHX A;  4YSX A;  4P44 A;  5JDL A;  2GIV A;  3SWH A;  1RTQ A;  2IAK A;  4LMK A;  1ARM A;  2X9H A;  3BJ8 A;  4E2A A;  4UFX A;  4Y49 C;  2YNC A;  2BKN A;  2QML A;  3P4Q A;  2Q04 A;  4FBE A;  1N32 T;  2P9B A;  3KHZ A;  4E0A A;  3RC8 A;  5IB9 A;  3MA9 A;  3R9G A;  3SJE A;  4TV9 E;  2Q4V A;  5LHI B;  2HN1 A;  4UIA A;  4HFD A;  1Z8U A;  3C4X A;  4UIB A;  3ZYL A;  3CQC B;  3JAF A;  3AED A;  2AE6 A;  4TN7 B;  3UUM A;  2HC9 A;  3KIN B;  3B13 A;  3FBL A;  3T9Y A;  4CXY A;  1VOM A;  4F8H A;  2WWU A;  2BVM A;  3K3O A;  1IAP A;  3MN8 A;  3FXE B;  2ZEO A;  3TLV A;  2F4V T;  4PSW A;  4R8F A;  1YLO A;  4JWP A;  1O3X A;  2VB6 A;  3JRU A;  3HKE E;  3UTK A;  5A1L A;  2LSG A;  3ZMS B;  4L5G A;  2X7B A;  5HH1 A;  3NH4 A;  2FUP A;  3AEB A;  3A9L A;  4PFO A;  4IAV A;  2MBG A;  4EVY A;  1XF8 A;  2WZN A;  4U9Z A;  4IDO A;  4DV5 T;  4A37 A;  1LCP A;  3ZC1 A;  1CM0 A;  4MI4 A;  5JPH A;  2I6H A;  2X51 A;  4OME A;  5KX5 E;  1GHE A;  3AE9 A;  5F46 A;  3GWH A;  3FBU A;  2X0L B;  1J1J A;  2HPJ A;  1JNR A;  3N9M A;  5LXT E;  3FXD B;  2UXD T;  2N1G A;  3Q5W A;  2ZM6 T;  5FP3 A;  4JI0 T;  4Q7A A;  3NRX A;  2RPA A;  4U2Z A;  4EB6 E;  1OED C;  4IE5 A;  2CNT A;  3E22 E;  4I4T E;  2UXB T;  2OA5 A;  1N33 T;  2XEJ A;  3FVL A;  5LHH B;  2CWO A;  2HUZ A;  3FRM A;  3KGQ A;  3LDQ B;  2LRL A;  3TFY A;  5J2T E;  5HEU A;  1B6B A;  3IC1 A;  3CPX A;  2G3A A;  3QNV A;  3H8E A;  5FXX A;  2ABZ A;  1CP7 A;  2XQ3 A;  4LQ6 A;  5LYI A;  4YSZ A;  5F8P A;  2BUE A;  4UWJ A;  4JD6 A;  1Z0P A;  3M65 A;  3BJ7 A;  3T1Y T;  3IEH A;  4U74 A;  2XQA A;  2ACX A;  2AFZ A;  4H9Q C;  2WMN A;  2A4N A;  3TX8 A;  2AJ6 A;  2YGW A;  2VAS A;  4ZI2 C;  1S5K A;  3LG7 A;  4NPP A;  5L3B B;  4DV6 T;  4KOW A;  3GKR A;  1KUV A;  3RYO A;  2FJD A;  2Q9Q C;  1KF6 A;  4EV6 A;  1Q2D A;  2E9X C;  3GB0 A;  1Y0R A;  3E0K A;  2DPS A;  4OLL A;  5FVK A;  3SI1 A;  3BXM A;  2SPC A;  2Z3L A;  1N36 T;  2QGS A;  2V5D A;  2PVW A;  1PCA A;  4EIW A;  3RX6 A;  2PJ4 A;  4ZEY A;  4MFP A;  2RP4 A;  1IU8 A;  3WAB A;  4H9P C;  4P45 A;  4U9Y A;  2QVA A;  2AFS A;  2ZOF A;  2AFW A;  3PUZ F;  4MCQ A;  4IST A;  3EC4 A;  5LBQ B;  1YR0 A;  1U5P A;  1Z4R A;  3N9Q A;  2K9A A;  2PJB A;  1LVK A;  1GQE A;  4BMH A;  1D1C A;  2FJB A;  4NGM A;  3I3G A;  2CTC A;  2WQY A;  1NWM X;  2IC6 A;  2PIY A;  2CTB A;  1IYL A;  5L3E B;  1XFO A;  1Z5R A;  3MZK B;  4OX9 T;  1W0B A;  4NCZ A;  4MHC A;  2XAS B;  2AXD S;  3PRT A;  5FVJ A;  1MMA A;  2VL1 A;  1FMW A;  2BZB A;  1S3Z A;  4DVD A;  1B7T A;  4AIS A;  3LK3 B;  5LP6 E;  1HDU A;  1CPS A;  3LK2 B;  4TWH A;  5IYZ E;  5AQI B;  3RKO A;  4DR4 T;  1XDP A;  3IGR A;  1YK3 A;  3UQ4 A;  2K24 A;  3ETV A;  2XTL A;  3PJA J;  2DWK A;  2F7V A;  2XEI A;  3N5F A;  3NH8 A;  3RYH E;  1V9D A;  1MJA A;  4FJO A;  4MFJ A;  4ILC A;  4RN7 A;  1S7F A;  5KMG P;  1HNX T;  4DV7 T;  2JQ9 A;  1KK7 A;  2BG9 B;  1YME A;  1UCU A;  3ZMZ B;  4AKL A;  2LHN A;  1IJ6 A;  3LBX A;  2VKD A;  3V5S A;  4AXP A;  4KUB A;  4W9Y A;  5HEJ A;  5CGM A;  5EBV A;  3CIR A;  4B3R T;  5EK2 A;  4P1N A;  3C50 A;  4EYY R;  4KUM B;  3O1I A;  2KXP B;  4B6Z A;  4DYO A;  4GKJ T;  5HXH A;  5ABH A;  2RFH A;  3N2G E;  1TXR A;  4R7M A;  2XAQ B;  2WAU A;  4K0K T;  2R7H A;  2NYQ A;  3BK9 A;  2LSK A;  4BJN A;  5C88 A;  1OZP A;  2WDR A;  3VR8 A;  1Z9U A;  5D8N A;  4EXT A;  4M85 A;  5AQF B;  1QMU A;  3ZYM A;  5HVH A;  5K8O A;  1UUS A;  1KNP A;  5L4H A;  4R76 A;  2WBL A;  4O4J E;  4XPK A;  2A3D A;  3CX7 B;  3GN5 B;  5LJM A;  4MCS A;  4DR5 T;  2Y0M A;  4HKF A;  3KKW A;  4X62 T;  1M62 A;  2PQ8 A;  2YOE A;  1ZO0 A;  4XNH C;  3P8C D;  5G21 A;  3AB3 B;  1T7S A;  4BAY B;  4UEZ A;  5LMU T;  5HEH A;  1HEE A;  3EFA A;  5H84 A;  4A31 A;  1MJ9 A;  2CWY A;  2D0T A;  3CDX A;  1TKJ A;  2C0S A;  3WC6 A;  4QH5 A;  5LYF A;  2FIW A;  5F5W A;  3BQI A;  5HXS A;  3EO4 A;  1YXR A;  5FL0 A;  5LBM A;  4QUS A;  1Q7L A;  4COF A;  3GA8 A;  4EZ4 A;  1XMT A;  5JGF A;  1IZN B;  3OTO T;  2J62 A;  4P0B A;  3DR6 A;  2W61 A;  2KSR A;  4LF6 T;  3NRY A;  3RYI E;  5HCJ A;  4DBR A;  2N2N A;  2R98 A;  1FMV A;  3VHL A;  3CPA A;  3KV5 A;  3T1H T;  2Z3N A;  4CXW A;  4TNW A;  4UV8 B;  3ZEF B;  3K9U A;  4OK0 A;  2BEI A;  4HFH A;  3JC6 C;  2WZI A;  3GY9 A;  3RIU C;  3FJU A;  2VBQ A;  2V26 A;  4MBU A;  3AEE A;  2PC1 A;  1Y01 A;  5JH7 E;  4QWN B;  4JXQ A;  3IF8 B;  1YQ4 A;  3VRA A;  3Q5X A;  1F2O A;  2IJZ A;  4PK6 A;  3H4Q A;  4HTE A;  2V7M A;  2C1C A;  4ZI2 D;  1S7K A;  5KTC A;  5K8M A;  5IUX A;  4HNW B;  2BVL A;  4KOU A;  1M44 A;  4K3N A;  2E9X D;  3GUX A;  2JJ9 A;  3MAC A;  1MNE A;  1HG5 A;  2C5J A;  1Y9K A;  4PPZ A;  4EAH A;  2XQ8 A;  2C6C A;  3LWU A;  3KBU A;  2QRX A;  4IF5 A;  4X5K A;  5A27 A;  2DLR A;  1QSR A;  2EHO B;  2XEG A;  4CAW A;  3QUJ A;  5ADX L;  1YW6 A;  2LEH A;  3KVB A;  5JVD E;  4IE0 A;  2M6B A;  2OB0 A;  4KVX A;  3N2K E;  4I50 E;  5AQP B;  2V6Y B;  4IT4 A;  1L0V A;  1HR0 T;  5HEO A;  2KT9 A;  3J7Y q;  4NEX A;  4AKI A;  2Y48 B;  3NZP A;  3PUA A;  1UUR A;  1TKF A;  3NVO A;  3P4P A;  2ARH A;  2XSA A;  3RPU A;  2IML A;  2LLY A;  5AQV B;  1JNZ A;  4B3T T;  1NSL A;  2XAJ B;  4R87 A;  1S35 A;  3WR7 A;  3EXN A;  3C98 B;  2VKO A;  1QSN A;  1ON0 A;  2BS3 A;  1YLE A;  4NSQ A;  4NUV A;  5JDH A;  5EMI A;  4NGS A;  3O9X A;  2UUC T;  2PJ1 A;  2ZXV A;  1UWY A;  3PUS A;  2PE3 A;  5DQW A;  3D0T A;  1X79 A;  1ZG7 A;  1H8L A;  3GIU A;  3ZCJ A;  4U33 A;  2YNC C;  3TCV A;  1YW0 A;  3VU7 H;  3Q5D A;  2ZED A;  2EO8 A;  4X2T A;  4UBR A;  3IFE A;  2Q0Y A;  5KDM C;  2UXN B;  1YGH A;  2J47 A;  4AVC A;  4TNU A;  2ZEL A;  2X66 A;  3I9Y A;  3AAA B;  4X1I E;  4Q38 A;  4GYR A;  4TZ4 C;  3S6H A;  4UFV A;  2WDQ A;  4AIU A;  2MTQ A;  1Q2Y A;  2PJQ A;  2CLY C;  3VKG A;  2L9Q A;  3GYA A;  1IIC A;  2K5B B;  4ILB A;  4GYS A;  2V7I A;  1YVK A;  1Y64 B;  3W15 B;  5C2T A;  2V8D A;  2L3L A;  3MRU A;  4BD9 A;  4Z91 A;  3UUB A;  3U78 A;  2G3T A;  3KZW A;  2HV2 A;  3KR4 A;  2ZEF A;  1JWQ A;  2PTF A;  2B1E A;  2PJC A;  5F47 A;  5H86 A;  4BIN A;  2G0B A;  5LB7 B;  2NW7 A;  3B57 A;  1IBK T;  2X0H A;  5JDQ A;  2YK0 A;  3HKB E;  3UFE A;  3SXO A;  1XJO A;  1B87 A;  4A98 A;  2IW5 B;  5D29 A;  2XPK A;  5I4M A;  4DUZ T;  1ZHC A;  3ONX A;  4KHP T;  2ACZ A;  3JAD A;  4JEU B;  1MND A;  4YTN A;  1TIQ A;  3AA7 B;  2WU2 A;  5C3J A;  3IWE A;  4JLY A;  1T98 A;  3GLJ A;  2YNE A;  5BWA B;  3TLW A;  3NWI A;  1LVF A;  4E7Z A;  1Z4E A;  2I79 A;  2JQH A;  4UXN B;  3AVR A;  3A7M A;  5LYD A;  4JEH B;  4KUA A;  5CJ5 A;  2A72 A;  3H8G A;  3FB2 A;  4IDN A;  2JBK A;  4A32 A;  5JR9 B;  3RH3 A;  1XNQ T;  3ABV A;  3TC8 A;  2XQY A;  3IJ3 A;  2A2F X;  4CS0 B;  1TKH A;  3FH4 A;  4KOV A;  4A95 A;  5JQ4 A;  2IQ6 A;  2XUE A;  2WZH A;  2DL1 A;  1ELM P;  2PR1 A;  1W9R A;  4TWF A;  3OPC A;  4JI8 T;  2LM9 A;  4PW8 A;  3WAJ A;  3ZT7 A;  2X9W A;  3RGL A;  3F31 A;  2FXF A;  2I59 A;  1MMD A;  4HE8 A;  2V7L A;  3CXS A;  4WZX A;  3ONJ A;  2BO9 A;  5G22 A;  2Y8D A;  3P7I A;  1K4J A;  4PAG A;  1J5W A;  4CI1 B;  4NXY A;  4IDZ A;  2UXX B;  5C8Y E;  3AAI A;  4QHO A;  2DWG A;  2Y6X A;  3JC6 D;  2D2S A;  4HFV A;  1I6Z A;  1YKE B;  1IID A;  1E1H B;  4CGP A;  1J4J A;  1ZV4 X;  3RBU A;  3MJX A;  4LFA T;  2WSS V;  1D1B A;  2V77 A;  2E9X B;  4KHZ F;  2FSR A;  4AVB A;  3CXQ A;  1G8X A;  5KXJ A;  4YTP A;  4ZOL E;  4CGN A;  5ETW A;  7CPA A;  4LUA A;  1MMN A;  3SXN A;  3IU2 A;  2FVG A;  4JYW A;  3N9L A;  1MMG A;  4QH4 A;  1AYE A;  4RS2 A;  4XPD B;  4Z65 A;  3CQX C;  2GE3 A;  4A94 A;  2J9A A;  4CAF A;  4IL9 A;  3PUY F;  3ZYK A;  3TO9 A;  4CYQ A;  1T72 A;  3PUV F;  1YRE A;  3D7H A;  4OC1 A;  4KSI A;  1CUN A;  4J3G A;  4P6Y A;  1ARL A;  2YND A;  3AXJ B;  3D8P A;  4C2X A;  1H7C A;  2H89 A;  2GU2 A;  2LT3 A;  5A28 A;  2BBJ A;  4HNY B;  1OBR A;  3UT5 E;  1L0C A;  3K1S A;  4YJ3 E;  5JDN A;  4ZI7 E;  2Q4Y A;  2V6X A;  4P4J A;  2W2U A;  2ZEN A;  4PK5 A;  3UUL A;  4ANJ A;  1XE4 A;  4OC0 A;  1VGY A;  3ZKR A;  2EWB A;  3P50 A;  3KQX A;  4KVM E;  1Z2L A;  3AA6 B;  4JV5 T;  4MFZ A;  4X1Y E;  1ZLI A;  4FD6 A;  3B7I A;  2WMO A;  4XZC A;  4AQF A;  5JQG E;  3B3V A;  1VHE A;  4KOT A;  2CNM A;  2CHO A;  5FXW A;  3RKG A;  1LOK A;  3OVU A;  5HAX A;  2KND A;  2V5C A;  4Z8X A;  2PG8 A;  3GN5 A;  2CBJ A;  1M4D A;  4IIJ E;  3RQU A;  2NR4 A;  4PQA A;  1PU9 A;  4LF4 T;  2EVN A;  3FHN A;  1VHS A;  5AGE A;  4FD5 A;  4AB7 A;  4M1P A;  3SJF A;  4TX5 A;  2DF5 A;  1ZKE A;  4YHH T;  3IIB A;  4UCN A;  2YEV C;  4HPS A;  2HH7 A;  2GFQ A;  3N2O A;  1AUG A;  4I0U A;  1W09 A;  4V1A v;  3F5B A;  4R9M A;  1MJB A;  1YD8 G;  1Z8X A;  3VAT A;  4KI0 F;  2WSA A;  2H3R A;  5F49 A;  4OAE A;  1BPM A;  3QC9 A;  2V8V A;  2Q4Z A;  3DJB A;  2YDR A;  1KFY A;  1EE3 P;  1WLX A;  1WR0 A;  4NXM T;  3TLT A;  2OZH A;  4X66 T;  4ZYQ A;  1NMT A;  4YRH A;  2ZMA A;  4HGA A;  3HA4 A;  1W0A A;  4QB9 A;  2Z11 A;  2BL1 A;  4HFB A;  4UF4 A;  2XEF A;  2Z3K A;  3TKL B;  2MOZ A;  5AQJ B;  2BS4 A;  3OJA A;  3SI0 A;  4Q25 A;  2X9X A;  2J1D G;  1CX8 A;  3V7Z A;  3RIA A;  2OZG A;  4MHZ A;  4G1P A;  4X5T A;  4DV4 T;  2EBJ A;  4BBH A;  5M4Y A;  5AFU L;  3NKZ A;  4ISS A;  1ZG8 A;  2J8R A;  4ZY2 A;  2FL4 A;  2XQ4 A;  4UVB B;  4AKR B;  3SS1 A;  4ZI3 C;  4EFD A;  5ISV A;  3ETU A;  3L2N A;  4G63 A;  2UU9 T;  4L0R A;  5LOV E;  5L3G B;  5E96 A;  4U2Y A;  5GCN A;  2V6Y A;  4O2A E;  5J8F A;  2EHO D;  2XQ9 A;  3RZA A;  4YSY A;  3SHP A;  3AE7 A;  3ZJ1 A;  5CNP A;  4IHM A;  1IBL T;  4C68 A;  2KWI B;  2QVP A;  3O4X E;  1IOI A;  1HX8 A;  2Z3P A;  2V7J A;  1WK4 A;  4PV6 A;  3I0O A;  4HWF A;  5AQK B;  3CKD A;  3MXZ A;  3AE2 A;  2BOA A;  5L3C B;  2VVN A;  4HWI B;  5ABF B;  4MFL A;  4ZI6 A;  1I94 T;  4CXX A;  2C5I T;  2ZM2 A;  3EUH A;  4DMV A;  2JDD A;  4DR7 T;  2GK9 A;  4F9V A;  4KMC A;  5LMN T;  2C5K T;  3P4W A;  3QB5 A;  5AQN B;  1P4N A;  4R3K A;  4QX7 B;  4DV2 T;  3LAC A;  1KNZ A;  4TUY E;  4C91 A;  3IHR A;  3AAE B;  1ZEE A;  2WM9 A;  1VKC A;  4PJL A;  3NE7 A;  1QSM A;  5AQH B;  5IWA T;  3BI0 A;  5HEG A;  3FIX A;  3D7G A;  5KTD A;  4ORF A;  2XAF B;  1QSD A;  3Q5E A;  2F8H A;  3ZT5 A;  3ZT6 A;  4O4H E;  4ZX9 A;  3PV0 F;  4LF5 T;  3BHX A;  1V0C A;  2AFO A;  1X10 A;  4U31 A;  1XEB A;  1S7L A;  2LOP A;  2WWV A;  3DDD A;  1HCI A;  2JIW A;  4EME A;  2D4P A;  4ASK A;  4UEM A;  2K5T A;  2PR8 A;  5DWN A;  4NGP A;  3KVA A;  4KSF A;  5H6Q B;  4TNV A;  3PGP A;  1KZF A;  3SOL A;  1XNR T;  1SA0 E;  2JEW A;  4ZGY B;  1IBM T;  4JI4 T;  1FEW A;  5AQU B;  3DLJ A;  4OC2 A;  5HXR A;  1U6M A;  3H37 A;  2D4O A;  5G20 A;  1SE7 A;  2JLM A;  2QYV A;  5CA0 E;  4A56 A;  4DNC A;  1SUM B;  4MFR A;  1WWZ A;  2ODV A;  2J8N A;  3CXP A;  3V8I A;  3CT9 A;  3FF3 A;  3SJX A;  3BQK A;  2ANP A;  1XMB A;  2BCO A;  4IK2 A;  2CIJ A;  2FBW A;  4B10 A;  2VEZ A;  2C27 A;  3N9N A;  3NE8 A;  4DID B;  5CFB A;  5F48 A;  1IB1 E;  4DUY T;  1TF8 A;  4G2A A;  5JR9 A;  1XOV A;  4H9O C;  4OHF A;  2LOS A;  5FMN A;  2P6G A;  3PE0 A;  2ZEP A;  3KR5 A;  3D67 A;  4P4I A;  1KNR A;  4WWV A;  1DE4 C;  4EED A;  2NP9 A;  2EK9 A;  4CYO A;  4IDQ A;  3B8G A;  2PDO A;  2X9Y A;  2XQ7 A;  2ZW6 A;  3PB6 X;  5L47 A;  1S60 A;  5LGU B;  5F09 A;  4CRZ B;  4PJM A;  2WYR A;  3UUN A;  4NJR A;  3CML A;  5L2L A;  2ZEG A;  4U7I A;  4DR2 T; 
#chains in the Genus database with same CATH homology
 5LGT B;  3KFW X;  2R8V A;  4PK2 A;  3UY5 A;  3CPZ A;  2ZW5 A;  3LFM A;  5LYJ E;  3W91 A;  4XAX B;  2NWB A;  3ZLI A;  1FY7 A;  2OH1 A;  3L09 A;  4IUS A;  4H6Z A;  2Q9Q D;  4UV9 B;  2W63 A;  2CE7 A;  3C26 A;  2B4D B;  5DWM A;  2LSJ A;  4ZI3 D;  4UIG A;  2W62 A;  4HKA A;  3ZZI A;  4AVA A;  4AKG A;  4C2Z A;  4CAV A;  2HQY A;  2Z3O A;  5FXV A;  2NTX A;  2RA1 A;  1S7N A;  4UVC B;  3I1A A;  4C7I A;  1G73 A;  5LJN A;  3CQG B;  2BDE A;  2B58 A;  3ZJ2 A;  4KOS A;  2Z10 A;  1BO4 A;  1HF8 A;  3S6F A;  4JXR A;  3WAK A;  2ES0 A;  4JLE A;  3ZMU B;  4WBO A;  4KSA A;  2VI7 A;  4GS4 A;  3R9F A;  4KOY A;  3BLN A;  2JMH A;  1KUX A;  3C64 A;  4IE4 A;  3ZN0 B;  2ATR A;  5FXZ A;  4Y49 B;  5G1Z A;  2EUI A;  3TOB A;  2YU1 A;  4CRY B;  2PFV A;  3JTK A;  3KBT A;  4KBM B;  3CX6 B;  1IYK A;  3PU3 A;  4U72 A;  2ZLY A;  4XPL A;  4MHD A;  3TTH A;  5I0C A;  3U3I A;  3KDS E;  4UA3 A;  4YLH A;  4KVO E;  4IHJ E;  4MFQ A;  4GIW A;  3AA1 B;  4AQF C;  4KLW A;  4B5P B;  2YU2 A;  2L8K A;  2LSY A;  3F2E A;  4H9N C;  5E0O A;  1HS7 A;  2FT0 A;  2XAG B;  3FB3 A;  2K48 A;  5FY1 A;  5AG7 A;  5LHG B;  2VXK A;  3LBX B;  1YVO A;  2FCK A;  2VZY A;  4YGO A;  2KCW A;  2CXL A;  5DAB A;  3H5Z A;  3C4W A;  2LE8 A;  3F8K A;  3IEE A;  5HWX A;  2OU2 A;  4KOR A;  4NUU A;  3OKQ A;  4KP3 C;  2JRK A;  3F0A A;  5LCY A;  2NTY A;  5AG5 A;  3MKD A;  3T8O A;  3ZN1 B;  4KLV A;  5JRE A;  1UFH A;  4MAL A;  2VK9 A;  4A2Z A;  5IV0 A;  2VKH A;  4L89 A;  4C2Y A;  4F0Y A;  1P0H A;  3LD2 A;  4OYK A;  3PZJ A;  3RC3 A;  5DQV A;  3DNS A;  5FYM A;  4EYU A;  5AG4 A;  3T90 A;  5JRC B;  4Q36 A;  3HI2 A;  2B3U A;  3CWZ B;  2B4B A;  3K8P C;  2FS5 A;  3I0Q A;  4X1K E;  2Q9Q B;  3KV6 A;  2DNX A;  2I00 A;  4XBF B;  4II9 A;  4N78 D;  5JDM A;  3R6N A;  4AG9 A;  4B12 A;  1Y9W A;  4F6A A;  2CMR A;  2Z6E A;  1NE9 A;  4ZHQ E;  3PU8 A;  4L8A A;  3I9W A;  4PFP A;  3P2H A;  3TT2 A;  5J2U E;  4MJ8 A;  1WYC A;  5LA6 E;  4C7H A;  4U5Y A;  4O8S A;  3MGD A;  4TV8 E;  2ODU A;  3N9O A;  2GAN A;  4PK3 A;  2KMF A;  2H5M A;  2CCQ A;  2VQY A;  3O1H A;  4B13 A;  4H63 H;  1YKH B;  3FXT A;  5AG6 A;  5HMN A;  4ILU A;  1RXT A;  5EC4 A;  1D0Y A;  2P6E A;  1M4G A;  3HR0 A;  4H9R C;  3PDY A;  4E8O A;  2Q44 A;  4DND A;  3ZPO A;  4ADZ A;  4AI6 A;  2ZM0 A;  2KIN B;  4EZH A;  1BR1 A;  2JDC A;  3IU1 A;  4HNX B;  2F5I A;  2CY2 A;  1XIX A;  1NAF A;  4CGL A;  4EOZ B;  3AA0 B;  3I9S A;  4E7S A;  3EY5 A;  3FYN A;  4QXH B;  2XHE B;  2CNS A;  4I49 A;  2V7K A;  5L3F B;  2P0W A;  1WRD A;  4L9I A;  3UUX B;  4O4I E;  3PUQ A;  4HEA A;  1IJ5 A;  4OAD A;  3TO7 A;  1S94 A;  4PK4 A;  4XNH B;  3EVY A;  3S6G A;  5JR9 C;  4WBN E;  1I1D A;  3MK7 C;  5L3D B;  4MFK A;  2CEA A;  4CYN A;  4MY0 A;  3GMI A;  4PSX A;  2FE7 A;  5IB0 A;  3C4Z A;  4QX8 B;  2B4D A;  2EHO A;  2Z3M A;  3VWE A;  3HKC E;  4NF1 A;  1MIW A;  3TE4 A;  2B5G B;  4CAX A;  1D1A A;  3ANW B;  2X68 A;  2ZPA A;  4IGU A;  4BJM A;  3ZC0 A;  1QSO A;  2NMT A;  4KZT A;  5FY0 A;  3P2F A;  3S4U A;  3L3P A;  4FD4 A;  2ZW4 A;  4GOU A;  2KLQ A;  4O2B E;  1FIO A;  4YHJ A;  3RRC A;  3PUR A;  1VRB A;  4UF0 B;  4XPD C;  4YJ2 E;  3VKH A;  1I12 A;  4FD7 A;  3PUG A;  3PP9 A;  5TAO A;  3C51 A;  1MK4 A;  1BR0 A;  5HYA A;  3V5U A;  4CYP A;  5LNK A;  4MLK A;  4DO0 A;  4BA9 A;  5EK3 A;  2NW9 A;  3HKD E;  3R95 A;  2REF A;  3LOD A;  2CXD A;  2ZM8 A;  4IE6 A;  2Z0Z A;  4HN9 A;  4CZZ B;  3K3Q C;  5KTA A;  5HWY A;  2DI4 A;  4AKH A;  2DXQ A;  5LG4 A;  4H89 A;  4PJJ A;  5GON E;  4B5P A;  1LKX A;  2QA7 A;  3TO6 A;  5IHY A;  2DCF A;  4J2C A;  2DPT A;  2R1I A;  2HPL A;  3WI3 A;  3OYX A;  3J9X 1;  1EZ3 A;  3NBX X;  3D3S A;  1BOB A;  5IX3 A;  2YIN A;  4DMW A;  5EK4 A;  4PJN A;  5DJQ C;  1SQH A;  2VWA A;  4RI1 A;  2CLY B;  4M3S A;  4ZBG A;  4C90 A;  1U4Q A;  3E08 A;  3ZMV B;  3W6X A;  1OXZ A;  1M4I A;  4H6U A;  3HL6 A;  4ONU A;  2KZ7 B;  2IC9 A;  2CM0 A;  3G8W A;  3JVN A;  1WR6 A;  1D0X A;  3Q9D A;  1Y7R A;  2JQQ A;  2NW8 A;  1QUU A;  5H6R B;  4OFZ A;  4CGM A;  2X67 A;  3CVR A;  3S6K A;  4FI5 A;  5JRC A;  3JUW A;  3H3A A;  3LK4 2;  4JJX A;  4UVA B;  2PRB A;  2Q9Q A;  2VL8 A;  1RO5 A;  4MY3 A;  3SRZ A;  2E9X A;  3R96 A;  2XAH B;  3FNC A;  4P0A A;  4B14 A;  4F0X A;  4R3L A;  4UCM A;  3O1J A;  5LGN B;  3PTR B;  4AQG A;  2H7O A;  4B5O A;  3OBV E;  4ERR A;  1M1D A;  2OZU A;  2O28 A;  3OYZ A;  3IWG A;  2JEV A;  3ZMT B;  2DHR A;  2REE A;  4H9S E;  4QBJ A;  1PUA A;  2ZW7 A;  3DTO A;  2W00 A;  4ZS2 A;  5EZY E;  3D2M A;  4PNI A;  1LRZ A;  5C82 A;  5FY7 A;  2NOX A;  3A5X A;  4A30 A;  1UX5 A;  4UEL A;  4X20 E;  2W0G A;  2D0U A;  1N71 A;  2N9D A;  2QEC A;  1MIV A;  1US7 B;  2V1D B;  3G3S A;  4CI3 B;  3N9P A;  4CQI A;  4QKN A;  3K3N A;  1SHZ C;  2LSI A;  3W6S A;  4YFS A;  2WPW A;  4O4L E;  2CXF A;  2G0U A;  2IL4 A;  2FIA A;  3BQL A;  4AG7 A;  2WPX A;  3R9E A;  4F6R C;  3ZCI A;  4MBQ A;  2B3V A;  3KV9 A;  2JMK A;  3QB8 A;  4GK5 E;  5JDG A;  2PBI A;  3DR8 A;  2QIR A;  3QK6 A;  3RRW A;  4KOX A;  4YFJ A;  1Q2C A;  4CI2 B;  5CA1 E;  4P09 A;  4QVT A;  2D5U A;  3ZJ0 A;  4QXC B;  4JUY A;  3LJC A;  3DSB A;  3TOA A;  3NZQ A;  2P6F A;  1D0Z A;  3AVS A;  1MIY A;  3R1K A;  3KV4 A;  3Q2M A;  4DBQ A;  2CXA A;  5HXE A;  4GK0 E;  1BR2 A;  2MYS A;  4H63 V;  4K30 A;  2VKJ A;  1R57 A;  4I55 E;  3E0Z A;  1BR4 A;  3D2P A;  4WW0 A;  1KUY A;  2LHR A;  2M67 A;  2J8M A;  1UX4 A;  4IE7 A;  1AJ3 A;  1WYB A;  5J8C A;  5CB4 E;  2E8I A;  4UFW A;  4UWI A;  3F57 A;  5FNV E;  1I21 A;  4R57 A;  3VWD A;  3IBP A;  5HXC A;  1QST A;  4ZS3 A;  2B5G A;  3ANW A;  1CJW A;  2H7V C;  1YX0 A;  4OYJ A;  3CX8 B;  2WUU A;  3RYC E;  1HFA A;  4UF0 A;  4B11 A;  3R84 B;  3OWC A;  4KS9 A;  2KWH A;  3N5L A;  5JDF A;  4A33 A;  5J1G A;  2EHO C;  3QAH A;  4QXB B;  3EDU A;  4WNK A;  5BMV E;  4I43 B;  4CAE A;  1HG2 A;  2CA5 A;  2LJL A;  4UCP A;  3FBZ A;  3EDV A;  4CGO A;  4B6X A;  2VZZ A;  2Q7B A;  2PSW A;  5F3J A;  1HTJ F;  3N7Z A;  3DP7 A;  4K0U A;  4QC6 A;  2JPF A;  3ESL A;  2BSW A;  3RYF E;  2RC4 A;  1OWA A;  4LX9 A;  5JDL A;  2GIV A;  3SWH A;  2IAK A;  2X9H A;  3BJ8 A;  4E2A A;  4UFX A;  4Y49 C;  2YNC A;  2QML A;  2Q04 A;  2P9B A;  4E0A A;  3RC8 A;  3MA9 A;  3R9G A;  4TV9 E;  2Q4V A;  5LHI B;  3C4X A;  3ZYL A;  3CQC B;  2AE6 A;  4TN7 B;  3UUM A;  3KIN B;  3B13 A;  3FBL A;  3T9Y A;  4CXY A;  1VOM A;  2WWU A;  2BVM A;  3K3O A;  1IAP A;  3FXE B;  4PSW A;  4JWP A;  1O3X A;  2VB6 A;  3HKE E;  3UTK A;  5A1L A;  2LSG A;  3ZMS B;  4L5G A;  2X7B A;  5HH1 A;  3A9L A;  4PFO A;  2MBG A;  4EVY A;  1XF8 A;  4U9Z A;  3ZC1 A;  1CM0 A;  4MI4 A;  5JPH A;  2X51 A;  5KX5 E;  1GHE A;  5F46 A;  3GWH A;  3FBU A;  2X0L B;  2HPJ A;  3N9M A;  5LXT E;  3FXD B;  2N1G A;  3Q5W A;  5FP3 A;  3NRX A;  2CNT A;  4EB6 E;  4IE5 A;  3E22 E;  4I4T E;  2OA5 A;  5LHH B;  2CWO A;  2HUZ A;  3FRM A;  3TFY A;  5J2T E;  1B6B A;  2G3A A;  5FXX A;  5F8P A;  2BUE A;  4UWJ A;  4JD6 A;  1Z0P A;  3M65 A;  3BJ7 A;  4U74 A;  2ACX A;  4H9Q C;  2WMN A;  2A4N A;  2AJ6 A;  2YGW A;  2VAS A;  4ZI2 C;  1S5K A;  3LG7 A;  5L3B B;  4KOW A;  3GKR A;  1KUV A;  3RYO A;  2Q9Q C;  1Q2D A;  2E9X C;  3E0K A;  4OLL A;  2DPS A;  2SPC A;  2Z3L A;  2QGS A;  4EIW A;  3RX6 A;  4MFP A;  2RP4 A;  4H9P C;  4U9Y A;  4IST A;  3EC4 A;  5LBQ B;  1YR0 A;  1U5P A;  1Z4R A;  3N9Q A;  2K9A A;  1LVK A;  4BMH A;  1D1C A;  3I3G A;  1NWM X;  2IC6 A;  1IYL A;  5L3E B;  3MZK B;  4NCZ A;  4MHC A;  2XAS B;  5FVJ A;  1MMA A;  1FMW A;  2BZB A;  1S3Z A;  4DVD A;  1B7T A;  3LK3 B;  5LP6 E;  3LK2 B;  5IYZ E;  3RKO A;  3IGR A;  1YK3 A;  2K24 A;  3ETV A;  2XTL A;  2DWK A;  3RYH E;  1V9D A;  1MJA A;  4FJO A;  4MFJ A;  1S7F A;  5KMG P;  1KK7 A;  1UCU A;  3ZMZ B;  4AKL A;  2LHN A;  1IJ6 A;  3LBX A;  2VKD A;  3V5S A;  4AXP A;  4KUB A;  5EBV A;  5EK2 A;  3C50 A;  4EYY R;  4KUM B;  3O1I A;  2KXP B;  5HXH A;  3N2G E;  2XAQ B;  2WAU A;  2R7H A;  3BK9 A;  2LSK A;  4BJN A;  5C88 A;  1OZP A;  1Z9U A;  4EXT A;  4M85 A;  3ZYM A;  2WBL A;  4O4J E;  4XPK A;  2A3D A;  3CX7 B;  3GN5 B;  5LJM A;  2Y0M A;  4HKF A;  3KKW A;  2PQ8 A;  1ZO0 A;  4XNH C;  3P8C D;  5G21 A;  3AB3 B;  4BAY B;  3EFA A;  5H84 A;  4A31 A;  1MJ9 A;  2CWY A;  2D0T A;  2C0S A;  2FIW A;  5HXS A;  3BQI A;  3EO4 A;  5LBM A;  4QUS A;  3GA8 A;  4EZ4 A;  1XMT A;  1IZN B;  4P0B A;  3DR6 A;  2W61 A;  3NRY A;  3RYI E;  4DBR A;  2R98 A;  2N2N A;  1FMV A;  3VHL A;  3KV5 A;  2Z3N A;  4CXW A;  4UV8 B;  3ZEF B;  3K9U A;  4OK0 A;  2BEI A;  3JC6 C;  3GY9 A;  2VBQ A;  2V26 A;  4MBU A;  2PC1 A;  5JH7 E;  4JXQ A;  4QWN B;  3IF8 B;  3Q5X A;  4PK6 A;  3H4Q A;  4HTE A;  2V7M A;  4ZI2 D;  1S7K A;  5KTC A;  4HNW B;  2BVL A;  4KOU A;  1M44 A;  2E9X D;  2JJ9 A;  3MAC A;  1MNE A;  1HG5 A;  2C5J A;  1Y9K A;  4EAH A;  3KBU A;  4IF5 A;  4X5K A;  5A27 A;  2DLR A;  1QSR A;  2EHO B;  4CAW A;  3QUJ A;  5ADX L;  2LEH A;  3KVB A;  5JVD E;  4IE0 A;  2OB0 A;  4KVX A;  3N2K E;  4I50 E;  2KT9 A;  3J7Y q;  4NEX A;  4AKI A;  2Y48 B;  3NZP A;  3PUA A;  2ARH A;  3RPU A;  1NSL A;  2XAJ B;  4R87 A;  1S35 A;  3WR7 A;  3EXN A;  3C98 B;  2VKO A;  1QSN A;  1ON0 A;  1YLE A;  4NSQ A;  4NUV A;  5JDH A;  3O9X A;  2ZXV A;  3PUS A;  5DQW A;  3D0T A;  1X79 A;  3ZCJ A;  2YNC C;  3TCV A;  1YW0 A;  3VU7 H;  4UBR A;  2Q0Y A;  5KDM C;  2UXN B;  1YGH A;  4AVC A;  2X66 A;  3I9Y A;  3AAA B;  4X1I E;  4Q38 A;  4GYR A;  4TZ4 C;  3S6H A;  4UFV A;  2MTQ A;  1Q2Y A;  2PJQ A;  2CLY C;  3VKG A;  2L9Q A;  3GYA A;  1IIC A;  2K5B B;  4GYS A;  2V7I A;  1YVK A;  1Y64 B;  3W15 B;  2L3L A;  2G3T A;  3U78 A;  2HV2 A;  2B1E A;  5F47 A;  5H86 A;  2G0B A;  2NW7 A;  3B57 A;  5JDQ A;  2YK0 A;  3HKB E;  3UFE A;  3SXO A;  1B87 A;  2IW5 B;  1ZHC A;  3ONX A;  4JEU B;  1MND A;  1TIQ A;  3AA7 B;  3IWE A;  4JLY A;  1T98 A;  2YNE A;  5BWA B;  1LVF A;  4E7Z A;  1Z4E A;  2I79 A;  4UXN B;  3AVR A;  4JEH B;  4KUA A;  2A72 A;  3FB2 A;  4A32 A;  5JR9 B;  3RH3 A;  2XQY A;  2A2F X;  4CS0 B;  4KOV A;  4A95 A;  5JQ4 A;  2XUE A;  2PR1 A;  2LM9 A;  4PW8 A;  3WAJ A;  2X9W A;  3F31 A;  2FXF A;  2I59 A;  1MMD A;  4HE8 A;  2V7L A;  3CXS A;  5G22 A;  2Y8D A;  3P7I A;  1K4J A;  4PAG A;  4CI1 B;  4NXY A;  4IDZ A;  2UXX B;  5C8Y E;  3AAI A;  4QHO A;  2DWG A;  2Y6X A;  3JC6 D;  2D2S A;  4HFV A;  1YKE B;  1IID A;  1E1H B;  4CGP A;  1J4J A;  1ZV4 X;  3MJX A;  2WSS V;  1D1B A;  2E9X B;  2FSR A;  4AVB A;  3CXQ A;  1G8X A;  4ZOL E;  4CGN A;  5ETW A;  4LUA A;  1MMN A;  3SXN A;  3IU2 A;  3N9L A;  1MMG A;  4RS2 A;  4XPD B;  3CQX C;  2GE3 A;  4CAF A;  3ZYK A;  3TO9 A;  4CYQ A;  1YRE A;  1CUN A;  4J3G A;  2YND A;  3D8P A;  4C2X A;  1H7C A;  2LT3 A;  5A28 A;  4HNY B;  3UT5 E;  1L0C A;  4YJ3 E;  5JDN A;  4ZI7 E;  2Q4Y A;  4PK5 A;  3UUL A;  4ANJ A;  1XE4 A;  4KVM E;  3AA6 B;  4MFZ A;  4X1Y E;  4FD6 A;  2WMO A;  4XZC A;  4AQF A;  5JQG E;  4KOT A;  2CNM A;  5FXW A;  5HAX A;  2KND A;  4Z8X A;  2PG8 A;  3GN5 A;  1M4D A;  4IIJ E;  1PU9 A;  2EVN A;  3FHN A;  1VHS A;  5AGE A;  4FD5 A;  4AB7 A;  4M1P A;  4TX5 A;  1ZKE A;  4UCN A;  2YEV C;  2HH7 A;  3N2O A;  4V1A v;  3F5B A;  4R9M A;  1MJB A;  1YD8 G;  2WSA A;  2H3R A;  5F49 A;  4OAE A;  3QC9 A;  3DJB A;  1WLX A;  2OZH A;  1NMT A;  4YRH A;  2ZMA A;  4HGA A;  3HA4 A;  4QB9 A;  2Z11 A;  2BL1 A;  2Z3K A;  3TKL B;  2MOZ A;  3OJA A;  2X9X A;  2J1D G;  2OZG A;  4BBH A;  5M4Y A;  5AFU L;  4ISS A;  2J8R A;  2FL4 A;  4UVB B;  4AKR B;  3SS1 A;  4ZI3 C;  5ISV A;  3ETU A;  4G63 A;  4L0R A;  5LOV E;  5L3G B;  5E96 A;  5GCN A;  4O2A E;  5J8F A;  2EHO D;  3SHP A;  3ZJ1 A;  5CNP A;  4C68 A;  2KWI B;  3O4X E;  1HX8 A;  2Z3P A;  2V7J A;  1WK4 A;  4PV6 A;  3I0O A;  3CKD A;  3MXZ A;  5L3C B;  4MFL A;  4CXX A;  2C5I T;  2ZM2 A;  3EUH A;  4DMV A;  2JDD A;  2GK9 A;  4KMC A;  2C5K T;  1P4N A;  4R3K A;  4QX7 B;  1KNZ A;  4TUY E;  4C91 A;  3IHR A;  3AAE B;  1ZEE A;  2WM9 A;  1VKC A;  4PJL A;  3NE7 A;  1QSM A;  3FIX A;  5KTD A;  4ORF A;  2XAF B;  1QSD A;  4O4H E;  1V0C A;  1XEB A;  1S7L A;  2LOP A;  3DDD A;  1HCI A;  2D4P A;  4ASK A;  4UEM A;  2K5T A;  2PR8 A;  5DWN A;  3KVA A;  4KSF A;  5H6Q B;  3PGP A;  1KZF A;  3SOL A;  1SA0 E;  4ZGY B;  1FEW A;  5HXR A;  1U6M A;  3H37 A;  2D4O A;  5G20 A;  2JLM A;  5CA0 E;  4A56 A;  4DNC A;  4MFR A;  1WWZ A;  2ODV A;  2J8N A;  3CXP A;  3V8I A;  3BQK A;  4B10 A;  2VEZ A;  2C27 A;  3N9N A;  5F48 A;  1IB1 E;  4G2A A;  5JR9 A;  4H9O C;  4OHF A;  2LOS A;  5FMN A;  2P6G A;  3PE0 A;  4CYO A;  2NP9 A;  3B8G A;  2PDO A;  2X9Y A;  2ZW6 A;  1S60 A;  5LGU B;  4CRZ B;  4PJM A;  3UUN A;  3CML A;  5L2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...