4CYQA

Leishmania major n-myristoyltransferase in complex with a hybrid inhibitor (compound 45).
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cyqA00
4C2ZA 5A27A 4C2XA 4UCNA 5G22A 4C7HA 4CYNA 5G1ZA 4A2ZA 4B14A 5AG6A 4CGOA 4B11A 4UCPA 4CYQA 3H5ZA 3IU2A 4A30A 5AG7A 4CGLA 2YNDA 4B10A 4CYPA 4B12A 4B13A 4CAEA 2WSAA 5G21A 4A33A 4C7IA 3IU1A 4CYOA 4UFVA 3IWEA 5AG5A 4CAFA 5A28A 4A32A 4CGNA 5AG4A 5AGEA 4A31A 4C2YA 2YNCA 4UFWA 2YNEA 3JTKA 4UCMA 5G20A 4BBHA 4CGPA 4A95A 4UFXA 2WUUA 2YNCC 4CGMA 4C68A
chains in the Genus database with same CATH superfamily
4CAXA 3FEEA 4UCNA 4F8ZA 1XIXA 1P4NA 1Z2LA 4YWYA 4UIBA 4CS0B 2IMOA 2B3UA 4UWJA 4LUAA 3B3WA 1QSOA 1QQ9A 4MFQA 2AFUA 2EK8A 2OOTA 4A37A 8CPAA 4CGLA 4II9A 5ELYA 3WABA 4B12A 4P4EA 2CF4A 2J9AA 2WSAA 3UY5A 3IU1A 3LWUA 4P10A 4E8OA 1XMBA 2NSMA 2PJBA 4HNXB 2VXKA 2EO8A 4ZY1A 3D7FA 3W6SA 4MHYA 4DJLA 4UIAA 2BL1A 1IYLA 1MJAA 1PCAA 6CPAA 4KOYA 4UEFA 4UA3A 2ZELA 4R57A 4BBHA 3K9TA 4C68A 4MCRA 4MHNA 4RI1A 3BLNA 1AUGA 4AVCA 2EWBA 2JLMA 2PC1A 4PSWA 2OB0A 4OAEA 4NF1A 1I12A 4L89A 4OC1A 4AG7A 4CGOA 4KZTA 1PU9A 4MY3A 1IYKA 3SJXA 4OIWA 1NSLA 4K30A 3PEIA 4Q38A 2QYVA 3I1UA 3NFZA 5LRJA 5IB9A 1Q2YA 2PJ2A 2O4HA 3TE4A 2P6EA 1XOVA 1YREA 2PIZA 2Q4YA 1CPSA 5D29A 5K8PA 4RS2A 1NE9A 1KZFA 4R3LA 2D4PA 1CM0A 2KCWA 4KVOE 2WUUA 4F0YA 3NE8A 5JQ4A 2DXQA 4MJ8A 4CRZB 2NYQA 4PV6A 3D68A 3KHXA 4IHMA 5JH9A 4LX9A 4KOUA 5I0CA 2GFQA 2DEAA 3S9NA 2PJAA 4CYQA 1R57A 3R9GA 4KLWA 4BD9A 4OC5A 3T9YA 4NCZA 2VQYA 3TCVA 2JDDA 2AE6A 4M6GA 2VEZA 4OC2A 1S7LA 5ISVA 1GYTA 3FH4A 3L2NA 2REFA 1R3NA 4I49A 2X7BA 1OBRA 4C7IA 2ODFA 4P4IA 4QB9A 3KKWA 4EFDA 3GIUA 4P4DA 1YLOA 3RYOA 4EVYA 4X5KA 2WZNA 1KUYA 2YGWA 2DPTA 2H5MA 4IAVA 1BOBA 2CIJA 3CT9A 4XPDB 2HC9A 3S9MA 1Q2CA 4NFRA 2AJ6A 3OWCA 2Z3NA 1U6MA 2B3VA 2PRQA 3QNVA 2K5TA 1DE4C 2ZW5A 2GLFA 3RBUA 4Y49B 3FECA 1QSTA 3CPXA 4P44A 4RN7A 3IFEA 3MGDA 3BHXA 4HNWB 3FEDA 3TO6A 1RO5A 3I9SA 4H89A 3V7ZA 3FIXA 1KUVA 3VH9A 3WC5A 4IF5A 5K8NA 4R87A 1Z8XA 4FD7A 2ZW4A 4X8IA 2HB6A 3D3SA 4ZI6A 2PJ0A 1KUXA 3SI1A 3MN8A 4PK3A 1XEBA 2PJ7A 3VARA 5AG5A 1PUAA 2IQ6A 1YQEA 4KOXA 4KOSA 5C82A 5H86A 3CDXA 3EC4A 2PVWA 2ZOGA 4UEZA 4R76A 2B5GA 4TNUA 5HH1A 1VHEA 2B58A 1PYTB 1YVOA 1JWQA 2Z11A 1IU8A 3RO0A 1HDQA 5H84A 2EK9A 2HQYA 4PK2A 2IJZA 1Y0RA 5F47A 3H4QA 4OIDA 1ZG9A 2QIRA 2AFSA 1TKFA 2OH1A 1IY7A 3KASA 4HNYB 2JEVA 3GYAA 2Z3MA 1CJWA 2JBJA 1LRZA 2C1CA 4UBRA 2I79A 5DS0A 4JXRA 4MHZA 3NA6A 4KORA 3D66A 3SHPA 2PJ8A 2PJCA 4KOVA 4XPKA 4F9UA 5G21A 1F57A 4P4JA 4MCPA 2B4DA 4CAFA 3BI1A 4Q36A 3D67A 1QSRA 2ZOFA 1M4LA 1TKJA 2P6GA 5EBVA 2DF5A 2PRBA 3FF3A 1FNOA 1ON0A 4J3GA 3FRMA 3FX6A 1CP6A 2EUIA 3DSBA 4YRHA 4MHDA 1Z5RA 1AYEA 4OC0A 3B7IA 1Z8TA 3K9UA 3WT4A 3N7ZA 4R6TA 1LCPA 2XEIA 2QMLA 3WR7A 2CY2A 2FE7A 3PGPA 4NEXA 4BMHA 5KTAA 2ZEHA 1S60A 3CXPA 2ZEGA 4MFKA 4UWIA 4YU9A 4E0AA 5J8CA 1B87A 3MRUA 2PJ1A 1TIQA 2C6GA 5EC4A 3LMSA 4F6AA 4QBJA 4BINA 3JRUA 2P6FA 5FVJA 2R7HA 2O28A 1TKHA 4NGNA 2Z3OA 2AFZA 2HV2A 3BJ8A 4NGSA 1FY7A 3NH5A 3D8PA 3E0KA 4ZY2A 5J1QA 1MJBA 3FBUA 3DLJA 3KI9A 1Q2DA 2OU2A 3NH8A 2J8NA 1F2PA 4FWUA 1Y7EA 3NH4A 4GM5A 1XBUA 1M4DA 2PVVA 2GIVA 3ZZIA 1QSNA 1ARMA 5CBMA 2CXAA 1ELMP 1XJOA 2GANA 2PR8A 1HEEA 2Q4VA 1V0CA 4LQ6A 3R9EA 4OC4A 4A33A 3F8KA 4CAVA 4P45A 3D7HA 3V38A 4O23A 2GLJA 2RC4A 1Q7LA 3TO9A 3PB4X 3WC6A 4DUKA 2POKA 2CNMA 4FD4A 2AFWA 4XPLA 3SI0A 2YNEA 3JTKA 3GB0A 3PFOA 2P0WA 2WYRA 1S3ZA 4UFXA 5HVGA 4NGRA 4ONWA 5LRGA 1WWZA 1M4IA 3S6FA 4C2ZA 3H8GA 3PFEA 4FAIA 3PB6X 3B2YA 3DNSA 3T8WA 4AG9A 4B14A 4M6HA 2ARHA 4PQAA 1XF8A 1SQHA 3HUVA 3KR5A 3S6KA 2YNDA 1F2OA 3CPAA 4B6ZA 1VHOA 3FJUA 3PBEA 2ZENA 3PB8X 4XPDC 2ANPA 4UFVA 1LFWA 2G3TA 4EWTA 5THWA 3FVLA 2IL4A 3JVNA 4NXYA 1Z8WA 4ZX9A 4ZX8A 2PJ6A 3IWGA 3CXQA 4KUAA 1YK3A 2ZEMA 4Y49C 4H6UA 5CPAA 3R95A 2J8MA 1LANA 2OZHA 4KS9A 1DTDA 4IUSA 1QMUA 2YNCC 3KR4A 2ZW6A 2C6CA 3LD2A 2PJ9A 4U5YA 3RAMA 4QC6A 5G22A 4OP4A 2DPSA 1OZPA 1TF8A 4ZBGA 1XMTA 3EY5A 2PCUA 3D2MA 3D7GA 2XEFA 2B5GB 2V77A 4A2ZA 5AG6A 3VWDA 1R43A 2PSWA 3IO1A 4LQGA 4R3KA 1ZG7A 2AFMA 2I00A 2Q44A 4MFLA 4UF4A 3KQXA 1X12A 4GS4A 2FVGA 2A4NA 4TWEA 4CAEA 4OC3A 3IJ3A 4B5OA 5HMNA 2Q7SA 4KOWA 4P4BA 1RXTA 4MMOA 2B4BA 2JEWA 2Y0MA 4JJXA 4NGTA 4NGPA 5C88A 3G3SA 2ZW7A 5GCNA 5HVFA 3QAHA 3C26A 4KVME 5AG4A 3S9LA 4YGOA 1BAVA 5JPHA 4H6ZA 2R98A 1BPNA 4PPZA 4U9YA 1BLLE 3D7DA 5D8NA 4ZGYB 4M3SA 4CGMA 2Q0YA 3S6GA 2Z3KA 4ZY0A 5A27A 5K8OA 2V8GA 2B4DB 5HXDA 4QUSA 5DWMA 1TXRA 1CX8A 4Z65A 3K2KA 5LYLA 3A9LA 1Z4RA 3T90A 2GREA 4WJBA 3BJ7A 4MFPA 2FS5A 1IB1E 4L8AA 1RTQA 3P2FA 4OKOA 2OZUA 4DNCA 5IB0A 3D4UA 2ATRA 4HKFA 5LYFA 3IGRA 1QSMA 3ISXA 1S7FA 3B35A 1CPXA 3B3CA 4CYOA 3GKRA 4PXCA 2RFHA 1ZG8A 1VKCA 4A39A 1WK4A 2VI7A 4A32A 4A38A 2Z10A 5J8FA 3VATA 2EVNA 2GU2A 3TT2A 4OMEA 2AFOA 4JD6A 5JGFA 2XEGA 4FBEA 4QVTA 3PZJA 4MFJA 4MCQA 3TTHA 4CYNA 4MBUA 3PP9A 3QB8A 3FXTA 3TX8A 4F0XA 1YVKA 1P0HA 3KQZA 3W91A 4B11A 2PR1A 3IU2A 5HVHA 4H2KA 5LYIA 1ARLA 3FYNA 3EFAA 3HLPA 4PSXA 2QVPA 3SJGA 4B5PA 3IEHA 5KTDA 5LYDA 2V8DA 2QECA 3DDDA 3DGVA 2Q4ZA 1LAPA 3D2PA 3CZXA 4WWVA 5DWNA 2J8RA 1ZLHA 2Q51A 2WPWA 4JLYA 3CXSA 1BO4A 4F9VA 2JDCA 1GHEA 4EMEA 1BPMA 4RUHA 1CG2A 3N5FA 4JZ0A 5F46A 2D4OA 2CTCA 4UFWA 4AB7A 4G1PA 3SXNA 2ZEEA 4A95A 3ZJ0A 2PIYA 2CNSA 1Z9UA 1MJ9A 2CTBA 3I3GA 4M6IA 1HDUA 3KGQA 1YLEA 4C7HA 2O53A 4AVBA 2ZEOA 1VHSA 2VZYA 2ZEDA 4HPSA 1S7KA 3GLJA 5JM6A 1Y7RA 4JWPA 2BUEA 4UCPA 1M4GA 4MY0A 4MFZA 1MK4A 4R7MA 4CYPA 4AVAA 2FCKA 2V8VA 4DYOA 2NMTA 1NMTA 2FSRA 2QJ8A 4IK2A 1M1DA 4K3NA 1I21A 3SXOA 3PRTA 1XE4A 2VBQA 1YGHA 4PXDA 1YW4A 3IIBA 4KSAA 2G0BA 4C2YA 1A2ZA 1X10A 1Z4EA 3BI0A 2BOAA 4NGMA 5G20A 4CGPA 2C27A 5E96A 4NGQA 3SI2A 1H8LA 3IC1A 2I3CA 4MXUA 3LODA 1N71A 3B8GA 3KZWA 3PBBA 3SJEA 4JYWA 4KLVA 3TFYA 1YW6A 4R8FA 2Q7BA 4MI4A 1IOIA 4YFJA 2Q04A 4M85A 2ZXVA 2VZZA 3FNCA 3F5BA 5BWAB 4B10A 1XRYA 5K8MA 5CNPA 2XEJA 1I1DA 1CBXA 3FMCA 2Z3LA 2BSWA 5I4MA 1VIXA 4PXBA 1UWYA 3FB3A 2F5IA 5AGEA 3B3SA 3JUWA 4ORFA 2ABZA 2GE3A 3DR8A 1IOFA 1S7NA 3GUXA 2EBJA 2AFXA 2R8VA 3ISZA 3R1KA 2CNTA 4C2XA 4NJQA 4ZYQA 2WPXA 3VWEA 3EXNA 2V8HA 4CRYB 1L0CA 2F7VA 2PJ4A 3V8IA 5F48A 4KOTA 2REEA 4Q7AA 1AMPA 4UEEA 2VL1A 3QAYA 4OLLA 4FUUA 4MRIA 3KL9A 4U9ZA 2FIAA 3EO4A 1LOKA 2ZEFA 5F49A 4P4FA 3G8WA 2HUZA 2FT0A 3TOAA 1IICA 2OR4A 3KHZA 3BXMA 2G9DA 1YSJA 3TC8A 2BEIA 1ZO0A 4CAWA 1Y9KA 2F8HA 4MHPA 4P6YA 2ZEPA 1YMEA 4X3RA 3W6XA 2RB7A 4ONUA 1J4JA 2C6PA 4A94A 4R9MA 3TOBA 5IX3A 2PE3A 3R9FA 1K4JA 2OZGA 4JXQA 3TO7A 3H5ZA 4FD5A 2G3AA 5IV0A 2Z0ZA 5AG7A 2R1IA 3NE7A 4CPAA 4W9YA 3H8EA 5KTCA 4XNHC 1YR0A 3RNZA 4KVXA 3WC7A 3R96A 1TF9A 2BCOA 2PJ5A 1IIDA 4CGNA 4B5PB 2JBKA 3H8FA 4FD6A 3B3VA 4NJRA 2YNCA 5LRKA 1XFOA 1S5KA 1EE3P 4XNHB 1FT7A 1YX0A 4UCMA 4E2AA 3PB9X 5EMIA 1CP7A 2PJ3A 3F0AA 3RZAA 1KWMA 4OADA 1B6BA 1Z8LA 5G1ZA 1JQGA 2PQ8A 3B3TA 2BO9A 2ZPAA 1UFHA 4A30A 1Y9WA 2FXFA 2FL4A 4KUBA 4PXEA 4B13A 3LACA 3PB7X 4X2TA 4NSQA 3S6HA 1IGBA 1LAMA 3IWEA 1ELLP 1VGYA 5A28A 3DR6A 3P2HA 4AXVA 1M44A 4A31A 1NSAA 4KSFA 2FIWA 4GXHA 3SJFA 4MCSA 1ZLIA 2Q43A 2PDOA 3IWWA 4KSIA 5F09A 3GY9A 1Y0YA 2Z3PA 7CPAA
chains in the Genus database with same CATH topology
4CAXA 4UCNA 1XIXA 1P4NA 4CS0B 2B3UA 4UWJA 4LUAA 1QSOA 4MFQA 4CGLA 4II9A 4B12A 2WSAA 3UY5A 3IU1A 4E8OA 4HNXB 2VXKA 3W6SA 2BL1A 1IYLA 1MJAA 4KOYA 4BBHA 4UA3A 4R57A 4C68A 4RI1A 3BLNA 4AVCA 2JLMA 2PC1A 4PSWA 2OB0A 4OAEA 4NF1A 1I12A 4L89A 4AG7A 4CGOA 4KZTA 1PU9A 4MY3A 1IYKA 1NSLA 4K30A 4Q38A 1Q2YA 3TE4A 2P6EA 1YREA 2Q4YA 4RS2A 1NE9A 1KZFA 4R3LA 2D4PA 1CM0A 2KCWA 4KVOE 2WUUA 4F0YA 5JQ4A 2DXQA 4MJ8A 4CRZB 4PV6A 4LX9A 4KOUA 5I0CA 4CYQA 1R57A 3R9GA 4KLWA 3T9YA 4NCZA 2VQYA 3TCVA 2JDDA 2AE6A 5ISVA 2VEZA 1S7LA 2REFA 4I49A 2X7BA 4C7IA 4QB9A 3KKWA 4EVYA 3RYOA 4X5KA 1KUYA 2YGWA 2DPTA 2H5MA 1BOBA 4XPDB 1Q2CA 2AJ6A 3OWCA 2Z3NA 1U6MA 2B3VA 2K5TA 2ZW5A 4Y49B 1QSTA 3MGDA 4HNWB 3TO6A 3ZZIA 1RO5A 3I9SA 4H89A 3FIXA 1KUVA 4IF5A 4R87A 4FD7A 2ZW4A 3D3SA 1KUXA 4PK3A 1XEBA 5AG5A 1PUAA 4KOXA 4KOSA 5C82A 5H86A 3EC4A 2B5GA 5HH1A 2B58A 1YVOA 2Z11A 5H84A 2HQYA 4PK2A 5F47A 3H4QA 2QIRA 2OH1A 4HNYB 2JEVA 3GYAA 2Z3MA 1CJWA 1LRZA 4UBRA 2I79A 4JXRA 4KORA 3SHPA 4KOVA 4XPKA 5G21A 2B4DA 4CAFA 4Q36A 1QSRA 2P6GA 5EBVA 2PRBA 1ON0A 4J3GA 3FRMA 2EUIA 3DSBA 4YRHA 4MHDA 3K9UA 3N7ZA 2QMLA 3WR7A 2CY2A 2FE7A 3PGPA 4NEXA 4BMHA 5KTAA 1S60A 3CXPA 4MFKA 4UWIA 5J8CA 4E0AA 1B87A 1TIQA 5EC4A 4F6AA 4QBJA 2P6FA 5FVJA 2R7HA 2O28A 2Z3OA 2HV2A 3BJ8A 1FY7A 3D8PA 3E0KA 1MJBA 3FBUA 1Q2DA 2OU2A 2J8NA 1M4DA 2GIVA 1QSNA 2CXAA 2PR8A 2GANA 2Q4VA 1V0CA 3R9EA 4CAVA 4A33A 3F8KA 2RC4A 3TO9A 2CNMA 4FD4A 4XPLA 2YNEA 3JTKA 2P0WA 1S3ZA 4UFXA 3S6FA 1WWZA 1M4IA 4C2ZA 3DNSA 4AG9A 4B14A 2ARHA 1XF8A 1SQHA 3S6KA 2YNDA 4XPDC 4UFVA 2G3TA 2IL4A 3JVNA 4NXYA 3IWGA 3CXQA 4KUAA 1YK3A 4Y49C 4H6UA 3R95A 2J8MA 4KS9A 2OZHA 4IUSA 2YNCC 2ZW6A 3LD2A 4U5YA 4QC6A 5G22A 2DPSA 1OZPA 4ZBGA 1XMTA 3EY5A 3D2MA 2B5GB 4A2ZA 5AG6A 3VWDA 2PSWA 5IV0A 4R3KA 2I00A 2Q44A 4MFLA 4GS4A 2A4NA 4CAEA 4B5OA 5HMNA 4KOWA 1RXTA 2B4BA 2Y0MA 4JJXA 5C88A 3G3SA 2ZW7A 5GCNA 3QAHA 3C26A 4KVME 5AG4A 4YGOA 5JPHA 4H6ZA 2R98A 4U9YA 4ZGYB 4M3SA 4CGMA 2Q0YA 3S6GA 2Z3KA 5A27A 2B4DB 4QUSA 5DWMA 3A9LA 1Z4RA 3T90A 3BJ7A 4MFPA 2FS5A 1IB1E 4L8AA 3P2FA 2OZUA 4DNCA 5IB0A 2ATRA 4HKFA 3IGRA 1QSMA 1S7FA 4CYOA 3GKRA 1VKCA 1WK4A 2VI7A 4A32A 2Z10A 5J8FA 2EVNA 3TT2A 4JD6A 4QVTA 3PZJA 4MFJA 3TTHA 4CYNA 4MBUA 3PP9A 3QB8A 3FXTA 4F0XA 1YVKA 1P0HA 3W91A 4B11A 2PR1A 3IU2A 3FYNA 4B5PA 3EFAA 4PSXA 5KTDA 2QECA 3DDDA 3D2PA 5DWNA 2J8RA 2WPWA 4JLYA 3CXSA 1BO4A 2JDCA 1GHEA 5F46A 2D4OA 4UFWA 4AB7A 3SXNA 4A95A 3ZJ0A 2CNSA 1Z9UA 1MJ9A 3I3GA 1YLEA 4C7HA 4AVBA 1VHSA 2VZYA 1S7KA 4JWPA 1Y7RA 2BUEA 4UCPA 1M4GA 4MY0A 4MFZA 1MK4A 4CYPA 4AVAA 2FCKA 2NMTA 1NMTA 2FSRA 1M1DA 1I21A 3SXOA 1XE4A 2VBQA 1YGHA 4KSAA 2G0BA 4C2YA 1Z4EA 5G20A 4CGPA 2C27A 5E96A 3LODA 1N71A 3B8GA 3TFYA 4KLVA 2Q7BA 4MI4A 4YFJA 2Q04A 4M85A 2ZXVA 2VZZA 3FNCA 3F5BA 5BWAB 4B10A 5CNPA 1I1DA 2Z3LA 2BSWA 3FB3A 2F5IA 5AGEA 3JUWA 4ORFA 2GE3A 3DR8A 1S7NA 2R8VA 3R1KA 2CNTA 4C2XA 2WPXA 3VWEA 3EXNA 4CRYB 1L0CA 3V8IA 5F48A 4KOTA 2REEA 4OLLA 4U9ZA 2FIAA 3EO4A 5F49A 3G8WA 2HUZA 2FT0A 3TOAA 1IICA 2BEIA 1ZO0A 4CAWA 1Y9KA 3W6XA 4ONUA 1J4JA 4R9MA 3TOBA 5IX3A 3R9FA 1K4JA 2OZGA 4JXQA 3TO7A 3H5ZA 4FD5A 2G3AA 2Z0ZA 5AG7A 2R1IA 3NE7A 5KTCA 4XNHC 1YR0A 4KVXA 3R96A 1IIDA 4CGNA 4B5PB 4FD6A 2YNCA 1S5KA 4XNHB 1YX0A 4UCMA 4E2AA 3F0AA 4OADA 1B6BA 5G1ZA 2PQ8A 2ZPAA 1UFHA 4A30A 1Y9WA 2FXFA 2FL4A 4KUBA 4B13A 4NSQA 3S6HA 3IWEA 5A28A 3DR6A 3P2HA 1M44A 4A31A 4KSFA 2FIWA 2PDOA 3GY9A 2Z3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2Z A;  5A27 A;  4C2X A;  4UCN A;  5G22 A;  4C7H A;  4CYN A;  5G1Z A;  4A2Z A;  4B14 A;  5AG6 A;  4CGO A;  4B11 A;  4UCP A;  4CYQ A;  3H5Z A;  3IU2 A;  4A30 A;  5AG7 A;  4CGL A;  2YND A;  4B10 A;  4CYP A;  4B12 A;  4B13 A;  4CAE A;  2WSA A;  5G21 A;  4A33 A;  4C7I A;  3IU1 A;  4CYO A;  4UFV A;  3IWE A;  5AG5 A;  4CAF A;  5A28 A;  4A32 A;  4CGN A;  5AG4 A;  5AGE A;  4A31 A;  4C2Y A;  2YNC A;  4UFW A;  2YNE A;  3JTK A;  4UCM A;  5G20 A;  4BBH A;  4CGP A;  4A95 A;  4UFX A;  2WUU A;  2YNC C;  4CGM A;  4C68 A; 
#chains in the Genus database with same CATH topology
 4CAX A;  3FEE A;  4UCN A;  4F8Z A;  1XIX A;  1P4N A;  1Z2L A;  4YWY A;  4UIB A;  4CS0 B;  2IMO A;  2B3U A;  4UWJ A;  4LUA A;  3B3W A;  1QSO A;  1QQ9 A;  4MFQ A;  2AFU A;  2EK8 A;  2OOT A;  4A37 A;  8CPA A;  4CGL A;  4II9 A;  5ELY A;  3WAB A;  4B12 A;  4P4E A;  2CF4 A;  2J9A A;  2WSA A;  3UY5 A;  3IU1 A;  3LWU A;  4P10 A;  4E8O A;  1XMB A;  2NSM A;  2PJB A;  4HNX B;  2VXK A;  2EO8 A;  4ZY1 A;  3D7F A;  3W6S A;  4MHY A;  4DJL A;  4UIA A;  2BL1 A;  1IYL A;  1MJA A;  1PCA A;  6CPA A;  4KOY A;  4UEF A;  4UA3 A;  2ZEL A;  4R57 A;  4BBH A;  3K9T A;  4C68 A;  4MCR A;  4MHN A;  4RI1 A;  3BLN A;  1AUG A;  4AVC A;  2EWB A;  2JLM A;  2PC1 A;  4PSW A;  2OB0 A;  4OAE A;  4NF1 A;  1I12 A;  4L89 A;  4OC1 A;  4AG7 A;  4CGO A;  4KZT A;  1PU9 A;  4MY3 A;  1IYK A;  3SJX A;  4OIW A;  1NSL A;  4K30 A;  3PEI A;  4Q38 A;  2QYV A;  3I1U A;  3NFZ A;  5LRJ A;  5IB9 A;  1Q2Y A;  2PJ2 A;  2O4H A;  3TE4 A;  2P6E A;  1XOV A;  1YRE A;  2PIZ A;  2Q4Y A;  1CPS A;  5D29 A;  5K8P A;  4RS2 A;  1NE9 A;  1KZF A;  4R3L A;  2D4P A;  1CM0 A;  2KCW A;  4KVO E;  2WUU A;  4F0Y A;  3NE8 A;  5JQ4 A;  2DXQ A;  4MJ8 A;  4CRZ B;  2NYQ A;  4PV6 A;  3D68 A;  3KHX A;  4IHM A;  5JH9 A;  4LX9 A;  4KOU A;  5I0C A;  2GFQ A;  2DEA A;  3S9N A;  2PJA A;  4CYQ A;  1R57 A;  3R9G A;  4KLW A;  4BD9 A;  4OC5 A;  3T9Y A;  4NCZ A;  2VQY A;  3TCV A;  2JDD A;  2AE6 A;  4M6G A;  2VEZ A;  4OC2 A;  1S7L A;  5ISV A;  1GYT A;  3FH4 A;  3L2N A;  2REF A;  1R3N A;  4I49 A;  2X7B A;  1OBR A;  4C7I A;  2ODF A;  4P4I A;  4QB9 A;  3KKW A;  4EFD A;  3GIU A;  4P4D A;  1YLO A;  3RYO A;  4EVY A;  4X5K A;  2WZN A;  1KUY A;  2YGW A;  2DPT A;  2H5M A;  4IAV A;  1BOB A;  2CIJ A;  3CT9 A;  4XPD B;  2HC9 A;  3S9M A;  1Q2C A;  4NFR A;  2AJ6 A;  3OWC A;  2Z3N A;  1U6M A;  2B3V A;  2PRQ A;  3QNV A;  2K5T A;  1DE4 C;  2ZW5 A;  2GLF A;  3RBU A;  4Y49 B;  3FEC A;  1QST A;  3CPX A;  4P44 A;  4RN7 A;  3IFE A;  3MGD A;  3BHX A;  4HNW B;  3FED A;  3TO6 A;  1RO5 A;  3I9S A;  4H89 A;  3V7Z A;  3FIX A;  1KUV A;  3VH9 A;  3WC5 A;  4IF5 A;  5K8N A;  4R87 A;  1Z8X A;  4FD7 A;  2ZW4 A;  4X8I A;  2HB6 A;  3D3S A;  4ZI6 A;  2PJ0 A;  1KUX A;  3SI1 A;  3MN8 A;  4PK3 A;  1XEB A;  2PJ7 A;  3VAR A;  5AG5 A;  1PUA A;  2IQ6 A;  1YQE A;  4KOX A;  4KOS A;  5C82 A;  5H86 A;  3CDX A;  3EC4 A;  2PVW A;  2ZOG A;  4UEZ A;  4R76 A;  2B5G A;  4TNU A;  5HH1 A;  1VHE A;  2B58 A;  1PYT B;  1YVO A;  1JWQ A;  2Z11 A;  1IU8 A;  3RO0 A;  1HDQ A;  5H84 A;  2EK9 A;  2HQY A;  4PK2 A;  2IJZ A;  1Y0R A;  5F47 A;  3H4Q A;  4OID A;  1ZG9 A;  2QIR A;  2AFS A;  1TKF A;  2OH1 A;  1IY7 A;  3KAS A;  4HNY B;  2JEV A;  3GYA A;  2Z3M A;  1CJW A;  2JBJ A;  1LRZ A;  2C1C A;  4UBR A;  2I79 A;  5DS0 A;  4JXR A;  4MHZ A;  3NA6 A;  4KOR A;  3D66 A;  3SHP A;  2PJ8 A;  2PJC A;  4KOV A;  4XPK A;  4F9U A;  5G21 A;  1F57 A;  4P4J A;  4MCP A;  2B4D A;  4CAF A;  3BI1 A;  4Q36 A;  3D67 A;  1QSR A;  2ZOF A;  1M4L A;  1TKJ A;  2P6G A;  5EBV A;  2DF5 A;  2PRB A;  3FF3 A;  1FNO A;  1ON0 A;  4J3G A;  3FRM A;  3FX6 A;  1CP6 A;  2EUI A;  3DSB A;  4YRH A;  4MHD A;  1Z5R A;  1AYE A;  4OC0 A;  3B7I A;  1Z8T A;  3K9U A;  3WT4 A;  3N7Z A;  4R6T A;  1LCP A;  2XEI A;  2QML A;  3WR7 A;  2CY2 A;  2FE7 A;  3PGP A;  4NEX A;  4BMH A;  5KTA A;  2ZEH A;  1S60 A;  3CXP A;  2ZEG A;  4MFK A;  4UWI A;  4YU9 A;  4E0A A;  5J8C A;  1B87 A;  3MRU A;  2PJ1 A;  1TIQ A;  2C6G A;  5EC4 A;  3LMS A;  4F6A A;  4QBJ A;  4BIN A;  3JRU A;  2P6F A;  5FVJ A;  2R7H A;  2O28 A;  1TKH A;  4NGN A;  2Z3O A;  2AFZ A;  2HV2 A;  3BJ8 A;  4NGS A;  1FY7 A;  3NH5 A;  3D8P A;  3E0K A;  4ZY2 A;  5J1Q A;  1MJB A;  3FBU A;  3DLJ A;  3KI9 A;  1Q2D A;  2OU2 A;  3NH8 A;  2J8N A;  1F2P A;  4FWU A;  1Y7E A;  3NH4 A;  4GM5 A;  1XBU A;  1M4D A;  2PVV A;  2GIV A;  3ZZI A;  1QSN A;  1ARM A;  5CBM A;  2CXA A;  1ELM P;  1XJO A;  2GAN A;  2PR8 A;  1HEE A;  2Q4V A;  1V0C A;  4LQ6 A;  3R9E A;  4OC4 A;  4A33 A;  3F8K A;  4CAV A;  4P45 A;  3D7H A;  3V38 A;  4O23 A;  2GLJ A;  2RC4 A;  1Q7L A;  3TO9 A;  3PB4 X;  3WC6 A;  4DUK A;  2POK A;  2CNM A;  4FD4 A;  2AFW A;  4XPL A;  3SI0 A;  2YNE A;  3JTK A;  3GB0 A;  3PFO A;  2P0W A;  2WYR A;  1S3Z A;  4UFX A;  5HVG A;  4NGR A;  4ONW A;  5LRG A;  1WWZ A;  1M4I A;  3S6F A;  4C2Z A;  3H8G A;  3PFE A;  4FAI A;  3PB6 X;  3B2Y A;  3DNS A;  3T8W A;  4AG9 A;  4B14 A;  4M6H A;  2ARH A;  4PQA A;  1XF8 A;  1SQH A;  3HUV A;  3KR5 A;  3S6K A;  2YND A;  1F2O A;  3CPA A;  4B6Z A;  1VHO A;  3FJU A;  3PBE A;  2ZEN A;  3PB8 X;  4XPD C;  2ANP A;  4UFV A;  1LFW A;  2G3T A;  4EWT A;  5THW A;  3FVL A;  2IL4 A;  3JVN A;  4NXY A;  1Z8W A;  4ZX9 A;  4ZX8 A;  2PJ6 A;  3IWG A;  3CXQ A;  4KUA A;  1YK3 A;  2ZEM A;  4Y49 C;  4H6U A;  5CPA A;  3R95 A;  2J8M A;  1LAN A;  2OZH A;  4KS9 A;  1DTD A;  4IUS A;  1QMU A;  2YNC C;  3KR4 A;  2ZW6 A;  2C6C A;  3LD2 A;  2PJ9 A;  4U5Y A;  3RAM A;  4QC6 A;  5G22 A;  4OP4 A;  2DPS A;  1OZP A;  1TF8 A;  4ZBG A;  1XMT A;  3EY5 A;  2PCU A;  3D2M A;  3D7G A;  2XEF A;  2B5G B;  2V77 A;  4A2Z A;  5AG6 A;  3VWD A;  1R43 A;  2PSW A;  3IO1 A;  4LQG A;  4R3K A;  1ZG7 A;  2AFM A;  2I00 A;  2Q44 A;  4MFL A;  4UF4 A;  3KQX A;  1X12 A;  4GS4 A;  2FVG A;  2A4N A;  4TWE A;  4CAE A;  4OC3 A;  3IJ3 A;  4B5O A;  5HMN A;  2Q7S A;  4KOW A;  4P4B A;  1RXT A;  4MMO A;  2B4B A;  2JEW A;  2Y0M A;  4JJX A;  4NGT A;  4NGP A;  5C88 A;  3G3S A;  2ZW7 A;  5GCN A;  5HVF A;  3QAH A;  3C26 A;  4KVM E;  5AG4 A;  3S9L A;  4YGO A;  1BAV A;  5JPH A;  4H6Z A;  2R98 A;  1BPN A;  4PPZ A;  4U9Y A;  1BLL E;  3D7D A;  5D8N A;  4ZGY B;  4M3S A;  4CGM A;  2Q0Y A;  3S6G A;  2Z3K A;  4ZY0 A;  5A27 A;  5K8O A;  2V8G A;  2B4D B;  5HXD A;  4QUS A;  5DWM A;  1TXR A;  1CX8 A;  4Z65 A;  3K2K A;  5LYL A;  3A9L A;  1Z4R A;  3T90 A;  2GRE A;  4WJB A;  3BJ7 A;  4MFP A;  2FS5 A;  1IB1 E;  4L8A A;  1RTQ A;  3P2F A;  4OKO A;  2OZU A;  4DNC A;  5IB0 A;  3D4U A;  2ATR A;  4HKF A;  5LYF A;  3IGR A;  1QSM A;  3ISX A;  1S7F A;  3B35 A;  1CPX A;  3B3C A;  4CYO A;  3GKR A;  4PXC A;  2RFH A;  1ZG8 A;  1VKC A;  4A39 A;  1WK4 A;  2VI7 A;  4A32 A;  4A38 A;  2Z10 A;  5J8F A;  3VAT A;  2EVN A;  2GU2 A;  3TT2 A;  4OME A;  2AFO A;  4JD6 A;  5JGF A;  2XEG A;  4FBE A;  4QVT A;  3PZJ A;  4MFJ A;  4MCQ A;  3TTH A;  4CYN A;  4MBU A;  3PP9 A;  3QB8 A;  3FXT A;  3TX8 A;  4F0X A;  1YVK A;  1P0H A;  3KQZ A;  3W91 A;  4B11 A;  2PR1 A;  3IU2 A;  5HVH A;  4H2K A;  5LYI A;  1ARL A;  3FYN A;  3EFA A;  3HLP A;  4PSX A;  2QVP A;  3SJG A;  4B5P A;  3IEH A;  5KTD A;  5LYD A;  2V8D A;  2QEC A;  3DDD A;  3DGV A;  2Q4Z A;  1LAP A;  3D2P A;  3CZX A;  4WWV A;  5DWN A;  2J8R A;  1ZLH A;  2Q51 A;  2WPW A;  4JLY A;  3CXS A;  1BO4 A;  4F9V A;  2JDC A;  1GHE A;  4EME A;  1BPM A;  4RUH A;  1CG2 A;  3N5F A;  4JZ0 A;  5F46 A;  2D4O A;  2CTC A;  4UFW A;  4AB7 A;  4G1P A;  3SXN A;  2ZEE A;  4A95 A;  3ZJ0 A;  2PIY A;  2CNS A;  1Z9U A;  1MJ9 A;  2CTB A;  3I3G A;  4M6I A;  1HDU A;  3KGQ A;  1YLE A;  4C7H A;  2O53 A;  4AVB A;  2ZEO A;  1VHS A;  2VZY A;  2ZED A;  4HPS A;  1S7K A;  3GLJ A;  5JM6 A;  1Y7R A;  4JWP A;  2BUE A;  4UCP A;  1M4G A;  4MY0 A;  4MFZ A;  1MK4 A;  4R7M A;  4CYP A;  4AVA A;  2FCK A;  2V8V A;  4DYO A;  2NMT A;  1NMT A;  2FSR A;  2QJ8 A;  4IK2 A;  1M1D A;  4K3N A;  1I21 A;  3SXO A;  3PRT A;  1XE4 A;  2VBQ A;  1YGH A;  4PXD A;  1YW4 A;  3IIB A;  4KSA A;  2G0B A;  4C2Y A;  1A2Z A;  1X10 A;  1Z4E A;  3BI0 A;  2BOA A;  4NGM A;  5G20 A;  4CGP A;  2C27 A;  5E96 A;  4NGQ A;  3SI2 A;  1H8L A;  3IC1 A;  2I3C A;  4MXU A;  3LOD A;  1N71 A;  3B8G A;  3KZW A;  3PBB A;  3SJE A;  4JYW A;  4KLV A;  3TFY A;  1YW6 A;  4R8F A;  2Q7B A;  4MI4 A;  1IOI A;  4YFJ A;  2Q04 A;  4M85 A;  2ZXV A;  2VZZ A;  3FNC A;  3F5B A;  5BWA B;  4B10 A;  1XRY A;  5K8M A;  5CNP A;  2XEJ A;  1I1D A;  1CBX A;  3FMC A;  2Z3L A;  2BSW A;  5I4M A;  1VIX A;  4PXB A;  1UWY A;  3FB3 A;  2F5I A;  5AGE A;  3B3S A;  3JUW A;  4ORF A;  2ABZ A;  2GE3 A;  3DR8 A;  1IOF A;  1S7N A;  3GUX A;  2EBJ A;  2AFX A;  2R8V A;  3ISZ A;  3R1K A;  2CNT A;  4C2X A;  4NJQ A;  4ZYQ A;  2WPX A;  3VWE A;  3EXN A;  2V8H A;  4CRY B;  1L0C A;  2F7V A;  2PJ4 A;  3V8I A;  5F48 A;  4KOT A;  2REE A;  4Q7A A;  1AMP A;  4UEE A;  2VL1 A;  3QAY A;  4OLL A;  4FUU A;  4MRI A;  3KL9 A;  4U9Z A;  2FIA A;  3EO4 A;  1LOK A;  2ZEF A;  5F49 A;  4P4F A;  3G8W A;  2HUZ A;  2FT0 A;  3TOA A;  1IIC A;  2OR4 A;  3KHZ A;  3BXM A;  2G9D A;  1YSJ A;  3TC8 A;  2BEI A;  1ZO0 A;  4CAW A;  1Y9K A;  2F8H A;  4MHP A;  4P6Y A;  2ZEP A;  1YME A;  4X3R A;  3W6X A;  2RB7 A;  4ONU A;  1J4J A;  2C6P A;  4A94 A;  4R9M A;  3TOB A;  5IX3 A;  2PE3 A;  3R9F A;  1K4J A;  2OZG A;  4JXQ A;  3TO7 A;  3H5Z A;  4FD5 A;  2G3A A;  5IV0 A;  2Z0Z A;  5AG7 A;  2R1I A;  3NE7 A;  4CPA A;  4W9Y A;  3H8E A;  5KTC A;  4XNH C;  1YR0 A;  3RNZ A;  4KVX A;  3WC7 A;  3R96 A;  1TF9 A;  2BCO A;  2PJ5 A;  1IID A;  4CGN A;  4B5P B;  2JBK A;  3H8F A;  4FD6 A;  3B3V A;  4NJR A;  2YNC A;  5LRK A;  1XFO A;  1S5K A;  1EE3 P;  4XNH B;  1FT7 A;  1YX0 A;  4UCM A;  4E2A A;  3PB9 X;  5EMI A;  1CP7 A;  2PJ3 A;  3F0A A;  3RZA A;  1KWM A;  4OAD A;  1B6B A;  1Z8L A;  5G1Z A;  1JQG A;  2PQ8 A;  3B3T A;  2BO9 A;  2ZPA A;  1UFH A;  4A30 A;  1Y9W A;  2FXF A;  2FL4 A;  4KUB A;  4PXE A;  4B13 A;  3LAC A;  3PB7 X;  4X2T A;  4NSQ A;  3S6H A;  1IGB A;  1LAM A;  3IWE A;  1ELL P;  1VGY A;  5A28 A;  3DR6 A;  3P2H A;  4AXV A;  1M44 A;  4A31 A;  1NSA A;  4KSF A;  2FIW A;  4GXH A;  3SJF A;  4MCS A;  1ZLI A;  2Q43 A;  2PDO A;  3IWW A;  4KSI A;  5F09 A;  3GY9 A;  1Y0Y A;  2Z3P A;  7CPA A; 
#chains in the Genus database with same CATH homology
 4CAX A;  4UCN A;  1XIX A;  1P4N A;  4CS0 B;  2B3U A;  4UWJ A;  4LUA A;  1QSO A;  4MFQ A;  4CGL A;  4II9 A;  4B12 A;  2WSA A;  3UY5 A;  3IU1 A;  4E8O A;  4HNX B;  2VXK A;  3W6S A;  2BL1 A;  1IYL A;  1MJA A;  4KOY A;  4BBH A;  4UA3 A;  4R57 A;  4C68 A;  4RI1 A;  3BLN A;  4AVC A;  2JLM A;  2PC1 A;  4PSW A;  2OB0 A;  4OAE A;  4NF1 A;  1I12 A;  4L89 A;  4AG7 A;  4CGO A;  4KZT A;  1PU9 A;  4MY3 A;  1IYK A;  1NSL A;  4K30 A;  4Q38 A;  1Q2Y A;  3TE4 A;  2P6E A;  1YRE A;  2Q4Y A;  4RS2 A;  1NE9 A;  1KZF A;  4R3L A;  2D4P A;  1CM0 A;  2KCW A;  4KVO E;  2WUU A;  4F0Y A;  5JQ4 A;  2DXQ A;  4MJ8 A;  4CRZ B;  4PV6 A;  4LX9 A;  4KOU A;  5I0C A;  4CYQ A;  1R57 A;  3R9G A;  4KLW A;  3T9Y A;  4NCZ A;  2VQY A;  3TCV A;  2JDD A;  2AE6 A;  5ISV A;  2VEZ A;  1S7L A;  2REF A;  4I49 A;  2X7B A;  4C7I A;  4QB9 A;  3KKW A;  4EVY A;  3RYO A;  4X5K A;  1KUY A;  2YGW A;  2DPT A;  2H5M A;  1BOB A;  4XPD B;  1Q2C A;  2AJ6 A;  3OWC A;  2Z3N A;  1U6M A;  2B3V A;  2K5T A;  2ZW5 A;  4Y49 B;  1QST A;  3MGD A;  4HNW B;  3TO6 A;  3ZZI A;  1RO5 A;  3I9S A;  4H89 A;  3FIX A;  1KUV A;  4IF5 A;  4R87 A;  4FD7 A;  2ZW4 A;  3D3S A;  1KUX A;  4PK3 A;  1XEB A;  5AG5 A;  1PUA A;  4KOX A;  4KOS A;  5C82 A;  5H86 A;  3EC4 A;  2B5G A;  5HH1 A;  2B58 A;  1YVO A;  2Z11 A;  5H84 A;  2HQY A;  4PK2 A;  5F47 A;  3H4Q A;  2QIR A;  2OH1 A;  4HNY B;  2JEV A;  3GYA A;  2Z3M A;  1CJW A;  1LRZ A;  4UBR A;  2I79 A;  4JXR A;  4KOR A;  3SHP A;  4KOV A;  4XPK A;  5G21 A;  2B4D A;  4CAF A;  4Q36 A;  1QSR A;  2P6G A;  5EBV A;  2PRB A;  1ON0 A;  4J3G A;  3FRM A;  2EUI A;  3DSB A;  4YRH A;  4MHD A;  3K9U A;  3N7Z A;  2QML A;  3WR7 A;  2CY2 A;  2FE7 A;  3PGP A;  4NEX A;  4BMH A;  5KTA A;  1S60 A;  3CXP A;  4MFK A;  4UWI A;  5J8C A;  4E0A A;  1B87 A;  1TIQ A;  5EC4 A;  4F6A A;  4QBJ A;  2P6F A;  5FVJ A;  2R7H A;  2O28 A;  2Z3O A;  2HV2 A;  3BJ8 A;  1FY7 A;  3D8P A;  3E0K A;  1MJB A;  3FBU A;  1Q2D A;  2OU2 A;  2J8N A;  1M4D A;  2GIV A;  1QSN A;  2CXA A;  2PR8 A;  2GAN A;  2Q4V A;  1V0C A;  3R9E A;  4CAV A;  4A33 A;  3F8K A;  2RC4 A;  3TO9 A;  2CNM A;  4FD4 A;  4XPL A;  2YNE A;  3JTK A;  2P0W A;  1S3Z A;  4UFX A;  3S6F A;  1WWZ A;  1M4I A;  4C2Z A;  3DNS A;  4AG9 A;  4B14 A;  2ARH A;  1XF8 A;  1SQH A;  3S6K A;  2YND A;  4XPD C;  4UFV A;  2G3T A;  2IL4 A;  3JVN A;  4NXY A;  3IWG A;  3CXQ A;  4KUA A;  1YK3 A;  4Y49 C;  4H6U A;  3R95 A;  2J8M A;  4KS9 A;  2OZH A;  4IUS A;  2YNC C;  2ZW6 A;  3LD2 A;  4U5Y A;  4QC6 A;  5G22 A;  2DPS A;  1OZP A;  4ZBG A;  1XMT A;  3EY5 A;  3D2M A;  2B5G B;  4A2Z A;  5AG6 A;  3VWD A;  2PSW A;  5IV0 A;  4R3K A;  2I00 A;  2Q44 A;  4MFL A;  4GS4 A;  2A4N A;  4CAE A;  4B5O A;  5HMN A;  4KOW A;  1RXT A;  2B4B A;  2Y0M A;  4JJX A;  5C88 A;  3G3S A;  2ZW7 A;  5GCN A;  3QAH A;  3C26 A;  4KVM E;  5AG4 A;  4YGO A;  5JPH A;  4H6Z A;  2R98 A;  4U9Y A;  4ZGY B;  4M3S A;  4CGM A;  2Q0Y A;  3S6G A;  2Z3K A;  5A27 A;  2B4D B;  4QUS A;  5DWM A;  3A9L A;  1Z4R A;  3T90 A;  3BJ7 A;  4MFP A;  2FS5 A;  1IB1 E;  4L8A A;  3P2F A;  2OZU A;  4DNC A;  5IB0 A;  2ATR A;  4HKF A;  3IGR A;  1QSM A;  1S7F A;  4CYO A;  3GKR A;  1VKC A;  1WK4 A;  2VI7 A;  4A32 A;  2Z10 A;  5J8F A;  2EVN A;  3TT2 A;  4JD6 A;  4QVT A;  3PZJ A;  4MFJ A;  3TTH A;  4CYN A;  4MBU A;  3PP9 A;  3QB8 A;  3FXT A;  4F0X A;  1YVK A;  1P0H A;  3W91 A;  4B11 A;  2PR1 A;  3IU2 A;  3FYN A;  4B5P A;  3EFA A;  4PSX A;  5KTD A;  2QEC A;  3DDD A;  3D2P A;  5DWN A;  2J8R A;  2WPW A;  4JLY A;  3CXS A;  1BO4 A;  2JDC A;  1GHE A;  5F46 A;  2D4O A;  4UFW A;  4AB7 A;  3SXN A;  4A95 A;  3ZJ0 A;  2CNS A;  1Z9U A;  1MJ9 A;  3I3G A;  1YLE A;  4C7H A;  4AVB A;  1VHS A;  2VZY A;  1S7K A;  4JWP A;  1Y7R A;  2BUE A;  4UCP A;  1M4G A;  4MY0 A;  4MFZ A;  1MK4 A;  4CYP A;  4AVA A;  2FCK A;  2NMT A;  1NMT A;  2FSR A;  1M1D A;  1I21 A;  3SXO A;  1XE4 A;  2VBQ A;  1YGH A;  4KSA A;  2G0B A;  4C2Y A;  1Z4E A;  5G20 A;  4CGP A;  2C27 A;  5E96 A;  3LOD A;  1N71 A;  3B8G A;  3TFY A;  4KLV A;  2Q7B A;  4MI4 A;  4YFJ A;  2Q04 A;  4M85 A;  2ZXV A;  2VZZ A;  3FNC A;  3F5B A;  5BWA B;  4B10 A;  5CNP A;  1I1D A;  2Z3L A;  2BSW A;  3FB3 A;  2F5I A;  5AGE A;  3JUW A;  4ORF A;  2GE3 A;  3DR8 A;  1S7N A;  2R8V A;  3R1K A;  2CNT A;  4C2X A;  2WPX A;  3VWE A;  3EXN A;  4CRY B;  1L0C A;  3V8I A;  5F48 A;  4KOT A;  2REE A;  4OLL A;  4U9Z A;  2FIA A;  3EO4 A;  5F49 A;  3G8W A;  2HUZ A;  2FT0 A;  3TOA A;  1IIC A;  2BEI A;  1ZO0 A;  4CAW A;  1Y9K A;  3W6X A;  4ONU A;  1J4J A;  4R9M A;  3TOB A;  5IX3 A;  3R9F A;  1K4J A;  2OZG A;  4JXQ A;  3TO7 A;  3H5Z A;  4FD5 A;  2G3A A;  2Z0Z A;  5AG7 A;  2R1I A;  3NE7 A;  5KTC A;  4XNH C;  1YR0 A;  4KVX A;  3R96 A;  1IID A;  4CGN A;  4B5P B;  4FD6 A;  2YNC A;  1S5K A;  4XNH B;  1YX0 A;  4UCM A;  4E2A A;  3F0A A;  4OAD A;  1B6B A;  5G1Z A;  2PQ8 A;  2ZPA A;  1UFH A;  4A30 A;  1Y9W A;  2FXF A;  2FL4 A;  4KUB A;  4B13 A;  4NSQ A;  3S6H A;  3IWE A;  5A28 A;  3DR6 A;  3P2H A;  1M44 A;  4A31 A;  4KSF A;  2FIW A;  2PDO A;  3GY9 A;  2Z3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...