4CYQA

Leishmania major n-myristoyltransferase in complex with a hybrid inhibitor (compound 45).
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 127
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cyqA00
4CGNA 4CYPA 4A32A 4B12A 4A95A 4B10A 4C7HA 4A31A 4C2YA 3IU2A 5AG5A 4CGMA 4UFVA 2YNEA 4CYNA 3JTKA 4A30A 5G22A 2WUUA 4CAFA 3IU1A 5AGEA 4C7IA 2WSAA 4CAEA 5G20A 4A2ZA 4C2XA 4UCMA 4A33A 4CYQA 2YNCA 3IWEA 5A27A 2YNDA 4UFWA 4UCPA 4B11A 4B14A 5A28A 4C68A 5G21A 5AG7A 2YNCC 5AG6A 4CGPA 4CGLA 4CGOA 5AG4A 4C2ZA 4B13A 4UCNA 4UFXA 4BBHA 4CYOA 5G1ZA 3H5ZA
chains in the Genus database with same CATH superfamily
2V8DA 5I0CA 1YLOA 1ZO0A 5DWNA 5HXDA 1MJ9A 4FAIA 4NFRA 4F0YA 2V77A 2JLMA 2IJZA 3R1KA 4KVXA 3W6SA 4MHZA 2G3TA 2I79A 3PB4X 3DR8A 2ZOGA 2C6GA 3FRMA 3S6KA 3V8IA 3A9LA 2RC4A 1I1DA 1QSOA 5LRKA 1B87A 2WSAA 3SJEA 4A2ZA 5IB0A 3H8FA 3TT2A 4KVME 2CIJA 1R57A 1S60A 3DR6A 4W9YA 4IF5A 4AVBA 4MI4A 4KSFA 4HPSA 2Z3MA 5K8NA 3CXQA 3NA6A 4R57A 4XPDC 3FJUA 3ZJ0A 3OWCA 2ZELA 4BINA 4BBHA 2B5GA 2R7HA 2CNMA 3B3VA 4OMEA 1Y0YA 2EWBA 1NSAA 2QYVA 1Y7RA 4ZX8A 2ARHA 2O53A 4ZI6A 3NFZA 4B12A 1YSJA 3RBUA 3B35A 4NXYA 4WWVA 2ANPA 4C7HA 4R7MA 4CGMA 1TF9A 1GHEA 3NH4A 1BO4A 3DNSA 3DDDA 4U9ZA 1IYKA 3FVLA 2PJ1A 1L0CA 3GKRA 2F7VA 2ZW4A 4PQAA 5HVHA 4PXBA 2PIZA 1YREA 1LAPA 3B7IA 2QJ8A 1Q2YA 4PV6A 3IGRA 4MY0A 1S5KA 1XFOA 4KOVA 3RAMA 4MHDA 2PR8A 5EBVA 4AG7A 4C2ZA 1XMBA 2Q0YA 1F2PA 2BSWA 2HQYA 4KOWA 5JPHA 1WWZA 2IQ6A 5C88A 5JGFA 5JH9A 4CGNA 3KHXA 5ISVA 1M1DA 5GCNA 4P4DA 2DPTA 4A37A 2GANA 1M4GA 4O23A 2FXFA 2PR1A 3FECA 2HUZA 4RS2A 3T8WA 3CZXA 2C27A 4MFKA 2VI7A 3V7ZA 1H8LA 3VARA 2XEJA 2IL4A 3BI1A 4XPDB 4NGPA 2D4PA 1CJWA 2EBJA 5J8CA 3H8GA 1YK3A 3IEHA 4JYWA 4UA3A 1QSTA 5G20A 2Q7SA 4ZX9A 3VWDA 4QBJA 2YNDA 3C26A 4UCPA 1IIDA 2VBQA 3NH5A 4B11A 5HVGA 3H8EA 3QAYA 3VWEA 1VIXA 3F8KA 5F46A 5AG4A 5H84A 4B13A 2OB0A 4CPAA 2VEZA 5CPAA 1LANA 2KCWA 2VXKA 2Q43A 3LACA 4KOUA 4CYOA 4ZY0A 2PJ7A 4HNYB 2P6FA 2C1CA 3CPXA 4JXRA 1NSLA 3F0AA 4CRYB 4MFPA 1IU8A 4KOSA 3SHPA 4R3LA 2XEIA 1BLLE 4UEEA 8CPAA 1A2ZA 1GYTA 3S6HA 4OIDA 2AJ6A 4ZY2A 3SJGA 1KUVA 3FNCA 3PFEA 4MCQA 3VATA 4KORA 1Z4EA 3K9UA 2FVGA 2NMTA 3H4QA 2Q7BA 2PJ5A 4A39A 4PK2A 2JDCA 2F8HA 1Z8WA 4JZ0A 2PQ8A 4C68A 3D8PA 1YW6A 2CTCA 3CPAA 4LUAA 2Z3NA 4P4FA 1WK4A 3F5BA 1QSNA 3D66A 4JLYA 3QB8A 3GLJA 4ONUA 2P6EA 3TO9A 2B4DA 2JDDA 3BHXA 1S7NA 3I9SA 4UFXA 4G1PA 4Y49C 3GB0A 5EMIA 3H5ZA 3KQZA 1CP7A 4KOXA 4XNHC 3W91A 2ZW5A 3VH9A 4NGNA 2P0WA 1TIQA 1Q2DA 1RTQA 4KUBA 2OH1A 5LRGA 3JTKA 1YX0A 3RZAA 4KOTA 2JBJA 4JXQA 4MFQA 4MHPA 2GREA 2ZENA 3CT9A 2Q4VA 4XPKA 3IJ3A 2B3UA 3BI0A 3FX6A 2WPWA 3QAHA 5C82A 3MN8A 4KVOE 4MFLA 3MGDA 3R95A 4UWIA 5JM6A 4H6ZA 3KR5A 1TXRA 4OLLA 1JQGA 1ZLIA 4Q38A 3ISXA 4BMHA 3D7GA 4LQGA 2GFQA 4OC1A 2Q4ZA 3SXNA 1UFHA 2I3CA 1S7FA 1KUXA 3N5FA 1DE4C 4H89A 4MCRA 5F49A 3W6XA 5EC4A 1BPMA 3DLJA 4MHNA 3KHZA 3IU2A 3PB7X 4P10A 1XOVA 5E96A 2VQYA 5KTDA 4A30A 2R1IA 3PFOA 2WUUA 2WZNA 5AGEA 2C6CA 4Y49B 5K8OA 1IOIA 4OC5A 4CYQA 3B3CA 5BWAB 3JRUA 1XJOA 3PZJA 2REFA 4XNHB 1J4JA 5AG7A 1TF8A 1F57A 2YNCC 1IB1E 2GIVA 1VKCA 3PB9X 3UY5A 4EFDA 4AVCA 2V8HA 3I3GA 5THWA 4QUSA 1HDUA 4UCNA 1BOBA 2Z11A 3D67A 4UF4A 2FSRA 4P4BA 1IOFA 2CNSA 2XEFA 4P6YA 4CRZB 5KTAA 3D7DA 3FBUA 2EUIA 3FF3A 4UIBA 4B5OA 3N7ZA 3KR4A 2POKA 1Y7EA 1AYEA 2PSWA 4A95A 4LQ6A 4NSQA 1VHEA 3KQXA 1OZPA 2PVVA 3RYOA 2PJ6A 3LD2A 2PJAA 1QSMA 1RO5A 5DS0A 3MRUA 2WYRA 5A28A 1CBXA 5JQ4A 1FY7A 2ZEDA 1KUYA 2R98A 2J8NA 5DWMA 1HEEA 4AVAA 4L8AA 2FIWA 4M6GA 4YWYA 1QSRA 2V8GA 4GS4A 3NE8A 4MMOA 2Z3LA 3FB3A 4M6HA 4QVTA 1Z5RA 3CXPA 5IV0A 1ZG8A 2H5MA 4E0AA 2EO8A 1U6MA 1M4DA 1TKFA 4NGTA 4MFZA 4TWEA 2Z10A 4P4EA 1CG2A 3DGVA 4P4IA 3S9MA 4C2YA 2IMOA 4PPZA 2PRBA 1XIXA 3BJ8A 4UFVA 4CYNA 3V38A 3JUWA 4FD6A 3SXOA 4EMEA 2X7BA 2BOAA 4WJBA 3KL9A 3KI9A 4NEXA 1QMUA 2YGWA 4IHMA 4OC4A 2DXQA 4OC0A 2FIAA 4RN7A 2HV2A 4OP4A 3TCVA 3TTHA 3PB8X 3IWGA 5G21A 3WC7A 2RFHA 4CGPA 5LRJA 4II9A 5F48A 4X5KA 4HNWB 3KKWA 3R9FA 2AFXA 4KOYA 5FVJA 3PP9A 4B5PB 4GM5A 4NGMA 2PC1A 4KLVA 4ZBGA 5F47A 1PYTB 2QMLA 3FIXA 2VZYA 1Z8TA 1CX8A 1S7LA 1YVKA 1XRYA 2ABZA 2QECA 4NCZA 4EWTA 2Q04A 4KSAA 4AG9A 2PCUA 2PIYA 4KSIA 2ZEOA 2F5IA 3I1UA 4UEZA 4E8OA 3IWWA 2XEGA 3S6FA 1I21A 4A33A 1Q2CA 4F9VA 2PE3A 4B14A 1LCPA 4ZYQA 4MJ8A 2GU2A 4OAEA 1Z8XA 4U9YA 3T90A 2BUEA 4HKFA 4NJQA 1BAVA 2AFZA 1VHSA 3D4UA 4X2TA 5I4MA 3EC4A 4ZGYB 2CTBA 4CYPA 3S9LA 1MJAA 1YMEA 2B3VA 4UEFA 5CBMA 3SI1A 4F8ZA 3WR7A 1S3ZA 5LYLA 4A32A 2I00A 3D3SA 2C6PA 1Y9WA 2OZHA 4OIWA 5LYDA 4A31A 4KUAA 3NH8A 2J8MA 4X3RA 1KZFA 4R9MA 4CAWA 2YNEA 3LWUA 1LAMA 4PXDA 3PRTA 5KTCA 4C7IA 1XMTA 2OR4A 5H86A 3D2PA 3WABA 2O28A 2ZEEA 4E2AA 1LFWA 4MHYA 4Z65A 3B2YA 1KWMA 2CF4A 3ISZA 1XEBA 2BEIA 4OC3A 2J9AA 3FEEA 3HLPA 2VZZA 1NMTA 1Z2LA 4XPLA 3R9GA 4FBEA 1X12A 3P2HA 3D68A 3E0KA 1YGHA 2PJ4A 3CXSA 1JWQA 2PDOA 5D29A 2ZOFA 4H2KA 4QB9A 2Z3PA 3SJXA 1QQ9A 3EY5A 2ODFA 1BPNA 2FS5A 2GLJA 4FWUA 3BLNA 4K30A 3LODA 5J8FA 3S9NA 1M44A 1R43A 4UCMA 4NJRA 1CPXA 3IWEA 4JJXA 2EVNA 1ARMA 4NF1A 4CAVA 4B6ZA 4UWJA 4U5YA 2ZEMA 3P2FA 1HDQA 2J8RA 4X8IA 1ARLA 2ZEPA 3GYAA 1B6BA 2BL1A 4OC2A 4F6AA 1VHOA 1ZLHA 2FCKA 3NE7A 1CPSA 2PJBA 1LRZA 1TKHA 2PJ2A 2ZPAA 3GUXA 5HH1A 4AB7A 4JD6A 1ELLP 3JVNA 2ZEHA 3RO0A 1YLEA 2B4BA 1Y0RA 3WT4A 1XE4A 3B3WA 1IICA 3K9TA 4IAVA 2ATRA 2JBKA 3CDXA 4FD4A 1PUAA 4MCPA 4CAFA 4NGQA 4CAEA 2AFSA 2FL4A 3SI0A 1MJBA 1XF8A 2O4HA 4IK2A 4MY3A 4F9UA 2B5GB 4CS0B 3EXNA 3DSBA 2ZXVA 4M6IA 2ZW7A 2ZEFA 4CGOA 3TOBA 3RNZA 7CPAA 2OU2A 2OZUA 1S7KA 3D2MA 3LMSA 3R96A 4R8FA 2PVWA 5CNPA 2GE3A 4PXCA 2PJ8A 2QIRA 1ZG7A 4DYOA 4J3GA 2B58A 4RUHA 1PU9A 2Z0ZA 5IX3A 4B10A 3IC1A 5LYIA 3IO1A 3TO6A 3G8WA 3TC8A 4A38A 3FH4A 4KS9A 4R76A 1NE9A 2Q4YA 3FXTA 2AFMA 4FD7A 4MFJA 2NSMA 2YNCA 2JEWA 2DEAA 1LOKA 2Q51A 3WC5A 3TOAA 1Y9KA 6CPAA 1IGBA 2PJCA 3K2KA 1YVOA 1N71A 4ONWA 3TO7A 4RI1A 4UIAA 1X10A 3G3SA 4NGSA 4EVYA 4PSWA 2FE7A 4TNUA 3KASA 5K8PA 2DF5A 1MK4A 1P4NA 2QVPA 3PGPA 4M85A 3D7HA 4DNCA 3TFYA 3PEIA 1DTDA 4JWPA 4B5PA 4DJLA 3BXMA 3WC6A 1ZG9A 4ZY1A 2HC9A 4I49A 2V8VA 2FT0A 4MXUA 4PK3A 1CM0A 1R3NA 2ZEGA 1VGYA 3KZWA 3SJFA 2ZW6A 1P0HA 2G3AA 4KZTA 1SQHA 4H6UA 1EE3P 3B3TA 1F2OA 4GXHA 5IB9A 3EFAA 1IYLA 2AFOA 3BJ7A 2PJ3A 3R9EA 3SI2A 2Z3KA 5F09A 2WPXA 3FYNA 1K4JA 2A4NA 4KLWA 2NYQA 4OADA 4OKOA 5J1QA 2BCOA 1M4LA 1ON0A 3T9YA 1PCAA 4YGOA 2Y0MA 1XBUA 4P4JA 4HNXB 1YQEA 3IIBA 1IY7A 4MRIA 5AG5A 3IFEA 4M3SA 3FEDA 3GIUA 3PBBA 4Q7AA 3B3SA 1FNOA 2PRQA 5HVFA 2PJ0A 4L89A 2VL1A 4YRHA 2OOTA 3PBEA 3FMCA 2Q44A 2REEA 3S6GA 4C2XA 2R8VA 5HMNA 5K8MA 2B4DB 5ELYA 2CNTA 1Z4RA 4MCSA 1CP6A 2GLFA 2OZGA 3TX8A 4CGLA 2G0BA 2Z3OA 3EO4A 4PSXA 4A94A 4NGRA 1YW4A 4LX9A 2D4OA 1UWYA 3KGQA 4ORFA 1Z9UA 3GY9A 2CXAA 5D8NA 4CAXA 4F0XA 1I12A 4R3KA 4P45A 1AMPA 3PB6X 3TE4A 4QC6A 2RB7A 3ZZIA 2G9DA 1M4IA 4P44A 2DPSA 4YU9A 5LYFA 2JEVA 5G22A 2AFUA 3IU1A 1FT7A 4MBUA 4FUUA 1V0CA 1AUGA 2EK8A 3D7FA 1TKJA 4PXEA 5A27A 2BO9A 2K5TA 4UBRA 4UFWA 1YR0A 4AXVA 2P6GA 4K3NA 1OBRA 5AG6A 4IUSA 1Z8LA 4DUKA 1ELMP 1Q7LA 2HB6A 2CY2A 3QNVA 2AFWA 4YFJA 4R87A 2PJ9A 4FD5A 4BD9A 4Q36A 2EK9A 4R6TA 2AE6A 1RXTA 3HUVA 3B8GA 3L2NA 5G1ZA
chains in the Genus database with same CATH topology
5I0CA 1ZO0A 5DWNA 1MJ9A 4F0YA 2JLMA 3R1KA 4KVXA 3W6SA 2G3TA 2I79A 3DR8A 3S6KA 3FRMA 3V8IA 3A9LA 2RC4A 1I1DA 1QSOA 1B87A 2WSAA 4A2ZA 5IB0A 3TT2A 4KVME 1R57A 1S60A 3DR6A 4AVBA 4IF5A 4MI4A 4KSFA 2Z3MA 3CXQA 4R57A 4XPDC 3ZJ0A 3OWCA 4BBHA 2B5GA 2R7HA 2CNMA 1Y7RA 2ARHA 4B12A 4C7HA 4NXYA 4CGMA 1GHEA 1BO4A 3DNSA 3DDDA 4U9ZA 1IYKA 1L0CA 3GKRA 2ZW4A 1YREA 4PV6A 1Q2YA 3IGRA 4MY0A 1S5KA 4KOVA 4MHDA 2PR8A 5EBVA 4AG7A 4C2ZA 2Q0YA 2BSWA 2HQYA 4KOWA 5JPHA 1WWZA 5C88A 4CGNA 5ISVA 1M1DA 5GCNA 2DPTA 2GANA 1M4GA 2FXFA 2PR1A 2HUZA 4RS2A 2C27A 4MFKA 2VI7A 2IL4A 4XPDB 2D4PA 1CJWA 5J8CA 5G20A 1YK3A 4UA3A 1QSTA 3VWDA 2YNDA 3C26A 4UCPA 1IIDA 2VBQA 4B11A 3VWEA 3F8KA 5F46A 5AG4A 5H84A 4B13A 2OB0A 2VEZA 2VXKA 2KCWA 4KOUA 4CYOA 4HNYB 2P6FA 4JXRA 4CRYB 1NSLA 3F0AA 4MFPA 4KOSA 3SHPA 4R3LA 3S6HA 2AJ6A 1KUVA 3FNCA 4KORA 1Z4EA 3K9UA 2NMTA 2Q7BA 3H4QA 4PK2A 2JDCA 2PQ8A 4C68A 3D8PA 4LUAA 2Z3NA 1WK4A 3F5BA 1QSNA 4JLYA 3QB8A 4ONUA 3TO9A 2P6EA 4QBJA 2B4DA 2JDDA 3I9SA 1S7NA 4UFXA 4Y49C 3H5ZA 4KOXA 4XNHC 3W91A 2ZW5A 2P0WA 1TIQA 1Q2DA 4KUBA 2OH1A 3JTKA 1YX0A 4KOTA 4JXQA 4MFQA 2Q4VA 4XPKA 2B3UA 2WPWA 3QAHA 5C82A 4MFLA 4KVOE 3MGDA 3R95A 4UWIA 4H6ZA 4OLLA 4Q38A 4BMHA 3SXNA 1UFHA 1S7FA 1KUXA 4H89A 5F49A 3W6XA 5EC4A 3IU2A 5E96A 2VQYA 5KTDA 4A30A 2R1IA 2WUUA 5AGEA 4Y49B 4CYQA 5BWAB 3PZJA 2REFA 4XNHB 1J4JA 5AG7A 2YNCC 1IB1E 2GIVA 1VKCA 3UY5A 4AVCA 3I3GA 4QUSA 4UCNA 1BOBA 2Z11A 2FSRA 2CNSA 4CRZB 5KTAA 3FBUA 2EUIA 4B5OA 3N7ZA 2PSWA 4A95A 4NSQA 1OZPA 3RYOA 3LD2A 1QSMA 1RO5A 5A28A 5JQ4A 1FY7A 1KUYA 2R98A 2J8NA 5DWMA 4AVAA 4L8AA 2FIWA 1QSRA 4GS4A 2Z3LA 3FB3A 4QVTA 3CXPA 5IV0A 2H5MA 4E0AA 1U6MA 1M4DA 4MFZA 2Z10A 4C2YA 2PRBA 1XIXA 3BJ8A 4UFVA 4CYNA 3JUWA 4FD6A 3SXOA 2X7BA 4NEXA 2YGWA 2DXQA 2FIAA 2HV2A 3TCVA 3TTHA 3IWGA 5G21A 4CGPA 4II9A 5F48A 4X5KA 4HNWB 3KKWA 3R9FA 4KOYA 5FVJA 3PP9A 4B5PB 2PC1A 4KLVA 4ZBGA 5F47A 2QMLA 3FIXA 2VZYA 1YVKA 1S7LA 2QECA 4NCZA 2Q04A 4KSAA 4AG9A 2F5IA 4E8OA 3S6FA 1I21A 4A33A 1Q2CA 4B14A 4MJ8A 4OAEA 4U9YA 3T90A 2BUEA 4HKFA 1VHSA 3EC4A 4ZGYB 4CYPA 1MJAA 2B3VA 3WR7A 1S3ZA 4A32A 2I00A 3D3SA 1Y9WA 2OZHA 4A31A 4KUAA 2J8MA 1KZFA 4R9MA 4CAWA 2YNEA 5KTCA 4C7IA 1XMTA 5H86A 3D2PA 4E2AA 2O28A 1XEBA 2BEIA 4XPLA 2VZZA 1NMTA 3R9GA 3P2HA 3E0KA 1YGHA 3CXSA 2PDOA 4QB9A 2Z3PA 3EY5A 2FS5A 3BLNA 4K30A 3LODA 5J8FA 1M44A 4UCMA 3IWEA 4JJXA 2EVNA 4NF1A 4CAVA 4UWJA 4U5YA 3P2FA 2J8RA 4F6AA 3GYAA 1B6BA 2BL1A 2FCKA 3NE7A 1LRZA 2ZPAA 5HH1A 4AB7A 4JD6A 3JVNA 1YLEA 2B4BA 1XE4A 1IICA 2ATRA 4FD4A 1PUAA 4CAFA 4CAEA 2FL4A 1MJBA 1XF8A 4MY3A 2B5GB 4CS0B 3EXNA 3DSBA 2ZXVA 2ZW7A 4CGOA 3TOBA 2OU2A 2OZUA 1S7KA 3D2MA 3R96A 5CNPA 2GE3A 2QIRA 4J3GA 2B58A 1PU9A 2Z0ZA 5IX3A 4B10A 3TO6A 3G8WA 4KS9A 1NE9A 2Q4YA 3FXTA 4FD7A 4MFJA 2YNCA 3TOAA 1Y9KA 1YVOA 1N71A 3TO7A 4RI1A 3G3SA 4EVYA 4PSWA 2FE7A 1MK4A 1P4NA 3PGPA 4M85A 3TFYA 4DNCA 4JWPA 4B5PA 4I49A 2FT0A 4PK3A 1CM0A 2ZW6A 1P0HA 2G3AA 4KZTA 1SQHA 4H6UA 3EFAA 1IYLA 3BJ7A 3R9EA 2Z3KA 2WPXA 3FYNA 1K4JA 2A4NA 4KLWA 4OADA 1ON0A 3T9YA 4YGOA 2Y0MA 4HNXB 5AG5A 4M3SA 4L89A 4YRHA 2Q44A 2REEA 3S6GA 4C2XA 2R8VA 5HMNA 2B4DB 2CNTA 1Z4RA 2OZGA 4CGLA 2G0BA 2Z3OA 3EO4A 4PSXA 4LX9A 2D4OA 4ORFA 1Z9UA 3GY9A 2CXAA 4CAXA 4F0XA 1I12A 4R3KA 3TE4A 4QC6A 3ZZIA 1M4IA 2DPSA 2JEVA 5G22A 3IU1A 4MBUA 1V0CA 5A27A 2K5TA 4UBRA 4UFWA 1YR0A 2P6GA 5AG6A 4IUSA 4YFJA 2CY2A 4R87A 4FD5A 4Q36A 2AE6A 1RXTA 3B8GA 5G1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGN A;  4CYP A;  4A32 A;  4B12 A;  4A95 A;  4B10 A;  4C7H A;  4A31 A;  4C2Y A;  3IU2 A;  5AG5 A;  4CGM A;  4UFV A;  2YNE A;  4CYN A;  3JTK A;  4A30 A;  5G22 A;  2WUU A;  4CAF A;  3IU1 A;  5AGE A;  4C7I A;  2WSA A;  4CAE A;  5G20 A;  4A2Z A;  4C2X A;  4UCM A;  4A33 A;  4CYQ A;  2YNC A;  3IWE A;  5A27 A;  2YND A;  4UFW A;  4UCP A;  4B11 A;  4B14 A;  5A28 A;  4C68 A;  5G21 A;  5AG7 A;  2YNC C;  5AG6 A;  4CGP A;  4CGL A;  4CGO A;  5AG4 A;  4C2Z A;  4B13 A;  4UCN A;  4UFX A;  4BBH A;  4CYO A;  5G1Z A;  3H5Z A; 
#chains in the Genus database with same CATH topology
 2V8D A;  5I0C A;  1YLO A;  1ZO0 A;  5DWN A;  5HXD A;  1MJ9 A;  4FAI A;  4NFR A;  4F0Y A;  2V77 A;  2JLM A;  2IJZ A;  3R1K A;  4KVX A;  3W6S A;  4MHZ A;  2G3T A;  2I79 A;  3PB4 X;  3DR8 A;  2ZOG A;  2C6G A;  3FRM A;  3S6K A;  3V8I A;  3A9L A;  2RC4 A;  1I1D A;  1QSO A;  5LRK A;  1B87 A;  2WSA A;  3SJE A;  4A2Z A;  5IB0 A;  3H8F A;  3TT2 A;  4KVM E;  2CIJ A;  1R57 A;  1S60 A;  3DR6 A;  4W9Y A;  4IF5 A;  4AVB A;  4MI4 A;  4KSF A;  4HPS A;  2Z3M A;  5K8N A;  3CXQ A;  3NA6 A;  4R57 A;  4XPD C;  3FJU A;  3ZJ0 A;  3OWC A;  2ZEL A;  4BIN A;  4BBH A;  2B5G A;  2R7H A;  2CNM A;  3B3V A;  4OME A;  1Y0Y A;  2EWB A;  1NSA A;  2QYV A;  1Y7R A;  4ZX8 A;  2ARH A;  2O53 A;  4ZI6 A;  3NFZ A;  4B12 A;  1YSJ A;  3RBU A;  3B35 A;  4NXY A;  4WWV A;  2ANP A;  4C7H A;  4R7M A;  4CGM A;  1TF9 A;  1GHE A;  3NH4 A;  1BO4 A;  3DNS A;  3DDD A;  4U9Z A;  1IYK A;  3FVL A;  2PJ1 A;  1L0C A;  3GKR A;  2F7V A;  2ZW4 A;  4PQA A;  5HVH A;  4PXB A;  2PIZ A;  1YRE A;  1LAP A;  3B7I A;  2QJ8 A;  1Q2Y A;  4PV6 A;  3IGR A;  4MY0 A;  1S5K A;  1XFO A;  4KOV A;  3RAM A;  4MHD A;  2PR8 A;  5EBV A;  4AG7 A;  4C2Z A;  1XMB A;  2Q0Y A;  1F2P A;  2BSW A;  2HQY A;  4KOW A;  5JPH A;  1WWZ A;  2IQ6 A;  5C88 A;  5JGF A;  5JH9 A;  4CGN A;  3KHX A;  5ISV A;  1M1D A;  5GCN A;  4P4D A;  2DPT A;  4A37 A;  2GAN A;  1M4G A;  4O23 A;  2FXF A;  2PR1 A;  3FEC A;  2HUZ A;  4RS2 A;  3T8W A;  3CZX A;  2C27 A;  4MFK A;  2VI7 A;  3V7Z A;  1H8L A;  3VAR A;  2XEJ A;  2IL4 A;  3BI1 A;  4XPD B;  4NGP A;  2D4P A;  1CJW A;  2EBJ A;  5J8C A;  3H8G A;  1YK3 A;  3IEH A;  4JYW A;  4UA3 A;  1QST A;  5G20 A;  2Q7S A;  4ZX9 A;  3VWD A;  4QBJ A;  2YND A;  3C26 A;  4UCP A;  1IID A;  2VBQ A;  3NH5 A;  4B11 A;  5HVG A;  3H8E A;  3QAY A;  3VWE A;  1VIX A;  3F8K A;  5F46 A;  5AG4 A;  5H84 A;  4B13 A;  2OB0 A;  4CPA A;  2VEZ A;  5CPA A;  1LAN A;  2KCW A;  2VXK A;  2Q43 A;  3LAC A;  4KOU A;  4CYO A;  4ZY0 A;  2PJ7 A;  4HNY B;  2P6F A;  2C1C A;  3CPX A;  4JXR A;  1NSL A;  3F0A A;  4CRY B;  4MFP A;  1IU8 A;  4KOS A;  3SHP A;  4R3L A;  2XEI A;  1BLL E;  4UEE A;  8CPA A;  1A2Z A;  1GYT A;  3S6H A;  4OID A;  2AJ6 A;  4ZY2 A;  3SJG A;  1KUV A;  3FNC A;  3PFE A;  4MCQ A;  3VAT A;  4KOR A;  1Z4E A;  3K9U A;  2FVG A;  2NMT A;  3H4Q A;  2Q7B A;  2PJ5 A;  4A39 A;  4PK2 A;  2JDC A;  2F8H A;  1Z8W A;  4JZ0 A;  2PQ8 A;  4C68 A;  3D8P A;  1YW6 A;  2CTC A;  3CPA A;  4LUA A;  2Z3N A;  4P4F A;  1WK4 A;  3F5B A;  1QSN A;  3D66 A;  4JLY A;  3QB8 A;  3GLJ A;  4ONU A;  2P6E A;  3TO9 A;  2B4D A;  2JDD A;  3BHX A;  1S7N A;  3I9S A;  4UFX A;  4G1P A;  4Y49 C;  3GB0 A;  5EMI A;  3H5Z A;  3KQZ A;  1CP7 A;  4KOX A;  4XNH C;  3W91 A;  2ZW5 A;  3VH9 A;  4NGN A;  2P0W A;  1TIQ A;  1Q2D A;  1RTQ A;  4KUB A;  2OH1 A;  5LRG A;  3JTK A;  1YX0 A;  3RZA A;  4KOT A;  2JBJ A;  4JXQ A;  4MFQ A;  4MHP A;  2GRE A;  2ZEN A;  3CT9 A;  2Q4V A;  4XPK A;  3IJ3 A;  2B3U A;  3BI0 A;  3FX6 A;  2WPW A;  3QAH A;  5C82 A;  3MN8 A;  4KVO E;  4MFL A;  3MGD A;  3R95 A;  4UWI A;  5JM6 A;  4H6Z A;  3KR5 A;  1TXR A;  4OLL A;  1JQG A;  1ZLI A;  4Q38 A;  3ISX A;  4BMH A;  3D7G A;  4LQG A;  2GFQ A;  4OC1 A;  2Q4Z A;  3SXN A;  1UFH A;  2I3C A;  1S7F A;  1KUX A;  3N5F A;  1DE4 C;  4H89 A;  4MCR A;  5F49 A;  3W6X A;  5EC4 A;  1BPM A;  3DLJ A;  4MHN A;  3KHZ A;  3IU2 A;  3PB7 X;  4P10 A;  1XOV A;  5E96 A;  2VQY A;  5KTD A;  4A30 A;  2R1I A;  3PFO A;  2WUU A;  2WZN A;  5AGE A;  2C6C A;  4Y49 B;  5K8O A;  1IOI A;  4OC5 A;  4CYQ A;  3B3C A;  5BWA B;  3JRU A;  1XJO A;  3PZJ A;  2REF A;  4XNH B;  1J4J A;  5AG7 A;  1TF8 A;  1F57 A;  2YNC C;  1IB1 E;  2GIV A;  1VKC A;  3PB9 X;  3UY5 A;  4EFD A;  4AVC A;  2V8H A;  3I3G A;  5THW A;  4QUS A;  1HDU A;  4UCN A;  1BOB A;  2Z11 A;  3D67 A;  4UF4 A;  2FSR A;  4P4B A;  1IOF A;  2CNS A;  2XEF A;  4P6Y A;  4CRZ B;  5KTA A;  3D7D A;  3FBU A;  2EUI A;  3FF3 A;  4UIB A;  4B5O A;  3N7Z A;  3KR4 A;  2POK A;  1Y7E A;  1AYE A;  2PSW A;  4A95 A;  4LQ6 A;  4NSQ A;  1VHE A;  3KQX A;  1OZP A;  2PVV A;  3RYO A;  2PJ6 A;  3LD2 A;  2PJA A;  1QSM A;  1RO5 A;  5DS0 A;  3MRU A;  2WYR A;  5A28 A;  1CBX A;  5JQ4 A;  1FY7 A;  2ZED A;  1KUY A;  2R98 A;  2J8N A;  5DWM A;  1HEE A;  4AVA A;  4L8A A;  2FIW A;  4M6G A;  4YWY A;  1QSR A;  2V8G A;  4GS4 A;  3NE8 A;  4MMO A;  2Z3L A;  3FB3 A;  4M6H A;  4QVT A;  1Z5R A;  3CXP A;  5IV0 A;  1ZG8 A;  2H5M A;  4E0A A;  2EO8 A;  1U6M A;  1M4D A;  1TKF A;  4NGT A;  4MFZ A;  4TWE A;  2Z10 A;  4P4E A;  1CG2 A;  3DGV A;  4P4I A;  3S9M A;  4C2Y A;  2IMO A;  4PPZ A;  2PRB A;  1XIX A;  3BJ8 A;  4UFV A;  4CYN A;  3V38 A;  3JUW A;  4FD6 A;  3SXO A;  4EME A;  2X7B A;  2BOA A;  4WJB A;  3KL9 A;  3KI9 A;  4NEX A;  1QMU A;  2YGW A;  4IHM A;  4OC4 A;  2DXQ A;  4OC0 A;  2FIA A;  4RN7 A;  2HV2 A;  4OP4 A;  3TCV A;  3TTH A;  3PB8 X;  3IWG A;  5G21 A;  3WC7 A;  2RFH A;  4CGP A;  5LRJ A;  4II9 A;  5F48 A;  4X5K A;  4HNW B;  3KKW A;  3R9F A;  2AFX A;  4KOY A;  5FVJ A;  3PP9 A;  4B5P B;  4GM5 A;  4NGM A;  2PC1 A;  4KLV A;  4ZBG A;  5F47 A;  1PYT B;  2QML A;  3FIX A;  2VZY A;  1Z8T A;  1CX8 A;  1S7L A;  1YVK A;  1XRY A;  2ABZ A;  2QEC A;  4NCZ A;  4EWT A;  2Q04 A;  4KSA A;  4AG9 A;  2PCU A;  2PIY A;  4KSI A;  2ZEO A;  2F5I A;  3I1U A;  4UEZ A;  4E8O A;  3IWW A;  2XEG A;  3S6F A;  1I21 A;  4A33 A;  1Q2C A;  4F9V A;  2PE3 A;  4B14 A;  1LCP A;  4ZYQ A;  4MJ8 A;  2GU2 A;  4OAE A;  1Z8X A;  4U9Y A;  3T90 A;  2BUE A;  4HKF A;  4NJQ A;  1BAV A;  2AFZ A;  1VHS A;  3D4U A;  4X2T A;  5I4M A;  3EC4 A;  4ZGY B;  2CTB A;  4CYP A;  3S9L A;  1MJA A;  1YME A;  2B3V A;  4UEF A;  5CBM A;  3SI1 A;  4F8Z A;  3WR7 A;  1S3Z A;  5LYL A;  4A32 A;  2I00 A;  3D3S A;  2C6P A;  1Y9W A;  2OZH A;  4OIW A;  5LYD A;  4A31 A;  4KUA A;  3NH8 A;  2J8M A;  4X3R A;  1KZF A;  4R9M A;  4CAW A;  2YNE A;  3LWU A;  1LAM A;  4PXD A;  3PRT A;  5KTC A;  4C7I A;  1XMT A;  2OR4 A;  5H86 A;  3D2P A;  3WAB A;  2O28 A;  2ZEE A;  4E2A A;  1LFW A;  4MHY A;  4Z65 A;  3B2Y A;  1KWM A;  2CF4 A;  3ISZ A;  1XEB A;  2BEI A;  4OC3 A;  2J9A A;  3FEE A;  3HLP A;  2VZZ A;  1NMT A;  1Z2L A;  4XPL A;  3R9G A;  4FBE A;  1X12 A;  3P2H A;  3D68 A;  3E0K A;  1YGH A;  2PJ4 A;  3CXS A;  1JWQ A;  2PDO A;  5D29 A;  2ZOF A;  4H2K A;  4QB9 A;  2Z3P A;  3SJX A;  1QQ9 A;  3EY5 A;  2ODF A;  1BPN A;  2FS5 A;  2GLJ A;  4FWU A;  3BLN A;  4K30 A;  3LOD A;  5J8F A;  3S9N A;  1M44 A;  1R43 A;  4UCM A;  4NJR A;  1CPX A;  3IWE A;  4JJX A;  2EVN A;  1ARM A;  4NF1 A;  4CAV A;  4B6Z A;  4UWJ A;  4U5Y A;  2ZEM A;  3P2F A;  1HDQ A;  2J8R A;  4X8I A;  1ARL A;  2ZEP A;  3GYA A;  1B6B A;  2BL1 A;  4OC2 A;  4F6A A;  1VHO A;  1ZLH A;  2FCK A;  3NE7 A;  1CPS A;  2PJB A;  1LRZ A;  1TKH A;  2PJ2 A;  2ZPA A;  3GUX A;  5HH1 A;  4AB7 A;  4JD6 A;  1ELL P;  3JVN A;  2ZEH A;  3RO0 A;  1YLE A;  2B4B A;  1Y0R A;  3WT4 A;  1XE4 A;  3B3W A;  1IIC A;  3K9T A;  4IAV A;  2ATR A;  2JBK A;  3CDX A;  4FD4 A;  1PUA A;  4MCP A;  4CAF A;  4NGQ A;  4CAE A;  2AFS A;  2FL4 A;  3SI0 A;  1MJB A;  1XF8 A;  2O4H A;  4IK2 A;  4MY3 A;  4F9U A;  2B5G B;  4CS0 B;  3EXN A;  3DSB A;  2ZXV A;  4M6I A;  2ZW7 A;  2ZEF A;  4CGO A;  3TOB A;  3RNZ A;  7CPA A;  2OU2 A;  2OZU A;  1S7K A;  3D2M A;  3LMS A;  3R96 A;  4R8F A;  2PVW A;  5CNP A;  2GE3 A;  4PXC A;  2PJ8 A;  2QIR A;  1ZG7 A;  4DYO A;  4J3G A;  2B58 A;  4RUH A;  1PU9 A;  2Z0Z A;  5IX3 A;  4B10 A;  3IC1 A;  5LYI A;  3IO1 A;  3TO6 A;  3G8W A;  3TC8 A;  4A38 A;  3FH4 A;  4KS9 A;  4R76 A;  1NE9 A;  2Q4Y A;  3FXT A;  2AFM A;  4FD7 A;  4MFJ A;  2NSM A;  2YNC A;  2JEW A;  2DEA A;  1LOK A;  2Q51 A;  3WC5 A;  3TOA A;  1Y9K A;  6CPA A;  1IGB A;  2PJC A;  3K2K A;  1YVO A;  1N71 A;  4ONW A;  3TO7 A;  4RI1 A;  4UIA A;  1X10 A;  3G3S A;  4NGS A;  4EVY A;  4PSW A;  2FE7 A;  4TNU A;  3KAS A;  5K8P A;  2DF5 A;  1MK4 A;  1P4N A;  2QVP A;  3PGP A;  4M85 A;  3D7H A;  4DNC A;  3TFY A;  3PEI A;  1DTD A;  4JWP A;  4B5P A;  4DJL A;  3BXM A;  3WC6 A;  1ZG9 A;  4ZY1 A;  2HC9 A;  4I49 A;  2V8V A;  2FT0 A;  4MXU A;  4PK3 A;  1CM0 A;  1R3N A;  2ZEG A;  1VGY A;  3KZW A;  3SJF A;  2ZW6 A;  1P0H A;  2G3A A;  4KZT A;  1SQH A;  4H6U A;  1EE3 P;  3B3T A;  1F2O A;  4GXH A;  5IB9 A;  3EFA A;  1IYL A;  2AFO A;  3BJ7 A;  2PJ3 A;  3R9E A;  3SI2 A;  2Z3K A;  5F09 A;  2WPX A;  3FYN A;  1K4J A;  2A4N A;  4KLW A;  2NYQ A;  4OAD A;  4OKO A;  5J1Q A;  2BCO A;  1M4L A;  1ON0 A;  3T9Y A;  1PCA A;  4YGO A;  2Y0M A;  1XBU A;  4P4J A;  4HNX B;  1YQE A;  3IIB A;  1IY7 A;  4MRI A;  5AG5 A;  3IFE A;  4M3S A;  3FED A;  3GIU A;  3PBB A;  4Q7A A;  3B3S A;  1FNO A;  2PRQ A;  5HVF A;  2PJ0 A;  4L89 A;  2VL1 A;  4YRH A;  2OOT A;  3PBE A;  3FMC A;  2Q44 A;  2REE A;  3S6G A;  4C2X A;  2R8V A;  5HMN A;  5K8M A;  2B4D B;  5ELY A;  2CNT A;  1Z4R A;  4MCS A;  1CP6 A;  2GLF A;  2OZG A;  3TX8 A;  4CGL A;  2G0B A;  2Z3O A;  3EO4 A;  4PSX A;  4A94 A;  4NGR A;  1YW4 A;  4LX9 A;  2D4O A;  1UWY A;  3KGQ A;  4ORF A;  1Z9U A;  3GY9 A;  2CXA A;  5D8N A;  4CAX A;  4F0X A;  1I12 A;  4R3K A;  4P45 A;  1AMP A;  3PB6 X;  3TE4 A;  4QC6 A;  2RB7 A;  3ZZI A;  2G9D A;  1M4I A;  4P44 A;  2DPS A;  4YU9 A;  5LYF A;  2JEV A;  5G22 A;  2AFU A;  3IU1 A;  1FT7 A;  4MBU A;  4FUU A;  1V0C A;  1AUG A;  2EK8 A;  3D7F A;  1TKJ A;  4PXE A;  5A27 A;  2BO9 A;  2K5T A;  4UBR A;  4UFW A;  1YR0 A;  4AXV A;  2P6G A;  4K3N A;  1OBR A;  5AG6 A;  4IUS A;  1Z8L A;  4DUK A;  1ELM P;  1Q7L A;  2HB6 A;  2CY2 A;  3QNV A;  2AFW A;  4YFJ A;  4R87 A;  2PJ9 A;  4FD5 A;  4BD9 A;  4Q36 A;  2EK9 A;  4R6T A;  2AE6 A;  1RXT A;  3HUV A;  3B8G A;  3L2N A;  5G1Z A; 
#chains in the Genus database with same CATH homology
 5I0C A;  1ZO0 A;  5DWN A;  1MJ9 A;  4F0Y A;  2JLM A;  3R1K A;  4KVX A;  3W6S A;  2G3T A;  2I79 A;  3DR8 A;  3S6K A;  3FRM A;  3V8I A;  3A9L A;  2RC4 A;  1I1D A;  1QSO A;  1B87 A;  2WSA A;  4A2Z A;  5IB0 A;  3TT2 A;  4KVM E;  1R57 A;  1S60 A;  3DR6 A;  4AVB A;  4IF5 A;  4MI4 A;  4KSF A;  2Z3M A;  3CXQ A;  4R57 A;  4XPD C;  3ZJ0 A;  3OWC A;  4BBH A;  2B5G A;  2R7H A;  2CNM A;  1Y7R A;  2ARH A;  4B12 A;  4C7H A;  4NXY A;  4CGM A;  1GHE A;  1BO4 A;  3DNS A;  3DDD A;  4U9Z A;  1IYK A;  1L0C A;  3GKR A;  2ZW4 A;  1YRE A;  4PV6 A;  1Q2Y A;  3IGR A;  4MY0 A;  1S5K A;  4KOV A;  4MHD A;  2PR8 A;  5EBV A;  4AG7 A;  4C2Z A;  2Q0Y A;  2BSW A;  2HQY A;  4KOW A;  5JPH A;  1WWZ A;  5C88 A;  4CGN A;  5ISV A;  1M1D A;  5GCN A;  2DPT A;  2GAN A;  1M4G A;  2FXF A;  2PR1 A;  2HUZ A;  4RS2 A;  2C27 A;  4MFK A;  2VI7 A;  2IL4 A;  4XPD B;  2D4P A;  1CJW A;  5J8C A;  5G20 A;  1YK3 A;  4UA3 A;  1QST A;  3VWD A;  2YND A;  3C26 A;  4UCP A;  1IID A;  2VBQ A;  4B11 A;  3VWE A;  3F8K A;  5F46 A;  5AG4 A;  5H84 A;  4B13 A;  2OB0 A;  2VEZ A;  2VXK A;  2KCW A;  4KOU A;  4CYO A;  4HNY B;  2P6F A;  4JXR A;  4CRY B;  1NSL A;  3F0A A;  4MFP A;  4KOS A;  3SHP A;  4R3L A;  3S6H A;  2AJ6 A;  1KUV A;  3FNC A;  4KOR A;  1Z4E A;  3K9U A;  2NMT A;  2Q7B A;  3H4Q A;  4PK2 A;  2JDC A;  2PQ8 A;  4C68 A;  3D8P A;  4LUA A;  2Z3N A;  1WK4 A;  3F5B A;  1QSN A;  4JLY A;  3QB8 A;  4ONU A;  3TO9 A;  2P6E A;  4QBJ A;  2B4D A;  2JDD A;  3I9S A;  1S7N A;  4UFX A;  4Y49 C;  3H5Z A;  4KOX A;  4XNH C;  3W91 A;  2ZW5 A;  2P0W A;  1TIQ A;  1Q2D A;  4KUB A;  2OH1 A;  3JTK A;  1YX0 A;  4KOT A;  4JXQ A;  4MFQ A;  2Q4V A;  4XPK A;  2B3U A;  2WPW A;  3QAH A;  5C82 A;  4MFL A;  4KVO E;  3MGD A;  3R95 A;  4UWI A;  4H6Z A;  4OLL A;  4Q38 A;  4BMH A;  3SXN A;  1UFH A;  1S7F A;  1KUX A;  4H89 A;  5F49 A;  3W6X A;  5EC4 A;  3IU2 A;  5E96 A;  2VQY A;  5KTD A;  4A30 A;  2R1I A;  2WUU A;  5AGE A;  4Y49 B;  4CYQ A;  5BWA B;  3PZJ A;  2REF A;  4XNH B;  1J4J A;  5AG7 A;  2YNC C;  1IB1 E;  2GIV A;  1VKC A;  3UY5 A;  4AVC A;  3I3G A;  4QUS A;  4UCN A;  1BOB A;  2Z11 A;  2FSR A;  2CNS A;  4CRZ B;  5KTA A;  3FBU A;  2EUI A;  4B5O A;  3N7Z A;  2PSW A;  4A95 A;  4NSQ A;  1OZP A;  3RYO A;  3LD2 A;  1QSM A;  1RO5 A;  5A28 A;  5JQ4 A;  1FY7 A;  1KUY A;  2R98 A;  2J8N A;  5DWM A;  4AVA A;  4L8A A;  2FIW A;  1QSR A;  4GS4 A;  2Z3L A;  3FB3 A;  4QVT A;  3CXP A;  5IV0 A;  2H5M A;  4E0A A;  1U6M A;  1M4D A;  4MFZ A;  2Z10 A;  4C2Y A;  2PRB A;  1XIX A;  3BJ8 A;  4UFV A;  4CYN A;  3JUW A;  4FD6 A;  3SXO A;  2X7B A;  4NEX A;  2YGW A;  2DXQ A;  2FIA A;  2HV2 A;  3TCV A;  3TTH A;  3IWG A;  5G21 A;  4CGP A;  4II9 A;  5F48 A;  4X5K A;  4HNW B;  3KKW A;  3R9F A;  4KOY A;  5FVJ A;  3PP9 A;  4B5P B;  2PC1 A;  4KLV A;  4ZBG A;  5F47 A;  2QML A;  3FIX A;  2VZY A;  1YVK A;  1S7L A;  2QEC A;  4NCZ A;  2Q04 A;  4KSA A;  4AG9 A;  2F5I A;  4E8O A;  3S6F A;  1I21 A;  4A33 A;  1Q2C A;  4B14 A;  4MJ8 A;  4OAE A;  4U9Y A;  3T90 A;  2BUE A;  4HKF A;  1VHS A;  3EC4 A;  4ZGY B;  4CYP A;  1MJA A;  2B3V A;  3WR7 A;  1S3Z A;  4A32 A;  2I00 A;  3D3S A;  1Y9W A;  2OZH A;  4A31 A;  4KUA A;  2J8M A;  1KZF A;  4R9M A;  4CAW A;  2YNE A;  5KTC A;  4C7I A;  1XMT A;  5H86 A;  3D2P A;  4E2A A;  2O28 A;  1XEB A;  2BEI A;  4XPL A;  2VZZ A;  1NMT A;  3R9G A;  3P2H A;  3E0K A;  1YGH A;  3CXS A;  2PDO A;  4QB9 A;  2Z3P A;  3EY5 A;  2FS5 A;  3BLN A;  4K30 A;  3LOD A;  5J8F A;  1M44 A;  4UCM A;  3IWE A;  4JJX A;  2EVN A;  4NF1 A;  4CAV A;  4UWJ A;  4U5Y A;  3P2F A;  2J8R A;  4F6A A;  3GYA A;  1B6B A;  2BL1 A;  2FCK A;  3NE7 A;  1LRZ A;  2ZPA A;  5HH1 A;  4AB7 A;  4JD6 A;  3JVN A;  1YLE A;  2B4B A;  1XE4 A;  1IIC A;  2ATR A;  4FD4 A;  1PUA A;  4CAF A;  4CAE A;  2FL4 A;  1MJB A;  1XF8 A;  4MY3 A;  2B5G B;  4CS0 B;  3EXN A;  3DSB A;  2ZXV A;  2ZW7 A;  4CGO A;  3TOB A;  2OU2 A;  2OZU A;  1S7K A;  3D2M A;  3R96 A;  5CNP A;  2GE3 A;  2QIR A;  4J3G A;  2B58 A;  1PU9 A;  2Z0Z A;  5IX3 A;  4B10 A;  3TO6 A;  3G8W A;  4KS9 A;  1NE9 A;  2Q4Y A;  3FXT A;  4FD7 A;  4MFJ A;  2YNC A;  3TOA A;  1Y9K A;  1YVO A;  1N71 A;  3TO7 A;  4RI1 A;  3G3S A;  4EVY A;  4PSW A;  2FE7 A;  1MK4 A;  1P4N A;  3PGP A;  4M85 A;  3TFY A;  4DNC A;  4JWP A;  4B5P A;  4I49 A;  2FT0 A;  4PK3 A;  1CM0 A;  2ZW6 A;  1P0H A;  2G3A A;  4KZT A;  1SQH A;  4H6U A;  3EFA A;  1IYL A;  3BJ7 A;  3R9E A;  2Z3K A;  2WPX A;  3FYN A;  1K4J A;  2A4N A;  4KLW A;  4OAD A;  1ON0 A;  3T9Y A;  4YGO A;  2Y0M A;  4HNX B;  5AG5 A;  4M3S A;  4L89 A;  4YRH A;  2Q44 A;  2REE A;  3S6G A;  4C2X A;  2R8V A;  5HMN A;  2B4D B;  2CNT A;  1Z4R A;  2OZG A;  4CGL A;  2G0B A;  2Z3O A;  3EO4 A;  4PSX A;  4LX9 A;  2D4O A;  4ORF A;  1Z9U A;  3GY9 A;  2CXA A;  4CAX A;  4F0X A;  1I12 A;  4R3K A;  3TE4 A;  4QC6 A;  3ZZI A;  1M4I A;  2DPS A;  2JEV A;  5G22 A;  3IU1 A;  4MBU A;  1V0C A;  5A27 A;  2K5T A;  4UBR A;  4UFW A;  1YR0 A;  2P6G A;  5AG6 A;  4IUS A;  4YFJ A;  2CY2 A;  4R87 A;  4FD5 A;  4Q36 A;  2AE6 A;  1RXT A;  3B8G A;  5G1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...