1QSOA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
NITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsoA00
4KLVA 1B6BA 2Q7BA 4OADA 4PSXA 1SQHA 2Z11A 3DNSA 1KUVA 1Z9UA 1YVOA 1IYLA 5I0CA 2FT0A 2FCKA 1S5KA 5DWNA 4X5KA 2QIRA 4L8AA 3SXNA 2PC1A 3FNCA 3TOBA 5C82A 2FE7A 2BSWA 2J8MA 4KOYA 4Y49C 2HQYA 3D2MA 1V0CA 4DNCA 1J4JA 1PUAA 4B5PB 1XF8A 3T90A 5HMNA 4UBRA 2VZZA 4CAXA 1NMTA 3FBUA 2B58A 5F49A 2IL4A 1PU9A 2Q04A 1Z4RA 4L89A 4PK2A 2H5MA 4H6UA 3F8KA 3V8IA 5H86A 5JPHA 1YX0A 4MHDA 4MJ8A 2P6GA 3N7ZA 4CS0B 4KVXA 1LRZA 5IB0A 4XNHB 2AE6A 1YVKA 4KVOE 4R9MA 4JXRA 3TO9A 4F0YA 3CXSA 1MJ9A 4PK3A 1S60A 5CNPA 1M1DA 1S7LA 5FVJA 2G3AA 4MBUA 2BUEA 3TT2A 2Q4VA 1M4DA 1MJAA 2P0WA 2CNMA 1QSTA 1Q2DA 3TTHA 1Y7RA 1RXTA 3IWGA 4NSQA 3PZJA 2F5IA 1KUYA 1Y9WA 5E96A 4OLLA 3CXPA 1BOBA 1NE9A 3EY5A 4JXQA 1M4IA 2ZPAA 4YFJA 3R96A 3P2HA 2RC4A 3R1KA 1TIQA 3R9FA 1IICA 1YR0A 1IIDA 2X7BA 5EC4A 2KCWA 2B4DA 2B4BA 3DR6A 4HNWB 3LODA 2R98A 4JWPA 3ZJ0A 1WWZA 3EC4A 1M44A 5H84A 2FS5A 4AG9A 3GY9A 3W6XA 3I3GA 1S7FA 2G0BA 3FB3A 1B87A 2P6FA 4OAEA 4QB9A 2Q0YA 2AJ6A 4LUAA 1XE4A 4FD4A 3B8GA 3I9SA 1XMTA 4B5PA 4R87A 2CNSA 4FD7A 4XPLA 2FL4A 3TCVA 2B5GA 4MY0A 3QB8A 4NEXA 2J8RA 4CRYB 3BJ8A 3R9GA 2VQYA 4ONUA 4Y49B 1YK3A 4BMHA 4IF5A 4F6AA 4KVME 3EO4A 3G8WA 3KKWA 2REEA 2PR8A 3S6FA 4II9A 3R95A 3LD2A 4QUSA 3G3SA 4E8OA 4KZTA 2ZW6A 1NSLA 2FIWA 3EXNA 2K5TA 3CXQA 3S6KA 3FYNA 2CY2A 2OZHA 2HUZA 3FIXA 5C88A 4JD6A 4E2AA 2Z0ZA 1ON0A 1CM0A 1P4NA 2ZW7A 1XIXA 4KLWA 3VWDA 4CAWA 3DSBA 1IB1E 1Q2CA 1CJWA 2PDOA 3JUWA 4QC6A 4J3GA 1N71A 4E0AA 4M85A 4UA3A 2ZXVA 1YREA 3OWCA 2D4OA 4FD6A 5DWMA 4AVAA 4EVYA 2GIVA 1MJBA 3R9EA 1L0CA 4ZBGA 2ARHA 5F48A 4IUSA 3S6GA 2JDCA 1YGHA 4AG7A 1YLEA 4XPDB 1QSRA 4UWIA 4FD5A 3TE4A 4JLYA 4MI4A 1M4GA 3SXOA 4AVCA 1IYKA 3T9YA 1FY7A 2WPWA 1VHSA 2PSWA 2VBQA 2NMTA 1MK4A 3F0AA 2P6EA 4U9ZA 5ISVA 5EBVA 3IGRA 2FSRA 1Y9KA 2OH1A 2QECA 4R57A 3GYAA 1K4JA 2PQ8A 2B4DB 3E0KA 4KOSA 2R7HA 2Q4YA 1GHEA 1QSNA 3PGPA 3FRMA 2VZYA 4GS4A 1S7NA 4K30A 2I00A 3NE7A 3QAHA 1R57A 3MGDA 4AB7A 1U6MA 2ZW5A 3JVNA 5GCNA 1XEBA 4JJXA 2EUIA 4YRHA 4KOVA 5F46A 1S7KA 4QVTA 2OZUA 4KOUA 3DDDA 5JQ4A 2I79A 4NCZA 2ATRA 2GE3A 2Y0MA 3FXTA 3D8PA 4NF1A 4NXYA 1I12A 4U5YA 5HH1A 2PRBA 2B5GB 5KTCA 4KOTA 4XNHC 2CNTA 3TOAA 1I1DA 3S6HA 5KTDA 3RYOA 3K9UA 1UFHA 2HV2A 2R1IA 2BL1A 1VKCA 2BEIA 2EVNA 3ZZIA 2B3UA 4HNYB 3UY5A 5F47A 3H4QA 5J8FA 4PV6A 3C26A 3W6SA 4M3SA 2A4NA 4I49A 4KOXA 3SHPA 4CAVA 3EFAA 1BO4A 5IV0A 4XPKA 2Z10A 1I21A 2OB0A 3BJ7A 2REFA 2R8VA 2ZW4A 4H89A 4KORA 1QSOA 2DXQA 4KUBA 1KUXA 4ORFA 4AVBA 2VXKA 3TFYA 1WK4A 4CRZB 5J8CA 1Z4EA 2JEVA 2VI7A 2GANA 3BLNA 3P2FA 4KOWA 4HKFA 4UWJA 1OZPA 4XPDC 4YGOA 3PP9A 3TO6A 2PR1A 2JLMA 1S3ZA 2G3TA 2J8NA 4HNXB 4H6ZA 4KUAA 2FIAA 2O28A 3W91A 3D3SA 2WPXA 1RO5A 4MY3A 3WR7A 2OU2A 1P0HA 1QSMA 3DR8A 4PSWA 4R3KA 2VEZA 3F5BA 3D2PA 5IX3A 2B3VA 4RI1A 2C27A 3GKRA 3VWEA 4RS2A 1KZFA 4QBJA 2D4PA 2OZGA 3TO7A 2QMLA 4U9YA 5KTAA 2Q44A 4R3LA 1Q2YA 2JDDA 2FXFA 4B5OA 4LX9A
chains in the Genus database with same CATH superfamily
4KLVA 1TXRA 4C2YA 1B6BA 3IWWA 2Q7BA 2QVPA 4OADA 4PSXA 1XMBA 4UEFA 1SQHA 2Z11A 3DNSA 4GM5A 1LOKA 4DYOA 1KUVA 1Z9UA 1YVOA 1IYLA 1RTQA 5HVGA 5I0CA 2FT0A 2FCKA 2ZOGA 1S5KA 4P4BA 5DWNA 1F57A 4X5KA 2QIRA 4L8AA 3SXNA 2YGWA 4G1PA 3LWUA 2PC1A 3FNCA 4PXCA 3QAYA 2IJZA 3TOBA 3KHXA 5C82A 3RNZA 2FE7A 1LCPA 1PCAA 4KSIA 2BSWA 4IAVA 4CGNA 1CPXA 3BI0A 2J8MA 5JM6A 4KOYA 4Y49C 4IHMA 2HQYA 3D2MA 4C2ZA 1V0CA 4DNCA 1J4JA 1PUAA 4B5PB 4R76A 1XF8A 3D67A 3T90A 3FVLA 5HMNA 2PJ9A 2Z3NA 4JYWA 3CT9A 4UBRA 2VZZA 4CAXA 1NMTA 1TF8A 2B58A 3FBUA 5F49A 5LRGA 2IL4A 1XJOA 1PU9A 1Y7EA 3KI9A 2Q04A 3KASA 4PQAA 4P10A 1Z4RA 2HC9A 1ELLP 2ANPA 2F8HA 4NGRA 2WZNA 2ZEHA 4L89A 5AG6A 2C6PA 4PK2A 2H5MA 1TKHA 4H6UA 3F8KA 3V8IA 5H86A 2YNDA 5JPHA 4PPZA 1YX0A 4MHDA 4F9UA 4MJ8A 2P6GA 2POKA 3N7ZA 4CS0B 2J9AA 1OBRA 4MFQA 3NH5A 4KVXA 3TC8A 1LRZA 4CGLA 5IB0A 1Y0YA 4B6ZA 4XNHB 4KSFA 1FT7A 2AE6A 2DPSA 3B3TA 3WT4A 1YVKA 4KVOE 4EWTA 4R9MA 4JXRA 1IGBA 2Z3LA 3TO9A 2Q4ZA 4RUHA 4OC1A 4UCNA 4F0YA 3CXSA 5K8OA 5A28A 3N5FA 1MJ9A 4PK3A 1AMPA 1S60A 3CZXA 3H8EA 4Q7AA 4AXVA 3VH9A 4B12A 4EFDA 5CNPA 3B2YA 1M1DA 1S7LA 5FVJA 2AFWA 4FUUA 4ZY1A 2G3AA 3HUVA 4CGOA 5AG4A 2Z3KA 4MBUA 2BUEA 4A30A 4ONWA 3TT2A 2Q4VA 3FJUA 2BCOA 4C2XA 1M4DA 2PJBA 2Q7SA 3I1UA 3PB8X 1BAVA 1MJAA 4DJLA 3CDXA 2P0WA 1BPMA 2CNMA 5K8NA 3FECA 3TX8A 4CYQA 4JZ0A 1JWQA 1QSTA 1Q2DA 2CTBA 2PJ0A 5JH9A 2EK9A 3TTHA 1Y7RA 1RXTA 3IJ3A 3B3CA 3IWGA 4CYNA 4NSQA 3PZJA 4FAIA 1PYTB 4A37A 2F5IA 3D66A 1KUYA 3S9LA 4OC5A 1ARMA 3RZAA 2GFQA 5ELYA 4KS9A 4UIAA 4ZY2A 1Y9WA 4ZGYB 2JBKA 4UF4A 5AG7A 5E96A 4OLLA 3CXPA 2ZOFA 5J1QA 1BOBA 1NE9A 1CP6A 3EY5A 4JXQA 6CPAA 1M4IA 4P4EA 3L2NA 2ZPAA 3SJFA 4YFJA 2PJAA 1A2ZA 2JBJA 3R96A 2ZEGA 4M6HA 3K2KA 3CPAA 3QNVA 4A95A 3P2HA 2OOTA 3DGVA 4WWVA 2RC4A 3R1KA 1TIQA 3IU1A 1YW6A 3IWEA 3JRUA 4UFVA 2AFUA 2DEAA 3FEDA 3H8FA 3R9FA 4A33A 1YW4A 3B3SA 3NH4A 2WUUA 4MFKA 1IICA 1ZLIA 1YR0A 3D7DA 1IIDA 1VHOA 1Z2LA 2KCWA 2B4DA 2B4BA 2ODFA 2X7BA 2AFOA 3KQXA 4HPSA 2BOAA 3DR6A 2PJCA 4HNWB 3LODA 3PRTA 3WC6A 2DF5A 2R98A 4JWPA 4LQGA 4CGMA 1M4LA 2PRQA 3ZJ0A 4YU9A 3KL9A 1WWZA 3EC4A 1M44A 3IC1A 4NGTA 4A31A 2PVVA 5G20A 4X2TA 1Z8TA 1F2PA 1VGYA 5H84A 4BINA 2FS5A 4P4IA 4A38A 4ZX9A 2Q51A 4AG9A 4BD9A 3GY9A 4R8FA 3B3VA 3RBUA 4NJRA 3W6XA 2QYVA 3I3GA 4A94A 1S7FA 4CAFA 2IMOA 3PFEA 2O53A 2G0BA 2NYQA 3JTKA 2AFXA 3FB3A 4MCPA 4Q38A 5EMIA 1B87A 2P6FA 4OAEA 5G22A 4QB9A 3IO1A 2Q0YA 2AJ6A 4LUAA 1XE4A 4FD4A 3B8GA 3I9SA 1GYTA 1XMTA 4P4JA 4B5PA 4CYPA 1IOIA 1JQGA 2GLFA 3KGQA 4R87A 2CNSA 2Z3PA 4FD7A 4XPLA 5CPAA 2FL4A 3TCVA 3WABA 3IFEA 4X3RA 2B5GA 4MY0A 2PJ3A 3RO0A 3QB8A 4B11A 4NEXA 2V8DA 2J8RA 3HLPA 1AYEA 1DTDA 1UWYA 3BJ8A 2VQYA 4ONUA 4Y49B 1YK3A 3ISZA 3R9GA 4BMHA 1XRYA 4MHYA 4IF5A 3PEIA 2V8HA 4F6AA 1EE3P 4X8IA 4DUKA 4KVME 5HVHA 3EO4A 3G8WA 3KKWA 5LYFA 2YNEA 2REEA 3FH4A 4TNUA 2AFZA 2PR8A 4MHZA 4UIBA 4TWEA 5D29A 3S6FA 4LQ6A 3R95A 4II9A 3MN8A 4MCRA 3LD2A 1X12A 4QUSA 3G3SA 5HXDA 3PFOA 4E8OA 4KZTA 3V38A 2ZW6A 1AUGA 1NSLA 2FIWA 3NH8A 3EXNA 2C6GA 4M6GA 4CAEA 2K5TA 1VHEA 3CXQA 3S6KA 2PIZA 1F2OA 5EC4A 1KWMA 3FYNA 2HB6A 2ZEDA 2OZHA 1TKJA 2AFMA 1R3NA 2CY2A 3KHZA 4C7IA 1X10A 2HUZA 2CXAA 3FIXA 5C88A 4JD6A 4GXHA 4E2AA 4UCMA 2Z0ZA 3KZWA 3ISXA 4B14A 2ZENA 3PB7X 4RN7A 4C68A 2V8GA 1ON0A 1CM0A 1P4NA 1CBXA 4OP4A 2ZW7A 1XIXA 3IU2A 4UFXA 4KLWA 4R6TA 1XFOA 3VWDA 4CAWA 3DSBA 4NGNA 4CPAA 1IB1E 1ZG7A 2JEWA 1Z8LA 1Q2CA 1CJWA 2PDOA 3JUWA 4QC6A 4J3GA 1N71A 5K8MA 4E0AA 3B7IA 4W9YA 4M85A 3D7HA 3NFZA 4UA3A 2ZXVA 2PJ7A 1YREA 3OWCA 3GLJA 2D4OA 4FD6A 4OKOA 5DWMA 4MFJA 2PJ8A 4MHNA 4AVAA 4EVYA 2GIVA 1LAMA 5AGEA 1MJBA 4P4FA 3R9EA 1L0CA 1XBUA 4MRIA 2ARHA 4ZBGA 5F48A 1HDQA 2XEGA 4IUSA 1ARLA 4F0XA 3DLJA 4A32A 1Z5RA 3S6GA 2JDCA 1LAPA 1YGHA 4AG7A 1YLEA 4XPDB 1QSRA 2ABZA 1CX8A 4UWIA 2YNCC 2C1CA 1TKFA 4FD5A 3PBBA 2IQ6A 4NGSA 3TE4A 2GU2A 1ZG9A 2YNCA 4JLYA 1CPSA 1Z8WA 4MXUA 4MI4A 4OC0A 1CP7A 1M4GA 1LFWA 2ZELA 2GREA 1BPNA 5LYLA 1TF9A 3SXOA 4AVCA 1IYKA 3T9YA 1FY7A 4M6IA 2ZEFA 2WPWA 1VHSA 2PSWA 2VBQA 2PJ1A 2GLJA 2NMTA 3SJGA 1MK4A 2XEJA 2WYRA 4IK2A 5JGFA 3PB4X 3F0AA 4NGMA 3WC5A 2P6EA 4U9ZA 2OR4A 5ISVA 5EBVA 3IGRA 2FSRA 1Y9KA 3D68A 4FBEA 2Z3OA 1ZLHA 2EWBA 3FF3A 4Q36A 2OH1A 2QECA 4R57A 3GYAA 3CPXA 1K4JA 2PQ8A 1HEEA 2B4DB 2G9DA 4P6YA 3E0KA 4KOSA 1FNOA 2R7HA 2Q4YA 3MRUA 1GHEA 1QSNA 3PGPA 1QQ9A 3FRMA 2VZYA 4GS4A 4NGQA 5LYIA 1S7NA 4K30A 4ZY0A 5AG5A 2I00A 3D7FA 4UCPA 4A39A 3NE7A 3QAHA 3SJXA 2PJ6A 4OIWA 1R57A 3FMCA 3MGDA 4AB7A 1IOFA 7CPAA 2FVGA 1U6MA 2ZW5A 2ZEMA 3GIUA 4P44A 2PJ2A 3JVNA 3KQZA 4O23A 8CPAA 5K8PA 2DPTA 5GCNA 1XEBA 4JJXA 2EUIA 4OIDA 1YQEA 4YRHA 3A9LA 4KOVA 4OC2A 5F46A 3SI1A 1S7KA 2CF4A 1LANA 4QVTA 2OZUA 4UEEA 4KOUA 4Z65A 5HVFA 3WC7A 5IB9A 3DDDA 2ZEEA 2BO9A 4B10A 2V8VA 3SI2A 2I79A 4NCZA 5JQ4A 2ATRA 3NA6A 2GE3A 2Y0MA 2PE3A 3FXTA 4YWYA 3SJEA 3K9TA 3D8PA 4NF1A 4NXYA 1I12A 4U5YA 4OC4A 5HH1A 5BWAB 2PRBA 3BI1A 4CRYB 2B5GB 5KTCA 5D8NA 3IEHA 4KOTA 4PXDA 1Y0RA 4XNHC 2CNTA 3TOAA 2XEIA 2VL1A 1I1DA 4NFRA 1H8LA 4F8ZA 3SI0A 4C7HA 3S6HA 5KTDA 3H5ZA 3RYOA 3K9UA 1UFHA 4CYOA 2HV2A 2R1IA 3PBEA 2XEFA 5THWA 3V7ZA 2BL1A 1QMUA 1VKCA 1ZG8A 3GUXA 2BEIA 2EVNA 4NJQA 3ZZIA 2B3UA 2C6CA 1IU8A 3B3WA 3VATA 2RFHA 1IY7A 4HNYB 4ZX8A 4FWUA 3RAMA 3UY5A 5F47A 1VIXA 3H4QA 4WJBA 5J8FA 4PV6A 3FX6A 4MFLA 3C26A 2AFSA 3W6SA 3GB0A 3VARA 4MCQA 3KR4A 2V77A 2A4NA 4M3SA 4I49A 4PXBA 1ELMP 2F7VA 4KOXA 3SHPA 4P45A 4CAVA 3EFAA 4MCSA 1BO4A 5IV0A 1YMEA 2PVWA 1HDUA 4UEZA 4XPKA 2Z10A 5DS0A 4ZYQA 1I21A 2OB0A 5LRKA 3BJ7A 2REFA 2R8VA 4MMOA 2CTCA 2ZW4A 4H89A 1YLOA 1Z8XA 4KORA 3IIBA 4B13A 5G21A 1QSOA 2PCUA 2DXQA 3D7GA 4KUBA 3FEEA 2Q43A 1KUXA 2EO8A 4ORFA 5LYDA 2WSAA 4AVBA 5LRJA 2VXKA 4F9VA 1WK4A 4CRZB 5J8CA 4UFWA 3TFYA 1Z4EA 2JEVA 1YSJA 5I4MA 2VI7A 2GANA 3BLNA 4PXEA 1DE4C 3P2FA 4KOWA 5A27A 4OC3A 4P4DA 4HKFA 3H8GA 4UWJA 4A2ZA 5CBMA 2CIJA 1OZPA 4XPDC 4YGOA 3PB6X 3BHXA 4EMEA 3PP9A 1CG2A 3TO6A 2PR1A 4NGPA 2JLMA 4K3NA 3BXMA 3S9MA 1S3ZA 2G3TA 4R7MA 3LMSA 2J8NA 4HNXB 2EBJA 3KR5A 5F09A 3LACA 4H6ZA 4KUAA 2NSMA 4ZI6A 2FIAA 4KSAA 2O28A 4BBHA 3S9NA 3W91A 3D3SA 1XOVA 2WPXA 4H2KA 1RO5A 2PJ5A 3NE8A 2PJ4A 4MY3A 3WR7A 2OU2A 1P0HA 1QSMA 3DR8A 4PSWA 4R3KA 2VEZA 3F5BA 1NSAA 3D2PA 5IX3A 1Q7LA 2EK8A 2QJ8A 1ZO0A 2B3VA 2PIYA 2C27A 3GKRA 4MHPA 4OMEA 4RI1A 3T8WA 3B35A 4RS2A 3VWEA 4MFZA 1KZFA 3D4UA 2O4HA 4CGPA 2I3CA 5G1ZA 4QBJA 2RB7A 2D4PA 2OZGA 2ZEOA 3TO7A 2QMLA 2ZEPA 1BLLE 2Z3MA 4U9YA 1R43A 2Q44A 4MFPA 4R3LA 1Q2YA 5KTAA 2JDDA 2FXFA 4B5OA 3PB9X 4LX9A
chains in the Genus database with same CATH topology
4KLVA 4C2YA 1B6BA 2Q7BA 4OADA 4PSXA 1SQHA 2Z11A 3DNSA 1KUVA 1Z9UA 1YVOA 1IYLA 5I0CA 2FT0A 2FCKA 1S5KA 5DWNA 4X5KA 2QIRA 4L8AA 3SXNA 2YGWA 2PC1A 3FNCA 3TOBA 5C82A 2FE7A 2BSWA 4CGNA 2J8MA 4KOYA 4Y49C 2HQYA 3D2MA 4C2ZA 1V0CA 4DNCA 1J4JA 1PUAA 4B5PB 1XF8A 3T90A 5HMNA 2Z3NA 4UBRA 2VZZA 4CAXA 1NMTA 3FBUA 2B58A 5F49A 2IL4A 1PU9A 2Q04A 1Z4RA 4L89A 5AG6A 4PK2A 2H5MA 4H6UA 3F8KA 3V8IA 5H86A 2YNDA 5JPHA 1YX0A 4MHDA 4MJ8A 2P6GA 3N7ZA 4CS0B 4MFQA 4CGLA 4KVXA 1LRZA 5IB0A 4XNHB 4KSFA 2AE6A 2DPSA 1YVKA 4KVOE 4R9MA 4JXRA 2Z3LA 3TO9A 4UCNA 4F0YA 3CXSA 5A28A 1MJ9A 4PK3A 1S60A 4B12A 5CNPA 1M1DA 1S7LA 5FVJA 2G3AA 4CGOA 5AG4A 2Z3KA 4MBUA 2BUEA 4A30A 3TT2A 2Q4VA 4C2XA 1M4DA 1MJAA 2P0WA 2CNMA 4CYQA 1QSTA 1Q2DA 3TTHA 4CYNA 1Y7RA 1RXTA 3IWGA 4NSQA 3PZJA 2F5IA 1KUYA 4KS9A 1Y9WA 4ZGYB 5AG7A 5E96A 4OLLA 3CXPA 1BOBA 1NE9A 3EY5A 4JXQA 1M4IA 2ZPAA 4YFJA 3R96A 4A95A 3P2HA 2RC4A 3R1KA 1TIQA 3IU1A 3IWEA 4UFVA 3R9FA 4A33A 2WUUA 4MFKA 1IICA 1YR0A 1IIDA 2X7BA 5EC4A 2KCWA 2B4DA 2B4BA 3DR6A 4HNWB 3LODA 2R98A 4JWPA 4CGMA 3ZJ0A 4A31A 1WWZA 3EC4A 1M44A 5G20A 5H84A 2FS5A 4AG9A 3GY9A 3W6XA 3I3GA 1S7FA 4CAFA 4Q38A 2G0BA 3JTKA 3FB3A 1B87A 2P6FA 4OAEA 5G22A 4QB9A 2Q0YA 2AJ6A 4LUAA 1XE4A 4FD4A 3B8GA 3I9SA 1XMTA 4B5PA 4CYPA 4R87A 2CNSA 2Z3PA 4FD7A 4XPLA 2FL4A 3TCVA 2B5GA 4MY0A 3QB8A 4B11A 4NEXA 2J8RA 4CRYB 3BJ8A 3R9GA 2VQYA 4ONUA 4Y49B 1YK3A 4BMHA 4IF5A 4F6AA 4KVME 3EO4A 3G8WA 3KKWA 2YNEA 2REEA 2PR8A 3S6FA 4II9A 3R95A 3LD2A 4QUSA 3G3SA 4E8OA 4KZTA 2ZW6A 1NSLA 2FIWA 3EXNA 4CAEA 2K5TA 3CXQA 3S6KA 3FYNA 2CY2A 2OZHA 4C7IA 2HUZA 2CXAA 3FIXA 5C88A 4JD6A 4E2AA 4UCMA 2Z0ZA 4B14A 4C68A 1ON0A 1CM0A 1P4NA 2ZW7A 1XIXA 3IU2A 4UFXA 4KLWA 3VWDA 4CAWA 3DSBA 1IB1E 1Q2CA 1CJWA 2PDOA 3JUWA 4QC6A 4J3GA 1N71A 4E0AA 4M85A 4UA3A 2ZXVA 1YREA 3OWCA 2D4OA 4FD6A 5DWMA 4MFJA 4AVAA 4EVYA 2GIVA 5AGEA 1MJBA 3R9EA 1L0CA 4ZBGA 2ARHA 5F48A 4IUSA 4F0XA 4A32A 3S6GA 2JDCA 1YGHA 4AG7A 1YLEA 4XPDB 1QSRA 4UWIA 2YNCC 4FD5A 3TE4A 2YNCA 4JLYA 4MI4A 1M4GA 3SXOA 4AVCA 1IYKA 3T9YA 1FY7A 2WPWA 1VHSA 2PSWA 2VBQA 2NMTA 1MK4A 3F0AA 2P6EA 4U9ZA 5ISVA 5EBVA 3IGRA 2FSRA 1Y9KA 2Z3OA 4Q36A 2OH1A 2QECA 4R57A 3GYAA 1K4JA 2PQ8A 2B4DB 3E0KA 4KOSA 2R7HA 2Q4YA 1GHEA 1QSNA 3PGPA 3FRMA 2VZYA 4GS4A 1S7NA 4K30A 5AG5A 2I00A 4UCPA 3NE7A 3QAHA 1R57A 3MGDA 4AB7A 1U6MA 2ZW5A 3JVNA 2DPTA 5GCNA 1XEBA 4JJXA 2EUIA 4YRHA 3A9LA 4KOVA 5F46A 1S7KA 4QVTA 2OZUA 4KOUA 3DDDA 4B10A 5JQ4A 2I79A 4NCZA 2ATRA 2GE3A 2Y0MA 3FXTA 3D8PA 4NF1A 4NXYA 1I12A 4U5YA 5BWAB 5HH1A 2PRBA 2B5GB 5KTCA 4KOTA 4XNHC 2CNTA 3TOAA 1I1DA 4C7HA 3S6HA 5KTDA 3H5ZA 3RYOA 3K9UA 1UFHA 4CYOA 2HV2A 2R1IA 2BL1A 1VKCA 2BEIA 2EVNA 3ZZIA 2B3UA 4HNYB 3UY5A 5F47A 3H4QA 5J8FA 4PV6A 4MFLA 3C26A 3W6SA 4M3SA 2A4NA 4I49A 4KOXA 3SHPA 4CAVA 3EFAA 1BO4A 5IV0A 4XPKA 2Z10A 1I21A 2OB0A 3BJ7A 2REFA 2R8VA 2ZW4A 4B13A 4H89A 4KORA 5G21A 1QSOA 2DXQA 4KUBA 1KUXA 4ORFA 2WSAA 4AVBA 2VXKA 3TFYA 1WK4A 4CRZB 5J8CA 4UFWA 1Z4EA 2JEVA 2VI7A 2GANA 3BLNA 3P2FA 4KOWA 5A27A 4HKFA 4UWJA 4A2ZA 1OZPA 4XPDC 4YGOA 3PP9A 3TO6A 2PR1A 2JLMA 1S3ZA 2G3TA 2J8NA 4HNXB 4H6ZA 4KUAA 2FIAA 4KSAA 2O28A 4BBHA 3W91A 3D3SA 2WPXA 1RO5A 4MY3A 3WR7A 2OU2A 1P0HA 1QSMA 3DR8A 4PSWA 4R3KA 2VEZA 3F5BA 3D2PA 5IX3A 1ZO0A 2B3VA 4RI1A 2C27A 3GKRA 3VWEA 4RS2A 4MFZA 1KZFA 4CGPA 5G1ZA 4QBJA 2D4PA 2OZGA 3TO7A 2QMLA 4U9YA 2Z3MA 5KTAA 4MFPA 2Q44A 4R3LA 1Q2YA 2JDDA 2FXFA 4B5OA 4LX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLV A;  1B6B A;  2Q7B A;  4OAD A;  4PSX A;  1SQH A;  2Z11 A;  3DNS A;  1KUV A;  1Z9U A;  1YVO A;  1IYL A;  5I0C A;  2FT0 A;  2FCK A;  1S5K A;  5DWN A;  4X5K A;  2QIR A;  4L8A A;  3SXN A;  2PC1 A;  3FNC A;  3TOB A;  5C82 A;  2FE7 A;  2BSW A;  2J8M A;  4KOY A;  4Y49 C;  2HQY A;  3D2M A;  1V0C A;  4DNC A;  1J4J A;  1PUA A;  4B5P B;  1XF8 A;  3T90 A;  5HMN A;  4UBR A;  2VZZ A;  4CAX A;  1NMT A;  3FBU A;  2B58 A;  5F49 A;  2IL4 A;  1PU9 A;  2Q04 A;  1Z4R A;  4L89 A;  4PK2 A;  2H5M A;  4H6U A;  3F8K A;  3V8I A;  5H86 A;  5JPH A;  1YX0 A;  4MHD A;  4MJ8 A;  2P6G A;  3N7Z A;  4CS0 B;  4KVX A;  1LRZ A;  5IB0 A;  4XNH B;  2AE6 A;  1YVK A;  4KVO E;  4R9M A;  4JXR A;  3TO9 A;  4F0Y A;  3CXS A;  1MJ9 A;  4PK3 A;  1S60 A;  5CNP A;  1M1D A;  1S7L A;  5FVJ A;  2G3A A;  4MBU A;  2BUE A;  3TT2 A;  2Q4V A;  1M4D A;  1MJA A;  2P0W A;  2CNM A;  1QST A;  1Q2D A;  3TTH A;  1Y7R A;  1RXT A;  3IWG A;  4NSQ A;  3PZJ A;  2F5I A;  1KUY A;  1Y9W A;  5E96 A;  4OLL A;  3CXP A;  1BOB A;  1NE9 A;  3EY5 A;  4JXQ A;  1M4I A;  2ZPA A;  4YFJ A;  3R96 A;  3P2H A;  2RC4 A;  3R1K A;  1TIQ A;  3R9F A;  1IIC A;  1YR0 A;  1IID A;  2X7B A;  5EC4 A;  2KCW A;  2B4D A;  2B4B A;  3DR6 A;  4HNW B;  3LOD A;  2R98 A;  4JWP A;  3ZJ0 A;  1WWZ A;  3EC4 A;  1M44 A;  5H84 A;  2FS5 A;  4AG9 A;  3GY9 A;  3W6X A;  3I3G A;  1S7F A;  2G0B A;  3FB3 A;  1B87 A;  2P6F A;  4OAE A;  4QB9 A;  2Q0Y A;  2AJ6 A;  4LUA A;  1XE4 A;  4FD4 A;  3B8G A;  3I9S A;  1XMT A;  4B5P A;  4R87 A;  2CNS A;  4FD7 A;  4XPL A;  2FL4 A;  3TCV A;  2B5G A;  4MY0 A;  3QB8 A;  4NEX A;  2J8R A;  4CRY B;  3BJ8 A;  3R9G A;  2VQY A;  4ONU A;  4Y49 B;  1YK3 A;  4BMH A;  4IF5 A;  4F6A A;  4KVM E;  3EO4 A;  3G8W A;  3KKW A;  2REE A;  2PR8 A;  3S6F A;  4II9 A;  3R95 A;  3LD2 A;  4QUS A;  3G3S A;  4E8O A;  4KZT A;  2ZW6 A;  1NSL A;  2FIW A;  3EXN A;  2K5T A;  3CXQ A;  3S6K A;  3FYN A;  2CY2 A;  2OZH A;  2HUZ A;  3FIX A;  5C88 A;  4JD6 A;  4E2A A;  2Z0Z A;  1ON0 A;  1CM0 A;  1P4N A;  2ZW7 A;  1XIX A;  4KLW A;  3VWD A;  4CAW A;  3DSB A;  1IB1 E;  1Q2C A;  1CJW A;  2PDO A;  3JUW A;  4QC6 A;  4J3G A;  1N71 A;  4E0A A;  4M85 A;  4UA3 A;  2ZXV A;  1YRE A;  3OWC A;  2D4O A;  4FD6 A;  5DWM A;  4AVA A;  4EVY A;  2GIV A;  1MJB A;  3R9E A;  1L0C A;  4ZBG A;  2ARH A;  5F48 A;  4IUS A;  3S6G A;  2JDC A;  1YGH A;  4AG7 A;  1YLE A;  4XPD B;  1QSR A;  4UWI A;  4FD5 A;  3TE4 A;  4JLY A;  4MI4 A;  1M4G A;  3SXO A;  4AVC A;  1IYK A;  3T9Y A;  1FY7 A;  2WPW A;  1VHS A;  2PSW A;  2VBQ A;  2NMT A;  1MK4 A;  3F0A A;  2P6E A;  4U9Z A;  5ISV A;  5EBV A;  3IGR A;  2FSR A;  1Y9K A;  2OH1 A;  2QEC A;  4R57 A;  3GYA A;  1K4J A;  2PQ8 A;  2B4D B;  3E0K A;  4KOS A;  2R7H A;  2Q4Y A;  1GHE A;  1QSN A;  3PGP A;  3FRM A;  2VZY A;  4GS4 A;  1S7N A;  4K30 A;  2I00 A;  3NE7 A;  3QAH A;  1R57 A;  3MGD A;  4AB7 A;  1U6M A;  2ZW5 A;  3JVN A;  5GCN A;  1XEB A;  4JJX A;  2EUI A;  4YRH A;  4KOV A;  5F46 A;  1S7K A;  4QVT A;  2OZU A;  4KOU A;  3DDD A;  5JQ4 A;  2I79 A;  4NCZ A;  2ATR A;  2GE3 A;  2Y0M A;  3FXT A;  3D8P A;  4NF1 A;  4NXY A;  1I12 A;  4U5Y A;  5HH1 A;  2PRB A;  2B5G B;  5KTC A;  4KOT A;  4XNH C;  2CNT A;  3TOA A;  1I1D A;  3S6H A;  5KTD A;  3RYO A;  3K9U A;  1UFH A;  2HV2 A;  2R1I A;  2BL1 A;  1VKC A;  2BEI A;  2EVN A;  3ZZI A;  2B3U A;  4HNY B;  3UY5 A;  5F47 A;  3H4Q A;  5J8F A;  4PV6 A;  3C26 A;  3W6S A;  4M3S A;  2A4N A;  4I49 A;  4KOX A;  3SHP A;  4CAV A;  3EFA A;  1BO4 A;  5IV0 A;  4XPK A;  2Z10 A;  1I21 A;  2OB0 A;  3BJ7 A;  2REF A;  2R8V A;  2ZW4 A;  4H89 A;  4KOR A;  1QSO A;  2DXQ A;  4KUB A;  1KUX A;  4ORF A;  4AVB A;  2VXK A;  3TFY A;  1WK4 A;  4CRZ B;  5J8C A;  1Z4E A;  2JEV A;  2VI7 A;  2GAN A;  3BLN A;  3P2F A;  4KOW A;  4HKF A;  4UWJ A;  1OZP A;  4XPD C;  4YGO A;  3PP9 A;  3TO6 A;  2PR1 A;  2JLM A;  1S3Z A;  2G3T A;  2J8N A;  4HNX B;  4H6Z A;  4KUA A;  2FIA A;  2O28 A;  3W91 A;  3D3S A;  2WPX A;  1RO5 A;  4MY3 A;  3WR7 A;  2OU2 A;  1P0H A;  1QSM A;  3DR8 A;  4PSW A;  4R3K A;  2VEZ A;  3F5B A;  3D2P A;  5IX3 A;  2B3V A;  4RI1 A;  2C27 A;  3GKR A;  3VWE A;  4RS2 A;  1KZF A;  4QBJ A;  2D4P A;  2OZG A;  3TO7 A;  2QML A;  4U9Y A;  5KTA A;  2Q44 A;  4R3L A;  1Q2Y A;  2JDD A;  2FXF A;  4B5O A;  4LX9 A; 
#chains in the Genus database with same CATH topology
 4KLV A;  1TXR A;  4C2Y A;  1B6B A;  3IWW A;  2Q7B A;  2QVP A;  4OAD A;  4PSX A;  1XMB A;  4UEF A;  1SQH A;  2Z11 A;  3DNS A;  4GM5 A;  1LOK A;  4DYO A;  1KUV A;  1Z9U A;  1YVO A;  1IYL A;  1RTQ A;  5HVG A;  5I0C A;  2FT0 A;  2FCK A;  2ZOG A;  1S5K A;  4P4B A;  5DWN A;  1F57 A;  4X5K A;  2QIR A;  4L8A A;  3SXN A;  2YGW A;  4G1P A;  3LWU A;  2PC1 A;  3FNC A;  4PXC A;  3QAY A;  2IJZ A;  3TOB A;  3KHX A;  5C82 A;  3RNZ A;  2FE7 A;  1LCP A;  1PCA A;  4KSI A;  2BSW A;  4IAV A;  4CGN A;  1CPX A;  3BI0 A;  2J8M A;  5JM6 A;  4KOY A;  4Y49 C;  4IHM A;  2HQY A;  3D2M A;  4C2Z A;  1V0C A;  4DNC A;  1J4J A;  1PUA A;  4B5P B;  4R76 A;  1XF8 A;  3D67 A;  3T90 A;  3FVL A;  5HMN A;  2PJ9 A;  2Z3N A;  4JYW A;  3CT9 A;  4UBR A;  2VZZ A;  4CAX A;  1NMT A;  1TF8 A;  2B58 A;  3FBU A;  5F49 A;  5LRG A;  2IL4 A;  1XJO A;  1PU9 A;  1Y7E A;  3KI9 A;  2Q04 A;  3KAS A;  4PQA A;  4P10 A;  1Z4R A;  2HC9 A;  1ELL P;  2ANP A;  2F8H A;  4NGR A;  2WZN A;  2ZEH A;  4L89 A;  5AG6 A;  2C6P A;  4PK2 A;  2H5M A;  1TKH A;  4H6U A;  3F8K A;  3V8I A;  5H86 A;  2YND A;  5JPH A;  4PPZ A;  1YX0 A;  4MHD A;  4F9U A;  4MJ8 A;  2P6G A;  2POK A;  3N7Z A;  4CS0 B;  2J9A A;  1OBR A;  4MFQ A;  3NH5 A;  4KVX A;  3TC8 A;  1LRZ A;  4CGL A;  5IB0 A;  1Y0Y A;  4B6Z A;  4XNH B;  4KSF A;  1FT7 A;  2AE6 A;  2DPS A;  3B3T A;  3WT4 A;  1YVK A;  4KVO E;  4EWT A;  4R9M A;  4JXR A;  1IGB A;  2Z3L A;  3TO9 A;  2Q4Z A;  4RUH A;  4OC1 A;  4UCN A;  4F0Y A;  3CXS A;  5K8O A;  5A28 A;  3N5F A;  1MJ9 A;  4PK3 A;  1AMP A;  1S60 A;  3CZX A;  3H8E A;  4Q7A A;  4AXV A;  3VH9 A;  4B12 A;  4EFD A;  5CNP A;  3B2Y A;  1M1D A;  1S7L A;  5FVJ A;  2AFW A;  4FUU A;  4ZY1 A;  2G3A A;  3HUV A;  4CGO A;  5AG4 A;  2Z3K A;  4MBU A;  2BUE A;  4A30 A;  4ONW A;  3TT2 A;  2Q4V A;  3FJU A;  2BCO A;  4C2X A;  1M4D A;  2PJB A;  2Q7S A;  3I1U A;  3PB8 X;  1BAV A;  1MJA A;  4DJL A;  3CDX A;  2P0W A;  1BPM A;  2CNM A;  5K8N A;  3FEC A;  3TX8 A;  4CYQ A;  4JZ0 A;  1JWQ A;  1QST A;  1Q2D A;  2CTB A;  2PJ0 A;  5JH9 A;  2EK9 A;  3TTH A;  1Y7R A;  1RXT A;  3IJ3 A;  3B3C A;  3IWG A;  4CYN A;  4NSQ A;  3PZJ A;  4FAI A;  1PYT B;  4A37 A;  2F5I A;  3D66 A;  1KUY A;  3S9L A;  4OC5 A;  1ARM A;  3RZA A;  2GFQ A;  5ELY A;  4KS9 A;  4UIA A;  4ZY2 A;  1Y9W A;  4ZGY B;  2JBK A;  4UF4 A;  5AG7 A;  5E96 A;  4OLL A;  3CXP A;  2ZOF A;  5J1Q A;  1BOB A;  1NE9 A;  1CP6 A;  3EY5 A;  4JXQ A;  6CPA A;  1M4I A;  4P4E A;  3L2N A;  2ZPA A;  3SJF A;  4YFJ A;  2PJA A;  1A2Z A;  2JBJ A;  3R96 A;  2ZEG A;  4M6H A;  3K2K A;  3CPA A;  3QNV A;  4A95 A;  3P2H A;  2OOT A;  3DGV A;  4WWV A;  2RC4 A;  3R1K A;  1TIQ A;  3IU1 A;  1YW6 A;  3IWE A;  3JRU A;  4UFV A;  2AFU A;  2DEA A;  3FED A;  3H8F A;  3R9F A;  4A33 A;  1YW4 A;  3B3S A;  3NH4 A;  2WUU A;  4MFK A;  1IIC A;  1ZLI A;  1YR0 A;  3D7D A;  1IID A;  1VHO A;  1Z2L A;  2KCW A;  2B4D A;  2B4B A;  2ODF A;  2X7B A;  2AFO A;  3KQX A;  4HPS A;  2BOA A;  3DR6 A;  2PJC A;  4HNW B;  3LOD A;  3PRT A;  3WC6 A;  2DF5 A;  2R98 A;  4JWP A;  4LQG A;  4CGM A;  1M4L A;  2PRQ A;  3ZJ0 A;  4YU9 A;  3KL9 A;  1WWZ A;  3EC4 A;  1M44 A;  3IC1 A;  4NGT A;  4A31 A;  2PVV A;  5G20 A;  4X2T A;  1Z8T A;  1F2P A;  1VGY A;  5H84 A;  4BIN A;  2FS5 A;  4P4I A;  4A38 A;  4ZX9 A;  2Q51 A;  4AG9 A;  4BD9 A;  3GY9 A;  4R8F A;  3B3V A;  3RBU A;  4NJR A;  3W6X A;  2QYV A;  3I3G A;  4A94 A;  1S7F A;  4CAF A;  2IMO A;  3PFE A;  2O53 A;  2G0B A;  2NYQ A;  3JTK A;  2AFX A;  3FB3 A;  4MCP A;  4Q38 A;  5EMI A;  1B87 A;  2P6F A;  4OAE A;  5G22 A;  4QB9 A;  3IO1 A;  2Q0Y A;  2AJ6 A;  4LUA A;  1XE4 A;  4FD4 A;  3B8G A;  3I9S A;  1GYT A;  1XMT A;  4P4J A;  4B5P A;  4CYP A;  1IOI A;  1JQG A;  2GLF A;  3KGQ A;  4R87 A;  2CNS A;  2Z3P A;  4FD7 A;  4XPL A;  5CPA A;  2FL4 A;  3TCV A;  3WAB A;  3IFE A;  4X3R A;  2B5G A;  4MY0 A;  2PJ3 A;  3RO0 A;  3QB8 A;  4B11 A;  4NEX A;  2V8D A;  2J8R A;  3HLP A;  1AYE A;  1DTD A;  1UWY A;  3BJ8 A;  2VQY A;  4ONU A;  4Y49 B;  1YK3 A;  3ISZ A;  3R9G A;  4BMH A;  1XRY A;  4MHY A;  4IF5 A;  3PEI A;  2V8H A;  4F6A A;  1EE3 P;  4X8I A;  4DUK A;  4KVM E;  5HVH A;  3EO4 A;  3G8W A;  3KKW A;  5LYF A;  2YNE A;  2REE A;  3FH4 A;  4TNU A;  2AFZ A;  2PR8 A;  4MHZ A;  4UIB A;  4TWE A;  5D29 A;  3S6F A;  4LQ6 A;  3R95 A;  4II9 A;  3MN8 A;  4MCR A;  3LD2 A;  1X12 A;  4QUS A;  3G3S A;  5HXD A;  3PFO A;  4E8O A;  4KZT A;  3V38 A;  2ZW6 A;  1AUG A;  1NSL A;  2FIW A;  3NH8 A;  3EXN A;  2C6G A;  4M6G A;  4CAE A;  2K5T A;  1VHE A;  3CXQ A;  3S6K A;  2PIZ A;  1F2O A;  5EC4 A;  1KWM A;  3FYN A;  2HB6 A;  2ZED A;  2OZH A;  1TKJ A;  2AFM A;  1R3N A;  2CY2 A;  3KHZ A;  4C7I A;  1X10 A;  2HUZ A;  2CXA A;  3FIX A;  5C88 A;  4JD6 A;  4GXH A;  4E2A A;  4UCM A;  2Z0Z A;  3KZW A;  3ISX A;  4B14 A;  2ZEN A;  3PB7 X;  4RN7 A;  4C68 A;  2V8G A;  1ON0 A;  1CM0 A;  1P4N A;  1CBX A;  4OP4 A;  2ZW7 A;  1XIX A;  3IU2 A;  4UFX A;  4KLW A;  4R6T A;  1XFO A;  3VWD A;  4CAW A;  3DSB A;  4NGN A;  4CPA A;  1IB1 E;  1ZG7 A;  2JEW A;  1Z8L A;  1Q2C A;  1CJW A;  2PDO A;  3JUW A;  4QC6 A;  4J3G A;  1N71 A;  5K8M A;  4E0A A;  3B7I A;  4W9Y A;  4M85 A;  3D7H A;  3NFZ A;  4UA3 A;  2ZXV A;  2PJ7 A;  1YRE A;  3OWC A;  3GLJ A;  2D4O A;  4FD6 A;  4OKO A;  5DWM A;  4MFJ A;  2PJ8 A;  4MHN A;  4AVA A;  4EVY A;  2GIV A;  1LAM A;  5AGE A;  1MJB A;  4P4F A;  3R9E A;  1L0C A;  1XBU A;  4MRI A;  2ARH A;  4ZBG A;  5F48 A;  1HDQ A;  2XEG A;  4IUS A;  1ARL A;  4F0X A;  3DLJ A;  4A32 A;  1Z5R A;  3S6G A;  2JDC A;  1LAP A;  1YGH A;  4AG7 A;  1YLE A;  4XPD B;  1QSR A;  2ABZ A;  1CX8 A;  4UWI A;  2YNC C;  2C1C A;  1TKF A;  4FD5 A;  3PBB A;  2IQ6 A;  4NGS A;  3TE4 A;  2GU2 A;  1ZG9 A;  2YNC A;  4JLY A;  1CPS A;  1Z8W A;  4MXU A;  4MI4 A;  4OC0 A;  1CP7 A;  1M4G A;  1LFW A;  2ZEL A;  2GRE A;  1BPN A;  5LYL A;  1TF9 A;  3SXO A;  4AVC A;  1IYK A;  3T9Y A;  1FY7 A;  4M6I A;  2ZEF A;  2WPW A;  1VHS A;  2PSW A;  2VBQ A;  2PJ1 A;  2GLJ A;  2NMT A;  3SJG A;  1MK4 A;  2XEJ A;  2WYR A;  4IK2 A;  5JGF A;  3PB4 X;  3F0A A;  4NGM A;  3WC5 A;  2P6E A;  4U9Z A;  2OR4 A;  5ISV A;  5EBV A;  3IGR A;  2FSR A;  1Y9K A;  3D68 A;  4FBE A;  2Z3O A;  1ZLH A;  2EWB A;  3FF3 A;  4Q36 A;  2OH1 A;  2QEC A;  4R57 A;  3GYA A;  3CPX A;  1K4J A;  2PQ8 A;  1HEE A;  2B4D B;  2G9D A;  4P6Y A;  3E0K A;  4KOS A;  1FNO A;  2R7H A;  2Q4Y A;  3MRU A;  1GHE A;  1QSN A;  3PGP A;  1QQ9 A;  3FRM A;  2VZY A;  4GS4 A;  4NGQ A;  5LYI A;  1S7N A;  4K30 A;  4ZY0 A;  5AG5 A;  2I00 A;  3D7F A;  4UCP A;  4A39 A;  3NE7 A;  3QAH A;  3SJX A;  2PJ6 A;  4OIW A;  1R57 A;  3FMC A;  3MGD A;  4AB7 A;  1IOF A;  7CPA A;  2FVG A;  1U6M A;  2ZW5 A;  2ZEM A;  3GIU A;  4P44 A;  2PJ2 A;  3JVN A;  3KQZ A;  4O23 A;  8CPA A;  5K8P A;  2DPT A;  5GCN A;  1XEB A;  4JJX A;  2EUI A;  4OID A;  1YQE A;  4YRH A;  3A9L A;  4KOV A;  4OC2 A;  5F46 A;  3SI1 A;  1S7K A;  2CF4 A;  1LAN A;  4QVT A;  2OZU A;  4UEE A;  4KOU A;  4Z65 A;  5HVF A;  3WC7 A;  5IB9 A;  3DDD A;  2ZEE A;  2BO9 A;  4B10 A;  2V8V A;  3SI2 A;  2I79 A;  4NCZ A;  5JQ4 A;  2ATR A;  3NA6 A;  2GE3 A;  2Y0M A;  2PE3 A;  3FXT A;  4YWY A;  3SJE A;  3K9T A;  3D8P A;  4NF1 A;  4NXY A;  1I12 A;  4U5Y A;  4OC4 A;  5HH1 A;  5BWA B;  2PRB A;  3BI1 A;  4CRY B;  2B5G B;  5KTC A;  5D8N A;  3IEH A;  4KOT A;  4PXD A;  1Y0R A;  4XNH C;  2CNT A;  3TOA A;  2XEI A;  2VL1 A;  1I1D A;  4NFR A;  1H8L A;  4F8Z A;  3SI0 A;  4C7H A;  3S6H A;  5KTD A;  3H5Z A;  3RYO A;  3K9U A;  1UFH A;  4CYO A;  2HV2 A;  2R1I A;  3PBE A;  2XEF A;  5THW A;  3V7Z A;  2BL1 A;  1QMU A;  1VKC A;  1ZG8 A;  3GUX A;  2BEI A;  2EVN A;  4NJQ A;  3ZZI A;  2B3U A;  2C6C A;  1IU8 A;  3B3W A;  3VAT A;  2RFH A;  1IY7 A;  4HNY B;  4ZX8 A;  4FWU A;  3RAM A;  3UY5 A;  5F47 A;  1VIX A;  3H4Q A;  4WJB A;  5J8F A;  4PV6 A;  3FX6 A;  4MFL A;  3C26 A;  2AFS A;  3W6S A;  3GB0 A;  3VAR A;  4MCQ A;  3KR4 A;  2V77 A;  2A4N A;  4M3S A;  4I49 A;  4PXB A;  1ELM P;  2F7V A;  4KOX A;  3SHP A;  4P45 A;  4CAV A;  3EFA A;  4MCS A;  1BO4 A;  5IV0 A;  1YME A;  2PVW A;  1HDU A;  4UEZ A;  4XPK A;  2Z10 A;  5DS0 A;  4ZYQ A;  1I21 A;  2OB0 A;  5LRK A;  3BJ7 A;  2REF A;  2R8V A;  4MMO A;  2CTC A;  2ZW4 A;  4H89 A;  1YLO A;  1Z8X A;  4KOR A;  3IIB A;  4B13 A;  5G21 A;  1QSO A;  2PCU A;  2DXQ A;  3D7G A;  4KUB A;  3FEE A;  2Q43 A;  1KUX A;  2EO8 A;  4ORF A;  5LYD A;  2WSA A;  4AVB A;  5LRJ A;  2VXK A;  4F9V A;  1WK4 A;  4CRZ B;  5J8C A;  4UFW A;  3TFY A;  1Z4E A;  2JEV A;  1YSJ A;  5I4M A;  2VI7 A;  2GAN A;  3BLN A;  4PXE A;  1DE4 C;  3P2F A;  4KOW A;  5A27 A;  4OC3 A;  4P4D A;  4HKF A;  3H8G A;  4UWJ A;  4A2Z A;  5CBM A;  2CIJ A;  1OZP A;  4XPD C;  4YGO A;  3PB6 X;  3BHX A;  4EME A;  3PP9 A;  1CG2 A;  3TO6 A;  2PR1 A;  4NGP A;  2JLM A;  4K3N A;  3BXM A;  3S9M A;  1S3Z A;  2G3T A;  4R7M A;  3LMS A;  2J8N A;  4HNX B;  2EBJ A;  3KR5 A;  5F09 A;  3LAC A;  4H6Z A;  4KUA A;  2NSM A;  4ZI6 A;  2FIA A;  4KSA A;  2O28 A;  4BBH A;  3S9N A;  3W91 A;  3D3S A;  1XOV A;  2WPX A;  4H2K A;  1RO5 A;  2PJ5 A;  3NE8 A;  2PJ4 A;  4MY3 A;  3WR7 A;  2OU2 A;  1P0H A;  1QSM A;  3DR8 A;  4PSW A;  4R3K A;  2VEZ A;  3F5B A;  1NSA A;  3D2P A;  5IX3 A;  1Q7L A;  2EK8 A;  2QJ8 A;  1ZO0 A;  2B3V A;  2PIY A;  2C27 A;  3GKR A;  4MHP A;  4OME A;  4RI1 A;  3T8W A;  3B35 A;  4RS2 A;  3VWE A;  4MFZ A;  1KZF A;  3D4U A;  2O4H A;  4CGP A;  2I3C A;  5G1Z A;  4QBJ A;  2RB7 A;  2D4P A;  2OZG A;  2ZEO A;  3TO7 A;  2QML A;  2ZEP A;  1BLL E;  2Z3M A;  4U9Y A;  1R43 A;  2Q44 A;  4MFP A;  4R3L A;  1Q2Y A;  5KTA A;  2JDD A;  2FXF A;  4B5O A;  3PB9 X;  4LX9 A; 
#chains in the Genus database with same CATH homology
 4KLV A;  4C2Y A;  1B6B A;  2Q7B A;  4OAD A;  4PSX A;  1SQH A;  2Z11 A;  3DNS A;  1KUV A;  1Z9U A;  1YVO A;  1IYL A;  5I0C A;  2FT0 A;  2FCK A;  1S5K A;  5DWN A;  4X5K A;  2QIR A;  4L8A A;  3SXN A;  2YGW A;  2PC1 A;  3FNC A;  3TOB A;  5C82 A;  2FE7 A;  2BSW A;  4CGN A;  2J8M A;  4KOY A;  4Y49 C;  2HQY A;  3D2M A;  4C2Z A;  1V0C A;  4DNC A;  1J4J A;  1PUA A;  4B5P B;  1XF8 A;  3T90 A;  5HMN A;  2Z3N A;  4UBR A;  2VZZ A;  4CAX A;  1NMT A;  3FBU A;  2B58 A;  5F49 A;  2IL4 A;  1PU9 A;  2Q04 A;  1Z4R A;  4L89 A;  5AG6 A;  4PK2 A;  2H5M A;  4H6U A;  3F8K A;  3V8I A;  5H86 A;  2YND A;  5JPH A;  1YX0 A;  4MHD A;  4MJ8 A;  2P6G A;  3N7Z A;  4CS0 B;  4MFQ A;  4CGL A;  4KVX A;  1LRZ A;  5IB0 A;  4XNH B;  4KSF A;  2AE6 A;  2DPS A;  1YVK A;  4KVO E;  4R9M A;  4JXR A;  2Z3L A;  3TO9 A;  4UCN A;  4F0Y A;  3CXS A;  5A28 A;  1MJ9 A;  4PK3 A;  1S60 A;  4B12 A;  5CNP A;  1M1D A;  1S7L A;  5FVJ A;  2G3A A;  4CGO A;  5AG4 A;  2Z3K A;  4MBU A;  2BUE A;  4A30 A;  3TT2 A;  2Q4V A;  4C2X A;  1M4D A;  1MJA A;  2P0W A;  2CNM A;  4CYQ A;  1QST A;  1Q2D A;  3TTH A;  4CYN A;  1Y7R A;  1RXT A;  3IWG A;  4NSQ A;  3PZJ A;  2F5I A;  1KUY A;  4KS9 A;  1Y9W A;  4ZGY B;  5AG7 A;  5E96 A;  4OLL A;  3CXP A;  1BOB A;  1NE9 A;  3EY5 A;  4JXQ A;  1M4I A;  2ZPA A;  4YFJ A;  3R96 A;  4A95 A;  3P2H A;  2RC4 A;  3R1K A;  1TIQ A;  3IU1 A;  3IWE A;  4UFV A;  3R9F A;  4A33 A;  2WUU A;  4MFK A;  1IIC A;  1YR0 A;  1IID A;  2X7B A;  5EC4 A;  2KCW A;  2B4D A;  2B4B A;  3DR6 A;  4HNW B;  3LOD A;  2R98 A;  4JWP A;  4CGM A;  3ZJ0 A;  4A31 A;  1WWZ A;  3EC4 A;  1M44 A;  5G20 A;  5H84 A;  2FS5 A;  4AG9 A;  3GY9 A;  3W6X A;  3I3G A;  1S7F A;  4CAF A;  4Q38 A;  2G0B A;  3JTK A;  3FB3 A;  1B87 A;  2P6F A;  4OAE A;  5G22 A;  4QB9 A;  2Q0Y A;  2AJ6 A;  4LUA A;  1XE4 A;  4FD4 A;  3B8G A;  3I9S A;  1XMT A;  4B5P A;  4CYP A;  4R87 A;  2CNS A;  2Z3P A;  4FD7 A;  4XPL A;  2FL4 A;  3TCV A;  2B5G A;  4MY0 A;  3QB8 A;  4B11 A;  4NEX A;  2J8R A;  4CRY B;  3BJ8 A;  3R9G A;  2VQY A;  4ONU A;  4Y49 B;  1YK3 A;  4BMH A;  4IF5 A;  4F6A A;  4KVM E;  3EO4 A;  3G8W A;  3KKW A;  2YNE A;  2REE A;  2PR8 A;  3S6F A;  4II9 A;  3R95 A;  3LD2 A;  4QUS A;  3G3S A;  4E8O A;  4KZT A;  2ZW6 A;  1NSL A;  2FIW A;  3EXN A;  4CAE A;  2K5T A;  3CXQ A;  3S6K A;  3FYN A;  2CY2 A;  2OZH A;  4C7I A;  2HUZ A;  2CXA A;  3FIX A;  5C88 A;  4JD6 A;  4E2A A;  4UCM A;  2Z0Z A;  4B14 A;  4C68 A;  1ON0 A;  1CM0 A;  1P4N A;  2ZW7 A;  1XIX A;  3IU2 A;  4UFX A;  4KLW A;  3VWD A;  4CAW A;  3DSB A;  1IB1 E;  1Q2C A;  1CJW A;  2PDO A;  3JUW A;  4QC6 A;  4J3G A;  1N71 A;  4E0A A;  4M85 A;  4UA3 A;  2ZXV A;  1YRE A;  3OWC A;  2D4O A;  4FD6 A;  5DWM A;  4MFJ A;  4AVA A;  4EVY A;  2GIV A;  5AGE A;  1MJB A;  3R9E A;  1L0C A;  4ZBG A;  2ARH A;  5F48 A;  4IUS A;  4F0X A;  4A32 A;  3S6G A;  2JDC A;  1YGH A;  4AG7 A;  1YLE A;  4XPD B;  1QSR A;  4UWI A;  2YNC C;  4FD5 A;  3TE4 A;  2YNC A;  4JLY A;  4MI4 A;  1M4G A;  3SXO A;  4AVC A;  1IYK A;  3T9Y A;  1FY7 A;  2WPW A;  1VHS A;  2PSW A;  2VBQ A;  2NMT A;  1MK4 A;  3F0A A;  2P6E A;  4U9Z A;  5ISV A;  5EBV A;  3IGR A;  2FSR A;  1Y9K A;  2Z3O A;  4Q36 A;  2OH1 A;  2QEC A;  4R57 A;  3GYA A;  1K4J A;  2PQ8 A;  2B4D B;  3E0K A;  4KOS A;  2R7H A;  2Q4Y A;  1GHE A;  1QSN A;  3PGP A;  3FRM A;  2VZY A;  4GS4 A;  1S7N A;  4K30 A;  5AG5 A;  2I00 A;  4UCP A;  3NE7 A;  3QAH A;  1R57 A;  3MGD A;  4AB7 A;  1U6M A;  2ZW5 A;  3JVN A;  2DPT A;  5GCN A;  1XEB A;  4JJX A;  2EUI A;  4YRH A;  3A9L A;  4KOV A;  5F46 A;  1S7K A;  4QVT A;  2OZU A;  4KOU A;  3DDD A;  4B10 A;  5JQ4 A;  2I79 A;  4NCZ A;  2ATR A;  2GE3 A;  2Y0M A;  3FXT A;  3D8P A;  4NF1 A;  4NXY A;  1I12 A;  4U5Y A;  5BWA B;  5HH1 A;  2PRB A;  2B5G B;  5KTC A;  4KOT A;  4XNH C;  2CNT A;  3TOA A;  1I1D A;  4C7H A;  3S6H A;  5KTD A;  3H5Z A;  3RYO A;  3K9U A;  1UFH A;  4CYO A;  2HV2 A;  2R1I A;  2BL1 A;  1VKC A;  2BEI A;  2EVN A;  3ZZI A;  2B3U A;  4HNY B;  3UY5 A;  5F47 A;  3H4Q A;  5J8F A;  4PV6 A;  4MFL A;  3C26 A;  3W6S A;  4M3S A;  2A4N A;  4I49 A;  4KOX A;  3SHP A;  4CAV A;  3EFA A;  1BO4 A;  5IV0 A;  4XPK A;  2Z10 A;  1I21 A;  2OB0 A;  3BJ7 A;  2REF A;  2R8V A;  2ZW4 A;  4B13 A;  4H89 A;  4KOR A;  5G21 A;  1QSO A;  2DXQ A;  4KUB A;  1KUX A;  4ORF A;  2WSA A;  4AVB A;  2VXK A;  3TFY A;  1WK4 A;  4CRZ B;  5J8C A;  4UFW A;  1Z4E A;  2JEV A;  2VI7 A;  2GAN A;  3BLN A;  3P2F A;  4KOW A;  5A27 A;  4HKF A;  4UWJ A;  4A2Z A;  1OZP A;  4XPD C;  4YGO A;  3PP9 A;  3TO6 A;  2PR1 A;  2JLM A;  1S3Z A;  2G3T A;  2J8N A;  4HNX B;  4H6Z A;  4KUA A;  2FIA A;  4KSA A;  2O28 A;  4BBH A;  3W91 A;  3D3S A;  2WPX A;  1RO5 A;  4MY3 A;  3WR7 A;  2OU2 A;  1P0H A;  1QSM A;  3DR8 A;  4PSW A;  4R3K A;  2VEZ A;  3F5B A;  3D2P A;  5IX3 A;  1ZO0 A;  2B3V A;  4RI1 A;  2C27 A;  3GKR A;  3VWE A;  4RS2 A;  4MFZ A;  1KZF A;  4CGP A;  5G1Z A;  4QBJ A;  2D4P A;  2OZG A;  3TO7 A;  2QML A;  4U9Y A;  2Z3M A;  5KTA A;  4MFP A;  2Q44 A;  4R3L A;  1Q2Y A;  2JDD A;  2FXF A;  4B5O A;  4LX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...