1QSOA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
b'NITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 32
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsoA00
4E2AA 4YRHA 1NMTA 2ZXVA 4KUAA 4BMHA 4OADA 2FXFA 4PSXA 3I9SA 4XPDC 4LX9A 4OLLA 4UBRA 5C88A 3JVNA 2K5TA 3DSBA 1VKCA 1YVKA 1M1DA 4QC6A 2BUEA 1XEBA 1Q2YA 1S5KA 2OU2A 5F46A 2R1IA 4IF5A 1P4NA 1QSRA 2PR1A 5EC4A 1I21A 4E0AA 3DNSA 3SXOA 4FD7A 4CRYB 3D2PA 1XF8A 4UWJA 4R9MA 2ZW5A 2Z0ZA 1L0CA 2CNTA 4AB7A 1K4JA 2D4OA 1KZFA 2REFA 3T90A 1S3ZA 1BO4A 2BL1A 2QIRA 4B5PB 1QSTA 4H6UA 3T9YA 1Y9KA 3DDDA 4JXRA 5H84A 1WK4A 2BSWA 2R7HA 4XNHB 3UY5A 3EXNA 3W6SA 1S60A 4HNYB 2G0BA 4KOYA 3WR7A 3LD2A 2VI7A 2ARHA 1IIDA 4MY3A 5IV0A 1KUVA 3BLNA 3BJ7A 1QSMA 5JQ4A 3JUWA 1S7LA 4XPLA 1VHSA 2AE6A 3FYNA 3W6XA 1PUAA 2R8VA 5I0CA 5IB0A 2QECA 2RC4A 4JLYA 1U6MA 4KOVA 4KOSA 2B4BA 2AJ6A 1S7NA 1CJWA 3MGDA 2D4PA 2P6EA 4M85A 1I12A 3C26A 4KVXA 5J8CA 2WPWA 2B5GB 4K30A 3IGRA 3R9EA 3TCVA 3R96A 2FIWA 3GY9A 1XE4A 3FNCA 3D3SA 5IX3A 1Z9UA 3R95A 5DWMA 5KTDA 1M44A 3RYOA 2PRBA 5HMNA 4F0YA 4KOWA 2VZYA 4R87A 2JEVA 2OH1A 2R98A 1SQHA 4PK3A 1YR0A 2REEA 1LRZA 2HV2A 1GHEA 1Y7RA 2IL4A 4B5PA 3TFYA 3EFAA 3OWCA 4KVOE 3KKWA 4GS4A 3D8PA 4H6ZA 1YK3A 2CNMA 4R3KA 3F5BA 4CAWA 1TIQA 3BJ8A 2HUZA 4QBJA 4MI4A 5DWNA 2Z11A 3PGPA 4MBUA 1B6BA 4H89A 2B3VA 5ISVA 1QSNA 5C82A 1YVOA 2JDCA 3S6KA 4Y49B 2EVNA 4AVAA 2Q0YA 2WPXA 2G3AA 4OAEA 5J8FA 3CXQA 3QB8A 2VQYA 5KTAA 4MHDA 4MJ8A 4NCZA 3P2HA 5FVJA 3F0AA 3NE7A 1Q2DA 5F49A 3EC4A 4FD5A 2FE7A 2FT0A 3B8GA 4UWIA 3FRMA 2VEZA 2PSWA 1FY7A 3DR6A 3ZZIA 1MJ9A 2CY2A 2P6FA 2B5GA 4KOXA 1KUXA 2DXQA 2J8NA 3I3GA 3TT2A 4HNWB 2Q44A 4R57A 4PV6A 2P6GA 2Q4VA 1XMTA 3TO6A 4KORA 4RS2A 2PR8A 4M3SA 4Y49C 2VZZA 4QUSA 3K9UA 4JJXA 1Z4RA 3V8IA 2OZUA 2PQ8A 2JDDA 5F47A 3SHPA 3D2MA 4JXQA 3TOBA 3S6FA 2ZW6A 4PSWA 1IYKA 4XNHC 4ZBGA 3GYAA 2GIVA 3R9FA 2FS5A 1S7FA 1R57A 4YGOA 2B3UA 4NEXA 1BOBA 4JWPA 4LUAA 1V0CA 3H4QA 2OZGA 4MY0A 3PP9A 4L8AA 3LODA 1IICA 1J4JA 4XPDB 4NXYA 3R9GA 1M4GA 3FIXA 1M4IA 1IYLA 2FSRA 3CXPA 1ON0A 2F5IA 4KZTA 5F48A 4AG7A 1B87A 1RXTA 4U5YA 2ZPAA 4CAXA 1CM0A 1I1DA 2A4NA 4F6AA 4B5OA 3VWDA 4JD6A 4ONUA 3TO7A 4QVTA 2PDOA 1N71A 4IUSA 5EBVA 2GANA 2OB0A 4AVCA 3F8KA 2VBQA 2FL4A 2ZW7A 3SXNA 4CRZB 3G3SA 2Q7BA 5CNPA 4KOUA 5KTCA 5HH1A 2GE3A 3QAHA 4ORFA 2HQYA 1OZPA 3EY5A 1P0HA 4L89A 2B4DB 3S6GA 4E8OA 1MJAA 1M4DA 3TOAA 3ZJ0A 1YGHA 4R3LA 2X7BA 1PU9A 2VXKA 2OZHA 4EVYA 4II9A 1UFHA 5E96A 4KLWA 4UA3A 2ATRA 4X5KA 3S6HA 4AG9A 2J8MA 4KOTA 3W91A 2C27A 1WWZA 1Z4EA 2EUIA 4CAVA 3R1KA 4CS0B 3G8WA 3TTHA 2PC1A 1XIXA 4U9ZA 1KUYA 2FCKA 2QMLA 3E0KA 1Q2CA 4FD6A 4YFJA 4AVBA 1YREA 3DR8A 1QSOA 2O28A 3TO9A 3FXTA 2J8RA 2ZW4A 3FB3A 2G3TA 3VWEA 4J3GA 4RI1A 2H5MA 4KLVA 3EO4A 4QB9A 4I49A 1NSLA 2NMTA 4XPKA 2Z10A 3IWGA 2Q04A 4HNXB 1RO5A 4NF1A 1YX0A 2JLMA 2Q4YA 4HKFA 4NSQA 2I79A 2FIAA 1MK4A 5GCNA 1IB1E 5JPHA 4FD4A 1S7KA 2P0WA 3PZJA 3N7ZA 1Y9WA 3FBUA 1MJBA 1NE9A 2B4DA 2KCWA 2Y0MA 4PK2A 2I00A 5H86A 1YLEA 4KUBA 4U9YA 2CNSA 3GKRA 3TE4A 4DNCA 3P2FA 4KVME 2B58A 2BEIA 3CXSA
chains in the Genus database with same CATH superfamily
1LAMA 4YRHA 4E2AA 1NMTA 4C2XA 2ZXVA 4KUAA 4BMHA 1YSJA 3DLJA 2PJ8A 2ZEEA 3H8FA 3SJFA 4OADA 2FXFA 4PSXA 3I9SA 4UF4A 4P4FA 4XPDC 1QMUA 2O4HA 4LX9A 4OLLA 2C6GA 4UBRA 4X8IA 5C88A 4NGNA 3JVNA 2K5TA 2WUUA 2PE3A 3DSBA 1VKCA 1YVKA 5K8PA 1TKJA 1M1DA 5K8NA 4QC6A 2BUEA 1Z8TA 4WJBA 1XEBA 3IIBA 3GLJA 5LYLA 1H8LA 1Y0YA 4NGSA 4NGPA 3B3VA 1Q2YA 1S5KA 2GFQA 2OU2A 5AG7A 5F46A 4NJQA 2R1IA 4IF5A 1P4NA 1QSRA 2PR1A 4F9UA 4PXEA 2GU2A 4C68A 5EC4A 1I21A 4AXVA 4CYOA 4E0AA 3V7ZA 3DNSA 3SXOA 1BPNA 4YU9A 4EWTA 1GYTA 4FD7A 4CRYB 3D2PA 4MRIA 1XF8A 3CT9A 4UWJA 4MFPA 4R9MA 2ZW5A 2Z0ZA 2WSAA 5HVFA 1KWMA 1L0CA 2CNTA 1AMPA 4AB7A 1K4JA 2D4OA 4CAFA 3T9YA 1KZFA 1R43A 1UWYA 2REFA 1DTDA 1BO4A 1S3ZA 3T90A 2BL1A 2DEAA 2QIRA 3KHXA 3SI1A 4A37A 1ELMP 3B3WA 2GREA 2VL1A 2CIJA 4B5PB 1RTQA 4A31A 1QSTA 2DPTA 4H6UA 5AG5A 2PJ5A 1Y9KA 2CF4A 2GLFA 2PJAA 2PJ1A 3D67A 3DDDA 4KS9A 4PXBA 3PRTA 4JXRA 5H84A 1WK4A 2BSWA 1LFWA 2R7HA 4UCNA 4UEZA 4XNHB 3FX6A 3UY5A 4F0XA 3B7IA 3EXNA 2XEJA 3W6SA 4OC2A 2C6CA 2ZEPA 1S60A 4OKOA 3H8GA 3D7DA 4HNYB 3T8WA 2BOAA 2G0BA 3SI2A 4OP4A 4OMEA 4KOYA 3WR7A 2DF5A 5I4MA 2Z3KA 1HDUA 3LD2A 2VI7A 2ARHA 4OC1A 4A32A 1IIDA 3PBBA 3WT4A 2WYRA 5AG4A 4MY3A 1ELLP 4OC0A 5IV0A 1KUVA 3BLNA 3BJ7A 2PJCA 1QSMA 5JQ4A 3JUWA 1S7LA 2EK9A 4XPLA 1VHSA 2AE6A 3FYNA 3JTKA 3W6XA 3FMCA 3KHZA 4MFZA 4MCRA 1PUAA 7CPAA 2R8VA 4JYWA 5I0CA 4P4EA 5IB0A 2QECA 2RC4A 4JLYA 4R8FA 1U6MA 4HPSA 4KOVA 2V8VA 8CPAA 2AFXA 4KOSA 2B4BA 3D66A 5LRGA 1F57A 3L2NA 1XOVA 3IWEA 1LAPA 2AJ6A 1Y0RA 4WWVA 1A2ZA 1Y7EA 1S7NA 1CJWA 2PVVA 3MGDA 4DJLA 2D4PA 2P6EA 1IY7A 1I12A 3DGVA 3C26A 4M85A 4KVXA 5J8CA 4R76A 2WPWA 2B5GB 4K30A 4MCPA 4FBEA 3IGRA 2BO9A 4NJRA 4IK2A 3R9EA 3TCVA 4RUHA 3ISZA 3R96A 3WABA 3TC8A 2FIWA 3GY9A 4NGMA 1XE4A 4BINA 4A94A 3FNCA 2PJ3A 1CP6A 4MFKA 3D3SA 5AG6A 2AFUA 2F8HA 1F2OA 4W9YA 4K3NA 5IX3A 2V77A 1Z9UA 3B3SA 3R95A 5HVHA 5DWMA 5KTDA 1ARLA 1M44A 3RYOA 3PFOA 3FJUA 3H5ZA 2PRBA 4MHYA 4Q7AA 5AGEA 5HMNA 4F0YA 4KOWA 4H2KA 1ZO0A 2VZYA 4MHPA 4R87A 2JBJA 3VARA 3CDXA 2JEVA 2OH1A 2R98A 1SQHA 1R3NA 4PK3A 1YR0A 3BHXA 1OBRA 4UFXA 2JEWA 2REEA 1LRZA 2HV2A 1GHEA 1Y7RA 2ANPA 2IL4A 4B5PA 2FVGA 2IQ6A 2IMOA 3TFYA 3EFAA 3OWCA 2AFOA 4KVOE 3KKWA 4GS4A 3D8PA 4H6ZA 1F2PA 2BCOA 1VGYA 4RN7A 1YK3A 2CNMA 4IAVA 4R3KA 5CPAA 3F5BA 1ARMA 1TIQA 4CAWA 2ODFA 3H8EA 3BJ8A 3B3TA 2XEIA 2HUZA 4QBJA 4NFRA 5LYFA 2PRQA 4MI4A 1Z8XA 1FNOA 5DWNA 2Z11A 3NA6A 4TWEA 3B35A 3RNZA 1TF8A 3PGPA 4MBUA 4X2TA 2HB6A 1B6BA 1CX8A 4H89A 1ZLIA 4OC4A 4P4BA 3PEIA 2B3VA 5ISVA 4UCMA 1QSNA 2XEGA 5C82A 1YVOA 5IB9A 4PPZA 4M6IA 3S9NA 1XBUA 2JDCA 3TX8A 3S6KA 4Y49B 5HXDA 2EVNA 4AVAA 2Q0YA 1Z2LA 2WPXA 3RBUA 2G3AA 2YNEA 2Z3NA 4OAEA 2CTBA 5J8FA 3CXQA 5LRKA 3IEHA 3QB8A 2VQYA 5KTAA 4MHDA 4MJ8A 4NCZA 3P2HA 5FVJA 1CPSA 3F0AA 3NE7A 1Q2DA 5F49A 3EC4A 4FD5A 4UFWA 2FE7A 2EK8A 2FT0A 3GB0A 4UEFA 3B8GA 4UWIA 3FRMA 3MRUA 2VEZA 2PSWA 1FY7A 1ZG9A 3DR6A 3NH4A 3ZZIA 4ZYQA 2G9DA 4KSIA 1MJ9A 3KR4A 2CY2A 2O53A 2P6FA 4GXHA 1LOKA 2B5GA 5LYDA 4KOXA 2ZEOA 2ZENA 1KUXA 2DXQA 5D8NA 2ZEHA 4MXUA 3SI0A 2CTCA 5G22A 1EE3P 1VIXA 2J8NA 2ZEFA 3I3GA 4P44A 3TT2A 4HNWB 3FH4A 2V8HA 2Q44A 1PCAA 2I3CA 4G1PA 4R57A 3S9MA 1IOIA 2P6GA 3CPXA 4PV6A 4YWYA 2Q4VA 1XMTA 1TF9A 3TO6A 4B13A 4KORA 4C2YA 4RS2A 2PR8A 2QJ8A 3NH8A 3KI9A 4M3SA 1X12A 1YW4A 1TXRA 4Y49C 2VZZA 4NGRA 3D4UA 4NGQA 3PB8X 3K9UA 1DE4C 4QUSA 3BXMA 3VH9A 4JJXA 4ONWA 5G1ZA 1TKFA 1XFOA 1Z4RA 3V8IA 3IU1A 4A38A 4FWUA 3K2KA 4R7MA 2OZUA 2PQ8A 2JDDA 1CPXA 3KGQA 4TNUA 4UEEA 3D2MA 4JXQA 5F47A 3SHPA 4ZX8A 3TOBA 2AFWA 4M6HA 3S6FA 2ZW6A 4PSWA 1IYKA 4XNHC 3I1UA 4ZBGA 1XRYA 3GYAA 2GIVA 1M4LA 2FS5A 2V8GA 3R9FA 4A30A 1S7FA 2Z3PA 1R57A 4YGOA 2PJ9A 1FT7A 1CG2A 4OIWA 2B3UA 2YNDA 2V8DA 4NEXA 1BOBA 4MCQA 4JWPA 4BD9A 4LUAA 4CYPA 1V0CA 3FVLA 3H4QA 2OZGA 4MY0A 3PP9A 4C2ZA 4BBHA 4L8AA 2Q4ZA 3NH5A 3LODA 1IICA 2QVPA 1J4JA 4OIDA 3PFEA 4NXYA 4XPDB 1YQEA 3R9GA 4UIAA 1VHEA 5D29A 1M4GA 4R6TA 2EO8A 1M4IA 3FIXA 1IYLA 2WZNA 5DS0A 4C7HA 2FSRA 3PB7X 3CXPA 4ZY1A 4UFVA 4A95A 1YW6A 3GIUA 3PB6X 4OC5A 4B11A 3FEDA 1ON0A 2EWBA 5F09A 2F5IA 2YGWA 4KZTA 5F48A 1B87A 2F7VA 2YNCA 4AG7A 4DUKA 1RXTA 1ZG8A 3KR5A 2ZPAA 1YMEA 4U5YA 2Q51A 2OOTA 2OR4A 4CAXA 3HUVA 1CM0A 4FAIA 4FUUA 1I1DA 4B10A 2A4NA 4F9VA 4F6AA 2Z3MA 3B2YA 2C1CA 5HVGA 2QYVA 4B5OA 4EMEA 3VWDA 4JD6A 4ONUA 3TO7A 2PIZA 4A39A 3CZXA 4QVTA 2PDOA 4P4DA 2ABZA 1N71A 4IUSA 5EBVA 4ZI6A 2ZEDA 2GANA 4Z65A 1IOFA 2OB0A 4AVCA 3F8KA 4A33A 2PJBA 1IU8A 2XEFA 2VBQA 2ZOGA 2FL4A 2ZW7A 3SXNA 4CGMA 4CRZB 3G3SA 1AYEA 3SJGA 3IU2A 4LQGA 2Q7BA 5CNPA 4KOUA 5JGFA 3KQZA 5KTCA 1NSAA 2ZOFA 5HH1A 5K8OA 2ZELA 2EBJA 4NGTA 4CGLA 2GE3A 1X10A 3QAHA 4ORFA 4CGNA 3RZAA 2HQYA 1OZPA 4A2ZA 3EY5A 3FF3A 3IWWA 3FEEA 3PBEA 4O23A 1P0HA 1Q7LA 4L89A 4ZY2A 2B4DB 2JBKA 1BPMA 3IC1A 3S6GA 4F8ZA 4E8OA 1MJAA 1Z8LA 1JQGA 1M4DA 3TOAA 3ZJ0A 1YGHA 4R3LA 4P10A 2X7BA 4LQ6A 1PU9A 3KZWA 2NYQA 4MFLA 1XJOA 3FECA 2PJ6A 2VXKA 4B12A 3IFEA 1BAVA 2OZHA 4EVYA 3N5FA 4II9A 5JH9A 1UFHA 5E96A 4KLWA 2PJ7A 4ZGYB 4UA3A 2AFSA 2ATRA 1TKHA 2ZEMA 4X5KA 3S6HA 4UIBA 4OC3A 4AG9A 2J8MA 4KOTA 3W91A 2C27A 1WWZA 1Z4EA 1YLOA 2EUIA 4CAVA 4CGOA 3WC5A 2Q7SA 2PIYA 3BI0A 3K9TA 3KASA 4CYNA 5LYIA 3BI1A 3R1KA 4CS0B 3G8WA 5K8MA 1AUGA 1VHOA 3D68A 3D7FA 3TTHA 2PC1A 1XIXA 5A28A 3B3CA 4U9ZA 5A27A 1KUYA 2FCKA 4PXCA 1HDQA 2QMLA 3E0KA 1Q2CA 4FD6A 4YFJA 1CBXA 4P45A 4AVBA 4PXDA 4DYOA 1YREA 3SJXA 3LWUA 3DR8A 2YNCC 1ZG7A 4UCPA 2PVWA 5ELYA 4MFJA 1HEEA 1QSOA 2O28A 4JZ0A 3LMSA 3MN8A 4MHZA 5THWA 1CP7A 3JRUA 3TO9A 3FXTA 3V38A 1LCPA 2J8RA 1JWQA 2ZW4A 3FB3A 1Z8WA 3PB4X 2G3TA 2DPSA 5EMIA 3VWEA 2C6PA 3D7GA 4IHMA 4ZX9A 4J3GA 4RI1A 3KQXA 4B6ZA 4CAEA 2H5MA 4KLVA 3EO4A 4MHNA 4QB9A 4I49A 1NSLA 4CPAA 3IO1A 2NMTA 4KSFA 4CYQA 4XPKA 3HLPA 4Q38A 3RAMA 2PJ4A 2Z10A 4P4JA 3IWGA 2Q04A 3QNVA 3NE8A 4HNXB 4X3RA 3PB9X 5G21A 1RO5A 4MMOA 4NF1A 1YX0A 1BLLE 2CXAA 2JLMA 2PCUA 2Q4YA 5LRJA 2AFMA 2PJ2A 2Q43A 1ZLHA 4HKFA 4P4IA 1LANA 2Z3LA 4PQAA 4NSQA 2I79A 4EFDA 4M6GA 2FIAA 2IJZA 2RFHA 1MK4A 5GCNA 3IJ3A 1IB1E 5JPHA 4FD4A 1S7KA 4P6YA 4ZY0A 2RB7A 2P0WA 3PZJA 5G20A 3RO0A 3N7ZA 1Y9WA 3KL9A 4CGPA 3FBUA 2Z3OA 1MJBA 1NE9A 2PJ0A 2B4DA 5JM6A 2KCWA 4MCSA 1QQ9A 3NFZA 2Y0MA 2ZEGA 3WC6A 3CPAA 2GLJA 4PK2A 3D7HA 5BWAB 2I00A 1IGBA 2AFZA 4MFQA 3VATA 5CBMA 5H86A 3A9LA 1YLEA 1XMBA 4KUBA 1PYTB 2HC9A 3GUXA 3WC7A 1Z5RA 4B14A 3SJEA 4U9YA 6CPAA 2CNSA 2NSMA 3GKRA 3LACA 4C7IA 4DNCA 3S9LA 3TE4A 4GM5A 4KSAA 5J1QA 3P2FA 4KVME 2J9AA 2POKA 3ISXA 2B58A 4Q36A 3QAYA 2BEIA 3CXSA
chains in the Genus database with same CATH topology
4E2AA 4YRHA 1NMTA 4C2XA 2ZXVA 4KUAA 4BMHA 4OADA 2FXFA 4PSXA 3I9SA 4XPDC 4LX9A 4OLLA 4UBRA 5C88A 3JVNA 2K5TA 2WUUA 3DSBA 1VKCA 1YVKA 1M1DA 4QC6A 2BUEA 1XEBA 1Q2YA 1S5KA 2OU2A 5AG7A 5F46A 2R1IA 4IF5A 1P4NA 1QSRA 2PR1A 4C68A 5EC4A 1I21A 4CYOA 4E0AA 3DNSA 3SXOA 4FD7A 4CRYB 3D2PA 1XF8A 4UWJA 4MFPA 4R9MA 2ZW5A 2Z0ZA 2WSAA 1L0CA 2CNTA 4AB7A 1K4JA 2D4OA 4CAFA 1KZFA 2REFA 3T90A 1S3ZA 1BO4A 2BL1A 2QIRA 4B5PB 4A31A 1QSTA 2DPTA 4H6UA 5AG5A 3T9YA 1Y9KA 3DDDA 4KS9A 4JXRA 5H84A 1WK4A 2BSWA 4UCNA 2R7HA 4XNHB 3UY5A 4F0XA 3EXNA 3W6SA 1S60A 4HNYB 2G0BA 4KOYA 3WR7A 2Z3KA 3LD2A 2VI7A 2ARHA 4A32A 1IIDA 5AG4A 4MY3A 5IV0A 1KUVA 3BLNA 3BJ7A 1QSMA 5JQ4A 3JUWA 1S7LA 4XPLA 1VHSA 2AE6A 3FYNA 3JTKA 3W6XA 4MFZA 1PUAA 2R8VA 5I0CA 5IB0A 2QECA 2RC4A 4JLYA 1U6MA 4KOVA 4KOSA 2B4BA 3IWEA 2AJ6A 1S7NA 1CJWA 3MGDA 2D4PA 2P6EA 1I12A 4M85A 3C26A 4KVXA 5J8CA 2WPWA 2B5GB 4K30A 3IGRA 3R9EA 3TCVA 3R96A 2FIWA 3GY9A 1XE4A 3FNCA 4MFKA 3D3SA 5AG6A 5IX3A 1Z9UA 3R95A 5DWMA 5KTDA 1M44A 3RYOA 3H5ZA 2PRBA 5AGEA 5HMNA 4F0YA 4KOWA 1ZO0A 2VZYA 4R87A 2JEVA 2OH1A 2R98A 1SQHA 4PK3A 1YR0A 4UFXA 2REEA 1LRZA 2HV2A 1GHEA 1Y7RA 2IL4A 4B5PA 3TFYA 3EFAA 3OWCA 4KVOE 3KKWA 4GS4A 3D8PA 4H6ZA 1YK3A 2CNMA 4R3KA 3F5BA 4CAWA 1TIQA 3BJ8A 2HUZA 4QBJA 4MI4A 5DWNA 2Z11A 3PGPA 4MBUA 1B6BA 4H89A 2B3VA 5ISVA 4UCMA 1QSNA 5C82A 1YVOA 2JDCA 3S6KA 4Y49B 2EVNA 4AVAA 2Q0YA 2WPXA 2G3AA 2YNEA 2Z3NA 4OAEA 5J8FA 3CXQA 3QB8A 2VQYA 5KTAA 4MHDA 4MJ8A 4NCZA 3P2HA 5FVJA 3F0AA 3NE7A 1Q2DA 5F49A 3EC4A 4FD5A 4UFWA 2FE7A 2FT0A 3B8GA 4UWIA 3FRMA 2VEZA 2PSWA 1FY7A 3DR6A 3ZZIA 1MJ9A 2CY2A 2P6FA 2B5GA 4KOXA 1KUXA 2DXQA 5G22A 2J8NA 3I3GA 3TT2A 4HNWB 2Q44A 4R57A 4PV6A 2P6GA 2Q4VA 1XMTA 3TO6A 4B13A 4KORA 4C2YA 4RS2A 2PR8A 4M3SA 4Y49C 2VZZA 4QUSA 3K9UA 4JJXA 5G1ZA 1Z4RA 3V8IA 3IU1A 2OZUA 2PQ8A 2JDDA 5F47A 3SHPA 3D2MA 4JXQA 3TOBA 3S6FA 2ZW6A 4PSWA 1IYKA 4XNHC 4ZBGA 3GYAA 2GIVA 3R9FA 2FS5A 4A30A 1S7FA 2Z3PA 1R57A 4YGOA 2B3UA 2YNDA 4NEXA 1BOBA 4JWPA 4LUAA 4CYPA 1V0CA 3H4QA 2OZGA 4MY0A 3PP9A 4C2ZA 4BBHA 4L8AA 3LODA 1IICA 1J4JA 4XPDB 4NXYA 3R9GA 1M4GA 3FIXA 1M4IA 1IYLA 4C7HA 2FSRA 3CXPA 4UFVA 4A95A 4B11A 1ON0A 2F5IA 2YGWA 4KZTA 5F48A 1B87A 2YNCA 4AG7A 1RXTA 4U5YA 2ZPAA 4CAXA 1CM0A 1I1DA 4B10A 2A4NA 4F6AA 2Z3MA 4B5OA 3VWDA 4JD6A 4ONUA 3TO7A 4QVTA 2PDOA 1N71A 4IUSA 5EBVA 2GANA 2OB0A 4AVCA 3F8KA 4A33A 2VBQA 2FL4A 2ZW7A 3SXNA 4CGMA 4CRZB 3G3SA 3IU2A 2Q7BA 5CNPA 4KOUA 5KTCA 5HH1A 4CGLA 2GE3A 3QAHA 4ORFA 4CGNA 2HQYA 1OZPA 4A2ZA 3EY5A 1P0HA 4L89A 2B4DB 3S6GA 4E8OA 1MJAA 1M4DA 3TOAA 3ZJ0A 1YGHA 4R3LA 2X7BA 1PU9A 4MFLA 2VXKA 4B12A 2OZHA 4EVYA 4II9A 1UFHA 5E96A 4KLWA 4ZGYB 4UA3A 2ATRA 4X5KA 3S6HA 4AG9A 2J8MA 4KOTA 3W91A 2C27A 1WWZA 1Z4EA 2EUIA 4CAVA 4CGOA 4CYNA 3R1KA 4CS0B 3G8WA 3TTHA 2PC1A 1XIXA 5A28A 4U9ZA 5A27A 1KUYA 2FCKA 2QMLA 3E0KA 1Q2CA 4FD6A 4YFJA 4AVBA 1YREA 3DR8A 2YNCC 4UCPA 4MFJA 1QSOA 2O28A 3TO9A 3FXTA 2J8RA 2ZW4A 3FB3A 2G3TA 2DPSA 3VWEA 4J3GA 4RI1A 4CAEA 2H5MA 4KLVA 3EO4A 4QB9A 4I49A 1NSLA 4KSFA 2NMTA 4CYQA 4XPKA 4Q38A 2Z10A 3IWGA 2Q04A 4HNXB 5G21A 1RO5A 4NF1A 1YX0A 2CXAA 2JLMA 2Q4YA 4HKFA 2Z3LA 4NSQA 2I79A 2FIAA 1MK4A 5GCNA 1IB1E 5JPHA 4FD4A 1S7KA 2P0WA 3PZJA 5G20A 3N7ZA 1Y9WA 4CGPA 3FBUA 2Z3OA 1MJBA 1NE9A 2B4DA 2KCWA 2Y0MA 4PK2A 5BWAB 2I00A 4MFQA 5H86A 3A9LA 1YLEA 4KUBA 4B14A 4U9YA 2CNSA 3GKRA 4C7IA 4DNCA 3TE4A 4KSAA 3P2FA 4KVME 2B58A 4Q36A 2BEIA 3CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2A A;  4YRH A;  1NMT A;  2ZXV A;  4KUA A;  4BMH A;  4OAD A;  2FXF A;  4PSX A;  3I9S A;  4XPD C;  4LX9 A;  4OLL A;  4UBR A;  5C88 A;  3JVN A;  2K5T A;  3DSB A;  1VKC A;  1YVK A;  1M1D A;  4QC6 A;  2BUE A;  1XEB A;  1Q2Y A;  1S5K A;  2OU2 A;  5F46 A;  2R1I A;  4IF5 A;  1P4N A;  1QSR A;  2PR1 A;  5EC4 A;  1I21 A;  4E0A A;  3DNS A;  3SXO A;  4FD7 A;  4CRY B;  3D2P A;  1XF8 A;  4UWJ A;  4R9M A;  2ZW5 A;  2Z0Z A;  1L0C A;  2CNT A;  4AB7 A;  1K4J A;  2D4O A;  1KZF A;  2REF A;  3T90 A;  1S3Z A;  1BO4 A;  2BL1 A;  2QIR A;  4B5P B;  1QST A;  4H6U A;  3T9Y A;  1Y9K A;  3DDD A;  4JXR A;  5H84 A;  1WK4 A;  2BSW A;  2R7H A;  4XNH B;  3UY5 A;  3EXN A;  3W6S A;  1S60 A;  4HNY B;  2G0B A;  4KOY A;  3WR7 A;  3LD2 A;  2VI7 A;  2ARH A;  1IID A;  4MY3 A;  5IV0 A;  1KUV A;  3BLN A;  3BJ7 A;  1QSM A;  5JQ4 A;  3JUW A;  1S7L A;  4XPL A;  1VHS A;  2AE6 A;  3FYN A;  3W6X A;  1PUA A;  2R8V A;  5I0C A;  5IB0 A;  2QEC A;  2RC4 A;  4JLY A;  1U6M A;  4KOV A;  4KOS A;  2B4B A;  2AJ6 A;  1S7N A;  1CJW A;  3MGD A;  2D4P A;  2P6E A;  4M85 A;  1I12 A;  3C26 A;  4KVX A;  5J8C A;  2WPW A;  2B5G B;  4K30 A;  3IGR A;  3R9E A;  3TCV A;  3R96 A;  2FIW A;  3GY9 A;  1XE4 A;  3FNC A;  3D3S A;  5IX3 A;  1Z9U A;  3R95 A;  5DWM A;  5KTD A;  1M44 A;  3RYO A;  2PRB A;  5HMN A;  4F0Y A;  4KOW A;  2VZY A;  4R87 A;  2JEV A;  2OH1 A;  2R98 A;  1SQH A;  4PK3 A;  1YR0 A;  2REE A;  1LRZ A;  2HV2 A;  1GHE A;  1Y7R A;  2IL4 A;  4B5P A;  3TFY A;  3EFA A;  3OWC A;  4KVO E;  3KKW A;  4GS4 A;  3D8P A;  4H6Z A;  1YK3 A;  2CNM A;  4R3K A;  3F5B A;  4CAW A;  1TIQ A;  3BJ8 A;  2HUZ A;  4QBJ A;  4MI4 A;  5DWN A;  2Z11 A;  3PGP A;  4MBU A;  1B6B A;  4H89 A;  2B3V A;  5ISV A;  1QSN A;  5C82 A;  1YVO A;  2JDC A;  3S6K A;  4Y49 B;  2EVN A;  4AVA A;  2Q0Y A;  2WPX A;  2G3A A;  4OAE A;  5J8F A;  3CXQ A;  3QB8 A;  2VQY A;  5KTA A;  4MHD A;  4MJ8 A;  4NCZ A;  3P2H A;  5FVJ A;  3F0A A;  3NE7 A;  1Q2D A;  5F49 A;  3EC4 A;  4FD5 A;  2FE7 A;  2FT0 A;  3B8G A;  4UWI A;  3FRM A;  2VEZ A;  2PSW A;  1FY7 A;  3DR6 A;  3ZZI A;  1MJ9 A;  2CY2 A;  2P6F A;  2B5G A;  4KOX A;  1KUX A;  2DXQ A;  2J8N A;  3I3G A;  3TT2 A;  4HNW B;  2Q44 A;  4R57 A;  4PV6 A;  2P6G A;  2Q4V A;  1XMT A;  3TO6 A;  4KOR A;  4RS2 A;  2PR8 A;  4M3S A;  4Y49 C;  2VZZ A;  4QUS A;  3K9U A;  4JJX A;  1Z4R A;  3V8I A;  2OZU A;  2PQ8 A;  2JDD A;  5F47 A;  3SHP A;  3D2M A;  4JXQ A;  3TOB A;  3S6F A;  2ZW6 A;  4PSW A;  1IYK A;  4XNH C;  4ZBG A;  3GYA A;  2GIV A;  3R9F A;  2FS5 A;  1S7F A;  1R57 A;  4YGO A;  2B3U A;  4NEX A;  1BOB A;  4JWP A;  4LUA A;  1V0C A;  3H4Q A;  2OZG A;  4MY0 A;  3PP9 A;  4L8A A;  3LOD A;  1IIC A;  1J4J A;  4XPD B;  4NXY A;  3R9G A;  1M4G A;  3FIX A;  1M4I A;  1IYL A;  2FSR A;  3CXP A;  1ON0 A;  2F5I A;  4KZT A;  5F48 A;  4AG7 A;  1B87 A;  1RXT A;  4U5Y A;  2ZPA A;  4CAX A;  1CM0 A;  1I1D A;  2A4N A;  4F6A A;  4B5O A;  3VWD A;  4JD6 A;  4ONU A;  3TO7 A;  4QVT A;  2PDO A;  1N71 A;  4IUS A;  5EBV A;  2GAN A;  2OB0 A;  4AVC A;  3F8K A;  2VBQ A;  2FL4 A;  2ZW7 A;  3SXN A;  4CRZ B;  3G3S A;  2Q7B A;  5CNP A;  4KOU A;  5KTC A;  5HH1 A;  2GE3 A;  3QAH A;  4ORF A;  2HQY A;  1OZP A;  3EY5 A;  1P0H A;  4L89 A;  2B4D B;  3S6G A;  4E8O A;  1MJA A;  1M4D A;  3TOA A;  3ZJ0 A;  1YGH A;  4R3L A;  2X7B A;  1PU9 A;  2VXK A;  2OZH A;  4EVY A;  4II9 A;  1UFH A;  5E96 A;  4KLW A;  4UA3 A;  2ATR A;  4X5K A;  3S6H A;  4AG9 A;  2J8M A;  4KOT A;  3W91 A;  2C27 A;  1WWZ A;  1Z4E A;  2EUI A;  4CAV A;  3R1K A;  4CS0 B;  3G8W A;  3TTH A;  2PC1 A;  1XIX A;  4U9Z A;  1KUY A;  2FCK A;  2QML A;  3E0K A;  1Q2C A;  4FD6 A;  4YFJ A;  4AVB A;  1YRE A;  3DR8 A;  1QSO A;  2O28 A;  3TO9 A;  3FXT A;  2J8R A;  2ZW4 A;  3FB3 A;  2G3T A;  3VWE A;  4J3G A;  4RI1 A;  2H5M A;  4KLV A;  3EO4 A;  4QB9 A;  4I49 A;  1NSL A;  2NMT A;  4XPK A;  2Z10 A;  3IWG A;  2Q04 A;  4HNX B;  1RO5 A;  4NF1 A;  1YX0 A;  2JLM A;  2Q4Y A;  4HKF A;  4NSQ A;  2I79 A;  2FIA A;  1MK4 A;  5GCN A;  1IB1 E;  5JPH A;  4FD4 A;  1S7K A;  2P0W A;  3PZJ A;  3N7Z A;  1Y9W A;  3FBU A;  1MJB A;  1NE9 A;  2B4D A;  2KCW A;  2Y0M A;  4PK2 A;  2I00 A;  5H86 A;  1YLE A;  4KUB A;  4U9Y A;  2CNS A;  3GKR A;  3TE4 A;  4DNC A;  3P2F A;  4KVM E;  2B58 A;  2BEI A;  3CXS A; 
#chains in the Genus database with same CATH topology
 1LAM A;  4YRH A;  4E2A A;  1NMT A;  4C2X A;  2ZXV A;  4KUA A;  4BMH A;  1YSJ A;  3DLJ A;  2PJ8 A;  2ZEE A;  3H8F A;  3SJF A;  4OAD A;  2FXF A;  4PSX A;  3I9S A;  4UF4 A;  4P4F A;  4XPD C;  1QMU A;  2O4H A;  4LX9 A;  4OLL A;  2C6G A;  4UBR A;  4X8I A;  5C88 A;  4NGN A;  3JVN A;  2K5T A;  2WUU A;  2PE3 A;  3DSB A;  1VKC A;  1YVK A;  5K8P A;  1TKJ A;  1M1D A;  5K8N A;  4QC6 A;  2BUE A;  1Z8T A;  4WJB A;  1XEB A;  3IIB A;  3GLJ A;  5LYL A;  1H8L A;  1Y0Y A;  4NGS A;  4NGP A;  3B3V A;  1Q2Y A;  1S5K A;  2GFQ A;  2OU2 A;  5AG7 A;  5F46 A;  4NJQ A;  2R1I A;  4IF5 A;  1P4N A;  1QSR A;  2PR1 A;  4F9U A;  4PXE A;  2GU2 A;  4C68 A;  5EC4 A;  1I21 A;  4AXV A;  4CYO A;  4E0A A;  3V7Z A;  3DNS A;  3SXO A;  1BPN A;  4YU9 A;  4EWT A;  1GYT A;  4FD7 A;  4CRY B;  3D2P A;  4MRI A;  1XF8 A;  3CT9 A;  4UWJ A;  4MFP A;  4R9M A;  2ZW5 A;  2Z0Z A;  2WSA A;  5HVF A;  1KWM A;  1L0C A;  2CNT A;  1AMP A;  4AB7 A;  1K4J A;  2D4O A;  4CAF A;  3T9Y A;  1KZF A;  1R43 A;  1UWY A;  2REF A;  1DTD A;  1BO4 A;  1S3Z A;  3T90 A;  2BL1 A;  2DEA A;  2QIR A;  3KHX A;  3SI1 A;  4A37 A;  1ELM P;  3B3W A;  2GRE A;  2VL1 A;  2CIJ A;  4B5P B;  1RTQ A;  4A31 A;  1QST A;  2DPT A;  4H6U A;  5AG5 A;  2PJ5 A;  1Y9K A;  2CF4 A;  2GLF A;  2PJA A;  2PJ1 A;  3D67 A;  3DDD A;  4KS9 A;  4PXB A;  3PRT A;  4JXR A;  5H84 A;  1WK4 A;  2BSW A;  1LFW A;  2R7H A;  4UCN A;  4UEZ A;  4XNH B;  3FX6 A;  3UY5 A;  4F0X A;  3B7I A;  3EXN A;  2XEJ A;  3W6S A;  4OC2 A;  2C6C A;  2ZEP A;  1S60 A;  4OKO A;  3H8G A;  3D7D A;  4HNY B;  3T8W A;  2BOA A;  2G0B A;  3SI2 A;  4OP4 A;  4OME A;  4KOY A;  3WR7 A;  2DF5 A;  5I4M A;  2Z3K A;  1HDU A;  3LD2 A;  2VI7 A;  2ARH A;  4OC1 A;  4A32 A;  1IID A;  3PBB A;  3WT4 A;  2WYR A;  5AG4 A;  4MY3 A;  1ELL P;  4OC0 A;  5IV0 A;  1KUV A;  3BLN A;  3BJ7 A;  2PJC A;  1QSM A;  5JQ4 A;  3JUW A;  1S7L A;  2EK9 A;  4XPL A;  1VHS A;  2AE6 A;  3FYN A;  3JTK A;  3W6X A;  3FMC A;  3KHZ A;  4MFZ A;  4MCR A;  1PUA A;  7CPA A;  2R8V A;  4JYW A;  5I0C A;  4P4E A;  5IB0 A;  2QEC A;  2RC4 A;  4JLY A;  4R8F A;  1U6M A;  4HPS A;  4KOV A;  2V8V A;  8CPA A;  2AFX A;  4KOS A;  2B4B A;  3D66 A;  5LRG A;  1F57 A;  3L2N A;  1XOV A;  3IWE A;  1LAP A;  2AJ6 A;  1Y0R A;  4WWV A;  1A2Z A;  1Y7E A;  1S7N A;  1CJW A;  2PVV A;  3MGD A;  4DJL A;  2D4P A;  2P6E A;  1IY7 A;  1I12 A;  3DGV A;  3C26 A;  4M85 A;  4KVX A;  5J8C A;  4R76 A;  2WPW A;  2B5G B;  4K30 A;  4MCP A;  4FBE A;  3IGR A;  2BO9 A;  4NJR A;  4IK2 A;  3R9E A;  3TCV A;  4RUH A;  3ISZ A;  3R96 A;  3WAB A;  3TC8 A;  2FIW A;  3GY9 A;  4NGM A;  1XE4 A;  4BIN A;  4A94 A;  3FNC A;  2PJ3 A;  1CP6 A;  4MFK A;  3D3S A;  5AG6 A;  2AFU A;  2F8H A;  1F2O A;  4W9Y A;  4K3N A;  5IX3 A;  2V77 A;  1Z9U A;  3B3S A;  3R95 A;  5HVH A;  5DWM A;  5KTD A;  1ARL A;  1M44 A;  3RYO A;  3PFO A;  3FJU A;  3H5Z A;  2PRB A;  4MHY A;  4Q7A A;  5AGE A;  5HMN A;  4F0Y A;  4KOW A;  4H2K A;  1ZO0 A;  2VZY A;  4MHP A;  4R87 A;  2JBJ A;  3VAR A;  3CDX A;  2JEV A;  2OH1 A;  2R98 A;  1SQH A;  1R3N A;  4PK3 A;  1YR0 A;  3BHX A;  1OBR A;  4UFX A;  2JEW A;  2REE A;  1LRZ A;  2HV2 A;  1GHE A;  1Y7R A;  2ANP A;  2IL4 A;  4B5P A;  2FVG A;  2IQ6 A;  2IMO A;  3TFY A;  3EFA A;  3OWC A;  2AFO A;  4KVO E;  3KKW A;  4GS4 A;  3D8P A;  4H6Z A;  1F2P A;  2BCO A;  1VGY A;  4RN7 A;  1YK3 A;  2CNM A;  4IAV A;  4R3K A;  5CPA A;  3F5B A;  1ARM A;  1TIQ A;  4CAW A;  2ODF A;  3H8E A;  3BJ8 A;  3B3T A;  2XEI A;  2HUZ A;  4QBJ A;  4NFR A;  5LYF A;  2PRQ A;  4MI4 A;  1Z8X A;  1FNO A;  5DWN A;  2Z11 A;  3NA6 A;  4TWE A;  3B35 A;  3RNZ A;  1TF8 A;  3PGP A;  4MBU A;  4X2T A;  2HB6 A;  1B6B A;  1CX8 A;  4H89 A;  1ZLI A;  4OC4 A;  4P4B A;  3PEI A;  2B3V A;  5ISV A;  4UCM A;  1QSN A;  2XEG A;  5C82 A;  1YVO A;  5IB9 A;  4PPZ A;  4M6I A;  3S9N A;  1XBU A;  2JDC A;  3TX8 A;  3S6K A;  4Y49 B;  5HXD A;  2EVN A;  4AVA A;  2Q0Y A;  1Z2L A;  2WPX A;  3RBU A;  2G3A A;  2YNE A;  2Z3N A;  4OAE A;  2CTB A;  5J8F A;  3CXQ A;  5LRK A;  3IEH A;  3QB8 A;  2VQY A;  5KTA A;  4MHD A;  4MJ8 A;  4NCZ A;  3P2H A;  5FVJ A;  1CPS A;  3F0A A;  3NE7 A;  1Q2D A;  5F49 A;  3EC4 A;  4FD5 A;  4UFW A;  2FE7 A;  2EK8 A;  2FT0 A;  3GB0 A;  4UEF A;  3B8G A;  4UWI A;  3FRM A;  3MRU A;  2VEZ A;  2PSW A;  1FY7 A;  1ZG9 A;  3DR6 A;  3NH4 A;  3ZZI A;  4ZYQ A;  2G9D A;  4KSI A;  1MJ9 A;  3KR4 A;  2CY2 A;  2O53 A;  2P6F A;  4GXH A;  1LOK A;  2B5G A;  5LYD A;  4KOX A;  2ZEO A;  2ZEN A;  1KUX A;  2DXQ A;  5D8N A;  2ZEH A;  4MXU A;  3SI0 A;  2CTC A;  5G22 A;  1EE3 P;  1VIX A;  2J8N A;  2ZEF A;  3I3G A;  4P44 A;  3TT2 A;  4HNW B;  3FH4 A;  2V8H A;  2Q44 A;  1PCA A;  2I3C A;  4G1P A;  4R57 A;  3S9M A;  1IOI A;  2P6G A;  3CPX A;  4PV6 A;  4YWY A;  2Q4V A;  1XMT A;  1TF9 A;  3TO6 A;  4B13 A;  4KOR A;  4C2Y A;  4RS2 A;  2PR8 A;  2QJ8 A;  3NH8 A;  3KI9 A;  4M3S A;  1X12 A;  1YW4 A;  1TXR A;  4Y49 C;  2VZZ A;  4NGR A;  3D4U A;  4NGQ A;  3PB8 X;  3K9U A;  1DE4 C;  4QUS A;  3BXM A;  3VH9 A;  4JJX A;  4ONW A;  5G1Z A;  1TKF A;  1XFO A;  1Z4R A;  3V8I A;  3IU1 A;  4A38 A;  4FWU A;  3K2K A;  4R7M A;  2OZU A;  2PQ8 A;  2JDD A;  1CPX A;  3KGQ A;  4TNU A;  4UEE A;  3D2M A;  4JXQ A;  5F47 A;  3SHP A;  4ZX8 A;  3TOB A;  2AFW A;  4M6H A;  3S6F A;  2ZW6 A;  4PSW A;  1IYK A;  4XNH C;  3I1U A;  4ZBG A;  1XRY A;  3GYA A;  2GIV A;  1M4L A;  2FS5 A;  2V8G A;  3R9F A;  4A30 A;  1S7F A;  2Z3P A;  1R57 A;  4YGO A;  2PJ9 A;  1FT7 A;  1CG2 A;  4OIW A;  2B3U A;  2YND A;  2V8D A;  4NEX A;  1BOB A;  4MCQ A;  4JWP A;  4BD9 A;  4LUA A;  4CYP A;  1V0C A;  3FVL A;  3H4Q A;  2OZG A;  4MY0 A;  3PP9 A;  4C2Z A;  4BBH A;  4L8A A;  2Q4Z A;  3NH5 A;  3LOD A;  1IIC A;  2QVP A;  1J4J A;  4OID A;  3PFE A;  4NXY A;  4XPD B;  1YQE A;  3R9G A;  4UIA A;  1VHE A;  5D29 A;  1M4G A;  4R6T A;  2EO8 A;  1M4I A;  3FIX A;  1IYL A;  2WZN A;  5DS0 A;  4C7H A;  2FSR A;  3PB7 X;  3CXP A;  4ZY1 A;  4UFV A;  4A95 A;  1YW6 A;  3GIU A;  3PB6 X;  4OC5 A;  4B11 A;  3FED A;  1ON0 A;  2EWB A;  5F09 A;  2F5I A;  2YGW A;  4KZT A;  5F48 A;  1B87 A;  2F7V A;  2YNC A;  4AG7 A;  4DUK A;  1RXT A;  1ZG8 A;  3KR5 A;  2ZPA A;  1YME A;  4U5Y A;  2Q51 A;  2OOT A;  2OR4 A;  4CAX A;  3HUV A;  1CM0 A;  4FAI A;  4FUU A;  1I1D A;  4B10 A;  2A4N A;  4F9V A;  4F6A A;  2Z3M A;  3B2Y A;  2C1C A;  5HVG A;  2QYV A;  4B5O A;  4EME A;  3VWD A;  4JD6 A;  4ONU A;  3TO7 A;  2PIZ A;  4A39 A;  3CZX A;  4QVT A;  2PDO A;  4P4D A;  2ABZ A;  1N71 A;  4IUS A;  5EBV A;  4ZI6 A;  2ZED A;  2GAN A;  4Z65 A;  1IOF A;  2OB0 A;  4AVC A;  3F8K A;  4A33 A;  2PJB A;  1IU8 A;  2XEF A;  2VBQ A;  2ZOG A;  2FL4 A;  2ZW7 A;  3SXN A;  4CGM A;  4CRZ B;  3G3S A;  1AYE A;  3SJG A;  3IU2 A;  4LQG A;  2Q7B A;  5CNP A;  4KOU A;  5JGF A;  3KQZ A;  5KTC A;  1NSA A;  2ZOF A;  5HH1 A;  5K8O A;  2ZEL A;  2EBJ A;  4NGT A;  4CGL A;  2GE3 A;  1X10 A;  3QAH A;  4ORF A;  4CGN A;  3RZA A;  2HQY A;  1OZP A;  4A2Z A;  3EY5 A;  3FF3 A;  3IWW A;  3FEE A;  3PBE A;  4O23 A;  1P0H A;  1Q7L A;  4L89 A;  4ZY2 A;  2B4D B;  2JBK A;  1BPM A;  3IC1 A;  3S6G A;  4F8Z A;  4E8O A;  1MJA A;  1Z8L A;  1JQG A;  1M4D A;  3TOA A;  3ZJ0 A;  1YGH A;  4R3L A;  4P10 A;  2X7B A;  4LQ6 A;  1PU9 A;  3KZW A;  2NYQ A;  4MFL A;  1XJO A;  3FEC A;  2PJ6 A;  2VXK A;  4B12 A;  3IFE A;  1BAV A;  2OZH A;  4EVY A;  3N5F A;  4II9 A;  5JH9 A;  1UFH A;  5E96 A;  4KLW A;  2PJ7 A;  4ZGY B;  4UA3 A;  2AFS A;  2ATR A;  1TKH A;  2ZEM A;  4X5K A;  3S6H A;  4UIB A;  4OC3 A;  4AG9 A;  2J8M A;  4KOT A;  3W91 A;  2C27 A;  1WWZ A;  1Z4E A;  1YLO A;  2EUI A;  4CAV A;  4CGO A;  3WC5 A;  2Q7S A;  2PIY A;  3BI0 A;  3K9T A;  3KAS A;  4CYN A;  5LYI A;  3BI1 A;  3R1K A;  4CS0 B;  3G8W A;  5K8M A;  1AUG A;  1VHO A;  3D68 A;  3D7F A;  3TTH A;  2PC1 A;  1XIX A;  5A28 A;  3B3C A;  4U9Z A;  5A27 A;  1KUY A;  2FCK A;  4PXC A;  1HDQ A;  2QML A;  3E0K A;  1Q2C A;  4FD6 A;  4YFJ A;  1CBX A;  4P45 A;  4AVB A;  4PXD A;  4DYO A;  1YRE A;  3SJX A;  3LWU A;  3DR8 A;  2YNC C;  1ZG7 A;  4UCP A;  2PVW A;  5ELY A;  4MFJ A;  1HEE A;  1QSO A;  2O28 A;  4JZ0 A;  3LMS A;  3MN8 A;  4MHZ A;  5THW A;  1CP7 A;  3JRU A;  3TO9 A;  3FXT A;  3V38 A;  1LCP A;  2J8R A;  1JWQ A;  2ZW4 A;  3FB3 A;  1Z8W A;  3PB4 X;  2G3T A;  2DPS A;  5EMI A;  3VWE A;  2C6P A;  3D7G A;  4IHM A;  4ZX9 A;  4J3G A;  4RI1 A;  3KQX A;  4B6Z A;  4CAE A;  2H5M A;  4KLV A;  3EO4 A;  4MHN A;  4QB9 A;  4I49 A;  1NSL A;  4CPA A;  3IO1 A;  2NMT A;  4KSF A;  4CYQ A;  4XPK A;  3HLP A;  4Q38 A;  3RAM A;  2PJ4 A;  2Z10 A;  4P4J A;  3IWG A;  2Q04 A;  3QNV A;  3NE8 A;  4HNX B;  4X3R A;  3PB9 X;  5G21 A;  1RO5 A;  4MMO A;  4NF1 A;  1YX0 A;  1BLL E;  2CXA A;  2JLM A;  2PCU A;  2Q4Y A;  5LRJ A;  2AFM A;  2PJ2 A;  2Q43 A;  1ZLH A;  4HKF A;  4P4I A;  1LAN A;  2Z3L A;  4PQA A;  4NSQ A;  2I79 A;  4EFD A;  4M6G A;  2FIA A;  2IJZ A;  2RFH A;  1MK4 A;  5GCN A;  3IJ3 A;  1IB1 E;  5JPH A;  4FD4 A;  1S7K A;  4P6Y A;  4ZY0 A;  2RB7 A;  2P0W A;  3PZJ A;  5G20 A;  3RO0 A;  3N7Z A;  1Y9W A;  3KL9 A;  4CGP A;  3FBU A;  2Z3O A;  1MJB A;  1NE9 A;  2PJ0 A;  2B4D A;  5JM6 A;  2KCW A;  4MCS A;  1QQ9 A;  3NFZ A;  2Y0M A;  2ZEG A;  3WC6 A;  3CPA A;  2GLJ A;  4PK2 A;  3D7H A;  5BWA B;  2I00 A;  1IGB A;  2AFZ A;  4MFQ A;  3VAT A;  5CBM A;  5H86 A;  3A9L A;  1YLE A;  1XMB A;  4KUB A;  1PYT B;  2HC9 A;  3GUX A;  3WC7 A;  1Z5R A;  4B14 A;  3SJE A;  4U9Y A;  6CPA A;  2CNS A;  2NSM A;  3GKR A;  3LAC A;  4C7I A;  4DNC A;  3S9L A;  3TE4 A;  4GM5 A;  4KSA A;  5J1Q A;  3P2F A;  4KVM E;  2J9A A;  2POK A;  3ISX A;  2B58 A;  4Q36 A;  3QAY A;  2BEI A;  3CXS A; 
#chains in the Genus database with same CATH homology
 4E2A A;  4YRH A;  1NMT A;  4C2X A;  2ZXV A;  4KUA A;  4BMH A;  4OAD A;  2FXF A;  4PSX A;  3I9S A;  4XPD C;  4LX9 A;  4OLL A;  4UBR A;  5C88 A;  3JVN A;  2K5T A;  2WUU A;  3DSB A;  1VKC A;  1YVK A;  1M1D A;  4QC6 A;  2BUE A;  1XEB A;  1Q2Y A;  1S5K A;  2OU2 A;  5AG7 A;  5F46 A;  2R1I A;  4IF5 A;  1P4N A;  1QSR A;  2PR1 A;  4C68 A;  5EC4 A;  1I21 A;  4CYO A;  4E0A A;  3DNS A;  3SXO A;  4FD7 A;  4CRY B;  3D2P A;  1XF8 A;  4UWJ A;  4MFP A;  4R9M A;  2ZW5 A;  2Z0Z A;  2WSA A;  1L0C A;  2CNT A;  4AB7 A;  1K4J A;  2D4O A;  4CAF A;  1KZF A;  2REF A;  3T90 A;  1S3Z A;  1BO4 A;  2BL1 A;  2QIR A;  4B5P B;  4A31 A;  1QST A;  2DPT A;  4H6U A;  5AG5 A;  3T9Y A;  1Y9K A;  3DDD A;  4KS9 A;  4JXR A;  5H84 A;  1WK4 A;  2BSW A;  4UCN A;  2R7H A;  4XNH B;  3UY5 A;  4F0X A;  3EXN A;  3W6S A;  1S60 A;  4HNY B;  2G0B A;  4KOY A;  3WR7 A;  2Z3K A;  3LD2 A;  2VI7 A;  2ARH A;  4A32 A;  1IID A;  5AG4 A;  4MY3 A;  5IV0 A;  1KUV A;  3BLN A;  3BJ7 A;  1QSM A;  5JQ4 A;  3JUW A;  1S7L A;  4XPL A;  1VHS A;  2AE6 A;  3FYN A;  3JTK A;  3W6X A;  4MFZ A;  1PUA A;  2R8V A;  5I0C A;  5IB0 A;  2QEC A;  2RC4 A;  4JLY A;  1U6M A;  4KOV A;  4KOS A;  2B4B A;  3IWE A;  2AJ6 A;  1S7N A;  1CJW A;  3MGD A;  2D4P A;  2P6E A;  1I12 A;  4M85 A;  3C26 A;  4KVX A;  5J8C A;  2WPW A;  2B5G B;  4K30 A;  3IGR A;  3R9E A;  3TCV A;  3R96 A;  2FIW A;  3GY9 A;  1XE4 A;  3FNC A;  4MFK A;  3D3S A;  5AG6 A;  5IX3 A;  1Z9U A;  3R95 A;  5DWM A;  5KTD A;  1M44 A;  3RYO A;  3H5Z A;  2PRB A;  5AGE A;  5HMN A;  4F0Y A;  4KOW A;  1ZO0 A;  2VZY A;  4R87 A;  2JEV A;  2OH1 A;  2R98 A;  1SQH A;  4PK3 A;  1YR0 A;  4UFX A;  2REE A;  1LRZ A;  2HV2 A;  1GHE A;  1Y7R A;  2IL4 A;  4B5P A;  3TFY A;  3EFA A;  3OWC A;  4KVO E;  3KKW A;  4GS4 A;  3D8P A;  4H6Z A;  1YK3 A;  2CNM A;  4R3K A;  3F5B A;  4CAW A;  1TIQ A;  3BJ8 A;  2HUZ A;  4QBJ A;  4MI4 A;  5DWN A;  2Z11 A;  3PGP A;  4MBU A;  1B6B A;  4H89 A;  2B3V A;  5ISV A;  4UCM A;  1QSN A;  5C82 A;  1YVO A;  2JDC A;  3S6K A;  4Y49 B;  2EVN A;  4AVA A;  2Q0Y A;  2WPX A;  2G3A A;  2YNE A;  2Z3N A;  4OAE A;  5J8F A;  3CXQ A;  3QB8 A;  2VQY A;  5KTA A;  4MHD A;  4MJ8 A;  4NCZ A;  3P2H A;  5FVJ A;  3F0A A;  3NE7 A;  1Q2D A;  5F49 A;  3EC4 A;  4FD5 A;  4UFW A;  2FE7 A;  2FT0 A;  3B8G A;  4UWI A;  3FRM A;  2VEZ A;  2PSW A;  1FY7 A;  3DR6 A;  3ZZI A;  1MJ9 A;  2CY2 A;  2P6F A;  2B5G A;  4KOX A;  1KUX A;  2DXQ A;  5G22 A;  2J8N A;  3I3G A;  3TT2 A;  4HNW B;  2Q44 A;  4R57 A;  4PV6 A;  2P6G A;  2Q4V A;  1XMT A;  3TO6 A;  4B13 A;  4KOR A;  4C2Y A;  4RS2 A;  2PR8 A;  4M3S A;  4Y49 C;  2VZZ A;  4QUS A;  3K9U A;  4JJX A;  5G1Z A;  1Z4R A;  3V8I A;  3IU1 A;  2OZU A;  2PQ8 A;  2JDD A;  5F47 A;  3SHP A;  3D2M A;  4JXQ A;  3TOB A;  3S6F A;  2ZW6 A;  4PSW A;  1IYK A;  4XNH C;  4ZBG A;  3GYA A;  2GIV A;  3R9F A;  2FS5 A;  4A30 A;  1S7F A;  2Z3P A;  1R57 A;  4YGO A;  2B3U A;  2YND A;  4NEX A;  1BOB A;  4JWP A;  4LUA A;  4CYP A;  1V0C A;  3H4Q A;  2OZG A;  4MY0 A;  3PP9 A;  4C2Z A;  4BBH A;  4L8A A;  3LOD A;  1IIC A;  1J4J A;  4XPD B;  4NXY A;  3R9G A;  1M4G A;  3FIX A;  1M4I A;  1IYL A;  4C7H A;  2FSR A;  3CXP A;  4UFV A;  4A95 A;  4B11 A;  1ON0 A;  2F5I A;  2YGW A;  4KZT A;  5F48 A;  1B87 A;  2YNC A;  4AG7 A;  1RXT A;  4U5Y A;  2ZPA A;  4CAX A;  1CM0 A;  1I1D A;  4B10 A;  2A4N A;  4F6A A;  2Z3M A;  4B5O A;  3VWD A;  4JD6 A;  4ONU A;  3TO7 A;  4QVT A;  2PDO A;  1N71 A;  4IUS A;  5EBV A;  2GAN A;  2OB0 A;  4AVC A;  3F8K A;  4A33 A;  2VBQ A;  2FL4 A;  2ZW7 A;  3SXN A;  4CGM A;  4CRZ B;  3G3S A;  3IU2 A;  2Q7B A;  5CNP A;  4KOU A;  5KTC A;  5HH1 A;  4CGL A;  2GE3 A;  3QAH A;  4ORF A;  4CGN A;  2HQY A;  1OZP A;  4A2Z A;  3EY5 A;  1P0H A;  4L89 A;  2B4D B;  3S6G A;  4E8O A;  1MJA A;  1M4D A;  3TOA A;  3ZJ0 A;  1YGH A;  4R3L A;  2X7B A;  1PU9 A;  4MFL A;  2VXK A;  4B12 A;  2OZH A;  4EVY A;  4II9 A;  1UFH A;  5E96 A;  4KLW A;  4ZGY B;  4UA3 A;  2ATR A;  4X5K A;  3S6H A;  4AG9 A;  2J8M A;  4KOT A;  3W91 A;  2C27 A;  1WWZ A;  1Z4E A;  2EUI A;  4CAV A;  4CGO A;  4CYN A;  3R1K A;  4CS0 B;  3G8W A;  3TTH A;  2PC1 A;  1XIX A;  5A28 A;  4U9Z A;  5A27 A;  1KUY A;  2FCK A;  2QML A;  3E0K A;  1Q2C A;  4FD6 A;  4YFJ A;  4AVB A;  1YRE A;  3DR8 A;  2YNC C;  4UCP A;  4MFJ A;  1QSO A;  2O28 A;  3TO9 A;  3FXT A;  2J8R A;  2ZW4 A;  3FB3 A;  2G3T A;  2DPS A;  3VWE A;  4J3G A;  4RI1 A;  4CAE A;  2H5M A;  4KLV A;  3EO4 A;  4QB9 A;  4I49 A;  1NSL A;  4KSF A;  2NMT A;  4CYQ A;  4XPK A;  4Q38 A;  2Z10 A;  3IWG A;  2Q04 A;  4HNX B;  5G21 A;  1RO5 A;  4NF1 A;  1YX0 A;  2CXA A;  2JLM A;  2Q4Y A;  4HKF A;  2Z3L A;  4NSQ A;  2I79 A;  2FIA A;  1MK4 A;  5GCN A;  1IB1 E;  5JPH A;  4FD4 A;  1S7K A;  2P0W A;  3PZJ A;  5G20 A;  3N7Z A;  1Y9W A;  4CGP A;  3FBU A;  2Z3O A;  1MJB A;  1NE9 A;  2B4D A;  2KCW A;  2Y0M A;  4PK2 A;  5BWA B;  2I00 A;  4MFQ A;  5H86 A;  3A9L A;  1YLE A;  4KUB A;  4B14 A;  4U9Y A;  2CNS A;  3GKR A;  4C7I A;  4DNC A;  3TE4 A;  4KSA A;  3P2F A;  4KVM E;  2B58 A;  4Q36 A;  2BEI A;  3CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...