3GB0A

Crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
373
structure length
373
Chain Sequence
GMINQERLVNEFMELVQVDSETKFEAEICKVLTKKFTDLGVEVFEDDTMAVTGHGAGNLICTLPATKDGVDTIYFTSHMDTVVPGNGIKPSIKDGYIVSDGTTILGADDKAGLASMFEAIRVLKEKNIPHGTIEFIITVGEESGLVGAKALDRERITAKYGYALDSDGKVGEIVVAAPTQAKVNAIIRGKTAHAGVAPEKGVSAITIAAKAIAKMPLGRIDSETTANIGRFEGGTQTNIVCDHVQIFAEARSLINEKMEAQVAKMKEAFETTAKEMGGHADVEVNVMYPGFKFADGDHVVEVAKRAAEKIGRTPSLHQSGGGSDANVIAGHGIPTVNLAVGYEEIHTTNEKIPVEELAKTAELVVAIIEEVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase T
publication title Crystal structure of aminopeptidase PepT (NP_980509.1) from Bacillus cereus ATCC 10987 at 2.04 A resolution
rcsb
source organism Bacillus cereus atcc 10987
molecule tags Hydrolase
total genus 114
structure length 373
sequence length 373
ec nomenclature ec 3.4.11.-:
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gb0A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3gb0A01
3WC6A 4P4BA 3IC1A 2AFWA 2QJ8A 4NGMA 4MMOA 1XBUA 2PJ7A 2C6CA 3IEHA 4MRIA 2ZEHA 1ARLA 1TKHA 1ZLHA 2IQ6A 3KR4A 1DE4C 4NGPA 4JZ0A 4NJRA 4MHNA 2ZEMA 3B3VA 3NH8A 3MN8A 3IO1A 4X2TA 2PIYA 1H8LA 2BO9A 5K8MA 2O53A 5J1QA 1YW4A 3BHXA 4WJBA 3NA6A 1VHOA 2PJAA 2PJBA 1Y0YA 3KZWA 3KL9A 2PJ1A 2ZEPA 3KQXA 4OC0A 4UEEA 3RZAA 5K8OA 2V8DA 2CIJA 3WT4A 3KHZA 4DYOA 3V38A 1HEEA 1QQ9A 3B35A 1XRYA 4OC4A 4MHYA 1FNOA 1ZG8A 2ABZA 3KR5A 3WC5A 3D68A 2JBJA 3KQZA 1ELMP 3PFEA 4WWVA 3SI1A 4P4JA 1ELLP 2IMOA 5JM6A 2ZENA 4FUUA 3MRUA 5K8NA 2PJ2A 4NGSA 5LYIA 1TKFA 2PJ0A 1VHEA 4MCRA 2AFOA 3D67A 1BAVA 2EWBA 3PB9X 3IWWA 2NYQA 3NFZA 2PJ5A 2V8GA 2Q51A 2ZOGA 3PB6X 1Z5RA 4KSIA 1R43A 1YW6A 5ELYA 3B3CA 4A37A 2XEIA 2F7VA 4MHPA 4R7MA 4P45A 4PXEA 3PB7X 2GREA 4IAVA 2POKA 4OKOA 2C6PA 4X8IA 4K3NA 5CBMA 4MCSA 1CP6A 1CPSA 5HVFA 2FVGA 2BOAA 3SJFA 2CTBA 3S9NA 4Q7AA 4R6TA 4TNUA 4UIAA 5F09A 3SJEA 2WYRA 3LWUA 3DLJA 3BI0A 3K2KA 1BPNA 3DGVA 5LRJA 3D7FA 3FF3A 1PYTB 2V8HA 7CPAA 5CPAA 3FJUA 1BLLE 6CPAA 4NGNA 5HVGA 4PPZA 4EFDA 2PVWA 3KASA 4FWUA 3SJGA 3D66A 2ZEEA 4EMEA 1LAPA 2V8VA 3D4UA 5LYLA 2ZOFA 2EK9A 1TXRA 1Z8LA 1ZG7A 2PCUA 4X3RA 3I1UA 5LRGA 5I4MA 1YLOA 3FMCA 2HB6A 4B6ZA 3B3WA 3VARA 2F8HA 3SI2A 5LYDA 4DJLA 4YU9A 1R3NA 4ZY1A 3CPXA 4A94A 4DUKA 1BPMA 3CPAA 1LFWA 1CPXA 2RB7A 2C1CA 4ZY2A 1KWMA 3JRUA 5K8PA 2PJ4A 2ANPA 4MXUA 2Q43A 3BXMA 4NGRA 1YSJA 1F2PA 1RTQA 2JBKA 3ISZA 1ZG9A 1YMEA 5LYFA 2ZEGA 3TX8A 1CG2A 4PXBA 3ISXA 3D7GA 2C6GA 1LCPA 3H8EA 1TKJA 4CPAA 4ZYQA 2OR4A 4F9UA 4UF4A 2AFXA 4P4IA 2PVVA 4P4FA 4Z65A 2ZELA 5JH9A 2HC9A 3SI0A 1DTDA 4MCQA 4R76A 2G9DA 4MHZA 2OOTA 4P4EA 3PRTA 3GB0A 2XEGA 1M4LA 3PBEA 4OC2A 3WABA 1LANA 3H8GA 3SJXA 1VIXA 3VATA 2ZEDA 1Y0RA 4IHMA 4F8ZA 1EE3P 1CBXA 4P6YA 4H2KA 4NGQA 5D29A 1Y7EA 4ZY0A 2ZEOA 3KGQA 2BCOA 5IB9A 3BI1A 3PEIA 3GLJA 3IJ3A 3QNVA 2QYVA 5LRKA 2V77A 4ZX9A 1CX8A 2EK8A 1HDQA 4FAIA 1F57A 3WC7A 5HXDA 3B7IA 3KI9A 3TC8A 4A38A 5THWA 1XFOA 2VL1A 5D8NA 3H8FA 2WZNA 3B3SA 1IGBA 2AFMA 4JYWA 4LQGA 1OBRA 1AMPA 3FX6A 4NGTA 1XMBA 1CP7A 3IFEA 3PFOA 3V7ZA 1LAMA 1GYTA 4MCPA 4UIBA 3KHXA 2Q4ZA 3NH5A 3VH9A 4P44A 3K9TA 1ZLIA 1ARMA 3FVLA 1AYEA 2AFSA 2DEAA 3NH4A 4OIDA 4UEFA 3HUVA 4OC3A 2ZEFA 3B2YA 1HDUA 2PRQA 1PCAA 2JEWA 4OC5A 4FBEA 2IJZA 4OMEA 3S9MA 4ZX8A 4IK2A 1F2OA 2O4HA 4PXDA 5DS0A 1FT7A 4ZI6A 1Z2LA 4O23A 3LMSA 3IIBA 4UEZA 3PB4X 1UWYA 3CT9A 2CF4A 4OIWA 4OC1A 3HLPA 3B3TA 3CDXA 4P4DA 3N5FA 1XJOA 2PJ8A 2I3CA 2PJCA 5HVHA 4EWTA 4BD9A 1TF8A 2GLJA 1NSAA 4OP4A 3FECA 2XEFA 4TWEA 3D7HA 1JQGA 4NFRA 4PXCA 3FH4A 1QMUA 2XEJA 2GU2A 4P10A 3FEEA 1VGYA 2QVPA 4G1PA 3FEDA 5JGFA 2NSMA 3RBUA 1IY7A 3PB8X 4NJQA 4PQAA 2RFHA 2AFZA 4W9YA 4F9VA 2GLFA 1LOKA 4YWYA 3S9LA 3D7DA 2AFUA 2CTCA 3L2NA 4AXVA 3T8WA 2PJ3A 2PJ9A 4GM5A 8CPAA 4ONWA 2PJ6A 4A39A 3PBBA 3GUXA 2J9AA 3RAMA 2PE3A 1TF9A 2PIZA 4R8FA 1Q7LA 4RUHA
chains in the Genus database with same CATH superfamily
1C1CB 1MJ9A 2EVZA 1OO0B 3GR1A 3VVTA 2NPIA 2JC1A 1XE4A 3SFGA 4JI1J 3GG0A 4ZVGA 1N88A 2D3UA 1XR7A 3THVA 2G13A 1RT2A 5EX0A 1SQEA 3MM8B 4BWJA 2CZVC 4WWSA 1IKYA 3EM1A 4K2XA 3QSYB 2O53A 3KDNA 2J6UA 1F3VA 1CS4A 1ZM2A 4JB8B 1IIDA 1RYRA 4NSQA 4ED2A 3SSRA 3OD2A 4DJBA 3CO9A 2ZZTA 5T41A 3THPA 4FF3A 5HQ8A 1RBAA 3GSIA 4DYOA 2PC1A 3RO0A 5DLFA 4K4XA 5KFJA 2APOA 4O3RA 3LH2S 3KMQA 5HQMA 2B5GB 1IICA 2YQ3A 2OPSB 4ILRA 2EUIA 1HHTP 3WX8A 1Q4RA 3BO2A 1AW0A 2Y0BB 3EE3A 2B51A 1J5EF 3JUWA 4LX9A 1BAVA 1S12A 4FZVA 1VQ8S 5I0CA 4A8MP 1UW4A 3PY8A 3GFYA 1TL7A 1DZ5A 4BWMA 2Z8QA 4BLGA 4KKOA 3NNCA 4J9LA 5GMKa 2F7VA 2B7CB 2XSFA 3LP2B 2HNYB 1IOFA 3KLIB 3Q8VA 3CD6S 4IAVA 3QO9A 4ZP8A 2IFXA 1UZHA 4ZVRB 1UW9A 4ILLA 3T1AA 3W62A 3SCJE 2DGXA 4DBQA 4KHPF 4GKJJ 2CTBA 1WI6A 3T9YA 3T90A 5DS7A 2PA3A 2UV8A 3RRKA 4A8SA 2O5DA 3CCZA 1WHYA 3DNSA 3PR4A 4KOXA 2C2KB 2H5MA 4LF9F 3KLEB 4PPZA 2HHHF 1K9MT 3NL0A 2HQGA 1Z4EA 4NA2A 2AGOA 1PIEA 1HHSA 3OQ2A 4MFKA 2FY8A 1TXRA 4TVAB 3NP5A 4ED6A 2R2TA 1EQ0A 2IM0A 4HYKA 2FIAA 2ZHOA 3MMAB 3I1UA 1YGYA 3QYYA 4NA3A 1T3NA 4ZBGA 3H2LA 2V94A 3S6FA 4A8XA 1FD2A 4CAXA 4HHHA 1GX5A 1RZMA 1YVFA 2HRUA 2RQKA 4X62J 4NZ7A 1LV5A 1HQ2A 4NA1A 3KLVA 4RW4B 1WG5A 2PJ4A 2ANPA 2DD8S 2Q43A 2Z3PA 4WXWA 3HT3A 4A8QA 3OHBA 4B3MJ 3DGPB 4LF1A 2XHCA 1VI7A 5LYFA 2L41A 5DETA 2MKJA 2ODFA 3GIUA 3IBCB 2UVUA 4NASA 1YTYA 4OZNA 4CAEA 3GJTB 3PKYA 2HBRB 4ECTA 2M3DA 5L1IA 4J9NA 2W01A 3LACA 5SUHA 4NI2B 1RA7A 4HKQA 3ETOA 1S7IA 3A13A 2M70A 1MROA 1TTHB 3Q8PB 1RJJA 3FBCA 3OJUA 4XPEA 2N7CA 1IKXA 2A2DA 2WBMA 1RAOA 1HDQA 4QR1A 3DLEB 1D09B 4JYWA 2VFRA 2FLNA 4HT7A 3TO8A 3FX6A 4NGTA 2EWHA 4NZ0A 2DJWA 4K2JA 1DTTB 4B13A 2V5HG 1SJ4P 3NH5A 1Y7PA 2ROEA 4LFCF 1JLCA 4GS4A 3PHEA 4ELUA 3H25A 2BJEA 5GVQA 3BSOA 3OR2A 2W2NP 4OYXA 3VZHA 4ZPWR 3BS9A 3CE8A 1S3ZA 1HNZJ 1VQ6S 2VKZG 4A8YA 2W4CA 2ZNYA 1F2OA 1GAOA 3TO6A 4PXDA 4U6PA 2CAJA 4O23A 3F8KA 2L9WA 2FGCA 2WSEC 2XI3A 3I3GA 2VC0A 2XS5A 1JKHA 3EVWA 1FVSA 4I64A 4QYRA 1UJ6A 3QT6A 3PW0A 1QAJA 3FH4A 1QMUA 2UU9J 3HO1A 2DHGA 4KVXA 1N5VA 4KGKA 3MGJA 3VAGA 1M1KT 3DRPA 4G1PA 2WRMA 2MYFA 2R8KA 4M5GA 3HSGA 1U26A 3PB8X 3M32B 2H65B 4W9YA 2DGUA 4O4RA 5LMNF 4CLSA 2XHWA 1N56A 2AFUA 1XR5A 4B9NA 4LIWA 2QA2A 3SXNA 1FWPA 2HFVA 4LF7F 2DPSA 2I00A 2HQDA 1RTHB 1YQHA 1DARA 1H7WA 1J5OA 3PW2A 4EFAC 2OZUA 2PIZA 3HD2A 1YG0A 4CCHA 1FXDA 1RAFB 1XBUA 2XZWA 4JUZA 2RU9A 2MHNA 1ARLA 2EVNA 1JWQA 2B4UA 4MT1A 2R2RA 1GT8A 1HQUB 3Q8SB 2ZW7A 2YKQA 2KH9A 2Z3NA 5FVJA 4X2TA 1GMWD 3PG9A 4RWWA 3QWPA 1SJ3P 1N52B 4J9UE 2NQPA 2B4BA 8ATCB 5HH1A 2YNHB 2ZHBA 3DNCA 2VZYA 1WTFA 2J8AA 3M4XA 1IVZA 2K8GA 4OHWA 5CNPA 3CUNA 4ECQA 4MJKA 3TZZA 3NLCA 4OC4A 1WELA 2ZJRQ 1RAEB 4Q2MA 2A1BA 1KRPA 2ZJPQ 3DOLA 1JMTA 4USWA 3KLGB 5K8NA 1KDNA 3JB9k 3RU0A 4FD7A 3W66A 2GGPB 1LWXA 1LWFB 1M0SA 2OIHA 3H5YA 4NCGA 4Z7YA 4CRYB 2OFHX 4NLSA 1T9WA 3QSIA 1NPRA 3KHGA 3FBUA 3O3LA 1BE4A 4DPWA 4MY3A 2YNGB 2J0WA 4DPOA 1PSDA 4NLVA 5J8FA 3F56A 2F3JA 5LSLA 3I0RA 4DG1B 5IX3A 2Z4PA 2PEHA 4WP8A 4LUBA 2Z30B 3SJFA 4HT5A 4JI8F 4TNUA 1TVRB 3D4JA 4GO7X 5L1LA 5J1NA 1W25A 3MXHP 2WB4A 2DGWA 3J7Z5 5HQLA 1KUYA 3AT1B 3G96A 4MFBB 4DV3F 2ASYA 3KLHA 4JXQA 2ZWOA 3RB6A 3NE7A 3MM5A 2ZOFA 1XMOF 3AQOA 3PGPA 2QSFA 2QL7B 3HSZA 5IM0B 2IVYA 4DUTA 4X3RA 3FC9A 3MM6B 2HB6A 4ZHRA 4Y28C 1H3DA 4ZP7A 4JV0A 5K9FA 4M5HA 4HPSA 5HJYA 5DWNA 3W5XA 2Q0YA 5KFCA 4DR2J 1URRA 1TV6B 2JDCA 4LF8F 5I3UA 3FRMA 4DS5A 2MB0B 2OH2A 1TFYA 2AMCB 1YSJA 4CLPA 4HKFA 4NLRA 1URNA 4EI2A 4DV0J 3NWGA 3H4QA 5J2PB 3DLHA 3I4PA 1ZBTA 4KRWA 1Q8IA 1P4NA 1V9OA 3BKTA 1I1DA 4F0HA 2ZH8A 4LFBJ 4Z65A 2HC9A 4DXLA 4MCQA 5EBVA 1KR4A 2MZRA 4LRBA 2AJ1A 4MHZA 2OOTA 4P4EA 2VD3A 4DV5F 1ZAWA 4MYUA 4CAVA 5CABA 1HW8A 2VIHA 4MY0A 3WABA 1E6VA 1I51B 5ADZA 1EE3P 4QQBA 3Q8RB 5GAHI 2V6AA 1VKCA 2YWWA 5G21A 4H4KA 2YNIA 1ZZNA 1KOOA 4NMLA 1UPPA 2RQ4A 1KLMA 1CX8A 1CJTA 1YI2S 4RN7A 2G0IA 1KN6A 2YNCA 2OHDA 2IRXA 2GVDB 2YWGA 3FMBA 3QAEA 4NYZA 4XK8C 3CCWA 4W90B 3TRGA 4PK3A 2JWNA 1DBDA 1KQFB 4LF5J 3C2PA 1LK5A 2YKNA 2MZ1A 2HBYB 2UUBJ 4OI0A 3PYDA 1UAWA 1CP7A 3OUYB 2YGWA 5KFHA 3AJDA 1H72C 2MPUA 2Z10A 4M8LA 4ECYA 2ZH5A 1GTEA 3BDPA 4LRDA 4ES3A 3LGMA 3F44A 2MHEA 3UVJA 3GIIA 2Y0SD 1PJ6A 2V50A 4JI3J 2LXFA 1PCAA 1OY8A 3RBXA 4PSWA 4DUZJ 1YKWA 1IYKA 3I0SA 4CLWA 1YLXA 4Y2AA 1S9GB 2VJUA 4DL4A 4ED8A 1U2RA 4WFAQ 3HHEA 5LMUF 2WCXA 3AAWB 4ZDNA 2LLZA 1SKUB 2DR9A 2B5GA 5I3PA 1ZTWA 1UEUA 4J5OA 3UDLA 3N6LA 3KK1B 5LSRA 1S57A 4CO1A 1S72S 4IR9A 5D4LA 4DR1J 4JI2J 4LRFA 3JXOA 1VK8A 3TX0A 5IB0A 2DGSA 2OEKA 4B5OA 4NOHA 2UUAJ 3DKDA 4XDCA 3HMJG 3QGIA 3JQKA 2HNYA 4E2FB 5ETPA 4IOAQ 2C2EA 3DOMB 4PRFA 1YJ7A 3KG1A 3HFKA 5EUHA 2R2UA 4GVBB 2PJ9A 2DXEA 1WG1A 3FCHA 2BABA 4A47A 3ZZIA 3AA8A 1DLOB 2X1FA 2GANA 3R5GA 1YGHA 1P6TA 3L09A 5IWAJ 3VVUA 1IU8A 1UVKA 3G6ES 4P6QA 4F3OA 2E5LJ 2P6TA 1Q7LB 1RB0A 4RPFA 1BD6A 2VBYA 2DH7A 3FJ2A 2DEIA 2K2PA 3MR3A 2ZBRA 2ZEMA 2HEKA 3UCZP 3IO1A 1TK5A 2AEFA 1XN9A 3UNYA 1CJUB 2RF2A 4TYAA 2JLMA 1MU2A 4Y6IA 3VHQA 3DU5A 2VBXA 3RZAA 3DLGB 3A8JA 1HBNA 5G20A 2XGPA 1R8BA 2K1RB 3WC5A 3EX7B 4RNFA 4ZP6A 1U1KA 3ZFVA 5IV3A 2IA0A 5J2NA 1VQYA 1TKTA 2EC0A 5F3ZA 5DO2A 3DRXA 1UWBA 2DB1A 2PJ0A 2JX2A 4II9A 2H5JB 3OV7A 5C5JA 1HHQA 3IRXB 1FDAA 1FNXH 4DSLA 2R7VA 1KC8T 1WKJA 2VG7B 5CD4H 1XERA 5EWEA 4F4AA 1ZPWX 1NSLA 1BOBA 2M4MA 1NK9A 5LL6d 4NI2A 1HWKA 6AT1B 2OB0A 1CP6A 2O01C 2BOPA 3VCDA 4URSA 4HDGA 3LPYA 2G2YA 5F09A 3MEEA 3DLJA 2WSFC 2C2RA 4KHRA 3K5OA 5LJ5Y 3D7FA 3I6PA 2Q66A 1PYTB 1KP6A 2HHTA 4F4WA 2KHDA 2XS7A 1CJVA 2QE5A 4LSNA 3DLEA 1WK4A 2EKYA 2GCFA 3SHPA 1L3VA 2F8EX 3CJSA 3SJGA 1VJWA 2FL4A 1LAPA 4N77A 1X9WA 4ECSA 3GIKA 4ZLPA 2XMVA 3KG0A 1MK4A 4NCAA 4UFXA 3R97A 1OPIA 1MMLA 3HZGA 1IKWA 3ZTQA 3G71S 5IT9Y 1QSNA 2R8GA 1FKOB 4DNCA 1VBXA 5J1EA 2AEJA 1R3NA 3C3LA 1S76D 5J8CA 1N5QA 1FX2A 1AUGA 5KFBA 3MCNA 2KM8C 3CDUA 1TK8A 3M8PB 2XZDB 1ACMB 3OJSA 5AG7A 1KWMA 4DR6J 4F0MA 3RYLA 5L1KA 2KYZA 1GMUA 4DU8A 3MR2A 5AXMA 1FDBA 3MOJB 1ZG9A 2ZKUA 2KM8B 2CDQA 1VBKA 4L72B 1OSDA 3FEZA 3MM9B 4X84A 1VQ5S 4CLYA 4FF4A 4MFPA 4QBUA 1LCPA 5C25B 3FNCA 4CPAA 5BR8J 4UOGA 5D6GA 2CPZA 5D3GB 2E7VA 4CO2A 2I0XA 1FRKA 4A2ZA 3MEKA 2JVOA 3JTNA 2AGQA 4M5DB 1IN0A 5E3RA 1U1QA 2B4VA 3H8GA 2B4OA 5J1PA 4O4GA 2DY9A 1DQ8A 4O44B 4IOCQ 1HLWA 3PP9A 1Q1KA 4H4MA 4PV6A 3ZTPA 3DXSX 1K0VA 4M1KA 1A2ZA 2GQQA 1SQFA 4RJVA 3SDEA 1VC6A 4Q8EA 2Q6BA 3BSCA 3GYXB 5F8MA 2IC3A 2W9CB 1X9MA 3TP2A 4LQGA 2OTLS 2J8NA 4NLGA 3R5DA 2LCWA 1IR2A 3M8RA 2BR0A 4KAIA 4LR8A 1GYTA 3KJFB 3DOKB 4OADA 4K4UA 2CQIA 3UN3A 1HQUA 2AD9A 2F65A 3V4MA 3MPDA 4ZGYB 4EYHB 1PJ5A 3M9OB 4P2MA 1D9FA 2VBWA 1NLKL 3CO0P 1CJKB 1Z8TA 4NLUA 1OJ4A 2JDDA 1RTZA 3PRBA 4CP5A 1WC6A 1TL4A 4PSXA 2M8HA 2J9CA 2WW8A 3V8IA 3UFCX 2AJ6A 1S1WB 5DQHA 1E6YB 2GHPA 3GIRA 2VONA 3L95X 1Q82T 1CULA 1UWYA 4D3HA 2HNZA 4A31A 2YNDA 4EBDA 4CIOA 4TLRA 1LW0B 1U09A 3C26A 4DX5A 2PJCA 2XZTB 1UVJA 2DHHA 3W8GA 1I6JA 3MZIA 2QC3A 2RH3A 4I2PB 3OL9A 5C2CA 2BRKA 2GGPA 4DR5J 1LWFA 4FBUA 1QAYA 1F60B 2PQ8A 1DQAA 2GAHC 4OHVA 4OYBA 3BM7A 3JTOA 4Y00A 3HX9A 4CZCA 1M4DA 2HQCA 3SFUA 3MTKA 4C0HA 4YWYA 3I4HX 5D4OA 4ONUA 2CJ9A 3WZ0A 5E5NA 1TKXB 1Y3KA 1RT3A 3BBFA 2DISA 2H3EB 3B54A 5KFWA 3TOBA 2PJ6A 2W2OP 1HNIB 2W9BB 3V6HA 1TVRA 1RWPB 4ZCIA 2X3GA 3BB5A 4WCEQ 2YKAA 2DCLA 3M6XA 2V69A 5F47A 3RR7A 4DLEA 3WIVA 3ZZUA 4C4WA 1NB7A 2GMJA 3NOCA 3PW5A 1R7IA 1L3TA 4MHNA 1HFEL 2NYIA 3EJMA 3MCSA 2PI5A 5A8RB 2PIYA 5IXUA 4DCJB 4ZK7M 3D6FB 4MFJA 4L76A 2J6SA 3EY5A 2VPZB 1HBOB 3VGSA 3NA6A 5LSOA 1B0PA 4CLFA 3WBZA 4JI5F 4DQSA 4OC0A 4UEEA 1X8DA 2BV3A 4LRCA 1N5YB 1V3RA 1WHWA 9RUBA 2ZM6J 1ZG8A 2Z2ZA 4RW9B 3UN5A 1IM4A 2OGUA 1MNEA 4DQIA 5ETLA 4J9KA 3D3CJ 2MGZB 3M05A 3EZOA 1XMQJ 5ETSA 3VAFA 1N6QA 2NREA 4NGSA 4Z7CA 5GAEI 4LBIA 1NXIA 1RWMB 2LEAA 1PKUA 2DITA 2FVSA 4HNYB 3DMJA 3B8GA 3GP9A 1T03A 2FD2A 4UT4A 1KUXA 1ZO0A 3TAMB 4R7MA 4JI7F 4B17A 1UL3A 3NGRA 3DDKA 1JLBB 1JLGA 4X8IA 4NLOA 1S6OA 5F41A 1CPSA 4O3PA 1VMBA 2F4VF 4Y2MA 2FJBB 3C6UB 4HH0A 3K59A 3H0PA 3SJEA 1HNWF 4DV2F 1H98A 7CPAA 3G87A 5D78A 4CGOA 4NGNA 2GVDA 3GCWP 3PTWA 2E7WA 4OLPA 3SCIE 2AHOB 4YP3A 3KASA 1X4CA 4K7QA 4C8NA 2I9SA 3OUYA 2CQ4A 1M5KC 1L3SA 3V4IB 4USUA 3J81j 2AZ3A 4X2BA 2UP1A 4DU7A 1S7NA 4R0EA 4O3OA 2R7RA 1KTQA 1HPZA 1RWOB 5E41A 5B0FA 4ANCA 4FF2A 2GA7A 1UFHA 4DUKA 1BPMA 2JFDA 5KG3A 4UOCA 2FZGB 1R0AA 5KT3A 1GMVA 4CAFA 4AE5A 2MSTA 2HHXA 3FDSA 3CCLS 4NGRA 1KFDA 3F73A 2ZITA 3VAJA 4OX9F 4DOZA 3C6TB 2C27A 1RDRA 1IUJA 2OZGA 1HYSB 2K3IA 3D7SB 1CG2A 4USVA 4UWJA 3RTVA 4YB7A 2HRTA 3DLKB 8AT1B 3H8EA 2QIRA 1FXRA 5C42B 3P5TL 4P4IA 4XO0A 5D8HB 3M2UB 2OPPB 1FT8A 2JLFA 1S48A 4TU7A 3PM9A 3PRDA 4MIBA 4CLKA 5E3QA 4J9RA 1PC4A 2WOMB 4AXIA 4DPXA 2C28A 4JXRA 4QIWD 4V19X 3DOMA 4LF2A 1Z2ZA 3HHLC 1XC9A 4FS2A 4OHXA 1SXLA 2VG5A 3HZEA 4FPRA 3I5CA 1JLAB 3IS9B 2FIUA 1RLDA 2EK8A 1J5EJ 3DYAB 1N0UA 1CBKA 3D2WA 1X4GA 2CUYA 4B14A 2XTJP 1AMPA 1VQSA 5EWGA 4X62F 3HHLB 4IQMA 1YVKA 1S6PB 2GO8A 2RNEA 2J7KA 5CA5A 2CVIA 4IG0B 4YY3F 4LSLB 1CQMA 4HVZA 4IO1A 3K9TA 3POTB 4ENOA 1YBUA 2W2MP 1X4EA 4HACB 3NH4A 3HP6A 3VZIA 1N0VC 2Q7BA 1CJUA 2A2CA 2Y0MA 1RHJB 2DTJA 2AEMA 1XWLA 3OSNA 4LF9J 1RTJA 2L3MA 4URQU 3IN5A 2HMIB 4OMEA 4OJ1A 4ZX8A 3Q8QB 3BR8A 2HHHJ 4CLLA 1B6BA 4EU0A 2J7UA 4TLQA 1KEKA 3ZO7A 2PE8A 4XPCA 1TL5A 2XSJA 3UDCA 1LXJA 3CT9A 2CF4A 3UWTA 1U6MA 1S4FA 4J90A 1XJOA 2PJ8A 3PVXA 4OIXA 1WSVA 2DNZA 2PR1A 1RYSA 3GE9A 2HAFA 5HP1A 1NSAA 2VFUA 3TQEA 4TWEA 2UVVA 4CGLA 4P10A 3HM9A 5D0HA 2E66A 1FTCA 4X4SA 1WC3A 3PZJA 1IY7A 4HI1A 2R7OA 1ZZFA 1UJ4A 2GLFA 3D7DA 4OZ3A 4P73A 1Y11A 2M88A 1IQZA 4A32A 1LRZA 3PBBA 5C24B 2BKOA 3GONA 1D1UA 4WFXA 2FXFA 3WC6A 3CJ8A 3ZZRA 2PJ7A 2FJWA 4YUDA 4AUKA 4E0DA 2JRSA 4UZBA 2HGMA 2N3LA 1X0FA 2HK3A 2W24A 1WF1A 2HUZA 2K06A 1GK8A 3I82A 2I2YA 1H8LA 1RXOB 1K8AT 2CY2A 1HMVB 1S1TA 4B9SA 2WSAA 1FKOA 1GTHA 2XGQA 1LQ9A 4LT6A 2PJ1A 2E5JA 3UY5A 2O1PA 5K8OA 2J8RA 1YJVA 3EDQB 3EZ5A 4B11A 2HVEA 4NLPA 4W4MA 5H86A 2WBRA 2AE6A 4JJXA 1CM0A 3G6XA 3HVTB 4LFCJ 3BGLA 1EKSA 3TANA 3CVKA 2QMWA 4KSAA 2DNRA 3RBZA 5AJ3F 3MUMP 3OL6A 2EKNA 3HVWA 1WOSA 2VOOA 1U1PA 1PBAA 3HDSA 5D77A 3MM7A 4RUCA 2B43A 1KHVA 2HZAA 1MJAA 3CWJA 1O8BA 2MKHA 3AH6A 3LP0B 2B6AA 4UW2A 2GREA 4WK3A 5KFVA 2LQ8A 2QT7A 1HQEB 2BQ3A 2JEIA 2KRBA 1D8YA 4I4BA 4O44A 1RHRB 4KZTA 4R6TA 2VODA 3OPKA 3NGTA 3WDOA 3ZTRA 2KFZA 1BPNA 3JTKA 4PPDA 3GG1A 3M2RA 5BYSA 2VPYB 5DQIA 3I55S 2MQ8A 2F9DA 3VGUA 4QUSA 8RUCA 3VWEA 1SJ1A 5HLFB 4WTOB 5LYLA 3EGWB 5LMNJ 5KFUA 4UCPA 2IRYA 2IRUA 4UA3A 1BXNA 1YR0A 1RTIB 4LF7J 4MBUA 1WKLA 1JLFA 4C97A 3GKRA 1CJKA 3IAM9 1YLEA 2DH8A 2RC4A 2C3YA 3K0JA 3P2FA 1EETA 1NE9A 3H59A 3C16A 2PT0A 2QLBB 2UUCF 2C1CA 3NBPA 4ZMMA 3C14B 2REFA 1OS5A 5HAOA 3OVBA 4HNXB 4FXVA 2KG0A 2UXCF 1U6FA 4RKUC 2ZEGA 1C0TB 2HQIA 2Y9HA 2VOPA 4CYOA 2FC8A 1TKJA 1FFSB 1TQLA 4BS2A 4ZYQA 3TQ1A 4JD6A 2DRBA 1D9AA 2AFXA 2PR8A 2PVVA 3BKUA 3QB8A 2R7UA 5CH7B 1O51A 3T5LA 4TU8A 3CXPA 2X1BA 1M4LA 1FE0A 1ZM9A 1YWXA 1VLYA 3UI3A 1WORA 1S99A 3D2MA 2VZ9A 3D9BA 2IL4A 4ZY0A 3T41A 3ITHB 4F0XA 4Q43A 1FVQA 3KJVB 4TU9A 3G9CA 2CNOB 2ZC4A 1TKXA 1CLFA 3PEIA 4H89A 1FF2A 5DM6Q 4FAIA 2BQUA 3LO3A 4ED0A 5M2RA 2B4DB 2XLJA 2PFDA 1IGBA 4X66F 4X4NA 4ECWA 3O6QA 2A0FB 2DEJA 1LKZA 2VASA 1YITS 3FEYB 1S1UA 2L9DA 2M8DB 3KHXA 3M7VA 2UUWA 3VH9A 3FQKA 3TJ8A 5J2MB 2ERRA 1LWCB 1VCTA 1ARMA 3LTOA 3W9JA 1AYEA 4JI8J 5HROB 1RWVB 2FJXA 3M1VB 3SV4A 4OI4A 1REVB 4I7FA 4QIFA 3G8QA 4MK7A 3ILLA 2IDLA 3BQ1A 3B2YA 5LOQA 1K47A 1R8CA 5AG5A 3MTJA 2YWHA 2MDAA 2IPOB 2D41A 4DV3J 3DI6A 3PYFA 3MOZA 2V9WA 1JJHA 2H5EA 4DPUA 1P9YA 3W2VA 5GADU 1N5YA 3NRBA 1RT7B 1XMOJ 4AVAA 1X5SA 4U7UK 4RW9A 4U5YA 3W2WB 4M5JA 3D1QA 1WC1A 2CPFA 4JI0F 3KLFA 4AL7A 3BO3A 4ILMA 3TVZA 2OZHA 2VI7A 1VBZA 4Y65A 4OP4A 2LQ5A 4PWDB 2DGQA 3MD3A 3BEGB 4I67A 2DY1A 4DHVA 3AA9A 1FESA 4UUXA 1O6XA 5JGFA 1HBMB 4LF5F 3R7BB 4LF8J 3DM2B 4MI4A 2ATLA 3QATA 2AFZA 1R8HA 2HQFA 3RR8A 3V2UC 1LOKA 3L2NA 4KQZA 3T8WA 1Y10A 4OV6A 3TVKA 2W4DA 8CPAA 4A39A 3FBBA 4ICLB 2CZ4A 2J9AA 3RYOA 3RAMA 4PAAA 2R7WA 3N79A 3J7YU 3D0IE 1M1HA 1HI0P 3OT9A 3SZ2A 1WC5A 4B3RF 2QJ8A 2MJNA 5KT4A 4MMOA 2AJ2A 2Z57B 2IQ6A 2ZH2A 3CNQP 4NJRA 3IWLA 2JEFA 1RT2B 3LF0A 3B82A 1T9UA 4KLVA 2VFSA 3P4UB 3E51A 1P9QC 4A48A 1CQNA 2DBBA 4I56A 3H5SA 1NZ8A 3SBMA 1XNRF 5JVGQ 4UQTA 3NY0A 2CQ1A 1A0OB 3V38A 4MHYA 5A6WA 2L48A 4X64F 3KQZA 5A27A 3DR6A 3WQPA 4FYVB 2XMKA 4U9ZA 2V4JB 2AYEA 2W8KA 4P4JA 1UPMB 2PMZD 3V81A 3QT7A 1NM2A 4RW6A 3C6TA 1TMMA 1HWIA 1PJ7A 1HYSA 1RQ0A 1H74A 2HW3A 4QU7A 4M5LA 2KXHA 3FSIA 1KQGB 3R8YA 3UR0A 1NK5A 5CHCB 4E8OA 1WEYA 3IWWA 2HK2A 1Z9UA 1TL7B 3DN9A 3QLHA 4LRAA 2LFVA 2RHQB 3FSXA 4KKOB 4HH1A 2E5LF 5CZVA 1RWKB 4BMHA 3R9FA 4WBFA 5LMUJ 2D3ZA 3HHLD 2C6PA 2WUUA 1VRTA 4F7VA 2RRNA 4KV8A 1RT4A 3SXOA 3DFEA 2WYRA 1N48A 4IOBA 2VZZA 1M5SA 4AL6A 1F5BA 4MH8A 2DHAA 1R8AA 5IFMA 1U25A 4ZPTR 3TA1A 1UEVA 3DYAA 2CQBA 1M5HA 2ATRA 4ED4A 2B0GA 3WHIA 1B0VA 1C4CA 3HI9A 3GIJA 1IXKA 2VA3A 1S6PA 5IC4B 4NEYA 3BGRA 3ISNC 1IBLF 3U1NA 3IG1B 3N6NA 2VQFJ 5EGYA 3POTA 2RHSB 3ZZ0A 1KQKA 4KVME 1NEEA 3FYNA 2RUSA 2YQ1A 4HACA 1P0HA 4OMFG 1S9FA 4WFYA 2OUGA 1WC0A 2MQPA 2P5VA 1AFIA 2IAJA 2RB7A 1Q8KA 3VGTA 5JQ4A 2FS5A 1KLNA 4ZCMA 4CQ1A 5J2QA 1SIWB 2G2ZA 5DGAA 2D9OA 1T9YA 2OU2A 1BUXA 3FVYA 3HLUA 5HSPA 2FVCA 4YQWA 2DNPA 4F9UA 1RSCA 3H40A 3IMQJ 4I69A 2ZFHA 4X5KA 5JH9A 2RQCA 2HWIA 1H2TZ 5JMNA 1HBUA 5ETQA 4EBCA 4ETZA 2FHJD 3D3SA 1T9XA 1FK9A 3BGFA 5KG5A 5D0RA 1VQKS 2ALYB 5MLCV 3AQPA 3MR7A 1UA0A 5A2QU 3QGHA 4C48A 1RU2A 1Y0RA 2DPTA 4CWBA 4DN9A 4XPLA 3EDRB 2IIHA 4V1Ak 3EO4A 4Q36A 2WAQD 1EB0A 1MROB 3GV5B 2K7JA 5B0EA 2RSQA 1RAGB 4F0YA 3TWZA 4QWEA 5B0BA 4ELTA 5HXDA 4LBPA 3QGGA 4LFAF 1NHUA 3TC8A 2FHJA 4K30A 4C8YA 1N36F 4C8OA 2XNRA 3LGHA 3UPFA 3KK2A 4N47A 1CEZA 1CC8A 5E2QA 4K5SA 4PG8A 3DU6A 4M95A 5AXKA 2JEGA 2HNDA 4QU6A 1YX0A 4QC6A 2FT0A 1JLCB 5CAAA 2AJFE 2Y8YA 2AFSA 5CYMB 2W9AA 4NF1A 5I3QA 1RE1B 3HUVA 1NSQA 1MWQA 4OC3A 1XJWB 3OR2B 3AXKA 3IGVA 2GQ2A 4EO8A 5G22A 4WKYA 4B9MA 1BWEA 4JI4F 3NG8A 3ADAC 3G86A 3R7SB 1I94J 1Q7YT 3N9UC 1W2BR 5CCMA 1I3OB 4B12A 1QM9A 1KVIA 1FE4A 2RS8A 3NS5A 4MHDA 1JKHB 1TL3A 3E01A 2O28A 1NRKA 2R8IA 1HD1A 2OPQB 1S4EA 3IGNA 1MN7A 3ENWA 2CQDA 4C6AA 1K0TA 2GC8A 2HVIA 5E33A 3T1HJ 2XWXA 2AX1A 4ZITA 1ZM4A 3PW7A 2Z2YB 1PYSB 3DRPB 3OFEA 1P1LA 3K5LA 1NJWA 1VQ4S 4FD4A 2DRAA 3GWCA 1NK4A 3LP0A 2V2ZA 4DCPB 2HBQB 3ZC4A 4OZ5A 4ZA1A 4U8VA 2NCKL 3R27A 1J5OB 3IGRA 5H9EJ 2OTJS 1IWAA 4ECXA 3GQCA 4ZJLA 2C6CA 3M6UA 1ROFA 1QSSA 4NGPA 2ZH3A 4KGMA 3B3VA 4LMZA 2KDOA 1NO8A 2IJRA 2YQ0A 2ZVSA 2C2DA 1FRJA 3AOAA 3BHXA 2B3VA 1VHOA 3D2PA 4GMKA 4F36A 4P75A 4Y2CA 4XDDA 1FJ7A 4C11A 2ZEPA 4DQRA 4PZVA 3KQXA 3SYZA 3QIPA 2CQ3A 4QWDA 1FNOA 3I9ZA 1NU4A 3PDNA 2WHOA 3S6HA 2ZH7A 2BE2A 3ZZOA 1ZAVA 3SI1A 3P6YC 4I2QB 3N5BA 3DOLB 2YNEA 3MRUA 2PFFB 1QSRA 4FP9A 1GXLA 5MAOA 4B9UA 1N4LA 5RUBA 4NCGB 3GYGA 2V8GA 5KFFA 5DZ7A 3RW6A 4B5PA 3B3CA 3GU0A 2FHOB 2QMLA 4MHPA 5ETRA 5HBMA 1UTAA 1S7FA 2NPFA 1Q86T 2HGLA 5A28A 1G3OA 5F9NA 3RBEA 3I0RB 5DLGA 1AT1B 2J0XA 4K4WA 3S9NA 3TAQA 1Q95G 3DDIA 4PG7A 1Y9WA 4P2XA 2XB2D 1FDDA 5IQQA 2B4DA 1EHWA 2JDJA 1TR0A 1VBYA 3BDEA 3HSJA 3KLHB 3I31A 3QT5A 2KYXA 4EMEA 3PO4A 2FCKA 3IAS9 3MM5B 3KDOA 1UFLA 5DDRC 3ET6B 4P9SA 3NCRA 2HLTA 4N8NA 3D1HA 1V5IB 4G1QA 3V5RA 1VQOS 2FIWA 2OAUA 1QY7A 4DI6A 3IXQA 4N5SA 2GJIA 3SI2A 4ZHRB 4DJLA 1PILA 2CNMA 2AYBA 4A94A 2CXEA 3CJ5A 2MXYA 3CJ3A 2E9ZA 2MQMA 2G0BA 2G3TA 3TTHA 2G1DA 3MAAB 4I6YA 2DVIA 1XK8A 3N28A 2HPUA 2J0QD 1YBTA 3S7RA 4WTYA 2CNLB 2J5AA 2HHPA 2RUGA 3CJTA 3Q2SC 2DXDA 1VRQC 3MMBA 4PXBA 2OD6A 5F8GA 3R1KA 2C6GA 4OI3A 3R5BA 4UF4A 4JI5J 4R57A 2XY5A 4LBHA 4UFVA 2QYGA 4K4TA 3K58A 1QUVA 1X7VA 4CS0B 2NXEA 3MGDA 1G2EA 2CNSA 4JI6J 4DSFA 1LANA 3CD7A 3Q23A 1E6VB 2YNCC 4F8ZA 3AOBA 1RWWB 4P6YA 4U7CA 1RBLA 2GIQA 5D29A 2Q4YA 1RADB 2B9EA 2HG4A 1B3TA 2YNIB 1FHTA 3IJ3A 5EMIA 1U8WA 2RAQA 1FTRA 4B10A 1KLMB 3WC7A 3MF5A 1CJTB 2HHUA 1B0TA 2ASLA 3HVRA 2JOQA 4ZVTB 1T7PA 2ZH1A 1GHEA 4UQGA 1LWEA 4FYDA 1I12A 2OPRB 2YKNB 5B09A 4A4JA 4AVBA 3O2IA 4JI7J 3TEHB 3DRRA 3V7ZA 2UXBF 3L7UA 3OL8A 2BUEA 2F4VJ 1I5OB 2ASJA 2E1AA 4ATNA 3N4WA 2EBEA 1JWWA 3L3CA 1HNWJ 3O8WA 2WONA 4DV2J 3KHHA 2O66A 4MK9A 3UVJB 5IT9U 3IR5B 4C2XA 1ZM3A 1AB8A 4FVCA 3D6MB 3DR8A 5D0EA 3NGKA 5E0OA 4LVOP 3OHAA 4RNOA 5HMZA 1EZZB 4D3GA 4HHUA 4IK2A 4J9QA 3I0SB 2O4HA 4KGVB 5GMEA 4DN0A 5IZHA 4I6AA 3M8QA 3UN2A 4ZOSA 2OJ3A 4OC1A 4OHYA 2MKCA 2BEFA 1VQNS 2ZH6A 4P4DA 2V4JA 1KHWA 1XF8A 2M2BA 3LQVA 3LD2A 3EMTA 1X9SA 1T05A 1EJ7L 2UV8G 1DHMA 1RTDA 4PXCA 3GTYX 3HPOA 5KFEA 3FEEA 3CPWR 4QIVA 2QVPA 3PV8A 5HATA 5JVHQ 2NSMA 1Y5LB 4RNNA 4OZ1A 4NJQA 1RT1A 1U7LA 3N0VA 3BR9A 1U1RA 4WXOA 3TR5A 2JNJA 1D3WA 4PYDA 4OX9J 4CTAA 4CH7A 4R9MA 3BLNA 3E0KA 5E7OB 3KG4A 2WVCA 3PZPA 1SB6A 3H5ZA 3MEGB 4XPKA 1WOOA 1ULRA 3BQ2A 4J9MA 3AHPA 1U47A 4R8FA 1S9EA 4K8RA 1NK8A 2ACYA 5CQGA 3ISND 2IMWP 1SL2A 4ZVEA 1WD6A 3OTDA 3GR0A 3EXNA 1V3SA 3IG1A 1U0HB 1F0XA 3NGDA 5M2UA 5KTDA 2ROGA 2GNKA 5IT0A 1YZ6A 1EAYC 5CD4A 3ZZTA 1FJEB 2PJBA 2RF2B 4I1TA 5EHHA 1MU2B 2H9ZA 3FKBA 1U45A 6FDRA 1HWJA 1SBRA 3MPUB 2BVZA 1HEEA 4OFZA 1HNVB 1HBNB 4M85A 3GPAA 2CPIA 4DWIA 4TKTA 2ABZA 1M4GA 5DDQC 3EYZA 4YY3J 3SCLE 3L7OA 2XM3A 2KJWA 3LAMA 1WHVA 1WF2A 2QECA 2CXAA 5J2NB 1Q81T 3BH6B 1KD1T 2MKKA 2DR6A 1TKTB 4NXMF 4DV7F 2QN6B 2R7SA 4ZLJA 2VBQA 2AJ0A 2MZJA 3W8PA 4EZ6A 1UWBB 2UXDF 1RP5A 3RRHA 1A9NB 2AFOA 4DV4F 5H9EK 3CXSA 3PB9X 5KFOA 3NFZA 5T7LB 3GJSB 3LPEA 2DO4A 4B3OA 4YFJA 3LOUA 2CYYA 3ZNUA 1JXLA 5AE2A 4RNHA 3K2YA 2BJ1A 1QE1A 3B8HA 4X65F 1QJHA 3CXCR 2HHWA 4UFWA 4K3NA 1X4AA 2FLPA 2HS4A 4PABA 2MZTA 3M30A 2BOAA 2DNQA 2RMLA 1FNMA 4DCOB 4HHJA 5KFAA 3AODA 3BPSP 4CO5A 5KOXA 3RB4A 3LWUA 2U2FA 2OELA 3MEEB 1BQMA 5G0RB 4U9YA 4DFPA 2VG6B 3FF3A 3H20A 4F0KA 3MWBA 3Q89A 2Y8WA 5EDWA 4UWIA 1CJVB 3BV8A 4LSNB 1TKDA 3BZQA 2E9TA 3OLAA 2OLWA 2ZEEA 3D4UA 3CZXA 2WVEA 3D0HE 5ITHA 3Q83A 1UFWA 2PCUA 2R3VA 2O67A 4RUAA 4B6ZA 1IKWB 1SI9A 3UDEA 5CYMA 2WSCC 3TA2A 3CCVS 5C88A 2H51B 5J1EB 2R8HA 1S49A 1LFWA 1KFSA 3TT2A 2PO4A 4CT9A 4DL0C 4ZPBA 4ZY2A 1FWKA 5K8PA 4G65A 2DIVA 2XMMA 2MY8A 1XNQF 1F2PA 2JBKA 3ISZA 3OXGA 3OBIA 3T5KA 3A8KA 1U6ZA 1VC0A 3ISXA 2KCWA 2Q7SA 3A1YG 1HI1A 3S6GA 2OPQA 1AUSL 1YRXA 1HNXF 2A10A 2MKSA 4DZ6A 3IU1A 3HULA 3PRTA 3GB0A 2KFYA 3Q8YA 3UW1A 1UZDA 4ALZA 5IOLA 4OL8A 2E9RX 5ETTA 2CJQA 5KG0A 4O4GB 4YB1P 4U95A 1AZSA 1HKAA 3C66A 4H4MB 5AJ3J 2YH1A 3SDEB 1UFKA 3MR5A 1T9TA 4URGA 3L7PA 4LR7A 3CJRA 5AE1A 4YB5A 2BRLA 3W61A 2CRLA 2IC3B 4M5IA 3S6EA 4N8OA 3QAUA 4KT0C 1A7GE 1KKHA 1NDCA 3G2XA 2Q4ZA 1NKBA 4HL9A 1QTNB 2QA1A 5L46A 1AROP 5KT6A 3BO4A 2Z11A 4KSFA 2RS2A 3ULHA 2NXNA 2LDYA 2DEAA 5KG6A 2FVRA 3CCRS 2X1AA 3TAPA 5L39A 5I42B 3TA0A 1Q0NA 2IYGA 4RNMA 5HMYA 4DV6F 1NDLA 3CIMA 5ETNA 2CZ9A 3PW4A 5SZTA 2P6GA 4FXWA 2R7QA 1S0OA 4A33A 3M8SA 1TIQA 1NMTA 4V19J 1Z2LA 3PR5B 3LMSA 2HQYA 4UEZA 5A8KA 1TU0B 4YR3A 1CULB 2C2ZB 1H2VZ 3HLPA 2HNZB 4I2QA 2QO3A 3MMCA 2I3CA 4JP8A 2B56A 1F3FA 2GO9A 4EWTA 3WC2A 2NSCA 5L9NA 3GIMA 1I21A 3H5XA 2QLXA 1Q2CA 3J80U 1JQGA 1FD8A 4NMXA 2QA4S 5AG6A 2BANB 1NKCA 3KUGA 5A2QY 2UUCJ 2EG1A 1FWLA 1NMEB 4GRSA 1Y00A 4F9VA 3OTOF 2FDNA 3KUHA 2UXCJ 4WYWA 2J76E 1KSPA 5GADI 1RT3B 1RWXB 2B3UA 3PXGa 1T94A 2W8LA 3CMQA 1M5PC 4HNWB 1VYAA 1FERA 3IRWP 4RUHA 2HFZA 3DRSA 1FO1A 2C3MA 3P3DA 3QAYA 4F6AA 1S97A 1TELA 2AJ4A 3K57A 1XOVA 1CJWA 2ZEHA 1TKHA 2WVDA 3ENAA 4RX6A 2IDEA 2DYAA 4HR2A 2V67A 3KR4A 2CNKB 2DXQA 2HRYA 1DY3A 1RI7A 2ZEJA 3ET6A 4DZDA 2BSWA 5K8MA 2HS0A 1RISA 2P9CA 3T1YF 1KQSR 3NNHA 4DS4A 3CCMS 3KL9A 1WTBA 1KBRA 3QRPA 2J9DA 4MFLA 4X66J 1QDUB 2GJFA 2V8DA 2CIJA 3WT4A 3TO7A 1XRYA 4G1IA 4IKAA 1SV5B 3MAAA 2GE3A 4WZMA 3J7YI 3AD8C 3PFEA 1JNRB 2HFSA 4NXYA 1U2CA 3EWGA 1QLNA 5ETKA 1CVJA 2RILA 1WWZA 2ZH4A 1N6QB 1H6KX 4H54A 1K4JA 4BC7A 1IJFB 5E96A 3JAMY 4J9PA 1RHKB 4KOTA 3QJJA 1UKUA 4DPYA 2NYQA 3MPWA 2ZOGA 4CLUA 2Q1LA 3DMJB 4KSIA 1YW6A 1T03B 4TY8A 2LVWA 1RABB 4OLLA 1EIYB 4DL6A 2Y1JA 2B5JA 3K8VA 1FRMA 4DSKA 4LVNP 2KU7A 1JLGB 1UVLA 1D9DA 4MCSA 1Q8LA 5M2PA 2UVWA 4F67A 2KJVA 4JI0J 5CCLA 4DF4A 2LKZA 4Q38A 2CG8A 2ZE2B 2F40A 3TUJC 3VALA 4DX8H 2HFOA 2K7KA 4HTJA 5LRJA 4ECZA 4XPDC 2CJBA 2V8HA 4C0OC 2GIVA 1J4JA 1B64A 4E8UA 1C2PA 2G4BA 1S1VA 2KVQE 5IS2A 2LQ9A 4F2SA 1C1BB 2OPRA 3MCMA 1R89A 1MJBA 4NX9A 1IBKF 2EK9A 3PO5A 1QSOA 1Z8LA 4RI1A 4XPDB 1S7KA 2V2KA 3E3XA 2BEIA 4ZVOB 3HJVA 5B0GA 1Z1ZA 3QFHA 3LAKA 3P2HA 5H9FJ 1U8SA 4YU9A 3FRYA 1VISA 1HPZB 3BBBA 4B3RJ 4KFBA 2DRDA 1R0AB 4AYBD 3PIOQ 2FB0A 2B3TB 2JEJA 1NSPA 3EUNA 1YQEA 3UCUP 4IH7A 2JVRA 4ZLLA 3N7ZA 2QIFA 1OY9A 2F9JA 3M2VB 4GVLA 2YX1A 1J2VA 3AFGA 1XBWA 2RD5C 1YIJS 5BWAB 3OXFA 1RKJA 1XNRJ 2YH0A 5ETMA 4NLDA 2G9DA 2LA6A 1MN9A 4X64J 3OSPA 3QZ8A 3DLBA 3T3FA 2P9EA 1OSCA 1OY6A 4H2KA 4R5PA 3GV8B 2A4NA 1HI8A 4P2SA 4X4TA 3FBEA 1Y7EA 3KGQA 3GJRB 2MLZA 2CPYA 5EC4A 3PIPQ 2VQFF 3PJ9A 3QNVA 2VG5B 4KPCA 5EX3A 2CFXA 4O0IA 4DX7A 4PYAA 3MEGA 2AV5A 5DWMA 3RG6A 2X1GA 3B3SA 3NS7B 5KFRA 4U67Q 3R1LA 3I96A 4AG7A 3KUEA 2C3UA 4UIBA 1S60A 2G0CA 4K59A 2ZD1A 4P44A 3M6WA 4HTIA 1H73A 2KT2A 5DGBA 3CDEA 4YHHJ 3RAQA 1U0HA 3S1TA 2HYIB 1KOHA 3DDDA 3W9HA 3OTCA 5KTAA 3EC4A 1RHMB 4PK2A 3V6DA 4OC5A 4RL1A 4OLOA 2MKIA 1FEEA 1RTJB 3X1LB 1RXTA 2JFKA 1YRUA 4Q45A 4ZN3A 1EX8A 1S59A 3A4TA 5IV0A 1YX2A 1FT7A 1W26A 1HNVA 3DDNA 4YB6A 1REGX 3OFFA 1S6QA 1IBLJ 3PB4X 1NHVA 2XSJB 3B3TA 1K1QA 3BJ8A 2EC2A 3W6SA 5CXTA 3MPVA 1HR0F 4OZLA 2XLKA 1DRZA 3T6JA 4CLTA 4NXNJ 3H7HB 5HP1B 2CQHA 3K17A 4PCQA 1WEXA 3CCES 5T7LA 3PJWA 2PDAA 2VFVA 3GFZA 4CO3A 3ZJ0A 2FC9A 2E44A 1JK9B 2D3OR 1Y3JA 3IM8A 2HSEB 4CRJA 3G3SA 5T14A 4HDHA 1OYDA 2H5IB 1H7XA 4C8KA 4USJC 1RAJA 4ORFA 2EO8A 1SKRA 2P6SA 1PGZA 2ATCB 3OFHA 2ZC3A 3ONQA 3FCVA 3HD1A 3KKFA 1X0PA 1F9FA 5G0RA 2J9EA 1TF9A 2VG6A 3VQSA 3L9ZA 3NMAA 3GV7B 3MHYA 1RT5B 4P4BA 1LK7A 1S7LA 3IEHA 4DF8A 3SMZA 1ZLHA 4PG5A 3GSDA 1YREA 2MQQA 4ZPDA 1MW7A 3ILOA 3QJPA 3FUYA 3NH8A 4NRTA 4WU2A 2BM1A 3LWLA 3THTA 1NK0A 2BM0A 1I94F 2N4CA 1SH0A 2WB1D 4OJ3A 1O5JA 4WJBA 5EN1A 4R8UA 1SVDA 1S1TB 4LFAJ 3KZWA 3OL7A 2XMUA 2EFOA 5F0UA 1N36J 3BQ0A 4WFBQ 1NH7A 3KHZA 3GYAA 3B35A 5BYQA 2Z2MA 1Q53A 3T1HF 4C7QA 1VQLS 2CPJA 5KFGA 1TAQA 3AY0A 2HHQA 5D4PA 4J9VA 3TI0A 2KFNA 2KXNB 5JM6A 2UUTA 1VS3A 4NZ6A 3T9ZA 1Y0HA 1Q78A 3W5ZA 1N32F 4Y2IA 2HVHA 1AA1B 5KT5A 2GIFA 3MM7B 4A37A 2LP4A 1L3UA 4GC7A 4JI4J 1IR1A 2AGPA 1VFJA 4PXEA 4QVTA 4G6VB 3NNAA 2ABYA 2EFPA 3KJQB 4WIIA 1DURA 2B6AB 2IYIA 4C8LA 4DSJA 5D4NA 5CBMA 2FJEB 3D6TB 4CGPA 1MG7A 4L73A 1RT6A 3EPIA 3A3PB 1S0VA 4GO5X 5FIIA 1M1GA 4F4YA 2QL9B 2ZPAA 3M2RB 2D7SA 5KG7A 3HFVA 2MTLA 3D66A 5GAEU 4J91A 2NXUA 3H4BA 4OQJA 1SIZA 1ZG7A 3I9SA 1TL1A 3NEKA 3G8TA 1X10A 2PC6A 2L08A 1V5VA 2NR0A 2HZVA 3B3WA 4WZQA 1JLFB 5JJBA 4M6GA 2FYXA 5I42A 3CPXA 4UUWA 2EI5A 2CVEA 4Y34A 4ANEA 5AG4A 1EETB 1N54B 3C16B 2AQ4A 3PEJA 4YDDB 1MMDA 3KHLA 1X12A 3A9LA 1VLOA 2RDIA 1NJYA 1EARA 3BXMA 1T11A 4N7TA 3NBPB 4RW7A 3RAXA 4OJHA 1EP4B 4ZCLA 4RR5A 2R9LA 1SL0A 1TUGB 1SCJB 3F0AA 3T6BA 3D7GA 4WKRA 2GX8A 2C2NA 2VPXB 2SXLA 4C8MA 3AJ1A 2QMUB 2ZELA 2DNYA 3SI0A 1NJZA 1JXVA 3G8SA 2FHKA 2AIRB 4ER8A 2BANA 4E0AA 4OC2A 1WF0A 5HJXA 4F02A 1WC4A 2FVQA 4MKYA 3WR7A 3FGVA 2V68A 4CLZA 4ID8A 3CJ0A 3U02A 5GAGU 2BCOA 2JLEA 1UJ5A 2ZUGA 5H9FK 2V77A 4MKAA 1F57A 3CJKA 3O44A 1IM6A 1RACB 2V8PA 2EBGA 4O3QA 3C8YA 3HCXA 3V6KA 3CULA 4WE1A 2KO1A 1XQIA 2DR5A 4AD6A 2ZDOA 4BC9A 3QZ7A 5H1SV 1OYEA 3EXCX 3OXLA 5E3PA 4MCPA 2ZKTA 2I5JA 1FRHA 4DL3A 4ZVFA 5HMWA 1S1UB 4DUYF 4DR4J 4X4PA 2H48B 3G82A 2YNFA 1X60A 3FVLA 4C3KA 1IKVA 2D1CA 3OR1A 3J7ZT 4RU2A 5KG4A 5KFQA 3RW7A 5KG1A 2DPJA 4I7FB 3KWMA 2GW8A 1TUWA 3AJ2A 3TUPA 5IC6B 2AYGA 1G7CB 2YKMA 3SCKE 3VV2B 3ENVA 2GHWA 3DI6B 5DS0A 3LANA 3A12A 4ZI6A 3U27A 3W2VB 4J3GA 1SV5A 4YOEA 4JI6F 4QR0A 2VDIA 1L3KA 3FFIB 4LQ3A 2DF5A 3J81U 1TKZA 3KLFB 1SQHA 2QSWA 1R0CB 7FD1A 4KGZB 3PHTA 2JEVA 2MZQA 4YFUA 4NPOA 4UCMA 4O0NA 2G0JA 1X4BA 1YJRA 2R4FA 3TUIC 2RFHA 2MJUA 1GX6A 5B0DA 2FLLA 3JSMA 4QWAA 5KFTA 4KORA 5GCNA 2C22A 4AXJA 2R2SA 4GKKJ 2ZE2A 4ID5A 2YX4A 1FJGF 4RLEA 5K20B 1Z8XA 1WI8A 4Y49C 3BSNA 2XLIA 4TXSA 2IVMA 1F9HA 1WSRA 4MRIA 3BBCA 4AVCA 1S7HA 4KOWA 4I49A 2EFVA 1NAQA 4IFYA 1C1BA 4KO0A 3OTBA 3KOAA 3LP1B 3RB0A 4GXHA 3X3UA 1OZPA 2YPYA 2BJ7A 5K14A 4CT8A 4Y49B 1K1SA 2Z58B 5IQ6A 1N34F 4TYBA 4HI2A 5EWFA 3C15B 2ZUAA 4QYZJ 4NL5A 2L9NA 4LREA 2PJAA 2Y1IA 3I56S 4L89A 3TARA 4NLYA 2OH1A 4H4OA 5IT4A 5ETOA 3AB4B 1Y4ZB 5FLXU 1QQ9A 1BC6A 2BE7D 3D28A 3MECA 4K4YA 2UXBJ 2J0SD 4ED5A 2M52A 2BJ3A 2LMIA 5D15A 2IMOA 4CI0B 2LXUA 2ZENA 2DNNA 3V81B 4PQUB 1B70B 5F3TA 3BJ7A 4RW6B 5LYIA 2Z56B 1TKFA 2Z2LA 1VHEA 4EEYA 3M2VA 3J80Y 3OVAA 1FEHA 2CWKA 3KKWA 2Z3LA 1WJ9A 4KOYA 3LUYA 3CC7S 3UE2A 3PB6X 1WWHA 3SXLA 2QLJB 3QLHB 2BBEA 3HHNB 2DXFA 1R6YA 4C68A 2E1MC 1ELOA 4S0MA 3VAIA 1VRTB 2VDHA 5HVFA 2FVGA 4MIAA 1R0BG 4KV8B 1RT4B 3NCPA 4NCZA 1U48A 2GAGC 1OMSA 3MPYA 2PI4A 5HL7Q 2GVZA 3PRVA 3MFIA 2AYMA 2HKEA 5HVGA 4IO9Q 3D6HB 3I9V9 5LJ3Y 3B4DA 2EPIA 1NB2A 5KFNA 3BGRB 1NDKA 4N56A 4MTPA 3SI8A 5E3CA 1F2HA 1S0MA 1SQGA 1KVKA 2D9PA 2OD4A 1SUQA 3FMCA 4IUSA 3FEXB 3VARA 1IJEB 2O3DA 3W63A 4MFZA 1IOIA 2P2CB 4I68A 4LR9A 3KNGA 4KTQA 4I6WA 1WUUA 2YWKA 3DRYA 4USTA 2EW9A 2BQRA 4F4KA 3Q86A 1IBMF 1K73T 2EK6A 2IAJB 1X4FA 4MXUA 2K3KA 1YHQS 1GMWA 1HA1A 2GMHA 3R1HA 5J2QB 3M9NB 1XEBA 3S8SA 4ZLNA 2NZCA 3D3BJ 2JC0A 4ZVPB 2MLXA 2NLWA 1PBUA 4CGMA 3SQGA 2IJFA 5CYQB 2XMAA 2VHGA 4B3TF 1U1LA 2CQ2A 2IJNA 4OYZA 1HBUB 2VU5A 3GMGA 2KT3A 1B7YB 1FK9B 3H42A 2P0WA 1NHKL 4AQYF 3VATA 2HURA 2VFTA 2PIIA 2F5IA 2V34A 4FYWB 4PEOA 4O3SA 4NXMJ 4DV7J 5IB9A 3BI1A 4MIWA 1N33F 2UXDJ 1SKSA 4CYNA 4OX8A 3AD7C 2XO6A 4DV4J 4LF4F 4LIRA 2Q3PA 2BMBA 2I1RA 4CM2A 3KI9A 4PUOA 1JXEA 2B9YA 1XFOA 3ELHA 4CO0A 1UA1A 3OWCA 2ROPA 4EK2A 2E1CA 2LA4A 1JLQB 1BHNA 1RT5A 4LSZB 3KK2B 4X65J 4QCLA 2FZKB 1LXNA 4KOSA 1GFWB 4YR0A 4OAEA 1WDTA 4RZRA 3BPDA 2HNDB 1VHSA 2KHCA 3E2EA 3HT0A 2ZW4A 2XYHB 4DV1F 4UY8T 4L74A 2MQLA 2XO7A 4ES1A 1OPZA 1RHQB 2GFQA 4DLGA 1XMTA 4USMA 4FYXB 2BZ2A 1V3ZA 4JV5F 4IF5A 5CYJA 2PMHA 4ZVHA 4FBTA 2DH9A 1N5SA 2QYCA 4C8ZA 5CZXA 1QTMA 3HHDA 4M94A 3HHKA 3TCVA 1VRUA 3CDXA 1FKPB 4RBTA 3K5PA 2AJQA 4M3SA 1TL3B 3E01B 4EYIB 4NYPA 4JV2A 3WX4A 3PEHA 4K50A 2N7YA 5DJBA 1U2FA 1ZA1B 2XEJA 2CG4A 1J27A 2ILZA 3BKFA 2ZVIA 1IWGA 2GJ2A 2VEZA 4MKVA 5GMDA 2Z3OA 2IM2A 3GJQB 4FDFA 1XNQJ 1FY7A 3S9LA 2J8MA 2PJ3A 3M8ZA 4GM5A 3I32A 2XMJA 4ONWA 4NLXA 1H2UX 3NS6A 2QRRA 2G9OA 2BW7A 3R3TA 2WVBA 4IFVA 1GXTA 2H4WB 4TQSA 1HNXJ 1C1CA 2LECA 1WDDA 3N01A 4NGMA 2AF6A 3SSSA 2MQOA 4IRCA 4RWXA 2FJVA 3MDFA 4MYTA 4PKDB 4JZ0A 2OSRA 3MM8A 1L5UA 2XBPA 1QSLA 2N82B 4RUBA 1Y5IB 4IR1A 3TOAA 1ZOTA 5H84A 4F3QA 3CIZA 1YW4A 3MUVP 5C2GA 2B9WA 2GHVC 5HMNA 1HARA 4KS9A 1DTQB 2IY5B 3MUTP 4C11B 4AL5A 1KVJA 2BA9A 4KVOE 4OV1A 3R5AA 2V2QA 3QIPB 1U1OA 5AGEA 4AB7A 3BYRA 1OQ3A 3DC2A 5JXSA 4KSEB 2BE2B 2OPSA 4DFJA 4JV1A 4CM0A 3L4BC 3NCQA 4XIUA 4YRHA 1EP4A 2VV5A 2BJ9A 2HIQA 4NLWA 3RRGA 4Z37A 1W2IA 2AX0A 4QR2A 2ZBCA 1S0NA 4P7VA 2XCAA 1F1BB 4DV6J 4EMDA 1R27B 3VAHA 3NAHA 4IH6A 2RKIB 5ETVA 1YJ9S 1Z5RA 1R43A 2C2MB 4B5PB 3LP2A 2CJXB 3KLIA 2BW2A 4FXDA 2R1IA 5HBMB 5KTQA 1Q79A 1PU9A 3M8WA 2DNMA 2IHR1 3ICLA 4FKXA 1B87A 2P9GA 4QYZK 2D3O1 3K89A 1NPPA 4BBHA 3K2KA 3H2UB 5AXNA 4KHMA 3FJUA 1SC4B 1I1GA 3KLEA 3O5TB 2UZAA 2E1RA 5BXIA 2PVWA 4B3SJ 2WPXA 3PYGA 2QG9B 5L9XA 2V8VA 4P72A 4WFZA 3FK4A 3OTOJ 1U1NA 2XCPA 3P96A 2D69A 2V2VA 3MMAA 1NUEA 4G1QB 5LRGA 2P6EA 3V6JA 1SC6A 2VQEF 4OYIA 1DFDA 2NZ4A 3NXZA 2XMWA 2W4PA 3KHRA 2WW4A 3HSDA 4K0KF 4ZY1A 4FF1A 3EGZA 5DG9A 1UETA 4R3LA 1GNKA 1TP7A 3CPAA 1C0UB 3NAIA 4R0JA 2YKOA 1RO5A 1P27B 2PSWA 2Z3MA 2B7BB 4RW4A 2ADCA 5L1JA 3BGUA 3UR3C 4DDFA 2C3OA 2Q44A 3NOGA 2G1HA 3K8WA 2ADBA 4E98A 1M5VC 3SEOA 3DGPA 5C7PA 3MMJA 3JQJA 2CQCA 2W7OA 4L3KA 3FFIA 3TX8A 1X5OA 3T1YJ 3PACA 4EVYA 9ATCB 3MMBB 1LW2B 3K7RA 3R2DJ 2VC1A 2OR4A 3H8YA 1QSMA 4P4FA 1VDHA 1HIYA 4CYPA 5G4DA 2CQPA 4DR3F 4RBVA 2ASDA 2WVFA 1JB0C 4WPAA 1VIXA 1RWNB 1BGXT 3GFXA 2Y3YA 4NGQA 4LF6J 3EICA 2ZEOA 1B7FA 2ZZMA 5AE3A 3VWDA 3HF5A 4JLYA 1PUAA 4Z2XA 2LQJA 4ZX9A 1F5CA 4UY85 2VBZA 4A38A 4IUFA 2VL1A 5D8NA 3H8FA 5KOWA 1Y7RA 3QPIA 1RKIA 2YPZA 2WZNA 2HS3A 3NE8A 1LWEB 4NLTA 1DTTA 2P6FA 1CSJA 4KH0B 1IBCB 3R5JB 3DRRB 2CPHA 2X7BA 2V0NA 3LP1A 4I0WA 4JYAF 3MURP 4EZ9A 1CPZA 1QUPA 3R6LB 4U96A 4N76A 1RU1A 3C46A 4YS2A 5DG7A 2A18A 4OYWA 4DR7F 1RGVA 3C15A 4IDKB 4A8OA 2WONB 1NK7A 2ZEFA 1UVNA 4NLQA 3EFAA 1ZH5A 4FBEA 4KBIA 4DEZA 1ZETA 3G4SS 1QD1A 3CB4A 1WNEA 2NXCA 3QNWB 2CJAA 3BJYA 2FJAB 2X7IA 2R98A 2VH7A 1IB1E 4ZIVA 1IBKJ 3JYTB 2J9DE 4KR0B 3M8QB 4Q5VA 1F2GA 3R7NB 2ZBIA 3TNVA 4PQUA 2FHMA 3FB3A 1T05B 3TW0A 3UD4P 2M7SA 3FECA 3CD5A 4WU3A 1KNZA 2GU2A 4W92B 1RTDB 2JH3A 5A8WB 4C2MA 4OZ2A 3P49B 1RAAB 3SSQA 4JOUA 5L8RC 3FEDA 1SJFA 4KYZA 3M32A 3RBUA 1ZAXA 2OO4A 2F63A 4QW8A 4DL7A 2HAIA 2QTWA 1RT1B 2EEYA 2PGCA 4F50A 1XEZA 4AFFA 4AXVA 2CTCA 3RB3A 1F6TA 2Q79A 4CTAB 3ZZYA 2XS2A 3DHXA 2Z0GA 1RTHA 4YR2A 1XIXA 1SC1B 4UOFA 4YHHF 2W25A 4F04B 4MAKA 4QOTA 3NGUA 1RCXB 5G1ZA 2CPDA 2HWHA 3T5JA 3QRRA 1S9EB 2AFWA 1FFWB 5FDLB 5F8NA 2KVIA 4FNIA 1NDPA 1VHIA 3QFWA 4QJVA 5F48A 4CYUB 3QMQA 1D0EA 2OEJA 3K5NA 1F9EB 1X5TA 2E5HA 3KK3B 2EXUA 3IBWA 5IV4A 3ILJA 4A46A 2RU3A 1RA6A 4M63A 2QFJA 2YNHA 5HANA 4IYQA 4DSIA 1G6BA 4NXNF 3T9NA 2F1FA 1R6VA 3W1YC 5KFSA 4HLBA 3NGSA 3SV3A 4H6ZA 4WWVA 3FZBA 3KNAA 1FKAF 1UVMA 3J81Y 5DM7Q 3PKMA 4KH1B 3KLGA 2CPEA 3TZXA 3NWRA 2QA4G 2VQYA 3ENQA 2CNNB 3PX0A 4BHQA 2BE9B 1HWLA 2BKNA 5DRKA 2YTCA 5CYQA 3VTIA 4IRKA 4B3OB 1RAIB 2JZ5A 2I8EA 2YNGA 4YMEA 1JIHA 1QE1B 5KAKA 4OKOA 3BN7A 4A95A 4DG1A 2XMTA 2COLA 5F9LA 1M1DA 3VAKA 4JBCA 3M30B 1HR0J 2MLYA 3MR6A 2ZW6A 4KOVA 2HWTA 1JJ2R 3MAHA 3DGVA 1BQMB 2G3AA 2RRAA 2QZ8A 1TFWA 4MFBA 2AZ1A 4QWCA 3BN4A 7FDRA 2B58A 3M6VA 1FDNA 1JLQA 1Q2YA 3MCOA 5IM0A 1X31C 5F8IA 3MM6A 1TAUA 3MFHA 1PC5A 1MSWD 2EFGA 3GFHA 2JHEA 4CGNA 1D8ZA 4RO0A 3QAHA 3U1LA 4MKBA 5FLXY 1XIQA 3KTQA 3BH7B 3MD1A 1TV6A 3SIPB 3EXYA 3JRUA 3LA0A 2V4QA 1BLUA 1VR6A 4G3IA 2XC9A 4EGLA 1Q8BA 5J2PA 2OMOA 3DXBA 2FUG9 1YMEA 2FVPA 1FKPA 3W3SA 3G6VA 5LM7E 5DDOC 1OWXA 4NRUA 4PWUA 3IWNC 2W7PA 3P45B 1DTDA 3EGNA 3JAMU 4BCAA 3NKYA 4NWBA 4R76A 2FY1A 3PYEA 4TNOA 3IBFB 4Y0FA 3PBEA 3KMSA 3SJXA 4YDXA 4JI1F 2ZEDA 1H0HB 2RRBA 5BYRA 4C3MA 2KL8A 2GMLA 2ZBQA 1AZSB 2HHVA 1K44A 1JJ4A 2QYVA 2XY7A 1YDLA 3FRZA 1N32J 4R3KA 4LQ6A 5THWA 1QAIA 1Y9KA 2VXKA 2V63A 3UD3P 4WF9Q 3SQOP 2AFMA 1OBRA 2MMYA 2EK1A 3A3OB 4USKA 2IVFB 4P74A 3J7A1 3QBCA 4A8WA 2ZHAA 1JJCB 1BO4A 2LDIA 4QB9A 2XI2A 3O1LA 2W2PP 3CJQA 3PX4A 3W6XA 4ITSA 2MY7A 1YK3A 4DSEA 4AG9A 2EFQA 3BSAA 4CYQA 2BL1A 2ZWPA 5KTCA 5GAGI 1DTQA 4ZJOA 6FD1A 1S9GA 2RIJA 4TQRA 1Q5VA 3CJ2A 3IIBA 3EGVA 4RBUA 4DFMA 5A8KB 3IP0A 3I5BA 4LQ9A 1HD0A 1KONA 3KK1A 2J8SA 4GKJF 3MMCB 2E5GA 1R57A 2GLJA 3CCJS 3U7JA 4OYOA 1LOUA 4K4ZA 4NFRA 2HLUA 5DDPC 3H4DA 2Y1LB 3EVMA 5LT5A 2R7TA 2RKIA 1QSTA 4KB7A 3CD0A 3AXMA 3D5MA 5KFKA 2LXIA 3US5A 1Q5YA 3TOQA 2HQ3A 4GVBA 2KT5A 3B78A 1VQMS 4UCNA 4DR4F 1NZAA 2J6TA 2VPWB 1DLOA 2VB6A 1JLEB 4X4RA 2Z0ZA 3CDAA 4FNHA 4EO6A 2DPIA 1BQNB 1Q7LA 3CGIA 2KN4A 2Q6CA 3IC1A 3DRSB 1RAHB 1OQ6A 1U1MA 3TVYA 4L75A 2PRBA 4GC6A 1JX4A 4TN2A 1DE4C 2VKRA 4WP3A 4KHPJ 1S1XB 3A8IA 4B3MF 1DAXA 3OW2R 3F41A 3CCTA 2CWXA 2HV2A 5J1QA 2BYCA 3ZZZA 2CJKA 5E3AA 3ZNJ1 2FPHX 1Y0YA 4FD5A 4M5KA 1PAUB 4C7HA 3DLGA 1YVOA 4BDPA 2K1RA 1C0UA 2I6WA 1AUDA 3D0GE 1VK3A 3JTPA 2B8QA 4DMZA 3CDWA 3CDBA 2A6OA 2JBJA 2XNQA 1M5OC 4DUYJ 1ELLP 2IM3A 3FXTA 2GZOA 4CO4A 4XNHC 1LEOA 1NJIT 4MCRA 3IRXA 3AOCA 1LW2A 4YEAA 5KG2A 4GKKF 3ZZPA 1FJCA 4C3LA 4C2YA 5FJ4A 3CEDA 2ALZA 3BGOP 2X51A 2XEIA 2V9KA 2VG7A 4P45A 3W9IA 4TY8B 2ZBPA 4XNHB 2FQQB 3PB7X 3AD9C 1B4SA 2B5JB 2DKOB 1S5ZA 1T0TV 2QMXA 3EPGA 5F49A 3TJAA 1T3OA 4A8FA 5LXRA 3BI0A 1PYTA 4F8RA 4NEXA 2DGVA 3JS9A 6CPAA 4L6V3 1HNZF 4ZVSB 4OZJA 3ZXWA 2QEXS 3F5BA 1SJQA 1S1VB 2GQCA 4FWUA 1RLCL 3ZTOA 2YKPA 1S6UA 1FFGB 4QZVB 1VIOA 3IU2A 4X4VA 2A3JA 2JJ4D 2DNKA 4QPTA 2KTQA 3QGPA 3W5YA 1VC5A 4WFNQ 1FJGJ 1P8GA 2HVZA 4IG3B 4IDKA 2DHXA 1TUVA 4ZP9A 4ZCKA 4KJIA 2UU9F 3I87A 2GV1A 3CW2C 3M8PA 1QVFR 4KFBB 4QBJA 3FSYA 2BX6A 4Q0BB 4M6IA 2G2OA 1HW9A 3R9EA 3JYTA 5F8HA 2OSQA 4OX7A 1UCNA 1VQPS 2P8IA 5K5MA 4FPIA 1N34J 3MM9A 2F4FA 1YJTA 3VAMA 4C98A 5C25A 2DHSA 4TY9A 5D3GA 2LQBA 2XY6A 2RE1A 2BDPA 2DNOA 3FNNA 3GCXP 4YGOA 4M5DA 5A0YB 1S5KA 5A8WA 3DLLQ 4NE9C 2C3PA 2CKWA 1YJWS 2RQMA 2KRRA 4IHMA 1M4IA 3UD5A 4ZVUB 1BY9A 5B08A 3R95A 4R5PB 3H2VE 3JSYA 5JUMA 2CQ0A 5LRKA 2C42A 4J9SA 4ZKAA 3Q2TC 1TK0A 3R9GA 1NBEB 2W9CA 2DT9A 3Q8UA 1S79A 2E1PA 4OZ0A 1HWUA 2VF3A 1YZ7A 4AT1B 2YXLA 3PFOA 1CC7A 3DOKA 5FDLA 3LGNA 2ZD1B 2XEXA 4ZVQB 4LJMA 1SC3B 4CYUA 2OFGX 2HGNA 2HIYA 3P8BB 1WACA 3KK3A 1RCOB 4Q2LA 4OX6A 4ED1A 3G8WA 3J7AN 2QLWA 3RGIA 3WC0A 3V6DB 1S1WA 3S9MA 1PAEX 1E6YA 4ANDA 1GEHA 2MQNA 4QW9A 2XG8A 2W7AA 2H54B 5JPHA 2BKPA 4OYAA 3FBFA 1S6QB 1LW0A 2MSSA 4EBEA 1M90T 5KFMA 3IWXA 3T5HA 3HJFA 4I2PA 2LU2A 2V4RA 1RHUB 3TO9A 1TZ0A 2ZXVA 1VGYA 1IBMJ 3IA0A 4KLWA 3UDVA 4PQAA 5BJRA 4ED7A 3E8OA 2Z3KA 1N8RT 4CDIA 2FLOA 4IH5A 1ON0A 2BXJA 2X3DA 1QSYA 1HNIA 2W9BA 1IR0A 2DCUB 4IRDA 1XR6A 4B3TJ 2FE7A 1UVIA 7AT1B 1FRLA 3OFGA 1Q16B 3U1MA 1UWAA 4DR2F 2VICA 4AQYJ 3OVSA 2C1EB 2KZZA 5HMXA 4FS1A 2OI2A 2AWZA 2KI2A 5A8RA 1BMQB 4P71A 2MKYA 3MN8A 2ZDPA 4DV0F 3LODA 4L8AA 3W60A 1HBOA 4KIAA 1UP1A 3MEDB 1N33J 1BQXA 1UMJA 3GZ7A 4ECUA 4M6HA 4R8UB 4LF4J 2EFNA 2R42A 4Y2KA 1WG4A 4RU9A 2XYPB 4LFBF 4K5RA 4F4ZA 4F26A 2FSRA 1H38A 1EQMA 4U8YA 3CTRA 1KS2A 3HK2A 4A8KA 4KE5A 1VOMA 2N3OA 3T19A 3IR6B 4ETXA 2MGZA 2LEPA 2RDDA 4WK1A 4FUUA 3TUZC 4ZS6A 5KFDA 2PJ2A 4DV1J 2DR7A 4RW8B 3UO0A 2W2QP 1YBAA 3BF4A 1GXUA 4CH0S 1FCAA 2EWBA 3DCAA 2PJ5A 3I5AA 3WIUA 4KOUA 3QIDA 1FRXA 2WZ1A 3LWMA 2HHSA 4OI1A 4ECRA 3TAMA 4JV5J 4CNZA 1NKEA 2UUBF 1X4DA 4UTGA 4P2FA 1JLBA 2XULA 2POKA 2M9KA 3QT8A 4FVMA 4FN5A 4ELVA 2QV6A 4ZPCA 3C6UA 2IM1A 4B9LA 3R2CJ 4KY3A 3D54A 4YN3B 4UIAA 2M0GB 3RNZA 1DQ9A 2I38A 1RT6B 2IBOA 4ED3A 1T9VA 2BUNA 2RVJA 3KXDA 3KYLA 4JI3F 4PG4A 1APSA 4DV5J 3VF0B 3CC2S 4FKYA 4DUZF 3A8EA 3D1OA 4IQXA 1NH8A 2E5IA 4USIA 2OP5A 4OJGA 4NCBA 3V4IA 2CA9A 3HKWA 1TL1B 2XQCA 1P1TA 1IKYB 5B0CA 5I4MA 1IYLA 4PWWA 1KZFA 1YLOA 2BJDA 4UBRA 2DGOA 1FRIA 1WHXA 2KB2A 5LXYA 2F8HA 3JQMA 2LEBA 1A6LA 1CS4B 2LYVA 4OYPA 4DR1F 4JI2F 3OLBA 2BJ8A 1U6BA 3UNGC 4XTTA 3P5BP 5GAHU 2AU0A 2YWEA 3LW5C 2HVDA 3GY9A 3JSBA 2UUAF 2AW0A 5KT7A 3TEGA 1G1XA 3K5MA 4KUBA 5D0GA 4J7CA 3Q24A 5FD1A 4ECVA 3C19A 1VQ7S 5F8JA 4R25A 2FGOA 5AT1B 3IWGA 4RW7B 3RJMB 1RTQA 3ETMA 2ZZNA 2GS8A 2PDOA 2XWYA 2QL5B 2FZCB 3G6YA 3DLKA 2CNTA 4LUAA 5C42A 4C9DA 5KT2A 5IWAF 3M2UA 1PYOB 2OPPA 2KXFA 2DR8A 2C2OB 5C82A 3RBDA 1LFPA 2WOMA 4B3SF 1OIAA 3QO9B 4UOHA 4RS2A 4C7IA 2W1BA 1U49A 1T02A 1RWUA 1JLAA 1AFJA 3IS9A 3GLJA 3PCOB 2MEWA 4L3NA 3R6GB 2HZCA 1JLEA 3CJKB 5HN0A 3IM9A 2QLFB 1BQNA 2D4OA 2NXJA 3HHLA 1Z4RA 4MK8A 2PSZA 4W98A 3TZYA 4HEA9 1QVGR 4ES2A 4WYLA 1WEZA 3IFEA 4WE1B 4IG0A 4LSLA 2HFNA 2I5JB 4U9RA 2F5GA 3G82B 2YNFB 1S1XA 1N71A 3IR7B 1SKWA 1IKVB 3CMES 4F2RA 3CCSS 3OR1B 1NJXA 3QJLA 4OIDA 1FA0A 4DQQA 3D8PA 1M44A 2Q4VA 1HDUA 2PRQA 2JEWA 2CPXA 1LNQA 2HMIA 1X4HA 3R5CA 5B0AA 2B9XA 1W7WA 1WKKA 2YKMB 1XTZA 4NYOA 5AXLA 3QQCD 4F4XA 4B02A 1U24A 4QPXA 4DL2A 2JLGA 1VQ9S 2J7WA 3W64A 3HXMA 2VQEJ 1SL1A 2Q04A 1ITPA 2R8JA 4LF6F 1TKZB 4BD9A 4OI6A 5KFZA 2NSBA 1YRTA 4K0KJ 2XEFA 4PR6A 3F0NA 3D7HA 2D4PA 3EZUA 2RDJA 3BREA 4OI2A 4CNYA 4DPTA 3Q22A 1NPKA 1Y5NB 1KUVA 2H1YA 4KPYA 3JSMB 3JVNA 1U4BA 2ZOMA 4P7TA 4XAKA 1IKXB 3QRQA 3HKZD 4R87A 2ACMA 2AT1B 5HO4A 1MWZA 5KFXA 2MZSA 3DSBA 5C24A 3GUXA 1FI4A 1SH3A 1Z4UA 4ID5B 1C4AA 4QWBA 3PX6A 5DQGA 2IA6A 2HBZB 2ZW5A 5KFLA 1RUSA 5HK4A 4DR3J 3W91A 3GYNA 3ZTSA 1U0SA 2E7XA 2R7XA 4DR6F 2WTFA 1ZTTA 3IWEA 4KO0B 4IFYB 2B4PA 3FZ2A 2GIRA 2F8MA 5K14B 2IBKA 2BO9A 4C2ZA 1HMVA 4Q44A 1UEKA 2U1AA 5BR8F 2JL9A 3K9UA 4IG3A 1S77D 2DK2A 2B8PA 4OYMA 4QIEA 3R9LA 1V0CA 4H4OB 3RUBL 4KC5A 2QX0A 2OMLA 2KKHA 3CCUS 3KR5A 2R8VA 3D68A 1B99A 1ELMP 2NMTA 4USHA 3MECB 4Q0BA 3HVTA 2DNGA 2CJYB 4PG6A 4JYAJ 1AXQA 4DX6A 1VHFA 4OHZA 4DR7J 2FTRA 2R7HA 3D67A 3MI7X 1RBOB 4DFKA 4P52A 2H4YB 2Q51A 3B4MA 4CAWA 5ELYA 1X5PA 4ERDA 2E29A 2AKWB 1MWYA 3FQLA 5A0YA 2WPWA 5A6PA 4DQPA 2YX7A 1MMNA 3TFYA 1HQEA 3W7BA 1N5TA 5U47A 4K4SA 5HI7A 2OKQA 1WOPA 1F5AA 4Q7AA 2LU1A 4B9TA 4Y3CA 2Y1RI 2NUUG 2DO0A 5CPAA 5DZ6A 3Q0AA 3CSKA 1BLLE 3GILA 2VUGA 5KFIA 4C0BA 2GVZB 4EFDA 4FYYB 3NMRA 1R8PA 3VWSA 3DHWC 2EG2A 5HLFA 3CC4S 2BACA 2NUHA 2ZH9A 2JSXA 3S6KA 2UVRA 1RTIA 3PNIA 3FCWA 4ZJQA 2DIUA 1EKRA 4WP9A 1SUQB 2YVSA 1MLAA 4KGXB 2CADA 3FMWA 5B7WA 1T8EA 5LYDA 1YK9A 4M5MA 4F25A 3CMAS 3A3NB 2RJZA 1PG5B 4DR5F 2DNLA 4MJ8A 2QFIA 1VJQA 3OTEA 4BINA 4M5NA 5ISVA 1IQTA 1CPXA 4K4VA 1HL6A 5F8LA 3B6BA 3UCGA 2OEMA 2EBJA 4Q8FA 2CIMA 1NNDA 3C14A 2ILYA 2NS1B 2YY3A 3TYTA 5F46A 1ZS6A 4ZPVR 3R96A 1SJRA 4CRZB 4DL5A 4NEZA 4H6UA 1C0TA 2KG1A 3MAQA 1L0CA 3KFWX 1JNZB 2RT3A 4N41A 4X4OA 3CJ4A 3VQTA 3M8YA 2VA2A 2AP6A 3SQGB 4B08A 3HFZB 5F0WA 4ZIWA 3VGVA 1Q2DA 1S10A 1GQEA 2FJDB 2XEGA 3H98A 4J37A 5A76A 1ZA2B 2PA8D 4E2AA 2XYGB 2DNHA 3BYPA 3PJXA 1CBXA 1O0PA 2K5TA 1YJNS 1Z8WA 3ITHA 3KJVA 3JSRA 1GH8A 3LALA 4EUVA 4U7UD 2YBVA 3H90A 2A6MA 1BWVA 1FXLA 3B7IA 5KFYA 3M9MB 4PUOB 2YWFA 3N6MA 3CCQS 1RK8A 1Y9OA 3CXQA 1NK6A 5DG8A 2CQGA 3AB2B 2ZJQQ 3HVAA 3UQSA 1XMBA 2ZM6F 1LAMA 5J2MA 2GFFA 1LWCA 3TJ9A 1DJ0A 1ZLIA 3H5UA 1XMQF 4B9VA 3S01A 1ICEB 5HROA 4A30A 1R31A 3M1VA 2REEA 2PEBA 1ZPVA 2PD1A 1REVA 1QAXA 3MEDA 5KFPA 2PN6A 4UEFA 4UZCA 1NSKL 2M5YA 3TZWA 2IJZA 4FD6A 3CF5Q 4ZPAA 4WIQA 1RT7A 5I3UB 4O3NA 4F3MA 3VR1A 4MFQA 1YJUA 1G4CA 3W2WA 3TE4A 4OIWA 4ZN1A 1T95A 2N4DA 3N5FA 1VRUB 1FX4A 5HVHA 2WK4A 1TMJA 4X4UA 2QJ3A 1TF8A 4RW8A 2ZNZA 2VJVA 2HFUA 4PWDA 2D74B 4H4KC 3EVOA 4J9OA 1V6HA 4BBYA 1U02A 3FIXA 1NCLA 2QGFB 2CDRB 2ARHA 2DGTA 1HBMA 1ZYQA 3DM2A 1SPBP 4KUAA 1KTVA 4JWPA 2PMWA 1SH2A