1QSOA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
b'NITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 32
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsoA00
3FXTA 4XPDC 1Q2DA 4MBUA 3PP9A 2EUIA 4AG7A 2B4BA 4UWIA 2I79A 2REEA 1YR0A 3D8PA 4XNHC 3TO7A 1R57A 2PRBA 2RC4A 2D4PA 5CNPA 3W6XA 4ONUA 4Y49B 3IGRA 1P4NA 1I12A 3F5BA 2CNTA 3R1KA 3LD2A 4NEXA 3FRMA 1VKCA 2FE7A 3VWDA 2B4DA 2PDOA 4HNYB 3FIXA 3MGDA 4KVXA 3JVNA 2PQ8A 2R8VA 1XIXA 3UY5A 4L8AA 2IL4A 4LX9A 2JDCA 2Z0ZA 2OZUA 1RXTA 4R87A 1Y9KA 3E0KA 3FB3A 2GE3A 3SXOA 2P0WA 2Q4VA 4CAVA 3DDDA 4CRYB 2BEIA 4MHDA 2Q44A 4PSWA 1Z9UA 3SHPA 4MY3A 1S7NA 2FCKA 2ZW4A 5KTDA 2BSWA 4F0YA 1XF8A 3T9YA 2KCWA 4YRHA 3TOAA 1S7FA 4KOUA 1IB1E 1IICA 3BJ8A 3EC4A 4KVOE 5H84A 3WR7A 3GYAA 3TO9A 5KTAA 5IV0A 1M4DA 4FD4A 4J3GA 5GCNA 1S7LA 2BL1A 4GS4A 1YX0A 1YREA 5H86A 4II9A 3PGPA 5E96A 1KZFA 1P0HA 1S7KA 4L89A 3EY5A 3EFAA 4MJ8A 2OZHA 4KOVA 1QSMA 5DWNA 1KUXA 4R3LA 5DWMA 2FS5A 4PV6A 1KUYA 2K5TA 4K30A 1IIDA 3QB8A 3ZJ0A 2GIVA 3T90A 4NCZA 2AE6A 4KVME 1B6BA 2P6GA 1I1DA 2G3AA 2WPWA 1QSNA 3LODA 2AJ6A 2PC1A 1CJWA 4MI4A 1QSTA 2P6FA 1UFHA 2CNMA 2FSRA 5F46A 3FBUA 3TOBA 4KUAA 4U5YA 3D2MA 2P6EA 3GKRA 1FY7A 1CM0A 1XE4A 2JLMA 4QUSA 2D4OA 4XPLA 1YGHA 2FXFA 2ZW7A 4XPDB 3C26A 2H5MA 3FNCA 5I0CA 3TO6A 4KOXA 3B8GA 3R9EA 3RYOA 4XNHB 3P2FA 2CY2A 1WK4A 1S5KA 3JUWA 5IX3A 3H4QA 4UWJA 4NF1A 4E0AA 3G3SA 2VXKA 2A4NA 1BO4A 2OZGA 2HUZA 2ZXVA 4E2AA 3DR6A 2ARHA 3I3GA 2PSWA 4JJXA 2QECA 2O28A 4NXYA 3TFYA 2Q0YA 4R57A 2G3TA 3NE7A 2I00A 4RI1A 5IB0A 3BLNA 4CAWA 2J8MA 3VWEA 2G0BA 4KOSA 1Y7RA 1KUVA 1PUAA 4U9YA 1MJBA 1N71A 4RS2A 3SXNA 2OH1A 2ATRA 3S6KA 2VEZA 5F48A 3ZZIA 4X5KA 2EVNA 2FIAA 3W91A 4BMHA 2R7HA 4H6ZA 4HNXB 1MJAA 4QC6A 2FL4A 3G8WA 4HKFA 5JPHA 3GY9A 2VZYA 1YVOA 4I49A 1ON0A 3CXQA 2F5IA 5JQ4A 2R1IA 3F8KA 2DXQA 3DSBA 3TT2A 1LRZA 1RO5A 1NE9A 4OLLA 2QIRA 4JWPA 1YK3A 3D3SA 2REFA 4M3SA 4E8OA 4KOTA 1BOBA 5HMNA 4PK3A 5HH1A 4CAXA 4QBJA 4XPKA 2Q4YA 4B5PB 5ISVA 1YVKA 3TCVA 5J8CA 4PSXA 4JXRA 4NSQA 2FT0A 3N7ZA 1NMTA 4CRZB 4F6AA 1S60A 2GANA 5C88A 1GHEA 2VZZA 1Q2CA 1QSRA 2JEVA 3KKWA 3I9SA 2B3UA 1Z4EA 4M85A 1U6MA 4FD5A 1Y9WA 5J8FA 2FIWA 3BJ7A 4PK2A 1MJ9A 2QMLA 2Z10A 4ZBGA 3TTHA 4KLVA 4H89A 1M4GA 1TIQA 3EXNA 4Y49C 2C27A 2B5GB 1XEBA 3DR8A 3S6HA 3CXPA 4JD6A 4KZTA 2X7BA 2HQYA 1QSOA 4H6UA 1I21A 3P2HA 3FYNA 1J4JA 2PR1A 4KORA 4DNCA 2NMTA 4KOYA 1M4IA 5FVJA 5F49A 4B5PA 2Q04A 4KOWA 2OU2A 5F47A 4U9ZA 4R3KA 2ZW5A 2Z11A 2R98A 1WWZA 4QB9A 1B87A 5EC4A 3IWGA 3S6FA 2WPXA 2Q7BA 1SQHA 1L0CA 2VI7A 1S3ZA 1YLEA 4AG9A 4AVCA 1M1DA 4ORFA 1V0CA 3OWCA 4UBRA 2B58A 4CS0B 4EVYA 4AB7A 2ZW6A 2BUEA 1PU9A 2J8NA 2OB0A 3EO4A 4UA3A 4JLYA 2JDDA 2VBQA 2B4DB 4R9MA 3R96A 1IYLA 2J8RA 4AVBA 1MK4A 4FD6A 4KLWA 3PZJA 3DNSA 4OAEA 3F0AA 1OZPA 4OADA 2B5GA 4HNWB 1Z4RA 4JXQA 4YGOA 1M44A 2VQYA 4KUBA 3S6GA 3R9FA 3D2PA 3R95A 5EBVA 1XMTA 3TE4A 3K9UA 1Q2YA 2HV2A 4FD7A 1K4JA 4QVTA 4YFJA 4B5OA 4LUAA 3CXSA 3W6SA 4IF5A 2CNSA 2ZPAA 2Y0MA 5KTCA 2PR8A 1IYKA 5C82A 1NSLA 2B3VA 4MY0A 4IUSA 1VHSA 3QAHA 3V8IA 4AVAA 3R9GA
chains in the Genus database with same CATH superfamily
3FXTA 4FUUA 3IO1A 4XPDC 5D8NA 1Q2DA 4MBUA 4CGNA 4A31A 4ZX9A 3CT9A 1CBXA 4B6ZA 3PP9A 4ZY1A 1UWYA 2ODFA 2BOAA 2EUIA 4AG7A 2B4BA 3DLJA 4UWIA 3QNVA 3S9NA 2AFXA 2I79A 4CYQA 2REEA 3KHXA 1TXRA 1YR0A 3D8PA 4UFXA 4XNHC 4PXDA 3TO7A 4NGMA 1R57A 4A33A 2PRBA 2RC4A 4R76A 2D4PA 4UEEA 5CNPA 3W6XA 2OOTA 4ONUA 3B3TA 2PJ7A 4Y49B 2C6CA 3IGRA 1P4NA 1I12A 3F5BA 2CNTA 2ZELA 3R1KA 4A39A 3LD2A 4NEXA 5LYDA 2PJ9A 3FRMA 5K8MA 4KSIA 1VKCA 2FE7A 3GLJA 3VWDA 2B4DA 2DEAA 2PDOA 4HNYB 4NGRA 3FIXA 3MGDA 3SI0A 2C6PA 4KVXA 4MCRA 3JVNA 3JRUA 2PJ6A 1HEEA 2PQ8A 2R8VA 1XIXA 3UY5A 5G21A 1EE3P 4L8AA 2IL4A 4LX9A 1Z8WA 2JDCA 3A9LA 2Z0ZA 4F0XA 2OZUA 1RXTA 4R87A 2ZEEA 2EK8A 4OIWA 1Y9KA 3E0KA 5CPAA 3FB3A 2GE3A 3SXOA 2P0WA 4HPSA 5LYFA 4DYOA 2Q4VA 1ELMP 4CAVA 3DDDA 3H8GA 4CRYB 1ARMA 2BEIA 2O4HA 4MHDA 3IIBA 2Z3KA 2Q44A 4OC4A 1PCAA 3B3CA 5KTDA 4PSWA 1Z9UA 3SHPA 2VL1A 4MY3A 1S7NA 2FCKA 4DUKA 3CDXA 2Q51A 4MHYA 2ZW4A 3B3SA 8CPAA 4CGOA 5JGFA 2BSWA 1R43A 3SJFA 2ZEDA 3WABA 3KL9A 4CGLA 4F0YA 1XF8A 3FMCA 4MCQA 3T9YA 2ZEHA 2KCWA 4P44A 2AFUA 4YRHA 3TOAA 3WC6A 1S7FA 1HDQA 1IB1E 1FT7A 4KOUA 1IICA 2J9AA 3BJ8A 4BINA 5IB9A 3B2YA 3EC4A 4KVOE 3RAMA 4CYPA 3PB8X 5H84A 2ZOGA 3PFEA 4O23A 1XBUA 2JBJA 4A30A 2EBJA 5LRKA 3WR7A 3HLPA 3GYAA 4P4DA 3TO9A 2F7VA 4UIBA 5G1ZA 5KTAA 5IV0A 4NGQA 4A94A 1IOFA 1M4DA 1Z8TA 4FD4A 4OP4A 4EMEA 4J3GA 5GCNA 1S7LA 2BL1A 3T90A 4RN7A 3B35A 2V8VA 4GS4A 4P4BA 1YX0A 1YREA 4Q7AA 5H86A 3PGPA 5E96A 3SJXA 4II9A 4OKOA 3BHXA 1KZFA 1P0HA 3VH9A 3SI1A 5G22A 5D29A 1S7KA 4L89A 3EY5A 3TX8A 3EFAA 4CAEA 4MJ8A 4MFZA 2FVGA 2OZHA 4KOVA 4B12A 4CAFA 1QSMA 5DWNA 1QQ9A 4R7MA 4ZX8A 1KUXA 4R3LA 5AG7A 5DWMA 4FBEA 2FS5A 4PV6A 2HB6A 1TF9A 1KUYA 2JBKA 4A2ZA 2K5TA 2PJ3A 3CPXA 4K30A 1IIDA 3QB8A 3ZJ0A 2GIVA 3H8EA 2ZEOA 2AE6A 4NCZA 4KVME 1B6BA 1Y7EA 2P6GA 1I1DA 1LANA 2G3AA 2WPWA 1QSNA 3LODA 3NH5A 2AJ6A 5DS0A 4AXVA 2PC1A 2RFHA 3RNZA 1CJWA 3V38A 5I4MA 1AYEA 3JTKA 4P4FA 3B3VA 4MI4A 1QSTA 4A95A 2P6FA 2DF5A 1UFHA 2CNMA 2FSRA 2PJAA 5ELYA 3FBUA 3TOBA 1H8LA 4KUAA 5F46A 2Q4ZA 4U5YA 3D2MA 1XOVA 4UIAA 2PCUA 3WC5A 1Y0RA 1XFOA 4A38A 2P6EA 1IU8A 2CF4A 1FY7A 3FX6A 1ZG7A 3GKRA 1CM0A 1XE4A 2JLMA 2OR4A 4QUSA 4UFWA 2D4OA 3SJEA 4M6HA 4GXHA 4OC0A 1YGHA 4XPLA 3IFEA 2FXFA 2ZW7A 3KGQA 2XEGA 4XPDB 4YU9A 1TKFA 3C26A 1Z5RA 1F2OA 2H5MA 3FNCA 5I0CA 2PIYA 3TO6A 2AFOA 4KOXA 3IWEA 3FJUA 1BPMA 3B8GA 4H2KA 3R9EA 1XRYA 3RYOA 1VIXA 4XNHB 2AFZA 2XEFA 3P2FA 2CY2A 3D67A 1VHOA 1S5KA 1WK4A 2YNCC 2POKA 3JUWA 5IX3A 3H4QA 4UWJA 1YSJA 4YWYA 3PFOA 1XJOA 5K8PA 4NF1A 2V8HA 4K3NA 2GU2A 3G3SA 4E0AA 2VXKA 2A4NA 1BO4A 2OZGA 3KQZA 4ONWA 2HUZA 4UEZA 2V77A 3V7ZA 1QMUA 1ARLA 2ZXVA 2EWBA 1XMBA 4E2AA 3PBBA 1R3NA 4UF4A 3CPAA 3DR6A 2ARHA 3I3GA 1CP7A 3KR4A 4IHMA 4F9UA 2PSWA 4JJXA 3K2KA 2QECA 4ZY2A 2ANPA 4MFLA 2PIZA 5AG4A 2O28A 4NXYA 3PEIA 2QVPA 1LAMA 3QAYA 4PQAA 3TFYA 4OC1A 2Q0YA 4WWVA 4R57A 2G3TA 3NE7A 2I00A 2Z3PA 4RI1A 5LRGA 3GUXA 1CPXA 3I1UA 3LMSA 1CG2A 2WSAA 5IB0A 3IU2A 5K8NA 5HVGA 1A2ZA 5AGEA 3IU1A 3BLNA 4CAWA 5CBMA 2J8MA 3VWEA 2G0BA 3KZWA 4NGNA 1KWMA 1TKJA 4KOSA 1Y7RA 1KUVA 1ZLHA 1PUAA 1Y0YA 2I3CA 2Z3NA 1ZO0A 4U9YA 2HC9A 1MJBA 1N71A 4G1PA 4RS2A 4UCPA 1Z8LA 2QYVA 2F8HA 2BCOA 3SXNA 2OH1A 2ATRA 4FAIA 3S6KA 2VEZA 5F48A 3ZZIA 4X5KA 2EVNA 2NSMA 2FIAA 3W91A 4BMHA 5JH9A 2R7HA 1IGBA 4H6ZA 4MMOA 4MRIA 4HNXB 4M6IA 5JM6A 1MJAA 4UEFA 3WC7A 4QC6A 2FL4A 3N5FA 3G8WA 2C1CA 2WUUA 2PJ5A 4HKFA 4NJQA 5JPHA 3GY9A 2VZYA 2Z3LA 1YVOA 3PBEA 4MCSA 1VHEA 4I49A 4LQGA 2GLJA 2EK9A 3TC8A 1Z2LA 3BXMA 4MFJA 1ON0A 4MCPA 2PJ8A 3FEDA 3CXQA 3CZXA 1OBRA 3NFZA 2F5IA 5THWA 2ZEPA 5JQ4A 4IK2A 4UCMA 2R1IA 2PVVA 1F57A 1BPNA 2PJ4A 1YW4A 3D4UA 2AFWA 3F8KA 2DXQA 3FF3A 4B14A 3LWUA 3RBUA 2PRQA 1YLOA 3DSBA 3TT2A 1LRZA 1RO5A 1NE9A 3MN8A 4NGPA 4OLLA 2QIRA 2WYRA 4JWPA 4PXBA 1LAPA 1YK3A 3D3SA 2YNDA 2REFA 4M3SA 4E8OA 4KOTA 1BOBA 4JYWA 5HMNA 4Q38A 4PK3A 5HH1A 4CAXA 4QBJA 4XPKA 2AFMA 4C7HA 1AUGA 1ELLP 2Q4YA 3KHZA 2PJ2A 4Q36A 4C2YA 4B5PB 3BI1A 5ISVA 1HDUA 1ZG9A 4OMEA 4UFVA 1YVKA 3TCVA 1GYTA 4EFDA 5J8CA 4LQ6A 4PSXA 3WT4A 4DJLA 4JXRA 5G20A 4NSQA 4F9VA 2O53A 4MHPA 2FT0A 3N7ZA 5HXDA 1DE4C 1NMTA 4CRZB 4F6AA 1S60A 3D7GA 2GANA 5C88A 1BLLE 4C2ZA 2PVWA 3PB4X 1GHEA 1CP6A 3T8WA 2C6GA 1Q7LA 1Z8XA 4NGSA 2VZZA 1Q2CA 2GREA 1QSRA 2BO9A 4EWTA 2JEVA 4GM5A 4NGTA 4OC3A 5J1QA 1TKHA 3KKWA 4P6YA 3I9SA 3NH8A 3KASA 3B3WA 2B3UA 1Z4EA 3LACA 4FWUA 4M85A 1U6MA 4PPZA 4C7IA 2XEJA 1Y9WA 4FD5A 5EMIA 5J8FA 2FIWA 4C2XA 2DPTA 3MRUA 4CPAA 3BJ7A 3SJGA 4PK2A 1MJ9A 4OC5A 4WJBA 2PJ0A 3FECA 4JZ0A 4ZI6A 3ISXA 2QMLA 4NJRA 4UCNA 2Z10A 3IEHA 3IJ3A 4ZBGA 3H8FA 3S9MA 7CPAA 4B10A 2ZOFA 4BD9A 4P4EA 1NSAA 3PB7X 1CPSA 4CGMA 3HUVA 3TTHA 1LOKA 3KI9A 4B13A 4KLVA 1YQEA 4H89A 1PYTB 1M4GA 1TIQA 3BI0A 3EXNA 4KSAA 2C27A 4Y49C 3S9LA 1ZG8A 3VATA 2AFSA 3RO0A 2B5GB 6CPAA 1XEBA 3DR8A 2YNEA 3S6HA 2JEWA 3CXPA 4JD6A 4KZTA 4MFKA 4B11A 1X12A 4CYOA 1VGYA 4TWEA 4A32A 2IJZA 3NE8A 2ZEMA 3PB9X 2X7BA 2HQYA 1QSOA 1LFWA 2Z3MA 3B7IA 3D7HA 3IWWA 2PJBA 2Q7SA 1I21A 4H6UA 3P2HA 3FYNA 1J4JA 2PR1A 4A37A 2GFQA 2YGWA 4KORA 4DNCA 2NMTA 2IQ6A 2PJCA 4KOYA 1M4IA 2PJ1A 5FVJA 5F49A 4B5PA 2Q04A 4KOWA 2OU2A 1IOIA 5F47A 5A28A 4X2TA 3R9GA 1M4LA 4U9ZA 4R3KA 1YW6A 2ZW5A 4KS9A 2Z11A 5BWAB 2PE3A 2R98A 4X3RA 3FH4A 4MXUA 1WWZA 4P4JA 4Z65A 4QB9A 1B87A 2WZNA 1F2PA 4OC2A 5EC4A 3IWGA 4MHNA 3S6FA 4PXCA 2WPXA 2Q7BA 4NFRA 2CIJA 1SQHA 5HVHA 1L0CA 2VI7A 3PRTA 1S3ZA 2ABZA 1YLEA 4P45A 2YNCA 4AG9A 4AVCA 2EO8A 1M1DA 2V8GA 1V0CA 2IMOA 1TF8A 3D7FA 3OWCA 2B58A 4ORFA 4UBRA 4IAVA 4CS0B 2G9DA 3GIUA 5HVFA 3KQXA 4AB7A 2ZEFA 4TNUA 4EVYA 2ZW6A 2BUEA 1PU9A 4ZY0A 3SI2A 2J8NA 4P10A 2OB0A 3DGVA 2XEIA 1LCPA 3EO4A 4UA3A 4JLYA 2JDDA 2VBQA 2B4DB 4CYNA 4R9MA 4BBHA 3R96A 1IYLA 1DTDA 1BAVA 4M6GA 3D66A 1X10A 4P4IA 2RB7A 5LRJA 3VARA 2J8RA 5LYLA 4AVBA 1MK4A 4FD6A 4KLWA 1YMEA 4C68A 3PZJA 3DNSA 4MHZA 2V8DA 4OAEA 3F0AA 1OZPA 3D7DA 4OADA 4R6TA 1FNOA 5A27A 2B5GA 4HNWB 5K8OA 1CX8A 1JQGA 1Z4RA 4OIDA 3RZAA 1RTQA 4JXQA 4YGOA 2Q43A 4F8ZA 1ZLIA 2GLFA 1M44A 4PXEA 2NYQA 2VQYA 4KUBA 3S6GA 1AMPA 3NH4A 3R9FA 5F09A 1JWQA 2DPSA 3D2PA 3R95A 3ISZA 1XMTA 5EBVA 3TE4A 3K9UA 1Q2YA 3L2NA 2HV2A 4KSFA 4FD7A 3NA6A 3IC1A 1K4JA 5AG6A 4QVTA 2ZEGA 4YFJA 4B5OA 2ZENA 4LUAA 2Z3OA 4RUHA 2CTCA 3FVLA 1IY7A 3PB6X 4X8IA 3CXSA 4MFPA 3W6SA 3FEEA 4ZGYB 4IF5A 2CTBA 4MFQA 2CNSA 3GB0A 4CGPA 2ZPAA 2Y0MA 3K9TA 5LYIA 3KR5A 5KTCA 2PR8A 1IYKA 3D68A 5C82A 5AG5A 2B3VA 1NSLA 4MY0A 4R8FA 2CXAA 4IUSA 1VHSA 3QAHA 3V8IA 4AVAA 4ZYQA 2QJ8A 4W9YA 3H5ZA
chains in the Genus database with same CATH topology
3FXTA 4XPDC 1Q2DA 4MBUA 4CGNA 4A31A 3PP9A 2EUIA 4AG7A 2B4BA 4UWIA 4CYQA 2I79A 2REEA 1YR0A 3D8PA 4UFXA 4XNHC 3TO7A 1R57A 4A33A 2PRBA 2RC4A 2D4PA 5CNPA 3W6XA 4ONUA 4Y49B 3IGRA 1P4NA 1I12A 3F5BA 2CNTA 3R1KA 3LD2A 4NEXA 3FRMA 1VKCA 2FE7A 3VWDA 2B4DA 2PDOA 4HNYB 3FIXA 3MGDA 4KVXA 3JVNA 2PQ8A 2R8VA 1XIXA 3UY5A 5G21A 4L8AA 2IL4A 4LX9A 2JDCA 3A9LA 2Z0ZA 4F0XA 2OZUA 1RXTA 4R87A 1Y9KA 3E0KA 3FB3A 2GE3A 3SXOA 2P0WA 2Q4VA 4CAVA 3DDDA 4CRYB 2BEIA 4MHDA 2Z3KA 2Q44A 4PSWA 1Z9UA 3SHPA 4MY3A 1S7NA 2FCKA 2ZW4A 5KTDA 4CGOA 2BSWA 4CGLA 4F0YA 1XF8A 3T9YA 2KCWA 4YRHA 3TOAA 1S7FA 4KOUA 1IB1E 1IICA 3BJ8A 3EC4A 4KVOE 4CYPA 5H84A 4A30A 3WR7A 3GYAA 3TO9A 5G1ZA 5KTAA 5IV0A 1M4DA 4FD4A 4J3GA 5GCNA 1S7LA 2BL1A 4GS4A 1YX0A 1YREA 5H86A 4II9A 3PGPA 5E96A 1KZFA 1P0HA 5G22A 1S7KA 4L89A 3EY5A 4CAEA 3EFAA 4MJ8A 4MFZA 4B12A 2OZHA 4KOVA 4CAFA 1QSMA 5DWNA 1KUXA 4R3LA 5AG7A 5DWMA 2FS5A 4PV6A 1KUYA 4A2ZA 2K5TA 4K30A 1IIDA 3QB8A 3ZJ0A 2GIVA 3T90A 4NCZA 2AE6A 4KVME 1B6BA 2P6GA 1I1DA 2G3AA 2WPWA 1QSNA 3LODA 2AJ6A 2PC1A 1CJWA 3JTKA 4MI4A 1QSTA 4A95A 2P6FA 1UFHA 2CNMA 2FSRA 5F46A 3FBUA 3TOBA 4KUAA 4U5YA 3D2MA 2P6EA 3GKRA 1FY7A 4UFWA 1CM0A 1XE4A 2JLMA 4QUSA 2D4OA 4XPLA 1YGHA 2FXFA 2ZW7A 4XPDB 3C26A 2H5MA 3FNCA 5I0CA 3TO6A 4KOXA 3IWEA 3B8GA 3R9EA 3RYOA 4XNHB 3P2FA 2CY2A 1WK4A 1S5KA 2YNCC 3JUWA 5IX3A 3H4QA 4UWJA 4NF1A 4E0AA 3G3SA 2VXKA 2A4NA 1BO4A 2OZGA 2HUZA 2ZXVA 4E2AA 3DR6A 2ARHA 3I3GA 2PSWA 4JJXA 2QECA 4MFLA 5AG4A 2O28A 4NXYA 3TFYA 2Q0YA 4R57A 2G3TA 3NE7A 2I00A 2Z3PA 4RI1A 2WSAA 5IB0A 3IU2A 5AGEA 3IU1A 3BLNA 4CAWA 2J8MA 3VWEA 2G0BA 4KOSA 1Y7RA 1KUVA 1PUAA 2Z3NA 1ZO0A 4U9YA 1MJBA 1N71A 4RS2A 4UCPA 3SXNA 2OH1A 2ATRA 3S6KA 2VEZA 5F48A 3ZZIA 4X5KA 2EVNA 2FIAA 3W91A 4BMHA 2R7HA 4H6ZA 4HNXB 1MJAA 4QC6A 2FL4A 3G8WA 2WUUA 4HKFA 5JPHA 3GY9A 2VZYA 1YVOA 4I49A 4MFJA 1ON0A 3CXQA 2F5IA 5JQ4A 4UCMA 2R1IA 4B14A 3F8KA 2DXQA 3DSBA 3TT2A 1LRZA 1RO5A 1NE9A 4OLLA 2QIRA 4JWPA 1YK3A 3D3SA 2YNDA 2REFA 4M3SA 4E8OA 4KOTA 1BOBA 5HMNA 4Q38A 4PK3A 5HH1A 4CAXA 4QBJA 4XPKA 4C7HA 2Q4YA 4Q36A 4C2YA 4B5PB 5ISVA 4UFVA 1YVKA 3TCVA 5J8CA 4PSXA 4JXRA 5G20A 4NSQA 2FT0A 3N7ZA 1NMTA 4CRZB 4F6AA 1S60A 2GANA 5C88A 4C2ZA 1GHEA 2VZZA 1Q2CA 1QSRA 2JEVA 3KKWA 3I9SA 2B3UA 1Z4EA 4M85A 1U6MA 4C7IA 4FD5A 1Y9WA 5J8FA 2FIWA 4C2XA 2DPTA 3BJ7A 4PK2A 1MJ9A 2QMLA 4UCNA 2Z10A 4ZBGA 4B10A 4CGMA 3TTHA 4B13A 4KLVA 4H89A 1M4GA 1TIQA 3EXNA 4KSAA 2C27A 4Y49C 2B5GB 1XEBA 3DR8A 2YNEA 3S6HA 3CXPA 4JD6A 4KZTA 4B11A 4MFKA 4CYOA 4A32A 2X7BA 2HQYA 1QSOA 2Z3MA 4H6UA 1I21A 3P2HA 3FYNA 1J4JA 2PR1A 4KORA 2YGWA 4DNCA 2NMTA 4KOYA 1M4IA 5FVJA 5F49A 4B5PA 2Q04A 4KOWA 2OU2A 5F47A 5A28A 4U9ZA 4R3KA 2ZW5A 4KS9A 2Z11A 5BWAB 2R98A 1WWZA 4QB9A 1B87A 5EC4A 3IWGA 3S6FA 2WPXA 2Q7BA 1SQHA 1L0CA 2VI7A 1S3ZA 1YLEA 2YNCA 4AG9A 4AVCA 1M1DA 4ORFA 1V0CA 3OWCA 4UBRA 2B58A 4CS0B 4EVYA 4AB7A 2ZW6A 2BUEA 1PU9A 2J8NA 2OB0A 3EO4A 4UA3A 4JLYA 2JDDA 2VBQA 2B4DB 4CYNA 4R9MA 4BBHA 3R96A 1IYLA 2J8RA 4AVBA 1MK4A 4FD6A 4KLWA 4C68A 3PZJA 3DNSA 4OAEA 3F0AA 1OZPA 4OADA 5A27A 2B5GA 4HNWB 1Z4RA 4JXQA 4YGOA 1M44A 2VQYA 4KUBA 3S6GA 3R9FA 2DPSA 3D2PA 3R95A 5EBVA 1XMTA 3TE4A 3K9UA 1Q2YA 2HV2A 4KSFA 4FD7A 1K4JA 5AG6A 4QVTA 4YFJA 4B5OA 4LUAA 2Z3OA 3CXSA 4MFPA 3W6SA 4ZGYB 4IF5A 4MFQA 2CNSA 4CGPA 2ZPAA 2Y0MA 5KTCA 2PR8A 1IYKA 5C82A 5AG5A 2B3VA 1NSLA 4MY0A 2CXAA 4IUSA 1VHSA 3QAHA 3V8IA 4AVAA 2Z3LA 3R9GA 3H5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXT A;  4XPD C;  1Q2D A;  4MBU A;  3PP9 A;  2EUI A;  4AG7 A;  2B4B A;  4UWI A;  2I79 A;  2REE A;  1YR0 A;  3D8P A;  4XNH C;  3TO7 A;  1R57 A;  2PRB A;  2RC4 A;  2D4P A;  5CNP A;  3W6X A;  4ONU A;  4Y49 B;  3IGR A;  1P4N A;  1I12 A;  3F5B A;  2CNT A;  3R1K A;  3LD2 A;  4NEX A;  3FRM A;  1VKC A;  2FE7 A;  3VWD A;  2B4D A;  2PDO A;  4HNY B;  3FIX A;  3MGD A;  4KVX A;  3JVN A;  2PQ8 A;  2R8V A;  1XIX A;  3UY5 A;  4L8A A;  2IL4 A;  4LX9 A;  2JDC A;  2Z0Z A;  2OZU A;  1RXT A;  4R87 A;  1Y9K A;  3E0K A;  3FB3 A;  2GE3 A;  3SXO A;  2P0W A;  2Q4V A;  4CAV A;  3DDD A;  4CRY B;  2BEI A;  4MHD A;  2Q44 A;  4PSW A;  1Z9U A;  3SHP A;  4MY3 A;  1S7N A;  2FCK A;  2ZW4 A;  5KTD A;  2BSW A;  4F0Y A;  1XF8 A;  3T9Y A;  2KCW A;  4YRH A;  3TOA A;  1S7F A;  4KOU A;  1IB1 E;  1IIC A;  3BJ8 A;  3EC4 A;  4KVO E;  5H84 A;  3WR7 A;  3GYA A;  3TO9 A;  5KTA A;  5IV0 A;  1M4D A;  4FD4 A;  4J3G A;  5GCN A;  1S7L A;  2BL1 A;  4GS4 A;  1YX0 A;  1YRE A;  5H86 A;  4II9 A;  3PGP A;  5E96 A;  1KZF A;  1P0H A;  1S7K A;  4L89 A;  3EY5 A;  3EFA A;  4MJ8 A;  2OZH A;  4KOV A;  1QSM A;  5DWN A;  1KUX A;  4R3L A;  5DWM A;  2FS5 A;  4PV6 A;  1KUY A;  2K5T A;  4K30 A;  1IID A;  3QB8 A;  3ZJ0 A;  2GIV A;  3T90 A;  4NCZ A;  2AE6 A;  4KVM E;  1B6B A;  2P6G A;  1I1D A;  2G3A A;  2WPW A;  1QSN A;  3LOD A;  2AJ6 A;  2PC1 A;  1CJW A;  4MI4 A;  1QST A;  2P6F A;  1UFH A;  2CNM A;  2FSR A;  5F46 A;  3FBU A;  3TOB A;  4KUA A;  4U5Y A;  3D2M A;  2P6E A;  3GKR A;  1FY7 A;  1CM0 A;  1XE4 A;  2JLM A;  4QUS A;  2D4O A;  4XPL A;  1YGH A;  2FXF A;  2ZW7 A;  4XPD B;  3C26 A;  2H5M A;  3FNC A;  5I0C A;  3TO6 A;  4KOX A;  3B8G A;  3R9E A;  3RYO A;  4XNH B;  3P2F A;  2CY2 A;  1WK4 A;  1S5K A;  3JUW A;  5IX3 A;  3H4Q A;  4UWJ A;  4NF1 A;  4E0A A;  3G3S A;  2VXK A;  2A4N A;  1BO4 A;  2OZG A;  2HUZ A;  2ZXV A;  4E2A A;  3DR6 A;  2ARH A;  3I3G A;  2PSW A;  4JJX A;  2QEC A;  2O28 A;  4NXY A;  3TFY A;  2Q0Y A;  4R57 A;  2G3T A;  3NE7 A;  2I00 A;  4RI1 A;  5IB0 A;  3BLN A;  4CAW A;  2J8M A;  3VWE A;  2G0B A;  4KOS A;  1Y7R A;  1KUV A;  1PUA A;  4U9Y A;  1MJB A;  1N71 A;  4RS2 A;  3SXN A;  2OH1 A;  2ATR A;  3S6K A;  2VEZ A;  5F48 A;  3ZZI A;  4X5K A;  2EVN A;  2FIA A;  3W91 A;  4BMH A;  2R7H A;  4H6Z A;  4HNX B;  1MJA A;  4QC6 A;  2FL4 A;  3G8W A;  4HKF A;  5JPH A;  3GY9 A;  2VZY A;  1YVO A;  4I49 A;  1ON0 A;  3CXQ A;  2F5I A;  5JQ4 A;  2R1I A;  3F8K A;  2DXQ A;  3DSB A;  3TT2 A;  1LRZ A;  1RO5 A;  1NE9 A;  4OLL A;  2QIR A;  4JWP A;  1YK3 A;  3D3S A;  2REF A;  4M3S A;  4E8O A;  4KOT A;  1BOB A;  5HMN A;  4PK3 A;  5HH1 A;  4CAX A;  4QBJ A;  4XPK A;  2Q4Y A;  4B5P B;  5ISV A;  1YVK A;  3TCV A;  5J8C A;  4PSX A;  4JXR A;  4NSQ A;  2FT0 A;  3N7Z A;  1NMT A;  4CRZ B;  4F6A A;  1S60 A;  2GAN A;  5C88 A;  1GHE A;  2VZZ A;  1Q2C A;  1QSR A;  2JEV A;  3KKW A;  3I9S A;  2B3U A;  1Z4E A;  4M85 A;  1U6M A;  4FD5 A;  1Y9W A;  5J8F A;  2FIW A;  3BJ7 A;  4PK2 A;  1MJ9 A;  2QML A;  2Z10 A;  4ZBG A;  3TTH A;  4KLV A;  4H89 A;  1M4G A;  1TIQ A;  3EXN A;  4Y49 C;  2C27 A;  2B5G B;  1XEB A;  3DR8 A;  3S6H A;  3CXP A;  4JD6 A;  4KZT A;  2X7B A;  2HQY A;  1QSO A;  4H6U A;  1I21 A;  3P2H A;  3FYN A;  1J4J A;  2PR1 A;  4KOR A;  4DNC A;  2NMT A;  4KOY A;  1M4I A;  5FVJ A;  5F49 A;  4B5P A;  2Q04 A;  4KOW A;  2OU2 A;  5F47 A;  4U9Z A;  4R3K A;  2ZW5 A;  2Z11 A;  2R98 A;  1WWZ A;  4QB9 A;  1B87 A;  5EC4 A;  3IWG A;  3S6F A;  2WPX A;  2Q7B A;  1SQH A;  1L0C A;  2VI7 A;  1S3Z A;  1YLE A;  4AG9 A;  4AVC A;  1M1D A;  4ORF A;  1V0C A;  3OWC A;  4UBR A;  2B58 A;  4CS0 B;  4EVY A;  4AB7 A;  2ZW6 A;  2BUE A;  1PU9 A;  2J8N A;  2OB0 A;  3EO4 A;  4UA3 A;  4JLY A;  2JDD A;  2VBQ A;  2B4D B;  4R9M A;  3R96 A;  1IYL A;  2J8R A;  4AVB A;  1MK4 A;  4FD6 A;  4KLW A;  3PZJ A;  3DNS A;  4OAE A;  3F0A A;  1OZP A;  4OAD A;  2B5G A;  4HNW B;  1Z4R A;  4JXQ A;  4YGO A;  1M44 A;  2VQY A;  4KUB A;  3S6G A;  3R9F A;  3D2P A;  3R95 A;  5EBV A;  1XMT A;  3TE4 A;  3K9U A;  1Q2Y A;  2HV2 A;  4FD7 A;  1K4J A;  4QVT A;  4YFJ A;  4B5O A;  4LUA A;  3CXS A;  3W6S A;  4IF5 A;  2CNS A;  2ZPA A;  2Y0M A;  5KTC A;  2PR8 A;  1IYK A;  5C82 A;  1NSL A;  2B3V A;  4MY0 A;  4IUS A;  1VHS A;  3QAH A;  3V8I A;  4AVA A;  3R9G A; 
#chains in the Genus database with same CATH topology
 3FXT A;  4FUU A;  3IO1 A;  4XPD C;  5D8N A;  1Q2D A;  4MBU A;  4CGN A;  4A31 A;  4ZX9 A;  3CT9 A;  1CBX A;  4B6Z A;  3PP9 A;  4ZY1 A;  1UWY A;  2ODF A;  2BOA A;  2EUI A;  4AG7 A;  2B4B A;  3DLJ A;  4UWI A;  3QNV A;  3S9N A;  2AFX A;  2I79 A;  4CYQ A;  2REE A;  3KHX A;  1TXR A;  1YR0 A;  3D8P A;  4UFX A;  4XNH C;  4PXD A;  3TO7 A;  4NGM A;  1R57 A;  4A33 A;  2PRB A;  2RC4 A;  4R76 A;  2D4P A;  4UEE A;  5CNP A;  3W6X A;  2OOT A;  4ONU A;  3B3T A;  2PJ7 A;  4Y49 B;  2C6C A;  3IGR A;  1P4N A;  1I12 A;  3F5B A;  2CNT A;  2ZEL A;  3R1K A;  4A39 A;  3LD2 A;  4NEX A;  5LYD A;  2PJ9 A;  3FRM A;  5K8M A;  4KSI A;  1VKC A;  2FE7 A;  3GLJ A;  3VWD A;  2B4D A;  2DEA A;  2PDO A;  4HNY B;  4NGR A;  3FIX A;  3MGD A;  3SI0 A;  2C6P A;  4KVX A;  4MCR A;  3JVN A;  3JRU A;  2PJ6 A;  1HEE A;  2PQ8 A;  2R8V A;  1XIX A;  3UY5 A;  5G21 A;  1EE3 P;  4L8A A;  2IL4 A;  4LX9 A;  1Z8W A;  2JDC A;  3A9L A;  2Z0Z A;  4F0X A;  2OZU A;  1RXT A;  4R87 A;  2ZEE A;  2EK8 A;  4OIW A;  1Y9K A;  3E0K A;  5CPA A;  3FB3 A;  2GE3 A;  3SXO A;  2P0W A;  4HPS A;  5LYF A;  4DYO A;  2Q4V A;  1ELM P;  4CAV A;  3DDD A;  3H8G A;  4CRY B;  1ARM A;  2BEI A;  2O4H A;  4MHD A;  3IIB A;  2Z3K A;  2Q44 A;  4OC4 A;  1PCA A;  3B3C A;  5KTD A;  4PSW A;  1Z9U A;  3SHP A;  2VL1 A;  4MY3 A;  1S7N A;  2FCK A;  4DUK A;  3CDX A;  2Q51 A;  4MHY A;  2ZW4 A;  3B3S A;  8CPA A;  4CGO A;  5JGF A;  2BSW A;  1R43 A;  3SJF A;  2ZED A;  3WAB A;  3KL9 A;  4CGL A;  4F0Y A;  1XF8 A;  3FMC A;  4MCQ A;  3T9Y A;  2ZEH A;  2KCW A;  4P44 A;  2AFU A;  4YRH A;  3TOA A;  3WC6 A;  1S7F A;  1HDQ A;  1IB1 E;  1FT7 A;  4KOU A;  1IIC A;  2J9A A;  3BJ8 A;  4BIN A;  5IB9 A;  3B2Y A;  3EC4 A;  4KVO E;  3RAM A;  4CYP A;  3PB8 X;  5H84 A;  2ZOG A;  3PFE A;  4O23 A;  1XBU A;  2JBJ A;  4A30 A;  2EBJ A;  5LRK A;  3WR7 A;  3HLP A;  3GYA A;  4P4D A;  3TO9 A;  2F7V A;  4UIB A;  5G1Z A;  5KTA A;  5IV0 A;  4NGQ A;  4A94 A;  1IOF A;  1M4D A;  1Z8T A;  4FD4 A;  4OP4 A;  4EME A;  4J3G A;  5GCN A;  1S7L A;  2BL1 A;  3T90 A;  4RN7 A;  3B35 A;  2V8V A;  4GS4 A;  4P4B A;  1YX0 A;  1YRE A;  4Q7A A;  5H86 A;  3PGP A;  5E96 A;  3SJX A;  4II9 A;  4OKO A;  3BHX A;  1KZF A;  1P0H A;  3VH9 A;  3SI1 A;  5G22 A;  5D29 A;  1S7K A;  4L89 A;  3EY5 A;  3TX8 A;  3EFA A;  4CAE A;  4MJ8 A;  4MFZ A;  2FVG A;  2OZH A;  4KOV A;  4B12 A;  4CAF A;  1QSM A;  5DWN A;  1QQ9 A;  4R7M A;  4ZX8 A;  1KUX A;  4R3L A;  5AG7 A;  5DWM A;  4FBE A;  2FS5 A;  4PV6 A;  2HB6 A;  1TF9 A;  1KUY A;  2JBK A;  4A2Z A;  2K5T A;  2PJ3 A;  3CPX A;  4K30 A;  1IID A;  3QB8 A;  3ZJ0 A;  2GIV A;  3H8E A;  2ZEO A;  2AE6 A;  4NCZ A;  4KVM E;  1B6B A;  1Y7E A;  2P6G A;  1I1D A;  1LAN A;  2G3A A;  2WPW A;  1QSN A;  3LOD A;  3NH5 A;  2AJ6 A;  5DS0 A;  4AXV A;  2PC1 A;  2RFH A;  3RNZ A;  1CJW A;  3V38 A;  5I4M A;  1AYE A;  3JTK A;  4P4F A;  3B3V A;  4MI4 A;  1QST A;  4A95 A;  2P6F A;  2DF5 A;  1UFH A;  2CNM A;  2FSR A;  2PJA A;  5ELY A;  3FBU A;  3TOB A;  1H8L A;  4KUA A;  5F46 A;  2Q4Z A;  4U5Y A;  3D2M A;  1XOV A;  4UIA A;  2PCU A;  3WC5 A;  1Y0R A;  1XFO A;  4A38 A;  2P6E A;  1IU8 A;  2CF4 A;  1FY7 A;  3FX6 A;  1ZG7 A;  3GKR A;  1CM0 A;  1XE4 A;  2JLM A;  2OR4 A;  4QUS A;  4UFW A;  2D4O A;  3SJE A;  4M6H A;  4GXH A;  4OC0 A;  1YGH A;  4XPL A;  3IFE A;  2FXF A;  2ZW7 A;  3KGQ A;  2XEG A;  4XPD B;  4YU9 A;  1TKF A;  3C26 A;  1Z5R A;  1F2O A;  2H5M A;  3FNC A;  5I0C A;  2PIY A;  3TO6 A;  2AFO A;  4KOX A;  3IWE A;  3FJU A;  1BPM A;  3B8G A;  4H2K A;  3R9E A;  1XRY A;  3RYO A;  1VIX A;  4XNH B;  2AFZ A;  2XEF A;  3P2F A;  2CY2 A;  3D67 A;  1VHO A;  1S5K A;  1WK4 A;  2YNC C;  2POK A;  3JUW A;  5IX3 A;  3H4Q A;  4UWJ A;  1YSJ A;  4YWY A;  3PFO A;  1XJO A;  5K8P A;  4NF1 A;  2V8H A;  4K3N A;  2GU2 A;  3G3S A;  4E0A A;  2VXK A;  2A4N A;  1BO4 A;  2OZG A;  3KQZ A;  4ONW A;  2HUZ A;  4UEZ A;  2V77 A;  3V7Z A;  1QMU A;  1ARL A;  2ZXV A;  2EWB A;  1XMB A;  4E2A A;  3PBB A;  1R3N A;  4UF4 A;  3CPA A;  3DR6 A;  2ARH A;  3I3G A;  1CP7 A;  3KR4 A;  4IHM A;  4F9U A;  2PSW A;  4JJX A;  3K2K A;  2QEC A;  4ZY2 A;  2ANP A;  4MFL A;  2PIZ A;  5AG4 A;  2O28 A;  4NXY A;  3PEI A;  2QVP A;  1LAM A;  3QAY A;  4PQA A;  3TFY A;  4OC1 A;  2Q0Y A;  4WWV A;  4R57 A;  2G3T A;  3NE7 A;  2I00 A;  2Z3P A;  4RI1 A;  5LRG A;  3GUX A;  1CPX A;  3I1U A;  3LMS A;  1CG2 A;  2WSA A;  5IB0 A;  3IU2 A;  5K8N A;  5HVG A;  1A2Z A;  5AGE A;  3IU1 A;  3BLN A;  4CAW A;  5CBM A;  2J8M A;  3VWE A;  2G0B A;  3KZW A;  4NGN A;  1KWM A;  1TKJ A;  4KOS A;  1Y7R A;  1KUV A;  1ZLH A;  1PUA A;  1Y0Y A;  2I3C A;  2Z3N A;  1ZO0 A;  4U9Y A;  2HC9 A;  1MJB A;  1N71 A;  4G1P A;  4RS2 A;  4UCP A;  1Z8L A;  2QYV A;  2F8H A;  2BCO A;  3SXN A;  2OH1 A;  2ATR A;  4FAI A;  3S6K A;  2VEZ A;  5F48 A;  3ZZI A;  4X5K A;  2EVN A;  2NSM A;  2FIA A;  3W91 A;  4BMH A;  5JH9 A;  2R7H A;  1IGB A;  4H6Z A;  4MMO A;  4MRI A;  4HNX B;  4M6I A;  5JM6 A;  1MJA A;  4UEF A;  3WC7 A;  4QC6 A;  2FL4 A;  3N5F A;  3G8W A;  2C1C A;  2WUU A;  2PJ5 A;  4HKF A;  4NJQ A;  5JPH A;  3GY9 A;  2VZY A;  2Z3L A;  1YVO A;  3PBE A;  4MCS A;  1VHE A;  4I49 A;  4LQG A;  2GLJ A;  2EK9 A;  3TC8 A;  1Z2L A;  3BXM A;  4MFJ A;  1ON0 A;  4MCP A;  2PJ8 A;  3FED A;  3CXQ A;  3CZX A;  1OBR A;  3NFZ A;  2F5I A;  5THW A;  2ZEP A;  5JQ4 A;  4IK2 A;  4UCM A;  2R1I A;  2PVV A;  1F57 A;  1BPN A;  2PJ4 A;  1YW4 A;  3D4U A;  2AFW A;  3F8K A;  2DXQ A;  3FF3 A;  4B14 A;  3LWU A;  3RBU A;  2PRQ A;  1YLO A;  3DSB A;  3TT2 A;  1LRZ A;  1RO5 A;  1NE9 A;  3MN8 A;  4NGP A;  4OLL A;  2QIR A;  2WYR A;  4JWP A;  4PXB A;  1LAP A;  1YK3 A;  3D3S A;  2YND A;  2REF A;  4M3S A;  4E8O A;  4KOT A;  1BOB A;  4JYW A;  5HMN A;  4Q38 A;  4PK3 A;  5HH1 A;  4CAX A;  4QBJ A;  4XPK A;  2AFM A;  4C7H A;  1AUG A;  1ELL P;  2Q4Y A;  3KHZ A;  2PJ2 A;  4Q36 A;  4C2Y A;  4B5P B;  3BI1 A;  5ISV A;  1HDU A;  1ZG9 A;  4OME A;  4UFV A;  1YVK A;  3TCV A;  1GYT A;  4EFD A;  5J8C A;  4LQ6 A;  4PSX A;  3WT4 A;  4DJL A;  4JXR A;  5G20 A;  4NSQ A;  4F9V A;  2O53 A;  4MHP A;  2FT0 A;  3N7Z A;  5HXD A;  1DE4 C;  1NMT A;  4CRZ B;  4F6A A;  1S60 A;  3D7G A;  2GAN A;  5C88 A;  1BLL E;  4C2Z A;  2PVW A;  3PB4 X;  1GHE A;  1CP6 A;  3T8W A;  2C6G A;  1Q7L A;  1Z8X A;  4NGS A;  2VZZ A;  1Q2C A;  2GRE A;  1QSR A;  2BO9 A;  4EWT A;  2JEV A;  4GM5 A;  4NGT A;  4OC3 A;  5J1Q A;  1TKH A;  3KKW A;  4P6Y A;  3I9S A;  3NH8 A;  3KAS A;  3B3W A;  2B3U A;  1Z4E A;  3LAC A;  4FWU A;  4M85 A;  1U6M A;  4PPZ A;  4C7I A;  2XEJ A;  1Y9W A;  4FD5 A;  5EMI A;  5J8F A;  2FIW A;  4C2X A;  2DPT A;  3MRU A;  4CPA A;  3BJ7 A;  3SJG A;  4PK2 A;  1MJ9 A;  4OC5 A;  4WJB A;  2PJ0 A;  3FEC A;  4JZ0 A;  4ZI6 A;  3ISX A;  2QML A;  4NJR A;  4UCN A;  2Z10 A;  3IEH A;  3IJ3 A;  4ZBG A;  3H8F A;  3S9M A;  7CPA A;  4B10 A;  2ZOF A;  4BD9 A;  4P4E A;  1NSA A;  3PB7 X;  1CPS A;  4CGM A;  3HUV A;  3TTH A;  1LOK A;  3KI9 A;  4B13 A;  4KLV A;  1YQE A;  4H89 A;  1PYT B;  1M4G A;  1TIQ A;  3BI0 A;  3EXN A;  4KSA A;  2C27 A;  4Y49 C;  3S9L A;  1ZG8 A;  3VAT A;  2AFS A;  3RO0 A;  2B5G B;  6CPA A;  1XEB A;  3DR8 A;  2YNE A;  3S6H A;  2JEW A;  3CXP A;  4JD6 A;  4KZT A;  4MFK A;  4B11 A;  1X12 A;  4CYO A;  1VGY A;  4TWE A;  4A32 A;  2IJZ A;  3NE8 A;  2ZEM A;  3PB9 X;  2X7B A;  2HQY A;  1QSO A;  1LFW A;  2Z3M A;  3B7I A;  3D7H A;  3IWW A;  2PJB A;  2Q7S A;  1I21 A;  4H6U A;  3P2H A;  3FYN A;  1J4J A;  2PR1 A;  4A37 A;  2GFQ A;  2YGW A;  4KOR A;  4DNC A;  2NMT A;  2IQ6 A;  2PJC A;  4KOY A;  1M4I A;  2PJ1 A;  5FVJ A;  5F49 A;  4B5P A;  2Q04 A;  4KOW A;  2OU2 A;  1IOI A;  5F47 A;  5A28 A;  4X2T A;  3R9G A;  1M4L A;  4U9Z A;  4R3K A;  1YW6 A;  2ZW5 A;  4KS9 A;  2Z11 A;  5BWA B;  2PE3 A;  2R98 A;  4X3R A;  3FH4 A;  4MXU A;  1WWZ A;  4P4J A;  4Z65 A;  4QB9 A;  1B87 A;  2WZN A;  1F2P A;  4OC2 A;  5EC4 A;  3IWG A;  4MHN A;  3S6F A;  4PXC A;  2WPX A;  2Q7B A;  4NFR A;  2CIJ A;  1SQH A;  5HVH A;  1L0C A;  2VI7 A;  3PRT A;  1S3Z A;  2ABZ A;  1YLE A;  4P45 A;  2YNC A;  4AG9 A;  4AVC A;  2EO8 A;  1M1D A;  2V8G A;  1V0C A;  2IMO A;  1TF8 A;  3D7F A;  3OWC A;  2B58 A;  4ORF A;  4UBR A;  4IAV A;  4CS0 B;  2G9D A;  3GIU A;  5HVF A;  3KQX A;  4AB7 A;  2ZEF A;  4TNU A;  4EVY A;  2ZW6 A;  2BUE A;  1PU9 A;  4ZY0 A;  3SI2 A;  2J8N A;  4P10 A;  2OB0 A;  3DGV A;  2XEI A;  1LCP A;  3EO4 A;  4UA3 A;  4JLY A;  2JDD A;  2VBQ A;  2B4D B;  4CYN A;  4R9M A;  4BBH A;  3R96 A;  1IYL A;  1DTD A;  1BAV A;  4M6G A;  3D66 A;  1X10 A;  4P4I A;  2RB7 A;  5LRJ A;  3VAR A;  2J8R A;  5LYL A;  4AVB A;  1MK4 A;  4FD6 A;  4KLW A;  1YME A;  4C68 A;  3PZJ A;  3DNS A;  4MHZ A;  2V8D A;  4OAE A;  3F0A A;  1OZP A;  3D7D A;  4OAD A;  4R6T A;  1FNO A;  5A27 A;  2B5G A;  4HNW B;  5K8O A;  1CX8 A;  1JQG A;  1Z4R A;  4OID A;  3RZA A;  1RTQ A;  4JXQ A;  4YGO A;  2Q43 A;  4F8Z A;  1ZLI A;  2GLF A;  1M44 A;  4PXE A;  2NYQ A;  2VQY A;  4KUB A;  3S6G A;  1AMP A;  3NH4 A;  3R9F A;  5F09 A;  1JWQ A;  2DPS A;  3D2P A;  3R95 A;  3ISZ A;  1XMT A;  5EBV A;  3TE4 A;  3K9U A;  1Q2Y A;  3L2N A;  2HV2 A;  4KSF A;  4FD7 A;  3NA6 A;  3IC1 A;  1K4J A;  5AG6 A;  4QVT A;  2ZEG A;  4YFJ A;  4B5O A;  2ZEN A;  4LUA A;  2Z3O A;  4RUH A;  2CTC A;  3FVL A;  1IY7 A;  3PB6 X;  4X8I A;  3CXS A;  4MFP A;  3W6S A;  3FEE A;  4ZGY B;  4IF5 A;  2CTB A;  4MFQ A;  2CNS A;  3GB0 A;  4CGP A;  2ZPA A;  2Y0M A;  3K9T A;  5LYI A;  3KR5 A;  5KTC A;  2PR8 A;  1IYK A;  3D68 A;  5C82 A;  5AG5 A;  2B3V A;  1NSL A;  4MY0 A;  4R8F A;  2CXA A;  4IUS A;  1VHS A;  3QAH A;  3V8I A;  4AVA A;  4ZYQ A;  2QJ8 A;  4W9Y A;  3H5Z A; 
#chains in the Genus database with same CATH homology
 3FXT A;  4XPD C;  1Q2D A;  4MBU A;  4CGN A;  4A31 A;  3PP9 A;  2EUI A;  4AG7 A;  2B4B A;  4UWI A;  4CYQ A;  2I79 A;  2REE A;  1YR0 A;  3D8P A;  4UFX A;  4XNH C;  3TO7 A;  1R57 A;  4A33 A;  2PRB A;  2RC4 A;  2D4P A;  5CNP A;  3W6X A;  4ONU A;  4Y49 B;  3IGR A;  1P4N A;  1I12 A;  3F5B A;  2CNT A;  3R1K A;  3LD2 A;  4NEX A;  3FRM A;  1VKC A;  2FE7 A;  3VWD A;  2B4D A;  2PDO A;  4HNY B;  3FIX A;  3MGD A;  4KVX A;  3JVN A;  2PQ8 A;  2R8V A;  1XIX A;  3UY5 A;  5G21 A;  4L8A A;  2IL4 A;  4LX9 A;  2JDC A;  3A9L A;  2Z0Z A;  4F0X A;  2OZU A;  1RXT A;  4R87 A;  1Y9K A;  3E0K A;  3FB3 A;  2GE3 A;  3SXO A;  2P0W A;  2Q4V A;  4CAV A;  3DDD A;  4CRY B;  2BEI A;  4MHD A;  2Z3K A;  2Q44 A;  4PSW A;  1Z9U A;  3SHP A;  4MY3 A;  1S7N A;  2FCK A;  2ZW4 A;  5KTD A;  4CGO A;  2BSW A;  4CGL A;  4F0Y A;  1XF8 A;  3T9Y A;  2KCW A;  4YRH A;  3TOA A;  1S7F A;  4KOU A;  1IB1 E;  1IIC A;  3BJ8 A;  3EC4 A;  4KVO E;  4CYP A;  5H84 A;  4A30 A;  3WR7 A;  3GYA A;  3TO9 A;  5G1Z A;  5KTA A;  5IV0 A;  1M4D A;  4FD4 A;  4J3G A;  5GCN A;  1S7L A;  2BL1 A;  4GS4 A;  1YX0 A;  1YRE A;  5H86 A;  4II9 A;  3PGP A;  5E96 A;  1KZF A;  1P0H A;  5G22 A;  1S7K A;  4L89 A;  3EY5 A;  4CAE A;  3EFA A;  4MJ8 A;  4MFZ A;  4B12 A;  2OZH A;  4KOV A;  4CAF A;  1QSM A;  5DWN A;  1KUX A;  4R3L A;  5AG7 A;  5DWM A;  2FS5 A;  4PV6 A;  1KUY A;  4A2Z A;  2K5T A;  4K30 A;  1IID A;  3QB8 A;  3ZJ0 A;  2GIV A;  3T90 A;  4NCZ A;  2AE6 A;  4KVM E;  1B6B A;  2P6G A;  1I1D A;  2G3A A;  2WPW A;  1QSN A;  3LOD A;  2AJ6 A;  2PC1 A;  1CJW A;  3JTK A;  4MI4 A;  1QST A;  4A95 A;  2P6F A;  1UFH A;  2CNM A;  2FSR A;  5F46 A;  3FBU A;  3TOB A;  4KUA A;  4U5Y A;  3D2M A;  2P6E A;  3GKR A;  1FY7 A;  4UFW A;  1CM0 A;  1XE4 A;  2JLM A;  4QUS A;  2D4O A;  4XPL A;  1YGH A;  2FXF A;  2ZW7 A;  4XPD B;  3C26 A;  2H5M A;  3FNC A;  5I0C A;  3TO6 A;  4KOX A;  3IWE A;  3B8G A;  3R9E A;  3RYO A;  4XNH B;  3P2F A;  2CY2 A;  1WK4 A;  1S5K A;  2YNC C;  3JUW A;  5IX3 A;  3H4Q A;  4UWJ A;  4NF1 A;  4E0A A;  3G3S A;  2VXK A;  2A4N A;  1BO4 A;  2OZG A;  2HUZ A;  2ZXV A;  4E2A A;  3DR6 A;  2ARH A;  3I3G A;  2PSW A;  4JJX A;  2QEC A;  4MFL A;  5AG4 A;  2O28 A;  4NXY A;  3TFY A;  2Q0Y A;  4R57 A;  2G3T A;  3NE7 A;  2I00 A;  2Z3P A;  4RI1 A;  2WSA A;  5IB0 A;  3IU2 A;  5AGE A;  3IU1 A;  3BLN A;  4CAW A;  2J8M A;  3VWE A;  2G0B A;  4KOS A;  1Y7R A;  1KUV A;  1PUA A;  2Z3N A;  1ZO0 A;  4U9Y A;  1MJB A;  1N71 A;  4RS2 A;  4UCP A;  3SXN A;  2OH1 A;  2ATR A;  3S6K A;  2VEZ A;  5F48 A;  3ZZI A;  4X5K A;  2EVN A;  2FIA A;  3W91 A;  4BMH A;  2R7H A;  4H6Z A;  4HNX B;  1MJA A;  4QC6 A;  2FL4 A;  3G8W A;  2WUU A;  4HKF A;  5JPH A;  3GY9 A;  2VZY A;  1YVO A;  4I49 A;  4MFJ A;  1ON0 A;  3CXQ A;  2F5I A;  5JQ4 A;  4UCM A;  2R1I A;  4B14 A;  3F8K A;  2DXQ A;  3DSB A;  3TT2 A;  1LRZ A;  1RO5 A;  1NE9 A;  4OLL A;  2QIR A;  4JWP A;  1YK3 A;  3D3S A;  2YND A;  2REF A;  4M3S A;  4E8O A;  4KOT A;  1BOB A;  5HMN A;  4Q38 A;  4PK3 A;  5HH1 A;  4CAX A;  4QBJ A;  4XPK A;  4C7H A;  2Q4Y A;  4Q36 A;  4C2Y A;  4B5P B;  5ISV A;  4UFV A;  1YVK A;  3TCV A;  5J8C A;  4PSX A;  4JXR A;  5G20 A;  4NSQ A;  2FT0 A;  3N7Z A;  1NMT A;  4CRZ B;  4F6A A;  1S60 A;  2GAN A;  5C88 A;  4C2Z A;  1GHE A;  2VZZ A;  1Q2C A;  1QSR A;  2JEV A;  3KKW A;  3I9S A;  2B3U A;  1Z4E A;  4M85 A;  1U6M A;  4C7I A;  4FD5 A;  1Y9W A;  5J8F A;  2FIW A;  4C2X A;  2DPT A;  3BJ7 A;  4PK2 A;  1MJ9 A;  2QML A;  4UCN A;  2Z10 A;  4ZBG A;  4B10 A;  4CGM A;  3TTH A;  4B13 A;  4KLV A;  4H89 A;  1M4G A;  1TIQ A;  3EXN A;  4KSA A;  2C27 A;  4Y49 C;  2B5G B;  1XEB A;  3DR8 A;  2YNE A;  3S6H A;  3CXP A;  4JD6 A;  4KZT A;  4B11 A;  4MFK A;  4CYO A;  4A32 A;  2X7B A;  2HQY A;  1QSO A;  2Z3M A;  4H6U A;  1I21 A;  3P2H A;  3FYN A;  1J4J A;  2PR1 A;  4KOR A;  2YGW A;  4DNC A;  2NMT A;  4KOY A;  1M4I A;  5FVJ A;  5F49 A;  4B5P A;  2Q04 A;  4KOW A;  2OU2 A;  5F47 A;  5A28 A;  4U9Z A;  4R3K A;  2ZW5 A;  4KS9 A;  2Z11 A;  5BWA B;  2R98 A;  1WWZ A;  4QB9 A;  1B87 A;  5EC4 A;  3IWG A;  3S6F A;  2WPX A;  2Q7B A;  1SQH A;  1L0C A;  2VI7 A;  1S3Z A;  1YLE A;  2YNC A;  4AG9 A;  4AVC A;  1M1D A;  4ORF A;  1V0C A;  3OWC A;  4UBR A;  2B58 A;  4CS0 B;  4EVY A;  4AB7 A;  2ZW6 A;  2BUE A;  1PU9 A;  2J8N A;  2OB0 A;  3EO4 A;  4UA3 A;  4JLY A;  2JDD A;  2VBQ A;  2B4D B;  4CYN A;  4R9M A;  4BBH A;  3R96 A;  1IYL A;  2J8R A;  4AVB A;  1MK4 A;  4FD6 A;  4KLW A;  4C68 A;  3PZJ A;  3DNS A;  4OAE A;  3F0A A;  1OZP A;  4OAD A;  5A27 A;  2B5G A;  4HNW B;  1Z4R A;  4JXQ A;  4YGO A;  1M44 A;  2VQY A;  4KUB A;  3S6G A;  3R9F A;  2DPS A;  3D2P A;  3R95 A;  5EBV A;  1XMT A;  3TE4 A;  3K9U A;  1Q2Y A;  2HV2 A;  4KSF A;  4FD7 A;  1K4J A;  5AG6 A;  4QVT A;  4YFJ A;  4B5O A;  4LUA A;  2Z3O A;  3CXS A;  4MFP A;  3W6S A;  4ZGY B;  4IF5 A;  4MFQ A;  2CNS A;  4CGP A;  2ZPA A;  2Y0M A;  5KTC A;  2PR8 A;  1IYK A;  5C82 A;  5AG5 A;  2B3V A;  1NSL A;  4MY0 A;  2CXA A;  4IUS A;  1VHS A;  3QAH A;  3V8I A;  4AVA A;  2Z3L A;  3R9G A;  3H5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...