4CYQA

Leishmania major n-myristoyltransferase in complex with a hybrid inhibitor (compound 45).
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cyqA00
4C7HA 2YNDA 4UCMA 4C68A 3JTKA 5AGEA 4UCPA 5G21A 4B13A 5A27A 4UCNA 4A2ZA 3IU2A 5AG6A 4C2XA 5AG7A 4CGOA 4CYOA 4B11A 4CYPA 4C2YA 4A95A 4CYQA 5AG4A 4A32A 2YNCA 4BBHA 2WUUA 3H5ZA 4UFXA 4A33A 4B14A 2WSAA 2YNCC 4B10A 5G20A 4C7IA 4CYNA 2YNEA 5AG5A 4CAEA 5G22A 4B12A 4UFWA 3IU1A 4C2ZA 4UFVA 3IWEA 5G1ZA 5A28A 4CGNA 4CGLA 4CAFA 4A30A 4A31A 4CGPA 4CGMA
chains in the Genus database with same CATH superfamily
1A2ZA 2FT0A 2YNDA 2AFUA 5HVGA 1Z8TA 5G21A 1YLEA 3G8WA 4K3NA 1IB1E 1Z2LA 2F7VA 3SJGA 3W91A 4P44A 4LUAA 4CYPA 4C2YA 3NFZA 4NXYA 2GANA 4A32A 2C6CA 2IJZA 2HQYA 3LWUA 1S7LA 3MGDA 4PSWA 4B14A 4QB9A 1OZPA 2JEVA 3R9EA 4YGOA 4AXVA 1UFHA 2VI7A 2FS5A 2IMOA 1LRZA 4KLVA 2BO9A 4DNCA 1J4JA 1PUAA 1ARMA 3PFOA 4PXEA 3TOBA 4O23A 3CPXA 2J9AA 5ELYA 1YLOA 3SJXA 3SHPA 1Z8WA 4GS4A 4I49A 1AUGA 4A31A 2G3AA 1JQGA 3D4UA 5CBMA 1CP7A 5EMIA 4P4IA 2B5GB 3OWCA 4CAVA 2ZEDA 2JBKA 4XNHB 5ISVA 3PRTA 4CYQA 4A37A 4DYOA 5KTDA 4ONWA 4OC0A 2Q44A 2Z3PA 2ZW6A 3KR5A 4KSIA 4BMHA 4CPAA 3B3TA 2RFHA 2YNCC 3CPAA 3K2KA 1OBRA 1BPMA 3WC6A 3SXNA 1XMTA 2PVWA 2OOTA 2D4OA 1YK3A 4OC4A 1LOKA 4OC2A 1IU8A 2GIVA 3H8GA 4R76A 3D2PA 2WYRA 3FJUA 1DTDA 1R3NA 5IV0A 2O53A 2HV2A 2Z3NA 2IL4A 3NH5A 1BAVA 4Q36A 4C68A 3D7HA 4X2TA 1VHSA 1YMEA 3FEEA 4UCPA 2PCUA 2VXKA 3SI2A 4MBUA 4L89A 5AG7A 3GB0A 3GIUA 4A95A 2B4BA 2XEFA 2IQ6A 2WUUA 4MHDA 4U9ZA 1Z5RA 2QVPA 4OIDA 3VARA 2VZZA 1QQ9A 3WABA 2B4DA 4NCZA 5AG5A 4B12A 4KOUA 1P4NA 2KCWA 5I4MA 3H4QA 4P4JA 5G1ZA 4UA3A 2CNTA 3HUVA 5D29A 2Z3KA 2G9DA 1QSRA 4Y49B 4A38A 4B5OA 4ZY2A 3N5FA 1LAMA 2BSWA 4KORA 4X5KA 4P4DA 3KGQA 4RUHA 5K8PA 4UCMA 4MFKA 4RN7A 4R87A 2PRBA 2BOAA 2GFQA 3FIXA 4R57A 4II9A 4KZTA 3VH9A 1CX8A 2G3TA 4R9MA 4CYOA 3IWWA 5LYFA 3KQXA 1NMTA 2R8VA 4EMEA 4NGMA 4AG7A 1IICA 4OC1A 1IGBA 3P2HA 2DXQA 2R1IA 1CG2A 2WSAA 4FD4A 4JZ0A 4PQAA 2YNEA 4R3LA 5DS0A 4PK3A 5J1QA 2H5MA 1Q7LA 1YGHA 1Z8LA 4LQ6A 4AVBA 3UY5A 4E2AA 3FX6A 3G3SA 1PU9A 2JEWA 2PJ1A 3S6GA 3TC8A 4MHYA 1AYEA 5KTCA 1I12A 1VKCA 3D7DA 3K9UA 3TO7A 5HMNA 2PVVA 4CAFA 1Z8XA 4EVYA 4E0AA 1ELMP 4CAWA 1ZG7A 2WZNA 3DNSA 3KASA 4P6YA 3PB9X 1Y9WA 1MJBA 2FXFA 2PJ2A 3TCVA 2F8HA 2BCOA 3HLPA 4C2XA 1LAPA 3R1KA 4CGOA 5DWMA 4X3RA 4B11A 3EXNA 1FT7A 5F09A 5J8FA 4JYWA 1RTQA 2ZEPA 4M6HA 2I00A 1Z4EA 1Y7EA 2VBQA 1XE4A 3PP9A 4B10A 4ZBGA 1IOFA 4NSQA 2K5TA 3IO1A 3D66A 4M6GA 3PB8X 3KQZA 1ON0A 2FIWA 4QVTA 4AVCA 2DEAA 3H8EA 3D3SA 2PJBA 3IWEA 1Y7RA 4CRZB 2ZEHA 4NGTA 1B87A 3D7GA 4CAXA 3W6XA 1S7FA 3ISZA 1BOBA 4MRIA 4A30A 2R7HA 4UIAA 3EFAA 1YW4A 5I0CA 3NH4A 1AMPA 3FXTA 3DSBA 4ORFA 1I1DA 1S60A 4CGPA 5J8CA 2ZW4A 3SXOA 3B2YA 4QC6A 1P0HA 1Y0RA 4B13A 2OH1A 1YSJA 3BI1A 4UBRA 3IU2A 1CPSA 1S7KA 4KOSA 3S9NA 4HPSA 1HDUA 3EC4A 2GREA 3WR7A 5EBVA 5JGFA 5GCNA 4U9YA 1S5KA 3FF3A 3S9LA 2PJ4A 3D8PA 1F57A 2B58A 3P2FA 1TKHA 4QBJA 2EWBA 2RB7A 3CT9A 4AVAA 2CNSA 2NMTA 3GYAA 2FCKA 4F0YA 4ZGYB 4MCPA 5HXDA 1UWYA 1ZLIA 1TXRA 4PXDA 1TKFA 4EFDA 4HNXB 3F0AA 3D67A 3FECA 5EC4A 3TTHA 2C1CA 2Q7BA 2J8RA 4YU9A 1R43A 3WC7A 3TX8A 2CTBA 4M3SA 3GY9A 4OADA 3B8GA 4AG9A 4PV6A 1JWQA 2AFZA 1R57A 2B3VA 2NYQA 4P4FA 3ZZIA 4MCQA 3H5ZA 1S7NA 1XFOA 2QYVA 4KSAA 4A94A 1TF9A 3NE7A 5D8NA 4MFLA 4CYNA 4GM5A 2WPXA 3BLNA 2Z3LA 4UFWA 2QMLA 4B6ZA 2HC9A 4PPZA 3F8KA 1WWZA 2PRQA 2ZENA 3IIBA 5JM6A 3VWDA 3CZXA 3BI0A 3R9GA 4JWPA 2Q4VA 4G1PA 5IX3A 3BHXA 1KWMA 4UEZA 2PSWA 3WC5A 5C82A 3H8FA 1XEBA 2AE6A 4NGQA 3RAMA 2OB0A 3SJEA 1EE3P 1N71A 2ANPA 2V8GA 2D4PA 2F5IA 4UEFA 5DWNA 2PR1A 4XPDB 4MI4A 2PJ8A 2OZUA 2R98A 2ATRA 3E0KA 1XMBA 3B3WA 2PR8A 3QAYA 4CRYB 1M1DA 4FWUA 2CTCA 4UFVA 3W6SA 4KOYA 2Z0ZA 4F6AA 2CNMA 4B5PA 4A39A 3R9FA 5HVHA 2GU2A 4OAEA 4KOVA 4FBEA 1ARLA 2OZGA 3I9SA 3PGPA 3RYOA 3IWGA 4EWTA 2AFXA 2HB6A 4MY3A 1Y9KA 3S6FA 2PQ8A 3PBBA 1CPXA 1K4JA 1RXTA 4K30A 3TOAA 1YW6A 2DPTA 2JLMA 3B3VA 4NGNA 3RNZA 4NGPA 4Q7AA 3SI1A 1RO5A 2AFOA 2RC4A 2ZEEA 1TIQA 2O28A 2ZOGA 4IAVA 2ZXVA 5LRGA 2PC1A 2B4DB 2P0WA 3DR6A 3QNVA 2XEIA 8CPAA 2A4NA 5JH9A 3DDDA 2EK8A 3KKWA 4F8ZA 1NE9A 3KL9A 1GHEA 2AJ6A 3C26A 2Y0MA 3PFEA 5LRJA 3GLJA 3D2MA 4MFQA 5H84A 2QIRA 4IHMA 4R3KA 7CPAA 3T9YA 3B3SA 4OIWA 3D68A 2PJ6A 4CS0B 1TKJA 1VGYA 2Q7SA 2EVNA 4CGMA 1QSTA 4NGSA 2OR4A 4BD9A 5LYDA 1M4DA 1Z4RA 3SJFA 5AG6A 2PJ0A 4BBHA 4XNHC 1CP6A 2I79A 2GE3A 4OMEA 2WPWA 1LANA 5G20A 3KI9A 2ZW7A 3LODA 3B35A 1GYTA 4IK2A 4ZY0A 4P45A 4NFRA 3FNCA 4RS2A 3MN8A 1XRYA 4UWIA 3VWEA 4CGNA 4CGLA 4WWVA 1FNOA 1F2OA 1DE4C 1MJ9A 2REFA 3FRMA 1M4GA 3TE4A 2V8DA 1FY7A 1CBXA 1BPNA 2XEGA 2CF4A 2ZEMA 4QUSA 4RI1A 3VATA 4AB7A 3F5BA 3SI0A 4KVXA 3B7IA 2BEIA 2QJ8A 2DF5A 5IB9A 2C27A 2PJAA 4JD6A 2JDCA 4KSFA 1MK4A 1ZLHA 4TWEA 4X8IA 4FAIA 1VIXA 3TT2A 1IYLA 3S6KA 2ZELA 2Q51A 4M85A 4P10A 4ZX8A 5E96A 3IJ3A 5A28A 2ABZA 1QSOA 5LYLA 2FE7A 2PJ5A 3R96A 2PJ7A 4R6TA 1M44A 3PB4X 1TF8A 4KUBA 4M6IA 4MFJA 5K8OA 5KTAA 1ZO0A 4Y49C 5BWAB 4C7HA 2AFMA 3PEIA 3N7ZA 4UIBA 4MJ8A 4KLWA 2B5GA 5K8NA 5HH1A 1KUYA 2VEZA 1XJOA 5AG4A 2V8VA 2VZYA 3IFEA 4UF4A 3V38A 2O4HA 3RZAA 1Z9UA 3PZJA 4ZY1A 3FB3A 2P6FA 3FYNA 3IEHA 2FSRA 3KHXA 4OC5A 4ONUA 2VL1A 3JRUA 3CDXA 4MCSA 3IU1A 6CPAA 1XBUA 2OU2A 3BXMA 2C6PA 4KOXA 4UEEA 2JDDA 1CJWA 3B3CA 3CXSA 1ZG8A 3A9LA 5JPHA 2Q43A 1ELLP 2ARHA 5C88A 4MFZA 4GXHA 5LRKA 3WT4A 3DLJA 2X7BA 3DR8A 4PSXA 1IOIA 2P6EA 4FD6A 3IC1A 2Q04A 5F49A 2ZEOA 4YWYA 4WJBA 2GLJA 1YX0A 4HNYB 2G0BA 2Q0YA 4MHZA 4UCNA 4A2ZA 5A27A 4HNWB 3DGVA 5F47A 3LD2A 4JLYA 2EBJA 5H86A 4YRHA 3T8WA 1KZFA 4NEXA 2Q4YA 3RO0A 4XPLA 1BO4A 2FL4A 4C2ZA 1ZG9A 3NH8A 1HEEA 3T90A 4BINA 4JJXA 1LCPA 2BL1A 2CIJA 4FD7A 4FUUA 5JQ4A 3CXQA 1VHOA 2PJ9A 4F0XA 3BJ7A 3QAHA 2YGWA 4F9VA 2PIYA 4J3GA 4U5YA 1XIXA 2P6GA 4DUKA 1B6BA 2VQYA 3FH4A 3KHZA 3FEDA 4MMOA 3EO4A 4L8AA 3V8IA 2Z3MA 5HVFA 3NE8A 2HUZA 1IYKA 4OC3A 2CY2A 2GLFA 4KUAA 4MY0A 2Z10A 1IY7A 2PJCA 4MCRA 4NJRA 1QSNA 1YQEA 1YVKA 2PJ3A 3KR4A 2XEJA 4JXRA 5K8MA 1L0CA 4OKOA 4KVME 1IIDA 2EUIA 1I21A 3ZJ0A 2ZEGA 3FVLA 5IB0A 4B5PB 3K9TA 4OP4A 3NA6A 4H6ZA 1NSAA 4KS9A 1YVOA 2AFWA 4F9UA 2DPSA 4OLLA 3QB8A 4HKFA 4ZX9A 3RBUA 3V7ZA 4Q38A 2AFSA 1WK4A 2REEA 3JUWA 4LQGA 4DJLA 4LX9A 4MHNA 1SQHA 4H6UA 2JBJA 2B3UA 1U6MA 1YR0A 3LMSA 5THWA 2FVGA 1HDQA 5CPAA 1PCAA 1CM0A 3GUXA 4UWJA 1VHEA 1NSLA 4FD5A 4PK2A 2YNCA 1XF8A 3BJ8A 4PXBA 1F2PA 2PE3A 2C6GA 2POKA 3PB6X 4W9YA 4YFJA 4KOTA 1PYTB 5F46A 4JXQA 1BLLE 3FBUA 3KZWA 3S6HA 2V77A 1Q2YA 2ZW5A 3I3GA 4KVOE 4MXUA 4NGRA 5CNPA 5G22A 4CAEA 4NF1A 4MHPA 4Z65A 4PXCA 3JVNA 3S9MA 3TO9A 2QECA 2EO8A 3PB7X 2EK9A 3L2NA 4H2KA 3TO6A 5FVJA 1V0CA 2NSMA 4TNUA 1Q2DA 2OZHA 3I1UA 3FMCA 4P4EA 3LACA 2I3CA 2PDOA 1S3ZA 4XPKA 2ZPAA 2J8MA 2J8NA 3JTKA 2ZEFA 4P4BA 2FIAA 4R8FA 5AGEA 5F48A 1X10A 1X12A 1QSMA 3CXPA 3D7FA 2BUEA 3R95A 1KUXA 4R7MA 2Q4ZA 2Z11A 5LYIA 2ZOFA 4UFXA 4A33A 1LFWA 1M4IA 4H89A 4NJQA 3TFYA 2ODFA 4IUSA 1YREA 3EY5A 4IF5A 4XPDC 2V8HA 2PIZA 4C7IA 4ZI6A 3PBEA 2CXAA 2Z3OA 1QMUA 3MRUA 1Y0YA 4MFPA 4E8OA 1KUVA 1MJAA 3IGRA 4KOWA 1XOVA 4ZYQA 1M4LA 1H8LA 1Q2CA 3ISXA 3GKRA
chains in the Genus database with same CATH topology
2FT0A 2YNDA 5G21A 1YLEA 3G8WA 1IB1E 3W91A 4CYPA 4LUAA 4C2YA 4NXYA 2GANA 4A32A 2HQYA 1S7LA 3MGDA 4PSWA 4B14A 4QB9A 1OZPA 2JEVA 3R9EA 4YGOA 2VI7A 1UFHA 2FS5A 4KLVA 1LRZA 4DNCA 1J4JA 1PUAA 3TOBA 3SHPA 4GS4A 4I49A 4A31A 2G3AA 2B5GB 3OWCA 4CAVA 4XNHB 5ISVA 4CYQA 5KTDA 2Q44A 2Z3PA 2ZW6A 4BMHA 2YNCC 3SXNA 1XMTA 2D4OA 1YK3A 2GIVA 3D2PA 5IV0A 2HV2A 2Z3NA 2IL4A 4Q36A 4C68A 1VHSA 4UCPA 2VXKA 4MBUA 4L89A 5AG7A 4A95A 2B4BA 2WUUA 4MHDA 4U9ZA 2VZZA 2B4DA 4NCZA 5AG5A 4B12A 4KOUA 1P4NA 2KCWA 3H4QA 5G1ZA 4UA3A 2CNTA 2Z3KA 1QSRA 4Y49B 4B5OA 2BSWA 4KORA 4X5KA 4UCMA 4MFKA 4R87A 2PRBA 3FIXA 4R57A 4II9A 4KZTA 2G3TA 4R9MA 4CYOA 1NMTA 2R8VA 4AG7A 1IICA 3P2HA 2DXQA 2R1IA 2WSAA 4FD4A 4R3LA 4C7IA 2YNEA 4PK3A 2H5MA 1YGHA 4AVBA 3UY5A 4E2AA 3G3SA 3S6GA 1PU9A 5KTCA 1I12A 1VKCA 3K9UA 3TO7A 5HMNA 4CAFA 4EVYA 4E0AA 4CAWA 3DNSA 1Y9WA 1MJBA 2FXFA 3TCVA 4C2XA 4CGOA 3R1KA 5DWMA 4B11A 3EXNA 5J8FA 2I00A 1Z4EA 2VBQA 1XE4A 3PP9A 4B10A 4ZBGA 4NSQA 2K5TA 1ON0A 2FIWA 4QVTA 4AVCA 3D3SA 3IWEA 4CRZB 1Y7RA 4CAXA 1B87A 3W6XA 1S7FA 1BOBA 4A30A 2R7HA 3EFAA 5I0CA 3FXTA 4CGPA 3DSBA 4ORFA 1I1DA 1S60A 5J8CA 2ZW4A 3SXOA 4QC6A 1P0HA 4B13A 2OH1A 4UBRA 3IU2A 1S7KA 4KOSA 3EC4A 3WR7A 5EBVA 5GCNA 4U9YA 1S5KA 3D8PA 2B58A 3P2FA 4QBJA 4AVAA 2CNSA 2NMTA 3GYAA 2FCKA 4F0YA 4ZGYB 4HNXB 3F0AA 3TTHA 5EC4A 2Q7BA 2J8RA 4M3SA 3GY9A 4OADA 3B8GA 4AG9A 4PV6A 2B3VA 3ZZIA 1R57A 3H5ZA 1S7NA 4KSAA 3NE7A 4MFLA 4CYNA 2WPXA 3BLNA 2Z3LA 4UFWA 2QMLA 3F8KA 1WWZA 3VWDA 3R9GA 4JWPA 2Q4VA 5IX3A 5C82A 2PSWA 1XEBA 2AE6A 2OB0A 1N71A 2D4PA 2F5IA 5DWNA 2PR1A 4XPDB 4MI4A 2OZUA 2R98A 2ATRA 3E0KA 2PR8A 4CRYB 1M1DA 4UFVA 3W6SA 4KOYA 2Z0ZA 4F6AA 2CNMA 4B5PA 3R9FA 4OAEA 4KOVA 2OZGA 3I9SA 3PGPA 3RYOA 3IWGA 4MY3A 1Y9KA 3S6FA 2PQ8A 1RXTA 1K4JA 4K30A 2DPTA 2JLMA 1RO5A 2RC4A 1TIQA 2O28A 2ZXVA 2PC1A 2B4DB 2P0WA 3DR6A 2A4NA 3DDDA 3KKWA 1NE9A 1GHEA 2AJ6A 3C26A 2Y0MA 3D2MA 4MFQA 5H84A 2QIRA 4R3KA 3T9YA 4CS0B 4CGMA 2EVNA 1QSTA 1M4DA 1Z4RA 5AG6A 4BBHA 4XNHC 2I79A 2GE3A 2WPWA 5G20A 2ZW7A 3LODA 3FNCA 4RS2A 4UWIA 3VWEA 4CGNA 4CGLA 1MJ9A 2REFA 3FRMA 1M4GA 3TE4A 1FY7A 4QUSA 4RI1A 4AB7A 3F5BA 4KVXA 2BEIA 2C27A 4KSFA 4JD6A 2JDCA 1MK4A 3TT2A 1IYLA 3S6KA 4M85A 5E96A 5A28A 1QSOA 2FE7A 3R96A 1M44A 4KUBA 4MFJA 5KTAA 1ZO0A 4Y49C 5BWAB 4C7HA 3N7ZA 4MJ8A 4KLWA 2B5GA 5HH1A 1KUYA 2VEZA 5AG4A 2VZYA 1Z9UA 3PZJA 3FB3A 2P6FA 3FYNA 2FSRA 4ONUA 3IU1A 2OU2A 5JPHA 4KOXA 2JDDA 1CJWA 3CXSA 3A9LA 2ARHA 5C88A 4MFZA 2X7BA 3DR8A 4PSXA 2P6EA 4FD6A 5F49A 2Q04A 5A27A 1YX0A 4HNYB 2G0BA 2Q0YA 4UCNA 4A2ZA 4HNWB 5F47A 3LD2A 4JLYA 5H86A 4YRHA 1KZFA 4NEXA 2Q4YA 4XPLA 1BO4A 2FL4A 4C2ZA 3T90A 4JJXA 2BL1A 5JQ4A 4FD7A 3CXQA 4F0XA 3BJ7A 3QAHA 2YGWA 4J3GA 4U5YA 1XIXA 2P6GA 1B6BA 2VQYA 3EO4A 4L8AA 3V8IA 2Z3MA 2HUZA 1IYKA 2CY2A 4KUAA 4MY0A 2Z10A 1QSNA 1YVKA 4JXRA 1L0CA 4KVME 1IIDA 2EUIA 1I21A 3ZJ0A 5IB0A 4B5PB 4H6ZA 4KS9A 1YVOA 2DPSA 4OLLA 3QB8A 4HKFA 4Q38A 1WK4A 2REEA 3JUWA 4LX9A 1SQHA 4H6UA 2B3UA 1U6MA 1YR0A 1CM0A 4UWJA 1NSLA 4FD5A 4PK2A 2YNCA 1XF8A 3BJ8A 4YFJA 4KOTA 5F46A 4JXQA 3S6HA 3FBUA 3I3GA 1Q2YA 2ZW5A 4KVOE 4CAEA 5G22A 5CNPA 4NF1A 3JVNA 3TO9A 2QECA 3TO6A 5FVJA 1V0CA 1Q2DA 2OZHA 2PDOA 1S3ZA 4XPKA 2ZPAA 2J8MA 2J8NA 3JTKA 3TOAA 5AGEA 2FIAA 5F48A 1QSMA 3CXPA 2BUEA 3R95A 1KUXA 2Z11A 4UFXA 4A33A 1M4IA 4H89A 3TFYA 4IUSA 1YREA 3EY5A 4IF5A 4XPDC 2CXAA 2Z3OA 4MFPA 4E8OA 1KUVA 1MJAA 3IGRA 4KOWA 1Q2CA 3GKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7H A;  2YND A;  4UCM A;  4C68 A;  3JTK A;  5AGE A;  4UCP A;  5G21 A;  4B13 A;  5A27 A;  4UCN A;  4A2Z A;  3IU2 A;  5AG6 A;  4C2X A;  5AG7 A;  4CGO A;  4CYO A;  4B11 A;  4CYP A;  4C2Y A;  4A95 A;  4CYQ A;  5AG4 A;  4A32 A;  2YNC A;  4BBH A;  2WUU A;  3H5Z A;  4UFX A;  4A33 A;  4B14 A;  2WSA A;  2YNC C;  4B10 A;  5G20 A;  4C7I A;  4CYN A;  2YNE A;  5AG5 A;  4CAE A;  5G22 A;  4B12 A;  4UFW A;  3IU1 A;  4C2Z A;  4UFV A;  3IWE A;  5G1Z A;  5A28 A;  4CGN A;  4CGL A;  4CAF A;  4A30 A;  4A31 A;  4CGP A;  4CGM A; 
#chains in the Genus database with same CATH topology
 1A2Z A;  2FT0 A;  2YND A;  2AFU A;  5HVG A;  1Z8T A;  5G21 A;  1YLE A;  3G8W A;  4K3N A;  1IB1 E;  1Z2L A;  2F7V A;  3SJG A;  3W91 A;  4P44 A;  4LUA A;  4CYP A;  4C2Y A;  3NFZ A;  4NXY A;  2GAN A;  4A32 A;  2C6C A;  2IJZ A;  2HQY A;  3LWU A;  1S7L A;  3MGD A;  4PSW A;  4B14 A;  4QB9 A;  1OZP A;  2JEV A;  3R9E A;  4YGO A;  4AXV A;  1UFH A;  2VI7 A;  2FS5 A;  2IMO A;  1LRZ A;  4KLV A;  2BO9 A;  4DNC A;  1J4J A;  1PUA A;  1ARM A;  3PFO A;  4PXE A;  3TOB A;  4O23 A;  3CPX A;  2J9A A;  5ELY A;  1YLO A;  3SJX A;  3SHP A;  1Z8W A;  4GS4 A;  4I49 A;  1AUG A;  4A31 A;  2G3A A;  1JQG A;  3D4U A;  5CBM A;  1CP7 A;  5EMI A;  4P4I A;  2B5G B;  3OWC A;  4CAV A;  2ZED A;  2JBK A;  4XNH B;  5ISV A;  3PRT A;  4CYQ A;  4A37 A;  4DYO A;  5KTD A;  4ONW A;  4OC0 A;  2Q44 A;  2Z3P A;  2ZW6 A;  3KR5 A;  4KSI A;  4BMH A;  4CPA A;  3B3T A;  2RFH A;  2YNC C;  3CPA A;  3K2K A;  1OBR A;  1BPM A;  3WC6 A;  3SXN A;  1XMT A;  2PVW A;  2OOT A;  2D4O A;  1YK3 A;  4OC4 A;  1LOK A;  4OC2 A;  1IU8 A;  2GIV A;  3H8G A;  4R76 A;  3D2P A;  2WYR A;  3FJU A;  1DTD A;  1R3N A;  5IV0 A;  2O53 A;  2HV2 A;  2Z3N A;  2IL4 A;  3NH5 A;  1BAV A;  4Q36 A;  4C68 A;  3D7H A;  4X2T A;  1VHS A;  1YME A;  3FEE A;  4UCP A;  2PCU A;  2VXK A;  3SI2 A;  4MBU A;  4L89 A;  5AG7 A;  3GB0 A;  3GIU A;  4A95 A;  2B4B A;  2XEF A;  2IQ6 A;  2WUU A;  4MHD A;  4U9Z A;  1Z5R A;  2QVP A;  4OID A;  3VAR A;  2VZZ A;  1QQ9 A;  3WAB A;  2B4D A;  4NCZ A;  5AG5 A;  4B12 A;  4KOU A;  1P4N A;  2KCW A;  5I4M A;  3H4Q A;  4P4J A;  5G1Z A;  4UA3 A;  2CNT A;  3HUV A;  5D29 A;  2Z3K A;  2G9D A;  1QSR A;  4Y49 B;  4A38 A;  4B5O A;  4ZY2 A;  3N5F A;  1LAM A;  2BSW A;  4KOR A;  4X5K A;  4P4D A;  3KGQ A;  4RUH A;  5K8P A;  4UCM A;  4MFK A;  4RN7 A;  4R87 A;  2PRB A;  2BOA A;  2GFQ A;  3FIX A;  4R57 A;  4II9 A;  4KZT A;  3VH9 A;  1CX8 A;  2G3T A;  4R9M A;  4CYO A;  3IWW A;  5LYF A;  3KQX A;  1NMT A;  2R8V A;  4EME A;  4NGM A;  4AG7 A;  1IIC A;  4OC1 A;  1IGB A;  3P2H A;  2DXQ A;  2R1I A;  1CG2 A;  2WSA A;  4FD4 A;  4JZ0 A;  4PQA A;  2YNE A;  4R3L A;  5DS0 A;  4PK3 A;  5J1Q A;  2H5M A;  1Q7L A;  1YGH A;  1Z8L A;  4LQ6 A;  4AVB A;  3UY5 A;  4E2A A;  3FX6 A;  3G3S A;  1PU9 A;  2JEW A;  2PJ1 A;  3S6G A;  3TC8 A;  4MHY A;  1AYE A;  5KTC A;  1I12 A;  1VKC A;  3D7D A;  3K9U A;  3TO7 A;  5HMN A;  2PVV A;  4CAF A;  1Z8X A;  4EVY A;  4E0A A;  1ELM P;  4CAW A;  1ZG7 A;  2WZN A;  3DNS A;  3KAS A;  4P6Y A;  3PB9 X;  1Y9W A;  1MJB A;  2FXF A;  2PJ2 A;  3TCV A;  2F8H A;  2BCO A;  3HLP A;  4C2X A;  1LAP A;  3R1K A;  4CGO A;  5DWM A;  4X3R A;  4B11 A;  3EXN A;  1FT7 A;  5F09 A;  5J8F A;  4JYW A;  1RTQ A;  2ZEP A;  4M6H A;  2I00 A;  1Z4E A;  1Y7E A;  2VBQ A;  1XE4 A;  3PP9 A;  4B10 A;  4ZBG A;  1IOF A;  4NSQ A;  2K5T A;  3IO1 A;  3D66 A;  4M6G A;  3PB8 X;  3KQZ A;  1ON0 A;  2FIW A;  4QVT A;  4AVC A;  2DEA A;  3H8E A;  3D3S A;  2PJB A;  3IWE A;  1Y7R A;  4CRZ B;  2ZEH A;  4NGT A;  1B87 A;  3D7G A;  4CAX A;  3W6X A;  1S7F A;  3ISZ A;  1BOB A;  4MRI A;  4A30 A;  2R7H A;  4UIA A;  3EFA A;  1YW4 A;  5I0C A;  3NH4 A;  1AMP A;  3FXT A;  3DSB A;  4ORF A;  1I1D A;  1S60 A;  4CGP A;  5J8C A;  2ZW4 A;  3SXO A;  3B2Y A;  4QC6 A;  1P0H A;  1Y0R A;  4B13 A;  2OH1 A;  1YSJ A;  3BI1 A;  4UBR A;  3IU2 A;  1CPS A;  1S7K A;  4KOS A;  3S9N A;  4HPS A;  1HDU A;  3EC4 A;  2GRE A;  3WR7 A;  5EBV A;  5JGF A;  5GCN A;  4U9Y A;  1S5K A;  3FF3 A;  3S9L A;  2PJ4 A;  3D8P A;  1F57 A;  2B58 A;  3P2F A;  1TKH A;  4QBJ A;  2EWB A;  2RB7 A;  3CT9 A;  4AVA A;  2CNS A;  2NMT A;  3GYA A;  2FCK A;  4F0Y A;  4ZGY B;  4MCP A;  5HXD A;  1UWY A;  1ZLI A;  1TXR A;  4PXD A;  1TKF A;  4EFD A;  4HNX B;  3F0A A;  3D67 A;  3FEC A;  5EC4 A;  3TTH A;  2C1C A;  2Q7B A;  2J8R A;  4YU9 A;  1R43 A;  3WC7 A;  3TX8 A;  2CTB A;  4M3S A;  3GY9 A;  4OAD A;  3B8G A;  4AG9 A;  4PV6 A;  1JWQ A;  2AFZ A;  1R57 A;  2B3V A;  2NYQ A;  4P4F A;  3ZZI A;  4MCQ A;  3H5Z A;  1S7N A;  1XFO A;  2QYV A;  4KSA A;  4A94 A;  1TF9 A;  3NE7 A;  5D8N A;  4MFL A;  4CYN A;  4GM5 A;  2WPX A;  3BLN A;  2Z3L A;  4UFW A;  2QML A;  4B6Z A;  2HC9 A;  4PPZ A;  3F8K A;  1WWZ A;  2PRQ A;  2ZEN A;  3IIB A;  5JM6 A;  3VWD A;  3CZX A;  3BI0 A;  3R9G A;  4JWP A;  2Q4V A;  4G1P A;  5IX3 A;  3BHX A;  1KWM A;  4UEZ A;  2PSW A;  3WC5 A;  5C82 A;  3H8F A;  1XEB A;  2AE6 A;  4NGQ A;  3RAM A;  2OB0 A;  3SJE A;  1EE3 P;  1N71 A;  2ANP A;  2V8G A;  2D4P A;  2F5I A;  4UEF A;  5DWN A;  2PR1 A;  4XPD B;  4MI4 A;  2PJ8 A;  2OZU A;  2R98 A;  2ATR A;  3E0K A;  1XMB A;  3B3W A;  2PR8 A;  3QAY A;  4CRY B;  1M1D A;  4FWU A;  2CTC A;  4UFV A;  3W6S A;  4KOY A;  2Z0Z A;  4F6A A;  2CNM A;  4B5P A;  4A39 A;  3R9F A;  5HVH A;  2GU2 A;  4OAE A;  4KOV A;  4FBE A;  1ARL A;  2OZG A;  3I9S A;  3PGP A;  3RYO A;  3IWG A;  4EWT A;  2AFX A;  2HB6 A;  4MY3 A;  1Y9K A;  3S6F A;  2PQ8 A;  3PBB A;  1CPX A;  1K4J A;  1RXT A;  4K30 A;  3TOA A;  1YW6 A;  2DPT A;  2JLM A;  3B3V A;  4NGN A;  3RNZ A;  4NGP A;  4Q7A A;  3SI1 A;  1RO5 A;  2AFO A;  2RC4 A;  2ZEE A;  1TIQ A;  2O28 A;  2ZOG A;  4IAV A;  2ZXV A;  5LRG A;  2PC1 A;  2B4D B;  2P0W A;  3DR6 A;  3QNV A;  2XEI A;  8CPA A;  2A4N A;  5JH9 A;  3DDD A;  2EK8 A;  3KKW A;  4F8Z A;  1NE9 A;  3KL9 A;  1GHE A;  2AJ6 A;  3C26 A;  2Y0M A;  3PFE A;  5LRJ A;  3GLJ A;  3D2M A;  4MFQ A;  5H84 A;  2QIR A;  4IHM A;  4R3K A;  7CPA A;  3T9Y A;  3B3S A;  4OIW A;  3D68 A;  2PJ6 A;  4CS0 B;  1TKJ A;  1VGY A;  2Q7S A;  2EVN A;  4CGM A;  1QST A;  4NGS A;  2OR4 A;  4BD9 A;  5LYD A;  1M4D A;  1Z4R A;  3SJF A;  5AG6 A;  2PJ0 A;  4BBH A;  4XNH C;  1CP6 A;  2I79 A;  2GE3 A;  4OME A;  2WPW A;  1LAN A;  5G20 A;  3KI9 A;  2ZW7 A;  3LOD A;  3B35 A;  1GYT A;  4IK2 A;  4ZY0 A;  4P45 A;  4NFR A;  3FNC A;  4RS2 A;  3MN8 A;  1XRY A;  4UWI A;  3VWE A;  4CGN A;  4CGL A;  4WWV A;  1FNO A;  1F2O A;  1DE4 C;  1MJ9 A;  2REF A;  3FRM A;  1M4G A;  3TE4 A;  2V8D A;  1FY7 A;  1CBX A;  1BPN A;  2XEG A;  2CF4 A;  2ZEM A;  4QUS A;  4RI1 A;  3VAT A;  4AB7 A;  3F5B A;  3SI0 A;  4KVX A;  3B7I A;  2BEI A;  2QJ8 A;  2DF5 A;  5IB9 A;  2C27 A;  2PJA A;  4JD6 A;  2JDC A;  4KSF A;  1MK4 A;  1ZLH A;  4TWE A;  4X8I A;  4FAI A;  1VIX A;  3TT2 A;  1IYL A;  3S6K A;  2ZEL A;  2Q51 A;  4M85 A;  4P10 A;  4ZX8 A;  5E96 A;  3IJ3 A;  5A28 A;  2ABZ A;  1QSO A;  5LYL A;  2FE7 A;  2PJ5 A;  3R96 A;  2PJ7 A;  4R6T A;  1M44 A;  3PB4 X;  1TF8 A;  4KUB A;  4M6I A;  4MFJ A;  5K8O A;  5KTA A;  1ZO0 A;  4Y49 C;  5BWA B;  4C7H A;  2AFM A;  3PEI A;  3N7Z A;  4UIB A;  4MJ8 A;  4KLW A;  2B5G A;  5K8N A;  5HH1 A;  1KUY A;  2VEZ A;  1XJO A;  5AG4 A;  2V8V A;  2VZY A;  3IFE A;  4UF4 A;  3V38 A;  2O4H A;  3RZA A;  1Z9U A;  3PZJ A;  4ZY1 A;  3FB3 A;  2P6F A;  3FYN A;  3IEH A;  2FSR A;  3KHX A;  4OC5 A;  4ONU A;  2VL1 A;  3JRU A;  3CDX A;  4MCS A;  3IU1 A;  6CPA A;  1XBU A;  2OU2 A;  3BXM A;  2C6P A;  4KOX A;  4UEE A;  2JDD A;  1CJW A;  3B3C A;  3CXS A;  1ZG8 A;  3A9L A;  5JPH A;  2Q43 A;  1ELL P;  2ARH A;  5C88 A;  4MFZ A;  4GXH A;  5LRK A;  3WT4 A;  3DLJ A;  2X7B A;  3DR8 A;  4PSX A;  1IOI A;  2P6E A;  4FD6 A;  3IC1 A;  2Q04 A;  5F49 A;  2ZEO A;  4YWY A;  4WJB A;  2GLJ A;  1YX0 A;  4HNY B;  2G0B A;  2Q0Y A;  4MHZ A;  4UCN A;  4A2Z A;  5A27 A;  4HNW B;  3DGV A;  5F47 A;  3LD2 A;  4JLY A;  2EBJ A;  5H86 A;  4YRH A;  3T8W A;  1KZF A;  4NEX A;  2Q4Y A;  3RO0 A;  4XPL A;  1BO4 A;  2FL4 A;  4C2Z A;  1ZG9 A;  3NH8 A;  1HEE A;  3T90 A;  4BIN A;  4JJX A;  1LCP A;  2BL1 A;  2CIJ A;  4FD7 A;  4FUU A;  5JQ4 A;  3CXQ A;  1VHO A;  2PJ9 A;  4F0X A;  3BJ7 A;  3QAH A;  2YGW A;  4F9V A;  2PIY A;  4J3G A;  4U5Y A;  1XIX A;  2P6G A;  4DUK A;  1B6B A;  2VQY A;  3FH4 A;  3KHZ A;  3FED A;  4MMO A;  3EO4 A;  4L8A A;  3V8I A;  2Z3M A;  5HVF A;  3NE8 A;  2HUZ A;  1IYK A;  4OC3 A;  2CY2 A;  2GLF A;  4KUA A;  4MY0 A;  2Z10 A;  1IY7 A;  2PJC A;  4MCR A;  4NJR A;  1QSN A;  1YQE A;  1YVK A;  2PJ3 A;  3KR4 A;  2XEJ A;  4JXR A;  5K8M A;  1L0C A;  4OKO A;  4KVM E;  1IID A;  2EUI A;  1I21 A;  3ZJ0 A;  2ZEG A;  3FVL A;  5IB0 A;  4B5P B;  3K9T A;  4OP4 A;  3NA6 A;  4H6Z A;  1NSA A;  4KS9 A;  1YVO A;  2AFW A;  4F9U A;  2DPS A;  4OLL A;  3QB8 A;  4HKF A;  4ZX9 A;  3RBU A;  3V7Z A;  4Q38 A;  2AFS A;  1WK4 A;  2REE A;  3JUW A;  4LQG A;  4DJL A;  4LX9 A;  4MHN A;  1SQH A;  4H6U A;  2JBJ A;  2B3U A;  1U6M A;  1YR0 A;  3LMS A;  5THW A;  2FVG A;  1HDQ A;  5CPA A;  1PCA A;  1CM0 A;  3GUX A;  4UWJ A;  1VHE A;  1NSL A;  4FD5 A;  4PK2 A;  2YNC A;  1XF8 A;  3BJ8 A;  4PXB A;  1F2P A;  2PE3 A;  2C6G A;  2POK A;  3PB6 X;  4W9Y A;  4YFJ A;  4KOT A;  1PYT B;  5F46 A;  4JXQ A;  1BLL E;  3FBU A;  3KZW A;  3S6H A;  2V77 A;  1Q2Y A;  2ZW5 A;  3I3G A;  4KVO E;  4MXU A;  4NGR A;  5CNP A;  5G22 A;  4CAE A;  4NF1 A;  4MHP A;  4Z65 A;  4PXC A;  3JVN A;  3S9M A;  3TO9 A;  2QEC A;  2EO8 A;  3PB7 X;  2EK9 A;  3L2N A;  4H2K A;  3TO6 A;  5FVJ A;  1V0C A;  2NSM A;  4TNU A;  1Q2D A;  2OZH A;  3I1U A;  3FMC A;  4P4E A;  3LAC A;  2I3C A;  2PDO A;  1S3Z A;  4XPK A;  2ZPA A;  2J8M A;  2J8N A;  3JTK A;  2ZEF A;  4P4B A;  2FIA A;  4R8F A;  5AGE A;  5F48 A;  1X10 A;  1X12 A;  1QSM A;  3CXP A;  3D7F A;  2BUE A;  3R95 A;  1KUX A;  4R7M A;  2Q4Z A;  2Z11 A;  5LYI A;  2ZOF A;  4UFX A;  4A33 A;  1LFW A;  1M4I A;  4H89 A;  4NJQ A;  3TFY A;  2ODF A;  4IUS A;  1YRE A;  3EY5 A;  4IF5 A;  4XPD C;  2V8H A;  2PIZ A;  4C7I A;  4ZI6 A;  3PBE A;  2CXA A;  2Z3O A;  1QMU A;  3MRU A;  1Y0Y A;  4MFP A;  4E8O A;  1KUV A;  1MJA A;  3IGR A;  4KOW A;  1XOV A;  4ZYQ A;  1M4L A;  1H8L A;  1Q2C A;  3ISX A;  3GKR A; 
#chains in the Genus database with same CATH homology
 2FT0 A;  2YND A;  5G21 A;  1YLE A;  3G8W A;  1IB1 E;  3W91 A;  4CYP A;  4LUA A;  4C2Y A;  4NXY A;  2GAN A;  4A32 A;  2HQY A;  1S7L A;  3MGD A;  4PSW A;  4B14 A;  4QB9 A;  1OZP A;  2JEV A;  3R9E A;  4YGO A;  2VI7 A;  1UFH A;  2FS5 A;  4KLV A;  1LRZ A;  4DNC A;  1J4J A;  1PUA A;  3TOB A;  3SHP A;  4GS4 A;  4I49 A;  4A31 A;  2G3A A;  2B5G B;  3OWC A;  4CAV A;  4XNH B;  5ISV A;  4CYQ A;  5KTD A;  2Q44 A;  2Z3P A;  2ZW6 A;  4BMH A;  2YNC C;  3SXN A;  1XMT A;  2D4O A;  1YK3 A;  2GIV A;  3D2P A;  5IV0 A;  2HV2 A;  2Z3N A;  2IL4 A;  4Q36 A;  4C68 A;  1VHS A;  4UCP A;  2VXK A;  4MBU A;  4L89 A;  5AG7 A;  4A95 A;  2B4B A;  2WUU A;  4MHD A;  4U9Z A;  2VZZ A;  2B4D A;  4NCZ A;  5AG5 A;  4B12 A;  4KOU A;  1P4N A;  2KCW A;  3H4Q A;  5G1Z A;  4UA3 A;  2CNT A;  2Z3K A;  1QSR A;  4Y49 B;  4B5O A;  2BSW A;  4KOR A;  4X5K A;  4UCM A;  4MFK A;  4R87 A;  2PRB A;  3FIX A;  4R57 A;  4II9 A;  4KZT A;  2G3T A;  4R9M A;  4CYO A;  1NMT A;  2R8V A;  4AG7 A;  1IIC A;  3P2H A;  2DXQ A;  2R1I A;  2WSA A;  4FD4 A;  4R3L A;  4C7I A;  2YNE A;  4PK3 A;  2H5M A;  1YGH A;  4AVB A;  3UY5 A;  4E2A A;  3G3S A;  3S6G A;  1PU9 A;  5KTC A;  1I12 A;  1VKC A;  3K9U A;  3TO7 A;  5HMN A;  4CAF A;  4EVY A;  4E0A A;  4CAW A;  3DNS A;  1Y9W A;  1MJB A;  2FXF A;  3TCV A;  4C2X A;  4CGO A;  3R1K A;  5DWM A;  4B11 A;  3EXN A;  5J8F A;  2I00 A;  1Z4E A;  2VBQ A;  1XE4 A;  3PP9 A;  4B10 A;  4ZBG A;  4NSQ A;  2K5T A;  1ON0 A;  2FIW A;  4QVT A;  4AVC A;  3D3S A;  3IWE A;  4CRZ B;  1Y7R A;  4CAX A;  1B87 A;  3W6X A;  1S7F A;  1BOB A;  4A30 A;  2R7H A;  3EFA A;  5I0C A;  3FXT A;  4CGP A;  3DSB A;  4ORF A;  1I1D A;  1S60 A;  5J8C A;  2ZW4 A;  3SXO A;  4QC6 A;  1P0H A;  4B13 A;  2OH1 A;  4UBR A;  3IU2 A;  1S7K A;  4KOS A;  3EC4 A;  3WR7 A;  5EBV A;  5GCN A;  4U9Y A;  1S5K A;  3D8P A;  2B58 A;  3P2F A;  4QBJ A;  4AVA A;  2CNS A;  2NMT A;  3GYA A;  2FCK A;  4F0Y A;  4ZGY B;  4HNX B;  3F0A A;  3TTH A;  5EC4 A;  2Q7B A;  2J8R A;  4M3S A;  3GY9 A;  4OAD A;  3B8G A;  4AG9 A;  4PV6 A;  2B3V A;  3ZZI A;  1R57 A;  3H5Z A;  1S7N A;  4KSA A;  3NE7 A;  4MFL A;  4CYN A;  2WPX A;  3BLN A;  2Z3L A;  4UFW A;  2QML A;  3F8K A;  1WWZ A;  3VWD A;  3R9G A;  4JWP A;  2Q4V A;  5IX3 A;  5C82 A;  2PSW A;  1XEB A;  2AE6 A;  2OB0 A;  1N71 A;  2D4P A;  2F5I A;  5DWN A;  2PR1 A;  4XPD B;  4MI4 A;  2OZU A;  2R98 A;  2ATR A;  3E0K A;  2PR8 A;  4CRY B;  1M1D A;  4UFV A;  3W6S A;  4KOY A;  2Z0Z A;  4F6A A;  2CNM A;  4B5P A;  3R9F A;  4OAE A;  4KOV A;  2OZG A;  3I9S A;  3PGP A;  3RYO A;  3IWG A;  4MY3 A;  1Y9K A;  3S6F A;  2PQ8 A;  1RXT A;  1K4J A;  4K30 A;  2DPT A;  2JLM A;  1RO5 A;  2RC4 A;  1TIQ A;  2O28 A;  2ZXV A;  2PC1 A;  2B4D B;  2P0W A;  3DR6 A;  2A4N A;  3DDD A;  3KKW A;  1NE9 A;  1GHE A;  2AJ6 A;  3C26 A;  2Y0M A;  3D2M A;  4MFQ A;  5H84 A;  2QIR A;  4R3K A;  3T9Y A;  4CS0 B;  4CGM A;  2EVN A;  1QST A;  1M4D A;  1Z4R A;  5AG6 A;  4BBH A;  4XNH C;  2I79 A;  2GE3 A;  2WPW A;  5G20 A;  2ZW7 A;  3LOD A;  3FNC A;  4RS2 A;  4UWI A;  3VWE A;  4CGN A;  4CGL A;  1MJ9 A;  2REF A;  3FRM A;  1M4G A;  3TE4 A;  1FY7 A;  4QUS A;  4RI1 A;  4AB7 A;  3F5B A;  4KVX A;  2BEI A;  2C27 A;  4KSF A;  4JD6 A;  2JDC A;  1MK4 A;  3TT2 A;  1IYL A;  3S6K A;  4M85 A;  5E96 A;  5A28 A;  1QSO A;  2FE7 A;  3R96 A;  1M44 A;  4KUB A;  4MFJ A;  5KTA A;  1ZO0 A;  4Y49 C;  5BWA B;  4C7H A;  3N7Z A;  4MJ8 A;  4KLW A;  2B5G A;  5HH1 A;  1KUY A;  2VEZ A;  5AG4 A;  2VZY A;  1Z9U A;  3PZJ A;  3FB3 A;  2P6F A;  3FYN A;  2FSR A;  4ONU A;  3IU1 A;  2OU2 A;  5JPH A;  4KOX A;  2JDD A;  1CJW A;  3CXS A;  3A9L A;  2ARH A;  5C88 A;  4MFZ A;  2X7B A;  3DR8 A;  4PSX A;  2P6E A;  4FD6 A;  5F49 A;  2Q04 A;  5A27 A;  1YX0 A;  4HNY B;  2G0B A;  2Q0Y A;  4UCN A;  4A2Z A;  4HNW B;  5F47 A;  3LD2 A;  4JLY A;  5H86 A;  4YRH A;  1KZF A;  4NEX A;  2Q4Y A;  4XPL A;  1BO4 A;  2FL4 A;  4C2Z A;  3T90 A;  4JJX A;  2BL1 A;  5JQ4 A;  4FD7 A;  3CXQ A;  4F0X A;  3BJ7 A;  3QAH A;  2YGW A;  4J3G A;  4U5Y A;  1XIX A;  2P6G A;  1B6B A;  2VQY A;  3EO4 A;  4L8A A;  3V8I A;  2Z3M A;  2HUZ A;  1IYK A;  2CY2 A;  4KUA A;  4MY0 A;  2Z10 A;  1QSN A;  1YVK A;  4JXR A;  1L0C A;  4KVM E;  1IID A;  2EUI A;  1I21 A;  3ZJ0 A;  5IB0 A;  4B5P B;  4H6Z A;  4KS9 A;  1YVO A;  2DPS A;  4OLL A;  3QB8 A;  4HKF A;  4Q38 A;  1WK4 A;  2REE A;  3JUW A;  4LX9 A;  1SQH A;  4H6U A;  2B3U A;  1U6M A;  1YR0 A;  1CM0 A;  4UWJ A;  1NSL A;  4FD5 A;  4PK2 A;  2YNC A;  1XF8 A;  3BJ8 A;  4YFJ A;  4KOT A;  5F46 A;  4JXQ A;  3S6H A;  3FBU A;  3I3G A;  1Q2Y A;  2ZW5 A;  4KVO E;  4CAE A;  5G22 A;  5CNP A;  4NF1 A;  3JVN A;  3TO9 A;  2QEC A;  3TO6 A;  5FVJ A;  1V0C A;  1Q2D A;  2OZH A;  2PDO A;  1S3Z A;  4XPK A;  2ZPA A;  2J8M A;  2J8N A;  3JTK A;  3TOA A;  5AGE A;  2FIA A;  5F48 A;  1QSM A;  3CXP A;  2BUE A;  3R95 A;  1KUX A;  2Z11 A;  4UFX A;  4A33 A;  1M4I A;  4H89 A;  3TFY A;  4IUS A;  1YRE A;  3EY5 A;  4IF5 A;  4XPD C;  2CXA A;  2Z3O A;  4MFP A;  4E8O A;  1KUV A;  1MJA A;  3IGR A;  4KOW A;  1Q2C A;  3GKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...