4CYQA

Leishmania major n-myristoyltransferase in complex with a hybrid inhibitor (compound 45).
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cyqA00
5G21A 5A28A 2YNDA 2YNCC 4A32A 3JTKA 4CGMA 4CYQA 3H5ZA 4C2ZA 4UFXA 5A27A 5AG7A 4C2YA 4CYOA 4C7IA 4UCNA 4UFWA 4CGNA 4CYNA 2YNEA 4CGPA 4B11A 4A31A 4CGOA 4A2ZA 5AGEA 2WSAA 4A30A 4UCMA 5G22A 3IWEA 4C7HA 3IU1A 4UCPA 4CYPA 2WUUA 4UFVA 4B10A 5G20A 4A33A 4B12A 5AG6A 4A95A 4B13A 4C68A 4CGLA 4BBHA 4B14A 4CAFA 2YNCA 3IU2A 5AG5A 4C2XA 4CAEA 5G1ZA 5AG4A
chains in the Genus database with same CATH superfamily
3JVNA 5DS0A 3RBUA 4YU9A 2REEA 5JPHA 4JYWA 2RFHA 3NE7A 2YNCC 3PEIA 4PXBA 4P4EA 3SI1A 1IOFA 2ZEFA 3H8GA 4JJXA 4CAWA 3JRUA 2PSWA 2Z3OA 1CM0A 3KHZA 1IB1E 4MFKA 5FVJA 3E0KA 2PJ6A 3H8FA 4MFLA 3B7IA 2NMTA 1IY7A 3D67A 3ISZA 2O4HA 1TKFA 2ZENA 4TWEA 3TOBA 1S60A 1IU8A 1VGYA 1XBUA 4P45A 4H6ZA 2EUIA 2FVGA 4UF4A 4MHPA 2OOTA 4RN7A 4PSWA 4B10A 3KQXA 4RI1A 4A33A 4UIAA 3EXNA 4KOUA 1ZLIA 4W9YA 2PJCA 4CGLA 3D66A 1CJWA 5F09A 5J8FA 4C68A 2JDCA 5AG4A 2K5TA 2F5IA 1IOIA 1Z2LA 2D4PA 4R87A 2AFZA 4R8FA 3DSBA 3D4UA 3VARA 3BHXA 1XMTA 4ZGYB 2EBJA 4L89A 1Z4EA 3FNCA 4ZY0A 2QJ8A 2B5GB 5ISVA 4F9UA 5C88A 1SQHA 3KR5A 3R9GA 4CYOA 3D7FA 2Q04A 3FYNA 3LACA 1AMPA 3R9EA 4UIBA 2ZEEA 4HNYB 1QSOA 2FT0A 1ELLP 2ATRA 2Q4VA 2J8NA 5LRJA 4R76A 1ZO0A 1XEBA 1QSTA 4EMEA 5IB9A 3FB3A 4B5PB 1J4JA 2WUUA 3SXNA 3LODA 1FT7A 6CPAA 4A95A 1M4GA 4OC0A 5C82A 2PR8A 5HXDA 2VZYA 2PQ8A 4MHNA 4Q7AA 3DR6A 4IAVA 3RNZA 3KASA 3G3SA 2GLFA 5HVGA 2R1IA 1KUYA 2V8VA 3JUWA 4AXVA 2ZELA 2PJAA 5LYDA 4CYQA 4AB7A 4C2ZA 3GYAA 4GS4A 4UFXA 3SJGA 4IK2A 5EMIA 3SHPA 3SXOA 2FS5A 4FUUA 4A31A 4CGOA 5IX3A 1YW4A 3KQZA 4A38A 1YVOA 4KOTA 3S6HA 2C6CA 3CDXA 3PP9A 3FH4A 2XEIA 1QSRA 2PJ9A 4II9A 1B6BA 2EVNA 4PK3A 5H86A 1F2PA 3BXMA 3CXSA 1ZG7A 3N7ZA 4KSIA 5LRGA 4E2AA 3K9UA 1TKHA 2CNTA 2BOAA 3BJ7A 4K30A 3RO0A 4E0AA 1Y0YA 2C6GA 4P4IA 2VQYA 4FD4A 3RYOA 5J1QA 1YMEA 4ZY2A 4C7IA 1S7FA 2JDDA 3WR7A 3D2PA 2C27A 1A2ZA 2PJ5A 2XEFA 3PGPA 4OADA 4PPZA 4NGRA 2ANPA 2PRQA 1BAVA 3FBUA 1I21A 3F8KA 2DXQA 4G1PA 4MY0A 3RZAA 3K9TA 2QYVA 1I1DA 4UFVA 3T90A 1FY7A 4GM5A 1CPXA 4EWTA 5KTDA 1PU9A 4I49A 1XRYA 2AFUA 3B3SA 4R7MA 2ZOGA 4PQAA 1VHSA 1KZFA 1KUVA 1M44A 2B3VA 2GFQA 4R3LA 5EC4A 3GIUA 1KUXA 3F0AA 4R3KA 4ZYQA 2YGWA 4FD7A 4HKFA 4A32A 4FAIA 2B4BA 1UFHA 2BL1A 2GANA 2PJ8A 3D7GA 3H5ZA 4B5PA 4FBEA 4NSQA 1Z8LA 2G9DA 4CRYB 3SI2A 5JQ4A 3LWUA 1YQEA 2R8VA 3BI1A 3FJUA 5CPAA 2F7VA 2PR1A 2EWBA 2ODFA 3IWEA 3KI9A 4MI4A 1Q2YA 2GLJA 2POKA 2PJ1A 3IGRA 2R7HA 3FRMA 4NF1A 4UA3A 3S6FA 3WABA 5G20A 3V7ZA 4KUAA 2IQ6A 3QAHA 1TXRA 4NGMA 3I3GA 1XIXA 3R96A 2QMLA 1DE4C 4Q38A 3D3SA 5HVFA 4DJLA 5A28A 2A4NA 5HVHA 1XOVA 4MFZA 5JH9A 4L8AA 4NGPA 5JM6A 1MK4A 2ZEMA 3R9FA 2X7BA 5THWA 4NJQA 4ZX9A 1XFOA 2EK8A 2ZXVA 4X5KA 2CNMA 3HLPA 2Y0MA 2J9AA 5LYLA 4Q36A 3TO6A 4KS9A 4LQGA 3WC6A 3RAMA 3VH9A 2Q43A 3FF3A 2JBKA 3DLJA 2BO9A 3GY9A 4PXCA 4NGQA 4MFQA 2VZZA 3EO4A 4U9ZA 2AFWA 4XNHC 1XE4A 3CPXA 2QECA 3IIBA 1AUGA 2Q44A 2PJ3A 3B3CA 3TE4A 1GYTA 2HQYA 2CF4A 4P10A 2XEGA 3NE8A 4CGMA 3PB7X 2ZEOA 1PUAA 1CPSA 2B4DA 3L2NA 5K8NA 4MY3A 2I79A 3H4QA 2GIVA 3N5FA 4UEZA 2AFMA 3NFZA 3P2HA 1LCPA 5I4MA 4CS0B 3VWDA 4A2ZA 5HMNA 1MJ9A 5LRKA 1QSNA 1S5KA 4ZI6A 5D8NA 4XPLA 2ZEHA 1MJBA 4YGOA 2G3AA 5AG6A 1S3ZA 2KCWA 2Q4ZA 1F57A 5AG5A 1TF8A 3I1UA 3WT4A 3QB8A 4NJRA 2F8HA 5E96A 2PJ2A 1Q7LA 3R95A 4OP4A 1XJOA 2WPWA 2PIYA 3S6GA 4M6HA 1Y7RA 2AFSA 2ZOFA 1BPMA 2JLMA 2ZW7A 4FD6A 1M4LA 2REFA 3R1KA 3TFYA 2I00A 4C2YA 2PIZA 2QIRA 1GHEA 1R43A 1Y7EA 3VATA 4M3SA 4UEEA 5K8OA 4EVYA 1OBRA 4CGPA 1ELMP 3SJXA 1K4JA 4UWJA 4K3NA 2IL4A 5GCNA 2BCOA 1YGHA 2B4DB 2WPXA 4KLWA 4KOVA 1NSLA 5HH1A 1UWYA 3GUXA 3OWCA 4P6YA 5CNPA 3MRUA 2AJ6A 4WWVA 4MFPA 1HDUA 3A9LA 2YNCA 4GXHA 3ISXA 4LUAA 2OR4A 2CTBA 1LRZA 1N71A 4U5YA 2G3TA 4AG7A 2VEZA 5G21A 3GB0A 4FD5A 3IC1A 4P4JA 4QVTA 2P6EA 2Q4YA 2Z3LA 3WC7A 4KOXA 3G8WA 2Q7BA 3H8EA 5I0CA 2P0WA 3PB8X 4M6GA 3EY5A 4ZY1A 1LFWA 5K8MA 1YK3A 4KVXA 1IYLA 4XNHB 3V8IA 1LANA 4UFWA 4JXQA 1HDQA 2VBQA 1BPNA 2DPTA 2VXKA 2CIJA 1BLLE 1Q2DA 2BUEA 3LMSA 4EFDA 3KKWA 4M6IA 3DDDA 3K2KA 4WJBA 5G22A 3W91A 1LAMA 1QQ9A 1VKCA 3IU1A 4BD9A 4CYPA 4F0YA 4Y49C 1WK4A 3LD2A 3NH4A 4QBJA 2V8DA 4CAXA 2GU2A 1YW6A 1NE9A 2HB6A 4B14A 1TKJA 4CAEA 3UY5A 3QAYA 5LYFA 4ZX8A 3B35A 4YRHA 4KSFA 4MFJA 2OB0A 3PFOA 3VWEA 3TTHA 1Z8XA 1TF9A 5F48A 3FX6A 4R9MA 4KSAA 3SI0A 2PVWA 2GREA 3B2YA 3D68A 3KR4A 3HUVA 5F47A 2HUZA 2Z10A 3NA6A 1WWZA 2H5MA 3IWWA 4MRIA 4Y49B 5AG7A 5A27A 5KTCA 2ZEDA 1HEEA 3B3WA 4LX9A 4OC4A 3PB6X 1NMTA 3NH8A 4NEXA 1Z5RA 3PRTA 2WSAA 2NSMA 5DWMA 4C7HA 1YLOA 1I12A 2FE7A 3PBEA 1MJAA 4F0XA 4RUHA 1B87A 4MCQA 4OC3A 4KVME 4MCSA 5EBVA 4B12A 3S9MA 4BBHA 2JEWA 2FCKA 1VIXA 3IJ3A 3KL9A 1CP7A 3FIXA 4CRZB 1H8LA 1S7KA 1AYEA 2V8GA 2C6PA 2ZW5A 3GLJA 4DYOA 1Z8TA 3PZJA 2CTCA 5J8CA 1IICA 3S9NA 1RXTA 3DGVA 4NGSA 4UBRA 2NYQA 3CXPA 2VL1A 2PJBA 1YLEA 2Z0ZA 1X12A 3BI0A 1V0CA 3T8WA 2ZEPA 1ARMA 4CPAA 3FVLA 3B3TA 4OIWA 2ZW4A 1Z8WA 4KVOE 5DWNA 4JWPA 4AVBA 4X8IA 2AFOA 3BJ8A 3IU2A 1JWQA 2Q51A 4P4BA 2PCUA 4CAVA 4P44A 1U6MA 4FWUA 3EC4A 1LOKA 4IUSA 2R98A 2B3UA 2YNDA 2DPSA 2OH1A 5ELYA 2FSRA 4B6ZA 4BMHA 1M1DA 4QC6A 4NGTA 2ZW6A 2PJ0A 4A37A 2WYRA 3V38A 4MCPA 4QB9A 5D29A 4ONWA 2Z3KA 4PV6A 4KZTA 3IEHA 4DNCA 2IMOA 1ARLA 4MCRA 3DR8A 4HPSA 4UCPA 4KOSA 1M4IA 3SJEA 4OC2A 2IJZA 1YREA 2FL4A 1L0CA 2Z3NA 4PSXA 5F46A 4PK2A 5H84A 1R3NA 3DNSA 1P4NA 4XPKA 4F6AA 2FXFA 1KWMA 2O28A 1LAPA 4MBUA 4MJ8A 3W6SA 4AVCA 2Z3PA 1Q2CA 1S7LA 4RS2A 3CT9A 3WC5A 4OAEA 3CZXA 1Y9KA 4KOYA 4MHZA 3PB9X 4MHYA 1NSAA 2D4OA 4ONUA 2HC9A 3P2FA 4CGNA 1Y9WA 4JZ0A 4DUKA 1ZG9A 4YWYA 4B11A 4H89A 4UEFA 8CPAA 1F2OA 4YFJA 2Z3MA 3FEDA 1CBXA 1X10A 2B5GA 4HNWB 1YVKA 4XPDB 4QUSA 4H2KA 4NCZA 4P4DA 2BEIA 3D7DA 2FIWA 4R57A 5KTAA 4PXDA 4U9YA 2RB7A 4TNUA 1YR0A 4B13A 5IV0A 2PE3A 4CAFA 3KGQA 5CBMA 3PB4X 1EE3P 3ZZIA 1IYKA 5IB0A 1OZPA 3NH5A 4JLYA 3T9YA 4ORFA 4HNXB 2PJ7A 5LYIA 7CPAA 3C26A 2ZPAA 3IFEA 4KUBA 4X2TA 4BINA 2OZUA 4E8OA 2OZGA 3BLNA 4R6TA 4UWIA 4LQ6A 1CP6A 1PCAA 2EO8A 3S6KA 3TCVA 2Z11A 3MN8A 2OZHA 4NXYA 4OC1A 4A94A 2GE3A 2PC1A 1PYTB 4AVAA 4PXEA 3D8PA 1QSMA 2OU2A 3TC8A 1TIQA 2RC4A 2G0BA 4OC5A 3F5BA 1Z4RA 3TOAA 1M4DA 2CNSA 4OIDA 5BWAB 5JGFA 1BO4A 4IF5A 3TO9A 2WZNA 1ON0A 1JQGA 3FMCA 3ZJ0A 3D7HA 3KHXA 3TT2A 2O53A 1RTQA 3GKRA 4JXRA 2P6GA 4X3RA 3D2MA 4OMEA 1FNOA 2Q7SA 4IHMA 5F49A 1R57A 3JTKA 4NFRA 3KZWA 3TX8A 4NGNA 1QMUA 3PFEA 2AFXA 4P4FA 4AG9A 3S9LA 4OLLA 2ABZA 3B8GA 3CXQA 3FEEA 4J3GA 1CX8A 4CYNA 1CG2A 4KLVA 3PBBA 1IIDA 1XF8A 1Z9UA 4O23A 2C1CA 5AGEA 4A39A 2V77A 1IGBA 1YSJA 2HV2A 2FIAA 3CPAA 1BOBA 1XMBA 2CY2A 2VI7A 4MXUA 4F9VA 1DTDA 2BSWA 2P6FA 4C2XA 4B5OA 4F8ZA 1VHEA 2CXAA 2B58A 2ARHA 1ZLHA 2I3CA 2PJ4A 2EK9A 3TO7A 1Y0RA 2DF5A 4MHDA 2J8MA 2PDOA 1RO5A 1YX0A 3FXTA 4XPDC 3B3VA 4Z65A 1VHOA 2AE6A 2ZEGA 4KORA 2PVVA 4JD6A 4UCNA 3MGDA 4KOWA 2JEVA 2DEAA 3IO1A 3IWGA 2YNEA 3SJFA 1P0HA 4MMOA 2Q0YA 4A30A 4UCMA 3W6XA 2J8RA 1ZG8A 2QVPA 4OKOA 2XEJA 3EFAA 4ZBGA 1S7NA 2V8HA 5K8PA 2JBJA 2PRBA 4M85A 4H6UA 3FECA 5G1ZA 3QNVA 3I9SA
chains in the Genus database with same CATH topology
3JVNA 2REEA 5JPHA 3NE7A 2YNCC 4JJXA 4CAWA 2PSWA 2Z3OA 1CM0A 1IB1E 4MFKA 5FVJA 3E0KA 4MFLA 2NMTA 3TOBA 1S60A 4H6ZA 2EUIA 4PSWA 4B10A 4RI1A 4A33A 3EXNA 4KOUA 4CGLA 1CJWA 5J8FA 4C68A 2JDCA 5AG4A 2K5TA 2F5IA 2D4PA 4R87A 3DSBA 1XMTA 4ZGYB 4L89A 1Z4EA 3FNCA 2B5GB 5ISVA 5C88A 1SQHA 3R9GA 4CYOA 2Q04A 3FYNA 3R9EA 4HNYB 1QSOA 2FT0A 2ATRA 2Q4VA 2J8NA 1ZO0A 1XEBA 1QSTA 3FB3A 4B5PB 1J4JA 2WUUA 3SXNA 3LODA 4A95A 1M4GA 5C82A 2PR8A 2VZYA 2PQ8A 3DR6A 3G3SA 2R1IA 1KUYA 3JUWA 4CYQA 4AB7A 4C2ZA 3GYAA 4GS4A 4UFXA 3SHPA 3SXOA 2FS5A 4A31A 4CGOA 5IX3A 1YVOA 4KOTA 3S6HA 3PP9A 1QSRA 4II9A 1B6BA 2EVNA 4PK3A 5H86A 3N7ZA 3CXSA 4E2AA 3K9UA 2CNTA 3BJ7A 4K30A 4E0AA 2VQYA 4FD4A 3RYOA 4C7IA 1S7FA 2JDDA 3WR7A 3D2PA 2C27A 4OADA 3PGPA 3FBUA 1I21A 3F8KA 2DXQA 4MY0A 1I1DA 4UFVA 3T90A 1FY7A 5KTDA 1PU9A 4I49A 1VHSA 1KZFA 1KUVA 1M44A 2B3VA 4R3LA 5EC4A 1KUXA 3F0AA 4R3KA 2YGWA 4FD7A 4HKFA 4A32A 2B4BA 1UFHA 2BL1A 2GANA 3H5ZA 4B5PA 4NSQA 4CRYB 5JQ4A 2R8VA 2PR1A 3IWEA 3UY5A 4MI4A 1Q2YA 4NF1A 3IGRA 2R7HA 3FRMA 4UA3A 3S6FA 5G20A 4KUAA 3QAHA 3I3GA 1XIXA 3R96A 2QMLA 4Q38A 3D3SA 5A28A 2A4NA 4MFZA 4L8AA 1MK4A 3R9FA 2X7BA 2ZXVA 4X5KA 2CNMA 2Y0MA 4Q36A 3TO6A 4KS9A 3GY9A 4MFQA 2VZZA 3EO4A 4U9ZA 4XNHC 1XE4A 2QECA 2Q44A 3TE4A 2HQYA 4CGMA 1PUAA 2B4DA 4MY3A 2I79A 3H4QA 2GIVA 3P2HA 4CS0B 3VWDA 4A2ZA 5HMNA 1MJ9A 1QSNA 1S5KA 4XPLA 4YGOA 1MJBA 2G3AA 5AG6A 1S3ZA 2KCWA 5AG5A 3QB8A 5E96A 3R95A 2WPWA 3S6GA 1Y7RA 2JLMA 2ZW7A 4FD6A 2REFA 3R1KA 3TFYA 2I00A 4C2YA 2QIRA 1GHEA 4M3SA 4EVYA 4CGPA 1K4JA 4UWJA 5GCNA 2IL4A 1YGHA 2B4DB 2WPXA 4KLWA 4KOVA 1NSLA 5HH1A 3OWCA 5CNPA 2AJ6A 4MFPA 3A9LA 2YNCA 4LUAA 1LRZA 1N71A 4U5YA 2G3TA 4AG7A 2VEZA 5G21A 4FD5A 4QVTA 2P6EA 2Q4YA 2Z3LA 5I0CA 4KOXA 3G8WA 2Q7BA 2P0WA 3EY5A 1YK3A 4KVXA 1IYLA 4XNHB 3V8IA 4UFWA 4JXQA 2VBQA 2VXKA 2DPTA 1Q2DA 2BUEA 3KKWA 3DDDA 5G22A 3W91A 1VKCA 3IU1A 4CYPA 4F0YA 4Y49C 1WK4A 3LD2A 4QBJA 4CAXA 1NE9A 4CAEA 4B14A 4YRHA 4KSFA 4MFJA 2OB0A 3VWEA 3TTHA 5F48A 4R9MA 4KSAA 5F47A 2HUZA 2Z10A 1WWZA 2H5MA 5A27A 5AG7A 4Y49B 5KTCA 4LX9A 1NMTA 4NEXA 5DWMA 2WSAA 4C7HA 1I12A 2FE7A 1MJAA 4F0XA 1B87A 4KVME 4B12A 5EBVA 4BBHA 2FCKA 3FIXA 4CRZB 1S7KA 2ZW5A 3PZJA 5J8CA 1IICA 1RXTA 4UBRA 3CXPA 1YLEA 2Z0ZA 1V0CA 2ZW4A 4KVOE 5DWNA 4JWPA 4AVBA 3BJ8A 3IU2A 4CAVA 1U6MA 3EC4A 4IUSA 2R98A 2B3UA 2YNDA 2DPSA 2OH1A 2FSRA 4BMHA 1M1DA 4QC6A 2ZW6A 4QB9A 2Z3KA 4PV6A 4KZTA 4DNCA 3DR8A 4UCPA 4KOSA 1M4IA 1YREA 2FL4A 1L0CA 2Z3NA 4PSXA 5F46A 4PK2A 5H84A 3DNSA 1P4NA 4XPKA 4F6AA 2FXFA 2O28A 4MBUA 4MJ8A 3W6SA 4AVCA 2Z3PA 1Q2CA 1S7LA 4RS2A 4OAEA 1Y9KA 4KOYA 2D4OA 4ONUA 3P2FA 4CGNA 1Y9WA 4B11A 4H89A 4YFJA 2Z3MA 4HNWB 2B5GA 1YVKA 4XPDB 4QUSA 4NCZA 2BEIA 2FIWA 4R57A 5KTAA 4U9YA 4B13A 5IV0A 1YR0A 4CAFA 3ZZIA 1IYKA 5IB0A 1OZPA 4JLYA 3T9YA 4ORFA 4HNXB 3C26A 2ZPAA 4KUBA 4E8OA 2OZUA 2OZGA 3BLNA 4UWIA 3S6KA 3TCVA 2Z11A 4NXYA 2OZHA 2GE3A 2PC1A 4AVAA 3D8PA 1QSMA 2OU2A 1TIQA 2RC4A 2G0BA 3F5BA 1Z4RA 3TOAA 1M4DA 2CNSA 5BWAB 1BO4A 4IF5A 3TO9A 1ON0A 3ZJ0A 3TT2A 3GKRA 4JXRA 2P6GA 3D2MA 5F49A 1R57A 3JTKA 4AG9A 4OLLA 3B8GA 3CXQA 4J3GA 4CYNA 4KLVA 1IIDA 1XF8A 1Z9UA 5AGEA 2HV2A 2FIAA 1BOBA 2CY2A 2VI7A 2BSWA 2P6FA 4C2XA 4B5OA 2CXAA 2B58A 2ARHA 3TO7A 4MHDA 2J8MA 2PDOA 1RO5A 1YX0A 3FXTA 4XPDC 2AE6A 4KORA 4JD6A 4UCNA 3MGDA 4KOWA 2JEVA 3IWGA 2YNEA 1P0HA 2Q0YA 4A30A 4UCMA 3W6XA 2J8RA 3EFAA 4ZBGA 1S7NA 2PRBA 4M85A 4H6UA 5G1ZA 3I9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G21 A;  5A28 A;  2YND A;  2YNC C;  4A32 A;  3JTK A;  4CGM A;  4CYQ A;  3H5Z A;  4C2Z A;  4UFX A;  5A27 A;  5AG7 A;  4C2Y A;  4CYO A;  4C7I A;  4UCN A;  4UFW A;  4CGN A;  4CYN A;  2YNE A;  4CGP A;  4B11 A;  4A31 A;  4CGO A;  4A2Z A;  5AGE A;  2WSA A;  4A30 A;  4UCM A;  5G22 A;  3IWE A;  4C7H A;  3IU1 A;  4UCP A;  4CYP A;  2WUU A;  4UFV A;  4B10 A;  5G20 A;  4A33 A;  4B12 A;  5AG6 A;  4A95 A;  4B13 A;  4C68 A;  4CGL A;  4BBH A;  4B14 A;  4CAF A;  2YNC A;  3IU2 A;  5AG5 A;  4C2X A;  4CAE A;  5G1Z A;  5AG4 A; 
#chains in the Genus database with same CATH topology
 3JVN A;  5DS0 A;  3RBU A;  4YU9 A;  2REE A;  5JPH A;  4JYW A;  2RFH A;  3NE7 A;  2YNC C;  3PEI A;  4PXB A;  4P4E A;  3SI1 A;  1IOF A;  2ZEF A;  3H8G A;  4JJX A;  4CAW A;  3JRU A;  2PSW A;  2Z3O A;  1CM0 A;  3KHZ A;  1IB1 E;  4MFK A;  5FVJ A;  3E0K A;  2PJ6 A;  3H8F A;  4MFL A;  3B7I A;  2NMT A;  1IY7 A;  3D67 A;  3ISZ A;  2O4H A;  1TKF A;  2ZEN A;  4TWE A;  3TOB A;  1S60 A;  1IU8 A;  1VGY A;  1XBU A;  4P45 A;  4H6Z A;  2EUI A;  2FVG A;  4UF4 A;  4MHP A;  2OOT A;  4RN7 A;  4PSW A;  4B10 A;  3KQX A;  4RI1 A;  4A33 A;  4UIA A;  3EXN A;  4KOU A;  1ZLI A;  4W9Y A;  2PJC A;  4CGL A;  3D66 A;  1CJW A;  5F09 A;  5J8F A;  4C68 A;  2JDC A;  5AG4 A;  2K5T A;  2F5I A;  1IOI A;  1Z2L A;  2D4P A;  4R87 A;  2AFZ A;  4R8F A;  3DSB A;  3D4U A;  3VAR A;  3BHX A;  1XMT A;  4ZGY B;  2EBJ A;  4L89 A;  1Z4E A;  3FNC A;  4ZY0 A;  2QJ8 A;  2B5G B;  5ISV A;  4F9U A;  5C88 A;  1SQH A;  3KR5 A;  3R9G A;  4CYO A;  3D7F A;  2Q04 A;  3FYN A;  3LAC A;  1AMP A;  3R9E A;  4UIB A;  2ZEE A;  4HNY B;  1QSO A;  2FT0 A;  1ELL P;  2ATR A;  2Q4V A;  2J8N A;  5LRJ A;  4R76 A;  1ZO0 A;  1XEB A;  1QST A;  4EME A;  5IB9 A;  3FB3 A;  4B5P B;  1J4J A;  2WUU A;  3SXN A;  3LOD A;  1FT7 A;  6CPA A;  4A95 A;  1M4G A;  4OC0 A;  5C82 A;  2PR8 A;  5HXD A;  2VZY A;  2PQ8 A;  4MHN A;  4Q7A A;  3DR6 A;  4IAV A;  3RNZ A;  3KAS A;  3G3S A;  2GLF A;  5HVG A;  2R1I A;  1KUY A;  2V8V A;  3JUW A;  4AXV A;  2ZEL A;  2PJA A;  5LYD A;  4CYQ A;  4AB7 A;  4C2Z A;  3GYA A;  4GS4 A;  4UFX A;  3SJG A;  4IK2 A;  5EMI A;  3SHP A;  3SXO A;  2FS5 A;  4FUU A;  4A31 A;  4CGO A;  5IX3 A;  1YW4 A;  3KQZ A;  4A38 A;  1YVO A;  4KOT A;  3S6H A;  2C6C A;  3CDX A;  3PP9 A;  3FH4 A;  2XEI A;  1QSR A;  2PJ9 A;  4II9 A;  1B6B A;  2EVN A;  4PK3 A;  5H86 A;  1F2P A;  3BXM A;  3CXS A;  1ZG7 A;  3N7Z A;  4KSI A;  5LRG A;  4E2A A;  3K9U A;  1TKH A;  2CNT A;  2BOA A;  3BJ7 A;  4K30 A;  3RO0 A;  4E0A A;  1Y0Y A;  2C6G A;  4P4I A;  2VQY A;  4FD4 A;  3RYO A;  5J1Q A;  1YME A;  4ZY2 A;  4C7I A;  1S7F A;  2JDD A;  3WR7 A;  3D2P A;  2C27 A;  1A2Z A;  2PJ5 A;  2XEF A;  3PGP A;  4OAD A;  4PPZ A;  4NGR A;  2ANP A;  2PRQ A;  1BAV A;  3FBU A;  1I21 A;  3F8K A;  2DXQ A;  4G1P A;  4MY0 A;  3RZA A;  3K9T A;  2QYV A;  1I1D A;  4UFV A;  3T90 A;  1FY7 A;  4GM5 A;  1CPX A;  4EWT A;  5KTD A;  1PU9 A;  4I49 A;  1XRY A;  2AFU A;  3B3S A;  4R7M A;  2ZOG A;  4PQA A;  1VHS A;  1KZF A;  1KUV A;  1M44 A;  2B3V A;  2GFQ A;  4R3L A;  5EC4 A;  3GIU A;  1KUX A;  3F0A A;  4R3K A;  4ZYQ A;  2YGW A;  4FD7 A;  4HKF A;  4A32 A;  4FAI A;  2B4B A;  1UFH A;  2BL1 A;  2GAN A;  2PJ8 A;  3D7G A;  3H5Z A;  4B5P A;  4FBE A;  4NSQ A;  1Z8L A;  2G9D A;  4CRY B;  3SI2 A;  5JQ4 A;  3LWU A;  1YQE A;  2R8V A;  3BI1 A;  3FJU A;  5CPA A;  2F7V A;  2PR1 A;  2EWB A;  2ODF A;  3IWE A;  3KI9 A;  4MI4 A;  1Q2Y A;  2GLJ A;  2POK A;  2PJ1 A;  3IGR A;  2R7H A;  3FRM A;  4NF1 A;  4UA3 A;  3S6F A;  3WAB A;  5G20 A;  3V7Z A;  4KUA A;  2IQ6 A;  3QAH A;  1TXR A;  4NGM A;  3I3G A;  1XIX A;  3R96 A;  2QML A;  1DE4 C;  4Q38 A;  3D3S A;  5HVF A;  4DJL A;  5A28 A;  2A4N A;  5HVH A;  1XOV A;  4MFZ A;  5JH9 A;  4L8A A;  4NGP A;  5JM6 A;  1MK4 A;  2ZEM A;  3R9F A;  2X7B A;  5THW A;  4NJQ A;  4ZX9 A;  1XFO A;  2EK8 A;  2ZXV A;  4X5K A;  2CNM A;  3HLP A;  2Y0M A;  2J9A A;  5LYL A;  4Q36 A;  3TO6 A;  4KS9 A;  4LQG A;  3WC6 A;  3RAM A;  3VH9 A;  2Q43 A;  3FF3 A;  2JBK A;  3DLJ A;  2BO9 A;  3GY9 A;  4PXC A;  4NGQ A;  4MFQ A;  2VZZ A;  3EO4 A;  4U9Z A;  2AFW A;  4XNH C;  1XE4 A;  3CPX A;  2QEC A;  3IIB A;  1AUG A;  2Q44 A;  2PJ3 A;  3B3C A;  3TE4 A;  1GYT A;  2HQY A;  2CF4 A;  4P10 A;  2XEG A;  3NE8 A;  4CGM A;  3PB7 X;  2ZEO A;  1PUA A;  1CPS A;  2B4D A;  3L2N A;  5K8N A;  4MY3 A;  2I79 A;  3H4Q A;  2GIV A;  3N5F A;  4UEZ A;  2AFM A;  3NFZ A;  3P2H A;  1LCP A;  5I4M A;  4CS0 B;  3VWD A;  4A2Z A;  5HMN A;  1MJ9 A;  5LRK A;  1QSN A;  1S5K A;  4ZI6 A;  5D8N A;  4XPL A;  2ZEH A;  1MJB A;  4YGO A;  2G3A A;  5AG6 A;  1S3Z A;  2KCW A;  2Q4Z A;  1F57 A;  5AG5 A;  1TF8 A;  3I1U A;  3WT4 A;  3QB8 A;  4NJR A;  2F8H A;  5E96 A;  2PJ2 A;  1Q7L A;  3R95 A;  4OP4 A;  1XJO A;  2WPW A;  2PIY A;  3S6G A;  4M6H A;  1Y7R A;  2AFS A;  2ZOF A;  1BPM A;  2JLM A;  2ZW7 A;  4FD6 A;  1M4L A;  2REF A;  3R1K A;  3TFY A;  2I00 A;  4C2Y A;  2PIZ A;  2QIR A;  1GHE A;  1R43 A;  1Y7E A;  3VAT A;  4M3S A;  4UEE A;  5K8O A;  4EVY A;  1OBR A;  4CGP A;  1ELM P;  3SJX A;  1K4J A;  4UWJ A;  4K3N A;  2IL4 A;  5GCN A;  2BCO A;  1YGH A;  2B4D B;  2WPX A;  4KLW A;  4KOV A;  1NSL A;  5HH1 A;  1UWY A;  3GUX A;  3OWC A;  4P6Y A;  5CNP A;  3MRU A;  2AJ6 A;  4WWV A;  4MFP A;  1HDU A;  3A9L A;  2YNC A;  4GXH A;  3ISX A;  4LUA A;  2OR4 A;  2CTB A;  1LRZ A;  1N71 A;  4U5Y A;  2G3T A;  4AG7 A;  2VEZ A;  5G21 A;  3GB0 A;  4FD5 A;  3IC1 A;  4P4J A;  4QVT A;  2P6E A;  2Q4Y A;  2Z3L A;  3WC7 A;  4KOX A;  3G8W A;  2Q7B A;  3H8E A;  5I0C A;  2P0W A;  3PB8 X;  4M6G A;  3EY5 A;  4ZY1 A;  1LFW A;  5K8M A;  1YK3 A;  4KVX A;  1IYL A;  4XNH B;  3V8I A;  1LAN A;  4UFW A;  4JXQ A;  1HDQ A;  2VBQ A;  1BPN A;  2DPT A;  2VXK A;  2CIJ A;  1BLL E;  1Q2D A;  2BUE A;  3LMS A;  4EFD A;  3KKW A;  4M6I A;  3DDD A;  3K2K A;  4WJB A;  5G22 A;  3W91 A;  1LAM A;  1QQ9 A;  1VKC A;  3IU1 A;  4BD9 A;  4CYP A;  4F0Y A;  4Y49 C;  1WK4 A;  3LD2 A;  3NH4 A;  4QBJ A;  2V8D A;  4CAX A;  2GU2 A;  1YW6 A;  1NE9 A;  2HB6 A;  4B14 A;  1TKJ A;  4CAE A;  3UY5 A;  3QAY A;  5LYF A;  4ZX8 A;  3B35 A;  4YRH A;  4KSF A;  4MFJ A;  2OB0 A;  3PFO A;  3VWE A;  3TTH A;  1Z8X A;  1TF9 A;  5F48 A;  3FX6 A;  4R9M A;  4KSA A;  3SI0 A;  2PVW A;  2GRE A;  3B2Y A;  3D68 A;  3KR4 A;  3HUV A;  5F47 A;  2HUZ A;  2Z10 A;  3NA6 A;  1WWZ A;  2H5M A;  3IWW A;  4MRI A;  4Y49 B;  5AG7 A;  5A27 A;  5KTC A;  2ZED A;  1HEE A;  3B3W A;  4LX9 A;  4OC4 A;  3PB6 X;  1NMT A;  3NH8 A;  4NEX A;  1Z5R A;  3PRT A;  2WSA A;  2NSM A;  5DWM A;  4C7H A;  1YLO A;  1I12 A;  2FE7 A;  3PBE A;  1MJA A;  4F0X A;  4RUH A;  1B87 A;  4MCQ A;  4OC3 A;  4KVM E;  4MCS A;  5EBV A;  4B12 A;  3S9M A;  4BBH A;  2JEW A;  2FCK A;  1VIX A;  3IJ3 A;  3KL9 A;  1CP7 A;  3FIX A;  4CRZ B;  1H8L A;  1S7K A;  1AYE A;  2V8G A;  2C6P A;  2ZW5 A;  3GLJ A;  4DYO A;  1Z8T A;  3PZJ A;  2CTC A;  5J8C A;  1IIC A;  3S9N A;  1RXT A;  3DGV A;  4NGS A;  4UBR A;  2NYQ A;  3CXP A;  2VL1 A;  2PJB A;  1YLE A;  2Z0Z A;  1X12 A;  3BI0 A;  1V0C A;  3T8W A;  2ZEP A;  1ARM A;  4CPA A;  3FVL A;  3B3T A;  4OIW A;  2ZW4 A;  1Z8W A;  4KVO E;  5DWN A;  4JWP A;  4AVB A;  4X8I A;  2AFO A;  3BJ8 A;  3IU2 A;  1JWQ A;  2Q51 A;  4P4B A;  2PCU A;  4CAV A;  4P44 A;  1U6M A;  4FWU A;  3EC4 A;  1LOK A;  4IUS A;  2R98 A;  2B3U A;  2YND A;  2DPS A;  2OH1 A;  5ELY A;  2FSR A;  4B6Z A;  4BMH A;  1M1D A;  4QC6 A;  4NGT A;  2ZW6 A;  2PJ0 A;  4A37 A;  2WYR A;  3V38 A;  4MCP A;  4QB9 A;  5D29 A;  4ONW A;  2Z3K A;  4PV6 A;  4KZT A;  3IEH A;  4DNC A;  2IMO A;  1ARL A;  4MCR A;  3DR8 A;  4HPS A;  4UCP A;  4KOS A;  1M4I A;  3SJE A;  4OC2 A;  2IJZ A;  1YRE A;  2FL4 A;  1L0C A;  2Z3N A;  4PSX A;  5F46 A;  4PK2 A;  5H84 A;  1R3N A;  3DNS A;  1P4N A;  4XPK A;  4F6A A;  2FXF A;  1KWM A;  2O28 A;  1LAP A;  4MBU A;  4MJ8 A;  3W6S A;  4AVC A;  2Z3P A;  1Q2C A;  1S7L A;  4RS2 A;  3CT9 A;  3WC5 A;  4OAE A;  3CZX A;  1Y9K A;  4KOY A;  4MHZ A;  3PB9 X;  4MHY A;  1NSA A;  2D4O A;  4ONU A;  2HC9 A;  3P2F A;  4CGN A;  1Y9W A;  4JZ0 A;  4DUK A;  1ZG9 A;  4YWY A;  4B11 A;  4H89 A;  4UEF A;  8CPA A;  1F2O A;  4YFJ A;  2Z3M A;  3FED A;  1CBX A;  1X10 A;  2B5G A;  4HNW B;  1YVK A;  4XPD B;  4QUS A;  4H2K A;  4NCZ A;  4P4D A;  2BEI A;  3D7D A;  2FIW A;  4R57 A;  5KTA A;  4PXD A;  4U9Y A;  2RB7 A;  4TNU A;  1YR0 A;  4B13 A;  5IV0 A;  2PE3 A;  4CAF A;  3KGQ A;  5CBM A;  3PB4 X;  1EE3 P;  3ZZI A;  1IYK A;  5IB0 A;  1OZP A;  3NH5 A;  4JLY A;  3T9Y A;  4ORF A;  4HNX B;  2PJ7 A;  5LYI A;  7CPA A;  3C26 A;  2ZPA A;  3IFE A;  4KUB A;  4X2T A;  4BIN A;  2OZU A;  4E8O A;  2OZG A;  3BLN A;  4R6T A;  4UWI A;  4LQ6 A;  1CP6 A;  1PCA A;  2EO8 A;  3S6K A;  3TCV A;  2Z11 A;  3MN8 A;  2OZH A;  4NXY A;  4OC1 A;  4A94 A;  2GE3 A;  2PC1 A;  1PYT B;  4AVA A;  4PXE A;  3D8P A;  1QSM A;  2OU2 A;  3TC8 A;  1TIQ A;  2RC4 A;  2G0B A;  4OC5 A;  3F5B A;  1Z4R A;  3TOA A;  1M4D A;  2CNS A;  4OID A;  5BWA B;  5JGF A;  1BO4 A;  4IF5 A;  3TO9 A;  2WZN A;  1ON0 A;  1JQG A;  3FMC A;  3ZJ0 A;  3D7H A;  3KHX A;  3TT2 A;  2O53 A;  1RTQ A;  3GKR A;  4JXR A;  2P6G A;  4X3R A;  3D2M A;  4OME A;  1FNO A;  2Q7S A;  4IHM A;  5F49 A;  1R57 A;  3JTK A;  4NFR A;  3KZW A;  3TX8 A;  4NGN A;  1QMU A;  3PFE A;  2AFX A;  4P4F A;  4AG9 A;  3S9L A;  4OLL A;  2ABZ A;  3B8G A;  3CXQ A;  3FEE A;  4J3G A;  1CX8 A;  4CYN A;  1CG2 A;  4KLV A;  3PBB A;  1IID A;  1XF8 A;  1Z9U A;  4O23 A;  2C1C A;  5AGE A;  4A39 A;  2V77 A;  1IGB A;  1YSJ A;  2HV2 A;  2FIA A;  3CPA A;  1BOB A;  1XMB A;  2CY2 A;  2VI7 A;  4MXU A;  4F9V A;  1DTD A;  2BSW A;  2P6F A;  4C2X A;  4B5O A;  4F8Z A;  1VHE A;  2CXA A;  2B58 A;  2ARH A;  1ZLH A;  2I3C A;  2PJ4 A;  2EK9 A;  3TO7 A;  1Y0R A;  2DF5 A;  4MHD A;  2J8M A;  2PDO A;  1RO5 A;  1YX0 A;  3FXT A;  4XPD C;  3B3V A;  4Z65 A;  1VHO A;  2AE6 A;  2ZEG A;  4KOR A;  2PVV A;  4JD6 A;  4UCN A;  3MGD A;  4KOW A;  2JEV A;  2DEA A;  3IO1 A;  3IWG A;  2YNE A;  3SJF A;  1P0H A;  4MMO A;  2Q0Y A;  4A30 A;  4UCM A;  3W6X A;  2J8R A;  1ZG8 A;  2QVP A;  4OKO A;  2XEJ A;  3EFA A;  4ZBG A;  1S7N A;  2V8H A;  5K8P A;  2JBJ A;  2PRB A;  4M85 A;  4H6U A;  3FEC A;  5G1Z A;  3QNV A;  3I9S A; 
#chains in the Genus database with same CATH homology
 3JVN A;  2REE A;  5JPH A;  3NE7 A;  2YNC C;  4JJX A;  4CAW A;  2PSW A;  2Z3O A;  1CM0 A;  1IB1 E;  4MFK A;  5FVJ A;  3E0K A;  4MFL A;  2NMT A;  3TOB A;  1S60 A;  4H6Z A;  2EUI A;  4PSW A;  4B10 A;  4RI1 A;  4A33 A;  3EXN A;  4KOU A;  4CGL A;  1CJW A;  5J8F A;  4C68 A;  2JDC A;  5AG4 A;  2K5T A;  2F5I A;  2D4P A;  4R87 A;  3DSB A;  1XMT A;  4ZGY B;  4L89 A;  1Z4E A;  3FNC A;  2B5G B;  5ISV A;  5C88 A;  1SQH A;  3R9G A;  4CYO A;  2Q04 A;  3FYN A;  3R9E A;  4HNY B;  1QSO A;  2FT0 A;  2ATR A;  2Q4V A;  2J8N A;  1ZO0 A;  1XEB A;  1QST A;  3FB3 A;  4B5P B;  1J4J A;  2WUU A;  3SXN A;  3LOD A;  4A95 A;  1M4G A;  5C82 A;  2PR8 A;  2VZY A;  2PQ8 A;  3DR6 A;  3G3S A;  2R1I A;  1KUY A;  3JUW A;  4CYQ A;  4AB7 A;  4C2Z A;  3GYA A;  4GS4 A;  4UFX A;  3SHP A;  3SXO A;  2FS5 A;  4A31 A;  4CGO A;  5IX3 A;  1YVO A;  4KOT A;  3S6H A;  3PP9 A;  1QSR A;  4II9 A;  1B6B A;  2EVN A;  4PK3 A;  5H86 A;  3N7Z A;  3CXS A;  4E2A A;  3K9U A;  2CNT A;  3BJ7 A;  4K30 A;  4E0A A;  2VQY A;  4FD4 A;  3RYO A;  4C7I A;  1S7F A;  2JDD A;  3WR7 A;  3D2P A;  2C27 A;  4OAD A;  3PGP A;  3FBU A;  1I21 A;  3F8K A;  2DXQ A;  4MY0 A;  1I1D A;  4UFV A;  3T90 A;  1FY7 A;  5KTD A;  1PU9 A;  4I49 A;  1VHS A;  1KZF A;  1KUV A;  1M44 A;  2B3V A;  4R3L A;  5EC4 A;  1KUX A;  3F0A A;  4R3K A;  2YGW A;  4FD7 A;  4HKF A;  4A32 A;  2B4B A;  1UFH A;  2BL1 A;  2GAN A;  3H5Z A;  4B5P A;  4NSQ A;  4CRY B;  5JQ4 A;  2R8V A;  2PR1 A;  3IWE A;  3UY5 A;  4MI4 A;  1Q2Y A;  4NF1 A;  3IGR A;  2R7H A;  3FRM A;  4UA3 A;  3S6F A;  5G20 A;  4KUA A;  3QAH A;  3I3G A;  1XIX A;  3R96 A;  2QML A;  4Q38 A;  3D3S A;  5A28 A;  2A4N A;  4MFZ A;  4L8A A;  1MK4 A;  3R9F A;  2X7B A;  2ZXV A;  4X5K A;  2CNM A;  2Y0M A;  4Q36 A;  3TO6 A;  4KS9 A;  3GY9 A;  4MFQ A;  2VZZ A;  3EO4 A;  4U9Z A;  4XNH C;  1XE4 A;  2QEC A;  2Q44 A;  3TE4 A;  2HQY A;  4CGM A;  1PUA A;  2B4D A;  4MY3 A;  2I79 A;  3H4Q A;  2GIV A;  3P2H A;  4CS0 B;  3VWD A;  4A2Z A;  5HMN A;  1MJ9 A;  1QSN A;  1S5K A;  4XPL A;  4YGO A;  1MJB A;  2G3A A;  5AG6 A;  1S3Z A;  2KCW A;  5AG5 A;  3QB8 A;  5E96 A;  3R95 A;  2WPW A;  3S6G A;  1Y7R A;  2JLM A;  2ZW7 A;  4FD6 A;  2REF A;  3R1K A;  3TFY A;  2I00 A;  4C2Y A;  2QIR A;  1GHE A;  4M3S A;  4EVY A;  4CGP A;  1K4J A;  4UWJ A;  5GCN A;  2IL4 A;  1YGH A;  2B4D B;  2WPX A;  4KLW A;  4KOV A;  1NSL A;  5HH1 A;  3OWC A;  5CNP A;  2AJ6 A;  4MFP A;  3A9L A;  2YNC A;  4LUA A;  1LRZ A;  1N71 A;  4U5Y A;  2G3T A;  4AG7 A;  2VEZ A;  5G21 A;  4FD5 A;  4QVT A;  2P6E A;  2Q4Y A;  2Z3L A;  5I0C A;  4KOX A;  3G8W A;  2Q7B A;  2P0W A;  3EY5 A;  1YK3 A;  4KVX A;  1IYL A;  4XNH B;  3V8I A;  4UFW A;  4JXQ A;  2VBQ A;  2VXK A;  2DPT A;  1Q2D A;  2BUE A;  3KKW A;  3DDD A;  5G22 A;  3W91 A;  1VKC A;  3IU1 A;  4CYP A;  4F0Y A;  4Y49 C;  1WK4 A;  3LD2 A;  4QBJ A;  4CAX A;  1NE9 A;  4CAE A;  4B14 A;  4YRH A;  4KSF A;  4MFJ A;  2OB0 A;  3VWE A;  3TTH A;  5F48 A;  4R9M A;  4KSA A;  5F47 A;  2HUZ A;  2Z10 A;  1WWZ A;  2H5M A;  5A27 A;  5AG7 A;  4Y49 B;  5KTC A;  4LX9 A;  1NMT A;  4NEX A;  5DWM A;  2WSA A;  4C7H A;  1I12 A;  2FE7 A;  1MJA A;  4F0X A;  1B87 A;  4KVM E;  4B12 A;  5EBV A;  4BBH A;  2FCK A;  3FIX A;  4CRZ B;  1S7K A;  2ZW5 A;  3PZJ A;  5J8C A;  1IIC A;  1RXT A;  4UBR A;  3CXP A;  1YLE A;  2Z0Z A;  1V0C A;  2ZW4 A;  4KVO E;  5DWN A;  4JWP A;  4AVB A;  3BJ8 A;  3IU2 A;  4CAV A;  1U6M A;  3EC4 A;  4IUS A;  2R98 A;  2B3U A;  2YND A;  2DPS A;  2OH1 A;  2FSR A;  4BMH A;  1M1D A;  4QC6 A;  2ZW6 A;  4QB9 A;  2Z3K A;  4PV6 A;  4KZT A;  4DNC A;  3DR8 A;  4UCP A;  4KOS A;  1M4I A;  1YRE A;  2FL4 A;  1L0C A;  2Z3N A;  4PSX A;  5F46 A;  4PK2 A;  5H84 A;  3DNS A;  1P4N A;  4XPK A;  4F6A A;  2FXF A;  2O28 A;  4MBU A;  4MJ8 A;  3W6S A;  4AVC A;  2Z3P A;  1Q2C A;  1S7L A;  4RS2 A;  4OAE A;  1Y9K A;  4KOY A;  2D4O A;  4ONU A;  3P2F A;  4CGN A;  1Y9W A;  4B11 A;  4H89 A;  4YFJ A;  2Z3M A;  4HNW B;  2B5G A;  1YVK A;  4XPD B;  4QUS A;  4NCZ A;  2BEI A;  2FIW A;  4R57 A;  5KTA A;  4U9Y A;  4B13 A;  5IV0 A;  1YR0 A;  4CAF A;  3ZZI A;  1IYK A;  5IB0 A;  1OZP A;  4JLY A;  3T9Y A;  4ORF A;  4HNX B;  3C26 A;  2ZPA A;  4KUB A;  4E8O A;  2OZU A;  2OZG A;  3BLN A;  4UWI A;  3S6K A;  3TCV A;  2Z11 A;  4NXY A;  2OZH A;  2GE3 A;  2PC1 A;  4AVA A;  3D8P A;  1QSM A;  2OU2 A;  1TIQ A;  2RC4 A;  2G0B A;  3F5B A;  1Z4R A;  3TOA A;  1M4D A;  2CNS A;  5BWA B;  1BO4 A;  4IF5 A;  3TO9 A;  1ON0 A;  3ZJ0 A;  3TT2 A;  3GKR A;  4JXR A;  2P6G A;  3D2M A;  5F49 A;  1R57 A;  3JTK A;  4AG9 A;  4OLL A;  3B8G A;  3CXQ A;  4J3G A;  4CYN A;  4KLV A;  1IID A;  1XF8 A;  1Z9U A;  5AGE A;  2HV2 A;  2FIA A;  1BOB A;  2CY2 A;  2VI7 A;  2BSW A;  2P6F A;  4C2X A;  4B5O A;  2CXA A;  2B58 A;  2ARH A;  3TO7 A;  4MHD A;  2J8M A;  2PDO A;  1RO5 A;  1YX0 A;  3FXT A;  4XPD C;  2AE6 A;  4KOR A;  4JD6 A;  4UCN A;  3MGD A;  4KOW A;  2JEV A;  3IWG A;  2YNE A;  1P0H A;  2Q0Y A;  4A30 A;  4UCM A;  3W6X A;  2J8R A;  3EFA A;  4ZBG A;  1S7N A;  2PRB A;  4M85 A;  4H6U A;  5G1Z A;  3I9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...