1QSOA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
NITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
total genus 32
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsoA00
3N7ZA 3F0AA 2CY2A 2KCWA 1YLEA 2VZYA 4AG9A 2ZPAA 2REFA 2R98A 2VXKA 4HNWB 1S7LA 1S7NA 4JXRA 4MY0A 3TFYA 5JPHA 5HMNA 4XPKA 2OZUA 1Q2YA 3QAHA 3F8KA 1Y9KA 4AG7A 2CNTA 5DWMA 1S60A 2Q0YA 2ZW6A 2JDCA 3W6SA 1I1DA 3GYAA 2I79A 3IGRA 3LD2A 2WPWA 2ZW5A 4NF1A 4B5PB 3R9EA 3PP9A 1Y7RA 4YGOA 2FL4A 4E2AA 2Z11A 1Q2CA 4CRYB 2HV2A 3FB3A 4YFJA 3UY5A 2B5GA 4KVXA 4FD7A 1YK3A 2Y0MA 3TOBA 4U9ZA 4DNCA 3FRMA 2C27A 4AVBA 4F0YA 2BEIA 2JDDA 3R1KA 4YRHA 3B8GA 4I49A 2ARHA 2B4DA 4MHDA 3TOAA 4KOTA 1Z9UA 2G3TA 4ZBGA 1L0CA 3WR7A 2OZHA 4J3GA 3DR8A 3BJ8A 2OB0A 4U5YA 3QB8A 4PK2A 4UA3A 5IB0A 3DSBA 1XE4A 2ATRA 5J8FA 3VWDA 1XMTA 4Y49C 5GCNA 3T9YA 3CXPA 2FIAA 1NMTA 2J8MA 1MJBA 4II9A 1YR0A 3PZJA 1XF8A 4BMHA 2R7HA 5KTAA 2F5IA 4XPDB 2B5GB 3GY9A 4CAWA 4PK3A 4XNHB 2B3UA 1IICA 2PR8A 4AB7A 4Y49B 1WK4A 3BLNA 3IWGA 3D2PA 4KLVA 2HQYA 3S6GA 2FE7A 3VWEA 5E96A 4LUAA 1U6MA 1GHEA 2AE6A 1QSRA 4KVME 2D4OA 2Q4VA 2D4PA 1KZFA 3GKRA 1NE9A 3EFAA 4QC6A 1YX0A 4QBJA 3DR6A 4CS0B 3S6HA 1YREA 2ZXVA 1J4JA 4B5PA 4NXYA 4R87A 1QSMA 3RYOA 1KUVA 3SHPA 3E0KA 2OU2A 1M4DA 4E8OA 3S6FA 2JLMA 4X5KA 1RXTA 2X7BA 2A4NA 2PQ8A 4KORA 5J8CA 1YVKA 2FCKA 3R95A 5ISVA 3TT2A 3P2FA 3D8PA 4GS4A 3D2MA 4KUAA 4R57A 1IYKA 1ON0A 1R57A 4UWJA 3EC4A 3EXNA 4QVTA 5CNPA 1S5KA 3TTHA 2R1IA 2PDOA 5H84A 1PU9A 5F47A 2VEZA 3ZJ0A 2B4DB 1N71A 2O28A 1P4NA 4E0AA 1BOBA 3DNSA 2FSRA 1M4IA 1S3ZA 3G3SA 2VBQA 2BUEA 1BO4A 3I3GA 1NSLA 4MBUA 2FS5A 3MGDA 4KOUA 4HNYB 2PC1A 2HUZA 4M3SA 4R3KA 2FIWA 3F5BA 2Z0ZA 3JVNA 2Q7BA 3S6KA 2ZW4A 3G8WA 5EC4A 5H86A 4KOWA 3SXOA 4KUBA 3FXTA 3TCVA 4KOSA 3TO7A 1CM0A 3ZZIA 1CJWA 1B87A 2QECA 3CXQA 1Q2DA 1UFHA 4EVYA 2J8NA 4NCZA 3R9GA 4UWIA 4NSQA 2G3AA 3FNCA 2G0BA 3DDDA 3SXNA 3BJ7A 1IYLA 2Q44A 4CAVA 4B5OA 5HH1A 2P6GA 2QMLA 4KOXA 4H6ZA 4KOYA 4ONUA 1YVOA 4AVCA 2RC4A 4UBRA 3LODA 5C88A 4IF5A 5IX3A 5EBVA 4KLWA 4XNHC 4JD6A 5F46A 4KZTA 4ORFA 1Z4EA 2BSWA 4PV6A 1MJ9A 3OWCA 4LX9A 4MJ8A 1KUYA 1SQHA 1YGHA 4AVAA 1QSOA 1B6BA 2OZGA 4OADA 3CXSA 3FBUA 1TIQA 2Q04A 3FYNA 1K4JA 1WWZA 2B3VA 2CNSA 3C26A 2JEVA 1KUXA 2PR1A 2GANA 1XEBA 2FXFA 2GE3A 3PGPA 3JUWA 1FY7A 3W91A 1I21A 4H89A 5KTDA 1PUAA 3KKWA 5C82A 4M85A 2CNMA 1I12A 4JJXA 1P0HA 2EVNA 2DXQA 1IIDA 4XPDC 3D3SA 2IL4A 2EUIA 3R96A 3K9UA 2R8VA 4NEXA 2VI7A 1V0CA 1M1DA 4KVOE 1QSNA 3EY5A 2AJ6A 4IUSA 4FD4A 1S7KA 1IB1E 1RO5A 4MY3A 3TO6A 1QSTA 3T90A 4PSXA 5F48A 2B4BA 4FD5A 3P2HA 4CAXA 3TE4A 4JLYA 3NE7A 3R9FA 4R9MA 4CRZB 1Y9WA 2PRBA 2FT0A 1S7FA 2WPXA 4RS2A 4QUSA 5F49A 3W6XA 2P0WA 4KOVA 2NMTA 5JQ4A 4U9YA 1Z4RA 1VHSA 2P6EA 2Z10A 1LRZA 2ZW7A 2GIVA 1M4GA 1OZPA 1XIXA 4L8AA 4MI4A 2B58A 4JWPA 4R3LA 2J8RA 2H5MA 3TO9A 1M44A 3H4QA 4JXQA 4K30A 4L89A 5I0CA 5FVJA 3V8IA 5IV0A 3EO4A 3FIXA 5DWNA 4XPLA 1MK4A 2Q4YA 2REEA 3I9SA 2OH1A 2I00A 2P6FA 4H6UA 4OAEA 4F6AA 2QIRA 2BL1A 2VQYA 2PSWA 4RI1A 4QB9A 5KTCA 4FD6A 4OLLA 4PSWA 4HKFA 1MJAA 1VKCA 4HNXB 2VZZA 2K5TA
chains in the Genus database with same CATH superfamily
3N7ZA 4C2ZA 1VHOA 3F0AA 2CY2A 1IOFA 1TKFA 2KCWA 1YLEA 5LRJA 4UEEA 2IJZA 2PJ5A 2VZYA 3B3CA 4YWYA 4AG9A 2ZPAA 5LRKA 2REFA 2R98A 2VXKA 5THWA 1XBUA 4HNWB 5AGEA 1S7LA 1S7NA 5HVGA 3CT9A 4JXRA 4MY0A 3TFYA 3SJEA 5JPHA 1CPSA 4MRIA 2NYQA 5HMNA 2F8HA 4XPKA 2OZUA 4IHMA 5AG6A 5LYDA 1Q2YA 5JM6A 3NH4A 3QAHA 3F8KA 1Y9KA 4AG7A 1BAVA 2CNTA 5DWMA 1S60A 4NJQA 1LFWA 5D29A 2Q0YA 2ZW6A 7CPAA 4BD9A 2JDCA 3FMCA 3KGQA 3W6SA 2IMOA 1I1DA 4LQ6A 3GYAA 2QJ8A 4P4IA 4FUUA 3H8FA 2I79A 3IGRA 3LD2A 4K3NA 2WPWA 1XFOA 5HXDA 3SJXA 1XRYA 2ZW5A 3HLPA 3B3SA 2Z3KA 3CZXA 4NF1A 4A31A 4B5PB 3R9EA 1YQEA 4IAVA 3PP9A 3KI9A 1Y7RA 3KHZA 2ZELA 4YGOA 2FL4A 2Q51A 2CF4A 4E2AA 4CGMA 4UCMA 2Z11A 1Q2CA 1IY7A 4FBEA 4CRYB 2HV2A 3FB3A 2NSMA 3CDXA 3PBBA 4BINA 2Z3LA 4YFJA 2V8HA 3N5FA 3UY5A 2B5GA 4KVXA 4B14A 4DUKA 4R6TA 4ZX9A 3T8WA 5K8MA 5LYLA 1Z2LA 4FD7A 1YK3A 4Q36A 2Y0MA 3D7FA 4MFQA 3TOBA 2IQ6A 2DEAA 4U9ZA 4M6IA 4DNCA 2EBJA 2F7VA 1H8LA 2ZEOA 1F2OA 1X10A 3FRMA 2C27A 4AVBA 4P45A 4F0YA 1VGYA 4C7HA 2BEIA 3L2NA 3IO1A 2JDDA 2ZOGA 3D7GA 2FVGA 5DS0A 3IU2A 3R1KA 4MXUA 4X8IA 3FX6A 2G9DA 4H2KA 4YRHA 4DJLA 3SI0A 1Z5RA 3B8GA 3IWEA 4NGPA 1XMBA 5G1ZA 4MFZA 5LRGA 4NFRA 4ONWA 5G22A 4I49A 2ARHA 2ZENA 3SI1A 4ZY0A 2B4DA 4MHDA 3BHXA 1IU8A 4P4DA 3TOAA 5K8PA 4A95A 1F2PA 4KOTA 1Z9UA 2G3TA 4KSAA 4UCNA 4X3RA 4ZBGA 1TKHA 1PYTB 1L0CA 2GLJA 2GFQA 4RUHA 3WR7A 2OZHA 4J3GA 3DR8A 2V8VA 3BJ8A 5LYFA 2OB0A 4OKOA 2PVVA 4U5YA 3QB8A 4PK2A 4F0XA 4OC5A 4UA3A 2ZEMA 4NGQA 3TC8A 3DSBA 5IB0A 1XE4A 2ATRA 5J8FA 2ZEFA 5D8NA 8CPAA 1A2ZA 3VWDA 1XMTA 4WJBA 2J9AA 4Y49C 2O53A 5GCNA 3T9YA 3D4UA 4NGMA 3CXPA 4OC4A 2FIAA 1QMUA 3D7HA 2PJ1A 1NMTA 2J8MA 1MJBA 4II9A 2C1CA 1YR0A 3PZJA 3B2YA 4B13A 1XF8A 5HVHA 4BMHA 1TF8A 2R7HA 3LWUA 5KTAA 2F5IA 4XPDB 2B5GB 4ZY1A 4Q7AA 1Q7LA 3GY9A 3PB9X 4M6HA 4CAWA 4PK3A 5A28A 4XNHB 2B3UA 4JZ0A 1IICA 2Z3MA 3RZAA 2PIYA 2PR8A 2Q43A 4UCPA 4AB7A 4Y49B 3ISZA 2YNCC 1WK4A 4KSIA 3BLNA 2PJ0A 1AMPA 3IWGA 1YLOA 3D2PA 1ZG8A 2PJ6A 3IWWA 1ELLP 4KLVA 1CG2A 2HQYA 2ODFA 2FE7A 2V8GA 3S6GA 3VWEA 4A38A 1ARMA 5E96A 2HC9A 4LUAA 1U6MA 1GHEA 2AE6A 3D7DA 2JEWA 4NGNA 1QSRA 2C6CA 3H5ZA 4KVME 4PQAA 6CPAA 2D4OA 2Q4VA 1JQGA 2AFXA 2D4PA 4EWTA 2JBJA 3KQZA 3LMSA 1KZFA 3GKRA 2ABZA 1LANA 1NE9A 2EWBA 3EFAA 4YU9A 4QC6A 2QYVA 5IB9A 4OIWA 1YX0A 4QBJA 2AFMA 4F9VA 3DR6A 4CS0B 3S6HA 2C6GA 1YREA 2ZXVA 3NH8A 4KSFA 4NGSA 4Q38A 1J4JA 4B5PA 4NXYA 4R87A 1BPMA 2V77A 1QSMA 3RYOA 3KR5A 1KUVA 3SHPA 1CP7A 4MMOA 3E0KA 1YW4A 1PCAA 2OU2A 1M4DA 3K2KA 4E8OA 3S6FA 1Z8WA 2JLMA 4MHPA 4X5KA 1RXTA 2X7BA 4NGRA 2A4NA 2PQ8A 4KORA 5ELYA 5J8CA 4ZGYB 2Q4ZA 2PJCA 1YVKA 3KR4A 5G20A 2FCKA 3R95A 2PVWA 5ISVA 4OIDA 3TT2A 3P2FA 3GB0A 2BO9A 3D8PA 3GLJA 3D2MA 4GM5A 4GS4A 2AFUA 4KUAA 4R57A 1AUGA 3B3WA 4ZYQA 4UFWA 3V38A 2Z3OA 1IYKA 4UEFA 1ON0A 4CAFA 1R57A 4UWJA 2OOTA 5CPAA 4MFPA 3EC4A 3SJGA 3EXNA 3JTKA 2QVPA 4QVTA 4CAEA 3VARA 1LAPA 3BI0A 3H8GA 5CNPA 4ZX8A 4P44A 4C7IA 1S5KA 2ZEHA 3TTHA 2R1IA 2PDOA 5H84A 2ZOFA 2DPSA 2I3CA 1PU9A 5F47A 2VEZA 3IU1A 4UF4A 2XEFA 4FAIA 4TNUA 3ZJ0A 2B4DB 3NA6A 1N71A 1OBRA 1HDQA 2O28A 1EE3P 1P4NA 4E0AA 1BOBA 3DNSA 2FSRA 1M4IA 1S3ZA 3G3SA 4CYOA 2VBQA 4OC3A 2BUEA 1BO4A 3I3GA 4MHYA 4MBUA 2XEGA 1NSLA 1R3NA 2FS5A 3MGDA 3QNVA 3RAMA 4KOUA 4NJRA 4HNYB 2PJ7A 3S9NA 2XEJA 2PC1A 3TX8A 2HUZA 4M3SA 4OMEA 2ZEGA 4FWUA 1ZO0A 1HEEA 4A94A 4R3KA 4C68A 2FIWA 2OR4A 3F5BA 5J1QA 2GLFA 4UFVA 2Z0ZA 3JVNA 4A39A 2Q7BA 4ZY2A 3S6KA 4NGTA 4IK2A 4P10A 1ELMP 2ZW4A 5HVFA 1YW6A 4TWEA 3BI1A 3FEDA 3FECA 1KWMA 3G8WA 5EC4A 5H86A 2PIZA 3HUVA 1YMEA 3CPXA 4KOWA 4P4JA 3SXOA 3S9LA 2AFZA 1R43A 2CIJA 4KUBA 3FXTA 3TCVA 4KOSA 3TO7A 1CM0A 3ZZIA 1CJWA 1B87A 2QECA 3CXQA 1Q2DA 1UFHA 3A9LA 1XOVA 1X12A 2V8DA 4CGLA 4EVYA 2J8NA 4NCZA 3R9GA 4UWIA 3B35A 4NSQA 5K8NA 1XJOA 1TKJA 1VIXA 2G3AA 3FNCA 2CTCA 3MRUA 2G0BA 3PRTA 3DDDA 5JH9A 3SXNA 2EK9A 3S9MA 3D67A 2RFHA 3K9TA 2YNDA 2PCUA 3BJ7A 4AXVA 3PB4X 4CYQA 4OC0A 1IYLA 2PRQA 3GUXA 3PFOA 2Q44A 2YNCA 3DGVA 4CAVA 4OC2A 1Z8XA 5HH1A 4B5OA 2P6GA 2QMLA 1HDUA 4H6ZA 4KOYA 4KOXA 4ONUA 1YVOA 4P4BA 5I4MA 4AVCA 2RC4A 3FH4A 4UBRA 2ZEEA 2JBKA 3LODA 5C88A 4IF5A 4R8FA 5EBVA 5IX3A 4KLWA 3IFEA 4JD6A 4XNHC 2AFWA 3I1UA 3BXMA 4KZTA 4ORFA 3SJFA 4M6GA 1Z4EA 5F46A 1TXRA 2BSWA 4PV6A 4C2YA 1MJ9A 3OWCA 2PJ2A 4LX9A 4WWVA 4PXDA 4MJ8A 4R76A 1KUYA 1SQHA 4P4EA 3PFEA 4MHZA 3VH9A 1M4LA 1YGHA 4C2XA 4AVAA 2PJAA 1QSOA 1B6BA 2OZGA 4OADA 3CXSA 3PB6X 3FBUA 4Z65A 4MFJA 2AFOA 4MCQA 1TIQA 4A30A 4P6YA 1FNOA 3NH5A 2Q04A 3FYNA 1K4JA 1WWZA 1Y0YA 2B3VA 1ZLHA 2AFSA 2CNSA 5LYIA 3C26A 2JEVA 1KUXA 1FT7A 3KZWA 2PR1A 2PJ8A 2GANA 2YNEA 4MCRA 1XEBA 2FXFA 2GE3A 2PJ4A 2HB6A 2YGWA 3PB8X 3RBUA 3PGPA 3RNZA 3JUWA 1FY7A 3W91A 4RN7A 3QAYA 1I21A 1Y0RA 4H89A 3V7ZA 5KTDA 1PUAA 3KKWA 1Z8LA 5C82A 3VATA 4M85A 3CPAA 4A32A 4B12A 2CNMA 1I12A 4JJXA 1P0HA 4UFXA 2EVNA 2DXQA 1IIDA 4XPDC 3NFZA 3D3SA 2WUUA 2IL4A 1TF9A 1JWQA 4A37A 2EUIA 3R96A 3K9UA 5A27A 2R8VA 2XEIA 3KASA 4NEXA 2VI7A 1V0CA 1M1DA 1ZG9A 3KHXA 3KL9A 5AG4A 1DTDA 1CX8A 2PJBA 4O23A 4KVOE 1QSNA 3NE8A 2PJ9A 3RO0A 2PE3A 3EY5A 2AJ6A 4GXHA 4FD4A 4IUSA 4F8ZA 1S7KA 1ZG7A 1IB1E 3WC7A 1LCPA 1RO5A 4MY3A 3TO6A 4DYOA 1QSTA 1LOKA 3T90A 4PSXA 5F48A 1F57A 2B4BA 3FJUA 4FD5A 3P2HA 4CAXA 2ZEPA 2ZEDA 5K8OA 3TE4A 4PXBA 4JLYA 3NE7A 2DPTA 3D66A 4PPZA 4B6ZA 3R9FA 4R9MA 5AG7A 2POKA 3H8EA 2PJ3A 3FF3A 3B3TA 4CRZB 1Y9WA 2PRBA 4MHNA 1Z8TA 2O4HA 4MCSA 4CPAA 1ARLA 2FT0A 1S7FA 2WPXA 5CBMA 4RS2A 4A2ZA 4QUSA 5F49A 3W6XA 2P0WA 1CPXA 2EK8A 3GIUA 3WABA 1AYEA 4KOVA 3WC6A 2NMTA 5JQ4A 4U9YA 2BOAA 1Z4RA 4JYWA 3PB7X 3FEEA 4UIAA 1VHSA 4PXCA 2P6EA 2C6PA 2Z10A 3WT4A 1LRZA 1VHEA 2GU2A 2ZW7A 3ISXA 1BLLE 4PXEA 2GIVA 4KS9A 3WC5A 1M4GA 5AG5A 1OZPA 1XIXA 4L8AA 4MI4A 4LQGA 3FVLA 4BBHA 4ZI6A 2B58A 4JWPA 3SI2A 4R3LA 1LAMA 2J8RA 4G1PA 3LACA 3DLJA 3B7IA 2WSAA 2H5MA 3TO9A 5G21A 1NSAA 1M44A 2RB7A 3H4QA 4JXQA 4K30A 4L89A 4EMEA 5I0CA 4MFKA 5FVJA 4CYNA 5JGFA 3V8IA 1IOIA 2CXAA 5IV0A 3EO4A 3FIXA 5DWNA 1CP6A 2Z3PA 2BCOA 1MK4A 3B3VA 3MN8A 4OP4A 4UIBA 4XPLA 3IJ3A 2Q4YA 1Y7EA 2DF5A 1GYTA 2REEA 1DE4C 4OC1A 2ANPA 1BPNA 3I9SA 2OH1A 4EFDA 4HPSA 2I00A 3PBEA 4UEZA 2P6FA 3IEHA 4B10A 4MFLA 4R7MA 1QQ9A 3IC1A 1ZLIA 4H6UA 1IGBA 2EO8A 4OAEA 1UWYA 5EMIA 4F6AA 4CYPA 2QIRA 2WZNA 1CBXA 4F9UA 5BWAB 4MCPA 2BL1A 2VQYA 5F09A 2PSWA 4RI1A 3KQXA 1YSJA 2CTBA 4FD6A 4QB9A 4OLLA 4W9YA 5KTCA 4CGOA 4P4FA 2VL1A 4CGNA 4A33A 4PSWA 4X2TA 3PEIA 4HKFA 1MJAA 1VKCA 2WYRA 1RTQA 3IIBA 3JRUA 4B11A 2Q7SA 4HNXB 2VZZA 2K5TA 2GREA 4CGPA 3D68A 2Z3NA
chains in the Genus database with same CATH topology
3N7ZA 4C2ZA 3F0AA 2CY2A 2KCWA 1YLEA 2VZYA 4AG9A 2ZPAA 2REFA 2R98A 2VXKA 4HNWB 5AGEA 1S7LA 1S7NA 4JXRA 4MY0A 3TFYA 5JPHA 5HMNA 4XPKA 2OZUA 5AG6A 1Q2YA 3QAHA 3F8KA 1Y9KA 4AG7A 2CNTA 5DWMA 1S60A 2Q0YA 2ZW6A 2JDCA 3W6SA 1I1DA 3GYAA 2I79A 3IGRA 3LD2A 2WPWA 2ZW5A 2Z3KA 4NF1A 4A31A 4B5PB 3R9EA 3PP9A 1Y7RA 4YGOA 2FL4A 4E2AA 4CGMA 4UCMA 2Z11A 1Q2CA 4CRYB 2HV2A 3FB3A 2Z3LA 4YFJA 3UY5A 2B5GA 4KVXA 4B14A 4FD7A 1YK3A 4Q36A 2Y0MA 4MFQA 3TOBA 4U9ZA 4DNCA 3FRMA 2C27A 4AVBA 4F0YA 4C7HA 2BEIA 2JDDA 3IU2A 3R1KA 4YRHA 3B8GA 3IWEA 5G1ZA 4MFZA 5G22A 4I49A 2ARHA 2B4DA 4MHDA 3TOAA 4A95A 4KOTA 1Z9UA 2G3TA 4KSAA 4UCNA 4ZBGA 1L0CA 3WR7A 2OZHA 4J3GA 3DR8A 3BJ8A 2OB0A 4U5YA 3QB8A 4PK2A 4F0XA 4UA3A 5IB0A 3DSBA 1XE4A 2ATRA 5J8FA 3VWDA 1XMTA 4Y49C 5GCNA 3T9YA 3CXPA 2FIAA 1NMTA 2J8MA 1MJBA 4II9A 1YR0A 3PZJA 4B13A 1XF8A 4BMHA 2R7HA 5KTAA 2F5IA 4XPDB 2B5GB 3GY9A 4CAWA 4PK3A 5A28A 4XNHB 2B3UA 1IICA 2Z3MA 2PR8A 4UCPA 4AB7A 4Y49B 2YNCC 1WK4A 3BLNA 3IWGA 3D2PA 4KLVA 2HQYA 3S6GA 2FE7A 3VWEA 5E96A 4LUAA 1U6MA 1GHEA 2AE6A 1QSRA 3H5ZA 4KVME 2D4OA 2Q4VA 2D4PA 1KZFA 3GKRA 1NE9A 3EFAA 4QC6A 1YX0A 4QBJA 3DR6A 4CS0B 3S6HA 1YREA 2ZXVA 4KSFA 4Q38A 1J4JA 4B5PA 4NXYA 4R87A 1QSMA 3RYOA 1KUVA 3SHPA 3E0KA 2OU2A 1M4DA 4E8OA 3S6FA 2JLMA 4X5KA 1RXTA 2X7BA 2A4NA 2PQ8A 4KORA 5J8CA 4ZGYB 1YVKA 5G20A 2FCKA 3R95A 5ISVA 3TT2A 3P2FA 3D8PA 4GS4A 3D2MA 4KUAA 4R57A 4UFWA 2Z3OA 1IYKA 1ON0A 4CAFA 1R57A 4UWJA 4MFPA 3EC4A 3EXNA 3JTKA 4QVTA 4CAEA 5CNPA 4C7IA 1S5KA 3TTHA 2R1IA 2PDOA 5H84A 2DPSA 1PU9A 5F47A 2VEZA 3IU1A 3ZJ0A 2B4DB 1N71A 2O28A 1P4NA 4E0AA 1BOBA 3DNSA 2FSRA 1M4IA 1S3ZA 3G3SA 4CYOA 2VBQA 2BUEA 1BO4A 3I3GA 1NSLA 4MBUA 2FS5A 3MGDA 4KOUA 4HNYB 2PC1A 2HUZA 4M3SA 1ZO0A 4R3KA 4C68A 2FIWA 3F5BA 4UFVA 2Z0ZA 3JVNA 2Q7BA 3S6KA 2ZW4A 3G8WA 5EC4A 5H86A 4KOWA 3SXOA 4KUBA 3FXTA 3TCVA 4KOSA 3TO7A 1CM0A 3ZZIA 1CJWA 1B87A 2QECA 3CXQA 1Q2DA 1UFHA 3A9LA 4CGLA 4EVYA 2J8NA 4NCZA 3R9GA 4UWIA 4NSQA 2G3AA 3FNCA 2G0BA 3DDDA 3SXNA 2YNDA 3BJ7A 4CYQA 1IYLA 2Q44A 2YNCA 4CAVA 4B5OA 5HH1A 2P6GA 2QMLA 4KOXA 4H6ZA 4KOYA 4ONUA 1YVOA 4AVCA 2RC4A 4UBRA 3LODA 5C88A 4IF5A 5IX3A 5EBVA 4KLWA 4XNHC 4JD6A 5F46A 4KZTA 4ORFA 1Z4EA 2BSWA 4PV6A 4C2YA 1MJ9A 3OWCA 4LX9A 4MJ8A 1KUYA 1SQHA 4C2XA 1YGHA 4AVAA 1QSOA 1B6BA 2OZGA 4OADA 3CXSA 3FBUA 4MFJA 1TIQA 4A30A 2Q04A 3FYNA 1K4JA 1WWZA 2B3VA 2CNSA 3C26A 2JEVA 1KUXA 2PR1A 2YNEA 2GANA 1XEBA 2FXFA 2GE3A 2YGWA 3PGPA 3JUWA 1FY7A 3W91A 1I21A 4H89A 5KTDA 1PUAA 3KKWA 5C82A 4M85A 4A32A 4B12A 2CNMA 1I12A 4JJXA 1P0HA 4UFXA 2EVNA 2DXQA 1IIDA 4XPDC 3D3SA 2WUUA 2IL4A 2EUIA 3R96A 3K9UA 5A27A 2R8VA 4NEXA 2VI7A 1V0CA 1M1DA 5AG4A 4KVOE 1QSNA 3EY5A 2AJ6A 4IUSA 4FD4A 1S7KA 1IB1E 1RO5A 4MY3A 3TO6A 1QSTA 3T90A 4PSXA 5F48A 2B4BA 4FD5A 3P2HA 4CAXA 3TE4A 4JLYA 3NE7A 2DPTA 3R9FA 4R9MA 5AG7A 4CRZB 1Y9WA 2PRBA 2FT0A 1S7FA 2WPXA 4RS2A 4A2ZA 4QUSA 5F49A 3W6XA 2P0WA 4KOVA 2NMTA 5JQ4A 4U9YA 1Z4RA 1VHSA 2P6EA 2Z10A 1LRZA 2ZW7A 2GIVA 4KS9A 1M4GA 5AG5A 1OZPA 1XIXA 4L8AA 4MI4A 4BBHA 2B58A 4JWPA 4R3LA 2J8RA 2WSAA 2H5MA 3TO9A 5G21A 1M44A 3H4QA 4JXQA 4K30A 4L89A 5I0CA 4MFKA 5FVJA 4CYNA 3V8IA 2CXAA 5IV0A 3EO4A 3FIXA 5DWNA 2Z3PA 4XPLA 1MK4A 2Q4YA 2REEA 3I9SA 2OH1A 2I00A 2P6FA 4B10A 4MFLA 4H6UA 4OAEA 4F6AA 4CYPA 2QIRA 5BWAB 2BL1A 2VQYA 2PSWA 4RI1A 4QB9A 5KTCA 4FD6A 4OLLA 4CGOA 4CGNA 4A33A 4PSWA 4HKFA 1MJAA 1VKCA 4B11A 4HNXB 2VZZA 2K5TA 4CGPA 2Z3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7Z A;  3F0A A;  2CY2 A;  2KCW A;  1YLE A;  2VZY A;  4AG9 A;  2ZPA A;  2REF A;  2R98 A;  2VXK A;  4HNW B;  1S7L A;  1S7N A;  4JXR A;  4MY0 A;  3TFY A;  5JPH A;  5HMN A;  4XPK A;  2OZU A;  1Q2Y A;  3QAH A;  3F8K A;  1Y9K A;  4AG7 A;  2CNT A;  5DWM A;  1S60 A;  2Q0Y A;  2ZW6 A;  2JDC A;  3W6S A;  1I1D A;  3GYA A;  2I79 A;  3IGR A;  3LD2 A;  2WPW A;  2ZW5 A;  4NF1 A;  4B5P B;  3R9E A;  3PP9 A;  1Y7R A;  4YGO A;  2FL4 A;  4E2A A;  2Z11 A;  1Q2C A;  4CRY B;  2HV2 A;  3FB3 A;  4YFJ A;  3UY5 A;  2B5G A;  4KVX A;  4FD7 A;  1YK3 A;  2Y0M A;  3TOB A;  4U9Z A;  4DNC A;  3FRM A;  2C27 A;  4AVB A;  4F0Y A;  2BEI A;  2JDD A;  3R1K A;  4YRH A;  3B8G A;  4I49 A;  2ARH A;  2B4D A;  4MHD A;  3TOA A;  4KOT A;  1Z9U A;  2G3T A;  4ZBG A;  1L0C A;  3WR7 A;  2OZH A;  4J3G A;  3DR8 A;  3BJ8 A;  2OB0 A;  4U5Y A;  3QB8 A;  4PK2 A;  4UA3 A;  5IB0 A;  3DSB A;  1XE4 A;  2ATR A;  5J8F A;  3VWD A;  1XMT A;  4Y49 C;  5GCN A;  3T9Y A;  3CXP A;  2FIA A;  1NMT A;  2J8M A;  1MJB A;  4II9 A;  1YR0 A;  3PZJ A;  1XF8 A;  4BMH A;  2R7H A;  5KTA A;  2F5I A;  4XPD B;  2B5G B;  3GY9 A;  4CAW A;  4PK3 A;  4XNH B;  2B3U A;  1IIC A;  2PR8 A;  4AB7 A;  4Y49 B;  1WK4 A;  3BLN A;  3IWG A;  3D2P A;  4KLV A;  2HQY A;  3S6G A;  2FE7 A;  3VWE A;  5E96 A;  4LUA A;  1U6M A;  1GHE A;  2AE6 A;  1QSR A;  4KVM E;  2D4O A;  2Q4V A;  2D4P A;  1KZF A;  3GKR A;  1NE9 A;  3EFA A;  4QC6 A;  1YX0 A;  4QBJ A;  3DR6 A;  4CS0 B;  3S6H A;  1YRE A;  2ZXV A;  1J4J A;  4B5P A;  4NXY A;  4R87 A;  1QSM A;  3RYO A;  1KUV A;  3SHP A;  3E0K A;  2OU2 A;  1M4D A;  4E8O A;  3S6F A;  2JLM A;  4X5K A;  1RXT A;  2X7B A;  2A4N A;  2PQ8 A;  4KOR A;  5J8C A;  1YVK A;  2FCK A;  3R95 A;  5ISV A;  3TT2 A;  3P2F A;  3D8P A;  4GS4 A;  3D2M A;  4KUA A;  4R57 A;  1IYK A;  1ON0 A;  1R57 A;  4UWJ A;  3EC4 A;  3EXN A;  4QVT A;  5CNP A;  1S5K A;  3TTH A;  2R1I A;  2PDO A;  5H84 A;  1PU9 A;  5F47 A;  2VEZ A;  3ZJ0 A;  2B4D B;  1N71 A;  2O28 A;  1P4N A;  4E0A A;  1BOB A;  3DNS A;  2FSR A;  1M4I A;  1S3Z A;  3G3S A;  2VBQ A;  2BUE A;  1BO4 A;  3I3G A;  1NSL A;  4MBU A;  2FS5 A;  3MGD A;  4KOU A;  4HNY B;  2PC1 A;  2HUZ A;  4M3S A;  4R3K A;  2FIW A;  3F5B A;  2Z0Z A;  3JVN A;  2Q7B A;  3S6K A;  2ZW4 A;  3G8W A;  5EC4 A;  5H86 A;  4KOW A;  3SXO A;  4KUB A;  3FXT A;  3TCV A;  4KOS A;  3TO7 A;  1CM0 A;  3ZZI A;  1CJW A;  1B87 A;  2QEC A;  3CXQ A;  1Q2D A;  1UFH A;  4EVY A;  2J8N A;  4NCZ A;  3R9G A;  4UWI A;  4NSQ A;  2G3A A;  3FNC A;  2G0B A;  3DDD A;  3SXN A;  3BJ7 A;  1IYL A;  2Q44 A;  4CAV A;  4B5O A;  5HH1 A;  2P6G A;  2QML A;  4KOX A;  4H6Z A;  4KOY A;  4ONU A;  1YVO A;  4AVC A;  2RC4 A;  4UBR A;  3LOD A;  5C88 A;  4IF5 A;  5IX3 A;  5EBV A;  4KLW A;  4XNH C;  4JD6 A;  5F46 A;  4KZT A;  4ORF A;  1Z4E A;  2BSW A;  4PV6 A;  1MJ9 A;  3OWC A;  4LX9 A;  4MJ8 A;  1KUY A;  1SQH A;  1YGH A;  4AVA A;  1QSO A;  1B6B A;  2OZG A;  4OAD A;  3CXS A;  3FBU A;  1TIQ A;  2Q04 A;  3FYN A;  1K4J A;  1WWZ A;  2B3V A;  2CNS A;  3C26 A;  2JEV A;  1KUX A;  2PR1 A;  2GAN A;  1XEB A;  2FXF A;  2GE3 A;  3PGP A;  3JUW A;  1FY7 A;  3W91 A;  1I21 A;  4H89 A;  5KTD A;  1PUA A;  3KKW A;  5C82 A;  4M85 A;  2CNM A;  1I12 A;  4JJX A;  1P0H A;  2EVN A;  2DXQ A;  1IID A;  4XPD C;  3D3S A;  2IL4 A;  2EUI A;  3R96 A;  3K9U A;  2R8V A;  4NEX A;  2VI7 A;  1V0C A;  1M1D A;  4KVO E;  1QSN A;  3EY5 A;  2AJ6 A;  4IUS A;  4FD4 A;  1S7K A;  1IB1 E;  1RO5 A;  4MY3 A;  3TO6 A;  1QST A;  3T90 A;  4PSX A;  5F48 A;  2B4B A;  4FD5 A;  3P2H A;  4CAX A;  3TE4 A;  4JLY A;  3NE7 A;  3R9F A;  4R9M A;  4CRZ B;  1Y9W A;  2PRB A;  2FT0 A;  1S7F A;  2WPX A;  4RS2 A;  4QUS A;  5F49 A;  3W6X A;  2P0W A;  4KOV A;  2NMT A;  5JQ4 A;  4U9Y A;  1Z4R A;  1VHS A;  2P6E A;  2Z10 A;  1LRZ A;  2ZW7 A;  2GIV A;  1M4G A;  1OZP A;  1XIX A;  4L8A A;  4MI4 A;  2B58 A;  4JWP A;  4R3L A;  2J8R A;  2H5M A;  3TO9 A;  1M44 A;  3H4Q A;  4JXQ A;  4K30 A;  4L89 A;  5I0C A;  5FVJ A;  3V8I A;  5IV0 A;  3EO4 A;  3FIX A;  5DWN A;  4XPL A;  1MK4 A;  2Q4Y A;  2REE A;  3I9S A;  2OH1 A;  2I00 A;  2P6F A;  4H6U A;  4OAE A;  4F6A A;  2QIR A;  2BL1 A;  2VQY A;  2PSW A;  4RI1 A;  4QB9 A;  5KTC A;  4FD6 A;  4OLL A;  4PSW A;  4HKF A;  1MJA A;  1VKC A;  4HNX B;  2VZZ A;  2K5T A; 
#chains in the Genus database with same CATH topology
 3N7Z A;  4C2Z A;  1VHO A;  3F0A A;  2CY2 A;  1IOF A;  1TKF A;  2KCW A;  1YLE A;  5LRJ A;  4UEE A;  2IJZ A;  2PJ5 A;  2VZY A;  3B3C A;  4YWY A;  4AG9 A;  2ZPA A;  5LRK A;  2REF A;  2R98 A;  2VXK A;  5THW A;  1XBU A;  4HNW B;  5AGE A;  1S7L A;  1S7N A;  5HVG A;  3CT9 A;  4JXR A;  4MY0 A;  3TFY A;  3SJE A;  5JPH A;  1CPS A;  4MRI A;  2NYQ A;  5HMN A;  2F8H A;  4XPK A;  2OZU A;  4IHM A;  5AG6 A;  5LYD A;  1Q2Y A;  5JM6 A;  3NH4 A;  3QAH A;  3F8K A;  1Y9K A;  4AG7 A;  1BAV A;  2CNT A;  5DWM A;  1S60 A;  4NJQ A;  1LFW A;  5D29 A;  2Q0Y A;  2ZW6 A;  7CPA A;  4BD9 A;  2JDC A;  3FMC A;  3KGQ A;  3W6S A;  2IMO A;  1I1D A;  4LQ6 A;  3GYA A;  2QJ8 A;  4P4I A;  4FUU A;  3H8F A;  2I79 A;  3IGR A;  3LD2 A;  4K3N A;  2WPW A;  1XFO A;  5HXD A;  3SJX A;  1XRY A;  2ZW5 A;  3HLP A;  3B3S A;  2Z3K A;  3CZX A;  4NF1 A;  4A31 A;  4B5P B;  3R9E A;  1YQE A;  4IAV A;  3PP9 A;  3KI9 A;  1Y7R A;  3KHZ A;  2ZEL A;  4YGO A;  2FL4 A;  2Q51 A;  2CF4 A;  4E2A A;  4CGM A;  4UCM A;  2Z11 A;  1Q2C A;  1IY7 A;  4FBE A;  4CRY B;  2HV2 A;  3FB3 A;  2NSM A;  3CDX A;  3PBB A;  4BIN A;  2Z3L A;  4YFJ A;  2V8H A;  3N5F A;  3UY5 A;  2B5G A;  4KVX A;  4B14 A;  4DUK A;  4R6T A;  4ZX9 A;  3T8W A;  5K8M A;  5LYL A;  1Z2L A;  4FD7 A;  1YK3 A;  4Q36 A;  2Y0M A;  3D7F A;  4MFQ A;  3TOB A;  2IQ6 A;  2DEA A;  4U9Z A;  4M6I A;  4DNC A;  2EBJ A;  2F7V A;  1H8L A;  2ZEO A;  1F2O A;  1X10 A;  3FRM A;  2C27 A;  4AVB A;  4P45 A;  4F0Y A;  1VGY A;  4C7H A;  2BEI A;  3L2N A;  3IO1 A;  2JDD A;  2ZOG A;  3D7G A;  2FVG A;  5DS0 A;  3IU2 A;  3R1K A;  4MXU A;  4X8I A;  3FX6 A;  2G9D A;  4H2K A;  4YRH A;  4DJL A;  3SI0 A;  1Z5R A;  3B8G A;  3IWE A;  4NGP A;  1XMB A;  5G1Z A;  4MFZ A;  5LRG A;  4NFR A;  4ONW A;  5G22 A;  4I49 A;  2ARH A;  2ZEN A;  3SI1 A;  4ZY0 A;  2B4D A;  4MHD A;  3BHX A;  1IU8 A;  4P4D A;  3TOA A;  5K8P A;  4A95 A;  1F2P A;  4KOT A;  1Z9U A;  2G3T A;  4KSA A;  4UCN A;  4X3R A;  4ZBG A;  1TKH A;  1PYT B;  1L0C A;  2GLJ A;  2GFQ A;  4RUH A;  3WR7 A;  2OZH A;  4J3G A;  3DR8 A;  2V8V A;  3BJ8 A;  5LYF A;  2OB0 A;  4OKO A;  2PVV A;  4U5Y A;  3QB8 A;  4PK2 A;  4F0X A;  4OC5 A;  4UA3 A;  2ZEM A;  4NGQ A;  3TC8 A;  3DSB A;  5IB0 A;  1XE4 A;  2ATR A;  5J8F A;  2ZEF A;  5D8N A;  8CPA A;  1A2Z A;  3VWD A;  1XMT A;  4WJB A;  2J9A A;  4Y49 C;  2O53 A;  5GCN A;  3T9Y A;  3D4U A;  4NGM A;  3CXP A;  4OC4 A;  2FIA A;  1QMU A;  3D7H A;  2PJ1 A;  1NMT A;  2J8M A;  1MJB A;  4II9 A;  2C1C A;  1YR0 A;  3PZJ A;  3B2Y A;  4B13 A;  1XF8 A;  5HVH A;  4BMH A;  1TF8 A;  2R7H A;  3LWU A;  5KTA A;  2F5I A;  4XPD B;  2B5G B;  4ZY1 A;  4Q7A A;  1Q7L A;  3GY9 A;  3PB9 X;  4M6H A;  4CAW A;  4PK3 A;  5A28 A;  4XNH B;  2B3U A;  4JZ0 A;  1IIC A;  2Z3M A;  3RZA A;  2PIY A;  2PR8 A;  2Q43 A;  4UCP A;  4AB7 A;  4Y49 B;  3ISZ A;  2YNC C;  1WK4 A;  4KSI A;  3BLN A;  2PJ0 A;  1AMP A;  3IWG A;  1YLO A;  3D2P A;  1ZG8 A;  2PJ6 A;  3IWW A;  1ELL P;  4KLV A;  1CG2 A;  2HQY A;  2ODF A;  2FE7 A;  2V8G A;  3S6G A;  3VWE A;  4A38 A;  1ARM A;  5E96 A;  2HC9 A;  4LUA A;  1U6M A;  1GHE A;  2AE6 A;  3D7D A;  2JEW A;  4NGN A;  1QSR A;  2C6C A;  3H5Z A;  4KVM E;  4PQA A;  6CPA A;  2D4O A;  2Q4V A;  1JQG A;  2AFX A;  2D4P A;  4EWT A;  2JBJ A;  3KQZ A;  3LMS A;  1KZF A;  3GKR A;  2ABZ A;  1LAN A;  1NE9 A;  2EWB A;  3EFA A;  4YU9 A;  4QC6 A;  2QYV A;  5IB9 A;  4OIW A;  1YX0 A;  4QBJ A;  2AFM A;  4F9V A;  3DR6 A;  4CS0 B;  3S6H A;  2C6G A;  1YRE A;  2ZXV A;  3NH8 A;  4KSF A;  4NGS A;  4Q38 A;  1J4J A;  4B5P A;  4NXY A;  4R87 A;  1BPM A;  2V77 A;  1QSM A;  3RYO A;  3KR5 A;  1KUV A;  3SHP A;  1CP7 A;  4MMO A;  3E0K A;  1YW4 A;  1PCA A;  2OU2 A;  1M4D A;  3K2K A;  4E8O A;  3S6F A;  1Z8W A;  2JLM A;  4MHP A;  4X5K A;  1RXT A;  2X7B A;  4NGR A;  2A4N A;  2PQ8 A;  4KOR A;  5ELY A;  5J8C A;  4ZGY B;  2Q4Z A;  2PJC A;  1YVK A;  3KR4 A;  5G20 A;  2FCK A;  3R95 A;  2PVW A;  5ISV A;  4OID A;  3TT2 A;  3P2F A;  3GB0 A;  2BO9 A;  3D8P A;  3GLJ A;  3D2M A;  4GM5 A;  4GS4 A;  2AFU A;  4KUA A;  4R57 A;  1AUG A;  3B3W A;  4ZYQ A;  4UFW A;  3V38 A;  2Z3O A;  1IYK A;  4UEF A;  1ON0 A;  4CAF A;  1R57 A;  4UWJ A;  2OOT A;  5CPA A;  4MFP A;  3EC4 A;  3SJG A;  3EXN A;  3JTK A;  2QVP A;  4QVT A;  4CAE A;  3VAR A;  1LAP A;  3BI0 A;  3H8G A;  5CNP A;  4ZX8 A;  4P44 A;  4C7I A;  1S5K A;  2ZEH A;  3TTH A;  2R1I A;  2PDO A;  5H84 A;  2ZOF A;  2DPS A;  2I3C A;  1PU9 A;  5F47 A;  2VEZ A;  3IU1 A;  4UF4 A;  2XEF A;  4FAI A;  4TNU A;  3ZJ0 A;  2B4D B;  3NA6 A;  1N71 A;  1OBR A;  1HDQ A;  2O28 A;  1EE3 P;  1P4N A;  4E0A A;  1BOB A;  3DNS A;  2FSR A;  1M4I A;  1S3Z A;  3G3S A;  4CYO A;  2VBQ A;  4OC3 A;  2BUE A;  1BO4 A;  3I3G A;  4MHY A;  4MBU A;  2XEG A;  1NSL A;  1R3N A;  2FS5 A;  3MGD A;  3QNV A;  3RAM A;  4KOU A;  4NJR A;  4HNY B;  2PJ7 A;  3S9N A;  2XEJ A;  2PC1 A;  3TX8 A;  2HUZ A;  4M3S A;  4OME A;  2ZEG A;  4FWU A;  1ZO0 A;  1HEE A;  4A94 A;  4R3K A;  4C68 A;  2FIW A;  2OR4 A;  3F5B A;  5J1Q A;  2GLF A;  4UFV A;  2Z0Z A;  3JVN A;  4A39 A;  2Q7B A;  4ZY2 A;  3S6K A;  4NGT A;  4IK2 A;  4P10 A;  1ELM P;  2ZW4 A;  5HVF A;  1YW6 A;  4TWE A;  3BI1 A;  3FED A;  3FEC A;  1KWM A;  3G8W A;  5EC4 A;  5H86 A;  2PIZ A;  3HUV A;  1YME A;  3CPX A;  4KOW A;  4P4J A;  3SXO A;  3S9L A;  2AFZ A;  1R43 A;  2CIJ A;  4KUB A;  3FXT A;  3TCV A;  4KOS A;  3TO7 A;  1CM0 A;  3ZZI A;  1CJW A;  1B87 A;  2QEC A;  3CXQ A;  1Q2D A;  1UFH A;  3A9L A;  1XOV A;  1X12 A;  2V8D A;  4CGL A;  4EVY A;  2J8N A;  4NCZ A;  3R9G A;  4UWI A;  3B35 A;  4NSQ A;  5K8N A;  1XJO A;  1TKJ A;  1VIX A;  2G3A A;  3FNC A;  2CTC A;  3MRU A;  2G0B A;  3PRT A;  3DDD A;  5JH9 A;  3SXN A;  2EK9 A;  3S9M A;  3D67 A;  2RFH A;  3K9T A;  2YND A;  2PCU A;  3BJ7 A;  4AXV A;  3PB4 X;  4CYQ A;  4OC0 A;  1IYL A;  2PRQ A;  3GUX A;  3PFO A;  2Q44 A;  2YNC A;  3DGV A;  4CAV A;  4OC2 A;  1Z8X A;  5HH1 A;  4B5O A;  2P6G A;  2QML A;  1HDU A;  4H6Z A;  4KOY A;  4KOX A;  4ONU A;  1YVO A;  4P4B A;  5I4M A;  4AVC A;  2RC4 A;  3FH4 A;  4UBR A;  2ZEE A;  2JBK A;  3LOD A;  5C88 A;  4IF5 A;  4R8F A;  5EBV A;  5IX3 A;  4KLW A;  3IFE A;  4JD6 A;  4XNH C;  2AFW A;  3I1U A;  3BXM A;  4KZT A;  4ORF A;  3SJF A;  4M6G A;  1Z4E A;  5F46 A;  1TXR A;  2BSW A;  4PV6 A;  4C2Y A;  1MJ9 A;  3OWC A;  2PJ2 A;  4LX9 A;  4WWV A;  4PXD A;  4MJ8 A;  4R76 A;  1KUY A;  1SQH A;  4P4E A;  3PFE A;  4MHZ A;  3VH9 A;  1M4L A;  1YGH A;  4C2X A;  4AVA A;  2PJA A;  1QSO A;  1B6B A;  2OZG A;  4OAD A;  3CXS A;  3PB6 X;  3FBU A;  4Z65 A;  4MFJ A;  2AFO A;  4MCQ A;  1TIQ A;  4A30 A;  4P6Y A;  1FNO A;  3NH5 A;  2Q04 A;  3FYN A;  1K4J A;  1WWZ A;  1Y0Y A;  2B3V A;  1ZLH A;  2AFS A;  2CNS A;  5LYI A;  3C26 A;  2JEV A;  1KUX A;  1FT7 A;  3KZW A;  2PR1 A;  2PJ8 A;  2GAN A;  2YNE A;  4MCR A;  1XEB A;  2FXF A;  2GE3 A;  2PJ4 A;  2HB6 A;  2YGW A;  3PB8 X;  3RBU A;  3PGP A;  3RNZ A;  3JUW A;  1FY7 A;  3W91 A;  4RN7 A;  3QAY A;  1I21 A;  1Y0R A;  4H89 A;  3V7Z A;  5KTD A;  1PUA A;  3KKW A;  1Z8L A;  5C82 A;  3VAT A;  4M85 A;  3CPA A;  4A32 A;  4B12 A;  2CNM A;  1I12 A;  4JJX A;  1P0H A;  4UFX A;  2EVN A;  2DXQ A;  1IID A;  4XPD C;  3NFZ A;  3D3S A;  2WUU A;  2IL4 A;  1TF9 A;  1JWQ A;  4A37 A;  2EUI A;  3R96 A;  3K9U A;  5A27 A;  2R8V A;  2XEI A;  3KAS A;  4NEX A;  2VI7 A;  1V0C A;  1M1D A;  1ZG9 A;  3KHX A;  3KL9 A;  5AG4 A;  1DTD A;  1CX8 A;  2PJB A;  4O23 A;  4KVO E;  1QSN A;  3NE8 A;  2PJ9 A;  3RO0 A;  2PE3 A;  3EY5 A;  2AJ6 A;  4GXH A;  4FD4 A;  4IUS A;  4F8Z A;  1S7K A;  1ZG7 A;  1IB1 E;  3WC7 A;  1LCP A;  1RO5 A;  4MY3 A;  3TO6 A;  4DYO A;  1QST A;  1LOK A;  3T90 A;  4PSX A;  5F48 A;  1F57 A;  2B4B A;  3FJU A;  4FD5 A;  3P2H A;  4CAX A;  2ZEP A;  2ZED A;  5K8O A;  3TE4 A;  4PXB A;  4JLY A;  3NE7 A;  2DPT A;  3D66 A;  4PPZ A;  4B6Z A;  3R9F A;  4R9M A;  5AG7 A;  2POK A;  3H8E A;  2PJ3 A;  3FF3 A;  3B3T A;  4CRZ B;  1Y9W A;  2PRB A;  4MHN A;  1Z8T A;  2O4H A;  4MCS A;  4CPA A;  1ARL A;  2FT0 A;  1S7F A;  2WPX A;  5CBM A;  4RS2 A;  4A2Z A;  4QUS A;  5F49 A;  3W6X A;  2P0W A;  1CPX A;  2EK8 A;  3GIU A;  3WAB A;  1AYE A;  4KOV A;  3WC6 A;  2NMT A;  5JQ4 A;  4U9Y A;  2BOA A;  1Z4R A;  4JYW A;  3PB7 X;  3FEE A;  4UIA A;  1VHS A;  4PXC A;  2P6E A;  2C6P A;  2Z10 A;  3WT4 A;  1LRZ A;  1VHE A;  2GU2 A;  2ZW7 A;  3ISX A;  1BLL E;  4PXE A;  2GIV A;  4KS9 A;  3WC5 A;  1M4G A;  5AG5 A;  1OZP A;  1XIX A;  4L8A A;  4MI4 A;  4LQG A;  3FVL A;  4BBH A;  4ZI6 A;  2B58 A;  4JWP A;  3SI2 A;  4R3L A;  1LAM A;  2J8R A;  4G1P A;  3LAC A;  3DLJ A;  3B7I A;  2WSA A;  2H5M A;  3TO9 A;  5G21 A;  1NSA A;  1M44 A;  2RB7 A;  3H4Q A;  4JXQ A;  4K30 A;  4L89 A;  4EME A;  5I0C A;  4MFK A;  5FVJ A;  4CYN A;  5JGF A;  3V8I A;  1IOI A;  2CXA A;  5IV0 A;  3EO4 A;  3FIX A;  5DWN A;  1CP6 A;  2Z3P A;  2BCO A;  1MK4 A;  3B3V A;  3MN8 A;  4OP4 A;  4UIB A;  4XPL A;  3IJ3 A;  2Q4Y A;  1Y7E A;  2DF5 A;  1GYT A;  2REE A;  1DE4 C;  4OC1 A;  2ANP A;  1BPN A;  3I9S A;  2OH1 A;  4EFD A;  4HPS A;  2I00 A;  3PBE A;  4UEZ A;  2P6F A;  3IEH A;  4B10 A;  4MFL A;  4R7M A;  1QQ9 A;  3IC1 A;  1ZLI A;  4H6U A;  1IGB A;  2EO8 A;  4OAE A;  1UWY A;  5EMI A;  4F6A A;  4CYP A;  2QIR A;  2WZN A;  1CBX A;  4F9U A;  5BWA B;  4MCP A;  2BL1 A;  2VQY A;  5F09 A;  2PSW A;  4RI1 A;  3KQX A;  1YSJ A;  2CTB A;  4FD6 A;  4QB9 A;  4OLL A;  4W9Y A;  5KTC A;  4CGO A;  4P4F A;  2VL1 A;  4CGN A;  4A33 A;  4PSW A;  4X2T A;  3PEI A;  4HKF A;  1MJA A;  1VKC A;  2WYR A;  1RTQ A;  3IIB A;  3JRU A;  4B11 A;  2Q7S A;  4HNX B;  2VZZ A;  2K5T A;  2GRE A;  4CGP A;  3D68 A;  2Z3N A; 
#chains in the Genus database with same CATH homology
 3N7Z A;  4C2Z A;  3F0A A;  2CY2 A;  2KCW A;  1YLE A;  2VZY A;  4AG9 A;  2ZPA A;  2REF A;  2R98 A;  2VXK A;  4HNW B;  5AGE A;  1S7L A;  1S7N A;  4JXR A;  4MY0 A;  3TFY A;  5JPH A;  5HMN A;  4XPK A;  2OZU A;  5AG6 A;  1Q2Y A;  3QAH A;  3F8K A;  1Y9K A;  4AG7 A;  2CNT A;  5DWM A;  1S60 A;  2Q0Y A;  2ZW6 A;  2JDC A;  3W6S A;  1I1D A;  3GYA A;  2I79 A;  3IGR A;  3LD2 A;  2WPW A;  2ZW5 A;  2Z3K A;  4NF1 A;  4A31 A;  4B5P B;  3R9E A;  3PP9 A;  1Y7R A;  4YGO A;  2FL4 A;  4E2A A;  4CGM A;  4UCM A;  2Z11 A;  1Q2C A;  4CRY B;  2HV2 A;  3FB3 A;  2Z3L A;  4YFJ A;  3UY5 A;  2B5G A;  4KVX A;  4B14 A;  4FD7 A;  1YK3 A;  4Q36 A;  2Y0M A;  4MFQ A;  3TOB A;  4U9Z A;  4DNC A;  3FRM A;  2C27 A;  4AVB A;  4F0Y A;  4C7H A;  2BEI A;  2JDD A;  3IU2 A;  3R1K A;  4YRH A;  3B8G A;  3IWE A;  5G1Z A;  4MFZ A;  5G22 A;  4I49 A;  2ARH A;  2B4D A;  4MHD A;  3TOA A;  4A95 A;  4KOT A;  1Z9U A;  2G3T A;  4KSA A;  4UCN A;  4ZBG A;  1L0C A;  3WR7 A;  2OZH A;  4J3G A;  3DR8 A;  3BJ8 A;  2OB0 A;  4U5Y A;  3QB8 A;  4PK2 A;  4F0X A;  4UA3 A;  5IB0 A;  3DSB A;  1XE4 A;  2ATR A;  5J8F A;  3VWD A;  1XMT A;  4Y49 C;  5GCN A;  3T9Y A;  3CXP A;  2FIA A;  1NMT A;  2J8M A;  1MJB A;  4II9 A;  1YR0 A;  3PZJ A;  4B13 A;  1XF8 A;  4BMH A;  2R7H A;  5KTA A;  2F5I A;  4XPD B;  2B5G B;  3GY9 A;  4CAW A;  4PK3 A;  5A28 A;  4XNH B;  2B3U A;  1IIC A;  2Z3M A;  2PR8 A;  4UCP A;  4AB7 A;  4Y49 B;  2YNC C;  1WK4 A;  3BLN A;  3IWG A;  3D2P A;  4KLV A;  2HQY A;  3S6G A;  2FE7 A;  3VWE A;  5E96 A;  4LUA A;  1U6M A;  1GHE A;  2AE6 A;  1QSR A;  3H5Z A;  4KVM E;  2D4O A;  2Q4V A;  2D4P A;  1KZF A;  3GKR A;  1NE9 A;  3EFA A;  4QC6 A;  1YX0 A;  4QBJ A;  3DR6 A;  4CS0 B;  3S6H A;  1YRE A;  2ZXV A;  4KSF A;  4Q38 A;  1J4J A;  4B5P A;  4NXY A;  4R87 A;  1QSM A;  3RYO A;  1KUV A;  3SHP A;  3E0K A;  2OU2 A;  1M4D A;  4E8O A;  3S6F A;  2JLM A;  4X5K A;  1RXT A;  2X7B A;  2A4N A;  2PQ8 A;  4KOR A;  5J8C A;  4ZGY B;  1YVK A;  5G20 A;  2FCK A;  3R95 A;  5ISV A;  3TT2 A;  3P2F A;  3D8P A;  4GS4 A;  3D2M A;  4KUA A;  4R57 A;  4UFW A;  2Z3O A;  1IYK A;  1ON0 A;  4CAF A;  1R57 A;  4UWJ A;  4MFP A;  3EC4 A;  3EXN A;  3JTK A;  4QVT A;  4CAE A;  5CNP A;  4C7I A;  1S5K A;  3TTH A;  2R1I A;  2PDO A;  5H84 A;  2DPS A;  1PU9 A;  5F47 A;  2VEZ A;  3IU1 A;  3ZJ0 A;  2B4D B;  1N71 A;  2O28 A;  1P4N A;  4E0A A;  1BOB A;  3DNS A;  2FSR A;  1M4I A;  1S3Z A;  3G3S A;  4CYO A;  2VBQ A;  2BUE A;  1BO4 A;  3I3G A;  1NSL A;  4MBU A;  2FS5 A;  3MGD A;  4KOU A;  4HNY B;  2PC1 A;  2HUZ A;  4M3S A;  1ZO0 A;  4R3K A;  4C68 A;  2FIW A;  3F5B A;  4UFV A;  2Z0Z A;  3JVN A;  2Q7B A;  3S6K A;  2ZW4 A;  3G8W A;  5EC4 A;  5H86 A;  4KOW A;  3SXO A;  4KUB A;  3FXT A;  3TCV A;  4KOS A;  3TO7 A;  1CM0 A;  3ZZI A;  1CJW A;  1B87 A;  2QEC A;  3CXQ A;  1Q2D A;  1UFH A;  3A9L A;  4CGL A;  4EVY A;  2J8N A;  4NCZ A;  3R9G A;  4UWI A;  4NSQ A;  2G3A A;  3FNC A;  2G0B A;  3DDD A;  3SXN A;  2YND A;  3BJ7 A;  4CYQ A;  1IYL A;  2Q44 A;  2YNC A;  4CAV A;  4B5O A;  5HH1 A;  2P6G A;  2QML A;  4KOX A;  4H6Z A;  4KOY A;  4ONU A;  1YVO A;  4AVC A;  2RC4 A;  4UBR A;  3LOD A;  5C88 A;  4IF5 A;  5IX3 A;  5EBV A;  4KLW A;  4XNH C;  4JD6 A;  5F46 A;  4KZT A;  4ORF A;  1Z4E A;  2BSW A;  4PV6 A;  4C2Y A;  1MJ9 A;  3OWC A;  4LX9 A;  4MJ8 A;  1KUY A;  1SQH A;  4C2X A;  1YGH A;  4AVA A;  1QSO A;  1B6B A;  2OZG A;  4OAD A;  3CXS A;  3FBU A;  4MFJ A;  1TIQ A;  4A30 A;  2Q04 A;  3FYN A;  1K4J A;  1WWZ A;  2B3V A;  2CNS A;  3C26 A;  2JEV A;  1KUX A;  2PR1 A;  2YNE A;  2GAN A;  1XEB A;  2FXF A;  2GE3 A;  2YGW A;  3PGP A;  3JUW A;  1FY7 A;  3W91 A;  1I21 A;  4H89 A;  5KTD A;  1PUA A;  3KKW A;  5C82 A;  4M85 A;  4A32 A;  4B12 A;  2CNM A;  1I12 A;  4JJX A;  1P0H A;  4UFX A;  2EVN A;  2DXQ A;  1IID A;  4XPD C;  3D3S A;  2WUU A;  2IL4 A;  2EUI A;  3R96 A;  3K9U A;  5A27 A;  2R8V A;  4NEX A;  2VI7 A;  1V0C A;  1M1D A;  5AG4 A;  4KVO E;  1QSN A;  3EY5 A;  2AJ6 A;  4IUS A;  4FD4 A;  1S7K A;  1IB1 E;  1RO5 A;  4MY3 A;  3TO6 A;  1QST A;  3T90 A;  4PSX A;  5F48 A;  2B4B A;  4FD5 A;  3P2H A;  4CAX A;  3TE4 A;  4JLY A;  3NE7 A;  2DPT A;  3R9F A;  4R9M A;  5AG7 A;  4CRZ B;  1Y9W A;  2PRB A;  2FT0 A;  1S7F A;  2WPX A;  4RS2 A;  4A2Z A;  4QUS A;  5F49 A;  3W6X A;  2P0W A;  4KOV A;  2NMT A;  5JQ4 A;  4U9Y A;  1Z4R A;  1VHS A;  2P6E A;  2Z10 A;  1LRZ A;  2ZW7 A;  2GIV A;  4KS9 A;  1M4G A;  5AG5 A;  1OZP A;  1XIX A;  4L8A A;  4MI4 A;  4BBH A;  2B58 A;  4JWP A;  4R3L A;  2J8R A;  2WSA A;  2H5M A;  3TO9 A;  5G21 A;  1M44 A;  3H4Q A;  4JXQ A;  4K30 A;  4L89 A;  5I0C A;  4MFK A;  5FVJ A;  4CYN A;  3V8I A;  2CXA A;  5IV0 A;  3EO4 A;  3FIX A;  5DWN A;  2Z3P A;  4XPL A;  1MK4 A;  2Q4Y A;  2REE A;  3I9S A;  2OH1 A;  2I00 A;  2P6F A;  4B10 A;  4MFL A;  4H6U A;  4OAE A;  4F6A A;  4CYP A;  2QIR A;  5BWA B;  2BL1 A;  2VQY A;  2PSW A;  4RI1 A;  4QB9 A;  5KTC A;  4FD6 A;  4OLL A;  4CGO A;  4CGN A;  4A33 A;  4PSW A;  4HKF A;  1MJA A;  1VKC A;  4B11 A;  4HNX B;  2VZZ A;  2K5T A;  4CGP A;  2Z3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...