4CYQA

Leishmania major n-myristoyltransferase in complex with a hybrid inhibitor (compound 45).
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cyqA00
3IU1A 2YNCC 5AG5A 4CYPA 4A2ZA 2WUUA 4A30A 5AG4A 4C2XA 4CGNA 4CGPA 4UCPA 2WSAA 4CYQA 3H5ZA 4CYOA 4B12A 4B10A 4BBHA 4CAEA 5AGEA 5G21A 4C2ZA 3IWEA 4UFXA 5A27A 5A28A 5G20A 2YNEA 4CYNA 4UCMA 5G1ZA 4A32A 4B11A 5AG6A 5AG7A 4B13A 4CGOA 3JTKA 2YNDA 2YNCA 4B14A 4UCNA 4C7HA 4CGLA 4A95A 4C2YA 4CAFA 4A33A 4C68A 4A31A 4UFWA 4CGMA 4C7IA 3IU2A 5G22A 4UFVA
chains in the Genus database with same CATH superfamily
2PJ3A 2HQYA 2ZW4A 2ZEDA 5J8FA 5F46A 2C6GA 4UIBA 5BWAB 3NH5A 2G3TA 2JDDA 4OP4A 4ZY0A 1Z8XA 4OAEA 5H84A 3FJUA 1CP6A 2BL1A 3H8FA 1VHEA 4B12A 4ZYQA 2AFWA 4ONWA 5LYFA 4PXEA 1LRZA 3G8WA 1SQHA 1XRYA 1ZLIA 2CXAA 3FMCA 4PK2A 5KTDA 4KS9A 4UCMA 1YREA 3T90A 1F2PA 4R76A 2JLMA 2WPWA 4OC2A 4KLVA 1UWYA 2Q7SA 1IU8A 1Y9KA 2FVGA 3D7GA 3F5BA 3NH8A 4UCNA 4AB7A 2OR4A 2Q04A 3CPXA 4CAFA 1OBRA 4G1PA 4MI4A 2DXQA 2VXKA 1RXTA 4FD7A 2ATRA 4GM5A 4P4EA 3KHZA 2A4NA 4H6UA 4WWVA 1CX8A 1FNOA 1FY7A 2R8VA 3BI0A 4RN7A 5JQ4A 3TC8A 4K3NA 1Y9WA 2G0BA 4H89A 1Y7EA 2I3CA 2RB7A 2ZEEA 3PB4X 2F5IA 4R6TA 4FUUA 1PYTB 5LRJA 3IEHA 2OZGA 2EVNA 2EUIA 3RNZA 4P4DA 3SJFA 4A37A 3ZJ0A 1XOVA 2QECA 4JXRA 2PCUA 2FXFA 4ZX8A 1YVOA 4OMEA 4UBRA 2DPSA 2GLFA 2J8MA 3KASA 5D8NA 3S9NA 3NE8A 1QSTA 4AVAA 3BI1A 3PRTA 2BOAA 4GS4A 3K2KA 2Z3NA 4AXVA 4C7HA 2PJ7A 2PSWA 2B4DA 3SI0A 3W6XA 1ELMP 2B58A 4ONUA 4B5OA 4JLYA 5HXDA 5IB9A 1CM0A 3S6GA 2Z3KA 4NXYA 2F8HA 1VHSA 3CT9A 1QMUA 4UCPA 4MHYA 1RO5A 3WR7A 4E2AA 1HEEA 1ZG7A 2CTBA 2FSRA 2Z3LA 2DEAA 1X12A 2GU2A 3KZWA 4R8FA 1Z4RA 4P4FA 2H5MA 2OU2A 2K5TA 1BO4A 2V8VA 3E0KA 4JZ0A 4OC1A 2POKA 3MGDA 3WT4A 4MRIA 4YGOA 2PJCA 2C6CA 4AG7A 4OC3A 4YU9A 4L89A 2R98A 3FX6A 2ZW5A 5CNPA 1YK3A 2PJ1A 3DSBA 2AFUA 2PIZA 3BJ8A 3PZJA 1ELLP 4C7IA 3JRUA 1N71A 3TCVA 3WC5A 4AVCA 3L2NA 2BO9A 4A30A 4UWIA 4P6YA 3B2YA 2B5GA 2OH1A 3D8PA 4UIAA 4A38A 3LODA 1AMPA 1QQ9A 4QVTA 1M44A 2HB6A 2AE6A 4X2TA 1Y7RA 3KKWA 3PB6X 1VGYA 3WABA 3WC7A 4B5PA 1TKHA 1XFOA 5KTCA 1YMEA 3NH4A 4HNWB 4UWJA 4PXDA 4CAWA 4UF4A 2YNEA 1Z9UA 4HNXB 4EWTA 3FNCA 2ZOFA 1Q2CA 5JM6A 4PXBA 1MK4A 4PXCA 5EC4A 4FD5A 2NYQA 1L0CA 2PJ0A 1UFHA 3VATA 4EFDA 3T8WA 3D4UA 1IICA 4NGRA 4QBJA 3IU1A 2WYRA 2ZEFA 3TT2A 1CPSA 4KVOE 5H86A 3EFAA 1BPMA 3I9SA 4OC0A 2ZELA 4P4IA 2JEWA 2ZOGA 3FF3A 2P0WA 3FIXA 2PJAA 3D67A 2ZW6A 2GLJA 4X5KA 3FB3A 3N5FA 4GXHA 2P6GA 3SXNA 2Q4VA 1R3NA 4KOSA 4BINA 2PRQA 3HLPA 3QNVA 4NGQA 3BXMA 3B3SA 2CNTA 1ARMA 1XJOA 1QSMA 3R95A 2PQ8A 3K9UA 3KQXA 3SJXA 4CGLA 1Y0RA 2V77A 2AFZA 1WWZA 1M4IA 2B3UA 2Z10A 3KL9A 1OZPA 2NMTA 4UFVA 4TNUA 3G3SA 4LUAA 1S7FA 2Q43A 4CPAA 2V8DA 1P4NA 1CG2A 5DWNA 3TOAA 2Q0YA 1EE3P 4NJRA 2ODFA 1M4GA 4XPLA 4B10A 1JQGA 1MJAA 1Q2YA 2JBKA 5A27A 2Q4YA 4MCRA 5ISVA 4FWUA 1J4JA 1ZG9A 4R7MA 2GFQA 2F7VA 2R7HA 4U9YA 5I4MA 1Y0YA 2GE3A 3JTKA 4UEZA 4KOTA 2YNDA 4LQ6A 4B14A 1JWQA 4A95A 1F2OA 2ZENA 4C68A 2CNSA 3PBEA 4A31A 4F9VA 3GLJA 1I21A 1HDQA 1XF8A 3IJ3A 3KR4A 3PBBA 4MY0A 5F48A 5AG4A 4BMHA 2IQ6A 4QB9A 4XPKA 4MBUA 2RFHA 4F9UA 2R1IA 3H5ZA 3EY5A 4CYOA 4A94A 2C27A 3FECA 1VHOA 3DNSA 3TO6A 5ELYA 4FD4A 5G20A 3SI1A 2XEGA 3B3TA 3SJGA 1ARLA 1XMTA 4JD6A 2EK8A 3H4QA 4OIWA 4CAXA 4NJQA 5KTAA 4CRYB 4KLWA 4PK3A 1YX0A 1Z5RA 3PB8X 4OLLA 4QC6A 3IC1A 1XMBA 1S7LA 3IWWA 4OKOA 3KHXA 3QAYA 2AFXA 5G22A 4R87A 4M6GA 1Z8LA 2YNCC 3P2HA 4KOWA 4U5YA 5DWMA 3T9YA 5JGFA 2PRBA 2ZW7A 4HPSA 5J8CA 3LWUA 4EMEA 3DLJA 5JH9A 3CXSA 4NGPA 2ZEPA 7CPAA 2HUZA 2WZNA 1B6BA 3B8GA 4C2ZA 1QSNA 4K30A 3RBUA 3I3GA 1VIXA 1H8LA 2B4DB 2QJ8A 4AVBA 4KSIA 5IV0A 1MJ9A 2VBQA 2ANPA 4B13A 4J3GA 2D4OA 4L8AA 2Q51A 3F8KA 2VEZA 4X3RA 3B3CA 1IIDA 1R43A 3FXTA 5FVJA 2KCWA 3S6KA 4R3LA 2ZEOA 3D2MA 4ZGYB 1ON0A 2BEIA 3GYAA 1NSAA 3VH9A 2JBJA 4I49A 2XEJA 4IAVA 2OOTA 4C2XA 3IFEA 4CGNA 4XNHC 5HH1A 4CGPA 1NMTA 4M6HA 3VWEA 5LYDA 2WSAA 4P44A 4KUAA 1Z8TA 1YW4A 2OZUA 3PFEA 4MHZA 3MRUA 1S3ZA 2HC9A 2QYVA 3RO0A 4RI1A 3TOBA 4PV6A 2PDOA 5LYLA 4NGTA 2OZHA 3B7IA 2PR8A 1DTDA 1YLOA 4JJXA 4B11A 4CGOA 1IYLA 4MY3A 4NCZA 6CPAA 3R9GA 1TF8A 3BHXA 3TTHA 4KOVA 2PJ8A 2IL4A 4Y49B 2B5GB 4P4JA 2XEFA 2Q4ZA 4P45A 3SI2A 4H2KA 4Q36A 5AG5A 4B5PB 3GKRA 2Q7BA 1R57A 5K8MA 3CXPA 4Z65A 1S7KA 3RZAA 5CPAA 1IB1E 2CIJA 4F0XA 4FD6A 2O28A 3W6SA 4MCSA 3SJEA 5LRKA 2V8GA 1IYKA 4XPDB 4MFQA 4MFJA 2FT0A 3DDDA 4KVME 2G3AA 4DJLA 2CF4A 3GIUA 1LFWA 2QIRA 4OC4A 5AG7A 2Q44A 3R1KA 5C88A 3TFYA 3C26A 3D7FA 1GHEA 3IWGA 1NSLA 3EC4A 4B6ZA 1I12A 4KSAA 2EWBA 4A33A 1LCPA 4NGSA 1M4LA 1AUGA 3D7DA 2QMLA 3WC6A 4F8ZA 2PE3A 2PC1A 1YR0A 4DYOA 3KI9A 1YLEA 2PJBA 1TKJA 2GREA 2IJZA 3DR6A 3DR8A 5F47A 2IMOA 4YWYA 4R9MA 3BLNA 3ISZA 5LRGA 3S6HA 4A2ZA 3PFOA 4KZTA 5J1QA 3R96A 2B4BA 3PB9X 4KOXA 4KORA 4O23A 1YSJA 4M85A 4HNYB 3TX8A 2PJ2A 1KUVA 2PVVA 3LMSA 3TO7A 1FT7A 4PQAA 2V8HA 2ARHA 2DF5A 4UFXA 3D66A 4MFZA 2P6EA 1DE4C 4MHDA 4MFKA 4DUKA 3FYNA 3IGRA 4XNHB 3R9EA 4Q7AA 4RS2A 1ZG8A 3BJ7A 3B3VA 1BAVA 4PSXA 2VZZA 4KUBA 3FRMA 4C2YA 2FS5A 2P6FA 4YFJA 3IU2A 2JEVA 1YGHA 3KGQA 3NA6A 4NGNA 5DS0A 2CY2A 2ZPAA 3D3SA 1CP7A 5LYIA 2O4HA 1S5KA 2REFA 2VZYA 1M1DA 2FIWA 2WPXA 3OWCA 5E96A 5IX3A 2I79A 3PP9A 1YVKA 4CYQA 4LX9A 1PCAA 1YQEA 2FL4A 4IUSA 2JDCA 1TIQA 1WK4A 1X10A 4BBHA 5JPHA 2Y0MA 5HMNA 3MN8A 4P4BA 4Y49C 2ABZA 2YGWA 5C82A 3FVLA 3W91A 2AFOA 2ZEHA 4MXUA 1YW6A 3HUVA 4JYWA 5G1ZA 1Z4EA 2Z11A 5THWA 4A39A 4AG9A 4A32A 2AFMA 2PJ4A 2RC4A 3PGPA 1ZLHA 1LOKA 1P0HA 1BPNA 1IY7A 8CPAA 3QAHA 3PEIA 3S6FA 4XPDC 2B3VA 3V8IA 2PJ5A 4ZBGA 3IIBA 3LACA 3S9LA 1BLLE 3H8GA 4IHMA 2VL1A 1IOFA 2Z3OA 1KUYA 3ISXA 4KVXA 2GIVA 4JXQA 4MFLA 4R57A 3V7ZA 3CDXA 4RUHA 4DNCA 2BCOA 2J9AA 2X7BA 4ZX9A 4MFPA 5AGEA 5F09A 1XEBA 4X8IA 4TWEA 3D68A 1V0CA 2QVPA 4CRZB 1HDUA 1TXRA 2OB0A 1PU9A 1QSRA 1TKFA 1IOIA 2C6PA 4UFWA 4NGMA 4ORFA 1BOBA 5EBVA 2C1CA 4QUSA 1KWMA 1U6MA 3S9MA 4BD9A 4OIDA 1CPXA 1Q7LA 2WUUA 4WJBA 5F49A 2REEA 2PVWA 3CXQA 3GUXA 3SXOA 4IK2A 1XBUA 4M6IA 1RTQA 1XE4A 1VKCA 4MMOA 4UEFA 1A2ZA 1K4JA 1M4DA 4OADA 2Z0ZA 3FBUA 2DPTA 1GYTA 2FCKA 3P2FA 2O53A 4YRHA 3D7HA 2PJ6A 5G21A 3IWEA 3VWDA 2PIYA 3GB0A 5CBMA 3GY9A 3I1UA 4NSQA 3EO4A 2PR1A 1Z8WA 4W9YA 4ZY1A 4PSWA 5AG6A 1LAPA 2J8NA 1S7NA 3FH4A 1CJWA 3QB8A 2Z3MA 2CTCA 4NF1A 4P10A 4Q38A 5K8PA 4E8OA 5EMIA 4U9ZA 1LAMA 4H6ZA 2HV2A 3FEEA 4M3SA 5IB0A 2FE7A 4CAVA 1F57A 2VI7A 3CZXA 3V38A 1CBXA 1Q2DA 3DGVA 4CS0B 3RAMA 4MHNA 2BUEA 4NEXA 5D29A 5K8NA 3IO1A 2VQYA 3NE7A 4HKFA 2PJ9A 4ZI6A 4PPZA 5A28A 3SHPA 3EXNA 2D4PA 4EVYA 2I00A 2XEIA 4MJ8A 3KR5A 5HVFA 3D2PA 5HVHA 3RYOA 1KZFA 1S60A 1AYEA 4UA3A 1MJBA 4IF5A 4KOUA 2YNCA 3JUWA 2ZEMA 3R9FA 4F0YA 5I0CA 3LD2A 5GCNA 3KQZA 1TF9A 4NFRA 2GANA 4CGMA 1B87A 2AJ6A 2BSWA 2EO8A 4LQGA 2EBJA 2G9DA 4MCQA 4CYPA 3TE4A 1PUAA 2EK9A 3B3WA 1QSOA 2NSMA 3PB7X 3H8EA 1I1DA 3ZZIA 2ZEGA 3NFZA 1IGBA 4JWPA 1KUXA 4OC5A 4II9A 4FAIA 5K8OA 4CAEA 1Z2LA 1ZO0A 3K9TA 4MCPA 1LANA 2AFSA 3JVNA 1XIXA 3A9LA 4UEEA 4ZY2A 5HVGA 4CYNA 3UY5A 3FEDA 2ZXVA 3VARA 4MHPA 4FBEA 3N7ZA 4R3KA 3F0AA 2CNMA 2Z3PA 4KSFA 4E0AA 4F6AA 3TO9A 2FIAA 3B35A 2J8RA 1NE9A 3CPAA 4KOYA
chains in the Genus database with same CATH topology
2HQYA 2ZW4A 5J8FA 5F46A 5BWAB 2G3TA 2JDDA 4OAEA 5H84A 2BL1A 4B12A 1LRZA 3G8WA 1SQHA 4PK2A 2CXAA 5KTDA 4KS9A 4UCMA 1YREA 3T90A 2JLMA 2WPWA 4KLVA 1Y9KA 3F5BA 4AB7A 4UCNA 2Q04A 4CAFA 4MI4A 2DXQA 2VXKA 1RXTA 4FD7A 2ATRA 2A4NA 4H6UA 5JQ4A 1FY7A 2R8VA 1Y9WA 2G0BA 4H89A 2F5IA 2EVNA 2EUIA 2OZGA 3ZJ0A 2QECA 4JXRA 2FXFA 1YVOA 4UBRA 2DPSA 2J8MA 1QSTA 4AVAA 4GS4A 2Z3NA 4C7HA 2PSWA 3W6XA 2B4DA 2B58A 4ONUA 4B5OA 4JLYA 1CM0A 3S6GA 2Z3KA 4NXYA 1VHSA 4UCPA 1RO5A 3WR7A 4E2AA 2FSRA 2Z3LA 1Z4RA 2H5MA 2OU2A 2K5TA 1BO4A 3E0KA 3MGDA 4YGOA 4AG7A 4L89A 2R98A 2ZW5A 5CNPA 1YK3A 3DSBA 3BJ8A 3PZJA 4C7IA 1N71A 3TCVA 4AVCA 4A30A 4UWIA 2B5GA 2OH1A 3D8PA 3LODA 4QVTA 1M44A 2AE6A 4B5PA 1Y7RA 3KKWA 5KTCA 4HNWB 4UWJA 4CAWA 2YNEA 1Z9UA 4HNXB 3FNCA 1Q2CA 1MK4A 5EC4A 4FD5A 1L0CA 1UFHA 1IICA 4QBJA 3IU1A 3TT2A 4KVOE 5H86A 3EFAA 3I9SA 2P0WA 3FIXA 2ZW6A 4X5KA 3FB3A 2P6GA 3SXNA 2Q4VA 4KOSA 2CNTA 3R95A 1QSMA 2PQ8A 3K9UA 4CGLA 2B3UA 1WWZA 1M4IA 2Z10A 1OZPA 2NMTA 4UFVA 3G3SA 4LUAA 1S7FA 1P4NA 5DWNA 3TOAA 2Q0YA 1M4GA 4XPLA 4B10A 1MJAA 1Q2YA 5A27A 2Q4YA 5ISVA 1J4JA 2R7HA 4U9YA 2GE3A 3JTKA 4KOTA 2YNDA 4B14A 4A95A 4C68A 2CNSA 4A31A 1I21A 1XF8A 4MY0A 5F48A 5AG4A 4BMHA 4QB9A 4XPKA 4MBUA 2R1IA 3H5ZA 3EY5A 4CYOA 2C27A 3DNSA 3TO6A 4FD4A 5G20A 1XMTA 4JD6A 3H4QA 4CAXA 5KTAA 4CRYB 4KLWA 4PK3A 1YX0A 4OLLA 4QC6A 1S7LA 5G22A 4R87A 2YNCC 3P2HA 4KOWA 4U5YA 5DWMA 3T9YA 2PRBA 2ZW7A 5J8CA 3CXSA 2HUZA 1B6BA 3B8GA 4C2ZA 1QSNA 4K30A 3I3GA 2B4DB 4AVBA 5IV0A 1MJ9A 2VBQA 4B13A 4J3GA 2D4OA 4L8AA 3F8KA 2VEZA 1IIDA 3FXTA 5FVJA 2KCWA 3S6KA 4R3LA 3D2MA 4ZGYB 1ON0A 2BEIA 3GYAA 4I49A 4C2XA 4CGNA 4XNHC 5HH1A 4CGPA 1NMTA 3VWEA 2WSAA 4KUAA 2OZUA 1S3ZA 4RI1A 3TOBA 4PV6A 2PDOA 2OZHA 2PR8A 4JJXA 4B11A 4CGOA 1IYLA 4MY3A 4NCZA 3R9GA 3TTHA 4KOVA 2IL4A 4Y49B 2B5GB 4Q36A 5AG5A 4B5PB 3GKRA 2Q7BA 1R57A 3CXPA 1S7KA 1IB1E 4F0XA 4FD6A 2O28A 3W6SA 4XPDB 1IYKA 4MFQA 4MFJA 2FT0A 3DDDA 4KVME 2G3AA 2QIRA 5AG7A 2Q44A 3R1KA 5C88A 3TFYA 3C26A 1GHEA 3IWGA 1NSLA 3EC4A 1I12A 4KSAA 4A33A 2QMLA 2PC1A 1YR0A 1YLEA 3DR6A 3DR8A 5F47A 3S6HA 4R9MA 3BLNA 4A2ZA 4KZTA 3R96A 2B4BA 4KOXA 4KORA 4M85A 4HNYB 1KUVA 3TO7A 2ARHA 4UFXA 4MFZA 2P6EA 4MHDA 4MFKA 3FYNA 3IGRA 4XNHB 3R9EA 4RS2A 3BJ7A 4PSXA 2VZZA 4KUBA 3FRMA 4C2YA 2FS5A 2P6FA 4YFJA 3IU2A 2JEVA 1YGHA 2CY2A 2ZPAA 3D3SA 1S5KA 2REFA 2VZYA 1M1DA 2FIWA 2WPXA 3OWCA 5E96A 5IX3A 2I79A 3PP9A 1YVKA 4CYQA 4LX9A 2FL4A 4IUSA 2JDCA 1TIQA 1WK4A 4BBHA 5JPHA 2Y0MA 5HMNA 4Y49C 2YGWA 5C82A 3W91A 5G1ZA 1Z4EA 2Z11A 4AG9A 4A32A 2RC4A 3PGPA 1P0HA 3QAHA 3S6FA 4XPDC 2B3VA 3V8IA 4ZBGA 2Z3OA 4KVXA 1KUYA 4R57A 2GIVA 4JXQA 4MFLA 4DNCA 2X7BA 4MFPA 5AGEA 1XEBA 1V0CA 4CRZB 2OB0A 1PU9A 1QSRA 4UFWA 4ORFA 1BOBA 5EBVA 4QUSA 1U6MA 2WUUA 5F49A 2REEA 3CXQA 3SXOA 1XE4A 1VKCA 1K4JA 1M4DA 4OADA 2Z0ZA 3FBUA 2DPTA 4YRHA 2FCKA 3P2FA 5G21A 3IWEA 3VWDA 3GY9A 4NSQA 3EO4A 2PR1A 4PSWA 5AG6A 2J8NA 1S7NA 1CJWA 3QB8A 2Z3MA 4NF1A 4Q38A 4E8OA 4U9ZA 4H6ZA 2HV2A 4M3SA 5IB0A 2FE7A 4CAVA 2VI7A 1Q2DA 4CS0B 2BUEA 4NEXA 2VQYA 3NE7A 4HKFA 5A28A 3SHPA 3EXNA 2D4PA 4EVYA 2I00A 4MJ8A 3D2PA 3RYOA 1KZFA 1S60A 4UA3A 1MJBA 4IF5A 4KOUA 2YNCA 3JUWA 3R9FA 4F0YA 5I0CA 3LD2A 5GCNA 4CGMA 2GANA 1B87A 2AJ6A 2BSWA 4CYPA 3TE4A 1PUAA 1QSOA 1I1DA 3ZZIA 4JWPA 1KUXA 4II9A 4CAEA 1ZO0A 3JVNA 1XIXA 3A9LA 4CYNA 3UY5A 2ZXVA 3N7ZA 4R3KA 3F0AA 2CNMA 2Z3PA 4KSFA 4E0AA 4F6AA 3TO9A 2FIAA 2J8RA 1NE9A 4KOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU1 A;  2YNC C;  5AG5 A;  4CYP A;  4A2Z A;  2WUU A;  4A30 A;  5AG4 A;  4C2X A;  4CGN A;  4CGP A;  4UCP A;  2WSA A;  4CYQ A;  3H5Z A;  4CYO A;  4B12 A;  4B10 A;  4BBH A;  4CAE A;  5AGE A;  5G21 A;  4C2Z A;  3IWE A;  4UFX A;  5A27 A;  5A28 A;  5G20 A;  2YNE A;  4CYN A;  4UCM A;  5G1Z A;  4A32 A;  4B11 A;  5AG6 A;  5AG7 A;  4B13 A;  4CGO A;  3JTK A;  2YND A;  2YNC A;  4B14 A;  4UCN A;  4C7H A;  4CGL A;  4A95 A;  4C2Y A;  4CAF A;  4A33 A;  4C68 A;  4A31 A;  4UFW A;  4CGM A;  4C7I A;  3IU2 A;  5G22 A;  4UFV A; 
#chains in the Genus database with same CATH topology
 2PJ3 A;  2HQY A;  2ZW4 A;  2ZED A;  5J8F A;  5F46 A;  2C6G A;  4UIB A;  5BWA B;  3NH5 A;  2G3T A;  2JDD A;  4OP4 A;  4ZY0 A;  1Z8X A;  4OAE A;  5H84 A;  3FJU A;  1CP6 A;  2BL1 A;  3H8F A;  1VHE A;  4B12 A;  4ZYQ A;  2AFW A;  4ONW A;  5LYF A;  4PXE A;  1LRZ A;  3G8W A;  1SQH A;  1XRY A;  1ZLI A;  2CXA A;  3FMC A;  4PK2 A;  5KTD A;  4KS9 A;  4UCM A;  1YRE A;  3T90 A;  1F2P A;  4R76 A;  2JLM A;  2WPW A;  4OC2 A;  4KLV A;  1UWY A;  2Q7S A;  1IU8 A;  1Y9K A;  2FVG A;  3D7G A;  3F5B A;  3NH8 A;  4UCN A;  4AB7 A;  2OR4 A;  2Q04 A;  3CPX A;  4CAF A;  1OBR A;  4G1P A;  4MI4 A;  2DXQ A;  2VXK A;  1RXT A;  4FD7 A;  2ATR A;  4GM5 A;  4P4E A;  3KHZ A;  2A4N A;  4H6U A;  4WWV A;  1CX8 A;  1FNO A;  1FY7 A;  2R8V A;  3BI0 A;  4RN7 A;  5JQ4 A;  3TC8 A;  4K3N A;  1Y9W A;  2G0B A;  4H89 A;  1Y7E A;  2I3C A;  2RB7 A;  2ZEE A;  3PB4 X;  2F5I A;  4R6T A;  4FUU A;  1PYT B;  5LRJ A;  3IEH A;  2OZG A;  2EVN A;  2EUI A;  3RNZ A;  4P4D A;  3SJF A;  4A37 A;  3ZJ0 A;  1XOV A;  2QEC A;  4JXR A;  2PCU A;  2FXF A;  4ZX8 A;  1YVO A;  4OME A;  4UBR A;  2DPS A;  2GLF A;  2J8M A;  3KAS A;  5D8N A;  3S9N A;  3NE8 A;  1QST A;  4AVA A;  3BI1 A;  3PRT A;  2BOA A;  4GS4 A;  3K2K A;  2Z3N A;  4AXV A;  4C7H A;  2PJ7 A;  2PSW A;  2B4D A;  3SI0 A;  3W6X A;  1ELM P;  2B58 A;  4ONU A;  4B5O A;  4JLY A;  5HXD A;  5IB9 A;  1CM0 A;  3S6G A;  2Z3K A;  4NXY A;  2F8H A;  1VHS A;  3CT9 A;  1QMU A;  4UCP A;  4MHY A;  1RO5 A;  3WR7 A;  4E2A A;  1HEE A;  1ZG7 A;  2CTB A;  2FSR A;  2Z3L A;  2DEA A;  1X12 A;  2GU2 A;  3KZW A;  4R8F A;  1Z4R A;  4P4F A;  2H5M A;  2OU2 A;  2K5T A;  1BO4 A;  2V8V A;  3E0K A;  4JZ0 A;  4OC1 A;  2POK A;  3MGD A;  3WT4 A;  4MRI A;  4YGO A;  2PJC A;  2C6C A;  4AG7 A;  4OC3 A;  4YU9 A;  4L89 A;  2R98 A;  3FX6 A;  2ZW5 A;  5CNP A;  1YK3 A;  2PJ1 A;  3DSB A;  2AFU A;  2PIZ A;  3BJ8 A;  3PZJ A;  1ELL P;  4C7I A;  3JRU A;  1N71 A;  3TCV A;  3WC5 A;  4AVC A;  3L2N A;  2BO9 A;  4A30 A;  4UWI A;  4P6Y A;  3B2Y A;  2B5G A;  2OH1 A;  3D8P A;  4UIA A;  4A38 A;  3LOD A;  1AMP A;  1QQ9 A;  4QVT A;  1M44 A;  2HB6 A;  2AE6 A;  4X2T A;  1Y7R A;  3KKW A;  3PB6 X;  1VGY A;  3WAB A;  3WC7 A;  4B5P A;  1TKH A;  1XFO A;  5KTC A;  1YME A;  3NH4 A;  4HNW B;  4UWJ A;  4PXD A;  4CAW A;  4UF4 A;  2YNE A;  1Z9U A;  4HNX B;  4EWT A;  3FNC A;  2ZOF A;  1Q2C A;  5JM6 A;  4PXB A;  1MK4 A;  4PXC A;  5EC4 A;  4FD5 A;  2NYQ A;  1L0C A;  2PJ0 A;  1UFH A;  3VAT A;  4EFD A;  3T8W A;  3D4U A;  1IIC A;  4NGR A;  4QBJ A;  3IU1 A;  2WYR A;  2ZEF A;  3TT2 A;  1CPS A;  4KVO E;  5H86 A;  3EFA A;  1BPM A;  3I9S A;  4OC0 A;  2ZEL A;  4P4I A;  2JEW A;  2ZOG A;  3FF3 A;  2P0W A;  3FIX A;  2PJA A;  3D67 A;  2ZW6 A;  2GLJ A;  4X5K A;  3FB3 A;  3N5F A;  4GXH A;  2P6G A;  3SXN A;  2Q4V A;  1R3N A;  4KOS A;  4BIN A;  2PRQ A;  3HLP A;  3QNV A;  4NGQ A;  3BXM A;  3B3S A;  2CNT A;  1ARM A;  1XJO A;  1QSM A;  3R95 A;  2PQ8 A;  3K9U A;  3KQX A;  3SJX A;  4CGL A;  1Y0R A;  2V77 A;  2AFZ A;  1WWZ A;  1M4I A;  2B3U A;  2Z10 A;  3KL9 A;  1OZP A;  2NMT A;  4UFV A;  4TNU A;  3G3S A;  4LUA A;  1S7F A;  2Q43 A;  4CPA A;  2V8D A;  1P4N A;  1CG2 A;  5DWN A;  3TOA A;  2Q0Y A;  1EE3 P;  4NJR A;  2ODF A;  1M4G A;  4XPL A;  4B10 A;  1JQG A;  1MJA A;  1Q2Y A;  2JBK A;  5A27 A;  2Q4Y A;  4MCR A;  5ISV A;  4FWU A;  1J4J A;  1ZG9 A;  4R7M A;  2GFQ A;  2F7V A;  2R7H A;  4U9Y A;  5I4M A;  1Y0Y A;  2GE3 A;  3JTK A;  4UEZ A;  4KOT A;  2YND A;  4LQ6 A;  4B14 A;  1JWQ A;  4A95 A;  1F2O A;  2ZEN A;  4C68 A;  2CNS A;  3PBE A;  4A31 A;  4F9V A;  3GLJ A;  1I21 A;  1HDQ A;  1XF8 A;  3IJ3 A;  3KR4 A;  3PBB A;  4MY0 A;  5F48 A;  5AG4 A;  4BMH A;  2IQ6 A;  4QB9 A;  4XPK A;  4MBU A;  2RFH A;  4F9U A;  2R1I A;  3H5Z A;  3EY5 A;  4CYO A;  4A94 A;  2C27 A;  3FEC A;  1VHO A;  3DNS A;  3TO6 A;  5ELY A;  4FD4 A;  5G20 A;  3SI1 A;  2XEG A;  3B3T A;  3SJG A;  1ARL A;  1XMT A;  4JD6 A;  2EK8 A;  3H4Q A;  4OIW A;  4CAX A;  4NJQ A;  5KTA A;  4CRY B;  4KLW A;  4PK3 A;  1YX0 A;  1Z5R A;  3PB8 X;  4OLL A;  4QC6 A;  3IC1 A;  1XMB A;  1S7L A;  3IWW A;  4OKO A;  3KHX A;  3QAY A;  2AFX A;  5G22 A;  4R87 A;  4M6G A;  1Z8L A;  2YNC C;  3P2H A;  4KOW A;  4U5Y A;  5DWM A;  3T9Y A;  5JGF A;  2PRB A;  2ZW7 A;  4HPS A;  5J8C A;  3LWU A;  4EME A;  3DLJ A;  5JH9 A;  3CXS A;  4NGP A;  2ZEP A;  7CPA A;  2HUZ A;  2WZN A;  1B6B A;  3B8G A;  4C2Z A;  1QSN A;  4K30 A;  3RBU A;  3I3G A;  1VIX A;  1H8L A;  2B4D B;  2QJ8 A;  4AVB A;  4KSI A;  5IV0 A;  1MJ9 A;  2VBQ A;  2ANP A;  4B13 A;  4J3G A;  2D4O A;  4L8A A;  2Q51 A;  3F8K A;  2VEZ A;  4X3R A;  3B3C A;  1IID A;  1R43 A;  3FXT A;  5FVJ A;  2KCW A;  3S6K A;  4R3L A;  2ZEO A;  3D2M A;  4ZGY B;  1ON0 A;  2BEI A;  3GYA A;  1NSA A;  3VH9 A;  2JBJ A;  4I49 A;  2XEJ A;  4IAV A;  2OOT A;  4C2X A;  3IFE A;  4CGN A;  4XNH C;  5HH1 A;  4CGP A;  1NMT A;  4M6H A;  3VWE A;  5LYD A;  2WSA A;  4P44 A;  4KUA A;  1Z8T A;  1YW4 A;  2OZU A;  3PFE A;  4MHZ A;  3MRU A;  1S3Z A;  2HC9 A;  2QYV A;  3RO0 A;  4RI1 A;  3TOB A;  4PV6 A;  2PDO A;  5LYL A;  4NGT A;  2OZH A;  3B7I A;  2PR8 A;  1DTD A;  1YLO A;  4JJX A;  4B11 A;  4CGO A;  1IYL A;  4MY3 A;  4NCZ A;  6CPA A;  3R9G A;  1TF8 A;  3BHX A;  3TTH A;  4KOV A;  2PJ8 A;  2IL4 A;  4Y49 B;  2B5G B;  4P4J A;  2XEF A;  2Q4Z A;  4P45 A;  3SI2 A;  4H2K A;  4Q36 A;  5AG5 A;  4B5P B;  3GKR A;  2Q7B A;  1R57 A;  5K8M A;  3CXP A;  4Z65 A;  1S7K A;  3RZA A;  5CPA A;  1IB1 E;  2CIJ A;  4F0X A;  4FD6 A;  2O28 A;  3W6S A;  4MCS A;  3SJE A;  5LRK A;  2V8G A;  1IYK A;  4XPD B;  4MFQ A;  4MFJ A;  2FT0 A;  3DDD A;  4KVM E;  2G3A A;  4DJL A;  2CF4 A;  3GIU A;  1LFW A;  2QIR A;  4OC4 A;  5AG7 A;  2Q44 A;  3R1K A;  5C88 A;  3TFY A;  3C26 A;  3D7F A;  1GHE A;  3IWG A;  1NSL A;  3EC4 A;  4B6Z A;  1I12 A;  4KSA A;  2EWB A;  4A33 A;  1LCP A;  4NGS A;  1M4L A;  1AUG A;  3D7D A;  2QML A;  3WC6 A;  4F8Z A;  2PE3 A;  2PC1 A;  1YR0 A;  4DYO A;  3KI9 A;  1YLE A;  2PJB A;  1TKJ A;  2GRE A;  2IJZ A;  3DR6 A;  3DR8 A;  5F47 A;  2IMO A;  4YWY A;  4R9M A;  3BLN A;  3ISZ A;  5LRG A;  3S6H A;  4A2Z A;  3PFO A;  4KZT A;  5J1Q A;  3R96 A;  2B4B A;  3PB9 X;  4KOX A;  4KOR A;  4O23 A;  1YSJ A;  4M85 A;  4HNY B;  3TX8 A;  2PJ2 A;  1KUV A;  2PVV A;  3LMS A;  3TO7 A;  1FT7 A;  4PQA A;  2V8H A;  2ARH A;  2DF5 A;  4UFX A;  3D66 A;  4MFZ A;  2P6E A;  1DE4 C;  4MHD A;  4MFK A;  4DUK A;  3FYN A;  3IGR A;  4XNH B;  3R9E A;  4Q7A A;  4RS2 A;  1ZG8 A;  3BJ7 A;  3B3V A;  1BAV A;  4PSX A;  2VZZ A;  4KUB A;  3FRM A;  4C2Y A;  2FS5 A;  2P6F A;  4YFJ A;  3IU2 A;  2JEV A;  1YGH A;  3KGQ A;  3NA6 A;  4NGN A;  5DS0 A;  2CY2 A;  2ZPA A;  3D3S A;  1CP7 A;  5LYI A;  2O4H A;  1S5K A;  2REF A;  2VZY A;  1M1D A;  2FIW A;  2WPX A;  3OWC A;  5E96 A;  5IX3 A;  2I79 A;  3PP9 A;  1YVK A;  4CYQ A;  4LX9 A;  1PCA A;  1YQE A;  2FL4 A;  4IUS A;  2JDC A;  1TIQ A;  1WK4 A;  1X10 A;  4BBH A;  5JPH A;  2Y0M A;  5HMN A;  3MN8 A;  4P4B A;  4Y49 C;  2ABZ A;  2YGW A;  5C82 A;  3FVL A;  3W91 A;  2AFO A;  2ZEH A;  4MXU A;  1YW6 A;  3HUV A;  4JYW A;  5G1Z A;  1Z4E A;  2Z11 A;  5THW A;  4A39 A;  4AG9 A;  4A32 A;  2AFM A;  2PJ4 A;  2RC4 A;  3PGP A;  1ZLH A;  1LOK A;  1P0H A;  1BPN A;  1IY7 A;  8CPA A;  3QAH A;  3PEI A;  3S6F A;  4XPD C;  2B3V A;  3V8I A;  2PJ5 A;  4ZBG A;  3IIB A;  3LAC A;  3S9L A;  1BLL E;  3H8G A;  4IHM A;  2VL1 A;  1IOF A;  2Z3O A;  1KUY A;  3ISX A;  4KVX A;  2GIV A;  4JXQ A;  4MFL A;  4R57 A;  3V7Z A;  3CDX A;  4RUH A;  4DNC A;  2BCO A;  2J9A A;  2X7B A;  4ZX9 A;  4MFP A;  5AGE A;  5F09 A;  1XEB A;  4X8I A;  4TWE A;  3D68 A;  1V0C A;  2QVP A;  4CRZ B;  1HDU A;  1TXR A;  2OB0 A;  1PU9 A;  1QSR A;  1TKF A;  1IOI A;  2C6P A;  4UFW A;  4NGM A;  4ORF A;  1BOB A;  5EBV A;  2C1C A;  4QUS A;  1KWM A;  1U6M A;  3S9M A;  4BD9 A;  4OID A;  1CPX A;  1Q7L A;  2WUU A;  4WJB A;  5F49 A;  2REE A;  2PVW A;  3CXQ A;  3GUX A;  3SXO A;  4IK2 A;  1XBU A;  4M6I A;  1RTQ A;  1XE4 A;  1VKC A;  4MMO A;  4UEF A;  1A2Z A;  1K4J A;  1M4D A;  4OAD A;  2Z0Z A;  3FBU A;  2DPT A;  1GYT A;  2FCK A;  3P2F A;  2O53 A;  4YRH A;  3D7H A;  2PJ6 A;  5G21 A;  3IWE A;  3VWD A;  2PIY A;  3GB0 A;  5CBM A;  3GY9 A;  3I1U A;  4NSQ A;  3EO4 A;  2PR1 A;  1Z8W A;  4W9Y A;  4ZY1 A;  4PSW A;  5AG6 A;  1LAP A;  2J8N A;  1S7N A;  3FH4 A;  1CJW A;  3QB8 A;  2Z3M A;  2CTC A;  4NF1 A;  4P10 A;  4Q38 A;  5K8P A;  4E8O A;  5EMI A;  4U9Z A;  1LAM A;  4H6Z A;  2HV2 A;  3FEE A;  4M3S A;  5IB0 A;  2FE7 A;  4CAV A;  1F57 A;  2VI7 A;  3CZX A;  3V38 A;  1CBX A;  1Q2D A;  3DGV A;  4CS0 B;  3RAM A;  4MHN A;  2BUE A;  4NEX A;  5D29 A;  5K8N A;  3IO1 A;  2VQY A;  3NE7 A;  4HKF A;  2PJ9 A;  4ZI6 A;  4PPZ A;  5A28 A;  3SHP A;  3EXN A;  2D4P A;  4EVY A;  2I00 A;  2XEI A;  4MJ8 A;  3KR5 A;  5HVF A;  3D2P A;  5HVH A;  3RYO A;  1KZF A;  1S60 A;  1AYE A;  4UA3 A;  1MJB A;  4IF5 A;  4KOU A;  2YNC A;  3JUW A;  2ZEM A;  3R9F A;  4F0Y A;  5I0C A;  3LD2 A;  5GCN A;  3KQZ A;  1TF9 A;  4NFR A;  2GAN A;  4CGM A;  1B87 A;  2AJ6 A;  2BSW A;  2EO8 A;  4LQG A;  2EBJ A;  2G9D A;  4MCQ A;  4CYP A;  3TE4 A;  1PUA A;  2EK9 A;  3B3W A;  1QSO A;  2NSM A;  3PB7 X;  3H8E A;  1I1D A;  3ZZI A;  2ZEG A;  3NFZ A;  1IGB A;  4JWP A;  1KUX A;  4OC5 A;  4II9 A;  4FAI A;  5K8O A;  4CAE A;  1Z2L A;  1ZO0 A;  3K9T A;  4MCP A;  1LAN A;  2AFS A;  3JVN A;  1XIX A;  3A9L A;  4UEE A;  4ZY2 A;  5HVG A;  4CYN A;  3UY5 A;  3FED A;  2ZXV A;  3VAR A;  4MHP A;  4FBE A;  3N7Z A;  4R3K A;  3F0A A;  2CNM A;  2Z3P A;  4KSF A;  4E0A A;  4F6A A;  3TO9 A;  2FIA A;  3B35 A;  2J8R A;  1NE9 A;  3CPA A;  4KOY A; 
#chains in the Genus database with same CATH homology
 2HQY A;  2ZW4 A;  5J8F A;  5F46 A;  5BWA B;  2G3T A;  2JDD A;  4OAE A;  5H84 A;  2BL1 A;  4B12 A;  1LRZ A;  3G8W A;  1SQH A;  4PK2 A;  2CXA A;  5KTD A;  4KS9 A;  4UCM A;  1YRE A;  3T90 A;  2JLM A;  2WPW A;  4KLV A;  1Y9K A;  3F5B A;  4AB7 A;  4UCN A;  2Q04 A;  4CAF A;  4MI4 A;  2DXQ A;  2VXK A;  1RXT A;  4FD7 A;  2ATR A;  2A4N A;  4H6U A;  5JQ4 A;  1FY7 A;  2R8V A;  1Y9W A;  2G0B A;  4H89 A;  2F5I A;  2EVN A;  2EUI A;  2OZG A;  3ZJ0 A;  2QEC A;  4JXR A;  2FXF A;  1YVO A;  4UBR A;  2DPS A;  2J8M A;  1QST A;  4AVA A;  4GS4 A;  2Z3N A;  4C7H A;  2PSW A;  3W6X A;  2B4D A;  2B58 A;  4ONU A;  4B5O A;  4JLY A;  1CM0 A;  3S6G A;  2Z3K A;  4NXY A;  1VHS A;  4UCP A;  1RO5 A;  3WR7 A;  4E2A A;  2FSR A;  2Z3L A;  1Z4R A;  2H5M A;  2OU2 A;  2K5T A;  1BO4 A;  3E0K A;  3MGD A;  4YGO A;  4AG7 A;  4L89 A;  2R98 A;  2ZW5 A;  5CNP A;  1YK3 A;  3DSB A;  3BJ8 A;  3PZJ A;  4C7I A;  1N71 A;  3TCV A;  4AVC A;  4A30 A;  4UWI A;  2B5G A;  2OH1 A;  3D8P A;  3LOD A;  4QVT A;  1M44 A;  2AE6 A;  4B5P A;  1Y7R A;  3KKW A;  5KTC A;  4HNW B;  4UWJ A;  4CAW A;  2YNE A;  1Z9U A;  4HNX B;  3FNC A;  1Q2C A;  1MK4 A;  5EC4 A;  4FD5 A;  1L0C A;  1UFH A;  1IIC A;  4QBJ A;  3IU1 A;  3TT2 A;  4KVO E;  5H86 A;  3EFA A;  3I9S A;  2P0W A;  3FIX A;  2ZW6 A;  4X5K A;  3FB3 A;  2P6G A;  3SXN A;  2Q4V A;  4KOS A;  2CNT A;  3R95 A;  1QSM A;  2PQ8 A;  3K9U A;  4CGL A;  2B3U A;  1WWZ A;  1M4I A;  2Z10 A;  1OZP A;  2NMT A;  4UFV A;  3G3S A;  4LUA A;  1S7F A;  1P4N A;  5DWN A;  3TOA A;  2Q0Y A;  1M4G A;  4XPL A;  4B10 A;  1MJA A;  1Q2Y A;  5A27 A;  2Q4Y A;  5ISV A;  1J4J A;  2R7H A;  4U9Y A;  2GE3 A;  3JTK A;  4KOT A;  2YND A;  4B14 A;  4A95 A;  4C68 A;  2CNS A;  4A31 A;  1I21 A;  1XF8 A;  4MY0 A;  5F48 A;  5AG4 A;  4BMH A;  4QB9 A;  4XPK A;  4MBU A;  2R1I A;  3H5Z A;  3EY5 A;  4CYO A;  2C27 A;  3DNS A;  3TO6 A;  4FD4 A;  5G20 A;  1XMT A;  4JD6 A;  3H4Q A;  4CAX A;  5KTA A;  4CRY B;  4KLW A;  4PK3 A;  1YX0 A;  4OLL A;  4QC6 A;  1S7L A;  5G22 A;  4R87 A;  2YNC C;  3P2H A;  4KOW A;  4U5Y A;  5DWM A;  3T9Y A;  2PRB A;  2ZW7 A;  5J8C A;  3CXS A;  2HUZ A;  1B6B A;  3B8G A;  4C2Z A;  1QSN A;  4K30 A;  3I3G A;  2B4D B;  4AVB A;  5IV0 A;  1MJ9 A;  2VBQ A;  4B13 A;  4J3G A;  2D4O A;  4L8A A;  3F8K A;  2VEZ A;  1IID A;  3FXT A;  5FVJ A;  2KCW A;  3S6K A;  4R3L A;  3D2M A;  4ZGY B;  1ON0 A;  2BEI A;  3GYA A;  4I49 A;  4C2X A;  4CGN A;  4XNH C;  5HH1 A;  4CGP A;  1NMT A;  3VWE A;  2WSA A;  4KUA A;  2OZU A;  1S3Z A;  4RI1 A;  3TOB A;  4PV6 A;  2PDO A;  2OZH A;  2PR8 A;  4JJX A;  4B11 A;  4CGO A;  1IYL A;  4MY3 A;  4NCZ A;  3R9G A;  3TTH A;  4KOV A;  2IL4 A;  4Y49 B;  2B5G B;  4Q36 A;  5AG5 A;  4B5P B;  3GKR A;  2Q7B A;  1R57 A;  3CXP A;  1S7K A;  1IB1 E;  4F0X A;  4FD6 A;  2O28 A;  3W6S A;  4XPD B;  1IYK A;  4MFQ A;  4MFJ A;  2FT0 A;  3DDD A;  4KVM E;  2G3A A;  2QIR A;  5AG7 A;  2Q44 A;  3R1K A;  5C88 A;  3TFY A;  3C26 A;  1GHE A;  3IWG A;  1NSL A;  3EC4 A;  1I12 A;  4KSA A;  4A33 A;  2QML A;  2PC1 A;  1YR0 A;  1YLE A;  3DR6 A;  3DR8 A;  5F47 A;  3S6H A;  4R9M A;  3BLN A;  4A2Z A;  4KZT A;  3R96 A;  2B4B A;  4KOX A;  4KOR A;  4M85 A;  4HNY B;  1KUV A;  3TO7 A;  2ARH A;  4UFX A;  4MFZ A;  2P6E A;  4MHD A;  4MFK A;  3FYN A;  3IGR A;  4XNH B;  3R9E A;  4RS2 A;  3BJ7 A;  4PSX A;  2VZZ A;  4KUB A;  3FRM A;  4C2Y A;  2FS5 A;  2P6F A;  4YFJ A;  3IU2 A;  2JEV A;  1YGH A;  2CY2 A;  2ZPA A;  3D3S A;  1S5K A;  2REF A;  2VZY A;  1M1D A;  2FIW A;  2WPX A;  3OWC A;  5E96 A;  5IX3 A;  2I79 A;  3PP9 A;  1YVK A;  4CYQ A;  4LX9 A;  2FL4 A;  4IUS A;  2JDC A;  1TIQ A;  1WK4 A;  4BBH A;  5JPH A;  2Y0M A;  5HMN A;  4Y49 C;  2YGW A;  5C82 A;  3W91 A;  5G1Z A;  1Z4E A;  2Z11 A;  4AG9 A;  4A32 A;  2RC4 A;  3PGP A;  1P0H A;  3QAH A;  3S6F A;  4XPD C;  2B3V A;  3V8I A;  4ZBG A;  2Z3O A;  4KVX A;  1KUY A;  4R57 A;  2GIV A;  4JXQ A;  4MFL A;  4DNC A;  2X7B A;  4MFP A;  5AGE A;  1XEB A;  1V0C A;  4CRZ B;  2OB0 A;  1PU9 A;  1QSR A;  4UFW A;  4ORF A;  1BOB A;  5EBV A;  4QUS A;  1U6M A;  2WUU A;  5F49 A;  2REE A;  3CXQ A;  3SXO A;  1XE4 A;  1VKC A;  1K4J A;  1M4D A;  4OAD A;  2Z0Z A;  3FBU A;  2DPT A;  4YRH A;  2FCK A;  3P2F A;  5G21 A;  3IWE A;  3VWD A;  3GY9 A;  4NSQ A;  3EO4 A;  2PR1 A;  4PSW A;  5AG6 A;  2J8N A;  1S7N A;  1CJW A;  3QB8 A;  2Z3M A;  4NF1 A;  4Q38 A;  4E8O A;  4U9Z A;  4H6Z A;  2HV2 A;  4M3S A;  5IB0 A;  2FE7 A;  4CAV A;  2VI7 A;  1Q2D A;  4CS0 B;  2BUE A;  4NEX A;  2VQY A;  3NE7 A;  4HKF A;  5A28 A;  3SHP A;  3EXN A;  2D4P A;  4EVY A;  2I00 A;  4MJ8 A;  3D2P A;  3RYO A;  1KZF A;  1S60 A;  4UA3 A;  1MJB A;  4IF5 A;  4KOU A;  2YNC A;  3JUW A;  3R9F A;  4F0Y A;  5I0C A;  3LD2 A;  5GCN A;  4CGM A;  2GAN A;  1B87 A;  2AJ6 A;  2BSW A;  4CYP A;  3TE4 A;  1PUA A;  1QSO A;  1I1D A;  3ZZI A;  4JWP A;  1KUX A;  4II9 A;  4CAE A;  1ZO0 A;  3JVN A;  1XIX A;  3A9L A;  4CYN A;  3UY5 A;  2ZXV A;  3N7Z A;  4R3K A;  3F0A A;  2CNM A;  2Z3P A;  4KSF A;  4E0A A;  4F6A A;  3TO9 A;  2FIA A;  2J8R A;  1NE9 A;  4KOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...