1QSOA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
NITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 32
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsoA00
3FXTA 4XPKA 2G0BA 5EC4A 2Q4YA 5CNPA 2BUEA 2AJ6A 4R9MA 2R98A 3MGDA 1M1DA 1YX0A 3CXQA 4KOWA 3TT2A 3GKRA 2PSWA 2PC1A 4AVAA 3FNCA 3UY5A 3LD2A 1Z4RA 2REFA 1Z4EA 2R1IA 1TIQA 4KOSA 2KCWA 2P6EA 2ZW5A 3NE7A 1M44A 4E8OA 2P6GA 4NEXA 3R9GA 4R3KA 1MK4A 1GHEA 3I9SA 3V8IA 1XMTA 2VBQA 2FS5A 3FB3A 4KOUA 1I21A 1NE9A 2VZYA 4U9YA 3T9YA 2VZZA 5JQ4A 1Q2YA 5FVJA 3ZZIA 1WWZA 4X5KA 3P2HA 1KZFA 4CRYB 4H89A 1P0HA 2R8VA 4XPLA 1PUAA 2Q7BA 1QSOA 4Y49C 2GE3A 4AVBA 3IWGA 2B4DB 3TTHA 1S7LA 3W91A 4XPDB 3DR6A 4KORA 4KUBA 2BEIA 2NMTA 2B5GB 4RS2A 2Z10A 2VQYA 3CXPA 3E0KA 2QIRA 3H4QA 1PU9A 2OU2A 1FY7A 2CY2A 1S5KA 1Q2CA 3PP9A 1Z9UA 2X7BA 2BL1A 3R9EA 1YLEA 1IIDA 3FBUA 4U9ZA 2O28A 1VKCA 2FXFA 2VEZA 4NSQA 3VWDA 3JVNA 4QC6A 4B5OA 2CNMA 1J4JA 3EO4A 3R95A 5F46A 1YREA 4J3GA 2I00A 2P0WA 4R87A 2EVNA 1QSRA 2JEVA 4LUAA 2PQ8A 4LX9A 1ON0A 2QECA 4F6AA 2PDOA 4JXRA 4MY3A 3TO6A 3D3SA 4PV6A 4IF5A 4MHDA 4CS0B 2B3UA 3R96A 4MY0A 1BO4A 1QSNA 4YRHA 5F47A 2Y0MA 4PSWA 4XNHC 2C27A 2JDDA 3SXOA 5DWMA 1L0CA 1Y9WA 3BLNA 5KTAA 2FIWA 1IB1E 2QMLA 2GIVA 2ZXVA 3S6HA 1MJAA 2B4BA 1YGHA 2OZHA 3TE4A 4CAXA 2ZPAA 4B5PB 1Y9KA 5GCNA 5IB0A 3DR8A 4HNXB 1I12A 5F48A 2Q0YA 1KUVA 2WPWA 4KLVA 2PR8A 4AG9A 1XE4A 1IYKA 4I49A 1R57A 3C26A 4NXYA 3GYAA 1VHSA 4JD6A 4YGOA 1BOBA 4L89A 1Q2DA 1RXTA 3F5BA 4FD6A 3R9FA 3R1KA 3IGRA 2CNTA 4NF1A 1CJWA 2P6FA 3QB8A 4KVOE 2I79A 2ATRA 1K4JA 1UFHA 2PR1A 3P2FA 3S6FA 1P4NA 2A4NA 4KVME 2K5TA 4F0YA 4L8AA 3I3GA 2H5MA 3T90A 5C82A 2F5IA 2FL4A 2J8NA 1WK4A 1MJBA 3DSBA 1S7KA 3F0AA 1NMTA 1OZPA 3LODA 3SHPA 4ORFA 1S60A 4MI4A 3G8WA 3B8GA 4FD7A 2HQYA 1MJ9A 4UBRA 3VWEA 3PZJA 4Y49B 3OWCA 5KTDA 5J8CA 2B58A 2OZGA 3JUWA 4HNWB 4QBJA 2G3TA 5H86A 5JPHA 2JLMA 4CAWA 2IL4A 3S6GA 2HUZA 4KVXA 3PGPA 4ZBGA 2B3VA 3KKWA 1XIXA 2Q4VA 4QB9A 2R7HA 5C88A 4UWJA 4QVTA 1YR0A 4M3SA 1XF8A 3K9UA 5IX3A 1B87A 4ONUA 3W6XA 2B4DA 4R3LA 1NSLA 4JWPA 4KZTA 2FIAA 1U6MA 2D4PA 2B5GA 5HH1A 4NCZA 3D8PA 5HMNA 1QSMA 2ARHA 1I1DA 2HV2A 4JXQA 4FD5A 4HNYB 4RI1A 4JJXA 4OLLA 2CNSA 1IYLA 2REEA 1RO5A 2Z11A 2FCKA 4CRZB 5I0CA 2G3AA 1CM0A 2Q44A 2J8RA 3FYNA 4PSXA 3DDDA 4QUSA 1QSTA 4XNHB 4MBUA 4XPDC 4MJ8A 4U5YA 3TCVA 2RC4A 5EBVA 5F49A 4KLWA 2WPXA 1M4DA 4PK2A 1IICA 4BMHA 5IV0A 4KOVA 3BJ7A 2VXKA 3TFYA 3WR7A 2VI7A 5J8FA 1XEBA 3TOBA 4UWIA 4R57A 2OZUA 3S6KA 3GY9A 3SXNA 1YVKA 3DNSA 5H84A 1B6BA 3D2MA 4H6ZA 3CXSA 3TO7A 4AVCA 2ZW7A 4EVYA 4JLYA 4PK3A 5E96A 2Q04A 4KOXA 3F8KA 3ZJ0A 1KUYA 2EUIA 5DWNA 2D4OA 4K30A 2AE6A 2JDCA 4OADA 4B5PA 3BJ8A 1N71A 1S7NA 1S3ZA 2ZW4A 1YVOA 4HKFA 2FT0A 1M4IA 2J8MA 1LRZA 3EFAA 3TOAA 4YFJA 2BSWA 1YK3A 4KUAA 2GANA 1Y7RA 5KTCA 1S7FA 4CAVA 5ISVA 3FIXA 4DNCA 2Z0ZA 3EC4A 4AG7A 3N7ZA 1V0CA 3EXNA 4E2AA 2FSRA 2OH1A 4E0AA 4II9A 2DXQA 2OB0A 4AB7A 1M4GA 3FRMA 3G3SA 4H6UA 4M85A 4FD4A 4KOTA 4UA3A 3D2PA 4GS4A 3EY5A 2ZW6A 3QAHA 3RYOA 4IUSA 2PRBA 4OAEA 1SQHA 1KUXA 4KOYA 3W6SA 2FE7A 3TO9A
chains in the Genus database with same CATH superfamily
3GUXA 3CPXA 3FH4A 3FXTA 2YGWA 4XPKA 3V38A 3D66A 2G0BA 5EC4A 2Q4YA 5CNPA 2BUEA 2PJ4A 4DUKA 1Y7EA 3IWEA 2IQ6A 4CYQA 8CPAA 2AJ6A 4R9MA 2R98A 3MGDA 1M1DA 1ZO0A 1YX0A 3CXQA 4KOWA 4UIBA 3GKRA 1YSJA 3SI1A 3TT2A 1Z2LA 4B11A 2PSWA 2PC1A 3D7FA 3VARA 4AVAA 3FNCA 2ZEFA 5THWA 3LD2A 4UCMA 3UY5A 1FT7A 1Z4RA 2REFA 1Z4EA 5D29A 2R1IA 1ZLHA 4OIDA 4ZY1A 3PRTA 1TIQA 4ZYQA 4KOSA 1Y0YA 2KCWA 2P6EA 4P4EA 2ZW5A 5JM6A 4A31A 3NH4A 5HVFA 4LQGA 2C6CA 3NE7A 1M44A 3IFEA 1Z8TA 4YU9A 4E8OA 3B3TA 2P6GA 3FX6A 2GFQA 4A33A 4NEXA 3R9GA 5G1ZA 3B3SA 1MK4A 4R3KA 1CPXA 2EWBA 5LRJA 4CAEA 1GHEA 3I9SA 3H8EA 3QAYA 5HVHA 3FJUA 3V8IA 1F2PA 4EMEA 2ZELA 1XMTA 2VBQA 4MMOA 2FS5A 2V77A 2ZOFA 3FB3A 4R8FA 5LRGA 4KOUA 1I21A 1NE9A 2C1CA 2VZYA 3S9NA 4OC2A 4U9YA 3T9YA 2VZZA 5JQ4A 1Q2YA 3FEEA 5FVJA 3ZZIA 5A28A 1GYTA 3JTKA 1WWZA 4PXCA 4X5KA 1YLOA 2V8HA 3P2HA 1KZFA 3IIBA 4CRYB 4H89A 1P0HA 2R8VA 4XPLA 5AG7A 2AFOA 1PUAA 1VGYA 1YW6A 2Q7BA 1QSOA 4Y49C 2GE3A 3N5FA 4AVBA 1CBXA 3IWGA 2B4DB 3D68A 1S7LA 3CDXA 3TTHA 4TWEA 4XPDB 3W91A 3DR6A 3TC8A 2XEFA 4KORA 4KUBA 2BEIA 2NMTA 5LYIA 1VHOA 1Y0RA 2FVGA 1FNOA 4WWVA 1BAVA 1F57A 3K9TA 3B3VA 2B5GB 2YNEA 3B3CA 4MRIA 1EE3P 1JWQA 3BI0A 4RS2A 2Z10A 2VQYA 3CXPA 3E0KA 2QIRA 2V8VA 1RTQA 3H4QA 3RBUA 1HDUA 3H8GA 4C2ZA 1AUGA 4CGOA 3KGQA 4O23A 1PU9A 2OU2A 2PRQA 1TKHA 4P45A 1FY7A 2CY2A 1S5KA 1Q2CA 2ZOGA 3PP9A 5K8MA 1Z9UA 1IGBA 2X7BA 2BL1A 1YW4A 2WYRA 3R9EA 1YLEA 1IIDA 3FBUA 4U9ZA 2O28A 3KQZA 3PBEA 2DPTA 2CIJA 2ZEEA 3IC1A 1VKCA 2FXFA 2VEZA 3D7GA 3KI9A 4NSQA 3VWDA 3KR4A 2XEGA 3JVNA 4MHZA 2ABZA 4KSIA 4UFWA 2BCOA 2F7VA 2GLFA 1M4LA 4QC6A 2V8DA 3CPAA 4B5OA 2CNMA 4UIAA 1BLLE 1J4JA 3RZAA 3EO4A 4M6IA 3R95A 2AFXA 5F46A 1ELLP 4BD9A 4UEFA 1YREA 4J3GA 3ISZA 3GIUA 2PJAA 2I00A 2PIYA 3SI0A 4ZX8A 2P0WA 4R87A 4LQ6A 4F9VA 2EVNA 1AMPA 1QSRA 4MFPA 4F0XA 2AFWA 2OOTA 5LRKA 1IOIA 1DTDA 2AFMA 5AG4A 2Z3KA 1Z8XA 2JEVA 4LUAA 2PQ8A 4LX9A 1CX8A 1ON0A 2QECA 4F6AA 2IMOA 2PDOA 2CTBA 4JXRA 3KASA 1Z8LA 3WC7A 2PJ0A 4MY3A 3TO6A 5J1QA 3CT9A 5CPAA 3D3SA 4IAVA 2PJ6A 5AGEA 5K8NA 2WSAA 4TNUA 4PV6A 4IF5A 4W9YA 4F8ZA 1ARMA 3PB9X 4MHDA 4B6ZA 2B3UA 4CS0B 2IJZA 2ANPA 2PIZA 4UFXA 2ZEGA 3MRUA 3R96A 5CBMA 4X8IA 4MY0A 3WT4A 1BO4A 1QSNA 4YRHA 5F47A 2Y0MA 2YNCA 3WC5A 4PSWA 4XNHC 4NGRA 2C27A 2RFHA 4P10A 2JDDA 3SXOA 1JQGA 5DWMA 3IO1A 1X10A 1L0CA 1Y9WA 2DPSA 2EK9A 4MFLA 3PBBA 3WABA 4P4BA 3BLNA 5KTAA 2FIWA 1IB1E 2QMLA 4KSFA 3DGVA 3PB7X 2C6GA 2GIVA 4UFVA 4X3RA 5AG6A 4H2KA 5DS0A 2NSMA 4CYNA 2ZXVA 4RN7A 3S6HA 4OIWA 1MJAA 2EK8A 2B4BA 1YGHA 2XEJA 2OZHA 3TE4A 1UWYA 4MFQA 4CAXA 4P6YA 2ZPAA 4B5PB 1YMEA 1Y9KA 1HDQA 3IEHA 4FWUA 4NGTA 5GCNA 3WC6A 5IB0A 3DR8A 2Z3LA 2HC9A 4HNXB 1KWMA 4MXUA 1I12A 4C7HA 2PJ2A 4P4JA 3GB0A 5F48A 3V7ZA 2Q0YA 4M6HA 1TXRA 1KUVA 2WPWA 3BXMA 2PR8A 3CZXA 3IU1A 4KLVA 4AG9A 1XE4A 1IYKA 4I49A 4NJRA 2OR4A 1R57A 4CGNA 3C26A 3KQXA 1PYTB 3FMCA 4NXYA 3GYAA 3SJEA 1VHSA 4JD6A 2XEIA 5AG5A 4YGOA 3PFOA 1BOBA 1BPMA 4L89A 3TX8A 4CGMA 4JYWA 4A95A 1Q2DA 1RXTA 3F5BA 4FD6A 4K3NA 2YNCC 3R1KA 3R9FA 2QVPA 3IGRA 2CNTA 4CAFA 4NF1A 3D4UA 4P44A 5HVGA 1CJWA 2P6FA 3QB8A 2ZEDA 4KVOE 5I4MA 2Z3NA 4R6TA 4RUHA 2PJ3A 3LWUA 2I79A 2PJ7A 2ATRA 1K4JA 1UFHA 2PR1A 3H8FA 3P2FA 3PFEA 4MCRA 3S6FA 1LANA 1Z8WA 1IU8A 4OC0A 1P4NA 4NGNA 2A4NA 4MFKA 1XOVA 4ONWA 4KVME 2K5TA 3LACA 3NH8A 4F0YA 4L8AA 4OKOA 2ZEHA 3I3GA 3FF3A 4A2ZA 3FVLA 4UEZA 4ZI6A 1R43A 2H5MA 3T90A 2PCUA 5C82A 4KSAA 2F5IA 2F8HA 2FL4A 1A2ZA 2EO8A 1Z5RA 1XRYA 3D7HA 3KHZA 2J8NA 4MHNA 1WK4A 2PJ8A 4WJBA 1MJBA 3T8WA 3D7DA 3DSBA 5LYDA 3L2NA 4B13A 1TF9A 1S7KA 3F0AA 1NMTA 1OZPA 3LODA 1Q7LA 1CP6A 4OP4A 3B35A 4MCSA 3SHPA 2Q43A 4CYPA 4ORFA 3NFZA 4B14A 1S60A 3I1UA 4MI4A 2AFSA 2J9AA 3G8WA 4MHPA 2GLJA 4GM5A 3B8GA 2PJCA 3MN8A 2JBKA 4FD7A 3TO9A 2HQYA 1MJ9A 4UBRA 3VWEA 3PZJA 4Y49B 1QMUA 3OWCA 5D8NA 4PXDA 5KTDA 4OMEA 5J8CA 2B58A 1XMBA 3VH9A 2OZGA 3JUWA 4HNWB 4QBJA 3SI2A 4CPAA 2G3TA 4Z65A 5H86A 5JPHA 1VIXA 2JLMA 4A37A 4B10A 4CAWA 2POKA 2IL4A 4PXBA 4ZY2A 3S6GA 6CPAA 2HUZA 4KVXA 3PGPA 4JZ0A 4ZBGA 4A39A 2JEWA 2B3VA 3BI1A 3KKWA 1XIXA 5LYFA 1ARLA 1BPNA 2Q4VA 4QB9A 3PB8X 5JGFA 2R7HA 2Q7SA 4UWJA 4QVTA 5C88A 4C2XA 4IK2A 1YR0A 4M3SA 1XF8A 1HEEA 3QNVA 3K9UA 4CGLA 1B87A 4ONUA 5IX3A 3S9MA 3W6XA 2B4DA 4R3LA 4OC5A 1NSLA 3RAMA 3B7IA 4R7MA 1YQEA 2DF5A 4JWPA 1PCAA 4KZTA 2FIAA 2PJBA 5ELYA 2WUUA 1U6MA 2D4PA 4P4FA 1CG2A 2B5GA 2CF4A 4ZX9A 5HH1A 4NGQA 5BWAB 3DLJA 1IOFA 1TKJA 3KZWA 4NCZA 4P4IA 2G9DA 3D8PA 5HMNA 2HB6A 1QSMA 2O53A 2ARHA 2PE3A 4R76A 1ELMP 3B3WA 3GLJA 2CXAA 2JBJA 5HXDA 1I1DA 2HV2A 2WZNA 3NE8A 1ZG7A 4JXQA 2QJ8A 2YNDA 1VHEA 4FD5A 4HNYB 4RI1A 3BHXA 4JJXA 2PJ5A 1XBUA 4OLLA 2GU2A 3SJGA 3SJFA 1DE4C 2CNSA 1IYLA 1XJOA 2BO9A 4P4DA 2REEA 4GXHA 1RO5A 2Z11A 2FCKA 3HUVA 4NGPA 3IWWA 4CRZB 5JH9A 4OC3A 5I0CA 1H8LA 2ZEMA 2G3AA 4BINA 4A30A 1CM0A 2Q44A 2DEAA 2J8RA 3HLPA 3FYNA 3NH5A 4PSXA 1IY7A 3DDDA 4QUSA 2QYVA 1QSTA 1X12A 4XNHB 1LOKA 4MBUA 4XPDC 3H5ZA 4NGMA 4MJ8A 4U5YA 3TCVA 2RC4A 5EBVA 5F49A 4KLWA 3FECA 2WPXA 1M4DA 4IHMA 1IICA 4PK2A 3NA6A 4BMHA 4PXEA 5IV0A 4KOVA 3BJ7A 4M6GA 3D67A 2VXKA 3TFYA 3WR7A 2VI7A 5J8FA 1XEBA 2AFZA 3RNZA 1OBRA 1ZLIA 3TOBA 4UWIA 4R57A 2OZUA 3S6KA 4B12A 2Z3MA 3GY9A 3SXNA 4G1PA 4Q38A 1YVKA 3DNSA 5IB9A 5H84A 1B6BA 2Q4ZA 3D2MA 4H6ZA 1AYEA 3CXSA 3FEDA 4X2TA 4A94A 4MFJA 4MFZA 3TO7A 4AVCA 1TKFA 1NSAA 2ZW7A 3LMSA 4EVYA 4JLYA 4PK3A 5E96A 3A9LA 1LAPA 2Q04A 1F2OA 4KOXA 2PVVA 3F8KA 1ZG8A 2PJ9A 3ZJ0A 1LFWA 4ZY0A 1KUYA 2EUIA 2Z3OA 5DWNA 4MCQA 2D4OA 1LAMA 4K30A 2ZEPA 2ODFA 2ZENA 4A32A 2AE6A 5LYLA 4CYOA 1R3NA 1QQ9A 2JDCA 4OADA 3KHXA 3S9LA 3RO0A 4B5PA 3IJ3A 3BJ8A 4PQAA 4Q36A 1N71A 1S7NA 1S3ZA 2ZW4A 4EWTA 2CTCA 4C7IA 1YVOA 4HKFA 4OC1A 5K8OA 4NGSA 2FT0A 3KR5A 1XFOA 1M4IA 2J8MA 1LRZA 4UCNA 3VATA 3EFAA 3TOAA 4HPSA 4YFJA 2BSWA 2EBJA 1CP7A 5A27A 1YK3A 4KUAA 2GANA 1Y7RA 5G20A 4C2YA 7CPAA 1S7FA 4CAVA 5KTCA 5ISVA 2I3CA 3FIXA 4DNCA 2Z0ZA 3EC4A 3PB6X 2VL1A 5G22A 1CPSA 4AG7A 4CGPA 3N7ZA 3ISXA 1V0CA 4BBHA 3EXNA 4EFDA 4ZGYB 2NYQA 4UF4A 2FSRA 4E2AA 4NJQA 2OH1A 4Q7AA 3IU2A 4E0AA 5F09A 3JRUA 4F9UA 4DJLA 2DXQA 4II9A 2OB0A 2PJ1A 4AB7A 1M4GA 3FRMA 3G3SA 4UEEA 3K2KA 2ZEOA 3PB4X 4H6UA 4NFRA 4M85A 4FD4A 4YWYA 4KS9A 4MHYA 2O4HA 4KOTA 4FUUA 4UA3A 2PVWA 4UCPA 4DYOA 4MCPA 2BOAA 3D2PA 4GS4A 3EY5A 4C68A 4FBEA 2ZW6A 3QAHA 3RYOA 5K8PA 3SJXA 4IUSA 2GREA 2PRBA 4OAEA 3PEIA 4AXVA 3KL9A 1SQHA 1KUXA 4KOYA 5EMIA 3W6SA 1LCPA 4A38A 2Q51A 2RB7A 4PPZA 4OC4A 1TF8A 2C6PA 2V8GA 3B2YA 5G21A 2FE7A 2AFUA 4FAIA 1ZG9A 2Z3PA
chains in the Genus database with same CATH topology
3FXTA 2YGWA 4XPKA 2G0BA 5EC4A 2Q4YA 5CNPA 2BUEA 3IWEA 4CYQA 2AJ6A 4R9MA 2R98A 3MGDA 1M1DA 1ZO0A 1YX0A 3CXQA 4KOWA 3TT2A 3GKRA 4B11A 2PSWA 2PC1A 4AVAA 3FNCA 3UY5A 3LD2A 4UCMA 1Z4RA 2REFA 1Z4EA 2R1IA 1TIQA 4KOSA 2KCWA 2P6EA 2ZW5A 4A31A 3NE7A 1M44A 4E8OA 2P6GA 4A33A 4NEXA 3R9GA 5G1ZA 4R3KA 1MK4A 4CAEA 1GHEA 3I9SA 3V8IA 1XMTA 2VBQA 2FS5A 3FB3A 4KOUA 1I21A 1NE9A 2VZYA 4U9YA 3T9YA 2VZZA 5JQ4A 1Q2YA 5FVJA 3ZZIA 5A28A 3JTKA 1WWZA 4X5KA 3P2HA 1KZFA 4CRYB 4H89A 1P0HA 2R8VA 4XPLA 5AG7A 1PUAA 2Q7BA 1QSOA 4Y49C 2GE3A 4AVBA 3IWGA 2B4DB 3TTHA 1S7LA 3W91A 4XPDB 3DR6A 4KORA 4KUBA 2BEIA 2NMTA 2B5GB 2YNEA 4RS2A 2Z10A 2VQYA 3CXPA 3E0KA 2QIRA 3H4QA 4C2ZA 4CGOA 1PU9A 2OU2A 1FY7A 2CY2A 1S5KA 1Q2CA 3PP9A 1Z9UA 2X7BA 2BL1A 3R9EA 1YLEA 1IIDA 3FBUA 4U9ZA 2O28A 2DPTA 1VKCA 2FXFA 2VEZA 4NSQA 3VWDA 3JVNA 4UFWA 4QC6A 4B5OA 2CNMA 1J4JA 3EO4A 3R95A 5F46A 1YREA 4J3GA 2I00A 2P0WA 4R87A 2EVNA 1QSRA 4MFPA 4F0XA 5AG4A 2Z3KA 2JEVA 4LUAA 2PQ8A 4LX9A 1ON0A 2QECA 4F6AA 2PDOA 4JXRA 4MY3A 3TO6A 3D3SA 5AGEA 2WSAA 4PV6A 4IF5A 4MHDA 4CS0B 2B3UA 4UFXA 3R96A 4MY0A 1BO4A 1QSNA 4YRHA 5F47A 2Y0MA 2YNCA 4PSWA 4XNHC 2C27A 2JDDA 3SXOA 5DWMA 1L0CA 1Y9WA 2DPSA 4MFLA 3BLNA 5KTAA 2FIWA 1IB1E 2QMLA 4KSFA 2GIVA 4UFVA 5AG6A 4CYNA 2ZXVA 3S6HA 1MJAA 2B4BA 1YGHA 2OZHA 3TE4A 4MFQA 4CAXA 2ZPAA 4B5PB 1Y9KA 5GCNA 5IB0A 3DR8A 2Z3LA 4HNXB 1I12A 4C7HA 5F48A 2Q0YA 1KUVA 2WPWA 3IU1A 2PR8A 4KLVA 4AG9A 1XE4A 1IYKA 4I49A 4CGNA 1R57A 3C26A 4NXYA 3GYAA 1VHSA 4JD6A 5AG5A 4YGOA 1BOBA 4L89A 4CGMA 4A95A 1Q2DA 1RXTA 3F5BA 4FD6A 2YNCC 3R1KA 3R9FA 3IGRA 2CNTA 4CAFA 4NF1A 1CJWA 2P6FA 3QB8A 4KVOE 2Z3NA 2I79A 2ATRA 1K4JA 1UFHA 2PR1A 3P2FA 3S6FA 1P4NA 2A4NA 4MFKA 4KVME 2K5TA 4F0YA 4L8AA 4A2ZA 3I3GA 2H5MA 3T90A 5C82A 4KSAA 2F5IA 2FL4A 2J8NA 1WK4A 1MJBA 3DSBA 4B13A 1S7KA 3F0AA 1NMTA 1OZPA 3LODA 3SHPA 4CYPA 4ORFA 4B14A 1S60A 4MI4A 3G8WA 3B8GA 4FD7A 3TO9A 2HQYA 1MJ9A 4UBRA 3VWEA 3PZJA 4Y49B 3OWCA 5KTDA 5J8CA 2B58A 2OZGA 3JUWA 4HNWB 4QBJA 2G3TA 5H86A 5JPHA 2JLMA 4B10A 4CAWA 2IL4A 3S6GA 2HUZA 4KVXA 3PGPA 4ZBGA 2B3VA 3KKWA 1XIXA 2Q4VA 4QB9A 2R7HA 5C88A 4UWJA 4QVTA 4C2XA 1YR0A 4M3SA 1XF8A 3K9UA 4CGLA 1B87A 4ONUA 5IX3A 3W6XA 2B4DA 4R3LA 1NSLA 4JWPA 4KZTA 2FIAA 2WUUA 1U6MA 2D4PA 2B5GA 5HH1A 5BWAB 4NCZA 3D8PA 5HMNA 1QSMA 2ARHA 2CXAA 1I1DA 2HV2A 4JXQA 2YNDA 4FD5A 4HNYB 4RI1A 4JJXA 4OLLA 2CNSA 1IYLA 2REEA 1RO5A 2Z11A 2FCKA 4CRZB 5I0CA 2G3AA 4A30A 1CM0A 2Q44A 2J8RA 3FYNA 4PSXA 3DDDA 4QUSA 1QSTA 4XNHB 4MBUA 4XPDC 3H5ZA 4MJ8A 4U5YA 3TCVA 2RC4A 5EBVA 5F49A 4KLWA 2WPXA 1M4DA 4PK2A 1IICA 4BMHA 5IV0A 4KOVA 3BJ7A 2VXKA 3TFYA 3WR7A 2VI7A 5J8FA 1XEBA 3TOBA 4UWIA 4R57A 2OZUA 3S6KA 4B12A 2Z3MA 3GY9A 3SXNA 4Q38A 1YVKA 3DNSA 5H84A 1B6BA 3D2MA 4H6ZA 3CXSA 4MFJA 4MFZA 3TO7A 4AVCA 2ZW7A 4EVYA 4JLYA 4PK3A 5E96A 3A9LA 2Q04A 4KOXA 3F8KA 3ZJ0A 1KUYA 2EUIA 2Z3OA 5DWNA 2D4OA 4K30A 4A32A 2AE6A 4CYOA 2JDCA 4OADA 4B5PA 3BJ8A 4Q36A 1N71A 1S7NA 1S3ZA 2ZW4A 4C7IA 1YVOA 4HKFA 2FT0A 1M4IA 2J8MA 1LRZA 4UCNA 3EFAA 3TOAA 4YFJA 2BSWA 5A27A 1YK3A 4KUAA 2GANA 1Y7RA 5G20A 4C2YA 5KTCA 1S7FA 4CAVA 5ISVA 3FIXA 4DNCA 2Z0ZA 3EC4A 5G22A 4AG7A 4CGPA 3N7ZA 1V0CA 4BBHA 3EXNA 4ZGYB 4E2AA 2FSRA 2OH1A 3IU2A 4E0AA 4II9A 2DXQA 2OB0A 4AB7A 1M4GA 3FRMA 3G3SA 4H6UA 4M85A 4FD4A 4KS9A 4KOTA 4UA3A 4UCPA 3D2PA 4GS4A 3EY5A 4C68A 2ZW6A 3QAHA 3RYOA 4IUSA 2PRBA 4OAEA 1SQHA 1KUXA 4KOYA 3W6SA 5G21A 2FE7A 2Z3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXT A;  4XPK A;  2G0B A;  5EC4 A;  2Q4Y A;  5CNP A;  2BUE A;  2AJ6 A;  4R9M A;  2R98 A;  3MGD A;  1M1D A;  1YX0 A;  3CXQ A;  4KOW A;  3TT2 A;  3GKR A;  2PSW A;  2PC1 A;  4AVA A;  3FNC A;  3UY5 A;  3LD2 A;  1Z4R A;  2REF A;  1Z4E A;  2R1I A;  1TIQ A;  4KOS A;  2KCW A;  2P6E A;  2ZW5 A;  3NE7 A;  1M44 A;  4E8O A;  2P6G A;  4NEX A;  3R9G A;  4R3K A;  1MK4 A;  1GHE A;  3I9S A;  3V8I A;  1XMT A;  2VBQ A;  2FS5 A;  3FB3 A;  4KOU A;  1I21 A;  1NE9 A;  2VZY A;  4U9Y A;  3T9Y A;  2VZZ A;  5JQ4 A;  1Q2Y A;  5FVJ A;  3ZZI A;  1WWZ A;  4X5K A;  3P2H A;  1KZF A;  4CRY B;  4H89 A;  1P0H A;  2R8V A;  4XPL A;  1PUA A;  2Q7B A;  1QSO A;  4Y49 C;  2GE3 A;  4AVB A;  3IWG A;  2B4D B;  3TTH A;  1S7L A;  3W91 A;  4XPD B;  3DR6 A;  4KOR A;  4KUB A;  2BEI A;  2NMT A;  2B5G B;  4RS2 A;  2Z10 A;  2VQY A;  3CXP A;  3E0K A;  2QIR A;  3H4Q A;  1PU9 A;  2OU2 A;  1FY7 A;  2CY2 A;  1S5K A;  1Q2C A;  3PP9 A;  1Z9U A;  2X7B A;  2BL1 A;  3R9E A;  1YLE A;  1IID A;  3FBU A;  4U9Z A;  2O28 A;  1VKC A;  2FXF A;  2VEZ A;  4NSQ A;  3VWD A;  3JVN A;  4QC6 A;  4B5O A;  2CNM A;  1J4J A;  3EO4 A;  3R95 A;  5F46 A;  1YRE A;  4J3G A;  2I00 A;  2P0W A;  4R87 A;  2EVN A;  1QSR A;  2JEV A;  4LUA A;  2PQ8 A;  4LX9 A;  1ON0 A;  2QEC A;  4F6A A;  2PDO A;  4JXR A;  4MY3 A;  3TO6 A;  3D3S A;  4PV6 A;  4IF5 A;  4MHD A;  4CS0 B;  2B3U A;  3R96 A;  4MY0 A;  1BO4 A;  1QSN A;  4YRH A;  5F47 A;  2Y0M A;  4PSW A;  4XNH C;  2C27 A;  2JDD A;  3SXO A;  5DWM A;  1L0C A;  1Y9W A;  3BLN A;  5KTA A;  2FIW A;  1IB1 E;  2QML A;  2GIV A;  2ZXV A;  3S6H A;  1MJA A;  2B4B A;  1YGH A;  2OZH A;  3TE4 A;  4CAX A;  2ZPA A;  4B5P B;  1Y9K A;  5GCN A;  5IB0 A;  3DR8 A;  4HNX B;  1I12 A;  5F48 A;  2Q0Y A;  1KUV A;  2WPW A;  4KLV A;  2PR8 A;  4AG9 A;  1XE4 A;  1IYK A;  4I49 A;  1R57 A;  3C26 A;  4NXY A;  3GYA A;  1VHS A;  4JD6 A;  4YGO A;  1BOB A;  4L89 A;  1Q2D A;  1RXT A;  3F5B A;  4FD6 A;  3R9F A;  3R1K A;  3IGR A;  2CNT A;  4NF1 A;  1CJW A;  2P6F A;  3QB8 A;  4KVO E;  2I79 A;  2ATR A;  1K4J A;  1UFH A;  2PR1 A;  3P2F A;  3S6F A;  1P4N A;  2A4N A;  4KVM E;  2K5T A;  4F0Y A;  4L8A A;  3I3G A;  2H5M A;  3T90 A;  5C82 A;  2F5I A;  2FL4 A;  2J8N A;  1WK4 A;  1MJB A;  3DSB A;  1S7K A;  3F0A A;  1NMT A;  1OZP A;  3LOD A;  3SHP A;  4ORF A;  1S60 A;  4MI4 A;  3G8W A;  3B8G A;  4FD7 A;  2HQY A;  1MJ9 A;  4UBR A;  3VWE A;  3PZJ A;  4Y49 B;  3OWC A;  5KTD A;  5J8C A;  2B58 A;  2OZG A;  3JUW A;  4HNW B;  4QBJ A;  2G3T A;  5H86 A;  5JPH A;  2JLM A;  4CAW A;  2IL4 A;  3S6G A;  2HUZ A;  4KVX A;  3PGP A;  4ZBG A;  2B3V A;  3KKW A;  1XIX A;  2Q4V A;  4QB9 A;  2R7H A;  5C88 A;  4UWJ A;  4QVT A;  1YR0 A;  4M3S A;  1XF8 A;  3K9U A;  5IX3 A;  1B87 A;  4ONU A;  3W6X A;  2B4D A;  4R3L A;  1NSL A;  4JWP A;  4KZT A;  2FIA A;  1U6M A;  2D4P A;  2B5G A;  5HH1 A;  4NCZ A;  3D8P A;  5HMN A;  1QSM A;  2ARH A;  1I1D A;  2HV2 A;  4JXQ A;  4FD5 A;  4HNY B;  4RI1 A;  4JJX A;  4OLL A;  2CNS A;  1IYL A;  2REE A;  1RO5 A;  2Z11 A;  2FCK A;  4CRZ B;  5I0C A;  2G3A A;  1CM0 A;  2Q44 A;  2J8R A;  3FYN A;  4PSX A;  3DDD A;  4QUS A;  1QST A;  4XNH B;  4MBU A;  4XPD C;  4MJ8 A;  4U5Y A;  3TCV A;  2RC4 A;  5EBV A;  5F49 A;  4KLW A;  2WPX A;  1M4D A;  4PK2 A;  1IIC A;  4BMH A;  5IV0 A;  4KOV A;  3BJ7 A;  2VXK A;  3TFY A;  3WR7 A;  2VI7 A;  5J8F A;  1XEB A;  3TOB A;  4UWI A;  4R57 A;  2OZU A;  3S6K A;  3GY9 A;  3SXN A;  1YVK A;  3DNS A;  5H84 A;  1B6B A;  3D2M A;  4H6Z A;  3CXS A;  3TO7 A;  4AVC A;  2ZW7 A;  4EVY A;  4JLY A;  4PK3 A;  5E96 A;  2Q04 A;  4KOX A;  3F8K A;  3ZJ0 A;  1KUY A;  2EUI A;  5DWN A;  2D4O A;  4K30 A;  2AE6 A;  2JDC A;  4OAD A;  4B5P A;  3BJ8 A;  1N71 A;  1S7N A;  1S3Z A;  2ZW4 A;  1YVO A;  4HKF A;  2FT0 A;  1M4I A;  2J8M A;  1LRZ A;  3EFA A;  3TOA A;  4YFJ A;  2BSW A;  1YK3 A;  4KUA A;  2GAN A;  1Y7R A;  5KTC A;  1S7F A;  4CAV A;  5ISV A;  3FIX A;  4DNC A;  2Z0Z A;  3EC4 A;  4AG7 A;  3N7Z A;  1V0C A;  3EXN A;  4E2A A;  2FSR A;  2OH1 A;  4E0A A;  4II9 A;  2DXQ A;  2OB0 A;  4AB7 A;  1M4G A;  3FRM A;  3G3S A;  4H6U A;  4M85 A;  4FD4 A;  4KOT A;  4UA3 A;  3D2P A;  4GS4 A;  3EY5 A;  2ZW6 A;  3QAH A;  3RYO A;  4IUS A;  2PRB A;  4OAE A;  1SQH A;  1KUX A;  4KOY A;  3W6S A;  2FE7 A;  3TO9 A; 
#chains in the Genus database with same CATH topology
 3GUX A;  3CPX A;  3FH4 A;  3FXT A;  2YGW A;  4XPK A;  3V38 A;  3D66 A;  2G0B A;  5EC4 A;  2Q4Y A;  5CNP A;  2BUE A;  2PJ4 A;  4DUK A;  1Y7E A;  3IWE A;  2IQ6 A;  4CYQ A;  8CPA A;  2AJ6 A;  4R9M A;  2R98 A;  3MGD A;  1M1D A;  1ZO0 A;  1YX0 A;  3CXQ A;  4KOW A;  4UIB A;  3GKR A;  1YSJ A;  3SI1 A;  3TT2 A;  1Z2L A;  4B11 A;  2PSW A;  2PC1 A;  3D7F A;  3VAR A;  4AVA A;  3FNC A;  2ZEF A;  5THW A;  3LD2 A;  4UCM A;  3UY5 A;  1FT7 A;  1Z4R A;  2REF A;  1Z4E A;  5D29 A;  2R1I A;  1ZLH A;  4OID A;  4ZY1 A;  3PRT A;  1TIQ A;  4ZYQ A;  4KOS A;  1Y0Y A;  2KCW A;  2P6E A;  4P4E A;  2ZW5 A;  5JM6 A;  4A31 A;  3NH4 A;  5HVF A;  4LQG A;  2C6C A;  3NE7 A;  1M44 A;  3IFE A;  1Z8T A;  4YU9 A;  4E8O A;  3B3T A;  2P6G A;  3FX6 A;  2GFQ A;  4A33 A;  4NEX A;  3R9G A;  5G1Z A;  3B3S A;  1MK4 A;  4R3K A;  1CPX A;  2EWB A;  5LRJ A;  4CAE A;  1GHE A;  3I9S A;  3H8E A;  3QAY A;  5HVH A;  3FJU A;  3V8I A;  1F2P A;  4EME A;  2ZEL A;  1XMT A;  2VBQ A;  4MMO A;  2FS5 A;  2V77 A;  2ZOF A;  3FB3 A;  4R8F A;  5LRG A;  4KOU A;  1I21 A;  1NE9 A;  2C1C A;  2VZY A;  3S9N A;  4OC2 A;  4U9Y A;  3T9Y A;  2VZZ A;  5JQ4 A;  1Q2Y A;  3FEE A;  5FVJ A;  3ZZI A;  5A28 A;  1GYT A;  3JTK A;  1WWZ A;  4PXC A;  4X5K A;  1YLO A;  2V8H A;  3P2H A;  1KZF A;  3IIB A;  4CRY B;  4H89 A;  1P0H A;  2R8V A;  4XPL A;  5AG7 A;  2AFO A;  1PUA A;  1VGY A;  1YW6 A;  2Q7B A;  1QSO A;  4Y49 C;  2GE3 A;  3N5F A;  4AVB A;  1CBX A;  3IWG A;  2B4D B;  3D68 A;  1S7L A;  3CDX A;  3TTH A;  4TWE A;  4XPD B;  3W91 A;  3DR6 A;  3TC8 A;  2XEF A;  4KOR A;  4KUB A;  2BEI A;  2NMT A;  5LYI A;  1VHO A;  1Y0R A;  2FVG A;  1FNO A;  4WWV A;  1BAV A;  1F57 A;  3K9T A;  3B3V A;  2B5G B;  2YNE A;  3B3C A;  4MRI A;  1EE3 P;  1JWQ A;  3BI0 A;  4RS2 A;  2Z10 A;  2VQY A;  3CXP A;  3E0K A;  2QIR A;  2V8V A;  1RTQ A;  3H4Q A;  3RBU A;  1HDU A;  3H8G A;  4C2Z A;  1AUG A;  4CGO A;  3KGQ A;  4O23 A;  1PU9 A;  2OU2 A;  2PRQ A;  1TKH A;  4P45 A;  1FY7 A;  2CY2 A;  1S5K A;  1Q2C A;  2ZOG A;  3PP9 A;  5K8M A;  1Z9U A;  1IGB A;  2X7B A;  2BL1 A;  1YW4 A;  2WYR A;  3R9E A;  1YLE A;  1IID A;  3FBU A;  4U9Z A;  2O28 A;  3KQZ A;  3PBE A;  2DPT A;  2CIJ A;  2ZEE A;  3IC1 A;  1VKC A;  2FXF A;  2VEZ A;  3D7G A;  3KI9 A;  4NSQ A;  3VWD A;  3KR4 A;  2XEG A;  3JVN A;  4MHZ A;  2ABZ A;  4KSI A;  4UFW A;  2BCO A;  2F7V A;  2GLF A;  1M4L A;  4QC6 A;  2V8D A;  3CPA A;  4B5O A;  2CNM A;  4UIA A;  1BLL E;  1J4J A;  3RZA A;  3EO4 A;  4M6I A;  3R95 A;  2AFX A;  5F46 A;  1ELL P;  4BD9 A;  4UEF A;  1YRE A;  4J3G A;  3ISZ A;  3GIU A;  2PJA A;  2I00 A;  2PIY A;  3SI0 A;  4ZX8 A;  2P0W A;  4R87 A;  4LQ6 A;  4F9V A;  2EVN A;  1AMP A;  1QSR A;  4MFP A;  4F0X A;  2AFW A;  2OOT A;  5LRK A;  1IOI A;  1DTD A;  2AFM A;  5AG4 A;  2Z3K A;  1Z8X A;  2JEV A;  4LUA A;  2PQ8 A;  4LX9 A;  1CX8 A;  1ON0 A;  2QEC A;  4F6A A;  2IMO A;  2PDO A;  2CTB A;  4JXR A;  3KAS A;  1Z8L A;  3WC7 A;  2PJ0 A;  4MY3 A;  3TO6 A;  5J1Q A;  3CT9 A;  5CPA A;  3D3S A;  4IAV A;  2PJ6 A;  5AGE A;  5K8N A;  2WSA A;  4TNU A;  4PV6 A;  4IF5 A;  4W9Y A;  4F8Z A;  1ARM A;  3PB9 X;  4MHD A;  4B6Z A;  2B3U A;  4CS0 B;  2IJZ A;  2ANP A;  2PIZ A;  4UFX A;  2ZEG A;  3MRU A;  3R96 A;  5CBM A;  4X8I A;  4MY0 A;  3WT4 A;  1BO4 A;  1QSN A;  4YRH A;  5F47 A;  2Y0M A;  2YNC A;  3WC5 A;  4PSW A;  4XNH C;  4NGR A;  2C27 A;  2RFH A;  4P10 A;  2JDD A;  3SXO A;  1JQG A;  5DWM A;  3IO1 A;  1X10 A;  1L0C A;  1Y9W A;  2DPS A;  2EK9 A;  4MFL A;  3PBB A;  3WAB A;  4P4B A;  3BLN A;  5KTA A;  2FIW A;  1IB1 E;  2QML A;  4KSF A;  3DGV A;  3PB7 X;  2C6G A;  2GIV A;  4UFV A;  4X3R A;  5AG6 A;  4H2K A;  5DS0 A;  2NSM A;  4CYN A;  2ZXV A;  4RN7 A;  3S6H A;  4OIW A;  1MJA A;  2EK8 A;  2B4B A;  1YGH A;  2XEJ A;  2OZH A;  3TE4 A;  1UWY A;  4MFQ A;  4CAX A;  4P6Y A;  2ZPA A;  4B5P B;  1YME A;  1Y9K A;  1HDQ A;  3IEH A;  4FWU A;  4NGT A;  5GCN A;  3WC6 A;  5IB0 A;  3DR8 A;  2Z3L A;  2HC9 A;  4HNX B;  1KWM A;  4MXU A;  1I12 A;  4C7H A;  2PJ2 A;  4P4J A;  3GB0 A;  5F48 A;  3V7Z A;  2Q0Y A;  4M6H A;  1TXR A;  1KUV A;  2WPW A;  3BXM A;  2PR8 A;  3CZX A;  3IU1 A;  4KLV A;  4AG9 A;  1XE4 A;  1IYK A;  4I49 A;  4NJR A;  2OR4 A;  1R57 A;  4CGN A;  3C26 A;  3KQX A;  1PYT B;  3FMC A;  4NXY A;  3GYA A;  3SJE A;  1VHS A;  4JD6 A;  2XEI A;  5AG5 A;  4YGO A;  3PFO A;  1BOB A;  1BPM A;  4L89 A;  3TX8 A;  4CGM A;  4JYW A;  4A95 A;  1Q2D A;  1RXT A;  3F5B A;  4FD6 A;  4K3N A;  2YNC C;  3R1K A;  3R9F A;  2QVP A;  3IGR A;  2CNT A;  4CAF A;  4NF1 A;  3D4U A;  4P44 A;  5HVG A;  1CJW A;  2P6F A;  3QB8 A;  2ZED A;  4KVO E;  5I4M A;  2Z3N A;  4R6T A;  4RUH A;  2PJ3 A;  3LWU A;  2I79 A;  2PJ7 A;  2ATR A;  1K4J A;  1UFH A;  2PR1 A;  3H8F A;  3P2F A;  3PFE A;  4MCR A;  3S6F A;  1LAN A;  1Z8W A;  1IU8 A;  4OC0 A;  1P4N A;  4NGN A;  2A4N A;  4MFK A;  1XOV A;  4ONW A;  4KVM E;  2K5T A;  3LAC A;  3NH8 A;  4F0Y A;  4L8A A;  4OKO A;  2ZEH A;  3I3G A;  3FF3 A;  4A2Z A;  3FVL A;  4UEZ A;  4ZI6 A;  1R43 A;  2H5M A;  3T90 A;  2PCU A;  5C82 A;  4KSA A;  2F5I A;  2F8H A;  2FL4 A;  1A2Z A;  2EO8 A;  1Z5R A;  1XRY A;  3D7H A;  3KHZ A;  2J8N A;  4MHN A;  1WK4 A;  2PJ8 A;  4WJB A;  1MJB A;  3T8W A;  3D7D A;  3DSB A;  5LYD A;  3L2N A;  4B13 A;  1TF9 A;  1S7K A;  3F0A A;  1NMT A;  1OZP A;  3LOD A;  1Q7L A;  1CP6 A;  4OP4 A;  3B35 A;  4MCS A;  3SHP A;  2Q43 A;  4CYP A;  4ORF A;  3NFZ A;  4B14 A;  1S60 A;  3I1U A;  4MI4 A;  2AFS A;  2J9A A;  3G8W A;  4MHP A;  2GLJ A;  4GM5 A;  3B8G A;  2PJC A;  3MN8 A;  2JBK A;  4FD7 A;  3TO9 A;  2HQY A;  1MJ9 A;  4UBR A;  3VWE A;  3PZJ A;  4Y49 B;  1QMU A;  3OWC A;  5D8N A;  4PXD A;  5KTD A;  4OME A;  5J8C A;  2B58 A;  1XMB A;  3VH9 A;  2OZG A;  3JUW A;  4HNW B;  4QBJ A;  3SI2 A;  4CPA A;  2G3T A;  4Z65 A;  5H86 A;  5JPH A;  1VIX A;  2JLM A;  4A37 A;  4B10 A;  4CAW A;  2POK A;  2IL4 A;  4PXB A;  4ZY2 A;  3S6G A;  6CPA A;  2HUZ A;  4KVX A;  3PGP A;  4JZ0 A;  4ZBG A;  4A39 A;  2JEW A;  2B3V A;  3BI1 A;  3KKW A;  1XIX A;  5LYF A;  1ARL A;  1BPN A;  2Q4V A;  4QB9 A;  3PB8 X;  5JGF A;  2R7H A;  2Q7S A;  4UWJ A;  4QVT A;  5C88 A;  4C2X A;  4IK2 A;  1YR0 A;  4M3S A;  1XF8 A;  1HEE A;  3QNV A;  3K9U A;  4CGL A;  1B87 A;  4ONU A;  5IX3 A;  3S9M A;  3W6X A;  2B4D A;  4R3L A;  4OC5 A;  1NSL A;  3RAM A;  3B7I A;  4R7M A;  1YQE A;  2DF5 A;  4JWP A;  1PCA A;  4KZT A;  2FIA A;  2PJB A;  5ELY A;  2WUU A;  1U6M A;  2D4P A;  4P4F A;  1CG2 A;  2B5G A;  2CF4 A;  4ZX9 A;  5HH1 A;  4NGQ A;  5BWA B;  3DLJ A;  1IOF A;  1TKJ A;  3KZW A;  4NCZ A;  4P4I A;  2G9D A;  3D8P A;  5HMN A;  2HB6 A;  1QSM A;  2O53 A;  2ARH A;  2PE3 A;  4R76 A;  1ELM P;  3B3W A;  3GLJ A;  2CXA A;  2JBJ A;  5HXD A;  1I1D A;  2HV2 A;  2WZN A;  3NE8 A;  1ZG7 A;  4JXQ A;  2QJ8 A;  2YND A;  1VHE A;  4FD5 A;  4HNY B;  4RI1 A;  3BHX A;  4JJX A;  2PJ5 A;  1XBU A;  4OLL A;  2GU2 A;  3SJG A;  3SJF A;  1DE4 C;  2CNS A;  1IYL A;  1XJO A;  2BO9 A;  4P4D A;  2REE A;  4GXH A;  1RO5 A;  2Z11 A;  2FCK A;  3HUV A;  4NGP A;  3IWW A;  4CRZ B;  5JH9 A;  4OC3 A;  5I0C A;  1H8L A;  2ZEM A;  2G3A A;  4BIN A;  4A30 A;  1CM0 A;  2Q44 A;  2DEA A;  2J8R A;  3HLP A;  3FYN A;  3NH5 A;  4PSX A;  1IY7 A;  3DDD A;  4QUS A;  2QYV A;  1QST A;  1X12 A;  4XNH B;  1LOK A;  4MBU A;  4XPD C;  3H5Z A;  4NGM A;  4MJ8 A;  4U5Y A;  3TCV A;  2RC4 A;  5EBV A;  5F49 A;  4KLW A;  3FEC A;  2WPX A;  1M4D A;  4IHM A;  1IIC A;  4PK2 A;  3NA6 A;  4BMH A;  4PXE A;  5IV0 A;  4KOV A;  3BJ7 A;  4M6G A;  3D67 A;  2VXK A;  3TFY A;  3WR7 A;  2VI7 A;  5J8F A;  1XEB A;  2AFZ A;  3RNZ A;  1OBR A;  1ZLI A;  3TOB A;  4UWI A;  4R57 A;  2OZU A;  3S6K A;  4B12 A;  2Z3M A;  3GY9 A;  3SXN A;  4G1P A;  4Q38 A;  1YVK A;  3DNS A;  5IB9 A;  5H84 A;  1B6B A;  2Q4Z A;  3D2M A;  4H6Z A;  1AYE A;  3CXS A;  3FED A;  4X2T A;  4A94 A;  4MFJ A;  4MFZ A;  3TO7 A;  4AVC A;  1TKF A;  1NSA A;  2ZW7 A;  3LMS A;  4EVY A;  4JLY A;  4PK3 A;  5E96 A;  3A9L A;  1LAP A;  2Q04 A;  1F2O A;  4KOX A;  2PVV A;  3F8K A;  1ZG8 A;  2PJ9 A;  3ZJ0 A;  1LFW A;  4ZY0 A;  1KUY A;  2EUI A;  2Z3O A;  5DWN A;  4MCQ A;  2D4O A;  1LAM A;  4K30 A;  2ZEP A;  2ODF A;  2ZEN A;  4A32 A;  2AE6 A;  5LYL A;  4CYO A;  1R3N A;  1QQ9 A;  2JDC A;  4OAD A;  3KHX A;  3S9L A;  3RO0 A;  4B5P A;  3IJ3 A;  3BJ8 A;  4PQA A;  4Q36 A;  1N71 A;  1S7N A;  1S3Z A;  2ZW4 A;  4EWT A;  2CTC A;  4C7I A;  1YVO A;  4HKF A;  4OC1 A;  5K8O A;  4NGS A;  2FT0 A;  3KR5 A;  1XFO A;  1M4I A;  2J8M A;  1LRZ A;  4UCN A;  3VAT A;  3EFA A;  3TOA A;  4HPS A;  4YFJ A;  2BSW A;  2EBJ A;  1CP7 A;  5A27 A;  1YK3 A;  4KUA A;  2GAN A;  1Y7R A;  5G20 A;  4C2Y A;  7CPA A;  1S7F A;  4CAV A;  5KTC A;  5ISV A;  2I3C A;  3FIX A;  4DNC A;  2Z0Z A;  3EC4 A;  3PB6 X;  2VL1 A;  5G22 A;  1CPS A;  4AG7 A;  4CGP A;  3N7Z A;  3ISX A;  1V0C A;  4BBH A;  3EXN A;  4EFD A;  4ZGY B;  2NYQ A;  4UF4 A;  2FSR A;  4E2A A;  4NJQ A;  2OH1 A;  4Q7A A;  3IU2 A;  4E0A A;  5F09 A;  3JRU A;  4F9U A;  4DJL A;  2DXQ A;  4II9 A;  2OB0 A;  2PJ1 A;  4AB7 A;  1M4G A;  3FRM A;  3G3S A;  4UEE A;  3K2K A;  2ZEO A;  3PB4 X;  4H6U A;  4NFR A;  4M85 A;  4FD4 A;  4YWY A;  4KS9 A;  4MHY A;  2O4H A;  4KOT A;  4FUU A;  4UA3 A;  2PVW A;  4UCP A;  4DYO A;  4MCP A;  2BOA A;  3D2P A;  4GS4 A;  3EY5 A;  4C68 A;  4FBE A;  2ZW6 A;  3QAH A;  3RYO A;  5K8P A;  3SJX A;  4IUS A;  2GRE A;  2PRB A;  4OAE A;  3PEI A;  4AXV A;  3KL9 A;  1SQH A;  1KUX A;  4KOY A;  5EMI A;  3W6S A;  1LCP A;  4A38 A;  2Q51 A;  2RB7 A;  4PPZ A;  4OC4 A;  1TF8 A;  2C6P A;  2V8G A;  3B2Y A;  5G21 A;  2FE7 A;  2AFU A;  4FAI A;  1ZG9 A;  2Z3P A; 
#chains in the Genus database with same CATH homology
 3FXT A;  2YGW A;  4XPK A;  2G0B A;  5EC4 A;  2Q4Y A;  5CNP A;  2BUE A;  3IWE A;  4CYQ A;  2AJ6 A;  4R9M A;  2R98 A;  3MGD A;  1M1D A;  1ZO0 A;  1YX0 A;  3CXQ A;  4KOW A;  3TT2 A;  3GKR A;  4B11 A;  2PSW A;  2PC1 A;  4AVA A;  3FNC A;  3UY5 A;  3LD2 A;  4UCM A;  1Z4R A;  2REF A;  1Z4E A;  2R1I A;  1TIQ A;  4KOS A;  2KCW A;  2P6E A;  2ZW5 A;  4A31 A;  3NE7 A;  1M44 A;  4E8O A;  2P6G A;  4A33 A;  4NEX A;  3R9G A;  5G1Z A;  4R3K A;  1MK4 A;  4CAE A;  1GHE A;  3I9S A;  3V8I A;  1XMT A;  2VBQ A;  2FS5 A;  3FB3 A;  4KOU A;  1I21 A;  1NE9 A;  2VZY A;  4U9Y A;  3T9Y A;  2VZZ A;  5JQ4 A;  1Q2Y A;  5FVJ A;  3ZZI A;  5A28 A;  3JTK A;  1WWZ A;  4X5K A;  3P2H A;  1KZF A;  4CRY B;  4H89 A;  1P0H A;  2R8V A;  4XPL A;  5AG7 A;  1PUA A;  2Q7B A;  1QSO A;  4Y49 C;  2GE3 A;  4AVB A;  3IWG A;  2B4D B;  3TTH A;  1S7L A;  3W91 A;  4XPD B;  3DR6 A;  4KOR A;  4KUB A;  2BEI A;  2NMT A;  2B5G B;  2YNE A;  4RS2 A;  2Z10 A;  2VQY A;  3CXP A;  3E0K A;  2QIR A;  3H4Q A;  4C2Z A;  4CGO A;  1PU9 A;  2OU2 A;  1FY7 A;  2CY2 A;  1S5K A;  1Q2C A;  3PP9 A;  1Z9U A;  2X7B A;  2BL1 A;  3R9E A;  1YLE A;  1IID A;  3FBU A;  4U9Z A;  2O28 A;  2DPT A;  1VKC A;  2FXF A;  2VEZ A;  4NSQ A;  3VWD A;  3JVN A;  4UFW A;  4QC6 A;  4B5O A;  2CNM A;  1J4J A;  3EO4 A;  3R95 A;  5F46 A;  1YRE A;  4J3G A;  2I00 A;  2P0W A;  4R87 A;  2EVN A;  1QSR A;  4MFP A;  4F0X A;  5AG4 A;  2Z3K A;  2JEV A;  4LUA A;  2PQ8 A;  4LX9 A;  1ON0 A;  2QEC A;  4F6A A;  2PDO A;  4JXR A;  4MY3 A;  3TO6 A;  3D3S A;  5AGE A;  2WSA A;  4PV6 A;  4IF5 A;  4MHD A;  4CS0 B;  2B3U A;  4UFX A;  3R96 A;  4MY0 A;  1BO4 A;  1QSN A;  4YRH A;  5F47 A;  2Y0M A;  2YNC A;  4PSW A;  4XNH C;  2C27 A;  2JDD A;  3SXO A;  5DWM A;  1L0C A;  1Y9W A;  2DPS A;  4MFL A;  3BLN A;  5KTA A;  2FIW A;  1IB1 E;  2QML A;  4KSF A;  2GIV A;  4UFV A;  5AG6 A;  4CYN A;  2ZXV A;  3S6H A;  1MJA A;  2B4B A;  1YGH A;  2OZH A;  3TE4 A;  4MFQ A;  4CAX A;  2ZPA A;  4B5P B;  1Y9K A;  5GCN A;  5IB0 A;  3DR8 A;  2Z3L A;  4HNX B;  1I12 A;  4C7H A;  5F48 A;  2Q0Y A;  1KUV A;  2WPW A;  3IU1 A;  2PR8 A;  4KLV A;  4AG9 A;  1XE4 A;  1IYK A;  4I49 A;  4CGN A;  1R57 A;  3C26 A;  4NXY A;  3GYA A;  1VHS A;  4JD6 A;  5AG5 A;  4YGO A;  1BOB A;  4L89 A;  4CGM A;  4A95 A;  1Q2D A;  1RXT A;  3F5B A;  4FD6 A;  2YNC C;  3R1K A;  3R9F A;  3IGR A;  2CNT A;  4CAF A;  4NF1 A;  1CJW A;  2P6F A;  3QB8 A;  4KVO E;  2Z3N A;  2I79 A;  2ATR A;  1K4J A;  1UFH A;  2PR1 A;  3P2F A;  3S6F A;  1P4N A;  2A4N A;  4MFK A;  4KVM E;  2K5T A;  4F0Y A;  4L8A A;  4A2Z A;  3I3G A;  2H5M A;  3T90 A;  5C82 A;  4KSA A;  2F5I A;  2FL4 A;  2J8N A;  1WK4 A;  1MJB A;  3DSB A;  4B13 A;  1S7K A;  3F0A A;  1NMT A;  1OZP A;  3LOD A;  3SHP A;  4CYP A;  4ORF A;  4B14 A;  1S60 A;  4MI4 A;  3G8W A;  3B8G A;  4FD7 A;  3TO9 A;  2HQY A;  1MJ9 A;  4UBR A;  3VWE A;  3PZJ A;  4Y49 B;  3OWC A;  5KTD A;  5J8C A;  2B58 A;  2OZG A;  3JUW A;  4HNW B;  4QBJ A;  2G3T A;  5H86 A;  5JPH A;  2JLM A;  4B10 A;  4CAW A;  2IL4 A;  3S6G A;  2HUZ A;  4KVX A;  3PGP A;  4ZBG A;  2B3V A;  3KKW A;  1XIX A;  2Q4V A;  4QB9 A;  2R7H A;  5C88 A;  4UWJ A;  4QVT A;  4C2X A;  1YR0 A;  4M3S A;  1XF8 A;  3K9U A;  4CGL A;  1B87 A;  4ONU A;  5IX3 A;  3W6X A;  2B4D A;  4R3L A;  1NSL A;  4JWP A;  4KZT A;  2FIA A;  2WUU A;  1U6M A;  2D4P A;  2B5G A;  5HH1 A;  5BWA B;  4NCZ A;  3D8P A;  5HMN A;  1QSM A;  2ARH A;  2CXA A;  1I1D A;  2HV2 A;  4JXQ A;  2YND A;  4FD5 A;  4HNY B;  4RI1 A;  4JJX A;  4OLL A;  2CNS A;  1IYL A;  2REE A;  1RO5 A;  2Z11 A;  2FCK A;  4CRZ B;  5I0C A;  2G3A A;  4A30 A;  1CM0 A;  2Q44 A;  2J8R A;  3FYN A;  4PSX A;  3DDD A;  4QUS A;  1QST A;  4XNH B;  4MBU A;  4XPD C;  3H5Z A;  4MJ8 A;  4U5Y A;  3TCV A;  2RC4 A;  5EBV A;  5F49 A;  4KLW A;  2WPX A;  1M4D A;  4PK2 A;  1IIC A;  4BMH A;  5IV0 A;  4KOV A;  3BJ7 A;  2VXK A;  3TFY A;  3WR7 A;  2VI7 A;  5J8F A;  1XEB A;  3TOB A;  4UWI A;  4R57 A;  2OZU A;  3S6K A;  4B12 A;  2Z3M A;  3GY9 A;  3SXN A;  4Q38 A;  1YVK A;  3DNS A;  5H84 A;  1B6B A;  3D2M A;  4H6Z A;  3CXS A;  4MFJ A;  4MFZ A;  3TO7 A;  4AVC A;  2ZW7 A;  4EVY A;  4JLY A;  4PK3 A;  5E96 A;  3A9L A;  2Q04 A;  4KOX A;  3F8K A;  3ZJ0 A;  1KUY A;  2EUI A;  2Z3O A;  5DWN A;  2D4O A;  4K30 A;  4A32 A;  2AE6 A;  4CYO A;  2JDC A;  4OAD A;  4B5P A;  3BJ8 A;  4Q36 A;  1N71 A;  1S7N A;  1S3Z A;  2ZW4 A;  4C7I A;  1YVO A;  4HKF A;  2FT0 A;  1M4I A;  2J8M A;  1LRZ A;  4UCN A;  3EFA A;  3TOA A;  4YFJ A;  2BSW A;  5A27 A;  1YK3 A;  4KUA A;  2GAN A;  1Y7R A;  5G20 A;  4C2Y A;  5KTC A;  1S7F A;  4CAV A;  5ISV A;  3FIX A;  4DNC A;  2Z0Z A;  3EC4 A;  5G22 A;  4AG7 A;  4CGP A;  3N7Z A;  1V0C A;  4BBH A;  3EXN A;  4ZGY B;  4E2A A;  2FSR A;  2OH1 A;  3IU2 A;  4E0A A;  4II9 A;  2DXQ A;  2OB0 A;  4AB7 A;  1M4G A;  3FRM A;  3G3S A;  4H6U A;  4M85 A;  4FD4 A;  4KS9 A;  4KOT A;  4UA3 A;  4UCP A;  3D2P A;  4GS4 A;  3EY5 A;  4C68 A;  2ZW6 A;  3QAH A;  3RYO A;  4IUS A;  2PRB A;  4OAE A;  1SQH A;  1KUX A;  4KOY A;  3W6S A;  5G21 A;  2FE7 A;  2Z3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...