3GB0A

Crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
373
structure length
373
Chain Sequence
GMINQERLVNEFMELVQVDSETKFEAEICKVLTKKFTDLGVEVFEDDTMAVTGHGAGNLICTLPATKDGVDTIYFTSHMDTVVPGNGIKPSIKDGYIVSDGTTILGADDKAGLASMFEAIRVLKEKNIPHGTIEFIITVGEESGLVGAKALDRERITAKYGYALDSDGKVGEIVVAAPTQAKVNAIIRGKTAHAGVAPEKGVSAITIAAKAIAKMPLGRIDSETTANIGRFEGGTQTNIVCDHVQIFAEARSLINEKMEAQVAKMKEAFETTAKEMGGHADVEVNVMYPGFKFADGDHVVEVAKRAAEKIGRTPSLHQSGGGSDANVIAGHGIPTVNLAVGYEEIHTTNEKIPVEELAKTAELVVAIIEEVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminopeptidase PepT (NP_980509.1) from Bacillus cereus ATCC 10987 at 2.04 A resolution
rcsb
source organism Bacillus cereus atcc 10987
molecule tags Hydrolase
molecule keywords Peptidase T
total genus 114
structure length 373
sequence length 373
ec nomenclature ec 3.4.11.-:
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gb0A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3gb0A01
1LOKA 3FMCA 1BLLE 1XMBA 3FEEA 4MRIA 2ZOGA 3H8GA 5THWA 4RUHA 4UIAA 4P4JA 6CPAA 2ZEFA 4IHMA 1QQ9A 5HVFA 4MHPA 1BAVA 3H8EA 1TKHA 1OBRA 2Q51A 1CP6A 4PQAA 2AFSA 4H2KA 1TKJA 4OC3A 3PB4X 3PRTA 4ZY0A 2J9AA 4X3RA 2PJ1A 4Q7AA 1XFOA 1CPSA 2PJ6A 4FUUA 4DYOA 4AXVA 1BPMA 1CX8A 4G1PA 4CPAA 2XEFA 1BPNA 1JQGA 2WYRA 3PBBA 2PVWA 3S9NA 1CP7A 1LANA 4MCQA 4A38A 1TXRA 3TC8A 1ZG8A 1IY7A 5D29A 2QJ8A 3K9TA 2EK9A 3NA6A 3VH9A 1YW6A 2PJ2A 2PIYA 2G9DA 1YSJA 3PEIA 3IO1A 3CPAA 3IEHA 1FNOA 1TF8A 2GLFA 1AMPA 5LRGA 2IQ6A 5K8MA 2AFUA 1R43A 4IAVA 4FWUA 4MCPA 4P4EA 3K2KA 1YMEA 3B3CA 4R7MA 4ONWA 4EFDA 3GLJA 4UEFA 2V8GA 3KHXA 2JBJA 1KWMA 3V7ZA 5LYLA 3KASA 3TX8A 1HEEA 3CPXA 1HDUA 2OR4A 3RBUA 2AFZA 1M4LA 2V77A 4MHYA 4P45A 1ARMA 3IJ3A 3B35A 3WT4A 5LYDA 1ARLA 3IC1A 2ZEHA 3B7IA 3KR5A 1ZLHA 2ZENA 3BHXA 2BO9A 4OC4A 4OMEA 3GUXA 3WABA 5DS0A 2V8DA 4A39A 4TWEA 1EE3P 3B3TA 1VIXA 2OOTA 3WC5A 3KI9A 3I1UA 1LAPA 1XBUA 4PXDA 4OC5A 5HVHA 2AFMA 3SI0A 8CPAA 1TKFA 4ZI6A 3FECA 2ZEGA 3KQXA 1CPXA 4ZY1A 4P10A 3SJGA 1H8LA 3IWWA 3FJUA 3PBEA 4P4FA 4X8IA 2PVVA 1PCAA 3S9LA 3V38A 4P6YA 3KZWA 5JM6A 2EWBA 3CDXA 2PJ3A 3H8FA 3VATA 1VGYA 3JRUA 4OKOA 3S9MA 5F09A 2VL1A 1RTQA 3D7DA 4ZYQA 4P4DA 4DJLA 2ZEOA 4A37A 3PFOA 4F9UA 1LFWA 2PE3A 4UEEA 5LRKA 4ZX8A 2I3CA 3HUVA 4NGPA 3RZAA 1Z5RA 2ZOFA 3QNVA 5K8NA 2C6CA 1LCPA 3D68A 4MCSA 2PRQA 4WJBA 4YWYA 2ABZA 3LMSA 1VHOA 2CIJA 4MMOA 2ZEDA 2GU2A 1ELLP 4UIBA 2PJ0A 2PJ7A 4OIDA 1DTDA 3DLJA 3D66A 1Y0RA 3B3WA 3PB9X 4OP4A 4YU9A 4MXUA 4FAIA 4PXBA 2O4HA 1ZG9A 4JYWA 3D7FA 3WC7A 4A94A 1F57A 1F2PA 2JBKA 3SJFA 7CPAA 3L2NA 1YLOA 1ZLIA 2IJZA 4NGQA 3KR4A 2CTCA 2GLJA 2NSMA 3MN8A 1ZG7A 2C6GA 4Z65A 4PPZA 4NGMA 1HDQA 3BI0A 1GYTA 2FVGA 2NYQA 4BD9A 3SJXA 3BXMA 3D7HA 2GREA 3NH8A 3CT9A 3PB6X 4LQGA 3LWUA 5K8OA 3B3VA 2XEGA 4O23A 2Q43A 3WC6A 1AYEA 5ELYA 5J1QA 3NH4A 2PJAA 5HXDA 2RB7A 4ZY2A 1VHEA 5JH9A 2CF4A 3SI2A 4NGTA 2ZEMA 5LRJA 3KGQA 2QYVA 4P44A 2Q4ZA 4NGSA 5LYFA 2CTBA 3PB7X 4PXEA 1LAMA 4TNUA 1YW4A 2XEJA 1Y0YA 5JGFA 2ANPA 5CPAA 2ZELA 1XJOA 2AFOA 3FH4A 2XEIA 4UF4A 1CG2A 2RFHA 3PFEA 3VARA 1Q7LA 2PCUA 4MHZA 4IK2A 4JZ0A 4MCRA 4W9YA 4NJRA 2ZEPA 4R76A 2QVPA 2POKA 1Z8LA 3GB0A 1NSAA 4GM5A 1F2OA 2PJ8A 4OC1A 1UWYA 2ZEEA 2AFXA 3B3SA 2BCOA 3FEDA 4EMEA 2PJ4A 4NJQA 3FVLA 4NFRA 3D7GA 4UEZA 3ISZA 2PJ5A 4WWVA 1QMUA 1PYTB 5I4MA 1Z2LA 5HVGA 2V8HA 1XRYA 3T8WA 4OC0A 2BOAA 1TF9A 4DUKA 3NFZA 4F8ZA 3FX6A 4KSIA 3IFEA 3ISXA 4K3NA 4OIWA 3N5FA 4FBEA 1Y7EA 4X2TA 2PJ9A 4EWTA 5CBMA 3IIBA 1CBXA 2F8HA 3KQZA 4R6TA 3DGVA 3B2YA 2EK8A 2C1CA 1R3NA 1FT7A 2V8VA 2PIZA 3HLPA 4ZX9A 4OC2A 5K8PA 4MHNA 2PJCA 3RAMA 3KHZA 4NGRA 2DEAA 3FF3A 2HC9A 3SJEA 1DE4C 2O53A 3D4UA 5D8NA 3KL9A 4NGNA 2F7VA 4B6ZA 2JEWA 1ELMP 3SI1A 4R8FA 5LYIA 4PXCA 4P4IA 4F9VA 2IMOA 2AFWA 2WZNA 1IGBA 2PJBA 3MRUA 5IB9A 2C6PA 2HB6A 3NH5A 3D67A 3PB8X 3BI1A 4P4BA
chains in the Genus database with same CATH superfamily
5C42B 4L6V3 2HV2A 2BVZA 4ZVOB 4RUHA 1HR0J 1N48A 3RAXA 4OHVA 4MHPA 4J9VA 4MBUA 4N77A 2EC2A 4KUBA 2BBEA 4R57A 3J7YI 1EX8A 2G0CA 5B09A 3FJ2A 3JTPA 9ATCB 6FDRA 2CUYA 5DG8A 2HHQA 4UUWA 2J9AA 2R7TA 5J1NA 2QC3A 4OZ1A 3D2WA 3WDOA 4DN9A 4ECQA 4LFAJ 4ES1A 4JI7F 4F50A 2OO4A 4ID5B 3KNAA 1FFWB 5DETA 1OWXA 1D9FA 2EBEA 2HG4A 4NL5A 1XMOJ 5CNPA 3MR5A 5B0FA 4TU7A 2Z2YB 3KG4A 2WK4A 2NPFA 4CAXA 3N0VA 1N32J 2W24A 3M2RB 5GCNA 1EB0A 3M6UA 5IQQA 4PWDB 3PRDA 1T9TA 5E0OA 3ZNJ1 2OPPA 4KLVA 2V8GA 4DQRA 2OPRB 5KTQA 1EETA 5BR8J 3M8RA 3U1LA 3QGHA 2B9XA 1WELA 2R7WA 2MGZA 4R3KA 4KB7A 2RJZA 4LF6F 1EE3P 4ETXA 1P8GA 2CNOB 4F2RA 3C46A 2V2VA 4NSQA 2EG2A 1SKRA 3BYPA 4K2JA 4A8FA 4U8VA 3O2IA 5HVHA 4ECUA 4YP3A 1M1HA 3GYXB 3SZ2A 4JI2F 3AAWB 3CDWA 4ZI6A 2ZEGA 3T5HA 4ZJOA 1Q53A 4B9MA 1O6XA 4NPOA 4Y00A 2KCWA 1XMQJ 3NBPB 3IWWA 2D4OA 2NPIA 2YWGA 3V81A 5DQIA 2F8EX 1PCAA 3D1HA 4N41A 3S9LA 4Q8FA 2W25A 1Q2DA 5JM6A 1NMEB 1G3OA 2BV3A 4QIGA 3T90A 4EO6A 3H8FA 4B3SF 3UCZP 1J5OA 3CCWA 2PRBA 4KOVA 1ZM2A 2KT3A 1DRZA 4DUTA 1I1GA 5L1KA 5HMNA 5CZXA 1V0CA 2V94A 1WG4A 4NCBA 4JI4F 2OIHA 4YWYA 4KHMA 3AJDA 1WHVA 2DXQA 3DHXA 4NXMF 2MKJA 3FDSA 5HH1A 4K0KF 2OEJA 5BXIA 2J0QD 1DJ0A 3DRPB 2AYGA 1TL3B 1CJVA 1SJQA 4ECWA 4OP4A 2UVRA 3Q2TC 5FDLA 3WC7A 2LLZA 1FRHA 4OZLA 4XPKA 2A0FB 2OU2A 4A8KA 2DY9A 4J3GA 2EBJA 2FLNA 2B4DA 5KFQA 4CRZB 1Z9UA 4PYAA 1DQAA 3NGTA 1UEVA 1MU2B 3MMBB 2FVRA 3NE7A 4YY3F 1X4DA 4G3IA 4QVTA 5D3GA 5IT9Y 1SVDA 2UUBF 2Q43A 3PX0A 5E3CA 2J7UA 1GX5A 2BRLA 4HHJA 3PX6A 2ADBA 4FZVA 1C2PA 2GJ2A 3TUZC 2DCLA 2GS8A 5LRJA 2DHXA 2VC0A 2BE7D 2RVJA 2DNGA 4G1IA 2J8NA 4LT6A 3T9ZA 5LYFA 5KT3A 4PXEA 3HI9A 1WOSA 2GNKA 2C2KB 1LEOA 1BO4A 1LK7A 1CG2A 3TA0A 4YFJA 4K5RA 4GKJF 1L3TA 3PCOB 2C2NA 4M5KA 3GB0A 2E9TA 2RF2B 1LWFB 5E33A 3B3SA 3M4XA 4DR3F 5F8MA 5I0CA 3UNGC 2DITA 1YK9A 4OYWA 2DPIA 3CE8A 3H98A 4L3KA 2I0XA 2V4JA 2HLUA 3I32A 2UVVA 1RDRA 1M4GA 1WOOA 4S0MA 4DPUA 3SXOA 3W6SA 4RNOA 2A3JA 1F1BB 4ZS6A 2FC9A 3D3SA 2V68A 4ZX9A 1HQUA 2IJRA 2PJCA 4QIWD 4TXSA 2W7AA 1Q78A 2LQ8A 1HNVA 4B9SA 2AJQA 1YJRA 1XMTA 4USHA 3TAMB 4CGMA 2PA3A 5IXUA 3TOQA 2ZVIA 4GC6A 2OPSB 1ON0A 4NGNA 4QJVA 3OTOJ 5KFSA 3D5MA 1VQOS 1ELMP 4F9VA 1VBZA 2IJFA 1FKOB 2DRBA 4IUSA 3V8IA 3QYYA 2P6TA 2B4BA 3H7HB 5A2QY 3FBFA 3EZ5A 1TKDA 2CA9A 2P2CB 4ZDNA 3WQPA 5AE2A 3M6WA 4JI3J 1FDBA 5H9EJ 2B3TB 1RT7B 4DV1J 1AZSA 5ADZA 2HNZA 1RT1A 4NCGB 5IT9U 4IFVA 4BLGA 4OI4A 2WPXA 3SQOP 3THTA 1TMMA 3MD1A 2ZBCA 4CPAA 2PVWA 2JWNA 3UD4P 4CO1A 4Q2LA 2Q3PA 3DN9A 3MM5A 3UCUP 2XZTB 3CJSA 4L76A 2A6OA 4USTA 3CPAA 3IEHA 1I51B 1VQ8S 1TF8A 3BBCA 4CTAB 2YNCA 3QT8A 2HURA 3OTBA 3W65A 1VRQC 2R7QA 3QRRA 2W1BA 4EBCA 2Z2MA 4UW2A 1FVQA 2DHSA 2HNDA 3C15B 2HHUA 4P45A 4WKYA 3UNYA 1JLFB 1FJGJ 2VB6A 4XAKA 3MXHP 2L3MA 1F2GA 3MTJA 5GAEU 4DSFA 2MZQA 3BR9A 4IO9Q 1JNZB 3KLGA 2MTLA 3H5YA 1T02A 3OTDA 1Q8KA 3TTHA 2ZW4A 1LAPA 4X65J 1XQIA 5KFLA 2HFNA 1K73T 2J6SA 2W7PA 2R7HA 2LEBA 1N54B 4PEOA 2BJ8A 1SIWB 1SJ1A 3VQSA 2JDCA 2KFNA 1JLQB 4P75A 1FK9B 4GVBA 1PBAA 5KT7A 3H2UB 1CJUA 3PBEA 1PC5A 1ZYQA 3S6HA 1U2RA 1HI0P 3TUPA 1QLNA 2OEMA 3VGTA 4ZLJA 2IFXA 3D6FB 2AYBA 4KJIA 1PYTA 2FVSA 4GXHA 2DYAA 3I82A 4Q5VA 2F4VF 1KLNA 4ZP6A 2DR9A 4KGXB 1S9EA 2IBOA 1DFDA 4J9KA 3T5LA 2ASLA 2AT1B 3VVUA 5CCLA 1FWLA 1V6HA 4FDFA 1LCPA 2PRQA 3P49B 2KYXA 3N79A 4F0MA 2LXFA 1T03A 2ZH7A 3IS9A 3GYGA 1DTTA 2ZPAA 4PRFA 1XC9A 2ZEDA 4A2ZA 1RA7A 3QJPA 3DLJA 3R8YA 3D66A 1S99A 4DCJB 2KM8B 4YU9A 5KTCA 4CIOA 3FYNA 5F8JA 2O4HA 2HFVA 1TK8A 5KFUA 3BQ2A 5ETTA 1LWEA 4NLRA 4ZVEA 4PSXA 1CS4B 4HR2A 4ZLNA 4ECYA 2RUGA 4DV7F 5J2NA 4DBQA 4LQ9A 4A8MP 2ZE2A 3TFYA 1ZAXA 4ETZA 5D0GA 3X1LB 2OZGA 3JSMA 2CPFA 4E0AA 1UFKA 3ENQA 4HI2A 2XY7A 3J7AN 4QQBA 2O3DA 3TZZA 2FHOB 2E7XA 4EMDA 2FVGA 4NLYA 3DLGB 3FC9A 2ACMA 3FIXA 3NH8A 3MPWA 3JQMA 2N3OA 4RWWA 3MOJB 3PR5B 4YHHJ 5HMWA 4DUZJ 3NH4A 4RR5A 4X64J 2HAIA 2RB7A 3E0KA 4ZPTR 4X62F 2B3UA 3R96A 1VHEA 1WDDA 1Q5VA 4ZOSA 3TO9A 4RW8B 2GIQA 2HRYA 2QYVA 4ZPCA 1UW4A 2W7OA 3I6PA 1RWXB 2YNHA 1T05A 2KFZA 3FSYA 2QIRA 3FH4A 2YQ3A 2OZHA 3D6MB 2CADA 5MAOA 1S4EA 5AXNA 2WPWA 4QIFA 4M5DA 2ZEPA 3A3PB 4YR0A 3RR8A 3D7SB 1YJ9S 4JI6J 1F2OA 3UR0A 2AFXA 2PJ4A 5KFKA 3FVLA 2RSQA 4ICLA 2B56A 2LA4A 3ILOA 2P0WA 2JEJA 3MM7A 1FX2A 4ZP9A 3KLIB 2K3KA 2CG8A 4X4TA 2GE3A 4CQ1A 1F6TA 3KYLA 3P2FA 5CYMA 1EAYC 3FX6A 3P8BB 3GYAA 1RWVB 3HM9A 3RYOA 2CWXA 3MECA 2LDYA 4KHRA 3IGNA 4TQRA 4QIVA 3RB0A 5DM6Q 3R7NB 1BD6A 1CQMA 3DU5A 2ZEJA 5M2RA 1NKCA 2V8VA 2RC4A 4ZJLA 1RADB 2V9KA 2CYYA 4Y65A 1T9YA 3RAMA 3M8QA 8RUCA 4KUAA 4NMXA 3NGKA 2Y0SD 1C1BA 2IAJA 3BKTA 1N36J 2A6MA 2KXHA 2ZWOA 3BO4A 4CH1A 3KLFA 2E5LF 2GAHC 2AGPA 3I9SA 2R7XA 2VXKA 3MRUA 2VG7B 4CO2A 2C2ZB 1FXLA 3GIJA 3KNGA 1PIEA 2W2OP 1VLYA 4NMLA 2ALZA 3DRYA 2H1YA 1LXJA 3RJMB 3BO3A 3VQTA 4KFBA 5GAEI 1N5YB 4KZTA 3EO4A 4Y28C 1DQ9A 1R27B 3DDNA 3RRGA 5A6PA 3MCMA 2G2YA 1S6QB 2OMOA 5CD4H 2Y1LB 2XI2A 2PJ6A 4ZA1A 4U7CA 4G1PA 5CHCB 2R2RA 2PC6A 3FCHA 3PNIA 2BA9A 5IC6B 2U2FA 3GR0A 3NGDA 2AIRB 4JV1A 4A32A 1HYSB 2FLPA 3T9YA 3LWLA 2GJIA 1TL4A 2CQCA 2PIYA 4ZIWA 2V4RA 4DQIA 1HA1A 4P2XA 5KT4A 1KZFA 4WZMA 4NXNF 3VAGA 2VG5A 2BW7A 2DF5A 4C2XA 1RAEB 5DZ6A 2XNQA 2B4PA 4TU8A 3K2KA 2FHJA 3PJ9A 2BJ3A 4NF1A 1IBKF 2ZW5A 5LYLA 1XIXA 5EWFA 3CPXA 4KPCA 4ERDA 1PAUB 3BQ0A 3QB8A 2B9YA 4RLEA 4KSFA 4C2MA 3KLEA 1MN9A 1M5PC 4WFZA 4CT9A 3B7IA 5EBVA 3SCJE 2C3YA 2BYCA 4OMEA 4RJVA 1N36F 1P6TA 4L3NA 4KOSA 1BWVA 5LL6d 4FVMA 2K7KA 5GAHI 2DHAA 1XBUA 4N5SA 1E6YB 2D69A 4I2QA 1S7FA 1IOIA 1FD2A 1TZ0A 3AB4B 3OT9A 1SV5B 3MPYA 8CPAA 1S9GB 2G9OA 1NK5A 2HAFA 3PACA 1NH7A 1MMNA 1Q82T 3G86A 2R7SA 3SJGA 2OHDA 3NY0A 3T19A 1FWKA 4P4FA 1VQSA 3C6UA 2VQFF 2QA4G 4B3RF 2JLEA 1FFSB 1HHQA 3B54A 2EWBA 2PJ3A 3V4IB 2OZUA 3DGPB 4CAVA 3A8EA 4PG7A 1QAJA 2GO8A 4LSZB 5EMIA 4CLTA 4B3SJ 2PGCA 4NEXA 3IAM9 5LRKA 4ZX8A 1FDAA 3FNNA 1J27A 4X4PA 5H9EK 1FE0A 4J9RA 2F4FA 1XMQF 2P5VA 2ABZA 2QA1A 2QFIA 1DTDA 1BLUA 4QR2A 4DR6J 1D8ZA 3TR5A 2PE8A 2B8PA 4ELVA 5DWNA 5KG4A 2PI5A 3D7FA 3LANA 3EGVA 1KQSR 3SJFA 4MJ8A 1RTIB 2D41A 4J90A 5CZVA 2CPZA 3LGMA 4Z65A 3HHLC 2E5GA 4JYAJ 5KG0A 1GYTA 4ILLA 2RDIA 3CO0P 1SJ4P 2GREA 1YJVA 3HHLA 3MM9B 2ZD1A 4U6PA 3MDFA 4M5IA 3PV8A 5HROB 3CCLS 3A9LA 2FGCA 3IXQA 1T8EA 3KHHA 3F44A 3F0AA 4C0BA 2KFYA 3UR3C 2ZKUA 3PYFA 4ZGYB 4O4RA 1KLMA 3I0SB 4I64A 1KONA 2WRMA 1FRKA 3CCVS 4DLGA 4F4ZA 2HK3A 3MAAB 3JYTA 2YH0A 1YIJS 4DV3J 4ZVUB 3N01A 4JP8A 2ANPA 5CPAA 2C2EA 1K0TA 2V34A 3SEOA 1YQEA 1IR0A 2AFOA 1X8DA 3KKFA 2J8RA 2DD8S 4ZITA 3PFEA 4DZ6A 3VWEA 2PCUA 1M5KC 1EIYB 1PAEX 1I1DA 2ATCB 2DGSA 3L9ZA 4DUYF 3BGRA 3DHWC 3OHAA 3IBWA 1VR6A 4OC1A 4AVAA 2FJVA 1TUVA 4KVXA 4NJQA 1OPZA 4ELUA 2NR0A 1HNXJ 3GG1A 1M1KT 3PW5A 1XRYA 2Q79A 2V0NA 2ZXVA 5C7PA 1KVJA 1IKYB 1NXIA 2GHVC 3UN2A 4QBUA 3BSNA 1VQ5S 5LMNJ 5J2MB 1YJTA 3BS9A 4P2MA 4OX9J 3VWSA 4A8XA 1ZPWX 4RS2A 4WWSA 5DGAA 4O3OA 4Y0FA 4EBEA 3M1VA 1VBXA 2QLFB 1FERA 5C25A 4Y49C 3EXCX 4L73A 1NSPA 3SDEA 2REFA 3DU6A 1S77D 2FB0A 2K5TA 2QSWA 2JEFA 4UOGA 3M8YA 4D3GA 5HAOA 1JLAB 4ZVTB 5DRKA 1U6FA 2B7CB 1GEHA 1WJ9A 3D6HB 1WHXA 2UV8A 4CLKA 2V69A 3AB2B 2XMAA 1UW9A 4NA2A 4CYNA 2Z30B 4R8UA 1PILA 1BLLE 2DXFA 5DGBA 3M8PA 1PG5B 1UMJA 3GJTB 4AL6A 2HQIA 4PCQA 1U47A 1WC6A 1F60B 5JPHA 3QLHB 3TP2A 1URNA 2ZJRQ 2AJ0A 2RMLA 2HFZA 3H42A 4OI1A 4PYDA 1RHUB 2BKOA 4Z7YA 1T3NA 3KJFB 2Z3KA 2YNIB 3IWEA 2Y0MA 4PQUB 3TO6A 3H40A 1C1CB 1WF2A 3DLLQ 2ILYA 1A0OB 2WVBA 5DM7Q 5KFRA 3D8PA 3QIPB 5F47A 3EGZA 2WAQD 1S97A 3CCUS 4WK3A 2EK9A 1RHQB 1KVIA 2AE6A 2F8MA 3FRYA 3PEIA 1N0UA 3PW7A 3I0RB 5IX3A 4DL4A 3TO8A 5L38A 3JAMY 2V8PA 2YWEA 3QT5A 2RDDA 4FWUA 2VFVA 3HVTB 5E3QA 4WP9A 1QVFR 3MM8B 1VC6A 1MSWD 3KASA 3TX8A 2UUWA 1AUSL 4KYZA 2ZM6J 3O6QA 5EHHA 4MFZA 4CM0A 4I4BA 2AEFA 1B3TA 2AFZA 4K4UA 2VPZB 3BN4A 5IWAJ 5LYDA 2QSFA 4LBPA 5ITHA 2FSRA 4CYOA 3JXOA 4C2ZA 2VF3A 2ZENA 3G82B 3HVRA 4B10A 2CQGA 2CPDA 3I5BA 3QAEA 1DBDA 3ZTQA 1TL1A 2FHJD 3KJVB 3LP0B 4ZVSB 4NEZA 1VQPS 1H98A 3FEZA 3UVJB 3GIKA 1WNEA 2VG6B 3OLBA 2HQYA 5J1EB 1W7WA 3ET6B 3QPIA 2QLWA 5KG6A 4JJXA 4AG7A 2I8EA 1WF0A 2BX6A 3UN5A 2HVDA 2CQIA 4IH5A 1DAXA 2PVVA 2RRAA 1IM4A 4NLUA 1Z1ZA 1DTQA 2PO4A 5D4NA 1K1QA 5T7LB 3NGUA 2GQQA 3E8OA 4FXWA 2YBVA 3DMJB 1D9DA 3RB6A 3Q22A 4HHUA 4TNOA 4FYYB 3VAJA 1WD6A 3QFWA 3SCLE 2XO6A 1WEZA 3SSRA 3DLKB 3BGOP 3D6TB 1YI2S 1X5PA 1PKUA 2R4FA 1XR7A 4AFFA 5KFGA 3MFHA 3IG1A 5DDQC 4WJBA 1F9FA 2FD2A 4K0KJ 1IQZA 3PJWA 3HZGA 4JXRA 4LIRA 4USKA 1NSQA 1N6QB 3R95A 4A8YA 3TNVA 1S1UB 4CS0B 2AEMA 4MXUA 3O3LA 4PXBA 4PUOB 3RW6A 4CGOA 2AJFE 3LA0A 1F2PA 1WHWA 1QSYA 2J76E 2FY8A 2DNPA 2YWFA 4NGQA 1SH2A 2A4NA 2Y3YA 4ED5A 2GLJA 2RRNA 2GVDA 2XCPA 4Y3CA 4LSNB 3MTKA 1XR5A 2B7BB 4BD9A 1RT2B 1T9XA 3LH2S 5F0WA 4LBIA 2Y1IA 1ZA1B 2PMZD 2PQ8A 5ELYA 1RT6A 1T9WA 4AQYF 4G6VB 2OGUA 1JJ2R 2CF4A 4QPTA 2ZEMA 4QYZK 5DJBA 1CJKB 3EC4A 1SH0A 5E2QA 1S5KA 2V4QA 4XDDA 2ZBRA 3TYTA 3UCGA 3CVKA 2DNKA 4KE5A 2ZELA 1NK6A 1XJOA 4M1KA 5IV0A 1TKXB 4DUZF 4UF4A 4NXMJ 1GFWB 3CJ4A 3Q8SB 3PDNA 1YJ7A 1T9VA 4G1QA 1RAJA 2IDLA 4P7VA 1HD1A 2LCWA 4K4SA 5D4OA 2CNMA 1T94A 2RKIA 3MAHA 1AFJA 2V8HA 4QB9A 5DQGA 1IKWA 3HK2A 4LVOP 2MY8A 5EN1A 1TF9A 2F9JA 2AJ2A 4LF4J 4LRCA 5L39A 2DGXA 2IC3B 4C8OA 4DI6A 4ZLLA 1U1KA 3KTQA 2HS0A 4LF4F 4PWWA 3V2UC 3V6DA 2C2RA 4IDKB 1KSPA 1QSLA 1KUYA 3S8SA 1ZA2B 2ZZTA 3D28A 3GJQB 1MW7A 1Q95G 1VKCA 1YX2A 4IG0B 2UUTA 4ECSA 3JTNA 3HLPA 1S0NA 2HS4A 2DH9A 3CJ3A 5EGYA 3N28A 1YDLA 2H5EA 2ZUAA 3PRVA 1U7LA 3EICA 5D8NA 3HMJG 1EQ0A 2U1AA 2JDDA 2ASYA 4R8FA 1IGBA 1L3SA 1D3WA 3FGVA 2FJAB 3HPOA 3FMCA 5FD1A 1YRTA 2M9KA 2GMHA 4B5OA 3T41A 1HNIA 3FNCA 3C14A 1BAVA 2JH3A 4XO0A 1P9YA 4H4KC 4OADA 2Q4YA 1TKHA 3QO9B 1R0CB 2MZJA 4DR2J 3OXLA 1ZO0A 1TTHB 2MQMA 1N32F 2KU7A 4LF6J 2GGPB 4X4SA 1QSMA 3RU0A 2LEPA 1VRTA 2CVIA 3CD7A 3CCQS 4WE1B 1UVMA 1SC4B 1SH3A 5C42A 1I94J 5DDPC 4IH6A 2NREA 2HEKA 4LSLA 1U6MA 4H54A 4B3OA 2HMIA 2Q6BA 3CJQA 2IYIA 3GU0A 3MPUB 5CQGA 3CSKA 4OYMA 5A8WB 4JI0F 1FCAA 1HWIA 3S6EA 2L9DA 2QA2A 2A1BA 1GNKA 1B64A 4HH1A 1MWQA 4M5NA 3OL9A 2M2BA 4DDFA 4KC5A 2IQ6A 1RWWB 4YEAA 2Q1LA 3MUTP 1OZPA 2CQ4A 2H5JB 1CEZA 4X66F 4IOCQ 1O5JA 3B4MA 5IFMA 2OR4A 4KS9A 4JI7J 1M1DA 3KUHA 2V77A 3TARA 2HKEA 5IT4A 3GIIA 1FDNA 2PFDA 2G1HA 2RILA 3M2RA 5GMDA 1VBYA 3LODA 5F8LA 1FJ7A 3C16A 4A39A 3M2UA 4PWDA 1Y10A 1H7XA 5HQLA 1Y5NB 2ZHBA 2EKYA 1Y9KA 3KOAA 4K8RA 3M32B 2UUCJ 2R7VA 2E1AA 4KPYA 1U1OA 4DR3J 5K14B 1N34F 1TP7A 4KSAA 3CDAA 1UVKA 3H8YA 4DEZA 2VBZA 1U1QA 1HBMA 4KO0B 1SJFA 1WK4A 2R1IA 2W9CA 2VU5A 3JRUA 5AXKA 5F49A 4ZYQA 4RW4A 4ZPDA 2ZEOA 3BGFA 2BEIA 3GR1A 4CAWA 3G6VA 1Q5YA 3EM1A 1YRXA 1LW0A 4KT0C 2I3CA 2ASJA 1FY7A 3V81B 1QSOA 1Z4UA 2VQFJ 4DHVA 2IM1A 3LMSA 1RKJA 3MMAA 2CIJA 3US5A 4Q44A 2N4DA 2GU2A 3RYLA 1UFHA 2PJ7A 4QBJA 1NUEA 1JLBA 3B6BA 2XHCA 3PB9X 3I31A 1K0VA 3ZZTA 4DR7F 3IU2A 5GAGU 4HNXB 1I21A 4R0JA 2ZH2A 1WKJA 3W63A 3TWZA 2Y8YA 3LGHA 2BL1A 1U2CA 4N7TA 3ZTRA 2PMWA 3ZZPA 1L3VA 3ZZRA 3ILJA 4Q36A 4IRDA 2R8JA 3M30B 4PV6A 2DK2A 1SI9A 2UXBF 3BXMA 2HQCA 3EPGA 3WX8A 4EK2A 5K8OA 3B3VA 3R9LA 1Q7YT 3H4DA 1OYDA 4Y2AA 4CO5A 3DNCA 5HXDA 3D2PA 2J5AA 4ZY2A 1RT3B 1S57A 1RHRB 2MKIA 2PDAA 1CLFA 1P1LA 5B0DA 3OTOF 2FY1A 2R7UA 2AYMA 2BUNA 4DSKA 2DO4A 2QE5A 3IGVA 5D3GB 2J8AA 3CJ5A 1AXQA 3BPSP 2JSXA 5ETQA 1HLWA 4I2PA 3VARA 2LQ9A 2IIHA 2HZVA 2JNJA 1QSSA 2LDIA 4R76A 2G13A 2LXIA 3B4DA 4ZCKA 3C3LA 2LEAA 4FYWB 1RP5A 2MJNA 3FCWA 3D7GA 2XZWA 1MNEA 3EUNA 1N88A 1YJWS 4R3LA 4MI4A 2HHSA 2AHOB 1C0TA 4OX9F 2DCUB 3QATA 1OYEA 3KMSA 1GX6A 2RE1A 1D8YA 1KKHA 4A8SA 1LWFA 1TL7B 3CWJA 3C8YA 3MI7X 4M5JA 5E96A 2MHEA 1B87A 3CCES 1JLGB 1VBKA 4CP5A 3KQZA 3TEGA 4GVLA 3B2YA 3N4WA 3BM7A 4NLGA 3QRPA 4MHNA 2LXUA 2FXFA 5JVGQ 3CC7S 1LWCA 2L9NA 2EVZA 4OYOA 4DR2F 1IJEB 4NA3A 1TFYA 1IVZA 2JEWA 5LYIA 3OXFA 2IMOA 1LWXA 3K5NA 1C4CA 2A18A 4CLPA 2B58A 5HJYA 1RWKB 2OD6A 1N5VA 2VFRA 4ONUA 2UU9J 1T9UA 4KOWA 3RAQA 1HNWF 3J81U 1X4BA 4DV5J 1L3KA 2IM3A 4V19X 4N56A 4C2YA 2Y0BB 1KQKA 2XLJA 1UEUA 1W25A 2YNDA 1QDUB 4Z37A 2V2ZA 4A47A 5EDWA 4A4JA 3LP2B 1TK0A 1Q8LA 5IV3A 3UN3A 3HJFA 5DZ7A 2HHWA 3HF5A 3PKMA 3LF0A 2P9EA 4NZ6A 1VQMS 1X5TA 3NCQA 4MCQA 2VKZG 2WUUA 4AXJA 2P9CA 1NZ8A 1AA1B 2KG1A 1HNWJ 4ZPVR 5JMNA 1AB8A 1RT4A 1RT1B 3DOLA 5F41A 2PEBA 4L8AA 1YGHA 3AODA 1OY6A 2G1DA 2JFKA 5C24A 4OFZA 4UBRA 3CCRS 4LUBA 3MEGB 3W8PA 1FVSA 5LRGA 1FRXA 3NP5A 1HQ2A 5ETRA 2Z10A 1P0HA 1UTAA 1W26A 3MHYA 3SQGB 2CJBA 2KVIA 4H4OA 1M4LA 1IXKA 3JQJA 1ARMA 2VH7A 2ZFHA 3EJMA 3WT4A 1Y3JA 2HVHA 2MMYA 4OI6A 3BHXA 1S6PA 4NI2A 1Q81T 2YKMA 1S48A 4HACB 2KRBA 3CIMA 5L1LA 1GHEA 3H25A 3G2XA 3T6BA 3QQCD 4NYZA 2HNDB 3QGPA 1FEHA 4CWBA 1KBRA 2IHR1 2KM8C 4ZMMA 3C15A 4Y34A 3KQXA 4CLUA 3GP9A 1N8RT 5LJ3Y 1CJWA 4WU2A 3PEHA 1WKKA 3LAKA 2E1CA 5IT0A 3DI6A 1FO1A 2OUGA 4P6YA 1XNRF 4LREA 3TA1A 3V6HA 4ZKAA 3GSIA 5LMNF 1S1XA 1I3OB 3PTWA 5G0RB 1JJ4A 1HNXF 1TKTB 1NPRA 2YVSA 3PFOA 4RUAA 2VQYA 2PIIA 3L09A 1VDHA 4Q38A 4Y49B 1CJTB 2HNYB 4MIBA 1FK9A 3MR6A 2W9BB 1X0FA 4NGPA 5B08A 1UVLA 1RK8A 5ISVA 3VGSA 1B70B 2X7IA 2QL9B 1K1SA 4FF3A 1JWWA 1RTJB 3UO0A 3NCPA 1FTRA 4NOHA 2J8MA 1XERA 4KV8B 1SCJB 2VBWA 1IBLJ 3FQKA 2B6AB 4TLRA 3A12A 2HLTA 4IFYB 2MLYA 4DU8A 2MLZA 3Q24A 5HO4A 1U4BA 3SI8A 2X1FA 3H5ZA 5AG4A 1ZG7A 2C6GA 1TKZA 3GYNA 1Y4ZB 1RABB 1YVFA 2IDEA 2N7CA 2PI4A 5B0BA 2WTFA 2HBRB 3UD3P 1HDQA 2M0GB 4KQZA 3OUYA 4R0EA 4I6WA 2AMCB 2B43A 4ZPAA 2YXLA 2HHTA 3IR5B 1AYEA 1NJZA 3FBCA 1Y3KA 3UQSA 1G1XA 4TLQA 1Z4RA 4WXWA 3ULHA 4O3SA 4M63A 2ZE2B 2DR7A 3RB3A 2RRBA 3RO0A 4OJ1A 3OR1A 5HLFB 3R5BA 3CGIA 1FRJA 5L9NA 4XPCA 4OHZA 1XEZA 2XMMA 8ATCB 1TUWA 2VFUA 3CIZA 4ID5A 1VK8A 3M9MB 4OHXA 4RW9B 3CDBA 5ETOA 1NNDA 3M8WA 4C4WA 5G1ZA 3Q8YA 4OLLA 3LTOA 5IWAF 3DM2A 5JXSA 4PABA 4L75A 1S6UA 2HYIB 2DIUA 3P45B 3JQKA 2DEJA 1C0UA 2UUAJ 3ZTOA 3D54A 1JMTA 4UEZA 2MB0B 1RT5A 1FKPB 4ZVQB 4NLDA 4TVAB 3WR7A 2V50A 3T8WA 1HBUB 4X4QA 3I96A 2CFXA 2F65A 2HQ3A 3M2VA 2IBKA 5I3QA 4H4MB 2CRLA 2UUCF 2R8VA 1HNZJ 1NPPA 2DTJA 3CXSA 2DT9A 4DX8H 3QWUA 1WC3A 2W8KA 2E9RX 1NSLA 4CI0B 3DGVA 4JI1J 4UFVA 2EK8A 3QSIA 1YR0A 2VOOA 1ZS6A 2MZ1A 2UXDF 2KJWA 2R8KA 3KLIA 1C4AA 2VOPA 3SJEA 1QSRA 4OL8A 5IB0A 2HBQB 5EUHA 2XI3A 5ETPA 1NM2A 3CCJS 1BQNB 3CJ8A 2C2DA 3TCVA 4Q45A 4OI2A 2JOQA 4QWAA 3I9V9 3MECB 4ZP7A 4A8QA 4BDPA 2XNRA 3H2LA 4OJ3A 2YNGB 3KK2A 1X60A 1SQEA 3HP6A 4YB7A 3OWCA 2FE7A 4USWA 3HZEA 3JVNA 2ZDPA 1J5OB 3BI1A 5D78A 3TANA 4C11B 4JI0J 4MRIA 4NLWA 2ZOGA 3H8GA 4WPAA 4CDIA 6AT1B 1FFGB 4F3MA 5I3UB 4KY3A 5DLFA 1S1VB 2J9EA 1JKHA 5BYQA 2Z0GA 1BY9A 1VYAA 3DLBA 4LMZA 5JQ4A 2H54B 4KH0B 3POTA 5CYQB 3DFEA 2KKHA 4ZVPB 1R89A 1KUXA 3DRSB 4AXVA 3M6VA 5BJRA 3BDPA 2PDOA 2IPOB 3ZXWA 4DFJA 2WOMB 1N5YA 1U25A 4O44B 2ODFA 4J91A 3K9TA 2WONA 2LFVA 3BO2A 1HKAA 3SXNA 1A7GE 3HSGA 4JV5F 1HMVB 5ETKA 2MZSA 5H84A 4OX8A 4WP8A 4X4OA 2KI2A 4LX9A 4CZCA 1N34J 4EFDA 1MU2A 3KHXA 2RIJA 4HH0A 4M95A 1CC8A 2NMTA 4NYPA 2CNSA 1HYSA 2M8DB 3TOAA 2E5LJ 2YKNB 3SBMA 3CJKA 1JLCA 2LU1A 2XYHB 2X3GA 5A6WA 2Z3LA 1Y7RA 1LOUA 1TVRA 2KXNB 3ISNC 5KFFA 1REVB 3MEEA 3WC5A 5LM7E 2CZVC 1IOFA 5F8HA 2ZH9A 2KH9A 5F48A 1FTCA 3IMQJ 2UXCF 3J7ZT 4QU7A 2X3DA 1SC1B 3RB4A 1PU9A 5KG5A 2JVRA 4FYVB 4JI4J 4UUXA 3FEXB 3GPAA 2G2ZA 5KFTA 2XWYA 2VDHA 2PSZA 4Q0BA 3OJUA 1N0VC 2MZRA 1H73A 3CZXA 3D1OA 1E6YA 1RTHB 4O4GA 4GC7A 2P9GA 4EGLA 2CPJA 4LFCF 2FCKA 3HSZA 4LF5F 4M6GA 2Z2ZA 2PE3A 4I7FB 5D15A 2BM0A 1U0HA 2ZOFA 5K8NA 2DHHA 1M1GA 2V9WA 3HDSA 4XDCA 1RAHB 3BREA 2KN4A 4YB6A 2DHGA 1K44A 4ECZA 1IYKA 2JDJA 5T41A 5D0HA 3ZNUA 3AA8A 4NLOA 5E3RA 1N5SA 1KN6A 2CKWA 5L9XA 3OTEA 4C8YA 4D3HA 4WBFA 3D0GE 1KHWA 2FHKA 3PHEA 4F2SA 4A94A 1B6BA 2EI5A 3C66A 2J6TA 1Q8BA 3CDUA 4WIQA 2FC8A 1T0TV 4AVBA 3W2WA 2KB2A 1S7NA 2A2CA 4G65A 1WOPA 3FCVA 1FKOA 2HHVA 2B5GB 2UVWA 3KJQB 3R9FA 1P27B 2YTCA 3D7HA 4IH7A 3PB6X 4MKAA 3MEDB 2V2QA 2GCFA 1ZM4A 4BINA 3R7SB 3TA2A 4B3RJ 4KKOB 3EY5A 1X5SA 4NCGA 3I3GA 3B78A 1RUSA 2O01C 2QTWA 4P2FA 4YB1P 4F4KA 1YG0A 1XNQJ 5JH9A 2ZH3A 3AXKA 2AU0A 3CJTA 4IG3B 4LBHA 3T1YF 3V4MA 2OSQA 2NSCA 4DCPB 1O51A 2YPYA 4X2BA 5J8CA 2BANA 2VC1A 3MM9A 2IA0A 2OKQA 3ZZUA 1EZZB 4MCRA 3ETMA 3MOZA 2LQBA 1Z8LA 4LJMA 1IYLA 4QIEA 1S9FA 1UWYA 1PGZA 4ZCMA 1PJ5A 1ZAVA 3RW7A 2CDQA 2PJ5A 1RHKB 1YJNS 1Z2LA 1A6LA 1FA0A 2GFQA 3MMCB 5KOWA 4QWEA 3BJYA 3HSDA 2Y9HA 4RW6A 2QL7B 2HIQA 4YR2A 5J8FA 1TIQA 4FBEA 1VFJA 2XQCA 4FKYA 1VMBA 1L3UA 2E66A 3RG6A 2J9DE 4JV2A 2XS2A 3MCOA 4ZHRB 4B02A 3DRPA 9RUBA 3IBFB 4FYDA 4A30A 1Q0NA 1BOBA 4DV1F 2B51A 3DLHA 2DEAA 3QJLA 3KUGA 1EP4B 5DG9A 1RTZA 5A27A 1F5CA 2LP4A 3FSXA 3Q8PB 3GCXP 3DXBA 3BQ1A 4J9SA 4UCMA 5DG7A 2XB2D 3RTVA 5LOQA 5HP1A 3TW0A 4F25A 3VCDA 4F0KA 4H4KA 3IWXA 1DLOB 2J0SD 1NMTA 5THWA 1DZ5A 3R27A 3S7RA 4EI2A 1S79A 2HBZB 2QMXA 4RU9A 2I5JB 4AVCA 1MROA 5L1IA 5AE3A 3OFHA 3Q2SC 3TO7A 4OC3A 1N52B 2J7KA 4DPOA 2NXJA 4ZY0A 2D9PA 3KJNB 4DYOA 3CMES 1JNRB 3TQ1A 2GVZB 1UWBA 3W62A 4GKJJ 4X4RA 4WP3A 3ITHA 4U96A 1HIYA 4I56A 1TXRA 2I38A 2FYXA 1GXUA 2B9EA 4UWJA 2ZW7A 3V6JA 1YW6A 3UDVA 1VHFA 4NE9C 2D3UA 3OD2A 2C3MA 4DPYA 3AXMA 3EFAA 2H9ZA 2E7WA 4ZVGA 4B3MJ 4YB5A 2QLJB 3KK3B 4JI3F 1BC6A 2ROPA 1S5ZA 3TUIC 3WC2A 3DLGA 2JBJA 3GE9A 2KRRA 2QA4S 3W1YC 1KVKA 3IJ3A 1S10A 4FD7A 2V4JB 2QV6A 4C8LA 3TRGA 1GH8A 1FWPA 2BR0A 3WX4A 3K5PA 2BKPA 1G6BA 2YH1A 1ZOTA 3IP0A 3PHTA 4GS4A 4C7HA 1HHSA 4FNIA 1CPXA 2FPHX 1HNVB 4ZY1A 4X64F 3DLEA 4JI6F 1NDKA 2DEIA 1WC4A 2F63A 1KTVA 3CDXA 4DPXA 1DQ8A 1VRUB 2OPQB 1PC4A 3VGVA 3NAHA 1VGYA 1S3ZA 2B3VA 4OKOA 4GKKJ 4M6HA 4P4DA 4K50A 4FPRA 2XMVA 4F9UA 5KFZA 5CYMB 3CCZA 3I56S 5KFAA 4B08A 4DV4F 4B9NA 1RT7A 3HUVA 4B14A 2HGLA 2MQ8A 4A8OA 3D68A 3MUVP 3TEHB 5B0GA 4CYQA 1R6VA 1R0AA 5F46A 1DTQB 2MKCA 2AD9A 4ECXA 4DV2F 3DMJA 4MMOA 5EX3A 2PJ0A 2XMUA 4F3QA 2DISA 4LR9A 4DR5J 2LECA 2FT0A 1QE1A 3D1QA 3TVYA 3ELHA 4JYWA 1VQ6S 1FT8A 1XMOF 3MF5A 1U09A 4QCLA 2R8IA 3QT7A 3IG1B 4DPWA 3CJ2A 1IM6A 4C8ZA 2NSMA 2DY1A 2CXEA 2XSJB 4JI8F 2DB1A 4PPZA 2EO8A 2ZZNA 1JK9B 1QTMA 2G2OA 4ILMA 4OZJA 1MWZA 2BE2A 4PG5A 4LF7F 1MLAA 3L7PA 3U02A 2GHWA 5KFJA 5BR8F 5BYRA 2AGOA 3CT9A 1FXDA 3PY8A 3FBUA 3UWTA 4JXQA 4PUOA 4O23A 3IA0A 1N33F 4XNHC 3PKYA 3PIPQ 1XE4A 4MY3A 3GTYX 1PBUA 1RCOB 4MFQA 4JV0A 4ED1A 2XS7A 2GVDB 4RL1A 1APSA 3ZTSA 1HPZB 2JJ4D 4FKXA 3KLGB 2BXJA 3EDRB 1WHYA 2W4PA 2B5JB 4WTOB 2BEFA 1SUQB 4O3PA 3KLHA 1HI1A 5F3TA 4WIIA 1Y0YA 2A2DA 5DQHA 4KSEB 4X62J 3G6XA 4DV0J 2ACYA 4U95A 2DNQA 1JLQA 3A3OB 3NNAA 2NYIA 2VKRA 4NJRA 3DC2A 2MQPA 1WTBA 4USVA 2OJ3A 2RH3A 1QAIA 2HZCA 4EO8A 4NFRA 3FKBA 2H5IB 3OHBA 1QMUA 5HVGA 5I4MA 2NXNA 1NK4A 2FS5A 1RCXB 2JC0A 2K1RA 2Z3OA 4OC0A 2QYCA 2DXEA 1TKXA 3M7VA 2CZ9A 1BE4A 3SIPB 4F8ZA 2CQDA 1RLCL 1OMSA 1YBUA 1FJEB 1RACB 1J5EF 3HXMA 1ZAWA 3NXZA 4E98A 1IKXA 4HPSA 4DV4J 2DNZA 3CC4S 3ETOA 5H1SV 3R5CA 4V1Ak 1KFDA 3SCKE 4GKKF 2FZGB 3W9HA 2PIZA 2YNFA 1ZETA 4TYBA 4BC7A 5KFXA 4ALZA 3KLVA 3DXSX 4ILRA 1T95A 4KGKA 5A8RB 5I42A 4OZ5A 2ZH6A 4ZLPA 2Z0ZA 1N4LA 3I4PA 5J2NB 5F8IA 2ADCA 2QN6B 4P73A 2BJ1A 1UVIA 5KT5A 2HB6A 2CQHA 4IG0A 2EPIA 3QJJA 1RBAA 3PM9A 4X84A 1P9QC 4DL0C 3EYZA 4ZP8A 1O0PA 1BMQB 3PYDA 5D0RA 2XGPA 6CPAA 4QYRA 3H5UA 2DIVA 2OMLA 2CDRB 1TV6B 5J2PA 4DG1A 3RRHA 1T7PA 4BCAA 1H2VZ 2EEYA 2DPJA 5K9FA 5CD4A 1CP6A 1U8WA 2NZ4A 3IWLA 1TKJA 5RUBA 4IRKA 1Q8IA 1WF1A 1QSTA 1TFWA 3AY0A 8AT1B 1YITS 2XMJA 4FUUA 2VJVA 3MM6A 2OPPB 1NKBA 3B82A 2XEFA 1RB0A 5LXYA 2FVCA 2OPRA 2HWIA 3EXYA 1T05B 3AA9A 2ZH5A 5D8HB 1UFWA 3KUEA 1ZG8A 1IY7A 1RGVA 2OP5A 1NDCA 1FNXH 3R7BB 1YSJA 3BJ7A 3IO1A 3NE8A 2ZKTA 2M3DA 5IV4A 4TY8A 4DV6F 3J7Z5 1IR1A 1HBNA 2EUIA 4AD6A 3D3BJ 4B3OB 3W2VA 1XJWB 2XCAA 2ZD1B 4UT4A 1ELOA 1UJ6A 4CT8A 2WBRA 3VHQA 4MFKA 1U6ZA 4WK1A 1ZTTA 2CPXA 4ENOA 3BGLA 1FD8A 4PWUA 2HWTA 3OR2A 4PR6A 5CAAA 2VIHA 3IM9A 5K20B 5EC4A 3B3TA 2Q66A 5JUMA 1WSRA 3PYGA 1JB0C 3MAAA 2RU3A 4KVOE 2AQ4A 3NS5A 5F8NA 4UY8T 5HBMA 3SI0A 2YWKA 3VAHA 3DRXA 2JHEA 1EQMA 4OZ2A 1S60A 4ED0A 1ROFA 4ID8A 2MGZB 1YK3A 3MPDA 2IY5B 1LKZA 1IB1E 4CNYA 1PO6A 2KDOA 5A0YB 2CQ2A 1MK4A 5ETSA 2UXBJ 4MFPA 2J7WA 3D7DA 3P3DA 3W91A 2HQGA 4B13A 4TU9A 1UZDA 3U7JA 5FJ4A 4A37A 3NMAA 3I4HX 4QYZJ 5J2MA 3JS9A 4OAEA 1NHUA 3ENAA 1UL3A 2DRAA 3RBXA 2XM3A 4XIUA 4NRUA 2K7JA 2ZM6F 2XMKA 4LF9F 1LNQA 3W8GA 5HANA 4DL2A 3OTCA 4U7UK 2QLBB 2YWWA 1VHSA 1ELLP 4FXDA 4RW4B 3ZZOA 4QC6A 4PK3A 5G4DA 2DJWA 2NLWA 5H9FJ 4FAIA 4ZVHA 3OL6A 4FBTA 3L2NA 4DFPA 1VQLS 4CO4A 3W5XA 2Z3MA 3DOKA 1F3VA 3G87A 3PXGa 5F9LA 2VG5B 1FKAF 1WEYA 4CGLA 4NGMA 4RPFA 2D3O1 2DNMA 4DV3F 4U9YA 1SL1A 1CJVB 3A13A 1N56A 4LRFA 3W66A 3LWUA 3QLHA 4MYUA 1B7FA 4M8LA 1IICA 1M90T 2G3AA 1U02A 2I9SA 4CLSA 3ZZ0A 2QZ8A 3DNSA 2B4DB 4N8NA 1XF8A 3VTIA 3F8KA 4WTYA 1A9NB 1V3SA 3MMBA 5SZTA 3PB7X 4NLPA 3CDEA 3UE2A 2MSSA 3J81j 4F4XA 1S1WB 4B3TJ 2YGWA 2JEIA 1Q1KA 4M85A 1N71A 5A28A 4CLZA 1AUGA 2FJEB 1YBTA 3R5GA 3I0RA 4GM5A 2Z57B 4YY3J 1R8HA 4BWJA 4ZCIA 5AG7A 5CXTA 3AD8C 1RHJB 5HMXA 4DX7A 4I69A 2BOAA 3TVZA 3RNZA 4PG8A 3IFEA 2DNRA 5HMZA 2HHHJ 3HHDA 1XR6A 2Z3PA 2FJWA 2OPSA 3MR7A 2HHPA 4II9A 4F4YA 2BQRA 3VWDA 3KJVA 2J9CA 4KHPF 2VASA 2K8GA 4DX5A 2N3LA 2ZZMA 4ANDA 1AW0A 1ZZNA 1TL5A 1JX4A 4OZNA 4R5PA 4CLYA 2BE9B 5J1EA 1GTEA 3ILLA 2C1EB 3L7OA 3KHZA 1HBOB 1KQGB 3TX0A 1RJJA 2HC9A 4OJHA 4LQ3A 1AZSB 2PR1A 5E3PA 4EFAC 1HWUA 4IFVB 5KG2A 3IRXA 3G6YA 1CSJA 3CPWR 2FVQA 4B6ZA 4MFBB 4UOCA 2D4PA 3SFGA 3EMTA 1J4JA 4AG9A 2PA8D 1IBCB 3AD9C 1KDNA 2BM1A 3JSYA 5IB9A 2E5HA 2MDAA 5KFHA 5LSRA 3R97A 3VR1A 1LOKA 3PR4A 3THPA 2VZ9A 4OI3A 3HHLB 1RTDA 1QQ9A 1RU1A 5IC4B 5HROA 4U67Q 4Y2IA 4DR1J 3LACA 1JLEB 4H2KA 2BKNA 3M6XA 4IYQA 4X3RA 4Q7AA 4LFBJ 3J80Y 1TUGB 1N6QA 4ATNA 1S7KA 3JUWA 1S1UA 3JYTB 3BBBA 1LANA 1F5AA 2HGMA 3NGSA 1PYSB 1V5IB 4R87A 3MWBA 2EKNA 4RBVA 3SMZA 2XEXA 4U5YA 4KBIA 1H6KX 5KFMA 4QW9A 1NH8A 4O3QA 2RQMA 1M0SA 3Q86A 1DY3A 1EKRA 3CD6S 3W3SA 4MFLA 5KFPA 5KAKA 2LYVA 4C6AA 3KHGA 3R1KA 2LA6A 2VFSA 4MCPA 4P4EA 2QMLA 4LF9J 3GLJA 4IOBA 4M94A 5KG3A 3KFWX 3W6XA 4MKVA 1HEEA 2MXYA 1JXEA 1HDUA 1M4DA 4ZPBA 1AFIA 2HRUA 1IBMJ 3DR8A 3MM5B 3C6TB 3PZPA 4WU3A 5A8KA 1AUDA 2F1FA 2Z8QA 3G8TA 4F7VA 2FGOA 1NSKL 4E2AA 1JXVA 4DMZA 1Y5IB 5LMUJ 4CNZA 2DPSA 1FJGF 2JRSA 4MK9A 3KI9A 1V3ZA 1PYOB 3I1UA 4PXDA 2VPWB 1WEXA 3I9ZA 1HWLA 1S7LA 4Y6IA 3P2HA 1JLFA 3SFUA 2Z58B 2Y1RI 4P10A 3OVSA 1I12A 3IR6B 3RR7A 1ZTWA 3V38A 5E5NA 2P6FA 1DTTB 5AXMA 5D6GA 4UCPA 1H2UX 3Q0AA 3VATA 3CTRA 3TJAA 1IKVA 1M5HA 2UUAF 1MJAA 3NGRA 1RTQA 2M4MA 1S1TA 4JI1F 1GMVA 4BC9A 1X9WA 2GC8A 4U7UD 2Q4VA 1RISA 4ORFA 1YZ6A 2FTRA 1RWUA 3DI6B 2QG9B 4AT1B 2O67A 2OB0A 2CJQA 5AXLA 4DV6J 2PMHA 3JSMB 4FD6A 2FUG9 3EVMA 2AEJA 1ACMB 4ECRA 4C3KA 2I00A 2JEVA 3B3WA 2C2OB 3HSJA 4EBDA 2DVIA 3BZQA 1X4HA 5KFOA 4WKRA 3S6FA 1RAAB 1F57A 1FX4A 2JBKA 2H3EB 2VA2A 3FRMA 1T3OA 3EVOA 1ZLIA 1QUPA 2QYGA 3OPKA 2CVEA 4OJGA 4ZVRB 1T03B 3V5RA 1R0BG 4DFKA 1U1PA 2C3UA 1UKUA 3Q8UA 2Z3NA 1UA0A 1RYRA 2WCXA 1NDPA 3CXPA 2QL5B 3CXCR 3RUBL 3EWGA 3MM8A 5J2QB 2G0BA 2NYQA 1EKSA 1ZM9A 3DSBA 1HNIB 2YNHB 2EFQA 1KOHA 2XEGA 2MZTA 2XLIA 1LWEB 5J1QA 1Q7LB 3QO9A 3A8JA 4M5DB 1NJIT 2CQ1A 4KH1B 3JB9k 3CMQA 2GIFA 3CD5A 3L95X 2XTJP 1NRKA 4F36A 4IO1A 2EFPA 3UVJA 3MM7B 2HMIB 4XPDB 3N9UC 2YWHA 2CXAA 3LP1B 3KHLA 2XEIA 1SC6A 3EGWB 2ZBPA 4PG4A 3H90A 1R31A 2O66A 4PSWA 4MHZA 1VHIA 1V5VA 2ZJPQ 4J9QA 3UD5A 3QIDA 3T9NA 5HQ8A 2H5MA 2NCKL 3OR1B 3K8VA 3IWNC 2R2UA 2QX0A 2B4OA 1EETB 2YQ1A 3LUYA 4TY9A 4DS5A 3J80U 2KJVA 1X4AA 4HYKA 2GQ2A 1SPBP 4UY85 2NSBA 1F5BA 3M8QB 3R9GA 4WFXA 4FXVA 2AKWB 1RQ0A 2M5YA 4WCEQ 3DM2B 3H4BA 2Q7BA 1X31C 1B0PA 2YQ0A 3PGPA 2E5JA 2PJ9A 3MGJA 3OQ2A 1FHTA 2CJYB 2V6AA 5CBMA 4U9ZA 1UFLA 2F8HA 4K7QA 5HJXA 4R6TA 4ICLB 2C1CA 5F0UA 1B4SA 1RT5B 4RW7B 5GMEA 4A8WA 3TE4A 2MQNA 4H89A 2AF6A 2FLLA 3FUYA 1WI8A 3Q89A 2OTJS 3NS7B 3NBPA 3UFCX 4QWCA 4QU6A 3VZHA 4EEYA 3HULA 4NCZA 1GMWD 1H0HB 2JC1A 2X1AA 1PJ6A 3DDDA 4P4IA 3OFEA 2XS5A 4KORA 4CAFA 5KFIA 3ZTPA 4C8KA 2J0WA 2LVWA 1X10A 3FEEA 4R9MA 4OV6A 4HT7A 2IRYA 2R98A 2CQPA 2YX4A 1FEEA 5T14A 1R8BA 2DNHA 5D0EA 1VQ7S 2GANA 2AFSA 3KLFB 3HO1A 1U2FA 2G0IA 2YNGA 4TYAA 4K30A 2VHGA 2HFOA 4F8RA 2OFGX 2PJ1A 3J7A1 1Y00A 5JVHQ 4B3TF 1CPSA 2AWZA 4MAKA 3JTKA 4IR1A 3G3SA 3IR7B 2BJ9A 3CCSS 2R2TA 3ZC4A 1Y9OA 1NB7A 3DYAB 2K3IA 5FDLB 2P6GA 3TC8A 3QAHA 4YDXA 2CNLB 4DS4A 4C68A 3VH9A 1QD1A 2YX1A 3GZ7A 4YOEA 3Q8RB 1KOOA 4DV5F 1NZAA 2RHQB 4G1QB 1S6QA 2L9WA 1HQEA 3TZYA 4M3SA 1ZBTA 3ICLA 2ZWPA 4R7MA 4UEFA 2VD3A 1RYSA 1WTFA 4DPTA 2VEZA 4ED4A 1R8AA 2OD4A 1LRZA 3EE3A 1TU0B 1S9GA 3LALA 4MHYA 2Q0YA 5GMKa 1NU4A 2L08A 4P2SA 4C3MA 4UWIA 2F3JA 3HHKA 2ZEHA 3PW0A 3C6UB 2QMWA 3TVKA 3WABA 4CLLA 2V8DA 4QWDA 3FQLA 1UJ4A 4DV7J 2MKSA 1CULB 2KXFA 3V4IA 1LK5A 2N82B 3T1HJ 5IM0B 4YN3B 5IS2A 3FEYB 2R9LA 3WZ0A 4ZN3A 2LQ5A 5KTAA 3NNHA 2HQDA 4I2PB 1NAQA 2ROGA 3KLEB 1N5TA 3FFIA 2BQ3A 3NS6A 2Z4PA 2RF2A 5B0EA 3KG1A 2ZH4A 4QUSA 4TKTA 1BQMB 2HVZA 4URQU 2B9WA 4AQYJ 2AW0A 2CNKB 3MPVA 2VBYA 3GV7B 1E6VB 4AL5A 3R6LB 5CABA 5HMYA 2I2YA 2HBYB 1HW9A 3F5BA 2KG0A 4C98A 3AT1B 5AJ3J 4C8MA 3OLAA 3C14B 2ZOMA 1IIDA 3FMBA 4TN2A 4C0HA 2C28A 4FD4A 4K4ZA 2DNOA 1UVNA 3R1LA 1JLGA 1VHOA 5CCMA 3OXGA 2DRDA 1RTHA 4N76A 2NXUA 1MJBA 3C19A 4KGMA 4Q2MA 3VAMA 2WVEA 3IN5A 4PG6A 2WW4A 3K5MA 1YBAA 2IJZA 2CTCA 4CGPA 1WC1A 2MYFA 4C3LA 3A3NB 2HK2A 2P8IA 1HWJA 3AJ1A 1OQ6A 3BI0A 1UEKA 2ZHAA 4FF1A 3AOCA 2A10A 1HHTP 4O0NA 4LQGA 2EBGA 1Q4RA 4ECTA 1H72C 2PJAA 1R6YA 2JZ5A 2IVFB 4PZVA 4I68A 4DR7J 2RAQA 3DR6A 1FRIA 3C16B 4J5OA 4Q43A 3SI2A 3HT3A 2WSCC 2F5GA 5K5MA 3HKWA 1LAMA 1U49A 1YW4A 1U1MA 2DGVA 4DL6A 5JGFA 1IKYA 1QSNA 3MEDA 4J9OA 1D9AA 4M5GA 5K14A 3GSDA 1PJ7A 3H5SA 5L1JA 3GFXA 3GFYA 4YR3A 1KC8T 5GAGI 4DJBA 1EARA 3BSOA 1B99A 4J7CA 2ZEEA 2BCOA 1WI6A 3SDEB 4EMEA 1B0TA 3H0PA 4LIWA 3EZOA 4F6AA 3G6ES 1ZZFA 3ONQA 2W9CB 1UZHA 2KZZA 4RBTA 3HHNB 3ZZZA 1SL0A 4JOUA 4KLWA 4B5PA 4O0IA 2XWXA 1RXOB 2MQQA 2BJDA 1M44A 3G8WA 4BS2A 3LPYA 4OIWA 3R5AA 1Y7EA 1ZM3A 4USUA 1VS3A 5HN0A 4NRTA 4GO7X 1KHVA 2EXUA 2K06A 2C22A 4OLPA 5AG5A 4ANCA 1X4EA 5KG7A 4OMFG 3TT2A 4BBHA 2EFGA 2HS3A 2BUEA 4OC2A 4YRHA 2EWHA 1F0XA 2ZH8A 4DF4A 2LQJA 2AJ4A 2FVPA 1WORA 3CCMS 1CPZA 2UV8G 4FPIA 5ETLA 4RNHA 2F7VA 2F9DA 1Y9WA 4K4XA 5H9FK 2GMLA 1X0PA 2MHNA 3T1YJ 6FD1A 3GIMA 4EYHB 2PJBA 1WSVA 1KP6A 2V63A 2VICA 3NH5A 3PB8X 2VBXA 4RNNA 4AUKA 1VQNS 3N6MA 1TKTA 2WSAA 4UIAA 3IU1A 1S9EB 4DSIA 4OYPA 1H7WA 3H8EA 1UPPA 2IM2A 2LKZA 1CM0A 3HVWA 4DF8A 2KHCA 1RT3A 4PPDA 4LF5J 3IS9B 3PRTA 3T1HF 3NWRA 4XNHB 2M88A 4O3NA 2D3OR 3A8IA 5D4PA 4URGA 1BPMA 4F67A 4CYUA 2WYRA 3GFHA 4PAAA 1RAFB 4A38A 4YQWA 4B9UA 2G3TA 1R57A 2XY6A 2RQKA 3OBIA 2M52A 2XULA 4MYTA 4A48A 2AP6A 3KK1B 4DR1F 2VZYA 3UDCA 1BGXT 5G20A 1R7IA 1GXLA 4NA1A 5K8MA 1JJCB 4LVNP 3W60A 1YMEA 4PQUA 3OUYB 3ITHB 3V7ZA 1GT8A 3KWMA 2HQFA 3QIPA 2MEWA 5LXRA 4RN7A 4P74A 5E3AA 1OPIA 3CC2S 3UDEA 1Q16B 3MURP 1RBOB 4EZ6A 3BV8A 1G7CB 1V9OA 4RW8A 4TWEA 4XPEA 5D77A 3E51A 3BH7B 5E7OB 1YWXA 1WUUA 3HVTA 3NLCA 2IM0A 1VQKS 3EPIA 4KVME 5M2PA 5C82A 3FBEA 1K8AT 2AFMA 2NYHA 4OHWA 2GQCA 1HD0A 2UXCJ 2HRTA 4UOHA 2CQBA 2REEA 2GA7A 4YHHF 4RI1A 3VGUA 1K9MT 4I6AA 4M5LA 1UJ5A 1NLKL 3LGNA 3KKWA 2GX8A 2ABYA 2X1GA 2Y8WA 1X5OA 2VZZA 3GMGA 5F09A 1FKPA 2FJDB 3T3FA 4O3RA 4OLOA 3GKRA 4NX9A 4AXIA 1Q2CA 2I79A 1HBUA 3UW1A 2DGWA 3M2VB 4CRJA 2NUHA 3AHPA 4ES2A 4H4MA 2KYZA 4K4YA 4ES3A 3RZAA 2HNZB 1WC5A 1TELA 3CJRA 4DV0F 4WYLA 4CH0S 4CH7A 1GQEA 4LRAA 5T7LA 5AG6A 1TQLA 3QAYA 4LSNA 2OPQA 3I5AA 1Y0HA 4OIDA 1UPMB 1RBLA 2ATLA 3N5BA 3DRRA 3K5OA 1QY7A 1RT2A 2ZUGA 4B9LA 4OZ3A 3BJ8A 2DPTA 2GIRA 2WB4A 3DLKA 3PG9A 1RAGB 1R8CA 2IAJB 1N33J 1C1BB 1RT6B 3RBDA 3SV4A 4DL7A 1Y7PA 2D9OA 3F0NA 1SXLA 2PSWA 5C24B 3D4JA 3PW2A 3MEGA 1FESA 1H3DA 4RNMA 2UXDJ 4DR4F 2R8HA 3U1MA 1QAXA 4ZCLA 5G21A 4UZCA 3SCIE 4OI0A 4JUZA 4LFCJ 3ZZYA 4P52A 2PFFB 3WC0A 2RS8A 1VISA 1JKHB 1NDLA 3GIRA 4FS2A 2OLWA 2W2PP 3LW5C 2EK6A 4LR8A 1LW2A 1F9EB 1MWYA 4HACA 1XN9A 1SBRA 4P44A 2BE2B 4CLWA 4NGSA 2CTBA 2JLGA 1IWAA 4K4VA 4ITSA 4J37A 4HVZA 5DDRC 2PT0A 3OSPA 1NK9A 1FXRA 4C0OC 1Y11A 1U1LA 3DOMA 5HL7Q 4IK2A 1UVJA 2FIAA 4GVBB 1VQ4S 3ILIA 2QVPA 2POKA 4KAIA 3BYRA 1ICEB 2PJ8A 2ZDOA 4HTIA 3QT6A 1LFPA 1GMUA 1BQXA 4NWBA 1SUQA 3GY9A 4AL7A 1N5QA 4WWVA 2DGTA 2QGFB 1PYTB 3LAMA 1RWMB 1HNZF 3ZO7A 2FZKB 3E01B 3MGDA 1UAWA 2NS1B 1HW8A 3T5KA 3O5TB 1RI7A 2O28A 4L89A 4KSIA 4NLVA 5B7WA 3ISXA 2W9BA 1K47A 3BSAA 2XZDB 1G4CA 3OVBA 3G8SA 2YY3A 1X12A 4DLEA 1RTJA 3D2MA 4P7TA 3NG8A 4KV8A 2ZW6A 2RKIB 1S0OA 4I2QB 1R3NA 1IKWB 5DDOC 5KFVA 5FVJA 4JLYA 4HI1A 4OYAA 3QGGA 2IC3A 2IA6A 1CS4A 2FHMA 4F3OA 4RWXA 4ANEA 3V6DB 1CQNA 4K2XA 2AJ1A 4IDKA 4LR7A 4KOUA 3HHEA 3HT0A 3N7ZA 3SXLA 2C6PA 2NQPA 3FK4A 2XGQA 3R3TA 4CO0A 1KEKA 4FD5A 2D3ZA 3KG0A 4N47A 4NEYA 2CQ0A 5KFWA 4IHMA 2YX7A 5HVFA 4I7FA 2HIYA 4NCAA 4WFYA 5A8WA 4U9RA 4DOZA 3S1TA 3HKZD 2HFUA 3K89A 1RLDA 1RZMA 1XFOA 2DR5A 2F5IA 2D7SA 1CX8A 3EZUA 4DQSA 3MZIA 2QEXS 3D0HE 1NK8A 4UCNA 4RW9A 4I6YA 1U1RA 1ZPVA 1RTIA 2QIFA 4BHQA 3H4QA 3D9BA 2G9DA 3W2WB 2GAGC 3ZFVA 1SKWA 4KGZB 4ZK7M 1M5SA 4AYBD 5DLGA 1KRPA 5EWEA 3VZIA 3TZXA 4YDDB 2OAUA 4IAVA 3CJ0A 4ONWA 2EG1A 1KWMA 1KD1T 4DX6A 4M6IA 3RBUA 3R6GB 3Q23A 3OV7A 1I94F 1ARLA 3IC1A 4BBYA 2DNNA 1Q79A 4C48A 2BO9A 4IRCA 3SSSA 1U45A 3IWGA 3SHPA 3R5DA 1KLMB 4P9SA 1NO8A 1S0MA 2XYPB 2BJ7A 5LJ5Y 3GIUA 2NXEA 7FDRA 3W2VB 1FJCA 4OC5A 1V3RA 1YJUA 2YPZA 3QWPA 3FECA 1F2HA 2M70A 1YVKA 1QTNB 2YKQA 3P96A 1VJWA 2BACA 5C88A 1BQNA 2VDIA 3OR2B 2XSFA 1MN7A 1IU8A 3M2UB 4CLFA 3KK2B 2C27A 2O1PA 2W4DA 5DWMA 1VCTA 1B0VA 4HEA9 3K5LA 2J0XA 5E41A 3GWCA 2VL1A 3P5BP 2ATRA 5FLXU 3MMCA 4XPLA 1YZ7A 3Q83A 1TL3A 4DUYJ 4F4WA 4EU0A 4RW6B 2VQEF 4B11A 2CPEA 1S1VA 2XMTA 5F8GA 2ERRA 1G2EA 5C25B 3F73A 2QFJA 1HBMB 3FB3A 4E2FB 3GILA 2RNEA 1HARA 3NMRA 1ZH5A 3K2YA 3E2EA 4UA3A 2WVCA 5IOLA 1EP4A 4ZVFA 3LWMA 2AV5A 1VQYA 4O44A 2ZNZA 1S0VA 1YLOA 1L5UA 3KR4A 2VQEJ 3AQOA 4J9NA 4F0XA 4DWIA 2JL9A 2R8GA 4P6QA 1TAQA 1RXTA 1Z2ZA 1HMVA 3DKDA 3R2CJ 3H2VE 4FF2A 4YGOA 4M5MA 4I0WA 1U24A 5HI7A 1JLBB 3VV2B 1SKUB 1TR0A 2GZOA 4KHPJ 1DLOA 2BW2A 1SJ3P 4HNWB 1YHQS 2BABA 4MHDA 5L46A 4NLSA 2OEKA 2VPXB 5HSPA 4JV5J 1Z8TA 5SUHA 3NKYA 3J81Y 2G0JA 2UU9F 3DOKB 2JEGA 5HATA 4KOTA 3MEKA 1VOMA 2BZ2A 2PN6A 1Z4EA 3AH6A 4RKUC 2E9ZA 3W9JA 4FBUA 4FYXB 2JFDA 1YRUA 2PR8A 3MEEB 2KO1A 1UWBB 2W01A 2HVEA 3TAPA 3M8ZA 2CPIA 4TNUA 2X7BA 2H4YB 1S12A 4X65F 4F04B 2H65B 1GMWA 1C0TB 3HX9A 4W9YA 1RWPB 2FZCB 5KFDA 4Y2CA 2V2KA 4OX6A 3KK3A 3DGPA 2AYEA 3V6KA 1X9MA 1HQUB 2MKHA 4USJC 4BWMA 1WG5A 4USMA 2OSRA 1CC7A 2KVQE 5JJBA 1LWCB 1U0HB 2APOA 3TAMA 4OZ0A 3M8SA 2OTLS 2Q6CA 3THVA 2QRRA 4JI5J 2H48B 4MJKA 1TL1B 1NE9A 2DNYA 3FMWA 3QZ7A 1BWEA 2DH8A 3UY5A 1VC0A 1YKWA 2X51A 4UZBA 2Y1JA 2AZ1A 3MCNA 2FQQB 1IN0A 4NGRA 4KIAA 2B0GA 3ZZIA 3NRBA 1U0SA 2GV1A 2G4BA 1SC3B 3D4UA 4ED6A 1TL7A 3DDKA 3NOGA 2AGQA 4UFWA 4MY0A 4PXCA 2HHXA 2WZNA 4H6ZA 3T6JA 1IBKJ 2FJBB 1XK8A 2B5GA 1VRUA 3MAQA 2EFOA 5HK4A 2CIMA 5KTDA 2MPUA 2JLMA 4K59A 4KTQA 2ASDA 4P4JA 3N6LA 2L41A 1HBOA 3NCRA 3BH6B 2C3PA 3JSRA 5C2GA 1RT4B 4KKOA 4OQJA 3CW2C 3P6YC 3IRXB 3AFGA 3HLUA 4YS2A 2CJ9A 1BUXA 2N4CA 2WW8A 4IG3A 4CTAA 3OSNA 3I0SA 2OFHX 1UWAA 2M8HA 4QZVB 4B17A 1BPNA 2HZAA 4E0DA 5MLCV 7FD1A 3K7RA 3BLNA 2EFVA 2BANB 3CEDA 4X5KA 2I6WA 5D29A 1H74A 1VC5A 2QJ8A 3KXDA 1NJXA 4DNCA 3NA6A 3DDIA 3GQCA 3ISND 2X1BA 4EYIB 4KGVB 1VQ9S 4B3MF 3BGRB 4NI2B 1OIAA 1AMPA 3GFZA 4HHHA 2KL8A 2WBMA 4NLXA 1WWHA 1BXNA 2CNNB 4RO0A 1FE4A 3EDQB 1PSDA 3QGIA 2HPUA 4QR0A 2WVFA 3LD2A 3B35A 3S01A 3HHLD 2WSFC 4F0YA 2YKOA 2K2PA 1ZLHA 1CJUB 1VIOA 3C2PA 2RQ4A 1PUAA 4HNYB 1YX0A 3GUXA 5DS0A 2D1CA 1KQFB 2Q44A 3PYEA 5C5JA 3JSBA 1WWZA 4A33A 3KLHB 4GRSA 3K59A 4IQMA 3TI0A 1S1XB 2FL4A 5GADI 4MK8A 1SKSA 3SQGA 3P5TL 3GCWP 1JLAA 3KDOA 3EVWA 3HVAA 1HFEL 4LF2A 3NEKA 3SSQA 1S59A 3DCAA 2VPYB 4X8IA 4IR9A 2RUSA 4RUBA 3W61A 1KS2A 2YKMB 5GAHU 2W2NP 5FLXY 1GTHA 1H2TZ 4K4WA 1QJHA 3TAQA 1NHVA 2CJXB 2E1RA 1QUVA 2B8QA 3PW4A 1RU2A 3BPDA 1OQ3A 4OIXA 4XK8C 3PRBA 4LFBF 2I5JA 1WKLA 2C6CA 1UA1A 4OV1A 1HL6A 4A95A 4ZBGA 2CAJA 4Z2XA 4UIBA 2AZ3A 2AX0A 3SV3A 4J9MA 1IQTA 4XPDC 1XWLA 1UCNA 4EZ9A 2FJXA 2OI2A 1J5EJ 1W2IA 4ZIVA 4OYIA 3G8QA 5I42B 1M4IA 4DFMA 2R3VA 5EX0A 4C7IA 2VV5A 4ECVA 4ER8A 5KT2A 1EHWA 1NK7A 3TJ8A 4RUCA 5HLFA 2MY7A 1LXNA 3KMQA 1OO0B 4ED2A 3M9NB 4CGNA 3SJXA 4HKFA 4YUDA 4IFYA 1OY9A 2FIUA 4KOYA 5B0AA 4DG1B 5DO2A 1FRMA 5KFNA 1JJHA 4HLBA 2JVOA 3LQVA 2ZC3A 2VI7A 4BMHA 1MG7A 4W92B 4OYBA 2FIWA 3LO3A 4RX6A 3G82A 3G9CA 2VA3A 2GMJA 4NGTA 3KGQA 1C0UB 4WE1A 3LP0A 1S76D 2RT3A 5J2QA 1MMDA 4USIA 4LSLB 2XG8A 2VG6A 2DO0A 4JI2J 4AB7A 5M2UA 4NYOA 2HWHA 1S72S 2WSEC 2RFHA 1Q7LA 3BKUA 3Q8VA 4MIAA 3DLEB 4UQTA 5CYJA 1DHMA 5KFYA 4MFJA 1IR2A 5F9NA 2BMBA 3RGIA 1RA6A 4CM2A 3O44A 2VODA 1MJ9A 2MJUA 1XNRJ 4MKYA 1U26A 2L48A 4FVCA 3LP1A 2IL4A 4DUKA 2IMWP 3KHRA 2OH1A 1X4GA 2ARHA 2IVYA 3QRQA 1BHNA 2DGOA 3MFIA 4LRDA 1Y5LB 4R25A 3BB5A 1FI4A 4K3NA 3N5FA 2BJEA 4X2TA 1OS5A 4EWTA 4DR5F 4CO3A 5AE1A 4C97A 1SL2A 5GADU 1RWNB 3AOBA 3D3CJ 2R7RA 2DGUA 2VG7A 2F4VJ 4UQGA 2P6SA 3BGUA 1FT7A 3A8KA 2Z56B 2VUGA 3W7BA 5HBMB 3T5JA 5K8PA 3UI3A 3PO4A 1QE1B 2MSTA 2RS2A 4RNFA 3OJSA 3FF3A 2E7VA 2EVNA 2CQ3A 4KFBB 5I3UA 1GK8A 1DE4C 5ETMA 4HT5A 2QMUB 2VJUA 3WIVA 2WB1D 1X4FA 3L4BC 2E44A 1JWQA 3POTB 3SI1A 2AFWA 4J9UE 1L0CA 1SQFA 2VONA 4KO0A 2XBPA 1X9SA 2FDNA 4RU2A 2GO9A 3A4TA 1HR0F 3AD7C 1NEEA 1XMBA 1VJQA 3RRKA 4M5HA 2BRKA 2ZEFA 4JB8B 1LW0B 1P1TA 1AT1B 1OSDA 3UPFA 1OBRA 5ETNA 4PQAA 3PEJA 4LF7J 2E5IA 4DZDA 1SJRA 3MMAB 5IZHA 4QW8A 4F26A 2BSWA 1RKIA 2GJFA 3CF5Q 4NZ0A 3PBBA 1VI7A 1FDDA 4J9PA 1Q2YA 3B8HA 4L72B 2GFFA 1NJYA 2DGQA 2C42A 1U48A 4JWPA 4OYXA 2JX2A 2DNLA 2W4CA 4GMKA 1JLCB 1REGX 3CJKB 2J9DA 1FNOA 5CYQA 2OH2A 4NXNJ 2GLFA 3BDEA 2DR8A 1X7VA 4FNHA 3W9IA 5KT6A 2AFUA 1REVA 3DRSA 1DARA 3CB4A 3M30A 3WIUA 5KFEA 4Q8EA 2ZBQA 2HGNA 3PJXA 2I1RA 4N8OA 3DYAA 1SV5A 4YMEA 3BR8A 3OFGA 2MLXA 2ZNYA 4MT1A 2ZVSA 4A46A 2Z11A 4WZQA 3WBZA 2MQLA 2V67A 2BDPA 2RQCA 4ED7A 4IQXA 3HCXA 2XY5A 4A31A 1HQEB 1VIXA 2QO3A 4DQPA 4I67A 3ZJ0A 2Q04A 4O4GB 4CYPA 4ED3A 1S1WA 3PVXA 2R42A 2YNFB 1S49A 4ZJQA 1S7HA 4W90B 1TKFA 5BYSA 1D09B 3VAFA 2M7SA 2PD1A 1A2ZA 4X4VA 2YKNA 5A8RA 3M9OB 4XTTA 3KZWA 5KFCA 4MTPA 3CD0A 2QJ3A 5LMUF 3S9MA 4QR1A 2YNEA 1CVJA 2XHWA 2CY2A 3L7UA 3ENVA 2ZHOA 1LFWA 4UEEA 1TMJA 2EW9A 2CJKA 5J2PB 4L74A 2QT7A 3H20A 4DQQA 1Z5RA 1XNQF 4JBCA 3QNVA 2UZAA 2D74B 2CPYA 2DXDA 2LU2A 2OELA 5G22A 4KR0B 2YKAA 2ZITA 2W2QP 2V5HG 4Q0BB 4IUFA 2DBBA 3I55S 2HFSA 4H6UA 2H51B 1E6VA 3MCSA 2FLOA 2E29A 4DL5A 4R5PB 1Y0RA 2Z2LA 2WVDA 1I5OB 3I5CA 1RAOA 1YLXA 3HD2A 3BN7A 3QMQA 5A2QU 2QLXA 1ZG9A 3NNCA 2XLKA 7CPAA 1KTQA 5L8RC 4C8NA 2W9AA 4WFNQ 4DR4J 3MN8A 4Z7CA 4PKDB 4TY8B 1EJ7L 1XIQA 4OYZA 2ALYB 1IWGA 1HBNB 1Z8WA 3K17A 5LSLA 2Q7SA 4DSLA 5AT1B 1RTDB 1B7YB 4GO5X 4HDGA 1K4JA 2ZJQQ 3GG0A 3A1YG 3K9UA 1JLEA 5D4LA 1QAYA 3GV5B 3PIOQ 3CULA 4Y2MA 3TJ9A 3EXNA 3MMJA 4B9TA 4F02A 4EVYA 3U1NA 5AJ3F 3RBEA 2GW8A 3HD1A 3M32A 4UFXA 5C2CA 3FXTA 1IBMF 4FP9A 4ZN1A 2LMIA 3G96A 3QBCA 1S7IA 1YLEA 4DXLA 1U1NA 4DN0A 5FIIA 3M1VB 3CNQP 3J7YU 3AOAA 5A0YA 2WHOA 4RZRA 4IOAQ 1GAOA 3JTOA 3G4SS 3FRZA 1OSCA 1FRLA 3B8GA 4UTGA 2B4UA 4F0HA 3K57A 2HHHF 3NFZA 4ED8A 1O8BA 5KOXA 3C6TA 3MUMP 5A8KB 3M05A 4IF5A 1WG1A 1DURA 4JD6A 3HFZB 2H4WB 3ADAC 4F4AA 5IQ6A 1YGYA 2E1MC 3IIBA 2J8SA 1CBXA 1RE1B 4EUVA 3VAKA 1H38A 1RAIB 5HP1B 4E8OA 3BBFA 4R8UB 1MMLA 3IAS9 5J1PA 3PP9A 3M8PB 4IKAA 3EX7B 4B5PB 2R2SA 1YREA 1Q86T 3FZBA 3W64A 3UDLA 5A76A 3MR2A 1XOVA 3G71S 1JXLA 4JI8J 3IBCB 3L3CA 3VF0B 2KZMA 1HI8A 4DSEA 4YFUA 4OX7A 4JI5F 2RU9A 4DR6F 2RD5C 1WACA 5F3ZA 3BKFA 1R8PA 1IKVB 2F40A 3MD3A 4P4BA 2YNIA 4ZHRA 2GVZA 5G0RA 1C1CA 7AT1B 4QPXA 1NPKA 5DS7A 3AQPA 2IVMA 3QFHA 1CJTA 2HNYA 1I6JA 3QZ8A 2CJAA 3R2DJ 3IGRA 4DV2J 2XC9A 4NZ7A 2Q51A 2EC0A 1QVGR 4CRYB 2YNCC 1NHKL 3PB4X 2AJ6A 2MKKA 2KHDA 2C3OA 3K8WA 3IRWP 3I87A 5I3PA 3W5YA 3EGNA 2XO7A 3HFKA 3QSYB 4W98A 3TOBA 4DCOB 1JQGA 3S9NA 3H5XA 1OJ4A 1CP7A 1LQ9A 4URSA 2C2MB 1QM9A 3SYZA 3Q8QB 4I49A 4WFAQ 4TQSA 4WFBQ 1MROB 2DKOB 5LT5A 2PJ2A 4CCHA 3FSIA 1SB6A 3CO9A 4LQ6A 2QECA 5LSOA 1LV5A 1R43A 3VALA 2WZ1A 4MKBA 3B3CA 1P4NA 4AE5A 4CYUB 4LFAF 1TAUA 1NCLA 4MIWA 4W4MA 1U8SA 2HSEB 3ET6A 3VAIA 4FN5A 5AGEA 1M5VC 3TZWA 2GIVA 3KR5A 4FF4A 3CUNA 1YTYA 5GVQA 3KK1A 1KFSA 3PZJA 4ZPWR 2BOPA 4K5SA 4OC4A 3K58A 4LUAA 1Z8XA 1XBWA 2XYGB 2OOTA 4FS1A 3OVAA 3BF4A 3NAIA 3FZ2A 1NBEB 1SQGA 1NJWA 4HKQA 2KT2A 5KFBA 1UP1A 3IM8A 1VK3A 1S4FA 4KOXA 2BQUA 1GXTA 4MH8A 1YVOA 1H8LA 1NK0A 1ULRA 3FJUA 2P6EA 1FNMA 5U47A 4MFBA 5B0CA 3E3XA 4U8YA 2R7OA 4LF8F 1RSCA 3F56A 2B4VA 4WYWA 3QNWB 2DR6A 4DJLA 3MR3A 3S6KA 4WXOA 3PO5A 4NASA 4JYAF 3RBZA 3KDNA 4B9VA 4HL9A 3K0JA 3GV8B 3R1HA 2W2MP 4MCSA 1KNZA 1NKEA 2VFTA 5CA5A 2XSJA 3OFFA 3LP2A 2ILZA 4DU7A 1W2BR 3X3UA 2CNTA 2UP1A 3N6NA 3PX4A 3GJRB 3BSCA 4RW7A 2PC1A 3LOUA 4QWBA 4C9DA 3T1AA 1XTZA 3R9EA 3QAUA 1RO5A 1RWOB 2HW3A 4K4TA 4DL3A 1F3FA 4QOTA 2VBQA 1HWKA 2ZC4A 2IRUA 4I1TA 1S6OA 3DOLB 3W5ZA 4P72A 1D1UA 1UETA 4E8UA 3GONA 2E1PA 1R0AB 2CPHA 1KR4A 3NL0A 1TK5A 2CG4A 1HPZA 4C7QA 3AJ2A 1CJKA 3NWGA 3H59A 2GHPA 2N7YA 3CMAS 4ELTA 2COLA 4C11A 5HQMA 4DSJA 3DRRB 4NLQA 1SIZA 4X4UA 3S6GA 2J6UA 4H4OB 2EFNA 3WC6A 4LF1A 1CBKA 5ETVA 3FBBA 1RHMB 4NLTA 1XEBA 4CAEA 1S6PB 3OL8A 3HJVA 1U6BA 3OW2R 2IRXA 2PEHA 2Q4ZA 3R5JB 3CXQA 4KRWA 3F41A 2XEJA 2HVIA 4MK7A 2K1RB 2UUBJ 2WOMA 1FF2A 3TUJC 3U27A 2WONB 2NUUG 5EWGA 2HUZA 4X4NA 4JZ0A 3ENWA 2EK1A 2SXLA 4X66J 4HDHA 3P4UB 1NSAA 2DH7A 1VLOA 2IYGA 2JLFA 4PK2A 2AX1A 2ZH1A 1LW2B 4OHYA 2B5JA 3GJSB 3FEDA 1KUVA 2RHSB 2RDJA 3ISZA 1YQHA 4LRBA 3HFVA 1AROP 1S1TB 4Y2KA 3D0IE 4B12A 2MKYA 2UVUA 3FVYA 1D0EA 4P71A 3WHIA 3OL7A 2W8LA 1F9HA 3DOMB 1NB2A 2IJNA 1X4CA 4RBUA 2XMWA 3O1LA 3O8WA 2MQOA 2CZ4A 1OY8A 2NXCA 4NXYA 1TVRB 3TQEA 5H86A 2ROEA 2KTQA 1CULA 4HTJA 2CWKA 1IJFB 1JIHA 2NZCA 5BWAB 5IM0A 2B6AA 4LF8J 5CH7B 1IUJA 4UOFA 3E01A 4J9LA 1SQHA 3CCTA 1WDTA 1WC0A 1J2VA 3LPEA 1TV6A 3NOCA 4V19J 2O53A 2KT5A 2ZBIA 3FFIB 3KL9A 3BEGB 5KG1A 3VVTA 1IKXB 3C26A