3GB0A

Crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
373
structure length
373
Chain Sequence
GMINQERLVNEFMELVQVDSETKFEAEICKVLTKKFTDLGVEVFEDDTMAVTGHGAGNLICTLPATKDGVDTIYFTSHMDTVVPGNGIKPSIKDGYIVSDGTTILGADDKAGLASMFEAIRVLKEKNIPHGTIEFIITVGEESGLVGAKALDRERITAKYGYALDSDGKVGEIVVAAPTQAKVNAIIRGKTAHAGVAPEKGVSAITIAAKAIAKMPLGRIDSETTANIGRFEGGTQTNIVCDHVQIFAEARSLINEKMEAQVAKMKEAFETTAKEMGGHADVEVNVMYPGFKFADGDHVVEVAKRAAEKIGRTPSLHQSGGGSDANVIAGHGIPTVNLAVGYEEIHTTNEKIPVEELAKTAELVVAIIEEVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminopeptidase PepT (NP_980509.1) from Bacillus cereus ATCC 10987 at 2.04 A resolution
rcsb
source organism Bacillus cereus atcc 10987
molecule tags Hydrolase
molecule keywords Peptidase T
total genus 114
structure length 373
sequence length 373
ec nomenclature ec 3.4.11.-:
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gb0A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3gb0A01
4F9VA 3CPXA 4W9YA 2ANPA 3SI0A 3B3WA 1M4LA 3FECA 3NH8A 4F9UA 1IY7A 1BPMA 2RB7A 4LQGA 3S9NA 3D66A 3H8EA 3KQXA 4EFDA 4PQAA 3SJGA 4DJLA 2V8VA 3L2NA 2XEGA 4MCSA 3MN8A 1CPSA 4CPAA 3WABA 4A37A 2PJ5A 4P4DA 2C6CA 2Q4ZA 3VH9A 1VHOA 2PJ7A 4R6TA 4FUUA 4P4JA 1TKFA 1BAVA 4AXVA 2AFZA 1TXRA 2ZEPA 5THWA 4NGRA 2I3CA 3TX8A 3K2KA 4P4FA 3GLJA 3PB8X 5JM6A 1FT7A 1Z5RA 2ZELA 3QNVA 3D68A 1TF9A 5F09A 4MCQA 2NYQA 4EWTA 3KL9A 5HVFA 4NFRA 1OBRA 3BXMA 1QQ9A 2CTBA 3HUVA 3PRTA 1ZLIA 3IO1A 1YMEA 2HC9A 3D67A 1LCPA 5ELYA 5JGFA 4OC5A 4OKOA 3IIBA 2VL1A 1IGBA 2PJBA 2XEIA 3WT4A 4PXDA 2V8HA 4IAVA 1HDUA 3DGVA 4Z65A 1Y0YA 3DLJA 3B3CA 3GB0A 6CPAA 2AFWA 4FAIA 3KHZA 2PRQA 3B3TA 3FEDA 4P4BA 3WC5A 3RZAA 4H2KA 2PVWA 5D29A 4DUKA 4B6ZA 2F8HA 1LOKA 3I1UA 5K8OA 4JZ0A 1XJOA 1LFWA 3SJFA 2ZEDA 1BPNA 3FF3A 2Q43A 4PPZA 4P44A 3H8GA 3IEHA 2PJ3A 4NGSA 2AFXA 7CPAA 2CIJA 3KR4A 5K8PA 1YW4A 1CPXA 5LRGA 2AFOA 3D7GA 2OR4A 4Q7AA 4MHPA 2PIYA 4MHYA 4ZI6A 1UWYA 2JBJA 4IHMA 3BHXA 2HB6A 2QJ8A 2C1CA 2PVVA 3CT9A 3KI9A 2PJ6A 2V8GA 2PJ4A 5D8NA 3HLPA 1Q7LA 1F57A 3B3SA 1ZG7A 5HVGA 1ARLA 3RBUA 1ZG8A 1CP6A 2PJCA 1Y7EA 3KR5A 4MMOA 2PJ8A 4EMEA 3B7IA 2PJAA 4G1PA 4ONWA 2EK9A 3FH4A 4ZX9A 3JRUA 2OOTA 3PFEA 2WYRA 3NH4A 1XFOA 2ZEHA 3RAMA 4UEEA 2ZEFA 3PBEA 4R7MA 3KQZA 3IWWA 4TNUA 3WC7A 4UEZA 2IJZA 5K8MA 1HDQA 1TKJA 2RFHA 1F2PA 5LRKA 4MCPA 8CPAA 1KWMA 1R3NA 4P4EA 1XRYA 2ZEGA 1ZG9A 4PXEA 4YWYA 4NJQA 4P10A 2V8DA 2PCUA 1Y0RA 4KSIA 2F7VA 3CDXA 4ZY2A 1VGYA 2DEAA 3B3VA 1NSAA 2ZOFA 1LAPA 2PJ1A 1ARMA 2XEFA 3PEIA 4DYOA 3S9MA 4NGNA 1TKHA 4JYWA 4NGTA 2JBKA 2ZEEA 4R76A 4P6YA 5HXDA 3VARA 1CX8A 4X8IA 2GLFA 4NGMA 3NH5A 4WWVA 1VHEA 3PBBA 3D7DA 5J1QA 4P4IA 5LYDA 4MHNA 3BI1A 3NA6A 1GYTA 4FWUA 2BO9A 5JH9A 5LYLA 3CPAA 3IC1A 4UIAA 4A38A 4X2TA 4P45A 1H8LA 2IQ6A 1BLLE 2J9AA 2PJ2A 3SJXA 2QYVA 2ABZA 3FVLA 4A39A 5IB9A 2JEWA 2EK8A 1Z2LA 5LYFA 3S9LA 3H8FA 1YSJA 3N5FA 2BCOA 1ELLP 3PB7X 1DTDA 3PB4X 4RUHA 1PYTB 2PIZA 1EE3P 4GM5A 3VATA 3FJUA 4OC1A 4WJBA 2FVGA 1CG2A 4O23A 2O53A 2PJ9A 1AMPA 2GREA 3ISXA 1CBXA 4ZY0A 4TWEA 3ISZA 3B35A 4UEFA 5I4MA 2IMOA 3FMCA 4NGQA 3D7FA 4IK2A 4UF4A 4NJRA 5HVHA 3D7HA 3BI0A 3T8WA 1R43A 2GLJA 1Z8LA 3K9TA 3PB6X 2NSMA 2WZNA 2XEJA 3KGQA 2EWBA 5CPAA 4BD9A 4OP4A 4NGPA 4OC2A 5LRJA 3SI2A 2AFSA 2G9DA 4OMEA 1AYEA 4OC3A 1JQGA 4A94A 4YU9A 2C6GA 2PJ0A 3WC6A 2BOAA 3IFEA 2ZENA 5DS0A 5LYIA 3PFOA 2ZEOA 2C6PA 1VIXA 1LAMA 2PE3A 1QMUA 1CP7A 3IJ3A 4MCRA 3B2YA 2GU2A 3FX6A 1HEEA 1YW6A 3V38A 4MXUA 3LMSA 4OC0A 1RTQA 3V7ZA 4ZY1A 1ELMP 3LWUA 4ZYQA 3KZWA 5CBMA 4MRIA 1PCAA 2O4HA 4R8FA 1ZLHA 2ZEMA 4UIBA 2V77A 1FNOA 4PXBA 1TF8A 3PB9X 1F2OA 4X3RA 1XMBA 3KHXA 3SI1A 3SJEA 4OIDA 3NFZA 4MHZA 2AFUA 4F8ZA 3FEEA 4OIWA 4FBEA 3MRUA 3KASA 2QVPA 3TC8A 2ZOGA 2CF4A 2AFMA 5K8NA 1YLOA 2CTCA 1LANA 1DE4C 4OC4A 2Q51A 3GUXA 2POKA 3D4UA 1XBUA 4ZX8A 4PXCA 4K3NA
chains in the Genus database with same CATH superfamily
3H4QA 2X51A 4MY0A 2UVRA 3ONQA 5KFXA 1BMQB 5KTCA 2CWXA 3H2VE 1R0AA 3D8PA 1FFSB 2L41A 3KJVA 3LP0B 4IRCA 1JLBB 5A8RB 3D66A 3OFGA 2K3IA 2GX8A 2XNQA 3ZNJ1 2E5LF 5CNPA 2K5TA 4DL0C 3SIPB 2LFVA 2QLJB 2EUIA 4ZHRA 2B4OA 1BD6A 3HM9A 3HHKA 1WHVA 2U1AA 3MR6A 4AT1B 4CS0B 2GJ2A 1HW9A 2AMCB 4U8YA 4FUUA 7FD1A 3GIJA 4NLOA 4Q36A 1S9FA 2ZEPA 1U1KA 2LYVA 3AQPA 2F5GA 4RBVA 4R9MA 2OKQA 1TL3A 2OSQA 1RTDB 1WOPA 1S7HA 2FJAB 5C2GA 5C82A 2QFJA 1IWGA 2AYGA 1I5OB 3FRMA 1HWIA 5CCMA 1S79A 3HSJA 1OBRA 3IWGA 2BACA 1NKCA 5HO4A 1U7LA 1U6ZA 1Q53A 5D0EA 3MAAB 4UUWA 4UWJA 1E6YA 2FC9A 3P4UB 3SCJE 1Y0YA 4J9RA 3ILOA 2DR5A 2L08A 1U02A 5SZTA 1S60A 2YQ1A 3ILIA 4B6ZA 2HHUA 2B9XA 5EMIA 2VICA 4NCGA 2YNEA 3P3DA 1XJOA 1TL7B 4PPZA 5K20B 3M30A 2I1RA 5ETVA 2J9DE 3DYAA 1QAYA 5A0YA 5KFBA 3IMQJ 2NREA 3KG4A 3J7A1 4ED5A 2F4FA 1NCLA 4KKOA 1JJ4A 3OUYB 2HEKA 3SSRA 4P2SA 5LM7E 1SV5B 3CJSA 4K7QA 3UFCX 2CIMA 3C16B 3CJ5A 3GG0A 4IYQA 2DIUA 4X64F 2Y3YA 4WTYA 4OZ2A 3QLHB 4HLBA 2IM2A 3DLBA 3OR2A 4K59A 3V4MA 1WSVA 4K4WA 4NF1A 1KD1T 1Y7EA 4ZPDA 1YK9A 1RWVB 2RS2A 1KLNA 4G1IA 5CD4A 5EBVA 5BR8J 5D4NA 2R2SA 2YNHB 3FDSA 3OWCA 1HHQA 1VK8A 4N76A 1U0HA 4IOAQ 4C8YA 3DRPB 3VAIA 2PDAA 3IWWA 1HDQA 2J9DA 2NS1B 2G1HA 4RBTA 3OD2A 4OX8A 1E6VA 4XO0A 2CFXA 2UVVA 2IFXA 2OPSA 4KFBB 4ECUA 4PXEA 4DG1A 2H3EB 2PCUA 4DFMA 3NMRA 1SJ1A 4CQ1A 2GHVC 3P2FA 1XMTA 2RC4A 2CAJA 1RDRA 4ANEA 3EVMA 5GAGU 3D6MB 2FVPA 4DQPA 2D1CA 4NPOA 2FCKA 3PX0A 2Z2YB 3DRRB 5K14A 1KONA 2PMZD 3M6UA 1AUSL 1VRTB 3RW6A 5J1QA 3G71S 3WHIA 5MLCV 2YQ3A 4L76A 3TT2A 1U2FA 2IIHA 2YX1A 4LX9A 4Y3CA 3LGNA 1MMDA 2O67A 1F3VA 1XBWA 1S1XB 1OS5A 3J7YU 4NMXA 3GKRA 4JI4F 1Z2LA 2HMIB 5HSPA 3DRYA 1FD2A 4J7CA 4O44B 3PB7X 2DPJA 1WKLA 4CH7A 3VATA 1HBUA 2HKEA 3MUMP 4HHUA 1FJGF 3AXKA 2RAQA 3MD1A 2HHVA 3HMJG 4YR2A 4NCAA 3S6KA 2E44A 1S5ZA 5LMUF 3PYEA 1UETA 1D9AA 4DCPB 3HPOA 4R87A 2DGQA 3M1VA 5LL6d 4UF4A 2E7WA 2PSWA 4GRSA 4A8XA 4C11A 3FUYA 1O51A 1IR0A 3OLBA 3TAPA 4Q0BB 1RWWB 5MAOA 4AL7A 1RT6A 2WK4A 1KKHA 3TA2A 1WKJA 3FZBA 5IT9U 1X4HA 2AFSA 1GMWD 9ATCB 1LKZA 4HI2A 2ZH7A 4RO0A 1U6BA 4IOCQ 4ECQA 1K0VA 1HWKA 1CJUB 4A31A 2D4PA 4OV1A 4CNZA 3M9NB 3BH7B 4X84A 3RRHA 2O66A 1ZAXA 4LF9J 1TMJA 3S6FA 4NRUA 2IAJB 2V63A 1Q8LA 3OXFA 2ZOMA 1VQMS 1FRIA 4AG9A 2RRAA 4TY8B 1DY3A 3MTKA 4MIBA 4WE1B 2H48B 2MQNA 3LP1A 5G1ZA 3PB9X 1Q16B 2UUAF 3GQCA 3DOMB 1VLYA 2H4YB 2XZWA 2DNOA 3SI1A 3HKWA 2GC8A 2XWYA 1GTHA 4LSNB 1CVJA 3RBXA 3HI9A 4B3TJ 4NXNF 4ZA1A 4TXSA 5DETA 5EWFA 4R3KA 5KFCA 2UP1A 5AE3A 1YLOA 2J7KA 3IA0A 1T9WA 4OC4A 4R5PB 2DPSA 3QSYB 1LRZA 4CLZA 1UPMB 4DPOA 3EVOA 5HP1B 2AYMA 1ZTTA 4F9UA 4UZCA 4DV5F 2OFHX 2MQOA 1TKTA 1SJ3P 3GIMA 3DDNA 2V8VA 2CJBA 4WFBQ 4DPTA 4IO9Q 3KK2A 2W7OA 4ER8A 4HDHA 1CPSA 2ERRA 3NLCA 4RW9A 4ZVRB 1I94F 2R8KA 4NLGA 1YBUA 3I56S 4K50A 4HNXB 4PV6A 2W9CA 1S0VA 4ES1A 3KLEB 2Q4YA 2UXDJ 2KXNB 1KTVA 2ZWPA 3R2DJ 4KUBA 4QBJA 1RT1B 4F4YA 3M32A 1KBRA 3E01A 2DR8A 1J27A 3BGRA 3NOGA 4EUVA 3VGVA 1DLOA 1O8BA 3CULA 2R7VA 4FF4A 3DLGB 4WF9Q 5LXYA 2PMWA 2VASA 3V4IA 2ZBRA 3SQOP 4ATNA 4NFRA 5B0DA 1EHWA 2CTBA 3HUVA 4ZJQA 2EFNA 4QYRA 2N3OA 1TKDA 4OC5A 1JIHA 3IR7B 1YX2A 2VBXA 3O6QA 2VU5A 3DLJA 1DHMA 1QVFR 2HGNA 4L6V3 1IM4A 1WORA 4YHHJ 1WHXA 2DCUB 2B3VA 4P73A 2BYCA 4HT5A 1RBLA 1VQ9S 3ZZPA 1C4AA 2YNIB 4DV1F 2Y0SD 4P44A 3QJPA 1LEOA 3OR1B 5AE2A 3FEYB 4ED1A 1SJ4P 1YW4A 3D7GA 5HAOA 3CNQP 1L3TA 1O0PA 2RS8A 4DV0F 5IT4A 3L4BC 3I9ZA 5U47A 4IHMA 1WDTA 4ECYA 5CZVA 1U6FA 5EX0A 4UFXA 3PJ9A 3W64A 2V8GA 5J8CA 1ZAVA 1SCJB 3DM2B 2YPYA 4U5YA 2DGOA 1ZZFA 3O2IA 2ZH8A 2PJCA 5KTAA 4FNHA 4KQZA 2J0WA 5E2QA 4FS2A 2Z3OA 2C3MA 2KYXA 2JLFA 5E96A 4AB7A 4DR7J 1VBXA 4NOHA 1HIYA 1VISA 4X66F 3PW4A 1UEKA 2AE6A 4G1QB 2DIVA 2AX1A 2PD1A 4NMLA 1IYKA 1FKPA 5GAEI 3KG1A 3H5UA 4AVCA 4C0BA 4DV6F 4JXRA 1OY6A 4USIA 5F41A 3HVTA 3G96A 1Y0RA 4UT4A 5E3QA 3G8TA 3HJFA 2DEAA 3C26A 1NHKL 2CQ2A 3MAHA 1NSAA 1NDCA 3SFGA 3U7JA 2WOMA 3TI0A 1RTJB 3EO4A 1WG1A 1KHVA 4ILRA 4PG6A 2YTCA 2UUBJ 2WZ1A 2L48A 1C0UA 1X5PA 5KTDA 2DH9A 2OD6A 2FIUA 4F0YA 2IM0A 2M70A 4NLTA 3D7SB 2F9DA 1FEHA 1H2VZ 4NLYA 4IF5A 2PJ2A 2FTRA 3OFEA 2GQQA 2RRNA 2KKHA 4UZBA 2Z10A 3IWNC 2LDYA 4RNNA 3T5KA 3C8YA 3W2VB 3S9LA 5LYFA 2KXFA 2V0NA 3BGOP 3TUPA 4ERDA 1SUQB 4OYZA 2GVDB 3MPUB 1HNIA 4F04B 1PYTB 2Q3PA 4HTJA 4DR6F 1BGXT 2D9OA 2B4BA 5KAKA 5J2NA 1R8BA 1Y5NB 3FMBA 3FNNA 1RAAB 3ISZA 1IKYA 1GMUA 5L1IA 1B7YB 2QIRA 1X7VA 3P2HA 1H2TZ 1HKAA 5I4MA 1RO5A 1QVGR 3OT9A 3G8WA 4TU9A 4Y49B 3ITHB 4CLSA 3T9YA 4CGOA 5ETTA 1NLKL 5I42B 1U1RA 3OXLA 2FVRA 2HK2A 1VC6A 2XEJA 1FXLA 1KVKA 2ROGA 5F3ZA 3UO0A 3HSGA 3QZ7A 5HLFB 2R8VA 3QRRA 2VC1A 3PIPQ 2CPJA 2DY1A 5CYJA 2C6GA 3AOAA 4JV2A 1UVIA 3GG1A 4M5DA 5AXNA 2IL4A 3LACA 2MKHA 4RR5A 2J5AA 5LYIA 1W2IA 2A3JA 1NMTA 1ULRA 1FRHA 2IVFB 2SXLA 3QJJA 3B2YA 4A8MP 4ZVHA 1N33J 1RT2A 2OZHA 4DCOB 3J7YI 2XY7A 4E8OA 1KDNA 2DO4A 1U1OA 1RABB 1GT8A 2Z0ZA 5F0UA 3K59A 4RNOA 3M2RA 1CS4A 4G6VB 1X10A 2DY9A 1JLCA 3SSSA 4X3RA 1PO6A 3V6DA 3D0GE 4WXWA 2AGPA 3UN5A 3TJ9A 3NNCA 2CVIA 4DV4F 5IS2A 3OJSA 3O44A 2EG2A 1NZAA 2RDDA 4JV5F 2CJKA 4LF5F 5C42B 2HIQA 3VAKA 4DSIA 1S59A 2W25A 2ZW6A 3UR3C 4NI2B 4WZMA 4CRYB 2BE2B 4XDCA 2ZUAA 3RB3A 1YR0A 4IG3B 2GZOA 1QJHA 1Q8KA 4DFKA 1S1UA 5FVJA 1X4GA 3EXYA 2OH2A 3PW7A 1VHIA 4EGLA 4LQGA 4MFJA 1QAJA 3PP9A 4BHQA 1T11A 1U2CA 2AYEA 4RN7A 1W7WA 4CAFA 2QA1A 3PR4A 5KG4A 1MWZA 4C2YA 2P9EA 3VH9A 4XPEA 4IOBA 1UZDA 4MFZA 4MFBA 1ZM4A 3IR5B 4KPYA 2MHEA 3D0IE 1FKAF 4UWIA 3I4PA 1KEKA 2BQ3A 3TYTA 3UR0A 4DU7A 3G2XA 1H3DA 5KFLA 3D9BA 2HG4A 2YPZA 4DX8H 4RS2A 4QWEA 2V34A 4MTPA 1Q8IA 2HC9A 3D67A 2YNHA 1OY8A 3NWRA 3HO1A 2YWGA 2MQPA 4OL8A 5AGEA 1I6JA 3JB9k 5GAHU 2KO1A 4C2ZA 4P4BA 1P6TA 2H1YA 2L3MA 2LCWA 4ZHRB 4ZPVR 2KL8A 3DLEB 4ED8A 2ZE2A 2RHSB 1Y4ZB 3BO2A 4IH6A 1LOKA 4JZ0A 4EO8A 3BPDA 3N6MA 3EC4A 1WDDA 2BUEA 3R7NB 2OH1A 2CQ1A 2REEA 3BQ2A 1T05A 2VA3A 1K73T 2OAUA 2LXUA 5B0CA 1UFWA 3MOJB 2AJFE 3OFHA 3OTCA 4PG8A 5IQ6A 3QAHA 1NPKA 4O3NA 2VBZA 2HZAA 3W9IA 1ZG7A 1MSWD 2I5JB 4YB5A 4KORA 2HQGA 4Y00A 3CPWR 2Z8QA 2OFGX 3CD5A 3I5AA 1PAEX 2C1EB 1FXDA 2E9ZA 1BY9A 2JFDA 1H0HB 2ALYB 1FD8A 3MF5A 4B3SF 2ROEA 1T9UA 4CLWA 1UTAA 1FFWB 1XNQJ 3DXSX 1RTHA 2JLGA 1Q86T 3TA0A 2RFHA 5A8WB 1IKXB 2XI2A 4CNYA 3Q8RB 4LUBA 3SFUA 2ZDOA 1XIQA 4YWYA 2RD5C 5DM7Q 5E7OB 5F49A 4NSQA 3CDXA 4QBUA 2HFSA 2ZOFA 3EPIA 3A12A 2AQ4A 4DN9A 4ID8A 3PEJA 2XEFA 4ZVFA 1R6VA 2VBQA 2ZEEA 1Q2YA 3IU1A 4A46A 4CT8A 3OL7A 2GLFA 4DFPA 1OQ6A 5B09A 3ITHA 3W8PA 1KQGB 1UMJA 2W9BB 1HBMB 3QBCA 1RI7A 3DLLQ 1FRLA 4FXWA 4CYNA 3SJXA 1M5VC 2RILA 4LSLB 4C3MA 3RR8A 5HMYA 3IRXB 6FD1A 2EK8A 5HQ8A 2VBWA 2BEIA 1FKOA 2V5HG 1WKKA 2YKMA 3BKUA 1RSCA 4B9UA 2O53A 4OZJA 3QNWB 4BINA 1T03B 3W2WB 4PG7A 4YN3B 3FFIB 2IM3A 1S1WA 4A2ZA 4UFWA 3UPFA 2MZSA 3K57A 1NRKA 3SDEA 3QIPB 3D7FA 2GHWA 4Q45A 3D7HA 2ZJRQ 1TK5A 1FJEB 3T90A 2NUUG 5EGYA 3M9OB 3VAGA 1M5OC 5C88A 1EB0A 2KM8C 2QJ3A 5DG9A 5BJRA 1QDUB 3IG1A 4ED6A 4OMEA 4V1Ak 2W24A 3WX4A 5EWGA 4Q38A 4RW9B 1URRA 3PX6A 1RT7B 2DHXA 2PJ0A 3FVYA 2XY5A 3I3GA 2V2KA 2GO9A 1FERA 1RAHB 4IO1A 2ZC4A 3PFOA 2CYYA 2JLEA 1RHKB 3CCES 1SC1B 1TL3B 4D3HA 1VQKS 2VZ9A 2KG1A 2B58A 3TP2A 2ZDPA 3NE8A 4U7CA 4X2BA 4XTTA 4R8FA 5DG7A 3H25A 2DRAA 1FDAA 4PXBA 3OHAA 2ZH5A 1YK3A 3KHXA 2RF2A 2R2UA 3SJEA 5IB0A 4PUOA 3X1LB 1XF8A 1ZTWA 4PYAA 1MROB 3T5JA 3R9EA 4K4SA 1FT8A 2GAHC 1VMBA 3HFZB 4PYDA 3R9LA 2BJ1A 4DX6A 1S6QA 2KFYA 1TL7A 1UVNA 2DH7A 4WU2A 4WFNQ 4H4KA 4OYMA 4DL3A 5C25B 3QGGA 1RT4A 2JJ4D 2OSRA 3MM9B 1AZSA 3L7PA 1U4BA 5T7LB 1W2BR 1M4LA 3JTNA 4IR1A 1SL0A 2J7UA 4URGA 4F2RA 5BR8F 4KAIA 1Z4RA 3M8PB 3CCVS 2UV8A 2ZH9A 3O1LA 2XQCA 2W4PA 4OYIA 4PSWA 2HNZB 1DARA 2OPPA 3C14A 1PYSB 1FKOB 2VA2A 1JLQA 3QAYA 1TKTB 3JSMB 4JYAF 3S1TA 2HBQB 4FPRA 2HWTA 4KKOB 1WSRA 3MMAB 2D69A 4AFFA 2ILZA 3D68A 4ZLLA 4EZ6A 1DQ9A 2CJ9A 3R6GB 3KUGA 2HFOA 4V19X 3PRVA 2K8GA 1YMEA 2ZXVA 2GJFA 4C9DA 4EVYA 4C3KA 2NSBA 1NH7A 3NCRA 3IIBA 5B7WA 4FPIA 3H4BA 3DGVA 3AY0A 4B3OB 4GMKA 6CPAA 3DFEA 2JVOA 4M5JA 3PZPA 2Z30B 2F4VJ 3QMQA 5HH1A 1PC4A 4G65A 4YR3A 4H6ZA 3A1YG 2FJEB 2KJWA 4W92B 1XNQF 2CJXB 3BGUA 4K5SA 4NGSA 1RT4B 5J2PA 1VRQC 2J6UA 2YNCA 5K8PA 3FK4A 1TVRA 2DYAA 3A13A 2BJ7A 2XMTA 2HSEB 1S7IA 2QL9B 2RU3A 5JPHA 3UDCA 3R5DA 3Q8UA 4CYPA 5D8NA 2JEVA 4NXNJ 2YKQA 1LWFA 3FBEA 1TELA 1I1GA 3W9HA 2CNTA 4KBIA 1NDKA 1CJTB 3QGIA 3KLIA 3B7IA 4OYBA 1TL5A 3LPEA 5G0RB 4PCQA 3MM5A 4Q44A 3QT7A 3IAM9 2KT2A 1VQYA 4N47A 4X5KA 3NBPA 4UEZA 1LK5A 5K8MA 1VJQA 2D74B 3VV2B 2GW8A 1HNWF 2LXIA 2XB2D 5LRKA 1IR1A 8CPAA 2CUYA 5A8WA 2FLPA 1RXOB 4KH0B 1VC0A 1HNXJ 2PN6A 2W2OP 3B3VA 2HIYA 4HT7A 2H5IB 3PCOB 3PEIA 1R89A 4XNHB 4HHHA 2DF5A 1PAUB 4CYUB 3W6XA 1CX8A 2BJDA 3HSDA 4B9NA 3N9UC 3NH5A 4KO0A 4KTQA 4ZK7M 4N5SA 3MCMA 3MGDA 4LF7F 4CO2A 3AD8C 4IFYB 2W9BA 2D3ZA 1HHSA 2Z2LA 1EKSA 1UW4A 4FD7A 5IB9A 3OPKA 3C6UB 4UY85 2QLFB 1ON0A 4U9ZA 1HBOB 3C2PA 1S0NA 3PYFA 4AL6A 1Q2DA 2QA4G 4OLLA 3ZTOA 4RUHA 5DLFA 1LWCA 3EZOA 3MEKA 4I4BA 4KOXA 5HMWA 1QSRA 3T6BA 5A6WA 5F8MA 3SV3A 3M6XA 2WOMB 3I96A 2BBEA 2EKNA 1IWAA 2L9WA 4AYBD 2R7TA 5GADU 1OYEA 3J7ZT 5KFGA 3NGUA 2HHHJ 3ZFVA 3OTDA 3FNCA 3T8WA 4CYQA 1R43A 4W98A 2B6AB 3K2YA 2WB1D 3RBDA 2IRUA 1IBCB 3KNAA 2LECA 4JBCA 2GIRA 1N32J 1LFPA 1X12A 1Z4EA 2MYFA 5CZXA 3CJ4A 4IG3A 1WEZA 1NJYA 2B5GA 1AYEA 1F5BA 5AE1A 4GVBA 1SVDA 2W2PP 2ZWOA 4X4NA 3EDRB 2Q0YA 1RBOB 1JLAA 1NE9A 5EX3A 2ZEOA 2PE3A 2E29A 1EKRA 3P5BP 2GGPA 2EFGA 4OX7A 1T05B 1NM2A 2WVBA 3UVJB 5E33A 1RACB 4MY3A 5D77A 2VPYB 4ZIWA 1BQMB 1KTQA 2IC3B 2ZD1A 4NZ6A 4CLPA 1PCAA 5DM6Q 4XPLA 5D0HA 4ZDNA 1LW2B 3K8VA 1TMMA 3IWLA 4DR5J 2KHDA 3MMBB 1IQTA 2CPHA 4JUZA 4CH1A 2Z3MA 2F3JA 1IBKJ 4NYPA 4PUOB 2W8KA 4Z7CA 1Q81T 2CZ4A 1YVOA 5BYRA 1E6YB 4DR4F 4Z37A 1G4CA 2ZM6F 1M4GA 1CJVB 2QEXS 1VYAA 1DTTB 3ENQA 5E5NA 1H72C 4P72A 1LK7A 2P9CA 3VALA 1PBAA 5ETQA 5CCLA 3SI0A 3PDNA 3NH8A 2HS4A 3MAQA 3KLVA 1FK9B 5ETMA 1HPZB 2CQ4A 1HQUA 3KQXA 3BGLA 1Q2CA 3BEGB 4WCEQ 3VAJA 3MN8A 5IQQA 1KLMB 3L95X 4WZQA 2FJWA 1FCAA 5CYQA 2PJ7A 1JLGB 1X5SA 3SXNA 2ZBQA 3FQKA 2BZ2A 2OJ3A 1FRMA 2AU0A 3D6HB 3CVKA 1NJWA 4TQSA 3HFKA 4URQU 3SHPA 2ZELA 3PW5A 3M7VA 3FBBA 2E7VA 3KOAA 1DLOB 1SJRA 4M5LA 2AF6A 2LVWA 1QQ9A 4R3LA 1ZLIA 2KN4A 2UV8G 1FWLA 4YRHA 2NXCA 4TNOA 1YITS 1RKIA 3R5JB 4DWIA 3DLKA 4ILMA 4J9LA 2FHJA 3GFYA 3MMCB 5B0GA 1LW0A 1YG0A 1Y9OA 3S6GA 2CPIA 2RMLA 1NKEA 3GP9A 1RU2A 4TVAB 4KGZB 4YFUA 3NNHA 2VG5B 2FZKB 2GO8A 4EK2A 2BOPA 3PYGA 5BYQA 3K5PA 5LSLA 1U48A 3RJMB 2VG6B 4C2MA 4CAVA 3DDIA 2OEKA 1YZ7A 1APSA 2AJ0A 1F3FA 1AFIA 4HPSA 3CDBA 3BO3A 1WC5A 2CIJA 3DOKA 1Q7YT 3IP0A 2M88A 2IJNA 2VFVA 1NPPA 2HRYA 3LD2A 3JXOA 5LJ5Y 3K8WA 3W65A 1K0TA 4HEA9 2FUG9 5KOXA 2B0GA 3HT3A 1BWEA 2GFQA 2CPXA 2WONB 3MCSA 3B3SA 2XS2A 3RRKA 4RW8B 1N36J 3CJQA 3GIUA 4O3OA 5BYSA 3S01A 2J0QD 3TJ8A 5KT4A 1Z2ZA 3JUWA 3BBCA 3W61A 2ZBPA 5D3GA 3BO4A 3VGTA 4NCBA 4X65F 3AD7C 4I2PA 3J7Z5 3CO0P 4MIWA 1O6XA 4GKKF 4J91A 1RWMB 3MMAA 3H5SA 4RUCA 2IC3A 5I3QA 4OI1A 2VG7A 3SQGB 4P4EA 4NJQA 3MR2A 4NASA 2NCKL 3NCQA 4WPAA 3KLHB 2DR7A 4TYBA 4A48A 2OPQB 4C97A 5H9EK 2V2VA 3R96A 3OTOJ 2CRLA 2KVIA 3JS9A 4DYOA 3HVRA 4KV8B 3AJDA 3PKMA 1YDLA 4FVCA 1T9XA 2C2EA 3S7RA 4PQUA 3MI7X 5F3TA 4FN5A 1HBNA 1GEHA 3MR7A 1Y9KA 5A2QY 5L8RC 1RAIB 3UI3A 5AG5A 4B5PA 2M52A 3BI1A 1WC0A 3A8EA 5LYLA 1X5OA 4ZLPA 3KMSA 1REVA 2I79A 4LFBJ 2QYVA 1V5IB 3B4MA 1BQNB 1WTFA 3CDUA 4CO0A 2CNLB 4AL5A 3MR3A 4BWJA 3GJTB 4QCLA 5A0YB 1SJQA 3H8FA 2Q4VA 4LQ3A 3EWGA 1ELLP 3V6KA 1SXLA 3TZWA 1M5SA 1RGVA 5CHCB 2R2RA 1HBMA 3LP2A 4OC1A 4WJBA 2E66A 3GJRB 3QLHA 5LJ3Y 1YKWA 3TJAA 1WC4A 2J6SA 2AV5A 1JXVA 1N5SA 4NL5A 3TZZA 1VIOA 4UEFA 2DPIA 3I5CA 5DDOC 2WVEA 4MJKA 2VQEF 4FBUA 1RCOB 2M5YA 2JDDA 1NZ8A 1CBKA 3K9TA 1IQZA 1FO1A 2JLMA 1V3ZA 2CVEA 1S6OA 2FGOA 1HLWA 3M4XA 3R95A 3GFZA 1W26A 4YS2A 2EXUA 3QIPA 3NGDA 4DUYJ 3UE2A 4F50A 3CD6S 2XYGB 1R0BG 2D7SA 4NI2A 2BM0A 1FVQA 1D8YA 3R7BB 2AGQA 2PO4A 4WWSA 3O3LA 4MJ8A 4OLOA 2IYIA 4IH5A 1YI2S 3SV4A 4ID5A 1HBOA 3N6LA 4MCRA 3NS7B 3FX6A 4K30A 3JTPA 1SKUB 1R31A 2FY8A 5LOQA 4Y0FA 1ELMP 3CIZA 2R8GA 3ET6A 2VC0A 5CBMA 3GWCA 2O5DA 3SCLE 2IMWP 3GIKA 1PG5B 2H54B 4KOSA 3NFZA 3RUBL 2AFUA 3UCGA 3E8OA 4OIWA 1VC5A 3KASA 1WC1A 1RAEB 2HFZA 4X4QA 3TC8A 4XPDB 3CCLS 4XPCA 4Z7YA 5AXLA 2CTCA 4YB6A 3KLGA 2Y8YA 1RT7A 2BX6A 2BANB 4DL4A 2B51A 1RQ0A 3PRDA 1RHMB 3CPXA 3CXQA 3RO0A 3R3TA 2DO0A 1KRPA 1FDBA 2YNFA 3B3WA 4FF3A 3KHRA 1JMTA 4YP3A 1V6HA 2RB7A 1HNZJ 4I6AA 4Q2MA 4EFDA 1NB2A 3HCXA 3CF5Q 4JV0A 3L2NA 4DZ6A 1WOSA 2HNZA 2OPPB 2OZUA 2NLWA 1UWBA 2MZQA 4LVOP 5JJBA 2UXCJ 1S4FA 1REGX 2QO3A 4P4JA 3MM8B 4KRWA 1UVLA 1AW0A 4ED7A 2PGCA 1I94J 3GLJA 5M2RA 3Q24A 3CCSS 1RTIA 1MROA 4ZCMA 2EG1A 3MEEB 3T6JA 4U8VA 5JUMA 2V6AA 1DZ5A 3S6EA 1REVB 3BXMA 3M2RB 4J9SA 1U8SA 3OLAA 4WTOB 4CLLA 3H5XA 2Q7BA 2VL1A 2XEIA 4KGXB 3P45B 3CCWA 5DJBA 5I3UA 3OV7A 1SKWA 4Z65A 2KFNA 3FEDA 3GR0A 1Z4UA 3CCZA 1XR6A 2PVWA 3LQVA 3PEHA 4RWWA 2FD2A 5DWMA 3FSIA 4UA3A 1VBYA 2J9CA 2FS5A 3PJWA 1XNRF 4DR7F 1SQFA 3NOCA 3H8GA 1DTQA 3U1NA 2KYZA 1S9GB 4F0MA 2WW8A 1R27B 2AJQA 1FFGB 2ZNZA 5DZ6A 2FGCA 4ZVGA 4CCHA 4C68A 2PIYA 2MKYA 2DNHA 2VPZB 4YGOA 3DLGA 4Y2IA 4H4OA 5C25A 5F8JA 5G21A 1NK9A 3GYNA 4P2MA 4R8UA 1EAYC 3L3CA 3A3OB 1GK8A 1HWLA 3HVAA 1NKBA 2HHXA 4LQ6A 4DSJA 4DCJB 3W60A 3IR6B 2WONA 3TAQA 3MXHP 2QC3A 5C24B 2GNKA 2MPUA 3A4TA 2KRBA 1N5YA 2CQGA 3DRXA 1RT5A 1HNIB 2ZEHA 2FJXA 3W6SA 3ZZUA 1PSDA 4BWMA 1OPZA 4LFBF 4EYHB 2BKNA 3LW5C 5H1SV 2IJZA 1U0SA 1BC6A 3M2UA 1YVKA 2XMKA 3HXMA 1S9EB 3MFIA 2OMLA 4J9QA 2V9WA 4JI7F 2EO8A 3BBBA 1TVRB 3NXZA 3SEOA 2G0IA 1U47A 3N7ZA 4J3GA 3H8YA 3PXGa 3B82A 2K1RB 4YR0A 2MY8A 3BJYA 2PJ1A 4LBPA 5GMEA 2HHSA 4OX9J 5EN1A 3S9MA 1KNZA 2P2CB 3BDEA 3PR5B 3I32A 3GE9A 2JEFA 5CD4H 2B43A 5KG5A 1VK3A 4ANDA 2LEAA 3JSRA 3CMAS 5IC4B 3DHWC 2Y1LB 3MPYA 1GYTA 2OTLS 2ZHAA 4YDXA 5J2MA 3NL0A 2DGXA 2DXQA 1CM0A 2X7IA 2CZ9A 2OGUA 3OR1A 2PFDA 2VKRA 3A3PB 2VOPA 3H2LA 3T9ZA 2QE5A 2IYGA 3R9FA 4RJVA 3BBFA 4EBDA 4WFYA 1C1CB 4F4XA 1MLAA 3FJUA 4J9KA 1CG2A 2X7BA 2DTJA 2XS5A 3AODA 4TQRA 5KFZA 2H4WB 2FSRA 2Z3KA 2HMIA 3CD0A 2DCLA 4L3NA 5DDPC 1N33F 3K7RA 4ZPAA 2B8QA 1LWXA 2APOA 4NJRA 3EUNA 2AZ1A 5DG8A 2FJVA 2D41A 2QL7B 1D09B 1FJCA 3ZZYA 5K9FA 3CC4S 3FCVA 4M5IA 2BW7A 1PILA 4P7TA 1UAWA 4QIWD 1JLEA 3MMJA 2MKIA 4Y34A 2CNKB 4M6HA 2EFPA 4DV3F 3P5TL 3DU5A 1XR5A 2OELA 1FHTA 3G87A 1NSLA 4NA3A 3I0SA 3GJSB 2DNQA 3W2VA 1YJUA 2I2YA 2ZM6J 5HMNA 1XE4A 3SCKE 2EK1A 5KFEA 2MXYA 1SQEA 1V5VA 4EBEA 3D54A 1Y3JA 1IOFA 2VF3A 2G3TA 3V38A 2J0XA 1S7FA 3FKBA 3LWUA 1FWKA 1NBEB 4QU6A 3Q83A 1N6QA 3VWSA 4QWBA 3GV5B 1RHRB 4ZPCA 1I3OB 4CO1A 1SL1A 2GA7A 2IAJA 2FL4A 4YY3F 4PZVA 3NBPB 5J2QB 4FBEA 4RKUC 2G9OA 3G4SS 5KG6A 3JQKA 2VDHA 3M9MB 2W7PA 4USWA 2AWZA 2K3KA 2FY1A 3Q2TC 3C15B 1SB6A 4USKA 4LF5J 5GAEU 2CPDA 5HJYA 3BYRA 5HL7Q 1IBMJ 1IU8A 2V67A 1WK4A 1J5EJ 1IUJA 2FYXA 1OPIA 4QPXA 4B3MF 4KVOE 4R8UB 2V69A 1BPMA 4I6WA 1S97A 4ED3A 3H8EA 2XSJA 3H20A 2F63A 1RTDA 4WBFA 3RR7A 3R5AA 5KFVA 2H5EA 1H6KX 1YREA 1IXKA 1FTCA 3FGVA 1P1TA 2V2QA 3NMAA 4J9MA 2C6CA 2CA9A 2Q4ZA 2VDIA 3VQTA 1JXEA 1FX4A 4TLRA 1F6TA 2W7AA 1DTQB 3THVA 3KLIB 3MPVA 2C3UA 4E0DA 3CJKA 2Q6BA 1C0TB 2I3CA 1LWCB 2Z57B 4OI2A 2UUBF 2M3DA 2EC0A 3DM2A 3QNVA 1WHYA 5L39A 3LP1B 2ZW4A 2E9TA 2VFRA 3IO1A 2P6EA 2IRXA 2QGFB 1FA0A 2CG4A 2CQIA 2Z2MA 3DHXA 3WT4A 2R4FA 4IQMA 2Y1RI 3HJVA 3SBMA 4HH0A 5A8KA 1WOOA 4ZN3A 4LREA 2DH8A 1I51B 3IWEA 4UCNA 4DUKA 2HGMA 3GYAA 3IAS9 3GPAA 1LFWA 4CAXA 1T9VA 2R9LA 4URSA 3NY0A 3I0RA 2UU9J 4WFZA 3C46A 3BZQA 4DSEA 3JAMY 4DL7A 4KY3A 4JI2F 3ISNC 2QMLA 1FVSA 2FVCA 3NE7A 4MHYA 4ED4A 1C1CA 4E98A 3BHXA 2BMBA 3TRGA 4RWXA 1KFDA 3A8KA 3MM5B 1YJWS 4LF2A 5H84A 1JLEB 2E5LJ 2ZJQQ 4QQBA 1P4NA 1IBKF 4DUZJ 1UA0A 5AG4A 4WIQA 3KK1B 1XOVA 4GKJF 4KO0B 5G20A 4N56A 2G0BA 1LWFB 2IVYA 4DS5A 5AXKA 3M2VB 2IBOA 4C8NA 2WSFC 2YNGB 1XIXA 2ZEFA 1UP1A 2RNEA 4U67Q 3QGHA 5IFMA 1WHWA 4ORFA 2HAIA 3M8RA 1X5TA 3GMGA 4DEZA 2A18A 2HFNA 2E1CA 4NX9A 2MSTA 3LANA 3DXBA 2BM1A 2G3AA 1MJBA 2FLNA 1I21A 1L3KA 4NLVA 2HZCA 2RQKA 1RU1A 4W4MA 3FFIA 2HBRB 3BQ0A 3G82B 2IVMA 2FVSA 2QSFA 4L74A 4R76A 4ETZA 4PWDA 4WIIA 3US5A 2W9AA 3POTA 1BQXA 3MR5A 3GFXA 1AROP 2MLZA 3GFHA 2VJUA 4O44A 3C16A 4MHNA 4U96A 3FBUA 2B5JA 5LMNJ 3QSIA 2PA3A 4Q43A 3TA1A 4X65J 4LIRA 1JX4A 3TEGA 4DUTA 4F26A 2M4MA 2I6WA 3CMQA 4ELUA 4KB7A 3JSBA 3N5FA 2DGWA 2Z3LA 4Y2KA 3EDQB 5D0GA 1RT2B 3KXDA 1X0PA 5F47A 1Z1ZA 1WWHA 4XPKA 4ZP6A 2FLLA 1HQEA 1IKWA 2JH3A 1HW8A 3AHPA 1EP4B 4A8SA 2FVGA 4O4GB 2ALZA 1Y3KA 5L1JA 2WTFA 3ISXA 1JNRB 4KYZA 1D0EA 4DNCA 4MKAA 4XIUA 5ETLA 1X8DA 3H59A 1JJ2R 2MQQA 3QFHA 1O5JA 4USMA 1EX8A 2DEJA 3VVTA 2ADCA 3F56A 5C24A 2ZUGA 3RU0A 1FRXA 2NR0A 2NSMA 2VEZA 2HVIA 4MI4A 5F8HA 1CLFA 2CQ0A 5CPAA 3BQ1A 4OP4A 3KLEA 4B9VA 5LXRA 2QG9B 1LXJA 3Q0AA 3CDAA 3BJ8A 3I5BA 2DXFA 1WI6A 3JSMA 1HARA 2UVWA 1YRTA 3ZO7A 2BOAA 3BSCA 1N5TA 2ODFA 5EC4A 1PGZA 1Y5IB 5ETPA 2N7CA 3Q2SC 3W3SA 3K5OA 1YGHA 5LMUJ 1SIZA 3PYDA 2YBVA 2JDCA 3MEDA 1T3OA 2LDIA 1H7WA 4PK3A 3MAAA 1ACMB 4BBYA 2LA6A 3CCTA 3MM6A 2UU9F 2ZH4A 4FD4A 4UIBA 3ILJA 3U1LA 1SH3A 5H9FJ 2HRTA 2I8EA 1RA6A 2YY3A 2W2MP 3KDNA 2V50A 4F8ZA 1SC3B 3VWEA 2RKIB 3PRBA 2QVPA 2HHTA 3BKFA 4R0JA 3HD2A 3WZ0A 2VFSA 4XNHC 5AJ3F 1RT5B 4AD6A 2J8RA 1XBUA 2YX4A 2PT0A 4OHXA 3EM1A 1TK8A 3GJQB 2ZJPQ 4K4UA 4DX5A 3QFWA 2CZVC 4LF8J 3M8PA 2I38A 1T3NA 3BGRB 1Q95G 1K1SA 4NLPA 2AT1B 1GQEA 1D1UA 4PQAA 4K0KJ 2BANA 1P9QC 2ROPA 5IX3A 2HVHA 3V5RA 3IBCB 4DLEA 4KHPJ 4M1KA 3OVBA 4MK7A 4JI5J 3RGIA 3PO4A 1E6VB 3W5YA 3MCOA 2KT5A 4OV6A 5L38A 3DN9A 3RB4A 4A8YA 4KOTA 2OTJS 4TY9A 1XN9A 5ETNA 1GMWA 2MGZA 3ZTQA 2KB2A 3H4DA 2F5IA 2ASDA 4I67A 2PJBA 4CLTA 1FEEA 5AG6A 4J37A 4CLUA 3ZXWA 4DLGA 1ICEB 2DT9A 2PRQA 5HMZA 3TUZC 3AA8A 3AH6A 4X4UA 3JSYA 4FXDA 2QFIA 3CCQS 4DR1F 3GYXB 4Y6IA 2AGOA 4QPTA 2PJ3A 4KH1B 2BUNA 3P8BB 2MEWA 1MG7A 5KT5A 3HVTB 2ILYA 1RCXB 3BREA 4CLKA 1S48A 2E1AA 2ACMA 2G13A 4QYZK 2GMJA 1Q4RA 2HS0A 3UVJA 2DISA 4LFCF 1DURA 2PJ4A 4C7IA 2OMOA 1GX6A 4I2PB 1C0UB 1YLEA 3J81j 4QIFA 2W9CB 4DR1J 4IDKA 1FWPA 5D15A 5ISVA 3QAUA 5DDQC 4ZVUB 1HMVB 1RXTA 3W91A 2RHQB 2AKWB 3K58A 3T5HA 1YIJS 1T02A 4G1PA 3NH4A 3QO9B 4KGMA 2NUHA 4F3QA 4FYYB 3ZNUA 5HROA 2I5JA 3FQLA 4MK8A 6FDRA 4LFAF 2QRRA 5CYMA 1MK4A 3KDOA 1QUPA 3EPGA 4GO5X 2Z3NA 4NLQA 3J7AN 3TFYA 4C48A 4B5PB 4C3LA 1PYOB 4NA2A 2IDLA 1S49A 3RB0A 1WWZA 1QD1A 4L3KA 3ZZRA 1H74A 1D8ZA 3NS6A 3IBWA 2FLOA 4JI3J 3QPIA 3VARA 4K4XA 2CNSA 4WWVA 3V81B 1HI1A 4PG5A 1LQ9A 2W1BA 5A8RA 4X4VA 4A38A 1JLGA 1QSOA 4RLEA 4ZMMA 3IU2A 1EIYB 5ADZA 3SMZA 3WQPA 4KV8A 1TAUA 5HLFA 2B56A 3CWJA 2B3TB 4DV0J 2CXAA 1MWYA 4CAEA 4DMZA 1HQUB 4RI1A 2A6MA 3UY5A 1MN9A 1PJ6A 2FIAA 4R25A 1HHTP 3M6WA 2J8MA 2AX0A 1KUXA 3MM7A 1AMPA 1XNRJ 1RT3A 2V2ZA 3UDEA 1CBXA 3PHEA 4HNWB 3DRSB 4NXMJ 2RRBA 4LJMA 3IBFB 1Y11A 3H90A 4GC6A 2QYGA 4ZS6A 1X9MA 2R7XA 4NLUA 3TNVA 1EETB 2R8JA 4DHVA 1UWAA 4ED0A 4CLYA 3DC2A 5IV0A 5LT5A 4TLQA 3KGQA 2VI7A 3KYLA 4KOWA 1N71A 4NGPA 3D6FB 4ZVQB 5LRJA 3G8SA 3QQCD 3DGPB 4M5NA 4K4YA 3KLGB 1S3ZA 1CJVA 1B64A 1MJ9A 1N0UA 3KJFB 3G3SA 3NWGA 5F48A 1VKCA 1HR0J 3OBIA 3HHLA 1U8WA 5DS7A 4QOTA 1MU2A 2D3UA 2RF2B 1YLXA 3TVKA 2ZEJA 1ZAWA 1RTQA 2ZHOA 4DV6J 3IRXA 4MIAA 5DGAA 2IJRA 1N56A 3BH6B 3SYZA 5DLGA 2KHCA 3V8IA 1TKXA 3FSYA 3ET6B 1TF8A 4NLRA 4H54A 2J9EA 1BQMA 5EUHA 2CNNB 2H51B 1OMSA 1SIWB 3BSAA 4PABA 2ZE2B 5DZ7A 2R8IA 4USJC 3ULHA 4QVTA 3CUNA 4MHZA 1EQMA 3CO9A 2BABA 1IIDA 4RBUA 3MRUA 4WYLA 3CMES 1R8HA 2Y0MA 5KFAA 1UCNA 4N41A 4IG0B 2KG0A 2I00A 2VD3A 4PEOA 1DE4C 3I0SB 5JXSA 2Y1JA 2DGSA 5FDLA 4YUDA 4B3SJ 4ECWA 3O5TB 1RTZA 5HJXA 4OZLA 3T1AA 1RUSA 2HNYB 2PI5A 2IRYA 2XTJP 5IT0A 3S9NA 4LRFA 1KVIA 1LXNA 2YNDA 3SJGA 4A33A 1XR7A 4B3RF 2GMLA 1DQ8A 3HHLD 1VQPS 1NU4A 4A32A 1JLQB 4A8QA 3M05A 2DGTA 2BQRA 5D6GA 1J5OB 1F9HA 1IKYB 1HYSA 1GXTA 4AVAA 4HHJA 1FT7A 2JRSA 1VQOS 2V68A 5DDRC 1B4SA 2EVNA 1BWVA 5KFTA 2IA0A 3CW2C 4HI1A 1UFHA 4F3OA 1XMOF 2A2CA 4OKOA 1GTEA 1KQFB 2B7BB 2V8HA 2WRMA 1TUWA 3MM6B 1P27B 2Y8WA 1OY9A 4FYXB 1IOIA 5CH7B 1WG4A 4FD6A 1GH8A 4C7HA 5IV3A 1JJCB 1VHSA 1JLAB 4CYUA 5A6PA 4LF6F 2OPQA 1TQLA 3U27A 1RHJB 4B3OA 2B3UA 3BF4A 2Z56B 3HZEA 3SXLA 2YKNA 4M5KA 2AFOA 4WE1A 3FB3A 2OHDA 5RUBA 2QJ8A 3FRYA 4USHA 3CT9A 2R7OA 2PJ6A 2WBRA 2QTWA 4H4OB 4KC5A 1VFJA 1Q7LA 1S1WB 3RTVA 3VGUA 4PR6A 3R1KA 2BJ9A 2PJ8A 4ZJOA 3IS9B 3DDDA 3JQJA 3VHQA 4FXVA 1TK0A 2P0WA 1U25A 3UCZP 4O4GA 1M5KC 3WC7A 4GS4A 2AJ6A 3R8YA 1RAFB 1TL1A 3W5XA 1S1UB 1F2PA 3LH2S 2HYIB 1R3NA 3FCHA 4B11A 1S1VB 5I3UB 4DBQA 4KSIA 2IM1A 1CULA 4GKKJ 4I7FB 2VG7B 3SQGA 2Q79A 3SSQA 4EEYA 1WC6A 3QZ8A 4IH7A 2DGVA 4IKAA 2JEJA 4K2XA 4OIXA 4J9PA 3UDLA 3T5LA 1NJIT 5A2QU 4X4PA 1TIQA 4X8IA 1ZM2A 3E0KA 2VQFJ 1ZYQA 3F5BA 1QE1B 2YKAA 3J80U 4ECSA 3A8IA 3CSKA 3ISND 4FWUA 2HPUA 4DV7J 4P45A 3MWBA 3KMQA 2C42A 3HHLC 2DVIA 3MEGB 3DU6A 5H9EJ 2PDOA 2VUGA 5L1KA 2PA8D 4X4RA 1S72S 4Y2AA 1DTDA 4DSLA 1FKPB 3D2WA 4RU9A 1H38A 3C6TA 1AFJA 1EE3P 4JB8B 4FF1A 1PBUA 1IBMF 2BE7D 2YWFA 4EFAC 2XMVA 4AQYF 2YGWA 4J90A 3KFWX 4UW2A 3GZ7A 4WP8A 3FIXA 1K4JA 3B35A 4LIWA 1Z9UA 2A4NA 2MDAA 2LP4A 2B5GB 2XNRA 2FZCB 2XMWA 4AXIA 4ZCIA 2NQPA 2XI3A 4F4KA 2VJVA 1EP4A 4K2JA 2VQYA 3THPA 1Y5LB 1Z8LA 2ASYA 4ITSA 1JKHA 5E3AA 3SI8A 5CA5A 2CQCA 4QYZJ 2XBPA 2L9NA 1LWEB 3BM7A 1LV5A 3N79A 3CXSA 2XZDB 3I0RB 3D4JA 4Y2MA 1JKHB 2VQEJ 4DQSA 2WUUA 4ELTA 3WIUA 2J0SD 1RTJA 3TO9A 5KFHA 4RW6B 1HEEA 3QATA 1S1TA 2JZ5A 3QT8A 3KJVB 3H40A 1IYLA 4LSNA 4IFVB 4JI3F 2KH9A 1YJRA 2UUTA 3K5MA 1TKZB 3LTOA 4ZGYB 4NEZA 3B54A 3KK1A 1OSDA 1IB1E 1UWBB 3CCMS 1OO0B 3ELHA 3VAHA 2RJZA 3CE8A 3CDWA 4KGKA 3C6TB 1C2PA 4OIDA 2R7HA 3R9GA 3CB4A 2LLZA 3R1LA 3TCVA 5HANA 1L3SA 2RVJA 1KSPA 3AQOA 1U24A 2Q6CA 1NMEB 4GVBB 1VQ5S 4ZPBA 4S0MA 4YY3J 2POKA 3EGZA 4ZBGA 3QRPA 1ZOTA 2CPZA 3BPSP 1YZ6A 1KLMA 4K3NA 5GAGI 1AUDA 4PSXA 4C11B 2VG5A 2ANPA 1JB0C 3W63A 2GQCA 4ZVSB 4M6IA 4U7UD 4ZP7A 3D1HA 2R7SA 5GCNA 5EWEA 4UCPA 3W9JA 2J7WA 4QWDA 4HVZA 1S9GA 2XEGA 4B9SA 1FESA 3DMJA 3M6VA 3DR6A 4ELVA 1UJ4A 4B14A 1IN0A 2ABYA 1TKFA 2AFZA 1BHNA 2HQIA 5J2PB 3MPWA 4AE5A 1TUVA 2J8NA 3GSIA 4OJ1A 3ETMA 4MCQA 1Q8BA 3UNYA 2PC1A 4JV1A 3DLKB 1N5QA 2XO6A 4F4ZA 3MMCA 1U6MA 2B7CB 1HNXF 3QJLA 2WSEC 2O28A 2KXHA 4USTA 2XG8A 4HNYB 5DWNA 1GHEA 1S7KA 3B3CA 2H5JB 5E3CA 2VKZG 1HFEL 5LMNF 2O01C 2HK3A 1IICA 3DGPA 5J1NA 2MQMA 2BEFA 4WP3A 3WC5A 3FMWA 3I4HX 4AG7A 1U49A 1S77D 2E9RX 3FF3A 2V4JA 2VB6A 4HKFA 2IHR1 4IG0A 3PX4A 1ITPA 1F5CA 2XGPA 2VZZA 2DRDA 1CPXA 1MNEA 2GHPA 2QA2A 1SI9A 1NEEA 5EHHA 4ZLNA 4DX7A 1R57A 4JXQA 4OADA 3L7OA 2PVVA 1IJFB 4FNIA 3AXMA 4DV4J 5A28A 5ETSA 1XJWB 3S6HA 5HVGA 2CKWA 3VQSA 4V19J 4P9SA 1Q5YA 1CP6A 5BWAB 2BA9A 4EMEA 1SC4B 4OLPA 2HHPA 2WHOA 1AT1B 3AOCA 1XFOA 2D4OA 1YRXA 3CD7A 2CG8A 2JNJA 4TNUA 1ROFA 3R97A 3NNAA 4RL1A 4PAAA 5IV4A 3D1OA 1R0AB 4PWDB 2B9EA 4FS1A 4KUAA 1ZG9A 2CJYB 4ZJLA 3ZTPA 2UXBJ 4FD5A 5D4OA 4IRKA 5E41A 4FYWB 3D5MA 2R7QA 2LQ8A 2DBBA 1P0HA 1AB8A 4FZVA 5IWAJ 3OL6A 1QSMA 4KJIA 5F9LA 4CTAB 7AT1B 2ZFHA 3DRRA 1PU9A 4NYOA 2DNLA 3VGSA 1BLLE 1ZZNA 2RT3A 4NA1A 3R5CA 2EBJA 2HLTA 1RWKB 1YJTA 1F1BB 1SH2A 3PB4X 2WPWA 2KT3A 4CYOA 1U45A 1WACA 1WEYA 3LPYA 1QAXA 1N6QB 4Y2CA 4LF1A 4ES2A 2A0FB 2DR6A 2BR0A 2B4PA 4C8MA 1B70B 2Q04A 1BOBA 2IMOA 4NGQA 4LF7J 1BLUA 4KOVA 3BYPA 3EGVA 4B5OA 1D9FA 1TFWA 5HVHA 1AUGA 1RZMA 4ECZA 2RUSA 2FJBB 2OUGA 3THTA 2N3LA 4X4TA 2X3DA 3DRPA 1FE0A 2E5GA 4DJBA 4HACA 5J1PA 3BR9A 3PTWA 3E51A 4B3RJ 1NK6A 5IM0A 3Q8YA 1X4EA 4XAKA 3NG8A 3UW1A 4A94A 5J1EB 5L46A 4I7FA 1DRZA 3N01A 3CIMA 2JVRA 2V8PA 2XULA 2ZZMA 4JI1J 3OFFA 3MUTP 2UUCF 4C0OC 1KQSR 2Z3PA 1Y00A 2CJQA 1CC7A 1OQ3A 1YW6A 4A8OA 2R7RA 1HMVA 3MEEA 3W1YC 3ZZZA 2E5IA 2X3GA 1J5OA 1X9SA 4QR2A 1W25A 4ZCKA 2YKPA 1QTMA 2MTLA 2J8SA 2CPEA 3DI6A 5A27A 4OZ3A 2FE7A 3PW0A 1X0FA 3KJQB 2K06A 3AA9A 2KZZA 3CCUS 1HI8A 3KNGA 5ITHA 2HRUA 2M7SA 4K5RA 5HROB 4GC7A 4AVBA 4P2FA 1TKXB 1JJHA 2CF4A 2D3O1 1PIEA 4ZVTB 3TAMB 3NRBA 2OO4A 3Q89A 5LSOA 4JV5J 2EK6A 1T7PA 2ZVSA 3BN4A 2WW4A 3I6PA 4W9YA 1T9YA 1QSNA 5C2CA 1LNQA 1RJJA 2J6TA 1WUUA 4X66J 5HP1A 3BLNA 1M1GA 3ZZ0A 1ZS6A 4F0KA 4QWCA 4DPYA 4A37A 5SUHA 1QSLA 1WF0A 3IN5A 2RQCA 2MHNA 1NDLA 4LFAJ 2HNDB 2ZKUA 1LWEA 1V3RA 1BAVA 4OYAA 5THWA 2GQ2A 3POTB 1BQNA 1EZZB 1PKUA 3PB8X 2PI4A 4KOYA 4DUYF 3H7HB 5F0WA 2MKSA 3G6VA 2MKKA 2ZC3A 2NYQA 4DF8A 1N34J 2MZ1A 2E1MC 4NLXA 4EYIB 1XQIA 3FEXB 2JOQA 1M1KT 3PV8A 4P6QA 2OPSB 1X9WA 1HDUA 4DXLA 3L09A 2CNMA 1BO4A 3OSNA 1IKWB 4K4VA 3H42A 1H98A 1WG5A 2K7KA 3RZAA 4H2KA 2CDRB 1N88A 3QYYA 2MQLA 4M85A 4W90B 2BL1A 1RAJA 4Y65A 4DL6A 2XY6A 2DGUA 4PWWA 1Q78A 2C2RA 2V4RA 1RYRA 1RISA 1BPNA 4Y49C 2Q43A 1KS2A 2ZNYA 2MZJA 3EZUA 4Q2LA 2D3OR 2BJ3A 1C0TA 3KR4A 1XMQJ 4LF4F 2OP5A 3VAMA 4B9TA 3OXGA 4Y28C 3UDVA 2X1GA 1RT6B 1K8AT 2PR1A 4ZCLA 5E3RA 5DQHA 3J81Y 4DL5A 3F0NA 1X31C 1Z8XA 3R7SB 2C2OB 3ZZOA 4MHDA 2GE3A 5KG3A 1ZG8A 4MMOA 1C1BB 2B5JB 3MDFA 4CZCA 1QLNA 3FZ2A 3LAMA 1R6YA 3TQEA 3B6BA 3MFHA 2KJVA 2LQ5A 2B4UA 4RW7A 4F4AA 2K2PA 4JYAJ 2DEIA 3Q8PB 4DF4A 1R8PA 3EVWA 4JD6A 4U9RA 3T3FA 1SJFA 4MCPA 1JNZB 4JI4J 2N4CA 3UD5A 2QMWA 1PYTA 4NZ7A 2F7VA 4U95A 2HHWA 5HK4A 3G82A 4QB9A 1S99A 2XHCA 3DNCA 4NGNA 4JYWA 5CYMB 2IPOB 1TL4A 1N54B 1JLFB 4P7VA 1V3SA 3RBEA 3H2UB 3D7DA 4J9UE 2AZ3A 4DZDA 1XWLA 5AG7A 1T8EA 4ZVEA 4KOUA 1FRKA 5G0RA 2P8IA 2KTQA 3RB6A 1SC6A 4OJGA 3KTQA 4MAKA 1N5YB 5GADI 2ABZA 4RW8A 2V4JB 2ZH6A 3CJ3A 4DQIA 2I9SA 2U2FA 1ZA1B 3HLUA 4KGVB 4JI8J 3M2VA 3EXCX 4O3PA 3SCIE 1R7IA 2J8AA 4KLVA 4DPWA 1NNDA 2ZHBA 3NAIA 5FD1A 2GANA 2EBEA 1N36F 1QSYA 3TX0A 2FDNA 4NEXA 3M32B 1N48A 1UW9A 1T9TA 1X4CA 4BBHA 4TU8A 2CQDA 3N6NA 4CM0A 3GIRA 2WSCC 1B7FA 4DI6A 2DNNA 2RKIA 3HVWA 2GLJA 5J8FA 2JEIA 2FC8A 3I82A 4KLWA 1M0SA 5AT1B 5G4DA 2QMUB 4YFJA 3CXCR 5JMNA 4A8WA 3PIOQ 2PSZA 2X1AA 2G9DA 4P2XA 2ATRA 2OU2A 4ILLA 5L9NA 1U1MA 2HQFA 2ZENA 5DS0A 1OJ4A 5HMXA 5IZHA 2UXBF 4O3RA 1VQLS 1NXIA 1QMUA 2YNIA 1P9YA 1JWQA 1VBKA 3NGRA 1HYSB 2GU2A 4RNFA 1X60A 2FPHX 4MXUA 3VF0B 3MURP 4IQXA 1YJ7A 3C19A 4NLSA 4ZKAA 4DV3J 1FNOA 2G0JA 4B13A 4DN0A 4RW4A 1L3VA 1S1XA 1VJWA 1IKVA 3M8QB 2GV1A 3MTJA 3M8YA 1XTZA 2IA6A 4C8KA 3Q86A 8ATCB 4MK9A 3FEEA 1M4IA 4I49A 5DO2A 2YH0A 1FX2A 1S1VA 4GXHA 1VRUA 3HHNB 1MMLA 4KHRA 2EFVA 3FBFA 4DV2J 4Z2XA 2Q51A 1OYDA 3GUXA 2Z2ZA 3H0PA 3CCJS 2C28A 2CQPA 4UOGA 2C2DA 2VOOA 3LWLA 2HLUA 1NHUA 3PW2A 4F9VA 1N4LA 3BS9A 3LO3A 3G6ES 1HWJA 3VVUA 2G4BA 4QWAA 1KVJA 1MN7A 1YBAA 2ATLA 3D0HE 4DJLA 3C66A 4I1TA 1UVMA 2GVDA 4MCSA 2RUGA 3GV7B 4JI5F 4II9A 4MYUA 1UJ5A 2PJ5A 4KSFA 4KSEB 2E1RA 2HVEA 2HWIA 2H5MA 1VHOA 3TO8A 4ZPTR 1FNMA 3BN7A 4UTGA 2NYIA 1T95A 4X4SA 4ALZA 1NK0A 3WDOA 1RWUA 4I0WA 1ZO0A 3MPDA 5JM6A 1S57A 4OZNA 1HBUB 3AJ1A 3BJ7A 4BMHA 4BCAA 1TF9A 2DNYA 4A30A 1JXLA 2JC0A 1RTIB 1U26A 2LEBA 3H5ZA 1N32F 1GFWB 4J5OA 5KT6A 2QLWA 3R27A 3PNIA 4KPCA 1YTYA 2HQ3A 3G6YA 2ZW7A 1Q82T 3IXQA 3EGWB 4GKJJ 3TANA 3DYAB 4DUZF 2BJEA 4FAIA 2YNCC 2ZH3A 4OX6A 1WTBA 1BE4A 3N5BA 3UCUP 3JTOA 4Q8EA 3PZJA 3I1UA 3I9SA 2XZTB 2WVDA 4Q8FA 2AFXA 5C42A 1ZBTA 5FIIA 1RBAA 2GMHA 3VR1A 5DRKA 3EYZA 5LRGA 2XMJA 3TQ1A 5HATA 3TWZA 2OR4A 4I68A 1N8RT 3TOBA 4CTAA 2JBJA 3HF5A 1TZ0A 5GVQA 1TUGB 5E3PA 4LRCA 3V4IB 4KHMA 4N77A 1A0OB 4YQWA 3KI9A 3R5GA 3IWXA 2ZZNA 2DRBA 3KKFA 4LR9A 3N28A 4OI0A 2V94A 4EMDA 4M5GA 4F67A 3D3BJ 4WXOA 4M6GA 3KK3B 1IKVB 3SDEB 4AXJA 3LUYA 2F4VF 2LA4A 2PJAA 3I87A 1HI0P 3Q22A 4UEEA 2CXEA 2C3PA 3CTRA 4WK1A 1KP6A 3UNGC 3EX7B 2MLXA 3OHBA 1VHFA 2RE1A 1KWMA 1CC8A 2ZH1A 5B0BA 1UPPA 3ZTRA 4X64J 2V8DA 3T1HF 3V6HA 2IY5B 2DHAA 1S9EA 3AT1B 2E7XA 3PKYA 4MBUA 4YB7A 4H4KC 2DK2A 3N4WA 1K1QA 1YQEA 2YWEA 2LMIA 2DKOB 3HZGA 1NO8A 1CJUA 1NPRA 1F9FA 2XS7A 8RUCA 1RB0A 4M95A 2AP6A 4F0XA 2O3DA 5KFSA 3RAXA 5JH9A 1ELOA 3CPAA 4P75A 3IC1A 3HFVA 4ONUA 1H8LA 3WC0A 5H86A 2L9DA 3QO9A 4A39A 1N5VA 1Y7PA 4DQRA 2CQBA 1WELA 4AUKA 1U1PA 1HQEB 2HV2A 4G1QA 2RDIA 5AXMA 1BUXA 2GIFA 1VRUB 5H9FK 1P8GA 4L89A 4A8FA 1RYSA 3GYGA 4O23A 1S6QB 3RRGA 1VQ6S 2PJ9A 1UZHA 3NP5A 2GREA 4ZY0A 2G1DA 5I0CA 2UUCJ 2O1PA 2MLYA 5KG2A 4LSZB 2H9ZA 4OAEA 5FLXY 1M44A 3DSBA 3FMCA 5KFWA 4NRTA 1FE4A 2XO7A 3G86A 1G3OA 4LF9F 5J2NB 1UKUA 4XDDA 4WKYA 2VPWB 5KG7A 4MFPA 3NAHA 3AFGA 5EDWA 1JLFA 2R3VA 2EWBA 2BKPA 2Y9HA 1M5PC 5HQMA 1KZFA 4OC3A 1KFSA 4YU9A 3OVAA 1BXNA 3QB8A 1OSCA 1YX0A 2M8DB 5IOLA 2HNDA 2FQQB 4ZP8A 1VIXA 1CEZA 3LGMA 3E01B 1CP7A 3IJ3A 4NZ0A 1Q1KA 4B3TF 4U9YA 1U1LA 3LMSA 4DV7F 2RQ4A 1S76D 2LQ9A 3V7ZA 3IGVA 3OJUA 2MQ8A 5KFPA 1NH8A 3BKTA 2Q66A 1GX5A 4JP8A 1U1QA 2FHJD 2ARHA 2V77A 1A9NB 1SQHA 1F2OA 2NPFA 5ETKA 1K47A 4F0HA 3DR8A 1F2HA 2W01A 1S4EA 1VLOA 3NGKA 4OYXA 1MMNA 5IWAF 1NJZA 1Y9WA 2PMHA 1IR2A 3JVNA 5IM0B 1S6PB 4RNMA 2ZOGA 2AFMA 2QL5B 3KHHA 4DDFA 2HS3A 1NSKL 5C5JA 3D4UA 1U09A 2YNFB 4QIEA 3GR1A 2WAQD 4M3SA 4O3QA 2UVUA 4M8LA 3Q8QB 4HYKA 5A8KB 1CJKA 6AT1B 4F6AA 5I42A 5T41A 4ZP9A 3T1HJ 1Q79A 4ZIVA 4P4DA 5KFYA 1WD6A 2A10A 2W2QP 2QIFA 4CH0S 3EMTA 2QN6B 3LF0A 1H7XA 5J1EA 3TUIC 1Z5RA 1AXQA 3M8QA 5IC6B 4WU3A 3HKZD 4EWTA 1XMQF 4LF4J 3V6JA 1ZPWX 2B4DA 2J76E 4H6UA 4HL9A 1N0VC 4QR1A 1DBDA 5ETRA 1RWNB 4DR3F 5ELYA 5JGFA 3Q8VA 4DV5J 2HUZA 4PXDA 4IAVA 1Q0NA 2JL9A 3KHZA 3LALA 1QTNB 4XK8C 2JFKA 4X62F 4RPFA 4ZLJA 4C4WA 4R5PA 1PC5A 2PQ8A 4M94A 2I0XA 4C6AA 2CWKA 3ZTSA 5JQ4A 5HN0A 1UVJA 3Q23A 5HI7A 4MKBA 2UUAJ 2BE9B 4MHPA 2XLKA 4Q0BA 1UA1A 2HAFA 2REFA 1KUYA 1G2EA 3WR7A 2GCFA 5CQGA 3QRQA 2OLWA 2FVQA 2XSFA 1JLBA 2RH3A 4CRJA 2KI2A 4DR2J 2YQ0A 3SZ2A 2Q1LA 4MH8A 3UQSA 4LT6A 3BSOA 3GILA 3FH4A 2ZZTA 3QWPA 2YWKA 4FP9A 3PBEA 4R7MA 1NHVA 4L72B 1JWWA 2FHKA 2A1BA 4NCGB 1TV6B 1LOUA 3JYTA 2QSWA 4H4MA 2PR8A 5F8NA 3HDSA 1F60B 4QZVB 1R0CB 4P10A 3IGRA 1RWXB 3EY5A 1HD0A 5G22A 2VFTA 4ZY2A 3D6TB 1LAPA 2FT0A 2XMAA 2V9KA 2DJWA 3FXTA 1VI7A 2GIQA 4EI2A 1VRTA 4K8RA 5HXDA 4N8OA 1VDHA 4LRDA 1HA1A 1C4CA 1Q7LB 4M5DB 1GAOA 4UOCA 4EO6A 3JAMU 3PBBA 2BW2A 2HNYA 1FDNA 5KFMA 2DNGA 1HWUA 2F40A 2HQYA 2R2TA 1PUAA 3M8SA 1Z8TA 1UL3A 4LBIA 3H5YA 4F3MA 4OMFG 4ETXA 1TFYA 4NXYA 4KZTA 2OIHA 3P6YC 4OJ3A 1IJEB 1TR0A 4FYVB 4MFBB 3KUEA 4CO3A 4I2QB 2R98A 3AD9C 2NXNA 4C8ZA 4C98A 5DGBA 4K4ZA 4GM5A 1GMVA 5E0OA 5GMDA 3AB4B 2AW0A 4I64A 2MKCA 4OX9F 1DTTA 3MGJA 1CJWA 1G6BA 3D1QA 3PY8A 2HGLA 4TWEA 4RU2A 1HD1A 3QWUA 2G2YA 2MGZB 3WBZA 4YMEA 3VCDA 3UN3A 4RNHA 3EGNA 1X4FA 1RHUB 2NXJA 3QAEA 3ZZTA 4Q5VA 4MKVA 4PRFA 3V81A 1XEBA 3CC7S 1RAOA 2NXEA 4PWUA 3D28A 4L73A 2EFQA 2BVZA 1OIAA 4DL2A 4LRAA 4BD9A 3OW2R 4QJVA 1OWXA 4LMZA 1YRUA 4NLDA 5IT9Y 1WNEA 3CJRA 2VH7A 1ZPVA 3RYLA 4IUFA 2XLJA 2XEXA 1GXUA 4C0HA 1Y10A 3GY9A 3HT0A 2QECA 3DMJB 2PE8A 5GAHI 2FZGB 2LU1A 2DNZA 4O4RA 2F8EX 4O0IA 1TTHB 1S1TB 2CQ3A 2DXEA 2ZEMA 5D3GB 4KFBA 4QIVA 1NJXA 2R7WA 4F8RA 1NSQA 3ILLA 2ZITA 3LP2B 2PEBA 1QM9A 2RIJA 4DR4J 2Z11A 1IVZA 2VXKA 5D4LA 4KS9A 3I9V9 1U0HB 2PC6A 3KK3A 5B0FA 1A6LA 2AYBA 4JI1F 3DOKB 2FJDB 2F65A 2KZMA 2C3YA 3QT5A 1CQMA 4CLFA 4OI6A 4ICLA 3KG0A 1HNVB 3FC9A 1YWXA 2HBZB 2N7YA 1MU2B 4HR2A 4J9NA 1LW0B 2C2KB 1NAQA 2C3OA 4XPDC 4JOUA 1VR6A 5CAAA 4TN2A 2WPXA 4RW6A 4K4TA 1D9DA 2RSQA 1VQ8S 2X1BA 3TR5A 4D3GA 3OUYA 3QT6A 4ICLB 1J4JA 2KRRA 2VIHA 1XERA 2NPIA 4IRDA 3EZ5A 1C1BA 2W4DA 4QW8A 4UQGA 3A8JA 3TX8A 3K2KA 5T14A 4P4FA 3WC2A 3MEDB 4MFQA 2DHGA 5F09A 2WCXA 3ENAA 3VAFA 4CAWA 2CJAA 3CC2S 4BC7A 5HVFA 4KIAA 3PRTA 2B4VA 4A8KA 1M1DA 4LR8A 4ZPWR 3MUVP 1LCPA 4LBHA 3W66A 1FY7A 1GXLA 2MB0B 2EKYA 5F8IA 2F9JA 4E8UA 4HH1A 1RT3B 3BGFA 5LSRA 1DFDA 4ENOA 2OZGA 5B0EA 5M2UA 1F0XA 3B3TA 3ADAC 3LA0A 4UCMA 4JI0J 5D29A 3CGIA 3PG9A 4OYPA 2F8HA 2ZBCA 1NB7A 3K17A 4ZN1A 4U7UK 3SJFA 1UEVA 4JI8F 4OYWA 2HW3A 4F2SA 2OPRB 3IEHA 1SKRA 2JSXA 1RT1A 2FHOB 2YX7A 2NMTA 3DOLA 4DSKA 2M0GB 3U02A 3KK2B 4EBCA 5KFKA 3TVZA 1MWQA 1XC9A 2Y1IA 3A9LA 2JWNA 4ID5B 2YH1A 4ZI6A 4B3MJ 1UWYA 1JK9B 7FDRA 4UFVA 3T41A 1SH0A 3HHLB 3DOLB 3TW0A 2YVSA 3IS9A 3ICLA 1B99A 2NXUA 1FNXH 3D2MA 3KR5A 2EWHA 2NZCA 2XGQA 4ZX9A 2VHGA 2OOTA 1L5UA 2E5JA 3ENWA 3NGSA 4PPDA 3KQZA 1FJ7A 1J5EF 3KKWA 4RW4B 1V9OA 3DOMA 1TKJA 1F2GA 3TAMA 2GVZA 3GCXP 4OYOA 1UFKA 4I6YA 3LGHA 1XRYA 2EVZA 3W7BA 5D8HB 1LW2A 3CEDA 3CJ0A 4I69A 1S10A 1MW7A 2LEPA 4JJXA 1L0CA 3HULA 1WF1A 3TZXA 3MZIA 3T19A 3JQMA 1NK8A 4LSLA 3K5NA 4AQYJ 2JBKA 4OZ1A 4OHYA 1T0TV 2K7JA 4KSAA 4B12A 3KWMA 4P74A 5KFFA 4NGMA 1EETA 1EARA 3R6LB 2CPYA 4P4IA 1NK7A 3NA6A 3KJNB 4CRZB 3ZJ0A 4UIAA 1CPZA 2IQ6A 4P71A 4CIOA 4NLWA 5DQGA 4CGMA 2XMMA 3IGNA 2HQCA 2JEWA 2M9KA 3W2WA 1T03A 3L7UA 3KLFB 3AJ2A 2KM8B 1QE1A 2YWWA 3VZIA 4F7VA 4UQTA 3RYOA 3NGTA 2DD8S 2DHHA 2ASLA 2ATCB 2LQBA 4B02A 4IR9A 3T9NA 2HVDA 1ZA2B 1CULB 4H89A 1K44A 4C8OA 4YEAA 2WVCA 1RP5A 4DQQA 3RW7A 2OEMA 2R1IA 1P1LA 1VQSA 4LFCJ 3DI6B 2EI5A 4OJHA 1G7CB 1S12A 3FCWA 2OD4A 3PACA 1RWPB 1S6UA 2EPIA 3BI0A 3FBCA 1YQHA 3PB6X 2OI2A 3M8WA 2YXLA 2W4CA 2XWXA 3I31A 3CJ2A 1FI4A 1B87A 3UN2A 3MOZA 2AEFA 1KOOA 2E5HA 5L9XA 2G0CA 4BDPA 3IG1B 4R57A 3RAQA 1SQGA 3BR8A 1UJ6A 1FK9A 1NK4A 1LAMA 4CGPA 2BQUA 4NCZA 1F9EB 2COLA 1SPBP 4ZY1A 3MEGA 1QSSA 4X4OA 3KZWA 2NYHA 3TARA 3B4DA 4MRIA 2O4HA 4X62J 1HNZF 2M2BA 2XMUA 4YDDB 1URNA 3F44A 3C14B 2C2ZB 1QUVA 4OZ0A 2UXDF 4IDKB 3IM8A 1S0OA 3D3CJ 3TE4A 2AJ2A 3T1YF 2LU2A 5CXTA 4OHVA 4OHZA 4YB1P 1X4AA 1NK5A 2V4QA 2B9WA 3R2CJ 5K8NA 4ZOSA 4NWBA 4U6PA 2X1FA 4ZX8A 4ECVA 1FDDA 5KFJA 2CNOB 4ECTA 2VV5A 3D3SA 2PIIA 4M5HA 1DQAA 5AJ3J 4WKRA 1HNVA 4KT0C 5B0AA 3RG6A 3F73A 4JLYA 4FF2A 4C2XA 1Y7RA 4JI7J 5CYQB 2C2MB 3AB2B 4E2AA 1R8AA 3C6UA 2RQMA 3GONA 4ECXA 1JLCB 3E2EA 3GU0A 4R6TA 4L75A 2P6GA 2OPRA 3FYNA 1N52B 4IFYA 2VFUA 2MY7A 1YVFA 2BJ8A 1IM6A 2PEHA 5M2PA 4NGRA 4J9OA 2BKOA 2P5VA 2MKJA 1CJKB 1IKXA 2UUWA 1S7NA 3I55S 4CO5A 2XCAA 4JI2J 1S6PA 4DS4A 4CT9A 2VQFF 2ZPAA 2QT7A 3N0VA 1YJ9S 4UOFA 3CXPA 4ZVPB 3EJMA 2W8LA 2C27A 4ES3A 3AOBA 4WFXA 4BLGA 3KLFA 3M8ZA 4TU7A 2QV6A 5KFUA 3MECA 1RA7A 5HBMA 3GB0A 3MD3A 2C2NA 2AFWA 3KHGA 1HPZA 1RE1B 2RDJA 5KT2A 2KFZA 3TEHB 1YJVA 2DXDA 2HBYB 4UOHA 1S7LA 1KHWA 4CM2A 3BB5A 2XM3A 4DR5F 2ZEDA 3PVXA 2IBKA 2ADBA 3DLHA 4A95A 5KTQA 7CPAA 4HACB 2EW9A 1WF2A 1NSPA 3EFAA 3R5BA 2BE2A 5KOWA 4Q7AA 3LP0A 2BXJA 1XMOJ 3MM8A 2HB6A 3LODA 5KT3A 1CSJA 3F0AA 3G8QA 2C1CA 4MKYA 2ACYA 1SUQA 4LUAA 1U1NA 4PK2A 4J9VA 2AEJA 1IBLF 3RBUA 3HX9A 2CPFA 1UEUA 1B0PA 4O3SA 3GCWP 5C7PA 4MFKA 3S8SA 5D0RA 3FJ2A 3DDKA 4LF6J 1RADB 3RAMA 3KUHA 3MHYA 4G3IA 2UXCF 1VQ7S 4CDIA 1WC3A 4CP5A 4BC9A 3DRSA 2AJ4A 5K14B 3TUJC 2B4DB 2YNGA 4CWBA 3B8HA 5HBMB 4DG1B 1VGYA 1NDPA 4P52A 4KR0B 5D78A 1ARMA 5IXUA 5KFIA 3WX8A 1TKHA 2QA4S 4NGTA 2XSJB 4HDGA 3VWDA 4DU8A 3LWMA 2D9PA 3PJXA 3TO6A 2KCWA 1VHEA 1YGYA 3T1YJ 5LYDA 2ZKTA 2Q44A 3PO5A 1HL6A 1UVKA 4OI4A 4DPUA 4B17A 1D3WA 2YKNB 5FDLB 4YHHF 2CDQA 2ZH2A 3FVLA 3B78A 3TOAA 4JWPA 1YSJA 2B8PA 5KG1A 1TV6A 3W5ZA 2HURA 2BCOA 1XEZA 2YKMB 5J2QA 1GNKA 4KVXA 3BSNA 3OR2B 2DITA 2JX2A 5F46A 2PIZA 5F9NA 1S5KA 4B9LA 4E0AA 4CGNA 4FDFA 2EBGA 1RLDA 5FJ4A 3CCRS 4QR0A 1F5AA 2B9YA 2KU7A 3B8GA 3OL8A 1Y0HA 1S0MA 2HQDA 2BV3A 2EEYA 2ZD1B 2HZVA 4ZITA 4IK2A 1HR0F 3X3UA 3TVYA 1HNWJ 1NUEA 3EE3A 1VQ4S 5A76A 3FRZA 4N8NA 2WVFA 2G2OA 1KR4A 3DLEA 1Z8WA 4OC2A 3SI2A 3ETOA 5KG0A 4B10A 3CJKB 2Y0BB 1I1DA 1JQGA 4TY8A 1RWOB 3BV8A 2CY2A 2AHOB 3DNSA 3IFEA 4GO7X 2LQJA 3HD1A 4DR3J 1EQ0A 4JI0F 4CI0B 2C6PA 1RLCL 3MM9A 3UD4P 2KDOA 5BXIA 2QZ8A 1B3TA 3FSXA 4QC6A 4LQ9A 1B0VA 4ZVOB 3DKDA 5B08A 4QW9A 3OL9A 4OC0A 1TP7A 5F8LA 3MECB 1CQNA 4NE9C 1SL2A 4A47A 2HVZA 2AIRB 4ZYQA 2GVZB 4ANCA 3HHEA 3JTKA 4TYAA 1ZLHA 3SXOA 2GJIA 4IUSA 2JHEA 1EJ7L 2XC9A 3BDPA 1HQ2A 5F8GA 3C3LA 4WFAQ 1TKZA 1WJ9A 3NKYA 4DV1J 1X4BA 4H4MB 2MZRA 2ZBIA 1KQKA 3CZXA 2ASJA 5GMKa 2R7UA 2YKOA 4NYZA 3VZHA 4DFJA 1DAXA 3NCPA 1M5HA 2KVQE 1FTRA 1LANA 4NXMF 3RNZA 2MMYA 3O8WA 3U1MA 4RZRA 2DNMA 4CO4A 5J2MB 3AAWB 2R8HA 1L3UA 1AA1B 1HBNB 3V2UC 3R1HA 1DJ0A 1FJGJ 3GIIA 1ZM3A 1YBTA 2MSSA 3FECA 1B0TA 1IY7A 4F36A 4M5MA 4LVNP 2QMXA 2GAGC 3DCAA 3L9ZA 4M63A 4OI3A 5K5MA 1ZH5A 1WEXA 2AD9A 3ZZIA 1VBZA 2NSCA 4FYDA 4CPAA 2IJFA 3WABA 2K1RA 1KN6A 4QIGA 5ETOA 1VOMA 3OTEA 3WIVA 2DNPA 4FBTA 3HK2A 3CJ8A 3PGPA 1ZM9A 3MM7B 2E1PA 4AXVA 1QAIA 1TXRA 2UZAA 4OHWA 2FIWA 5L1LA 1YJNS 3F41A 2VBYA 2YWHA 4DV2F 4TKTA 2DPTA 3KL9A 2IDEA 4UUXA 8AT1B 1TU0B 2Z0GA 2DR9A 4E2FB 3D2PA 2W2NP 4C8LA 1OZPA 3OSPA 3J80Y 3GV8B 1IGBA 2MJUA 3RBZA 2P6FA 1IBLJ 3QIDA 4USVA 4WK3A 1M1HA 2XHWA 2N82B 4PG4A 2ZW5A 2GS8A 5T7LA 4PKDB 5I3PA 4DR6J 2OEJA 5K8OA 5KFDA 1R8CA 2HFVA 1KC8T 4B08A 2RU9A 4HTIA 2HHQA 3HP6A 3PHTA 3GSDA 5JVHQ 4IFVA 3G6XA 4USUA 3VTIA 2EFOA 4JI6F 5HQLA 2R42A 5KFRA 5DQIA 4LR7A 2CADA 1RAGB 1VS3A 2GGPB 4RW7B 2DHSA 1KUVA 2WSAA 4I2QA 1M90T 2G2ZA 2HFUA 4JI6J 4N7TA 3HLPA 2JEGA 1F57A 2LKZA 4CGLA 4WP9A 1ARLA 1QSTA 4KVME 3FEZA 5KFQA 1SKSA 2Z4PA 5D4PA 2VONA 2BRKA 1M4DA 3KHLA 1Q5VA 1K9MT 2EC2A 3ZC4A 4MFLA 1U2RA 3M1VB 1ZETA 4ONWA 2EK9A 3JRUA 3PFEA 2F1FA 2WYRA 3P96A 1G1XA 3OQ2A 3A3NB 1CS4B 4I56A 3M2UB 1TL1B 1MJAA 4DR2F 2FB0A 2LXFA 3EICA 4OQJA 2GFFA 3K89A 1A7GE 5FLXU 2QLBB 3GTYX 4OFZA 4PQUB 1X4DA 2ZEGA 4FVMA 3J81U 1H73A 4NEYA 2FXFA 3UWTA 4EU0A 3F8KA 4RUAA 5CABA 4BS2A 2A2DA 3MCNA 1T94A 3CJTA 4ECRA 1A2ZA 1V0CA 4O0NA 2HWHA 2PRBA 2WBMA 2B6AA 4GVLA 4P6YA 3TTHA 4C7QA 3LOUA 2P6SA 2P9GA 4QU7A 4LRBA 3HSZA 3OVSA 1QY7A 3LAKA 2ZVIA 5JVGQ 2H65B 2BDPA 2BO9A 1WI8A 4X2TA 3CDEA 4B9MA 2J9AA 3Q8SB 1RHQB 1SBRA 4EZ9A 1VQNS 1J2VA 1VCTA 3NEKA 2QX0A 2VPXB 3P49B 1PJ5A 2HHHF 2FHMA 3W62A 4WYWA 2MJNA 1FF2A 3UD3P 3OTBA 1SV5A 1PJ7A 3QGPA 4F25A 4DOZA 1XK8A 4UBRA 1UFLA 4HKQA 4RUBA 3JYTB 3ENVA 4DPXA 2BRLA 4QUSA 3K5LA 2XYHB 4KHPF 3M30B 1YHQS 1RTHB 4R0EA 4MYTA 3IM9A 2MZTA 3HHDA 2DNRA 3EXNA 4F4WA 1H2UX 2XYPB 2VG6A 2GIVA 4A4JA 2WZNA 1TAQA 1N34F 3H98A 3C15A 2VODA 2XLIA 2QYCA 2A6OA 2XCPA 4ED2A 2CQHA 9RUBA 4UY8T 4KE5A 2BSWA 1CJTA 3WC6A 2P6TA 2JC1A 3G9CA 4RX6A 3K9UA 4FKYA 2VZYA 4YOEA 4F02A 5KFOA 4L8AA 3IRWP 2C22A 4OZ5A 4LF8F 3E3XA 1FXRA 2Q7SA 2F8MA 1I12A 2AEMA 2NZ4A 5KFNA 2PFFB 3TZYA 2Z58B 1B6BA 2N4DA 3K0JA 3PM9A 1XMBA 4K0KF 4MT1A 1FRJA 3OTOF 4FKXA 5KT7A 2OB0A 1RK8A 2JDJA 3TOQA 2DNKA 3V6DB