1KUXA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serotonin N-acetyltransferase
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuxA00
3TO7A 2B4DA 2Q44A 2JDDA 2JDCA 2PRBA 1WK4A 4JXRA 4NEXA 2VZZA 2FS5A 4X5KA 2C27A 4MHDA 3EY5A 2ZW4A 4MJ8A 2NMTA 3I3GA 1Z4EA 3T90A 4DNCA 4R3KA 1YGHA 4NSQA 4AB7A 3CXPA 3TO6A 4Y49B 2VXKA 1S7LA 4GS4A 5FVJA 4R57A 1Q2DA 1TIQA 1YR0A 2G3TA 3RYOA 2OZHA 2HUZA 1MJBA 2ZXVA 4LUAA 3TE4A 4II9A 4M3SA 2R98A 1M44A 4EVYA 3BJ7A 4PK2A 1Z4RA 1IYKA 3DR6A 4QC6A 3TO9A 2GANA 5CNPA 3IWGA 4I49A 4XPDC 1NSLA 5DWNA 4AG7A 4BMHA 1S7FA 2I00A 2P6GA 2AJ6A 4JD6A 4PSWA 4K30A 4FD5A 3MGDA 5C88A 2EVNA 2FE7A 3OWCA 4MY0A 2J8RA 1M4GA 3QAHA 4IF5A 2QIRA 3EO4A 4ONUA 2BSWA 3K9UA 3NE7A 2Q0YA 1YREA 2BEIA 4KOVA 2G3AA 4MI4A 3G8WA 5KTDA 5GCNA 2PSWA 4B5PA 1NE9A 3TFYA 2B3UA 4KOSA 2FIAA 4KOUA 2R7HA 4XPKA 1VHSA 4KOXA 1B87A 2FL4A 4M85A 4KOWA 2FIWA 5I0CA 3EFAA 2F5IA 2GIVA 5E96A 1Y9KA 1IICA 2ARHA 2PR1A 1RXTA 3BLNA 4L8AA 4CAVA 4NF1A 3D8PA 1MJ9A 2B3VA 4KZTA 3CXQA 4CAWA 4Y49C 4JJXA 2FCKA 1S60A 1QSNA 5ISVA 3D3SA 1YX0A 1FY7A 5IB0A 1QSMA 2FT0A 4CAXA 1QSRA 2DXQA 4E8OA 1GHEA 2J8NA 3I9SA 4OLLA 3S6KA 1P0HA 3GY9A 2Z11A 2CY2A 4U9ZA 2VBQA 4PK3A 3DR8A 4HNXB 3LODA 3P2HA 5J8FA 3GKRA 4FD6A 2PQ8A 2AE6A 4E0AA 4PV6A 4KUBA 2KCWA 1XEBA 2PR8A 2JLMA 4XNHB 2GE3A 1ON0A 4RS2A 5KTCA 1PU9A 1I1DA 5IV0A 1S7KA 3QB8A 3FIXA 2O28A 4F0YA 4UBRA 4R9MA 2B4BA 3BJ8A 3S6GA 2VZYA 4U5YA 4OAEA 4KORA 2Q7BA 2HV2A 2B5GA 3FB3A 3S6FA 3V8IA 1CM0A 4JXQA 3TOAA 1S3ZA 5F49A 5C82A 1M1DA 3LD2A 4MBUA 3E0KA 3DDDA 5J8CA 3ZJ0A 4QBJA 1PUAA 1IB1E 3H4QA 1YVKA 3G3SA 3W6SA 2B5GB 2I79A 4ORFA 1MK4A 3FYNA 1N71A 3PZJA 5DWMA 3R95A 3JUWA 1UFHA 4QVTA 1QSTA 2A4NA 3W6XA 1Y9WA 3B8GA 2ZPAA 1B6BA 1YLEA 2ZW6A 4H89A 5HMNA 2EUIA 2ATRA 2X7BA 3IGRA 4KVOE 3SXNA 2PC1A 5H84A 4KVXA 2FSRA 3TCVA 3P2FA 4FD4A 4B5OA 4XPLA 5EC4A 3N7ZA 1I21A 3W91A 3T9YA 3EC4A 3FNCA 2K5TA 2JEVA 1P4NA 1Q2CA 3DNSA 3TT2A 4KUAA 5KTAA 3TTHA 4E2AA 4CRZB 2B58A 4FD7A 2CNMA 3PP9A 1SQHA 4QB9A 1U6MA 2H5MA 2OH1A 2Y0MA 1LRZA 1V0CA 2BUEA 4KLWA 1J4JA 4UWIA 3SXOA 3FBUA 1OZPA 4AVBA 1MJAA 4XNHC 1L0CA 2CNTA 3PGPA 1K4JA 1YVOA 5HH1A 4JLYA 4CRYB 2P6FA 4LX9A 3S6HA 3JVNA 1KUXA 4AVCA 1YK3A 4L89A 3F5BA 2OB0A 2P6EA 3VWDA 2PDOA 2VI7A 3EXNA 1KZFA 2REEA 3F8KA 3R9EA 2B4DB 3UY5A 1I12A 2REFA 1RO5A 4HKFA 2Q04A 1XIXA 4HNWB 2D4OA 2QECA 2R8VA 4H6UA 2RC4A 4MY3A 4NCZA 4YGOA 3D2MA 1XMTA 4JWPA 5EBVA 1KUVA 4HNYB 3ZZIA 3WR7A 3R9FA 4IUSA 4ZBGA 3DSBA 1KUYA 2ZW5A 2P0WA 3F0AA 3R9GA 4KVME 4PSXA 3SHPA 3C26A 4RI1A 3VWEA 3KKWA 1Q2YA 1IIDA 1IYLA 1XE4A 2VQYA 4KLVA 4AG9A 2WPWA 4CS0B 5F46A 4KOYA 4XPDB 3FXTA 1XF8A 4QUSA 2ZW7A 4KOTA 4UA3A 2D4PA 4YRHA 5H86A 1BO4A 4H6ZA 2Z10A 1R57A 2OU2A 2R1IA 2CNSA 1Z9UA 2J8MA 2G0BA 2QMLA 3R1KA 4R87A 4U9YA 2Q4YA 1VKCA 4OADA 2OZGA 5F48A 3R96A 3CXSA 1NMTA 4UWJA 2BL1A 4YFJA 3D2PA 1WWZA 4AVAA 4J3GA 5JPHA 2Q4VA 5F47A 2WPXA 1BOBA 3FRMA 4B5PB 1S5KA 2Z0ZA 1QSOA 1Y7RA 1CJWA 3TOBA 4F6AA 4R3LA 4NXYA 1M4DA 1S7NA 1M4IA 2IL4A 2OZUA 2HQYA 5IX3A 5JQ4A 3GYAA 2FXFA 2VEZA
chains in the Genus database with same CATH superfamily
3TO7A 3MRUA 3GUXA 2B4DA 2Q44A 2Z3KA 2JDDA 2QVPA 3PB4X 2JDCA 2G9DA 1WK4A 2PRBA 2QJ8A 3BI1A 4JXRA 4ONWA 4NEXA 2VZZA 2FS5A 4X5KA 2C27A 4MHDA 4UIBA 3EY5A 2ZW4A 4MJ8A 2WSAA 2NMTA 3I3GA 1Z4EA 3BI0A 3T90A 4DNCA 5K8OA 4R3KA 1YGHA 2ZEPA 2CTBA 4NSQA 4AB7A 5AGEA 4OC2A 3NA6A 4C2XA 3CXPA 3TO6A 1XRYA 4Y49B 2VXKA 3NH4A 4CAFA 1ZG9A 1BLLE 2ZEHA 1S7LA 1M4LA 2ZEEA 4GS4A 5FVJA 4R57A 1Q2DA 5DS0A 2PJ4A 4O23A 2OR4A 4F9UA 1CX8A 1TIQA 1YR0A 5D29A 2G3TA 2ODFA 3RYOA 2OZHA 4EMEA 2V8GA 2HUZA 3KL9A 3SJEA 3FF3A 1MJBA 2ZXVA 3FMCA 2PVVA 4LUAA 2GREA 3H5ZA 4UCNA 3IWEA 3TE4A 4II9A 3IU2A 3KHXA 4M3SA 2DPTA 2R98A 2WUUA 1ZLIA 1F2OA 1ELMP 3WT4A 4GXHA 1M44A 4YU9A 2Z3LA 4NGPA 3JRUA 4EVYA 4K3NA 5LRJA 1OBRA 3BJ7A 3BXMA 4IK2A 4PK2A 1Z4RA 5EMIA 4B13A 5JPHA 4KSAA 1UWYA 4CPAA 3V7ZA 1IOIA 2J9AA 2WYRA 4RUHA 5IB9A 5HXDA 1DE4C 1IYKA 5BWAB 4LQGA 3DR6A 4QC6A 3IWWA 3TO9A 2GANA 5CNPA 3IWGA 3HUVA 1ZO0A 3KR5A 4FUUA 4GM5A 4I49A 4XPDC 1NSLA 5DWNA 4AG7A 4BMHA 4C68A 1S7FA 2I00A 2P6GA 2AJ6A 5JH9A 1Z8LA 4JD6A 4JYWA 4PSWA 3S9LA 2Q7SA 4K30A 4FD5A 4OIDA 2VL1A 2NSMA 1VHOA 3MGDA 5C88A 2EVNA 2FE7A 4MCRA 3OWCA 3SI0A 4MY0A 2ZEMA 1IU8A 4OIWA 2J8RA 1M4GA 3NE8A 3QAHA 2ZEDA 4IF5A 2QIRA 2ZEOA 3EO4A 4ONUA 2DPSA 2BSWA 4UF4A 6CPAA 4WJBA 4PQAA 1F2PA 3K9UA 4X8IA 3NE7A 4H2KA 2PJ7A 2Q0YA 1YREA 2BEIA 2Z3MA 1FT7A 4FWUA 2PJ6A 1AMPA 3ISZA 2PJ2A 3B2YA 4KOVA 2G3AA 4NGMA 3VARA 2WZNA 3V38A 3W6SA 4MI4A 3G8WA 5KTDA 5GCNA 2PSWA 4B5PA 1NE9A 3PFEA 1TKJA 4M6GA 1YW6A 2B3UA 3TFYA 2Q43A 2YGWA 1NSAA 4CYPA 4KOSA 2HC9A 2ZEGA 2EO8A 2FIAA 4KOUA 2R7HA 4XPKA 4F0XA 4UFXA 1VHSA 4KOXA 1YSJA 1B87A 2FL4A 4MFQA 4M85A 4KOWA 1ELLP 2FIWA 5I0CA 3EFAA 4ZY2A 2F5IA 3SJFA 1R43A 2GIVA 2PJBA 1Y9KA 4MFLA 5E96A 3VATA 1IICA 2HB6A 4UEEA 4MFJA 4C7IA 2ARHA 2CXAA 3HLPA 3LACA 4LQ6A 4PXCA 3WC7A 4F9VA 5LRKA 2PR1A 4OC4A 5K8NA 2F8HA 1RXTA 3D7FA 3BLNA 2BCOA 4L8AA 1LFWA 4ZY0A 4CAVA 4NF1A 4DJLA 2PE3A 1IY7A 1MJ9A 3D8PA 3IU1A 4Q38A 2QYVA 4CYQA 2C6CA 5LYDA 2Q4ZA 2B3VA 4KZTA 4UEZA 3CXQA 2V8HA 4CAWA 2C6PA 4MFKA 4Y49C 3WABA 4JJXA 1LAMA 2DF5A 1LCPA 3CDXA 2POKA 3PRTA 3PB7X 4Q7AA 2FCKA 1HDUA 1S60A 1QSNA 3T8WA 1VIXA 2V8VA 4M6IA 4MXUA 5THWA 5ISVA 3D3SA 4NFRA 1YX0A 4CGLA 1FY7A 4A94A 1QSMA 2FT0A 4ZI6A 5IB0A 2C1CA 3IJ3A 4B12A 4CAXA 2OOTA 3DGVA 1QSRA 2DXQA 2ZELA 4BD9A 1GHEA 4E8OA 2J8NA 2JBKA 2PJ0A 3IO1A 1FNOA 3I9SA 4OLLA 5LYFA 3S6KA 4OKOA 1P0HA 3GY9A 2Z11A 2YNCA 5JM6A 2CY2A 4U9ZA 4A95A 2VBQA 4PK3A 4C2YA 3DR8A 4M6HA 4NGQA 4R7MA 3CPAA 2YNCC 4HNXB 5JGFA 4UEFA 3LODA 4Z65A 4AXVA 1Z8WA 3K2KA 4PXEA 3P2HA 5J8FA 3GKRA 2PJ9A 3PBEA 4FD6A 4B14A 2PQ8A 2AE6A 4E0AA 1CP7A 4PV6A 2AFSA 4KUBA 2IQ6A 2KCWA 2BOAA 2YNEA 1TF9A 4FAIA 1X10A 2PVWA 3PEIA 4EFDA 1XEBA 2PR8A 4CYOA 5HVGA 4A38A 2PJ8A 3DLJA 2JLMA 4XNHB 1QQ9A 1LOKA 2AFWA 3GLJA 4EWTA 5AG7A 2GE3A 3KQZA 1ON0A 4RS2A 5KTCA 4ZY1A 1PU9A 1A2ZA 1I1DA 5IV0A 1S7KA 3QB8A 3FIXA 4A2ZA 2O28A 1YMEA 3FVLA 4RN7A 4F0YA 2Z3NA 4UBRA 4R9MA 1YQEA 1Z8TA 1CPXA 2B4BA 3BJ8A 1HEEA 2Z3OA 3S6GA 2VZYA 4U5YA 4A37A 4OAEA 3WC5A 2ABZA 4KORA 2Q7BA 2HV2A 8CPAA 2B5GA 2C6GA 3FB3A 3S6FA 3B3WA 4P6YA 2FVGA 4X3RA 3V8IA 1CM0A 4JXQA 4MRIA 3TOAA 1LAPA 1S3ZA 3VH9A 1Y0YA 4A31A 5F49A 5C82A 1M1DA 4CGMA 3LD2A 4MBUA 3KHZA 3SJXA 2PJAA 3E0KA 1R3NA 3DDDA 5J8CA 3ZJ0A 4QBJA 1PUAA 2EBJA 2ZOFA 1IB1E 4UCPA 4R8FA 1PYTB 3H4QA 3TX8A 1YVKA 3D7GA 4MFZA 4P45A 1XFOA 1JQGA 3IIBA 5HVFA 1IGBA 3NH5A 4MMOA 4OC3A 1TXRA 3G3SA 4PPZA 2B5GB 2I79A 3CPXA 1MK4A 3FYNA 1N71A 3A9LA 3PZJA 4ORFA 4WWVA 3B3VA 7CPAA 5G21A 3B35A 4P4EA 5DWMA 3JUWA 2CTCA 3IEHA 3R95A 3B7IA 3RBUA 1UFHA 3K9TA 4UCMA 4QVTA 1QSTA 2A4NA 3PBBA 3W6XA 4ZX8A 1Y9WA 4BINA 2PJ5A 4A33A 3KASA 3B8GA 3LMSA 2AFXA 5AG5A 1BPNA 2ZENA 2ZPAA 5D8NA 2AFOA 5AG4A 1JWQA 1B6BA 1YLEA 2ZW6A 3CZXA 1Y7EA 4H89A 2EUIA 1ZLHA 2ATRA 5HMNA 2X7BA 3IGRA 3ISXA 3H8EA 4OP4A 5LYIA 3D7DA 3S9NA 4P4BA 4R6TA 1XMBA 3RAMA 4A30A 4KVOE 3SXNA 2PC1A 5H84A 4KVXA 2FSRA 1Q7LA 3TCVA 3FEEA 1AYEA 3P2FA 4FD4A 4YWYA 2EK8A 5F09A 4B5OA 4XPLA 2IMOA 4NGTA 1AUGA 4G1PA 5EC4A 4C7HA 3N7ZA 3IC1A 5A28A 3GB0A 1I21A 1CG2A 2GU2A 3W91A 3T9YA 1XOVA 1CPSA 2V8DA 2CF4A 3EC4A 3FNCA 4X2TA 2K5TA 2JEVA 3JTKA 1KWMA 2RB7A 3MN8A 1P4NA 1Q2CA 3FEDA 3DNSA 3TT2A 4KUAA 5KTAA 3TTHA 3RNZA 3RZAA 4E2AA 4MFPA 4CRZB 1TF8A 2B58A 5AG6A 3WC6A 4FD7A 2CNMA 1Z8XA 5LYLA 2EWBA 1Z5RA 3PP9A 1SQHA 3H8GA 4ZYQA 4QB9A 4CAEA 1U6MA 1XJOA 3CT9A 2H5MA 2OH1A 2Y0MA 1LRZA 1GYTA 1V0CA 2BUEA 4MHNA 4KLWA 1J4JA 4NGNA 4UWIA 4B11A 1VHEA 3PB6X 3SXOA 3FBUA 1OZPA 1H8LA 4AVBA 5I4MA 4DUKA 1MJAA 4XNHC 1L0CA 2BO9A 5LRGA 2CNTA 2I3CA 2AFUA 3PGPA 1K4JA 1YVOA 1BPMA 5HH1A 2AFZA 4JLYA 4CRYB 2P6FA 5CBMA 4NJRA 3KGQA 4LX9A 5CPAA 3S6HA 3KZWA 3S9MA 4DYOA 1LANA 3JVNA 3NH8A 1KUXA 3RO0A 4AVCA 4ZX9A 1YK3A 2AFMA 4L89A 4CYNA 4P4JA 2GLJA 3F5BA 5K8MA 2OB0A 4NJQA 2P6EA 3VWDA 2PDOA 4PXDA 4MHYA 1ZG7A 2VI7A 3EXNA 1KZFA 4OC1A 2PJCA 2REEA 3F8KA 4TNUA 3R9EA 4OC0A 4MHZA 2B4DB 4B10A 3UY5A 3B3TA 4MHPA 2O4HA 1I12A 2REFA 1RO5A 4HPSA 1XBUA 4HKFA 2YNDA 1X12A 2Q04A 4P10A 4FBEA 1XIXA 1YLOA 3FX6A 4HNWB 1CP6A 1Z2LA 2D4OA 2QECA 2F7VA 2R8VA 2RC4A 4H6UA 4MY3A 3FJUA 4NCZA 2NYQA 3BHXA 4OC5A 4YGOA 2Z3PA 4R76A 1CBXA 2JBJA 3KR4A 3D2MA 1HDQA 1XMTA 3NFZA 4MCPA 3I1UA 4JWPA 5EBVA 1KUVA 1ZG8A 4NGSA 5J1QA 4HNYB 2XEFA 5ELYA 4UFWA 1EE3P 3QNVA 1Y0RA 3ZZIA 3WR7A 3SJGA 4TWEA 3KQXA 3FECA 4KSIA 3R9FA 4IUSA 4ZBGA 3DSBA 4MCQA 4F8ZA 3KI9A 1KUYA 2PJ1A 2ZW5A 2P0WA 3F0AA 4MCSA 3R9GA 4KVME 4PSXA 3SHPA 5K8PA 5G1ZA 4C2ZA 3C26A 4RI1A 3VWEA 3KKWA 1Q2YA 3N5FA 4P4DA 1ARMA 4B6ZA 1IIDA 2CIJA 1IYLA 1XE4A 3PB9X 2VQYA 3D67A 3FH4A 4KLVA 4KSFA 4AG9A 4ZGYB 2WPWA 3H8FA 2GFQA 2O53A 4CS0B 4KOYA 5F46A 4UIAA 3B3CA 4XPDB 1QMUA 1IOFA 3FXTA 3GIUA 3IFEA 3QAYA 4OMEA 4UFVA 1XF8A 3D4UA 2ANPA 4QUSA 2ZW7A 4KOTA 3SI1A 2ZEFA 2ZOGA 4UA3A 2D4PA 5HVHA 4YRHA 2XEJA 5H86A 2JEWA 1BO4A 4Q36A 4H6ZA 1YW4A 2Q51A 3D66A 2Z10A 1TKHA 2IJZA 1R57A 2PRQA 2EK9A 3LWUA 1BAVA 2OU2A 2CNSA 2R1IA 1Z9UA 2J8MA 1TKFA 2G0BA 2XEGA 3PFOA 5A27A 4IAVA 2QMLA 4P4FA 1ARLA 2DEAA 4CGPA 3R1KA 4R87A 4U9YA 2Q4YA 1VKCA 3D7HA 4OADA 2PIZA 2PCUA 2OZGA 5F48A 2XEIA 3SI2A 2V77A 3R96A 3CXSA 4JZ0A 1NMTA 3PB8X 4PXBA 4UWJA 2BL1A 2GLFA 1VGYA 4YFJA 3D2PA 2PIYA 4CGOA 3B3SA 1WWZA 4AVAA 4J3GA 3TC8A 2Q4VA 5F47A 4A39A 4CGNA 2WPXA 3L2NA 1BOBA 3FRMA 4P44A 4B5PB 1S5KA 2Z0ZA 1RTQA 1QSOA 4IHMA 1CJWA 1Y7RA 1DTDA 5G22A 3TOBA 4BBHA 4R3LA 4NXYA 1M4DA 4P4IA 4F6AA 2RFHA 1S7NA 1M4IA 1PCAA 2IL4A 2OZUA 4NGRA 4W9YA 2HQYA 4A32A 4KS9A 5G20A 5IX3A 5JQ4A 3GYAA 2PJ3A 1F57A 2FXFA 3D68A 2VEZA
chains in the Genus database with same CATH topology
3TO7A 2B4DA 2Q44A 2Z3KA 2JDDA 2JDCA 2PRBA 1WK4A 4JXRA 4NEXA 2VZZA 2FS5A 4X5KA 2C27A 4MHDA 3EY5A 2ZW4A 4MJ8A 2WSAA 2NMTA 3I3GA 1Z4EA 3T90A 4DNCA 4R3KA 1YGHA 4NSQA 4AB7A 5AGEA 4C2XA 3CXPA 3TO6A 4Y49B 2VXKA 4CAFA 1S7LA 4GS4A 5FVJA 4R57A 1Q2DA 1TIQA 1YR0A 2G3TA 3RYOA 2OZHA 2HUZA 1MJBA 2ZXVA 4LUAA 4UCNA 3H5ZA 3IWEA 3TE4A 4II9A 3IU2A 4M3SA 2DPTA 2R98A 2WUUA 1M44A 2Z3LA 4EVYA 3BJ7A 4PK2A 1Z4RA 4B13A 4KSAA 1IYKA 5BWAB 3DR6A 4QC6A 3TO9A 2GANA 5CNPA 3IWGA 1ZO0A 4I49A 4XPDC 1NSLA 5DWNA 4AG7A 4BMHA 4C68A 1S7FA 2I00A 2P6GA 2AJ6A 4JD6A 4PSWA 4K30A 4FD5A 3MGDA 5C88A 2EVNA 2FE7A 3OWCA 4MY0A 2J8RA 1M4GA 3QAHA 4IF5A 2QIRA 3EO4A 4ONUA 2DPSA 2BSWA 3K9UA 3NE7A 2Q0YA 1YREA 2BEIA 2Z3MA 4KOVA 2G3AA 4MI4A 3G8WA 5KTDA 5GCNA 2PSWA 4B5PA 1NE9A 3TFYA 2B3UA 2YGWA 4CYPA 4KOSA 2FIAA 4KOUA 2R7HA 4XPKA 4F0XA 4UFXA 1VHSA 4KOXA 1B87A 4MFQA 2FL4A 4M85A 4KOWA 2FIWA 5I0CA 3EFAA 2F5IA 2GIVA 5E96A 1Y9KA 4MFLA 1IICA 4MFJA 4C7IA 2ARHA 2CXAA 2PR1A 1RXTA 3BLNA 4L8AA 4CAVA 4NF1A 3D8PA 1MJ9A 3IU1A 4Q38A 4CYQA 2B3VA 4KZTA 3CXQA 4CAWA 4MFKA 4Y49C 4JJXA 2FCKA 1S60A 1QSNA 5ISVA 3D3SA 1YX0A 4CGLA 1FY7A 5IB0A 1QSMA 2FT0A 4B12A 4CAXA 1QSRA 2DXQA 4E8OA 1GHEA 2J8NA 3I9SA 4OLLA 3S6KA 1P0HA 3GY9A 2Z11A 2YNCA 2CY2A 4U9ZA 4A95A 2VBQA 4PK3A 4C2YA 3DR8A 2YNCC 4HNXB 3LODA 3P2HA 5J8FA 3GKRA 4FD6A 4B14A 2PQ8A 2AE6A 4E0AA 4PV6A 4KUBA 2KCWA 2YNEA 1XEBA 2PR8A 4CYOA 2JLMA 4XNHB 5AG7A 2GE3A 1ON0A 4RS2A 5KTCA 1PU9A 1I1DA 5IV0A 1S7KA 3QB8A 3FIXA 4A2ZA 2O28A 4F0YA 2Z3NA 4UBRA 4R9MA 2B4BA 3BJ8A 2Z3OA 3S6GA 2VZYA 4U5YA 4OAEA 4KORA 2Q7BA 2HV2A 2B5GA 3FB3A 3S6FA 3V8IA 1CM0A 4JXQA 3TOAA 1S3ZA 4A31A 5F49A 5C82A 1M1DA 4CGMA 3LD2A 4MBUA 3E0KA 3DDDA 5J8CA 3ZJ0A 4QBJA 1PUAA 1IB1E 4UCPA 3H4QA 1YVKA 4MFZA 3G3SA 3W6SA 2B5GB 2I79A 4ORFA 1MK4A 3FYNA 1N71A 3A9LA 3PZJA 5G21A 5DWMA 3R95A 3JUWA 1UFHA 4UCMA 4QVTA 1QSTA 2A4NA 3W6XA 1Y9WA 4A33A 3B8GA 5AG5A 2ZPAA 5AG4A 1B6BA 1YLEA 2ZW6A 4H89A 5HMNA 2EUIA 2ATRA 2X7BA 3IGRA 4A30A 4KVOE 3SXNA 2PC1A 5H84A 4KVXA 2FSRA 3TCVA 3P2FA 4FD4A 4B5OA 4XPLA 4C7HA 5EC4A 3N7ZA 5A28A 1I21A 3W91A 3T9YA 3EC4A 3FNCA 2K5TA 2JEVA 3JTKA 1P4NA 1Q2CA 3DNSA 3TT2A 4KUAA 5KTAA 3TTHA 4E2AA 4MFPA 4CRZB 2B58A 5AG6A 4FD7A 2CNMA 3PP9A 1SQHA 4QB9A 4CAEA 1U6MA 2H5MA 2OH1A 2Y0MA 1LRZA 1V0CA 2BUEA 4KLWA 1J4JA 4UWIA 4B11A 3SXOA 3FBUA 1OZPA 4AVBA 1MJAA 4XNHC 1L0CA 2CNTA 3PGPA 1K4JA 1YVOA 5HH1A 4JLYA 4CRYB 2P6FA 4LX9A 3S6HA 3JVNA 1KUXA 4AVCA 1YK3A 4L89A 4CYNA 3F5BA 2OB0A 2P6EA 3VWDA 2PDOA 2VI7A 3EXNA 1KZFA 2REEA 3F8KA 3R9EA 2B4DB 4B10A 3UY5A 1I12A 2REFA 1RO5A 4HKFA 2YNDA 2Q04A 1XIXA 4HNWB 2D4OA 2QECA 2R8VA 4H6UA 2RC4A 4MY3A 4NCZA 4YGOA 2Z3PA 3D2MA 1XMTA 4JWPA 5EBVA 1KUVA 4HNYB 4UFWA 3ZZIA 3WR7A 3R9FA 4IUSA 4ZBGA 3DSBA 1KUYA 2ZW5A 2P0WA 3F0AA 3R9GA 4KVME 4PSXA 3SHPA 5G1ZA 4C2ZA 3C26A 4RI1A 3VWEA 3KKWA 1Q2YA 1IIDA 1IYLA 1XE4A 2VQYA 4KSFA 4KLVA 4AG9A 4ZGYB 2WPWA 4CS0B 5F46A 4KOYA 4XPDB 3FXTA 4UFVA 1XF8A 4QUSA 2ZW7A 4KOTA 4UA3A 2D4PA 4YRHA 5H86A 4Q36A 1BO4A 4H6ZA 2Z10A 1R57A 2OU2A 2R1IA 2CNSA 1Z9UA 2J8MA 2G0BA 5A27A 2QMLA 4CGPA 3R1KA 4R87A 4U9YA 2Q4YA 1VKCA 4OADA 2OZGA 5F48A 3R96A 3CXSA 1NMTA 4UWJA 2BL1A 4YFJA 3D2PA 4CGOA 1WWZA 4AVAA 4J3GA 4CGNA 2Q4VA 5F47A 5JPHA 2WPXA 1BOBA 3FRMA 4B5PB 1S5KA 2Z0ZA 1QSOA 1Y7RA 1CJWA 5G22A 3TOBA 4BBHA 4R3LA 4NXYA 1M4DA 4F6AA 1S7NA 1M4IA 2IL4A 2OZUA 4A32A 2HQYA 4KS9A 5G20A 5IX3A 5JQ4A 3GYAA 2FXFA 2VEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO7 A;  2B4D A;  2Q44 A;  2JDD A;  2JDC A;  2PRB A;  1WK4 A;  4JXR A;  4NEX A;  2VZZ A;  2FS5 A;  4X5K A;  2C27 A;  4MHD A;  3EY5 A;  2ZW4 A;  4MJ8 A;  2NMT A;  3I3G A;  1Z4E A;  3T90 A;  4DNC A;  4R3K A;  1YGH A;  4NSQ A;  4AB7 A;  3CXP A;  3TO6 A;  4Y49 B;  2VXK A;  1S7L A;  4GS4 A;  5FVJ A;  4R57 A;  1Q2D A;  1TIQ A;  1YR0 A;  2G3T A;  3RYO A;  2OZH A;  2HUZ A;  1MJB A;  2ZXV A;  4LUA A;  3TE4 A;  4II9 A;  4M3S A;  2R98 A;  1M44 A;  4EVY A;  3BJ7 A;  4PK2 A;  1Z4R A;  1IYK A;  3DR6 A;  4QC6 A;  3TO9 A;  2GAN A;  5CNP A;  3IWG A;  4I49 A;  4XPD C;  1NSL A;  5DWN A;  4AG7 A;  4BMH A;  1S7F A;  2I00 A;  2P6G A;  2AJ6 A;  4JD6 A;  4PSW A;  4K30 A;  4FD5 A;  3MGD A;  5C88 A;  2EVN A;  2FE7 A;  3OWC A;  4MY0 A;  2J8R A;  1M4G A;  3QAH A;  4IF5 A;  2QIR A;  3EO4 A;  4ONU A;  2BSW A;  3K9U A;  3NE7 A;  2Q0Y A;  1YRE A;  2BEI A;  4KOV A;  2G3A A;  4MI4 A;  3G8W A;  5KTD A;  5GCN A;  2PSW A;  4B5P A;  1NE9 A;  3TFY A;  2B3U A;  4KOS A;  2FIA A;  4KOU A;  2R7H A;  4XPK A;  1VHS A;  4KOX A;  1B87 A;  2FL4 A;  4M85 A;  4KOW A;  2FIW A;  5I0C A;  3EFA A;  2F5I A;  2GIV A;  5E96 A;  1Y9K A;  1IIC A;  2ARH A;  2PR1 A;  1RXT A;  3BLN A;  4L8A A;  4CAV A;  4NF1 A;  3D8P A;  1MJ9 A;  2B3V A;  4KZT A;  3CXQ A;  4CAW A;  4Y49 C;  4JJX A;  2FCK A;  1S60 A;  1QSN A;  5ISV A;  3D3S A;  1YX0 A;  1FY7 A;  5IB0 A;  1QSM A;  2FT0 A;  4CAX A;  1QSR A;  2DXQ A;  4E8O A;  1GHE A;  2J8N A;  3I9S A;  4OLL A;  3S6K A;  1P0H A;  3GY9 A;  2Z11 A;  2CY2 A;  4U9Z A;  2VBQ A;  4PK3 A;  3DR8 A;  4HNX B;  3LOD A;  3P2H A;  5J8F A;  3GKR A;  4FD6 A;  2PQ8 A;  2AE6 A;  4E0A A;  4PV6 A;  4KUB A;  2KCW A;  1XEB A;  2PR8 A;  2JLM A;  4XNH B;  2GE3 A;  1ON0 A;  4RS2 A;  5KTC A;  1PU9 A;  1I1D A;  5IV0 A;  1S7K A;  3QB8 A;  3FIX A;  2O28 A;  4F0Y A;  4UBR A;  4R9M A;  2B4B A;  3BJ8 A;  3S6G A;  2VZY A;  4U5Y A;  4OAE A;  4KOR A;  2Q7B A;  2HV2 A;  2B5G A;  3FB3 A;  3S6F A;  3V8I A;  1CM0 A;  4JXQ A;  3TOA A;  1S3Z A;  5F49 A;  5C82 A;  1M1D A;  3LD2 A;  4MBU A;  3E0K A;  3DDD A;  5J8C A;  3ZJ0 A;  4QBJ A;  1PUA A;  1IB1 E;  3H4Q A;  1YVK A;  3G3S A;  3W6S A;  2B5G B;  2I79 A;  4ORF A;  1MK4 A;  3FYN A;  1N71 A;  3PZJ A;  5DWM A;  3R95 A;  3JUW A;  1UFH A;  4QVT A;  1QST A;  2A4N A;  3W6X A;  1Y9W A;  3B8G A;  2ZPA A;  1B6B A;  1YLE A;  2ZW6 A;  4H89 A;  5HMN A;  2EUI A;  2ATR A;  2X7B A;  3IGR A;  4KVO E;  3SXN A;  2PC1 A;  5H84 A;  4KVX A;  2FSR A;  3TCV A;  3P2F A;  4FD4 A;  4B5O A;  4XPL A;  5EC4 A;  3N7Z A;  1I21 A;  3W91 A;  3T9Y A;  3EC4 A;  3FNC A;  2K5T A;  2JEV A;  1P4N A;  1Q2C A;  3DNS A;  3TT2 A;  4KUA A;  5KTA A;  3TTH A;  4E2A A;  4CRZ B;  2B58 A;  4FD7 A;  2CNM A;  3PP9 A;  1SQH A;  4QB9 A;  1U6M A;  2H5M A;  2OH1 A;  2Y0M A;  1LRZ A;  1V0C A;  2BUE A;  4KLW A;  1J4J A;  4UWI A;  3SXO A;  3FBU A;  1OZP A;  4AVB A;  1MJA A;  4XNH C;  1L0C A;  2CNT A;  3PGP A;  1K4J A;  1YVO A;  5HH1 A;  4JLY A;  4CRY B;  2P6F A;  4LX9 A;  3S6H A;  3JVN A;  1KUX A;  4AVC A;  1YK3 A;  4L89 A;  3F5B A;  2OB0 A;  2P6E A;  3VWD A;  2PDO A;  2VI7 A;  3EXN A;  1KZF A;  2REE A;  3F8K A;  3R9E A;  2B4D B;  3UY5 A;  1I12 A;  2REF A;  1RO5 A;  4HKF A;  2Q04 A;  1XIX A;  4HNW B;  2D4O A;  2QEC A;  2R8V A;  4H6U A;  2RC4 A;  4MY3 A;  4NCZ A;  4YGO A;  3D2M A;  1XMT A;  4JWP A;  5EBV A;  1KUV A;  4HNY B;  3ZZI A;  3WR7 A;  3R9F A;  4IUS A;  4ZBG A;  3DSB A;  1KUY A;  2ZW5 A;  2P0W A;  3F0A A;  3R9G A;  4KVM E;  4PSX A;  3SHP A;  3C26 A;  4RI1 A;  3VWE A;  3KKW A;  1Q2Y A;  1IID A;  1IYL A;  1XE4 A;  2VQY A;  4KLV A;  4AG9 A;  2WPW A;  4CS0 B;  5F46 A;  4KOY A;  4XPD B;  3FXT A;  1XF8 A;  4QUS A;  2ZW7 A;  4KOT A;  4UA3 A;  2D4P A;  4YRH A;  5H86 A;  1BO4 A;  4H6Z A;  2Z10 A;  1R57 A;  2OU2 A;  2R1I A;  2CNS A;  1Z9U A;  2J8M A;  2G0B A;  2QML A;  3R1K A;  4R87 A;  4U9Y A;  2Q4Y A;  1VKC A;  4OAD A;  2OZG A;  5F48 A;  3R96 A;  3CXS A;  1NMT A;  4UWJ A;  2BL1 A;  4YFJ A;  3D2P A;  1WWZ A;  4AVA A;  4J3G A;  5JPH A;  2Q4V A;  5F47 A;  2WPX A;  1BOB A;  3FRM A;  4B5P B;  1S5K A;  2Z0Z A;  1QSO A;  1Y7R A;  1CJW A;  3TOB A;  4F6A A;  4R3L A;  4NXY A;  1M4D A;  1S7N A;  1M4I A;  2IL4 A;  2OZU A;  2HQY A;  5IX3 A;  5JQ4 A;  3GYA A;  2FXF A;  2VEZ A; 
#chains in the Genus database with same CATH topology
 3TO7 A;  3MRU A;  3GUX A;  2B4D A;  2Q44 A;  2Z3K A;  2JDD A;  2QVP A;  3PB4 X;  2JDC A;  2G9D A;  1WK4 A;  2PRB A;  2QJ8 A;  3BI1 A;  4JXR A;  4ONW A;  4NEX A;  2VZZ A;  2FS5 A;  4X5K A;  2C27 A;  4MHD A;  4UIB A;  3EY5 A;  2ZW4 A;  4MJ8 A;  2WSA A;  2NMT A;  3I3G A;  1Z4E A;  3BI0 A;  3T90 A;  4DNC A;  5K8O A;  4R3K A;  1YGH A;  2ZEP A;  2CTB A;  4NSQ A;  4AB7 A;  5AGE A;  4OC2 A;  3NA6 A;  4C2X A;  3CXP A;  3TO6 A;  1XRY A;  4Y49 B;  2VXK A;  3NH4 A;  4CAF A;  1ZG9 A;  1BLL E;  2ZEH A;  1S7L A;  1M4L A;  2ZEE A;  4GS4 A;  5FVJ A;  4R57 A;  1Q2D A;  5DS0 A;  2PJ4 A;  4O23 A;  2OR4 A;  4F9U A;  1CX8 A;  1TIQ A;  1YR0 A;  5D29 A;  2G3T A;  2ODF A;  3RYO A;  2OZH A;  4EME A;  2V8G A;  2HUZ A;  3KL9 A;  3SJE A;  3FF3 A;  1MJB A;  2ZXV A;  3FMC A;  2PVV A;  4LUA A;  2GRE A;  3H5Z A;  4UCN A;  3IWE A;  3TE4 A;  4II9 A;  3IU2 A;  3KHX A;  4M3S A;  2DPT A;  2R98 A;  2WUU A;  1ZLI A;  1F2O A;  1ELM P;  3WT4 A;  4GXH A;  1M44 A;  4YU9 A;  2Z3L A;  4NGP A;  3JRU A;  4EVY A;  4K3N A;  5LRJ A;  1OBR A;  3BJ7 A;  3BXM A;  4IK2 A;  4PK2 A;  1Z4R A;  5EMI A;  4B13 A;  5JPH A;  4KSA A;  1UWY A;  4CPA A;  3V7Z A;  1IOI A;  2J9A A;  2WYR A;  4RUH A;  5IB9 A;  5HXD A;  1DE4 C;  1IYK A;  5BWA B;  4LQG A;  3DR6 A;  4QC6 A;  3IWW A;  3TO9 A;  2GAN A;  5CNP A;  3IWG A;  3HUV A;  1ZO0 A;  3KR5 A;  4FUU A;  4GM5 A;  4I49 A;  4XPD C;  1NSL A;  5DWN A;  4AG7 A;  4BMH A;  4C68 A;  1S7F A;  2I00 A;  2P6G A;  2AJ6 A;  5JH9 A;  1Z8L A;  4JD6 A;  4JYW A;  4PSW A;  3S9L A;  2Q7S A;  4K30 A;  4FD5 A;  4OID A;  2VL1 A;  2NSM A;  1VHO A;  3MGD A;  5C88 A;  2EVN A;  2FE7 A;  4MCR A;  3OWC A;  3SI0 A;  4MY0 A;  2ZEM A;  1IU8 A;  4OIW A;  2J8R A;  1M4G A;  3NE8 A;  3QAH A;  2ZED A;  4IF5 A;  2QIR A;  2ZEO A;  3EO4 A;  4ONU A;  2DPS A;  2BSW A;  4UF4 A;  6CPA A;  4WJB A;  4PQA A;  1F2P A;  3K9U A;  4X8I A;  3NE7 A;  4H2K A;  2PJ7 A;  2Q0Y A;  1YRE A;  2BEI A;  2Z3M A;  1FT7 A;  4FWU A;  2PJ6 A;  1AMP A;  3ISZ A;  2PJ2 A;  3B2Y A;  4KOV A;  2G3A A;  4NGM A;  3VAR A;  2WZN A;  3V38 A;  3W6S A;  4MI4 A;  3G8W A;  5KTD A;  5GCN A;  2PSW A;  4B5P A;  1NE9 A;  3PFE A;  1TKJ A;  4M6G A;  1YW6 A;  2B3U A;  3TFY A;  2Q43 A;  2YGW A;  1NSA A;  4CYP A;  4KOS A;  2HC9 A;  2ZEG A;  2EO8 A;  2FIA A;  4KOU A;  2R7H A;  4XPK A;  4F0X A;  4UFX A;  1VHS A;  4KOX A;  1YSJ A;  1B87 A;  2FL4 A;  4MFQ A;  4M85 A;  4KOW A;  1ELL P;  2FIW A;  5I0C A;  3EFA A;  4ZY2 A;  2F5I A;  3SJF A;  1R43 A;  2GIV A;  2PJB A;  1Y9K A;  4MFL A;  5E96 A;  3VAT A;  1IIC A;  2HB6 A;  4UEE A;  4MFJ A;  4C7I A;  2ARH A;  2CXA A;  3HLP A;  3LAC A;  4LQ6 A;  4PXC A;  3WC7 A;  4F9V A;  5LRK A;  2PR1 A;  4OC4 A;  5K8N A;  2F8H A;  1RXT A;  3D7F A;  3BLN A;  2BCO A;  4L8A A;  1LFW A;  4ZY0 A;  4CAV A;  4NF1 A;  4DJL A;  2PE3 A;  1IY7 A;  1MJ9 A;  3D8P A;  3IU1 A;  4Q38 A;  2QYV A;  4CYQ A;  2C6C A;  5LYD A;  2Q4Z A;  2B3V A;  4KZT A;  4UEZ A;  3CXQ A;  2V8H A;  4CAW A;  2C6P A;  4MFK A;  4Y49 C;  3WAB A;  4JJX A;  1LAM A;  2DF5 A;  1LCP A;  3CDX A;  2POK A;  3PRT A;  3PB7 X;  4Q7A A;  2FCK A;  1HDU A;  1S60 A;  1QSN A;  3T8W A;  1VIX A;  2V8V A;  4M6I A;  4MXU A;  5THW A;  5ISV A;  3D3S A;  4NFR A;  1YX0 A;  4CGL A;  1FY7 A;  4A94 A;  1QSM A;  2FT0 A;  4ZI6 A;  5IB0 A;  2C1C A;  3IJ3 A;  4B12 A;  4CAX A;  2OOT A;  3DGV A;  1QSR A;  2DXQ A;  2ZEL A;  4BD9 A;  1GHE A;  4E8O A;  2J8N A;  2JBK A;  2PJ0 A;  3IO1 A;  1FNO A;  3I9S A;  4OLL A;  5LYF A;  3S6K A;  4OKO A;  1P0H A;  3GY9 A;  2Z11 A;  2YNC A;  5JM6 A;  2CY2 A;  4U9Z A;  4A95 A;  2VBQ A;  4PK3 A;  4C2Y A;  3DR8 A;  4M6H A;  4NGQ A;  4R7M A;  3CPA A;  2YNC C;  4HNX B;  5JGF A;  4UEF A;  3LOD A;  4Z65 A;  4AXV A;  1Z8W A;  3K2K A;  4PXE A;  3P2H A;  5J8F A;  3GKR A;  2PJ9 A;  3PBE A;  4FD6 A;  4B14 A;  2PQ8 A;  2AE6 A;  4E0A A;  1CP7 A;  4PV6 A;  2AFS A;  4KUB A;  2IQ6 A;  2KCW A;  2BOA A;  2YNE A;  1TF9 A;  4FAI A;  1X10 A;  2PVW A;  3PEI A;  4EFD A;  1XEB A;  2PR8 A;  4CYO A;  5HVG A;  4A38 A;  2PJ8 A;  3DLJ A;  2JLM A;  4XNH B;  1QQ9 A;  1LOK A;  2AFW A;  3GLJ A;  4EWT A;  5AG7 A;  2GE3 A;  3KQZ A;  1ON0 A;  4RS2 A;  5KTC A;  4ZY1 A;  1PU9 A;  1A2Z A;  1I1D A;  5IV0 A;  1S7K A;  3QB8 A;  3FIX A;  4A2Z A;  2O28 A;  1YME A;  3FVL A;  4RN7 A;  4F0Y A;  2Z3N A;  4UBR A;  4R9M A;  1YQE A;  1Z8T A;  1CPX A;  2B4B A;  3BJ8 A;  1HEE A;  2Z3O A;  3S6G A;  2VZY A;  4U5Y A;  4A37 A;  4OAE A;  3WC5 A;  2ABZ A;  4KOR A;  2Q7B A;  2HV2 A;  8CPA A;  2B5G A;  2C6G A;  3FB3 A;  3S6F A;  3B3W A;  4P6Y A;  2FVG A;  4X3R A;  3V8I A;  1CM0 A;  4JXQ A;  4MRI A;  3TOA A;  1LAP A;  1S3Z A;  3VH9 A;  1Y0Y A;  4A31 A;  5F49 A;  5C82 A;  1M1D A;  4CGM A;  3LD2 A;  4MBU A;  3KHZ A;  3SJX A;  2PJA A;  3E0K A;  1R3N A;  3DDD A;  5J8C A;  3ZJ0 A;  4QBJ A;  1PUA A;  2EBJ A;  2ZOF A;  1IB1 E;  4UCP A;  4R8F A;  1PYT B;  3H4Q A;  3TX8 A;  1YVK A;  3D7G A;  4MFZ A;  4P45 A;  1XFO A;  1JQG A;  3IIB A;  5HVF A;  1IGB A;  3NH5 A;  4MMO A;  4OC3 A;  1TXR A;  3G3S A;  4PPZ A;  2B5G B;  2I79 A;  3CPX A;  1MK4 A;  3FYN A;  1N71 A;  3A9L A;  3PZJ A;  4ORF A;  4WWV A;  3B3V A;  7CPA A;  5G21 A;  3B35 A;  4P4E A;  5DWM A;  3JUW A;  2CTC A;  3IEH A;  3R95 A;  3B7I A;  3RBU A;  1UFH A;  3K9T A;  4UCM A;  4QVT A;  1QST A;  2A4N A;  3PBB A;  3W6X A;  4ZX8 A;  1Y9W A;  4BIN A;  2PJ5 A;  4A33 A;  3KAS A;  3B8G A;  3LMS A;  2AFX A;  5AG5 A;  1BPN A;  2ZEN A;  2ZPA A;  5D8N A;  2AFO A;  5AG4 A;  1JWQ A;  1B6B A;  1YLE A;  2ZW6 A;  3CZX A;  1Y7E A;  4H89 A;  2EUI A;  1ZLH A;  2ATR A;  5HMN A;  2X7B A;  3IGR A;  3ISX A;  3H8E A;  4OP4 A;  5LYI A;  3D7D A;  3S9N A;  4P4B A;  4R6T A;  1XMB A;  3RAM A;  4A30 A;  4KVO E;  3SXN A;  2PC1 A;  5H84 A;  4KVX A;  2FSR A;  1Q7L A;  3TCV A;  3FEE A;  1AYE A;  3P2F A;  4FD4 A;  4YWY A;  2EK8 A;  5F09 A;  4B5O A;  4XPL A;  2IMO A;  4NGT A;  1AUG A;  4G1P A;  5EC4 A;  4C7H A;  3N7Z A;  3IC1 A;  5A28 A;  3GB0 A;  1I21 A;  1CG2 A;  2GU2 A;  3W91 A;  3T9Y A;  1XOV A;  1CPS A;  2V8D A;  2CF4 A;  3EC4 A;  3FNC A;  4X2T A;  2K5T A;  2JEV A;  3JTK A;  1KWM A;  2RB7 A;  3MN8 A;  1P4N A;  1Q2C A;  3FED A;  3DNS A;  3TT2 A;  4KUA A;  5KTA A;  3TTH A;  3RNZ A;  3RZA A;  4E2A A;  4MFP A;  4CRZ B;  1TF8 A;  2B58 A;  5AG6 A;  3WC6 A;  4FD7 A;  2CNM A;  1Z8X A;  5LYL A;  2EWB A;  1Z5R A;  3PP9 A;  1SQH A;  3H8G A;  4ZYQ A;  4QB9 A;  4CAE A;  1U6M A;  1XJO A;  3CT9 A;  2H5M A;  2OH1 A;  2Y0M A;  1LRZ A;  1GYT A;  1V0C A;  2BUE A;  4MHN A;  4KLW A;  1J4J A;  4NGN A;  4UWI A;  4B11 A;  1VHE A;  3PB6 X;  3SXO A;  3FBU A;  1OZP A;  1H8L A;  4AVB A;  5I4M A;  4DUK A;  1MJA A;  4XNH C;  1L0C A;  2BO9 A;  5LRG A;  2CNT A;  2I3C A;  2AFU A;  3PGP A;  1K4J A;  1YVO A;  1BPM A;  5HH1 A;  2AFZ A;  4JLY A;  4CRY B;  2P6F A;  5CBM A;  4NJR A;  3KGQ A;  4LX9 A;  5CPA A;  3S6H A;  3KZW A;  3S9M A;  4DYO A;  1LAN A;  3JVN A;  3NH8 A;  1KUX A;  3RO0 A;  4AVC A;  4ZX9 A;  1YK3 A;  2AFM A;  4L89 A;  4CYN A;  4P4J A;  2GLJ A;  3F5B A;  5K8M A;  2OB0 A;  4NJQ A;  2P6E A;  3VWD A;  2PDO A;  4PXD A;  4MHY A;  1ZG7 A;  2VI7 A;  3EXN A;  1KZF A;  4OC1 A;  2PJC A;  2REE A;  3F8K A;  4TNU A;  3R9E A;  4OC0 A;  4MHZ A;  2B4D B;  4B10 A;  3UY5 A;  3B3T A;  4MHP A;  2O4H A;  1I12 A;  2REF A;  1RO5 A;  4HPS A;  1XBU A;  4HKF A;  2YND A;  1X12 A;  2Q04 A;  4P10 A;  4FBE A;  1XIX A;  1YLO A;  3FX6 A;  4HNW B;  1CP6 A;  1Z2L A;  2D4O A;  2QEC A;  2F7V A;  2R8V A;  2RC4 A;  4H6U A;  4MY3 A;  3FJU A;  4NCZ A;  2NYQ A;  3BHX A;  4OC5 A;  4YGO A;  2Z3P A;  4R76 A;  1CBX A;  2JBJ A;  3KR4 A;  3D2M A;  1HDQ A;  1XMT A;  3NFZ A;  4MCP A;  3I1U A;  4JWP A;  5EBV A;  1KUV A;  1ZG8 A;  4NGS A;  5J1Q A;  4HNY B;  2XEF A;  5ELY A;  4UFW A;  1EE3 P;  3QNV A;  1Y0R A;  3ZZI A;  3WR7 A;  3SJG A;  4TWE A;  3KQX A;  3FEC A;  4KSI A;  3R9F A;  4IUS A;  4ZBG A;  3DSB A;  4MCQ A;  4F8Z A;  3KI9 A;  1KUY A;  2PJ1 A;  2ZW5 A;  2P0W A;  3F0A A;  4MCS A;  3R9G A;  4KVM E;  4PSX A;  3SHP A;  5K8P A;  5G1Z A;  4C2Z A;  3C26 A;  4RI1 A;  3VWE A;  3KKW A;  1Q2Y A;  3N5F A;  4P4D A;  1ARM A;  4B6Z A;  1IID A;  2CIJ A;  1IYL A;  1XE4 A;  3PB9 X;  2VQY A;  3D67 A;  3FH4 A;  4KLV A;  4KSF A;  4AG9 A;  4ZGY B;  2WPW A;  3H8F A;  2GFQ A;  2O53 A;  4CS0 B;  4KOY A;  5F46 A;  4UIA A;  3B3C A;  4XPD B;  1QMU A;  1IOF A;  3FXT A;  3GIU A;  3IFE A;  3QAY A;  4OME A;  4UFV A;  1XF8 A;  3D4U A;  2ANP A;  4QUS A;  2ZW7 A;  4KOT A;  3SI1 A;  2ZEF A;  2ZOG A;  4UA3 A;  2D4P A;  5HVH A;  4YRH A;  2XEJ A;  5H86 A;  2JEW A;  1BO4 A;  4Q36 A;  4H6Z A;  1YW4 A;  2Q51 A;  3D66 A;  2Z10 A;  1TKH A;  2IJZ A;  1R57 A;  2PRQ A;  2EK9 A;  3LWU A;  1BAV A;  2OU2 A;  2CNS A;  2R1I A;  1Z9U A;  2J8M A;  1TKF A;  2G0B A;  2XEG A;  3PFO A;  5A27 A;  4IAV A;  2QML A;  4P4F A;  1ARL A;  2DEA A;  4CGP A;  3R1K A;  4R87 A;  4U9Y A;  2Q4Y A;  1VKC A;  3D7H A;  4OAD A;  2PIZ A;  2PCU A;  2OZG A;  5F48 A;  2XEI A;  3SI2 A;  2V77 A;  3R96 A;  3CXS A;  4JZ0 A;  1NMT A;  3PB8 X;  4PXB A;  4UWJ A;  2BL1 A;  2GLF A;  1VGY A;  4YFJ A;  3D2P A;  2PIY A;  4CGO A;  3B3S A;  1WWZ A;  4AVA A;  4J3G A;  3TC8 A;  2Q4V A;  5F47 A;  4A39 A;  4CGN A;  2WPX A;  3L2N A;  1BOB A;  3FRM A;  4P44 A;  4B5P B;  1S5K A;  2Z0Z A;  1RTQ A;  1QSO A;  4IHM A;  1CJW A;  1Y7R A;  1DTD A;  5G22 A;  3TOB A;  4BBH A;  4R3L A;  4NXY A;  1M4D A;  4P4I A;  4F6A A;  2RFH A;  1S7N A;  1M4I A;  1PCA A;  2IL4 A;  2OZU A;  4NGR A;  4W9Y A;  2HQY A;  4A32 A;  4KS9 A;  5G20 A;  5IX3 A;  5JQ4 A;  3GYA A;  2PJ3 A;  1F57 A;  2FXF A;  3D68 A;  2VEZ A; 
#chains in the Genus database with same CATH homology
 3TO7 A;  2B4D A;  2Q44 A;  2Z3K A;  2JDD A;  2JDC A;  2PRB A;  1WK4 A;  4JXR A;  4NEX A;  2VZZ A;  2FS5 A;  4X5K A;  2C27 A;  4MHD A;  3EY5 A;  2ZW4 A;  4MJ8 A;  2WSA A;  2NMT A;  3I3G A;  1Z4E A;  3T90 A;  4DNC A;  4R3K A;  1YGH A;  4NSQ A;  4AB7 A;  5AGE A;  4C2X A;  3CXP A;  3TO6 A;  4Y49 B;  2VXK A;  4CAF A;  1S7L A;  4GS4 A;  5FVJ A;  4R57 A;  1Q2D A;  1TIQ A;  1YR0 A;  2G3T A;  3RYO A;  2OZH A;  2HUZ A;  1MJB A;  2ZXV A;  4LUA A;  4UCN A;  3H5Z A;  3IWE A;  3TE4 A;  4II9 A;  3IU2 A;  4M3S A;  2DPT A;  2R98 A;  2WUU A;  1M44 A;  2Z3L A;  4EVY A;  3BJ7 A;  4PK2 A;  1Z4R A;  4B13 A;  4KSA A;  1IYK A;  5BWA B;  3DR6 A;  4QC6 A;  3TO9 A;  2GAN A;  5CNP A;  3IWG A;  1ZO0 A;  4I49 A;  4XPD C;  1NSL A;  5DWN A;  4AG7 A;  4BMH A;  4C68 A;  1S7F A;  2I00 A;  2P6G A;  2AJ6 A;  4JD6 A;  4PSW A;  4K30 A;  4FD5 A;  3MGD A;  5C88 A;  2EVN A;  2FE7 A;  3OWC A;  4MY0 A;  2J8R A;  1M4G A;  3QAH A;  4IF5 A;  2QIR A;  3EO4 A;  4ONU A;  2DPS A;  2BSW A;  3K9U A;  3NE7 A;  2Q0Y A;  1YRE A;  2BEI A;  2Z3M A;  4KOV A;  2G3A A;  4MI4 A;  3G8W A;  5KTD A;  5GCN A;  2PSW A;  4B5P A;  1NE9 A;  3TFY A;  2B3U A;  2YGW A;  4CYP A;  4KOS A;  2FIA A;  4KOU A;  2R7H A;  4XPK A;  4F0X A;  4UFX A;  1VHS A;  4KOX A;  1B87 A;  4MFQ A;  2FL4 A;  4M85 A;  4KOW A;  2FIW A;  5I0C A;  3EFA A;  2F5I A;  2GIV A;  5E96 A;  1Y9K A;  4MFL A;  1IIC A;  4MFJ A;  4C7I A;  2ARH A;  2CXA A;  2PR1 A;  1RXT A;  3BLN A;  4L8A A;  4CAV A;  4NF1 A;  3D8P A;  1MJ9 A;  3IU1 A;  4Q38 A;  4CYQ A;  2B3V A;  4KZT A;  3CXQ A;  4CAW A;  4MFK A;  4Y49 C;  4JJX A;  2FCK A;  1S60 A;  1QSN A;  5ISV A;  3D3S A;  1YX0 A;  4CGL A;  1FY7 A;  5IB0 A;  1QSM A;  2FT0 A;  4B12 A;  4CAX A;  1QSR A;  2DXQ A;  4E8O A;  1GHE A;  2J8N A;  3I9S A;  4OLL A;  3S6K A;  1P0H A;  3GY9 A;  2Z11 A;  2YNC A;  2CY2 A;  4U9Z A;  4A95 A;  2VBQ A;  4PK3 A;  4C2Y A;  3DR8 A;  2YNC C;  4HNX B;  3LOD A;  3P2H A;  5J8F A;  3GKR A;  4FD6 A;  4B14 A;  2PQ8 A;  2AE6 A;  4E0A A;  4PV6 A;  4KUB A;  2KCW A;  2YNE A;  1XEB A;  2PR8 A;  4CYO A;  2JLM A;  4XNH B;  5AG7 A;  2GE3 A;  1ON0 A;  4RS2 A;  5KTC A;  1PU9 A;  1I1D A;  5IV0 A;  1S7K A;  3QB8 A;  3FIX A;  4A2Z A;  2O28 A;  4F0Y A;  2Z3N A;  4UBR A;  4R9M A;  2B4B A;  3BJ8 A;  2Z3O A;  3S6G A;  2VZY A;  4U5Y A;  4OAE A;  4KOR A;  2Q7B A;  2HV2 A;  2B5G A;  3FB3 A;  3S6F A;  3V8I A;  1CM0 A;  4JXQ A;  3TOA A;  1S3Z A;  4A31 A;  5F49 A;  5C82 A;  1M1D A;  4CGM A;  3LD2 A;  4MBU A;  3E0K A;  3DDD A;  5J8C A;  3ZJ0 A;  4QBJ A;  1PUA A;  1IB1 E;  4UCP A;  3H4Q A;  1YVK A;  4MFZ A;  3G3S A;  3W6S A;  2B5G B;  2I79 A;  4ORF A;  1MK4 A;  3FYN A;  1N71 A;  3A9L A;  3PZJ A;  5G21 A;  5DWM A;  3R95 A;  3JUW A;  1UFH A;  4UCM A;  4QVT A;  1QST A;  2A4N A;  3W6X A;  1Y9W A;  4A33 A;  3B8G A;  5AG5 A;  2ZPA A;  5AG4 A;  1B6B A;  1YLE A;  2ZW6 A;  4H89 A;  5HMN A;  2EUI A;  2ATR A;  2X7B A;  3IGR A;  4A30 A;  4KVO E;  3SXN A;  2PC1 A;  5H84 A;  4KVX A;  2FSR A;  3TCV A;  3P2F A;  4FD4 A;  4B5O A;  4XPL A;  4C7H A;  5EC4 A;  3N7Z A;  5A28 A;  1I21 A;  3W91 A;  3T9Y A;  3EC4 A;  3FNC A;  2K5T A;  2JEV A;  3JTK A;  1P4N A;  1Q2C A;  3DNS A;  3TT2 A;  4KUA A;  5KTA A;  3TTH A;  4E2A A;  4MFP A;  4CRZ B;  2B58 A;  5AG6 A;  4FD7 A;  2CNM A;  3PP9 A;  1SQH A;  4QB9 A;  4CAE A;  1U6M A;  2H5M A;  2OH1 A;  2Y0M A;  1LRZ A;  1V0C A;  2BUE A;  4KLW A;  1J4J A;  4UWI A;  4B11 A;  3SXO A;  3FBU A;  1OZP A;  4AVB A;  1MJA A;  4XNH C;  1L0C A;  2CNT A;  3PGP A;  1K4J A;  1YVO A;  5HH1 A;  4JLY A;  4CRY B;  2P6F A;  4LX9 A;  3S6H A;  3JVN A;  1KUX A;  4AVC A;  1YK3 A;  4L89 A;  4CYN A;  3F5B A;  2OB0 A;  2P6E A;  3VWD A;  2PDO A;  2VI7 A;  3EXN A;  1KZF A;  2REE A;  3F8K A;  3R9E A;  2B4D B;  4B10 A;  3UY5 A;  1I12 A;  2REF A;  1RO5 A;  4HKF A;  2YND A;  2Q04 A;  1XIX A;  4HNW B;  2D4O A;  2QEC A;  2R8V A;  4H6U A;  2RC4 A;  4MY3 A;  4NCZ A;  4YGO A;  2Z3P A;  3D2M A;  1XMT A;  4JWP A;  5EBV A;  1KUV A;  4HNY B;  4UFW A;  3ZZI A;  3WR7 A;  3R9F A;  4IUS A;  4ZBG A;  3DSB A;  1KUY A;  2ZW5 A;  2P0W A;  3F0A A;  3R9G A;  4KVM E;  4PSX A;  3SHP A;  5G1Z A;  4C2Z A;  3C26 A;  4RI1 A;  3VWE A;  3KKW A;  1Q2Y A;  1IID A;  1IYL A;  1XE4 A;  2VQY A;  4KSF A;  4KLV A;  4AG9 A;  4ZGY B;  2WPW A;  4CS0 B;  5F46 A;  4KOY A;  4XPD B;  3FXT A;  4UFV A;  1XF8 A;  4QUS A;  2ZW7 A;  4KOT A;  4UA3 A;  2D4P A;  4YRH A;  5H86 A;  4Q36 A;  1BO4 A;  4H6Z A;  2Z10 A;  1R57 A;  2OU2 A;  2R1I A;  2CNS A;  1Z9U A;  2J8M A;  2G0B A;  5A27 A;  2QML A;  4CGP A;  3R1K A;  4R87 A;  4U9Y A;  2Q4Y A;  1VKC A;  4OAD A;  2OZG A;  5F48 A;  3R96 A;  3CXS A;  1NMT A;  4UWJ A;  2BL1 A;  4YFJ A;  3D2P A;  4CGO A;  1WWZ A;  4AVA A;  4J3G A;  4CGN A;  2Q4V A;  5F47 A;  5JPH A;  2WPX A;  1BOB A;  3FRM A;  4B5P B;  1S5K A;  2Z0Z A;  1QSO A;  1Y7R A;  1CJW A;  5G22 A;  3TOB A;  4BBH A;  4R3L A;  4NXY A;  1M4D A;  4F6A A;  1S7N A;  1M4I A;  2IL4 A;  2OZU A;  4A32 A;  2HQY A;  4KS9 A;  5G20 A;  5IX3 A;  5JQ4 A;  3GYA A;  2FXF A;  2VEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...