3GB0A

Crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
373
structure length
373
Chain Sequence
GMINQERLVNEFMELVQVDSETKFEAEICKVLTKKFTDLGVEVFEDDTMAVTGHGAGNLICTLPATKDGVDTIYFTSHMDTVVPGNGIKPSIKDGYIVSDGTTILGADDKAGLASMFEAIRVLKEKNIPHGTIEFIITVGEESGLVGAKALDRERITAKYGYALDSDGKVGEIVVAAPTQAKVNAIIRGKTAHAGVAPEKGVSAITIAAKAIAKMPLGRIDSETTANIGRFEGGTQTNIVCDHVQIFAEARSLINEKMEAQVAKMKEAFETTAKEMGGHADVEVNVMYPGFKFADGDHVVEVAKRAAEKIGRTPSLHQSGGGSDANVIAGHGIPTVNLAVGYEEIHTTNEKIPVEELAKTAELVVAIIEEVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidase T
publication title Crystal structure of aminopeptidase PepT (NP_980509.1) from Bacillus cereus ATCC 10987 at 2.04 A resolution
rcsb
source organism Bacillus cereus atcc 10987
total genus 114
structure length 373
sequence length 373
ec nomenclature ec 3.4.11.-:
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gb0A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3gb0A01
5HXDA 1NSAA 2CF4A 1DE4C 2XEJA 4W9YA 2GLJA 4X3RA 3KZWA 2RB7A 3FMCA 2PJAA 1R3NA 3KHXA 2PJ6A 5J1QA 2ZEMA 2C6CA 4P4EA 1YW6A 2AFUA 2ABZA 4MHZA 2PJ0A 2WZNA 4DUKA 2V77A 3FVLA 4FBEA 2BOAA 4MRIA 3FX6A 5K8PA 5K8MA 3FEDA 4KSIA 5LYIA 4R76A 4BD9A 3FEEA 4MXUA 4F8ZA 2ZEGA 2F7VA 2V8HA 4P4IA 4OC0A 4P4JA 1TKJA 4NJQA 3KR4A 2PJ4A 1YSJA 2IMOA 4LQGA 4P4BA 1LOKA 1XMBA 3PRTA 4AXVA 4EWTA 3TC8A 1LCPA 3CPXA 3RZAA 4Q7AA 2V8GA 4R7MA 4CPAA 2G9DA 4UEFA 1LAPA 4PPZA 5K8NA 4NGPA 1Y7EA 3K9TA 1Q7LA 4B6ZA 4G1PA 1ARMA 4MCRA 4P4DA 3FH4A 3CT9A 4K3NA 5THWA 2RFHA 4A37A 3FF3A 5CBMA 5K8OA 4MMOA 2PCUA 4PQAA 4F9UA 4PXEA 2FVGA 5DS0A 1ZLIA 3SI2A 1TKFA 8CPAA 4MHYA 2AFSA 3PB8X 1Y0YA 1BLLE 1IY7A 2XEFA 3IO1A 3GUXA 3B3VA 2ZOGA 1XFOA 2PJ7A 1Y0RA 4MCPA 4NFRA 4WJBA 2J9AA 3PB6X 1EE3P 2Q43A 2CTCA 3PEIA 3WT4A 2CTBA 2ZEDA 3WC6A 5IB9A 1TXRA 2GREA 3BHXA 4MCQA 2O4HA 2POKA 3V38A 4NJRA 1ARLA 3D7DA 1YMEA 3CPAA 3KASA 2PJ2A 5ELYA 1HDUA 2DEAA 2ZEEA 5LYLA 3SJEA 1YW4A 1CP6A 3B3SA 3IWWA 2Q4ZA 3H8FA 1PCAA 3BXMA 2BCOA 3GB0A 1H8LA 2QJ8A 3S9MA 1KWMA 4OKOA 1LAMA 3I1UA 1M4LA 1ZG7A 3V7ZA 1JQGA 4ZX8A 2PJBA 4IHMA 3KHZA 4NGSA 2ZEFA 1Z2LA 3B3TA 3LMSA 2V8DA 3WABA 2XEIA 4A39A 2PIZA 4UIBA 2IJZA 3HUVA 1BAVA 1F57A 2XEGA 3VARA 4R6TA 2ZELA 4A94A 1TF8A 4IAVA 3PFEA 4UIAA 3DLJA 1ZG8A 3NFZA 3WC5A 1XRYA 4YU9A 3MN8A 4MHNA 2JBKA 3NH4A 3QNVA 2CIJA 2NYQA 5HVFA 4Z65A 2PJ1A 3SJFA 1Z8LA 2ZEHA 3RBUA 3D67A 5JGFA 5CPAA 1DTDA 7CPAA 2JBJA 4NGTA 2ZEPA 3ISXA 4F9VA 2PVVA 2Q51A 1Z5RA 5LRKA 1XJOA 1ZLHA 2IQ6A 3KGQA 2HB6A 4NGMA 6CPAA 2EK8A 3FECA 3PBEA 3H8EA 3IIBA 1FT7A 4P6YA 3FJUA 1CBXA 1QMUA 3LWUA 2OOTA 1LANA 3TX8A 3D68A 4JZ0A 3H8GA 3JRUA 3T8WA 4OMEA 3BI0A 4UEZA 4OIDA 2GU2A 1CPXA 4FUUA 5F09A 3B2YA 5LRJA 2V8VA 1AYEA 3B35A 1CPSA 3KI9A 4OC2A 1LFWA 4ONWA 4FAIA 2AFMA 2EWBA 3PFOA 2PE3A 2C1CA 2BO9A 4EMEA 2AFWA 4ZY2A 3KR5A 2EK9A 3D66A 4TWEA 1HEEA 1RTQA 3VH9A 4A38A 3HLPA 3B3CA 1IGBA 2ANPA 4NGQA 3KQZA 1F2PA 4RUHA 5D29A 4MCSA 4P45A 4UF4A 3S9LA 1UWYA 2PJCA 4NGRA 2PJ9A 3KQXA 3IEHA 4ZX9A 1GYTA 5D8NA 1VIXA 3SJGA 2AFZA 4PXBA 3B7IA 3NH5A 5HVGA 4IK2A 1R43A 2PVWA 3IJ3A 5LRGA 4EFDA 2NSMA 4OP4A 1F2OA 1ELLP 3PBBA 4R8FA 3NA6A 3D7HA 4TNUA 5LYFA 4P44A 5JM6A 2PJ5A 1CP7A 3K2KA 4P10A 4OIWA 4YWYA 2GLFA 1VHOA 2PRQA 3BI1A 2ZEOA 3IFEA 4ZY1A 5LYDA 3PB4X 1FNOA 4WWVA 2ZOFA 2AFXA 4OC1A 4OC5A 1ZG9A 2PIYA 1CX8A 1YLOA 1XBUA 1TF9A 3ISZA 1VHEA 3D4UA 3D7FA 1TKHA 4GM5A 1BPNA 2PJ3A 3SI0A 4ZI6A 2C6PA 3KL9A 3MRUA 4NGNA 4OC4A 5JH9A 5HVHA 4DYOA 1HDQA 3B3WA 4OC3A 4FWUA 4X2TA 3S9NA 3DGVA 4DJLA 1VGYA 2I3CA 3WC7A 1BPMA 2PJ8A 3PB7X 4MHPA 2QVPA 1AMPA 1QQ9A 4JYWA 2QYVA 3GLJA 4PXDA 2F8HA 3VATA 5I4MA 3NH8A 2VL1A 2AFOA 1PYTB 4ZYQA 3L2NA 2ZENA 1CG2A 3RAMA 4P4FA 3SI1A 2HC9A 1ELMP 4O23A 2JEWA 3SJXA 2WYRA 4ZY0A 3PB9X 4H2KA 3D7GA 3IC1A 2C6GA 2OR4A 2O53A 4UEEA 3N5FA 4PXCA 1OBRA 4X8IA 3CDXA
chains in the Genus database with same CATH superfamily
5A76A 1XERA 4QWDA 1A2ZA 1DE4C 3MR3A 1U1NA 1YG0A 2DNGA 1QAJA 4NEYA 3KK2B 4XPDB 2LLZA 3PDNA 4J9OA 2PSWA 1RT2A 4X64J 4AQYF 1FJGF 3M2UB 3SQGB 4A4JA 3QJJA 3FX6A 5I3UB 2HEKA 3M9MB 4OZ5A 2DGQA 1KTQA 3FBFA 1OO0B 4C0OC 3D28A 1I51B 1V3RA 4AXJA 4B3RF 1S7KA 2X1FA 1X4BA 4NCGA 4KFBB 3Q86A 1X5OA 2RF2B 2WONA 2BL1A 4EEYA 5MAOA 4LF1A 3QT5A 4JV5F 2NYHA 1D8ZA 4RNFA 3J7A1 3I0RA 4HI1A 2PI5A 1JLCA 5DZ7A 2IA6A 2ZC3A 2QX0A 1VQSA 1D9FA 2ILYA 1JIHA 2YNGB 1ZTTA 4EVYA 5HP1B 4I49A 3TW0A 1JKHB 4UTGA 5C42A 4A8FA 4JI7F 3C19A 3IAM9 3MEGA 5JMNA 2DXDA 1HWJA 1KKHA 3MM7B 3AHPA 4BLGA 3VALA 1Y9WA 2R8JA 4X4NA 1K47A 3VAKA 2DVIA 3AY0A 5KTCA 2B9XA 3H2VE 4EMDA 2HZAA 1QLNA 3EXYA 4HH0A 3BN7A 4Z2XA 2H65B 2ADBA 2EEYA 3BYRA 2LA6A 1Z8WA 1RABB 3G86A 2E66A 1H98A 4DQRA 1TKZA 2CADA 4M5DB 5HSPA 2MKHA 3VQSA 2EG1A 2VIHA 1SQGA 1H8LA 3GCXP 2Z3MA 4O3NA 3M4XA 3PYGA 2CPYA 2ZW7A 2MHEA 2H3EB 2V8DA 1S76D 5E41A 4RNMA 2ZW6A 1URNA 3SCIE 4DCPB 3N6NA 1JLQA 4L3NA 3N0VA 4PG4A 1EIYB 2R3VA 2RKIB 4WFNQ 4DL4A 2AJFE 3VARA 4LFBJ 1Y7RA 1KEKA 5E2QA 2QLWA 3MMCA 1ZG8A 1X4EA 4FN5A 1PYOB 4YS2A 3QNVA 3G6YA 1M5HA 4Z65A 2IHR1 2XMUA 3D67A 1GMWA 1LWFB 3HD1A 4GMKA 3E01B 2MJNA 3UQSA 5JXSA 4O3SA 2V69A 2OLWA 1VK8A 2RVJA 4CP5A 2XCPA 4F9VA 1XE4A 1TQLA 3U1NA 3ZJ0A 3DC2A 3R9LA 3NS7B 1R0CB 3V81B 1I94F 4ER8A 3DYAB 1DLOA 3PJ9A 1M4GA 1JX4A 1KUYA 5ISVA 4LFCJ 2YWFA 4ECQA 4E8OA 2PMHA 2EPIA 5DRKA 2W1BA 3TE4A 3KMQA 2QE5A 4HEA9 1YI2S 1XOVA 4KVME 3KLHA 2D69A 4FUUA 1S7HA 4IR9A 4RBUA 2VICA 2AF6A 2R2RA 4HDGA 4WYLA 3MUTP 3EZUA 1IJFB 2K3KA 3KR5A 1X5PA 2XS7A 1SIWB 2DH9A 2OD4A 1HNWJ 4LREA 4B3SF 1WDTA 4L76A 1N5YA 3J80U 2WVDA 3K2YA 1WKJA 4NLGA 2MPUA 1LEOA 1Y9OA 4OZ3A 2ABYA 5D8NA 3CXSA 5IV3A 1M1KT 1VR6A 3PR4A 2XMTA 4DF8A 2X3DA 2DGXA 1E6YB 1F2OA 1UKUA 2MLYA 1J5EJ 2QTWA 3I96A 3RR7A 5KG6A 2GFQA 3WBZA 2GX8A 2HMIA 4DR2J 3T1HJ 3VGVA 2G3TA 1Y5IB 2GJ2A 4OC1A 2ATLA 4NLUA 4LBHA 3GYAA 3DU6A 3M32A 3CVKA 4HT5A 4NZ7A 1DBDA 5JQ4A 1VBYA 2V0NA 2C6PA 2PEHA 3W2WA 2YGWA 3O1LA 4DQSA 1HDQA 1KR4A 3RU0A 1F2GA 2M7SA 1EETA 5AG6A 3PIPQ 1T0TV 5CCLA 2A0FB 6FDRA 3C8YA 4X4VA 1HNVA 1Z8TA 1SH2A 2ERRA 1JK9B 1P9QC 1BOBA 3SJXA 4BWMA 2R7TA 4RZRA 4UEEA 2W25A 1X4CA 3VV2B 2ZKTA 2C3OA 2G2ZA 3V4IA 1NSAA 2O01C 2XLIA 1BC6A 4OZNA 3JYTA 2L48A 3EX7B 2EC0A 3MEDA 4B9NA 3RRGA 1EJ7L 2VDHA 4P4EA 3P8BB 4B3OA 1HLWA 4KKOA 3MECA 2CJXB 2QA1A 4QWEA 3SI8A 4LUBA 6FD1A 3FEDA 3M05A 1T9XA 4LBIA 1FXRA 4ZVRB 1J4JA 1RWUA 4KOUA 1ZZNA 5KT3A 2DNQA 1I3OB 4JI5J 3DM2B 5BJRA 5EHHA 1HWUA 3H5YA 4MFQA 2QSWA 1J2VA 4KJIA 5THWA 1TU0B 5KT5A 4XPKA 2XI3A 4LFAF 5I42A 4FYXB 3BH7B 4OI2A 1EHWA 2HVIA 2ZUAA 1PGZA 4FYWB 2XWXA 3PB8X 2CNKB 7FDRA 3OHBA 2ASDA 4EU0A 1FTCA 1SC6A 3U27A 3OFFA 3MMBB 1IWGA 1U6MA 4C3MA 4WP9A 3RGIA 2RQMA 4JI8J 4DSLA 1Y9KA 4DPUA 1HPZB 3CJ3A 1QSSA 2OAUA 4HDHA 2YXLA 4CAWA 3M2VA 5B0EA 3H4BA 5I0CA 4K4ZA 2FQQB 5E7OB 4ID5A 1RHJB 4IH5A 2RH3A 1V6HA 4ED2A 5ELYA 4P7TA 1FKOB 3WC0A 1MROA 2C3MA 2X3GA 3D1HA 3J81Y 1YW4A 5F8NA 2DCLA 2Y1JA 3DLKA 4IOCQ 4X2BA 1RBLA 3KLGA 1U1OA 1IKXB 1FERA 4DR4J 4PG6A 3GP9A 4HH1A 2HURA 4P74A 3I1UA 1X4AA 1RADB 4NGSA 2ZUGA 2GVDB 3MR6A 4EZ9A 2WHOA 4AXIA 3CJ2A 4OMFG 2COLA 1O0PA 4R25A 3U1MA 4C2YA 3BGUA 1XMOF 4C8NA 4NMXA 1YLEA 2XGQA 1VQOS 2W7PA 2AGPA 4RW8B 3NNHA 4LSNB 1IQTA 1Z8LA 2ZEHA 1A9NB 5J1PA 4DV3F 4HKFA 1RKIA 3A13A 3CC4S 1NB7A 4IRDA 3Q8RB 4I4BA 3H8YA 4LF9F 2JVRA 2FPHX 3MGDA 3KHRA 5KOWA 2ZW5A 4KOTA 2XC9A 1OYEA 2IQ6A 3RBDA 1CEZA 4Y49B 2OELA 3FECA 5D8HB 1RA7A 3FBEA 1RWMB 4P6YA 2VKZG 1LANA 2GO9A 4USVA 3C6TB 2BRKA 2HRUA 2F40A 2IPOB 4RUAA 1YJ9S 3E51A 3CZXA 1LKZA 4UOFA 4A8WA 4NZ6A 2VFRA 2RC4A 5HK4A 4DPWA 1WC6A 5D3GB 4IKAA 4ICLB 1VQ4S 3HHLC 4OYMA 4EMEA 2AFWA 4U8VA 4MFBB 3KUEA 3JB9k 3NOCA 3KWMA 1S4FA 2AKWB 1B70B 3SCJE 2KM8C 1RT3B 4DS5A 2GGPB 4F0HA 3UWTA 4JV2A 4K4WA 5KFEA 3FEXB 3S9LA 2M3DA 1C2PA 3W5YA 2ROPA 1U1RA 4O44A 4NX9A 4PG5A 2PT0A 5HATA 1OIAA 3AA9A 5AE3A 3OW2R 1WEZA 4O0NA 1XMTA 4OLPA 4EYHB 5ETQA 4ZGYB 3LAKA 4M8LA 5KG1A 3GFXA 5K14A 3PBBA 4TNUA 1Q95G 2ASJA 3BSCA 1T9VA 4X65J 3F73A 1HQEB 2XZDB 5J2PA 4LF4J 4YDXA 5LMUF 3K2KA 2UXBF 2ODFA 3FJ2A 5HAOA 2NXUA 4YWYA 1R31A 2HHWA 1WHWA 4ZLLA 2PRQA 4Y6IA 3NBPA 2B3UA 2OPRB 4KV8B 5C2CA 3G71S 1UTAA 5CXTA 2CAJA 2VOOA 4X4UA 3H59A 4FP9A 2FVRA 5RUBA 2QA4G 2J6TA 3TRGA 3TP2A 1U1KA 3CTRA 2UVVA 1YVFA 4FVCA 4QPXA 4ZCIA 4DR3F 3BB5A 1L3UA 3CDAA 3TYTA 3DR6A 1UEVA 4JV1A 3OFHA 1N4LA 2G13A 5LL6d 3QNWB 3H4DA 2F8HA 4OYPA 1KOHA 2DITA 5KG3A 4J9MA 4CLKA 1S0OA 2ZH4A 1SV5B 4JYAJ 1TKXB 2EBJA 3IU1A 2H4YB 2IM0A 2R42A 3BGRA 1F1BB 1FRJA 1JLAB 1XIQA 1YLXA 1ZPWX 1ELOA 1HBOA 4DUZF 3R5CA 2B6AB 1LV5A 4DV6J 3UR0A 1H7XA 2ABZA 2KL8A 2XULA 4U5YA 2DGVA 2MXYA 2AJ6A 5D4PA 4P2FA 3PJXA 2F4VJ 2K1RB 2ZZTA 4WYWA 2CQBA 5K20B 4R76A 3EICA 1VQ8S 3OHAA 3S1TA 4WKRA 5FLXY 1LWEB 2XS2A 4P4IA 2V8HA 5I3QA 5J8CA 1M0SA 3R95A 1TL4A 2V2VA 1X4HA 5HN0A 1RZMA 1TKJA 4P4JA 3KR4A 4LIRA 1WSVA 2IMOA 4TQRA 4AXVA 1U2RA 5H86A 3A3NB 4F4WA 3D6MB 4DV1F 3BKFA 1CJUB 1CS4A 2AZ1A 3JQMA 3FDSA 4CH1A 5A8RB 4B3MF 4G1PA 2KZMA 4OJ3A 2M9KA 3T9NA 3NS6A 1NB2A 5K8OA 1SJ4P 2ZJQQ 4HVZA 4WIIA 1NO8A 2QN6B 3MCSA 3THTA 4ED5A 2E1PA 4C8LA 2XCAA 1Q79A 4M94A 2AFSA 2HHTA 4RL1A 2U2FA 1YJVA 1S6QA 2GFFA 4HACB 2W4CA 2KFNA 2R98A 2WOMA 1NHKL 2V2ZA 2CTCA 2NXNA 2UU9F 1RE1B 4KSEB 3DHWC 3C3LA 3R1LA 3LW5C 3TZXA 3FFIB 3GJTB 1IKVA 3OJUA 4NLQA 2Q04A 1JLGB 4DI6A 4V19X 3D7DA 2W9BB 2OPPB 2V68A 2VUGA 2A2DA 3K5OA 4OI4A 3OTDA 2HNDB 2FTRA 3W9IA 1R8AA 4MTPA 1PBUA 4K4VA 4IFYA 2YX4A 3I9SA 3TZWA 1CP6A 5SUHA 2GV1A 3P5BP 2VJUA 4NI2B 3M8SA 1U1MA 4QCLA 2HYIB 3VZIA 5F8MA 4TU8A 1KWMA 1FHTA 5ETKA 2L9NA 4PSXA 4KPYA 4ZKAA 3TO9A 1M4IA 5MLCV 1RACB 1Z2LA 2Y0MA 1U0SA 4A39A 3EVMA 1S7LA 5ETRA 1NAQA 1SL1A 1FRXA 5EX0A 3HUVA 2ZD1A 1F57A 3B78A 4A94A 3VF0B 3TJ8A 1NZAA 4J91A 3VGTA 2B4VA 4OLLA 1GXLA 2LA4A 5CPAA 3I6PA 4A46A 4PWWA 4QIEA 3SCLE 3PY8A 5KFHA 4NGTA 4LF8F 3BDEA 3HLUA 1CJTA 1S1TB 1IKYB 1XJOA 2FY1A 1GTHA 2GVZB 2BZ2A 3PBEA 1TKTA 3IS9A 4FD5A 2FJAB 3HSGA 2XEXA 3T5HA 1N71A 2V4JB 5CZVA 5J2QB 1OSCA 3PZJA 3K5MA 2A6MA 4DR6J 2CQIA 1MWQA 4ZS6A 4F4AA 1RYSA 1S4EA 2Z56B 4A47A 3QGHA 1UVLA 1LFWA 2JNJA 5GAHI 2XB2D 4I67A 3PFOA 2C1CA 2M70A 2RAQA 4ZY2A 3FB3A 3RTVA 3K5NA 4Z7YA 1QTNB 2ZH9A 4CYUB 2B3TB 1FFSB 3K0JA 4KUBA 2H4WB 3W61A 4K4YA 3QGIA 2KVQE 3WIVA 4WZQA 2V8PA 3VTIA 1NK0A 2B5JA 2UUWA 2RS8A 5DZ6A 5C5JA 3JSMA 5AG7A 1UZDA 4OHYA 2DNNA 3DDIA 2MZRA 4UZBA 2DY9A 2W9CB 1RTJB 2OUGA 1NRKA 1S1VB 2GZOA 1NJYA 4MKVA 3VWEA 2OPSA 2F8MA 4FD4A 4AVAA 4JI4J 1RSCA 3UI3A 2GJFA 3CF5Q 4AVBA 1FNMA 3AOBA 3MM5B 5AXNA 4IO1A 3FZBA 2XNRA 4KH0B 1R7IA 1FESA 4ATNA 5LYDA 4DSKA 1BQMB 3NG8A 4ZITA 4DF4A 3VR1A 1TF9A 3NGTA 1FJCA 1N33J 1MMDA 4ITSA 1PU9A 5D4OA 3MAAB 1BQNA 1EQMA 3SI0A 3B6BA 2F4FA 3T1HF 1OQ3A 3P96A 4YB5A 2R2TA 5KFGA 4DG1B 5KFBA 4NSQA 3LGMA 4DCOB 3WC7A 4DLEA 2PRBA 3VAJA 2JC0A 3JQKA 4X62F 5GAGI 1LW2A 1DQAA 3CPWR 4H6UA 4K59A 3T5KA 4U96A 2QIFA 5LOQA 3QMQA 2EO8A 2BV3A 5FDLB 5J8FA 2BKOA 1PKUA 4DZ6A 4CTAA 3PYFA 2N3OA 2ACMA 1IR1A 2Z2LA 4CLYA 2Q3PA 3W65A 1JWWA 1Q2CA 2WPWA 3QQCD 3ILJA 3VAHA 1QTMA 3PO4A 3TARA 2HQFA 2ATRA 1NU4A 2RE1A 4DHVA 3DNSA 2HGMA 3V6DB 5E5NA 2NMTA 3P5TL 2C28A 4Y34A 3FIXA 2Q7SA 3W5ZA 4K4XA 4F2SA 1RCXB 4E0AA 5G1ZA 1DURA 2N4DA 4U8YA 3B4DA 4NRTA 2QA4S 1R89A 4NXYA 4E98A 4PG8A 4TY9A 2KO1A 4LQGA 1VQPS 1WC0A 1S6OA 3K57A 4IH6A 2UUAJ 4FD6A 4R7MA 4Q7AA 1FRKA 4LQ6A 3M1VB 2DH8A 2VV5A 3DLGB 1ACMB 3CEDA 3GTYX 3DSBA 2O3DA 4KIAA 4A37A 2IVMA 1B64A 4X4OA 1U25A 4JI5F 4PQAA 1NCLA 1G2EA 5B0DA 1XWLA 2F3JA 5DS0A 1ZLIA 2HFSA 1S1UA 3U1LA 4A8QA 3MFHA 3QT8A 2OPQA 2KHDA 3IO1A 3GUXA 2DHAA 4NRUA 4RW9B 3DR8A 1T9UA 4M5LA 2CQ2A 5HL7Q 1XEBA 1BD6A 3KJNB 1IWAA 4F67A 5A0YB 3NGUA 3QAEA 2N7YA 4MCQA 1EP4A 5KG4A 4EBEA 2HAIA 4ILLA 5C25A 2PI4A 5L1LA 4U7CA 5A6WA 1KQSR 2JVOA 2HBRB 3K5PA 3J81U 1HBUA 3H20A 1X0PA 3CW2C 2DNOA 1HDUA 1N6QB 3CJ4A 3P4UB 1CLFA 2I2YA 3H8FA 2BCOA 4WFXA 1X7VA 4LSZB 2AD9A 2B56A 5ETTA 3SQOP 2XS5A 3DGPA 4F2RA 3V7ZA 2DR6A 2LQBA 1AZSA 3U02A 1RT5B 3TAMB 5A28A 1IM4A 1G6BA 4ORFA 2XEIA 4DR4F 2I1RA 1KUVA 4PQUB 2O5DA 1YKWA 2FC8A 1SQEA 3GSIA 3ENWA 2ALZA 4OIXA 1SJ1A 1XK8A 3M2RB 3PFEA 2FJEB 4KOXA 2EBGA 3WC5A 1SH3A 4ZPCA 2JBKA 1RTIB 3V6JA 3NRBA 2RIJA 2MGZA 3GIMA 2WVEA 3RBUA 1RWOB 3CJRA 4GS4A 1NK9A 2WSCC 3H7HB 2H1YA 3S6EA 2Q0YA 2B4OA 1WELA 2HBQB 2M4MA 2XWYA 3LALA 3LO3A 2XSJA 2YNIA 5HO4A 5F0WA 1Q81T 4J9UE 5K5MA 2H5EA 4LF7J 3TA1A 3EC4A 1KVKA 4J5OA 4NWBA 4L89A 1KLNA 3K58A 2YKMA 2J9DA 4DNCA 2ADCA 1MU2A 1SBRA 3OTCA 4CCHA 2FLOA 4H54A 3LODA 3SXNA 1FXDA 4U9RA 4LMZA 1HHSA 2HLTA 1DZ5A 1N5VA 2L41A 2G1HA 4QUSA 1SJ3P 1AB8A 5LRJA 2VDIA 2FJDB 4UZCA 1C0TB 2CDRB 4PR6A 1GFWB 2KXNB 1X31C 3MEEB 2J9EA 1PG5B 3EPIA 3QIPA 1IBKJ 2N4CA 3J7YU 2W8LA 1VRTB 1R0BG 2FJBB 3O6QA 4M5JA 3GIUA 2QLXA 1SCJB 3UDVA 3G3SA 1UCNA 4ZDNA 2UUCJ 2A1BA 3A12A 2WSFC 3A1YG 4BS2A 2JHEA 1T03A 2HZVA 3CCMS 2Y8WA 2E44A 1XN9A 3QO9B 3DOMA 3FBUA 3HSZA 1VQ9S 2FB0A 3NH5A 3HVWA 1TAUA 3KLFB 5F41A 3HVTA 1N36J 1P4NA 3TOAA 3MR2A 1I6JA 4L72B 4L3KA 5LYFA 1QDUB 4AYBD 1TL5A 4CS0B 3H40A 4DUYF 1CP7A 3EY5A 4DSEA 1K9MT 3TEHB 4KR0B 2ZH5A 3KDOA 4MY3A 2VFVA 4OJHA 5H9EJ 2ZOFA 4WKYA 1YLOA 4LF4F 3C14B 1S9GA 4BC7A 1YRUA 1YR0A 4HLBA 1XR6A 4KHPJ 3EGZA 1TL7B 2MZSA 2ACYA 4DX5A 1S5KA 3Q8QB 5G0RA 2DNPA 1RTHB 1YBTA 4UFVA 4FPRA 2DHHA 1U09A 1QE1A 2B43A 4JI0F 3VATA 1TL3B 3M7VA 1QUVA 4ECRA 1CG2A 1U0HA 5A8WA 1BXNA 5A8KB 4NEZA 3CDWA 4F26A 4C68A 4NEXA 3VVTA 4PK2A 2BOPA 4FNHA 4HHJA 4DFMA 4F0KA 2YWEA 1YSJA 5F8IA 2DHXA 4J7CA 1XMQJ 2R7RA 4MT1A 3RBEA 2V50A 2CF4A 3FRMA 3ZZTA 4NLPA 5A2QY 2MKJA 2RB7A 4FBTA 2YKAA 1S1XA 4QC6A 4J90A 3KHXA 3NKYA 2ZEJA 3CCQS 4RS2A 1RAEB 1S72S 5F8LA 4MHZA 4DUTA 4WE1B 2WZNA 3FVLA 3KKWA 1H74A 4CZCA 1CULA 4NPOA 4GKJF 4OHVA 2QFJA 2CYYA 5EX3A 2E1CA 4DU8A 4DV6F 1SPBP 3LGHA 3BO4A 1QUPA 2BUEA 3AXKA 2BSWA 3TC8A 1F5AA 1IYKA 2WVCA 4CO5A 2Z3OA 1HI0P 3N5BA 4QJVA 2JEVA 2HHPA 2BM0A 4K3NA 1FX4A 2F65A 1TFYA 1MSWD 2EXUA 2UV8G 1CJKB 4J9PA 1IKWB 2Z0ZA 2FVQA 2FIAA 3SI2A 8CPAA 4UW2A 5CYQB 2IM1A 3L7OA 4B08A 2KZZA 4MHDA 5IT9Y 4XDCA 3TR5A 1BMQB 2NS1B 2QA2A 2BE7D 3D0HE 1WI8A 1RWVB 4YQWA 2A6OA 1NJXA 2EKNA 3OR2B 4X4SA 4NYZA 2I0XA 2GO8A 1LNQA 4M5MA 2W2QP 1M5PC 1N32J 3PHTA 5IB9A 1TXRA 3TCVA 4MY0A 2UXCF 3KOAA 3IMQJ 2E9TA 3IWLA 2UUTA 1RAGB 2C2EA 3K9UA 4BBHA 4Y2MA 2GHWA 2UUBJ 4NCBA 2B8PA 1PCAA 3QLHB 2XY6A 4UOCA 2HKEA 2BYCA 3E0KA 3SQGA 4ECTA 2J8MA 1MWZA 5I3UA 3EZ5A 2PIZA 2DTJA 2M5YA 2LXIA 2Q79A 5E0OA 2X7IA 2WB1D 1AT1B 1BAVA 5T41A 1UWBA 4IAVA 1VLYA 4UWIA 4C4WA 2IRYA 4XNHC 1XRYA 1UVJA 4OYIA 4OYWA 1Y3JA 2N7CA 3K17A 1O5JA 3T41A 4KFBA 4AT1B 1GK8A 3OR1A 1PIEA 1XR7A 2CPHA 2C2KB 3R5AA 1VC5A 3OWCA 5E3CA 2CA9A 1NJZA 5HMNA 3RO0A 2CPIA 3LP1A 4NF1A 5D15A 4C7IA 1KLMB 2FHOB 3CCRS 4OYAA 4DR1J 2OTJS 4DBQA 4PUOB 4UUXA 4ED4A 1YREA 4N47A 1IUJA 3CMES 4A33A 5T14A 4PYDA 2V9WA 2YTCA 1H73A 4HTIA 4QYZK 4PWUA 2O28A 3CXCR 1R57A 1X9MA 3OXLA 4FS2A 2VQEJ 4EYIB 1IQZA 1CPSA 3RW6A 4B5PA 1YJ7A 1YZ7A 4X4RA 4IR1A 2MSTA 2DXQA 4DL5A 1RTQA 3RG6A 2FXFA 5T7LB 2AGQA 3AH6A 4LQ3A 2MB0B 4JI1F 2BX6A 2HHUA 3SSRA 2K3IA 4NYOA 4JD6A 1DQ8A 1FJGJ 5KFPA 1PILA 2HHQA 3BKTA 1BHNA 3IGNA 2PJ9A 2W2PP 2ZPAA 4IFVB 4LIWA 2AZ3A 4EO6A 4V1Ak 4IK2A 2OHDA 4B3RJ 5LRGA 5FD1A 3G82A 1DTTA 3AB4B 4CIOA 2HAFA 1NHVA 3R5GA 4KHRA 3CD0A 4JV5J 1Y5NB 5HLFB 2OTLS 2ZNZA 4PK3A 2PDAA 3ZZIA 3Q2SC 1VHOA 1WWZA 2YQ3A 4IG0B 1HFEL 4OYXA 1RGVA 4R8UB 4JI4F 1RBAA 1FFGB 4GO5X 4HI2A 2VG6A 5IQQA 1ON0A 2BQUA 4PCQA 1R8CA 5KFDA 4JI7J 3TJ9A 3ZTQA 4LVOP 2AE6A 4PG7A 3MRUA 1B4SA 5BYQA 3I5BA 1N33F 4P2XA 3W91A 1VOMA 2FL4A 2DK2A 4NLOA 1IXKA 4HHHA 3LANA 4I2QA 4IDKB 3EPGA 3THVA 4CAEA 4I7FB 1F3FA 5JVGQ 1WEYA 4ZA1A 2MEWA 2EKYA 2Y1IA 2WYRA 4H2KA 2CVIA 2LQ5A 3BJ8A 2IBOA 1TZ0A 1SKSA 3HT3A 1JXEA 3CDXA 2JLMA 4OFZA 4ANEA 5CD4H 1RT2B 4OZLA 1UMJA 1WHVA 1JWQA 5IT0A 2GLJA 1ZAXA 3KZWA 1QAIA 2QYGA 1IU8A 1WC3A 1QSYA 2REEA 1ROFA 2BKNA 5GAEU 2V4RA 1NK6A 4ZPWR 3PTWA 1VC6A 4LR8A 2WRMA 3PRDA 5KT2A 4FNIA 5K8PA 2ZH3A 1BE4A 1HQUA 3HHLA 1RQ0A 3J7YI 1WG1A 2YNCC 3FEEA 4F7VA 4RBVA 3MURP 2DISA 2WONB 1HBMA 1TVRA 4ZCMA 2KTQA 3LA0A 2IDEA 1KOOA 2JEGA 4DX8H 4WZMA 3KJVA 3I0RB 1JLCB 3PO5A 4NGPA 3C15A 1C1BA 4H4MA 4FF1A 4B6ZA 3ZZ0A 5KG2A 3BQ0A 5EWFA 2CQPA 1I21A 5IWAF 1I94J 4QIFA 5EDWA 3SEOA 1Q4RA 1WF0A 5C42B 4ILRA 1KFDA 1XR5A 3MEGB 1N5SA 3M8ZA 3MWBA 3US5A 2XEFA 1N8RT 2HHXA 3P6YC 4ECVA 4LF5J 2KYZA 1F0XA 2MDAA 3O5TB 1YVOA 1FF2A 2YX7A 3ISND 4M5IA 4KY3A 1KSPA 2ZEDA 3G8TA 2IM2A 4OI1A 2RJZA 3NCRA 2E7WA 1B0VA 1NJWA 1QVGR 3D2WA 2XMWA 2CQHA 1TKZB 3HDSA 2GQCA 4B3SJ 4ES2A 1KDNA 2RT3A 3DNCA 1NKCA 1TL1A 3FUYA 4M95A 4MFLA 4RW4A 1MJBA 2DEAA 1SQFA 4PEOA 4UT4A 5ADZA 2VI7A 5CQGA 4KORA 3JQJA 2W7OA 5IZHA 4ELTA 2VBZA 4P52A 2HVZA 5KFWA 3CNQP 4ZX8A 2PJBA 1JLQB 4ZLPA 2XG8A 3QBCA 3OUYA 2W01A 1U1QA 4USHA 2K7KA 4ZVSB 2Z0GA 4PV6A 5HANA 4KVXA 1WNEA 1R8BA 2JH3A 3MMCB 2CZ4A 4BMHA 2Z3PA 2B0GA 5L46A 1OSDA 2PMZD 1NMTA 2GMJA 5AJ3J 2XO6A 4BDPA 5HI7A 3OLAA 2PJ1A 5LM7E 1UJ6A 1DTDA 3O44A 1VQMS 7CPAA 4DN9A 2Y0SD 3SFGA 5LSLA 1NSPA 1DLOB 2R7UA 1X10A 2LDIA 4RWXA 2CPZA 1VHFA 4JBCA 4EBDA 4R9MA 3IIBA 3IBWA 2PC6A 1Q7YT 3KLHB 3UPFA 3F0AA 2C2RA 3PVXA 3MCMA 3H8GA 4LF7F 3TI0A 3M8YA 2FGOA 3Q83A 2VA2A 4CLZA 4C8YA 4ZOSA 2RRAA 4QIVA 3UR3C 4ZJQA 2V8VA 1RTZA 2LYVA 1IICA 4FAIA 1IN0A 2RHQB 1QSLA 5D78A 1TELA 3GIRA 2YPYA 4C3LA 3D9BA 1JLBA 2MZ1A 1N5YB 1EX8A 3RBXA 2ZHOA 2CIMA 1NK4A 4ZVEA 1VRUA 1S6PA 3ZC4A 2VEZA 2CQ1A 4WP8A 1VDHA 4BBYA 3KQXA 5CHCB 2UUCF 1OZPA 3UD5A 2HS3A 2YNFA 4Y0FA 2CG4A 4OP4A 1TIQA 2BW2A 3I5AA 3MPVA 2GNKA 1P27B 3RNZA 2ZHAA 4XIUA 5KFVA 2HMIB 3FSXA 1AUDA 5J2MA 1RI7A 3LTOA 1N36F 4F4ZA 1FWKA 3M32B 3LP2A 4LFAJ 2HPUA 2R7SA 3ZZUA 3TAPA 3N7ZA 3GFHA 1JJ4A 3CMAS 1H0HB 3W2WB 1H3DA 5IC6B 2GA7A 2JJ4D 3HJVA 1X5SA 4UY85 1LW0A 3ZZZA 3SV3A 1EETB 3LWLA 1O51A 1GXUA 3EXCX 1YJNS 2VQYA 2DGSA 5ETLA 3MXHP 4FPIA 4CT8A 1ZM2A 5B7WA 2DNRA 1H7WA 3OPKA 3C6TA 4B3TF 3DI6A 4ZYQA 3G6ES 4C8KA 2ZWPA 3L2NA 1K4JA 4MH8A 1T95A 5DLFA 3PV8A 2OP5A 4O23A 5CNPA 4ZY0A 3V4IB 1IBCB 2BXJA 5A2QU 2YWWA 2ZBIA 4PXCA 3JYTB 4GC7A 3MEDB 2CFXA 2V4QA 3W7BA 2VHGA 3KK1A 2GGPA 4F25A 3QWPA 3GJSB 4B3OB 1NLKL 4KKOB 3MECB 4CAFA 5DG8A 3WDOA 2XZTB 4Y2AA 5J1QA 1KFSA 5M2PA 3S6HA 4M6HA 2I9SA 2PJ0A 2V77A 5L8RC 2H51B 2ZM6F 3QPIA 4QU7A 1UFHA 5K8MA 2ZDPA 2DGTA 1NEEA 4BD9A 1LK5A 4DPXA 4E0DA 3ILOA 2F7VA 1WEXA 5KT6A 1X8DA 4FDFA 4NXNJ 4ZVPB 3QFWA 3G96A 4DV3J 1XMBA 5EWGA 3CC7S 4IOAQ 1SC3B 2GIQA 1UVKA 2IDLA 2Z10A 5I42B 4P4DA 1KQKA 3HT0A 3WQPA 3T6BA 5DQHA 1TP7A 1NJIT 2CRLA 1T94A 4MMOA 5IT9U 2PCUA 2IY5B 4CRYB 1REGX 1TUGB 2GMLA 4UBRA 4USJC 4DN0A 2ZZNA 4DX6A 5IV4A 4AG7A 3BSNA 3Q8SB 2RILA 1UVNA 5J1EA 1XFOA 4YR0A 4IRKA 4CWBA 2GAGC 4P2SA 2NUUG 4J37A 2CWXA 2VC1A 4U95A 7FD1A 2GE3A 3M2VB 4WTOB 2NR0A 3W2VA 4ID5B 1YK9A 4R57A 2KVIA 1X4FA 1GX6A 1U45A 1MROB 1ARLA 3IBCB 3UN3A 3W8PA 1FK9B 3GR1A 4CRZB 3D0IE 3DLKB 4RWWA 1N32F 3CCVS 4DLGA 3SJEA 5BXIA 2I8EA 1U8SA 4EGLA 4KOYA 2CNTA 1ULRA 1M90T 4ZCLA 4J3GA 4A2ZA 4TQSA 2WUUA 4WFYA 1OWXA 1WDDA 2CPDA 2VPWB 2R2SA 2ZEFA 2AYEA 3SXLA 4NA1A 1S48A 4CO0A 2R7HA 4DFKA 2ZNYA 3BGOP 2PIIA 1I1GA 5ITHA 2CJBA 1P0HA 3GYNA 2R9LA 3A8KA 1YHQS 1OS5A 4L75A 5LMUJ 2UXBJ 1M5OC 3T19A 2XEGA 2BJ8A 4O4GA 2XHCA 4D3HA 4E2AA 4P72A 1S0VA 4W4MA 1C4CA 3IBFB 5GAEI 2G0JA 3MI7X 3ULHA 5DM7Q 2EFNA 1S9EA 2DXEA 2LEAA 1K73T 3P49B 4NZ0A 2QMUB 5HBMB 2IBKA 2PVVA 2Y0BB 2YWGA 1M44A 2XY7A 1Q78A 1ZLHA 1GAOA 3M8PA 3W9JA 3J7AN 2IL4A 2BA9A 2QIRA 1S7FA 4O3RA 1QMUA 1IIDA 2OOTA 2B4PA 1KONA 1UA0A 4TU7A 4GKKF 1KUXA 5DS7A 4DR1F 2KN4A 1B87A 5F0UA 2P0WA 2JOQA 4I6AA 1YJWS 1GQEA 1YZ6A 2HSEB 1JLGA 4ZVGA 4DSFA 3RB4A 4NXMF 2B9WA 1Q1KA 3D66A 2OPPA 2HFOA 2VQEF 2CZ9A 4KH1B 1U4BA 5CCMA 4CGLA 1HYSA 4W98A 2RU3A 4O44B 4AFFA 4U9ZA 2BDPA 4JV0A 4N41A 1UJ4A 3IEHA 1PSDA 4J9VA 2E5IA 5F3ZA 1U6FA 2JRSA 5K14B 2ZJRQ 2OD6A 3BS9A 1U49A 3B7IA 1YDLA 5LXYA 3T1YF 3AXMA 4K2JA 2BANA 1Q16B 4YGOA 4UUWA 4U6PA 5J2PB 3TOBA 2CPJA 4ZN1A 3G8SA 4DV1J 2IRXA 3WIUA 4KGMA 3PP9A 3TO7A 5JM6A 2HS0A 3CO9A 4B3MJ 1NDLA 4ZBGA 4KAIA 4Y65A 4CYNA 3CSKA 3NGRA 1TFWA 2AFXA 2AW0A 4U9YA 4OC5A 1DHMA 2CDQA 1S6UA 4DQPA 3DRRA 2KJVA 2M8HA 2E9ZA 2O66A 4RN7A 1WC4A 4IG3A 2VFTA 1UEUA 2ATCB 2VPYB 4GVBA 2D7SA 3QFHA 1IKYA 2FVCA 3KG1A 1RISA 4MKYA 3WX8A 4NGNA 1E6VA 1S57A 2XYGB 2QL5B 2UU9J 3AD8C 5I3PA 4LT6A 3B3WA 1WC1A 3R6GB 4RLEA 3H2UB 4I6YA 1VGYA 3CD5A 4EBCA 2GS8A 4F8RA 2PJ8A 3PB7X 3T9YA 1JLFB 4B5OA 4MJKA 1U26A 3KFWX 3OTBA 2HNYB 3W6SA 3D3BJ 5H9FJ 2HK3A 2AFOA 3DRXA 3LQVA 1XIXA 3K7RA 1RWNB 3SI1A 5LXRA 3BGRB 4CAVA 3IR6B 3WZ0A 1PYTA 2HHHJ 1TR0A 4JUZA 5LSRA 3E2EA 3A3PB 2O53A 2KRRA 1T7PA 1HBOB 1UEKA 3JTNA 4WFZA 5DG7A 3W3SA 1HR0J 1AUGA 3ZNJ1 2Q1LA 4N8NA 4C7QA 1PAEX 4OHXA 3ZNUA 2OH2A 1JLEA 1OQ6A 5FIIA 1KHWA 3BBBA 2DNZA 3SYZA 1TK8A 4CLUA 3G9CA 2DPTA 2CJAA 1PBAA 3C16A 3SFUA 1KBRA 4I68A 2FHJA 3RYLA 3DDNA 2ZEGA 2R1IA 3SMZA 3RAQA 1MK4A 1CS4B 2H5MA 2WTFA 4P4BA 2QYCA 1FDBA 1S9FA 3CPXA 1IM6A 1ZTWA 2UXDF 2G9DA 4LF8J 1U7LA 3QIDA 1F2HA 1Y7EA 1UZHA 8ATCB 1Q7LA 3HFKA 5IOLA 2BQ3A 4NCZA 4MFZA 4J9KA 4P71A 2HIQA 2YVSA 4CGMA 5H9EK 2FYXA 2D41A 2BJ1A 1S6QB 2VG7A 1LOUA 4MYTA 4MHYA 4A31A 2NQPA 4TXSA 2WOMB 2DRBA 2IM3A 5KAKA 4I56A 4GVLA 4KUAA 4V19J 3GV5B 2HQ3A 2GW8A 5IM0A 3BSAA 1IKVB 1CJVA 2J8AA 1TTHB 2V2KA 2ZVIA 1AA1B 3L7PA 4JI3F 1VJWA 4LR7A 5LJ3Y 2M88A 4LF5F 2BM1A 3EJMA 2R2UA 2DD8S 5FDLA 1A6LA 3V38A 3HVAA 2Z2MA 4QB9A 4IFYB 2AYMA 1WTFA 3NCPA 3KASA 2P2CB 5CZXA 3QRQA 1VFJA 1K1QA 3ITHA 4ZVUB 3QAHA 4C98A 1XNRJ 1WACA 4A32A 1F9EB 2MQ8A 1Q86T 1Q2DA 1B7FA 4PSWA 3MZIA 3SXOA 1VC0A 3RR8A 4X66F 3UFCX 1FE4A 4AVCA 2LP4A 4ZPDA 1OMSA 1Q8BA 2VC0A 3DOKB 2ZD1B 5ETMA 1R0AA 4Q5VA 1VBXA 5F49A 4OZJA 4J9SA 4HNWB 1RT1A 1QSTA 3TX0A 1Y5LB 3HM9A 2F9JA 5CABA 2IAJA 5CYMA 1ZM3A 2PD1A 2CIJA 1DQ9A 5IFMA 2MSSA 2K8GA 3SCKE 4QBUA 4DPOA 3M8QA 5JGFA 1CJTB 2AJQA 3M1VA 4CM0A 1WHXA 2HW3A 1RLCL 4LX9A 2G2OA 2A3JA 5AJ3F 1V0CA 3IS9B 1WI6A 3GFYA 2VBXA 3SDEA 2HB6A 2DPJA 1Q5YA 3CXQA 2DNLA 3B8GA 3PACA 4X62J 2RRNA 1B6BA 1UETA 4H4KA 4HPSA 1K1SA 4DV0F 4CNZA 4WCEQ 1PJ5A 2B4DB 3JXOA 3OTOF 1FT8A 4ZJLA 3CJKA 2J0QD 3HHNB 2V6AA 4FYYB 1D8YA 4XPDC 1VI7A 1J5OA 3B35A 1MW7A 4ONWA 4ED1A 3C6UA 1Z2ZA 3DLEA 2R7XA 4URGA 1HKAA 1HEEA 2QFIA 2IA0A 2RMLA 1ZO0A 3NGDA 4M6IA 2B5JB 4EZ6A 4I6WA 2RQKA 4RUHA 2KKHA 3E3XA 2QMLA 3I56S 3FZ2A 3AJDA 3JSMB 3UDLA 5A27A 1UWYA 4NGRA 2GC8A 2ZHBA 1GHEA 2WSAA 3UVJB 2M2BA 4Q0BA 4UA3A 3BPSP 4QPTA 3MM9A 1AXQA 1CJWA 1MN9A 2KT2A 4B9SA 4JJXA 2OPSB 1G7CB 5BR8J 1HNXJ 4OX6A 3D7HA 3IWEA 1U2CA 2BBEA 1RWPB 4YHHF 4CYOA 1L3VA 3W8GA 4P10A 4HL9A 1L3SA 5L1IA 1P1LA 4PYAA 1U02A 2ZEOA 2YNEA 4YR2A 1FNOA 2FY8A 2G0BA 4JXRA 3BQ1A 4ES3A 4TKTA 2C42A 1BQNB 1WTBA 3D7FA 1DAXA 4F0MA 1J27A 3QT6A 1QSOA 1SL2A 2AT1B 5G21A 5HVHA 3Q89A 3IG1A 1LW2B 2W8KA 4CYPA 2R7QA 4J9RA 3C66A 1BPMA 4QYZJ 4E2FB 4MK7A 4XDDA 2R8KA 3J7ZT 4KVOE 4MHPA 1JNZB 4WFBQ 1S1WA 4CTAB 2CJ9A 2DY1A 2ZENA 3RBZA 2RUGA 2K2PA 1RAIB 3TQ1A 4MI4A 4RKUC 3P45B 2I38A 4NLXA 2OI2A 2J9DE 3OSPA 1IB1E 2ZWOA 3OL7A 2CQ0A 4OI0A 2HWTA 3B4MA 2B58A 5H1SV 3T6JA 2XEJA 1REVA 3RRHA 3QZ7A 3ZZPA 3GKRA 3ILIA 3K8VA 1OY9A 3J80Y 4QR2A 4II9A 4CLLA 1ZS6A 3IAS9 3GJRB 4PKDB 3P3DA 4DR5F 4NA3A 2B8QA 3HHDA 4N5SA 1T3OA 2OMLA 1JJ2R 1ZPVA 1A0OB 5L1KA 1VJQA 4MXUA 4KYZA 2R7WA 3PX6A 2FZKB 1M1GA 4CO3A 2BJ7A 3R8YA 1LCPA 1MMLA 2ZDOA 2ZBPA 1LAPA 4FS1A 1EARA 2DGUA 3H2LA 1K8AT 4USUA 4NXNF 5G22A 5D0RA 3HD2A 1S1UB 3I5CA 4OHWA 1VK3A 2OPQB 3QRPA 3ETOA 1C0UA 1GEHA 5CYJA 5DWMA 4OX9F 1S60A 3MMAA 3MR7A 1BLLE 2FHMA 4OZ0A 2WCXA 2OH1A 3MR5A 1C1CA 1SUQA 4YFJA 4MKAA 4ENOA 1D9DA 2Q43A 2Q4YA 3OXGA 5EUHA 5C25B 2X1BA 2F5GA 4C11B 1HBUB 3OL6A 4NCAA 3SHPA 2QEXS 1BWVA 3LP0A 3PEHA 4IQMA 1PUAA 1NPRA 5FVJA 3Q23A 5HMYA 4Y00A 4ZVQB 3IN5A 2FVSA 5HMXA 4NOHA 4KSAA 2ZEEA 4B9TA 3B3SA 4RU9A 1LFPA 1XNQJ 3DGPB 3LD2A 4ZPVR 2OEJA 2MQQA 1AZSB 1HD1A 4Y2KA 4H4OB 2VBQA 1JQGA 3PGPA 4TNOA 3KHZA 2PFFB 1LXJA 1Q8KA 4CYQA 4ELUA 2W4PA 5DDRC 1VQ7S 1HHQA 4DUYJ 2EI5A 5IS2A 3KK3A 1FFWB 3BQ2A 3CCWA 3RYOA 1W7WA 3GR0A 2MGZB 2RUSA 1I5OB 4FKXA 3TANA 1RT4A 1MJ9A 2HHSA 2BRLA 1SB6A 5HVFA 1NK8A 2J9CA 5KFIA 2XSJB 2YNIB 3IR7B 2JBJA 1QAYA 3JAMU 1Q2YA 1EAYC 4MFJA 2YNCA 2NPFA 4FXVA 3M6XA 2EBEA 3JTKA 4ZVOB 2B5GB 2EFOA 3DLLQ 1S7NA 3MUVP 1MU2B 2ZH2A 1LWCA 1FO1A 1TK5A 5LMNJ 4OLOA 4JI0J 1VQYA 4DR7F 3D68A 5GMDA 5D6GA 3BJ7A 4C2ZA 3QGGA 4YY3F 1TV6A 1YRXA 3AAWB 3OR2A 5B0BA 4K8RA 4ZLJA 3QIPB 2FHKA 3EDRB 2FJVA 3BDPA 1RT6A 3H5SA 3MPYA 1SC4B 4TWEA 1QM9A 4WK1A 4KOSA 4RW6A 3HLPA 1A7GE 1IR0A 2ZVSA 1T03B 3PW4A 1N5TA 2HG4A 2AWZA 3HPOA 1P6TA 3CJTA 1ZAVA 1T9WA 4K30A 3MM6A 3N28A 3DOMB 1KP6A 4K4UA 4MCSA 2Z4PA 1X60A 4HYKA 4GKJJ 1GYTA 4N77A 3D2PA 1VIXA 3SJGA 3HVTB 3R27A 2ZH8A 2KXHA 3MD1A 3TJAA 2MKYA 2OZGA 2F63A 4WWSA 4WU2A 5EN1A 3GILA 1CQNA 2H9ZA 3CULA 4P44A 3OXFA 4DS4A 4KGVB 3QJPA 2PJ5A 5F47A 4YR3A 1F60B 2GMHA 3BLNA 1D0EA 3VZHA 3BI1A 3IFEA 1H2UX 1S9GB 3PW0A 3S01A 3W6XA 2YWKA 3GIKA 4E8UA 3VAFA 3K8WA 4ELVA 3VCDA 1XBUA 3THPA 2AX1A 1UPPA 1UFKA 4OZ1A 5AT1B 3JSRA 2IJNA 3FMWA 1N34J 4URSA 5G0RB 3F44A 4CNYA 3G6XA 3KL9A 5KFTA 1KVIA 4J9NA 2EFQA 5JH9A 1RWWB 4X5KA 4DYOA 3O8WA 2YNHA 1HHTP 2RDDA 2OO4A 1KLMA 1QE1B 5KG7A 1HBNA 3CCSS 3ZTPA 5F3TA 3AJ1A 2YBVA 2UXCJ 1U0HB 2FLLA 2KT5A 3OVAA 2G1DA 2ILZA 2LEBA 1JMTA 1HA1A 2BKPA 3UN2A 3HCXA 1CM0A 4P4FA 2YKPA 2VB6A 1NUEA 4A95A 4DSJA 2B51A 1LWXA 3D1OA 4RX6A 3PB9X 4B9UA 1GX5A 3IC1A 4NLWA 4RW7A 1VLOA 2IYIA 4X8IA 4B9VA 2F8EX 1X4GA 1S1XB 5T7LA 1O6XA 3NL0A 1KD1T 4OADA 5KFXA 3VWDA 4EI2A 2HHHF 4QWCA 3VGSA 5E3QA 3Q22A 3N01A 4LBPA 4HR2A 2C6CA 2DT9A 2Z3LA 1CULB 1EKRA 4KOVA 2HK2A 4CH0S 1OPIA 5CH7B 5D4LA 1HR0F 4YUDA 5LYIA 2GIFA 3FRZA 3QZ8A 1GMUA 2HQCA 1IR2A 2AEFA 5KFAA 1KN6A 3RRKA 4PAAA 3BF4A 3DXSX 4C7HA 4Y49C 4UEFA 3HXMA 3LF0A 3I4HX 4P75A 2IRUA 4OV1A 3GU0A 1YQHA 2RQCA 5CBMA 2J7UA 3EGWB 4X4TA 2IC3B 2HVHA 1SL0A 2DNHA 1T11A 3ZTOA 5IV0A 1T05A 4TYAA 3GJQB 3T5LA 1IY7A 3O3LA 2ZOGA 3LOUA 3FMBA 3A4TA 4NFRA 1AUSL 4RNNA 3A8EA 1HD0A 4KLWA 5EBVA 3W66A 1S97A 3JS9A 2XI2A 2M8DB 1ZM9A 1RB0A 3BHXA 2O4HA 2POKA 3G2XA 1R8HA 2YKQA 4JI1J 1HNZJ 2I5JB 3DRPA 2UZAA 4MIBA 2G3AA 1DY3A 2D3O1 2BR0A 3H25A 3OVBA 1WKLA 4A8KA 2EC2A 1WUUA 2Q4ZA 2DGOA 4YOEA 3EGNA 3OL9A 3PJWA 4N7TA 1HNIA 1Q0NA 4DV7F 4A8YA 1LAMA 2J0SD 1M1DA 1XNRF 1WJ9A 2YX1A 4ANCA 2PQ8A 1G1XA 4QIWD 3B3TA 4M63A 1OPZA 2C3UA 4GO7X 2BMBA 4B9LA 2JL9A 2CNNB 1UWBB 2XYPB 4WPAA 4UIBA 4CAXA 3ZZOA 1XEZA 4KPCA 5JUMA 4R6TA 3M30A 1Z4EA 2LXFA 3PR5B 2CG8A 4LQ9A 9ATCB 1UFWA 1APSA 4OV6A 2CNSA 1B7YB 3OR1B 2CJQA 4XPEA 2MKIA 3M8RA 3GV7B 2NYQA 3S6KA 3S8SA 1IJEB 2NYIA 2QZ8A 2APOA 2E5LF 2Y1LB 3HFVA 3LP1B 2PO4A 4AD6A 2WK4A 2E1MC 4AE5A 1RAFB 2EK8A 4CGNA 4P2MA 3L95X 3BGLA 4HKQA 3NLCA 4UCMA 3NP5A 2V94A 3FJUA 3PHEA 1CBXA 2OSQA 1H2TZ 3LWUA 3NCQA 3W64A 4KO0A 4URQU 1Y0HA 4QZVB 4B5PB 3FYNA 2B9EA 4U7UD 1K0TA 3S7RA 2PR1A 4I64A 3TUIC 4K0KF 3KI9A 4I2PA 2VH7A 1N48A 4CQ1A 5KG5A 3CDUA 5D0GA 5C2GA 3NGSA 4KB7A 1HMVA 4UF4A 4NYPA 3I9ZA 1GXTA 1FI4A 3Q8VA 2PJCA 4ZCKA 5CA5A 3PNIA 3I0SA 4ZX9A 1YBUA 3S6FA 3RJMB 8AT1B 1SKUB 2OSRA 1YGHA 4NE9C 2AFZA 2HLUA 3LPEA 3G82B 1VQLS 1DTTB 2Y3YA 4AL6A 2RU9A 2DR9A 4M5NA 2G0IA 4NA2A 4DL6A 3NMRA 3HJFA 5AGEA 2W2MP 2BE9B 2GLFA 4NLVA 5BR8F 2VQFF 2PE8A 1HNXF 5IWAJ 4X4PA 2VG6B 4WWVA 2DCUB 3UY5A 2XMVA 4YP3A 3W1YC 3SBMA 4R5PA 2NSCA 3KKFA 3TUZC 4DL3A 2C22A 1QSMA 3D54A 1RAAB 2CJYB 3NNAA 2P9EA 2AHOB 2LEPA 1BPNA 4OL8A 3HHLD 3TA2A 2DBBA 3ZZRA 2O1PA 2CNMA 1PO6A 4RNHA 2OEMA 3POTA 4TLQA 2AIRB 1HARA 1RCOB 4I2QB 2GIRA 5KOXA 1SJFA 2E5JA 2CUYA 2W24A 3QGPA 3FVYA 4K7QA 4A8SA 4C6AA 3TVKA 3RAMA 2DNKA 3D6FB 2G0CA 5KFSA 1SQHA 4WBFA 2AQ4A 1WWHA 3ET6A 4YFUA 2VZZA 4DMZA 3OTEA 4G1QA 4QBJA 3UO0A 3BJYA 2BVZA 5L9XA 3FMCA 2BJ9A 1YW6A 2AFUA 1HQUB 3HHLB 4HHUA 1FXLA 4PPDA 4DUKA 3PXGa 3MMJA 4MRIA 2PMWA 3NMAA 3IWGA 1PC5A 1I12A 2QMXA 2KM8B 1AROP 1HBMB 1TVRB 2FIUA 2D4PA 1SIZA 2HWIA 2P6EA 2RDJA 2B3VA 1YJTA 1RTDA 5J1NA 3KJVB 1T9TA 3C15B 3PRTA 1C1BB 4H4MB 3OV7A 1XQIA 2RQ4A 2XTJP 5KFNA 4ANDA 4ZHRA 2QJ3A 3HP6A 2AYBA 3QWUA 3Q2TC 4FXDA 2GJIA 5D0HA 4DL0C 4F9UA 1ZZFA 5E3AA 1N88A 4PXEA 3MTKA 1CVJA 3MTJA 4PABA 2D9OA 1Y0YA 4C0BA 3TWZA 3QB8A 4DWIA 4UFWA 2PC1A 3NE8A 2K06A 4DV5J 3I82A 1FKPA 4QOTA 2MQPA 1Q5VA 4P7VA 3PEIA 2NXCA 4HNXB 3WC6A 1IYLA 3MPDA 3M9OB 1FEHA 1P1TA 2KFZA 1TL1B 5H9FK 4RW4B 5KFJA 2CQGA 4F4KA 1HWKA 1LQ9A 2D4OA 4DZDA 1T3NA 2JLGA 1VQKS 4AL5A 4JI2F 3IM8A 2GHPA 4CT9A 3M6VA 2KH9A 3S9MA 3ADAC 2H54B 4W92B 5EGYA 3OUYB 4M5GA 2KFYA 3LMSA 4AUKA 1DRZA 1XNQF 1FNXH 3PZPA 1JJCB 2D3OR 4ED7A 3EWGA 4YB1P 4IOBA 5BYSA 2WBMA 3DMJA 5JPHA 5FJ4A 2CQ4A 2W2OP 3DOLA 5DWNA 3FK4A 4F0YA 4ECZA 3PW7A 1L3TA 4Y2CA 3FQLA 2ZH1A 3H5UA 3GIJA 4DXLA 1TK0A 2YNDA 3FEYB 1NDKA 3R96A 1S77D 3DU5A 1Y3KA 3I32A 1RAJA 5F8GA 2ZC4A 3E8OA 5GAHU 5EWEA 2CXAA 3KHLA 4TY8B 4C8MA 2ZBRA 3TNVA 3BGFA 1FEEA 4CLTA 4A8OA 4QWAA 4LR9A 5DDOC 5HROA 4B3TJ 2FIWA 2HHVA 3TX8A 2BEFA 4OMEA 4CO1A 3BI0A 1NPPA 1TMMA 3N6LA 3B54A 4G6VB 2ZE2A 4LVNP 1MJAA 1CPXA 4ED3A 2H5IB 5LMNF 1JLBB 4Q38A 3MM8A 3OT9A 3FKBA 2CY2A 1KHVA 2PE3A 1RUSA 2QGFB 1S3ZA 3IA0A 1RHMB 2V5HG 1VRUB 1DTQA 1S6PB 5J2NA 3BH6B 4Q45A 2OGUA 1W26A 4QIGA 3DRSA 1FK9A 4MIWA 3GG0A 4NL5A 3TEGA 2PFDA 1IBMJ 5D29A 4O0IA 4P45A 3EGVA 2L08A 2ZM6J 3V8IA 5H84A 1Y4ZB 2KG1A 2CPFA 2YNFB 2Y8YA 4FYVB 2DR7A 1IBLJ 2KU7A 1UL3A 3SSQA 3VHQA 5HVGA 3I55S 5FLXU 5C24A 3KTQA 3KMSA 2HWHA 4LRCA 1G4CA 5J2MB 2HFZA 2DHSA 4JOUA 3LACA 2DRAA 2H5JB 4R8FA 2IVFB 2RSQA 4QU6A 1YX2A 3VVUA 1URRA 3LP2B 2HNZA 4YB7A 4C2XA 4H4KC 5GAGU 4H6ZA 1UVMA 2OJ3A 4BC9A 3PB4X 1RT7A 1ZG9A 2BE2A 2DR5A 1HWLA 4ERDA 1C4AA 3I87A 5A6PA 4C0HA 2FD2A 1LW0B 3FEZA 3JVNA 5HBMA 3UD4P 3ZXWA 2V9KA 2RDIA 1M1HA 2MHNA 3WHIA 3PKYA 3FSIA 2E5HA 2NSBA 4OC3A 4X2TA 3L7UA 4DJLA 4ZK7M 1N34F 3DI6B 3KLIA 1U1LA 1S49A 2QVPA 1AMPA 1QQ9A 2QYVA 2VPZB 5I4MA 3NH8A 2QG9B 4ECWA 4KQZA 3HFZB 1NPKA 3KLEA 2OB0A 1I1DA 4I0WA 3IR5B 4N8OA 4DV2F 2FJWA 1YJUA 2Z8QA 3X3UA 2YKNA 3N79A 4OYBA 3KK1B 2P6SA 1M4DA 2VBWA 1OBRA 1RK8A 2ZITA 5LSOA 4LSLA 4IQXA 2DEJA 2HFUA 3GE9A 2V2QA 3GSDA 2PJ6A 4BCAA 3WR7A 1VQNS 2J6UA 3KK2A 2JWNA 4YRHA 5KFLA 3DDKA 4JP8A 3KUHA 3PX4A 1PAUB 4B17A 4ZP8A 3CDEA 4PZVA 4IUFA 3M2UA 4AB7A 1JNRB 4FXWA 4PWDB 1VHSA 3NWRA 3SSSA 4F8ZA 1RDRA 2KYXA 1N52B 1VYAA 1PJ7A 2DYAA 5DDQC 3N9UC 3T1AA 2FUG9 1FRHA 2HGLA 4L73A 2CQDA 3JTPA 1CQMA 5K8NA 5KTAA 1W2IA 4CLFA 1UVIA 4MCRA 1VISA 2RF2A 4RI1A 4TN2A 3CO0P 2RFHA 3UNGC 4ILMA 1X9WA 2O67A 3NS5A 2P5VA 4DFJA 2Q6BA 1X5TA 4C48A 5J1EB 2IJRA 2VG5B 2ZXVA 5L38A 2LQJA 5D4NA 2I00A 3DHXA 5KFCA 4GKKJ 2BJEA 2YNGA 1Y0RA 5HP1A 3TFYA 2KDOA 1IVZA 4JI6F 3R9EA 1JKHA 2IJFA 3W2VB 3QRRA 1P9YA 2AJ2A 1IOFA 1JLFA 2HNYA 5L1JA 4A8XA 4ZPTR 1X4DA 2M0GB 4NXMJ 4UFXA 1R27B 4ZPBA 3MM7A 1RU1A 4DQIA 2CVEA 2W4DA 1UFLA 3AFGA 4FZVA 4NJRA 3G8WA 2MKSA 3D7SB 3JSYA 2LVWA 2QLBB 3CDBA 2VOPA 4LRDA 4DSIA 4RUCA 3R6LB 4OJGA 5D77A 1HNZF 5ETOA 3AA8A 4M5DA 2QSFA 5L39A 3T1YJ 2HZCA 2EW9A 4F3QA 4KTQA 2Z2YB 3HSJA 1QJHA 5HQLA 4B13A 1ZOTA 4X64F 1Q8LA 2JLFA 3IGVA 4M5KA 3CXPA 4O4GB 2IIHA 2Q66A 2F5IA 1MLAA 2AMCB 3HVRA 1FRLA 5KTDA 4ZP7A 4J9QA 2WBRA 3D3SA 1S9EB 3KNGA 2E7XA 4G3IA 1OY8A 3TZYA 2MQLA 2RKIA 1YVKA 4YU9A 4L6V3 2ASLA 4H89A 3RUBL 2W7AA 3FBBA 5DGAA 1RWKB 4K4TA 4BHQA 4NMLA 3IRXB 5E3PA 3V6HA 2ZEPA 3M8PB 3TQEA 3M9NB 2Q51A 1LWFA 1Z5RA 2OIHA 2KCWA 3E01A 4G65A 2Z11A 3WC2A 5U47A 2REFA 5DM6Q 4IYQA 1RLDA 3FNCA 2UVUA 3VAMA 4B14A 3LWMA 4OI6A 1XBWA 4LF6J 5DLGA 2KRBA 1FT7A 3V81A 1AFJA 3DYAA 2XY5A 5B0CA 3BM7A 4JZ0A 3C26A 4X4QA 4F6AA 1R8PA 3BSOA 4I1TA 3B2YA 4MK9A 3I31A 4BWJA 4OC2A 2AFMA 4USWA 1MNEA 4EFAC 1HQ2A 3AOAA 3GCWP 1ZYQA 1HYSB 3IU2A 3BKUA 1MMNA 3MOZA 4R0EA 5G4DA 2HUZA 4F4YA 3B3CA 2XMJA 1IGBA 2QECA 2FT0A 2ANPA 4NGQA 3UE2A 1U6ZA 1WC5A 3DLBA 2YWHA 2ZJPQ 4Q2MA 1MG7A 3CJSA 4IH7A 4RUBA 2EFPA 2JFKA 2BANB 2D3ZA 4QR1A 4A8MP 3PRVA 4DQQA 5CD4A 1XC9A 4XAKA 2CPEA 4FF4A 4DDFA 3H4QA 2LU2A 3W9HA 3DOKA 4UQGA 2R7VA 2PVWA 2GQ2A 3HHKA 3IJ3A 2GANA 3IWXA 2Q44A 3DRYA 2JEIA 4BINA 2UXDJ 1TUWA 2Z30B 3FC9A 5LJ5Y 1EB0A 1BWEA 4NCGB 2P9GA 1E6YA 2C2ZB 2ZBQA 3TA0A 4NLYA 4LFBF 4FKYA 4TLRA 1U8WA 2ZOMA 3DRRB 3BZQA 4C9DA 4OX7A 3AD9C 1WOOA 4J9LA 1L3KA 1T9YA 2ZKUA 4IG3B 1CX8A 4GVBB 2BW7A 2DO4A 2NZ4A 3EM1A 4YN3B 2MYFA 1VHEA 4LUAA 1E6VB 3OD2A 2LQ8A 5KFQA 4PRFA 2FHJD 2HGNA 4F02A 2FCKA 1U6BA 1CPZA 1H6KX 3TZZA 4YMEA 1KVJA 3JUWA 3GYXB 1UJ5A 4JI3J 2QLFB 2B4DA 4LFCF 4C8OA 1LK7A 4JYWA 4ALZA 1Z1ZA 3CCZA 2VL1A 1PYTB 1ZH5A 4ID8A 5DDPC 1VCTA 3HZGA 2MZTA 4RR5A 3JSBA 2IVYA 4R0JA 3N5FA 3M6WA 1RHRB 1WKKA 1F5BA 3DKDA 4X66J 5HXDA 1UW9A 2XLKA 2OKQA 1HNWF 1O8BA 1JLEB 1R3NA 3DXBA 3C16B 3KG0A 3UVJA 2BOAA 1RAHB 1X0FA 1H38A 3CJ0A 2JC1A 4JLYA 3V5RA 4MBUA 3NXZA 4ES1A 2U1AA 3TVYA 6AT1B 2XYHB 2ZFHA 5DQGA 1QY7A 3P2FA 3D6HB 2DH7A 1FTRA 3R7SB 4UOGA 1Q7LB 2X1GA 4EWTA 3KG4A 2SXLA 2N82B 4CPAA 1N54B 1J5EF 2GCFA 3K9TA 2FC9A 2YY3A 3F8KA 3DM2A 3EVWA 1FDDA 2VG7B 5B0FA 2VZYA 3FQKA 5GMEA 4DR2F 4MKBA 1G3OA 1ITPA 2PN6A 1NXIA 4DV0J 1TKFA 4KLVA 3O2IA 4D3GA 5B0AA 5IM0B 3OTOJ 4CRJA 4RNOA 3TO8A 2AU0A 1CJVB 3MD3A 3FCVA 4K5SA 3CWJA 4MCPA 2JDJA 5M2RA 1S5ZA 4WJBA 2VJVA 2GIVA 2JSXA 2J7WA 3EFAA 4MIAA 2HQIA 3MMBA 1Y7PA 4DV5F 2BJ3A 2GREA 1NK5A 1L5UA 1HPZA 3ITHB 1YMEA 2XMMA 3B82A 1KZFA 4M1KA 4DU7A 3AB2B 4G1IA 1V9OA 3CIMA 3RB6A 1UA1A 1BO4A 4KGKA 3TO6A 3GWCA 1X9SA 3UCZP 4ZIVA 4ED6A 3ELHA 1FX2A 4ED8A 1LXNA 3CD7A 4K2XA 3GONA 1FKOA 4ZP9A 2RNEA 4JWPA 2YQ1A 2E29A 3CJ5A 2EWHA 1X12A 2C2NA 3R5JB 4OKOA 5HH1A 2YQ0A 1M4LA 1ZG7A 1R0AB 4OAEA 2MQOA 3MPUB 1NMEB 1IKXA 1RT1B 2EVZA 1RYRA 4HT7A 2MQMA 4YHHJ 2DPIA 4IRCA 2IJZA 3BPDA 2IAJB 2MY8A 2GVDA 3CCES 4M5HA 4KZTA 3CD6S 5CYMB 3VWSA 5E33A 2XSFA 2CPXA 1RWXB 3Q8PB 2QC3A 3M8QB 2OFGX 2VZ9A 3OBIA 1MN7A 1RP5A 3OLBA 2MTLA 4WTYA 3K59A 4F3OA 2LDYA 3EXNA 4JXQA 2UP1A 2MLZA 4CLWA 1FA0A 4RW8A 4NLRA 1Z9UA 4LSNA 4USTA 1NE9A 2NCKL 4K5RA 3SDEB 1M5VC 4CI0B 3T3FA 1AFIA 1V5VA 5ETNA 3H5XA 1WORA 2BABA 3QYYA 2BACA 3AQOA 2DIVA 3H8EA 4O3OA 3MFIA 1YQEA 3FNNA 3CJKB 1NK7A 3CGIA 1J5OB 3FSYA 4DJBA 3C6UB 2ARHA 2GU2A 1HNVB 2NREA 3KLVA 3KDNA 4GC6A 3DLEB 4OHZA 4C11A 5KFYA 4ZPAA 3T90A 4JI8F 5DGBA 3EVOA 4KHMA 1Y00A 1YIJS 2EVNA 1NKBA 3SZ2A 3VH9A 1SJRA 5D3GA 2R8HA 4ICLA 1VBZA 3AQPA 4MFBA 2DO0A 1F2PA 2HRTA 1EKSA 4ZJOA 4Q0BB 1FVSA 3HULA 4DR5J 2B4UA 1XF8A 3H98A 1RT3A 3MM9B 1HW9A 4WU3A 4MK8A 4H4OA 5GADU 1IBMF 3BO2A 5GVQA 5KFUA 2HRYA 2KI2A 4OYZA 2C1EB 2DHGA 4AL7A 2VONA 3I9V9 4OYOA 4RJVA 2JLEA 2W2NP 1IBLF 3W63A 1SJQA 3ILLA 2D74B 3W60A 1HQEA 5E96A 1OYDA 3EUNA 4F0XA 3QT7A 3MGJA 3LH2S 2LFVA 3K5LA 1OJ4A 4XK8C 3R7BB 5JJBA 4OX9J 2OPRA 3D4UA 4ZP6A 3KYLA 4KV8A 3AODA 3IG1B 4RO0A 4W90B 4XNHB 3PYDA 4UCNA 3QAUA 1ZETA 2Q4VA 3HI9A 3VAGA 5GMKa 2P6FA 1GT8A 2B5GA 2NXJA 3AJ2A 3DGVA 1S1WB 1BGXT 3G4SS 4K50A 2AJ4A 4YDDB 3ENVA 4ZVFA 2MMYA 1Z4RA 3NNCA 2J0XA 5HQMA 2VBYA 2ZH6A 1YX0A 3WX4A 4CH7A 1ELMP 1WOSA 2C27A 2WVBA 2XO7A 2CQCA 3PCOB 1REVB 3MCOA 1U1PA 2FZCB 3DDDA 2M52A 4WF9Q 2Z57B 3IP0A 1SV5A 1RAOA 1TKXA 1L0CA 3H5ZA 1OY6A 4L8AA 4W9YA 3KLGB 3ISNC 2VD3A 1TMJA 4NLTA 3IWNC 1KTVA 2C3PA 4O4RA 1JLAA 3JTOA 3HKZD 2ZEMA 5KFKA 3TUJC 1U47A 2YKOA 4TVAB 3MDFA 2B6AA 4MJ8A 1ZAWA 4IF5A 4CDIA 2K1RA 2LXUA 1F3VA 2DB1A 2GHVC 2HBZB 2PJ4A 1PC4A 2WW8A 4KRWA 2P6TA 3TOQA 3F0NA 1LWEA 1LOKA 4Y3CA 1M5SA 2LU1A 2VODA 3RZAA 1FD2A 2VA3A 1BLUA 3NOGA 2LCWA 4X65F 3BBFA 3A8IA 1ARMA 1EZZB 1CJUA 5DG9A 4P9SA 1D09B 2AEJA 3FF3A 2XGPA 2OFHX 1C0UB 5A8RA 3LAMA 3MHYA 3ZFVA 2QO3A 3MMAB 3KNAA 5AE1A 2FVGA 1LRZA 1RBOB 2K5TA 5ETSA 1C1CB 4A48A 5C82A 1SUQB 5AG5A 4DR7J 5ETPA 2ZBCA 3UCUP 3B3VA 4FBUA 4YY3J 1Z8XA 3Q0AA 1FKAF 2QL7B 2J9AA 3HHEA 3M6UA 1GTEA 1QAXA 3D8PA 5IXUA 1EE3P 3WT4A 4HACA 4QW8A 5B0GA 3LP0B 4LRBA 4F04B 2FE7A 1WK4A 4R3LA 2E1AA 3RW7A 3PM9A 5AG4A 3GV8B 1FDNA 1WOPA 4ZVHA 2XZWA 2KXFA 3NAIA 3EE3A 3OVSA 3FFIA 4QR0A 1CC8A 2UV8A 2W9BA 5LYLA 2JEFA 4JYAF 2HNDA 4CO2A 4DV4J 3GMGA 3OFGA 3CCUS 2RS2A 2JEJA 3RB0A 4NI2A 2BQRA 2DNMA 2AJ1A 1NDPA 1YK3A 3LPYA 3KK3B 1SKRA 4B12A 4KT0C 1KC8T 4NLDA 4I69A 2EG2A 3UW1A 4XTTA 2J8RA 2PA3A 3ICLA 2F4VF 5KFRA 2J8NA 1RT4B 2EUIA 2R8GA 3NE7A 4UIAA 2J76E 5F9LA 2WVFA 3PEJA 3NFZA 1YTYA 4QYRA 3Q8YA 2LECA 1NSQA 3NH4A 3NBPB 1KQGB 2VXKA 3MPWA 1N0VC 4KC5A 1FDAA 4DX7A 2DEIA 5D0EA 1FWPA 2KHCA 4CGOA 2XM3A 4O3PA 3ISXA 1N56A 4M3SA 2EFVA 4B9MA 2DGWA 1TKDA 4O3QA 2XHWA 5LRKA 1LWCB 2IC3A 2ROEA 1T8EA 4N56A 4NGMA 6CPAA 2J0WA 3GIIA 3UDCA 1RJJA 4EK2A 2VKRA 2CKWA 1RHQB 1S1TA 2FLPA 3HO1A 3HX9A 2DIUA 1TV6B 2GVZA 3DFEA 3D1QA 3IM9A 3BREA 1RO5A 1SKWA 2AP6A 4UEZA 4OIDA 1RT6B 2V4JA 5J2QA 1CC7A 3OQ2A 4LF6F 4LRAA 5F09A 3R1HA 3PW5A 4RW6B 5KFZA 4QW9A 5F9NA 3AT1B 2EK9A 2OMOA 1CBKA 3MM6B 2I5JA 4YB6A 3N4WA 4UCPA 4C97A 2DKOB 2PDOA 1K44A 3IXQA 3KQZA 3DCAA 1FRIA 4P73A 4CYUA 4USIA 2D3UA 3HF5A 1WD6A 2AJ0A 4NASA 2AEMA 4LRFA 2Y9HA 2HFNA 4EUVA 3AOCA 2E7VA 2EK6A 1P8GA 1JB0C 1PJ6A 1NHUA 1ELLP 1FD8A 3NA6A 3FCHA 3HKWA 3SIPB 2W9CA 1RTJA 2F9DA 4C3KA 1NSLA 4Q43A 3MCNA 1S1VA 2E5GA 2MJUA 1ICEB 3TT2A 3OJSA 1M5KC 3QAYA 2F1FA 5BWAB 4ECSA 1KS2A 4QWBA 2PIYA 3MM5A 4ED0A 3BYPA 2QMWA 3ENQA 1BQMA 1SXLA 1RHUB 2Z2ZA 3KJQB 2VPXB 2L9WA 3MAQA 2R7OA 2YNHB 2Q6CA 4FF2A 1HBNB 2MLXA 4NLSA 2CJKA 3ENAA 4FVMA 5DO2A 3MAAA 1DARA 4R87A 3LGNA 1NBEB 1KNZA 2XQCA 4U7UK 4DG1A 2C2OB 4PXDA 2UVRA 3PRBA 5AE2A 2J6SA 4DR6F 4RW7B 5SZTA 2HC9A 5IC4B 3EO4A 3CCTA 4Q8EA 4CLSA 2ALYB 3TTHA 2FSRA 2OR4A 3QATA 2BUNA 4Y2IA 4AQYJ 2OZHA 3GFZA 5C88A 2LMIA 4DV7J 1FRMA 2GQQA 1Y11A 1VKCA 4Q44A 3R7NB 1HIYA 3V2UC 3V6DA 3G6VA 4ZVTB 2HFVA 3CMQA 4KSIA 5EMIA 3GY9A 2ZW4A 2MZQA 2A4NA 3J81j 4USKA 4HNYB 3UCGA 4KGXB 1HW8A 4NJQA 2QLJB 3UNYA 2EFGA 2E5LJ 3MOJB 3PG9A 2HIYA 1R6YA 2IMWP 2C3YA 3D3CJ 2HQGA 1S7IA 2V63A 1QVFR 1NH7A 5GADI 2DJWA 2NXEA 3V4MA 5F8JA 5HMWA 3DLGA 1T05B 4KOWA 3D6TB 2PA8D 3QJLA 3I3GA 1F9FA 2NPIA 1D1UA 3ZO7A 2E1RA 1SH0A 1TKTB 4CGPA 3KHHA 2B7BB 2K7JA 2HBYB 2WAQD 3A9LA 4Y28C 3NWGA 2OEKA 2DR8A 3R9GA 4K0KJ 4ETZA 4RW9A 4ETXA 3GZ7A 4U67Q 3W5XA 2L3MA 3DRPB 2JDCA 3OSNA 3CC2S 4WP3A 1SVDA 5A0YA 2J5AA 3CPAA 4DPTA 2CZVC 3Q8UA 2WZ1A 2PJ2A 2D1CA 2WB4A 2B7CB 3GPAA 2C2DA 2ROGA 2MKKA 1HNIB 1FE0A 2CNOB 2V34A 1N6QA 3GB0A 2DNYA 2QJ8A 1Q53A 4P6QA 3CIZA 4OZ2A 2I79A 4IHMA 3CJ8A 1UP1A 4OX8A 2A18A 3MUMP 2W9AA 3KJFB 3M30B 2VF3A 1U48A 4DFPA 1NSKL 1RT5A 2DXFA 3TAMA 3KUGA 3QSIA 2HVDA 2VU5A 1S0MA 1NM2A 1TF8A 2VQFJ 1ZBTA 3BV8A 4PQUA 1F9HA 4MFPA 4CLPA 4YEAA 2G4BA 2YH1A 4KBIA 4MHNA 3M2RA 2AGOA 3V6KA 3W62A 3T9ZA 3F56A 2QRRA 2UUAF 1RTIA 2FLNA 2WPXA 2CNLB 5KFOA 1RXTA 3G87A 1AW0A 2WSEC 3CCLS 4CO4A 2FDNA 3Q24A 1ZA2B 2ZH7A 4GXHA 2P8IA 2G2YA 4KGZB 1UAWA 3J7Z5 4KO0B 2D9PA 4IO9Q 3GQCA 3CCJS 2XMAA 2VFSA 3ONQA 4DEZA 1KRPA 2A2CA 1HL6A 3T8WA 1GMWD 4I2PB 2FZGB 1V3ZA 2JZ5A 2R8IA 1HI8A 1B0TA 2ASYA 1AYEA 4KS9A 4B11A 4XPCA 2EWBA 1ZM4A 5KFFA 3R3TA 2VFUA 1WF2A 3QSYB 2FJXA 1QSRA 1C0TA 1HMVB 4A38A 3C2PA 3UDEA 4ECYA 2I6WA 1NH8A 3FBCA 3MEEA 3TAQA 2Y1RI 2FGCA 5KT7A 1VRTA 4X84A 3I0SB 2OU2A 1YRTA 4M85A 4M6GA 3P2HA 4F50A 1DJ0A 5AXMA 2WW4A 5G20A 4GRSA 1UPMB 3QO9A 3ETMA 2DF5A 2NSMA 2AYGA 3OL8A 4ZLNA 3KLFA 4FYDA 5JVHQ 2V67A 1S10A 1VRQC 4B10A 1WHYA 5KT4A 1FY7A 3FRYA 1Q8IA 5LT5A 4R5PB 1WF1A 4JB8B 4KE5A 9RUBA 3BBCA 4ZY1A 4Q36A 1NNDA 4LF2A 1VS3A 2EK1A 1WG4A 3MEKA 3SV4A 4WXOA 4ZIWA 3G8QA 1TKHA 2JFDA 5HMZA 4GM5A 4ZI6A 1WG5A 3POTB 4EO8A 4TY8A 3C14A 1B3TA 2MQNA 5F48A 4OC4A 4ZMMA 4USMA 2PEBA 3PKMA 4RU2A 5EC4A 4FWUA 3R2CJ 4DPYA 2I3CA 1TL7A 2VASA 2BEIA 3RB3A 2RRBA 1VQ6S 1RTHA 2Q7BA 3EMTA 1W25A 4CM2A 1XJWB 1EP4B 3BEGB 1UW4A 1NDCA 3ET6B 2QV6A 4OQJA 1TL3A 3R97A 3H90A 2JEWA 4G1QB 4WXWA 3ZTSA 1N0UA 3D7GA 3BR9A 2C6GA 4ZN3A 4JI2J 4TU9A 5A8KA 4HTJA 1D9AA 2N3LA 3VQTA 1IBKF 1TAQA 2R8VA 1RU2A 5E3RA 4X3RA 2PJAA 2HQYA 2DPSA 3A8JA 3AD7C 2XLJA 3CJQA 4DL7A 1U2FA 4FBEA 3S6GA 1V5IB 1S59A 3VGUA 1RHKB 1RTDB 3IGRA 1H2VZ 3D5MA 4WE1A 2AV5A 1MWYA 2XMKA 1S12A 2Z58B 1T02A 2NZCA 8RUCA 4OC0A 3R9FA 5F8HA 3GG1A 5AXLA 4F4XA 3PW2A 4ZHRB 2PGCA 2V8GA 5K9FA 5F46A 3TUPA 2DRDA 4PPZA 1JXLA 3TVZA 1S79A 5DQIA 4B02A 3FH4A 3CT9A 2E9RX 1Y10A 2X51A 2BJDA 2KT3A 4ECUA 2NUHA 3L9ZA 1S0NA 3R5DA 4DCJB 4LJMA 2CQ3A 1FKPB 3H42A 2R4FA 4K4SA 1CJKA 2YKMB 1SC1B 1IKWA 3EDQB 4MYUA 1FWLA 5HQ8A 4KHPF 5CYQA 2PJ7A 3X1LB 4UY8T 1HI1A 3PB6X 2J7KA 3F41A 2CTBA 3NEKA 3FCWA 3MF5A 5IQ6A 4UOHA 5L9NA 1GNKA 1GH8A 1S99A 2YH0A 2KG0A 5KTQA 5KG0A 4Q8FA 1IOIA 3L3CA 1JJHA 3CB4A 3IWWA 1H72C 1YJRA 1FJ7A 3DN9A 2P6GA 3BXMA 4XPLA 4QQBA 3BN4A 3HK2A 2RHSB 1XMQF 2HV2A 3T5JA 4F36A 1B99A 1K0VA 2MKCA 3UD3P 2MY7A 5M2UA 3QLHA 1XMOJ 3DLHA 1B0PA 2B9YA 3NAHA 1F6TA 4FF3A 4R3KA 3WABA 4DV4F 3DMJB 3RAXA 2GAHC 3D4JA 3LUYA 3HSDA 1VHIA 2LQ9A 4C8ZA 3DOLB 3C46A 4PWDA 2ZELA 2IFXA 2XNQA 5B09A 1D3WA 4LF9J 2NLWA 2JDDA 3DLJA 4OI3A 4XO0A 5KFMA 3MN8A 1BQXA 1YBAA 3B8HA 1WSRA 1U24A 2YPZA 3SJFA 4N76A 3ZTRA 2Z3KA 5GCNA 3CE8A 5CAAA 3U7JA 1GMVA 1EQ0A 3FXTA 3GYGA 1XTZA 2A10A 3KGQA 4RBTA 2VG5A 5HROB 4C2MA 4DL2A 3I4PA 1HWIA 1VQ5S 4ONUA 2UVWA 2IYGA 2ZE2B 1DFDA 1RA6A 2HQDA 2LKZA 3NY0A 2G9OA 4WIQA 3JRUA 2AX0A 4DV2J 4PUOA 3H0PA 3MM8B 1YITS 4MFKA 4AG9A 5IT4A 5A8WB 2B4BA 1DTQB 2CWKA 5J2NB 2HS4A 3FGVA 1KQFB 2X7BA 3UN5A 2BO9A 3DRSB 3BO3A 1VBKA 3R1KA 1F5CA 2XBPA 1JXVA 5IB0A 2P9CA 4A30A 4MAKA 2X1AA 5AXKA 4UQTA 4Z37A 3KHGA 2PR8A 2Z3NA 3BR8A 2UUBF 1SI9A 1VIOA 1CSJA 2JX2A 3L4BC 5C24B 1UWAA 4TYBA 4WK3A 4OJ1A 4KSFA 1TUVA 3HMJG 2KB2A 4PXBA 3PX0A 2L9DA 4Q2LA 4IFVA 1R43A 4F3MA 3EZOA 1QSNA 1YWXA 4ECXA 5C7PA 4EFDA 1W2BR 3IRWP 2PSZA 2HNZB 4QVTA 3HZEA 3L09A 3N6MA 5DETA 2CXEA 5HJYA 3ZZYA 1NKEA 1BY9A 1RT7B 4IUSA 4FD7A 4OIWA 2FVPA 2RD5C 3K89A 2BE2B 3D0GE 3A3OB 3MAHA 1Z4UA 5HLFA 3PIOQ 4DR3J 3M8WA 3PYEA 5IX3A 4S0MA 2H48B 2J8SA 2KJWA 1NZ8A 3ISZA 1BUXA 4IG0A 3IRXA 1ZA1B 1R6VA 3F5BA 4L74A 2OZUA 3JAMY 3KXDA 5BYRA 4R8UA 5B08A 2PJ3A 4DOZA 1PYSB 3R5BA 1YGYA 3NGKA 4JI6J 2MZJA 4RPFA 1VMBA 3KLIB 1FCAA 7AT1B 1V3SA 2ZZMA 3CUNA 3S9NA 3R2DJ 1QD1A 4WFAQ 3VAIA 3KLEB 5ETVA 2QT7A 3GLJA 1RKJA 1FJEB 2YKNB 1N5QA 1RXOB 3D2MA 5HJXA