1KUXA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serotonin N-acetyltransferase
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuxA00
1MK4A 2OB0A 4EVYA 4YRHA 4XNHC 2KCWA 3FIXA 1NE9A 3R9FA 3BJ8A 4XPDB 1S7NA 2VZZA 1P4NA 3DNSA 3F0AA 4KOSA 2VI7A 2B3UA 4U5YA 2H5MA 2B5GB 3FBUA 1WWZA 4QBJA 2REEA 2PDOA 4JXRA 4UWIA 4PV6A 5F46A 4UA3A 4XPDC 4CRYB 2R7HA 5IB0A 1MJ9A 3TOBA 2VZYA 2GIVA 4KUAA 3P2HA 2Z0ZA 1S7KA 1IYKA 4II9A 1S3ZA 1KUXA 5C82A 1KZFA 5J8CA 3LODA 1M4GA 2ZPAA 2VQYA 3W6SA 5JPHA 4B5PA 4HNYB 5JQ4A 3R96A 4CAXA 1IIDA 1Q2CA 2Y0MA 3MGDA 2J8NA 1KUVA 1RXTA 3EXNA 4QUSA 2Q7BA 3EY5A 2HQYA 3TO6A 2OZUA 3H4QA 3JVNA 3K9UA 3S6KA 1LRZA 1I12A 1PU9A 4KUBA 1XEBA 2HV2A 4LUAA 2B58A 2B5GA 2Z10A 2Q4VA 3VWEA 4J3GA 2BL1A 4KOTA 1Q2DA 2AE6A 1U6MA 2ZW5A 4KORA 1RO5A 2Q04A 4JWPA 1YVOA 2A4NA 2ZW6A 2GE3A 4IUSA 4FD7A 4AVBA 4R9MA 5I0CA 4IF5A 4ZBGA 4FD6A 3P2FA 3NE7A 1XMTA 1XF8A 3CXQA 4HKFA 3LD2A 5H86A 4NXYA 2X7BA 2FXFA 2ZXVA 4OAEA 4I49A 4QB9A 2B3VA 4PSXA 2ATRA 2G3TA 3D2MA 2NMTA 4OADA 1IYLA 2PRBA 3TT2A 4GS4A 2QMLA 4B5PB 1YX0A 1Z4RA 3R9EA 3GYAA 2PSWA 5IV0A 4KLWA 4MBUA 3ZZIA 4Y49B 1B87A 1S60A 2F5IA 2FS5A 2PQ8A 1CM0A 4PK2A 2RC4A 1S7FA 3TOAA 1IICA 4XPKA 2JDCA 3TO7A 3SXOA 2WPXA 4F6AA 5KTAA 2GANA 2P6FA 4K30A 3TE4A 1S7LA 3JUWA 3QB8A 2OH1A 4KOUA 2VEZA 2FIAA 3DSBA 4KLVA 4MY3A 1N71A 2QIRA 4Y49C 2Q4YA 3G8WA 2D4PA 1I1DA 2QECA 2Z11A 3DR8A 1FY7A 3SXNA 2PR1A 3EFAA 3ZJ0A 4RS2A 2R98A 3CXSA 4NF1A 4X5KA 2BEIA 4F0YA 4QC6A 4OLLA 2R8VA 2B4DA 2I79A 2OZGA 3FRMA 4LX9A 1S5KA 1P0HA 1YK3A 5HMNA 4JD6A 5DWNA 1NMTA 3G3SA 1ON0A 4R57A 3S6HA 3D2PA 1Y9KA 4CAVA 1WK4A 1GHEA 4L8AA 2D4OA 4ORFA 3FNCA 2CNTA 3PZJA 2FT0A 2CNMA 1Z4EA 3EO4A 1R57A 4AG9A 3FB3A 1PUAA 2WPWA 5EBVA 5FVJA 2EUIA 3N7ZA 1VKCA 1Z9UA 1NSLA 1XE4A 2B4BA 3W6XA 4PSWA 3F5BA 5KTCA 4E0AA 3F8KA 4CAWA 3W91A 4NSQA 5CNPA 1V0CA 1OZPA 1M4IA 4KOYA 4RI1A 4MHDA 1CJWA 2FCKA 2BSWA 3WR7A 3QAHA 4KZTA 3TO9A 5J8FA 1QSOA 2OU2A 4QVTA 4ONUA 1SQHA 1QSRA 2G0BA 4E2AA 4L89A 1KUYA 5F48A 2AJ6A 1YVKA 4NCZA 3SHPA 2CNSA 1Y9WA 3PGPA 2B4DB 4MJ8A 4KVOE 5HH1A 3BJ7A 4PK3A 5F47A 2G3AA 2JLMA 3IWGA 4AG7A 2FL4A 1MJBA 1Q2YA 3VWDA 4FD4A 3B8GA 4JJXA 4KVME 4AVAA 4UBRA 5F49A 4AB7A 3T90A 4M85A 1QSTA 2R1IA 3TTHA 3CXPA 1QSMA 1YREA 3I9SA 2I00A 2JDDA 2VBQA 3D3SA 2FSRA 4YGOA 1B6BA 5DWMA 4MY0A 2DXQA 1M44A 3GKRA 4R3LA 4U9YA 2K5TA 1Y7RA 3T9YA 2IL4A 5E96A 2PR8A 1I21A 2FIWA 3GY9A 1MJAA 5EC4A 4AVCA 4R3KA 4JXQA 4CRZB 2REFA 2Q0YA 4B5OA 3PP9A 1YLEA 1BOBA 2C27A 4HNXB 2ARHA 1QSNA 1YGHA 4KOVA 2P6EA 3RYOA 4H6ZA 2HUZA 3S6GA 1IB1E 2ZW7A 5KTDA 4U9ZA 3C26A 4KVXA 1M1DA 4NEXA 4KOWA 3DDDA 2OZHA 2PC1A 3S6FA 4H6UA 3UY5A 1TIQA 4FD5A 2FE7A 5IX3A 3R95A 5GCNA 2ZW4A 4HNWB 3TCVA 3FYNA 4UWJA 3TFYA 1K4JA 4M3SA 2CY2A 3OWCA 3EC4A 3E0KA 4YFJA 4BMHA 3DR6A 4E8OA 3BLNA 5H84A 3R9GA 2BUEA 1YR0A 3I3GA 4KOXA 4JLYA 4XPLA 2P6GA 1M4DA 2O28A 1L0CA 4XNHB 1VHSA 4H89A 3V8IA 1XIXA 2VXKA 2P0WA 3IGRA 1UFHA 5C88A 2Q44A 4R87A 1J4JA 5ISVA 2EVNA 4MI4A 3FXTA 2JEVA 2J8MA 4DNCA 3R1KA 4CS0B 1BO4A 2J8RA 3KKWA 3D8PA
chains in the Genus database with same CATH superfamily
4FUUA 1MK4A 2HB6A 1KWMA 1HDUA 2OB0A 4BD9A 4EVYA 4YRHA 5THWA 5LYDA 2DPSA 3FEDA 1UWYA 5HMNA 5DS0A 1Q7LA 2WSAA 4CYNA 4R8FA 4XNHC 2KCWA 3FIXA 4UIBA 5HVFA 1NE9A 3R9FA 1XRYA 1CG2A 2QYVA 1S7NA 3BJ8A 4P10A 2VZZA 1QMUA 2CF4A 3FMCA 4XPDB 2CXAA 2ZEEA 1OBRA 1P4NA 3DNSA 3F0AA 4KOSA 4NJRA 2VI7A 4A32A 2B3UA 2ZEOA 4PXCA 4U5YA 3HUVA 4AXVA 2AFMA 2JBJA 3SJGA 3FECA 2H5MA 5K8PA 2ODFA 2B5GB 3FBUA 3NE8A 2PRQA 5HVHA 5CPAA 2Z3KA 3D68A 2OOTA 2ABZA 1WWZA 3B2YA 4QBJA 2C6PA 2XEJA 4P4JA 4RUHA 4YWYA 1IOFA 3PRTA 1LANA 1LFWA 2REEA 2PDOA 4JXRA 4UWIA 1CP6A 3NA6A 3QAYA 4PV6A 4P4IA 4KS9A 5F46A 2V8GA 4UA3A 3CPXA 2NSMA 4G1PA 4XPDC 4CRYB 3PB8X 3SI1A 3S9MA 2R7HA 5IB0A 2V77A 1MJ9A 1BPNA 2WYRA 3TOBA 7CPAA 2VZYA 5HVGA 1PCAA 2GIVA 4KUAA 2ZOFA 3P2HA 2Z0ZA 1IYKA 1S7KA 4C2YA 4II9A 1KUXA 1S3ZA 1GYTA 3H8FA 5C82A 1KZFA 5J8CA 4B10A 3LODA 1JWQA 4O23A 1M4GA 1XMBA 3ISXA 5D8NA 4R6TA 2ZPAA 4MHNA 4F9VA 2VQYA 3W6SA 5JPHA 4B5PA 3KR5A 4HNYB 5JQ4A 4B6ZA 2PVWA 3R96A 1HEEA 4CAXA 1TKHA 4OC2A 1IIDA 4LQGA 4LQ6A 1Q2CA 2Y0MA 3MGDA 2J8NA 1KUVA 1RXTA 3EXNA 2Q51A 4QUSA 2Q7BA 4C2ZA 4DJLA 3EY5A 2HQYA 3TO6A 3V38A 2OZUA 3H4QA 3JVNA 3K9UA 4WJBA 4ZX8A 3S6KA 1LRZA 1TKFA 2C6CA 2V8VA 1I12A 4NJQA 1PU9A 4OC4A 3JTKA 2XEFA 4KUBA 1XEBA 2HV2A 4LUAA 2B58A 2B5GA 2O4HA 2Z10A 3FX6A 1R43A 2Q4VA 4MXUA 2F8HA 3CPAA 1A2ZA 2WZNA 3VWEA 3LACA 2ZEFA 2BL1A 4J3GA 4KOTA 4NGTA 4CGLA 1Q2DA 2AE6A 1Z5RA 3D66A 1U6MA 1CP7A 2VL1A 2ZW5A 4MCQA 4P4EA 1RO5A 2Q04A 4JWPA 4KORA 2AFOA 2ZEPA 3KQZA 4UEEA 1YVOA 4TNUA 2A4NA 2ZW6A 2GE3A 4IUSA 3SJFA 3FF3A 4FD7A 4AVBA 4R9MA 1TXRA 3WC6A 5I0CA 3DGVA 3S9LA 4IF5A 4ZBGA 4FD6A 3P2FA 3NE7A 1XMTA 1ELMP 3PB4X 1XF8A 3CXQA 4HKFA 1IU8A 1JQGA 2ZEHA 3LD2A 1Z8TA 5H86A 4NXYA 2X7BA 5AG6A 4OC5A 5ELYA 2PJ2A 2FXFA 2ZXVA 4OAEA 4I49A 4MHPA 1VIXA 1CX8A 4OKOA 4QB9A 2B3VA 1Y0YA 4CYQA 3KHXA 4PSXA 2ATRA 5G22A 1LAMA 2G3TA 3KL9A 1ZLIA 5AG7A 4MMOA 3GUXA 4X3RA 1VHEA 2V8DA 2NMTA 1Z8WA 3D2MA 5EMIA 3CZXA 4CAFA 4OADA 3BI1A 1IYLA 2PRBA 3TT2A 1BLLE 1BAVA 4GS4A 2QMLA 3KGQA 4B5PB 1YX0A 1Z4RA 4PXDA 4X8IA 2Z3PA 3R9EA 3VH9A 3GYAA 4UFXA 2PSWA 5IV0A 1ZG7A 1YQEA 3QNVA 4KLWA 4OP4A 4MBUA 4DUKA 3ZZIA 4Y49B 1B87A 1S60A 2F5IA 2FS5A 2PQ8A 1CM0A 4MHYA 4Z65A 4PK2A 2RC4A 4RN7A 4OC3A 3SI2A 1S7FA 4A30A 4C7HA 2PE3A 3TOAA 4Q36A 1IICA 4XPKA 3FVLA 4MCRA 4UIAA 2JDCA 4IHMA 4A2ZA 3TO7A 2I3CA 3L2NA 2RB7A 4R7MA 3SXOA 2WPXA 4F6AA 4TWEA 5KTAA 4MFZA 4K3NA 4X2TA 1YLOA 2GANA 2PJ3A 2ZEGA 4FWUA 4GM5A 1F2OA 2P6FA 3JRUA 2GU2A 4K30A 3TE4A 1S7LA 4JZ0A 1ZG9A 3JUWA 3QB8A 2OH1A 4KOUA 2J9AA 2VEZA 3KHZA 4P4FA 2FIAA 5J1QA 3DSBA 4KLVA 4MY3A 4CGNA 4ZY0A 1N71A 2QIRA 3KQXA 2PJBA 4Y49C 2Q4YA 5A28A 3G8WA 4MFPA 2O53A 3SJEA 2D4PA 1I1DA 3WC5A 2EWBA 2QECA 3IC1A 2Z11A 4UCNA 3DLJA 3DR8A 5HXDA 1FY7A 2AFSA 3SXNA 2IMOA 2PR1A 3K2KA 2ZELA 3EFAA 1AUGA 3ZJ0A 4Q38A 3GB0A 2PJ4A 4RS2A 2R98A 4DYOA 4OC0A 4A95A 4A33A 3CXSA 4NF1A 4X5KA 2CIJA 2BEIA 3B3CA 1XJOA 4F0YA 3KASA 4FAIA 4QC6A 4OLLA 2PJ6A 2R8VA 2PJ9A 4UFWA 4KSIA 2B4DA 4UFVA 3WABA 3FJUA 2PIYA 4H2KA 2I79A 3ISZA 2OZGA 3NH5A 2POKA 3FRMA 3NFZA 4LX9A 1S5KA 1CPSA 1P0HA 1YK3A 2AFZA 4JD6A 5DWNA 1NMTA 2WUUA 3GLJA 3KI9A 4KSFA 3G3SA 1ON0A 1YW6A 5D29A 4R57A 2EO8A 2Z3OA 3S6HA 4P44A 1LCPA 2Z3MA 3D2PA 1Y9KA 4KSAA 1IGBA 4A39A 4CAVA 3B7IA 1WK4A 1EE3P 1GHEA 4F9UA 4L8AA 4GXHA 4MRIA 2D4OA 1YSJA 4MFKA 4ORFA 3FNCA 2CNTA 3D7FA 3PZJA 3VATA 5F09A 1DE4C 2FT0A 4CGMA 4P4BA 5LRKA 2CNMA 1Z4EA 3EO4A 1X12A 1R57A 2V8HA 4AG9A 5K8MA 1X10A 2PJ0A 3FB3A 1PUAA 2WPWA 5EBVA 5FVJA 1YMEA 2EUIA 1VKCA 2ZENA 3N7ZA 3TC8A 3WC7A 1Z9UA 3PB9X 4MFLA 1NSLA 3B3WA 3T8WA 4P4DA 1XE4A 4JYWA 2B4BA 3W6XA 4WWVA 4PSWA 3F5BA 4CGOA 4OC1A 5KTCA 4E0AA 4OIDA 3F8KA 4CAWA 3W91A 3FH4A 4M6IA 4MCSA 4NSQA 5CNPA 5BWAB 1V0CA 3PBBA 3PFOA 4MFQA 1OZPA 4A31A 1M4IA 4KOYA 4RI1A 3RO0A 4A37A 4MHDA 1CJWA 2FCKA 4CAEA 2BSWA 2YNEA 3QAHA 4KZTA 3TO9A 3WR7A 5J8FA 1QSOA 2PJAA 3HLPA 5JGFA 2OU2A 4C7IA 2Q43A 2AFXA 4QVTA 4ONUA 1SQHA 1QSRA 2G0BA 4E2AA 4L89A 4PXBA 1KUYA 1Y0RA 4C2XA 5F48A 3D7DA 2AJ6A 4B12A 3SI0A 1YVKA 3MN8A 4NCZA 3IO1A 2CNSA 3SHPA 2PJ8A 4IK2A 3B3VA 3B3SA 3SJXA 1Y9WA 3PGPA 2ZEDA 2Z3LA 2AFWA 2B4DB 2GFQA 5G21A 4HPSA 4MJ8A 2YNCA 4KVOE 3TX8A 1VHOA 3PFEA 5HH1A 3KZWA 1ARLA 3BJ7A 4A94A 2BOAA 4PK3A 5F47A 1QQ9A 2G3AA 2F7VA 2JLMA 3H8EA 2RFHA 3IWGA 3B3TA 4ZY1A 4AG7A 2FL4A 1DTDA 1MJBA 2OR4A 5JM6A 1Q2YA 2BO9A 2XEIA 3VWDA 2XEGA 4FD4A 1ARMA 3B8GA 4JJXA 4KVME 4AVAA 4UBRA 5F49A 4OMEA 4AB7A 1CBXA 2Q4ZA 5K8NA 4M6GA 4NGMA 3T90A 3D7GA 4ZY2A 4M85A 4FBEA 1QSTA 4EMEA 2R1IA 3TTHA 3CXPA 1QSMA 1H8LA 4M6HA 8CPAA 2JBKA 3BI0A 2YNDA 2EK8A 2IQ6A 1VGYA 1YREA 3I9SA 2I00A 2DEAA 2PJ5A 2PVVA 2JDDA 2VBQA 4OIWA 4CYOA 1ZO0A 3BHXA 3D3SA 3RBUA 3RNZA 4ONWA 2FSRA 3GIUA 4YGOA 3V7ZA 1B6BA 2ZOGA 5DWMA 4ZYQA 4MY0A 2DXQA 1M44A 3PB7X 4P45A 4W9YA 3CT9A 3GKRA 5IB9A 4R3LA 4U9YA 1NSAA 2K5TA 2ZEMA 6CPAA 4NGQA 1Y7RA 4NGPA 3S9NA 4C68A 3IWEA 2ANPA 2FVGA 3T9YA 2IL4A 3FEEA 3KR4A 4PQAA 5K8OA 5E96A 3N5FA 4ZI6A 5LYLA 2Z3NA 4F0XA 1BPMA 2CTBA 2PR8A 3K9TA 3PB6X 1I21A 2FIWA 4UF4A 3WT4A 3GY9A 5AG4A 3PEIA 1ZLHA 1MJAA 2PJ1A 5EC4A 4AVCA 4R3KA 4JXQA 4BINA 1Z2LA 2Q7SA 4CRZB 2REFA 2Q0YA 4B5OA 2G9DA 3PP9A 3IU1A 3D67A 1YLEA 2JEWA 2GLJA 1BOBA 1R3NA 2C27A 4MCPA 1LOKA 2PJCA 4NGSA 4HNXB 4UEFA 2PCUA 4IAVA 2PIZA 2ARHA 2QJ8A 4MFJA 1QSNA 1YGHA 2DPTA 1HDQA 4B11A 2NYQA 4PPZA 2HC9A 4KOVA 2P6EA 3RYOA 4H6ZA 2DF5A 2HUZA 2GREA 1LAPA 3S6GA 1IB1E 3H5ZA 2ZW7A 5KTDA 1PYTB 5AG5A 3IWWA 4U9ZA 2CTCA 3C26A 4B14A 4KVXA 5JH9A 2YGWA 1M1DA 3H8GA 3IU2A 4BBHA 1ELLP 2GLFA 3IJ3A 4NEXA 1IY7A 3DDDA 1TKJA 2EK9A 4KOWA 2OZHA 2PC1A 3S6FA 1AMPA 2C6GA 3MRUA 4H6UA 1XFOA 3UY5A 2PJ7A 5LYIA 4B13A 1TIQA 4FD5A 3LWUA 2IJZA 2FE7A 4Q7AA 3CDXA 3R95A 5IX3A 2YNCC 5GCNA 2ZW4A 4HNWB 3TCVA 3FYNA 1XOVA 4CYPA 4UWJA 3TFYA 1RTQA 1AYEA 1K4JA 4M3SA 1TF8A 2CY2A 4UEZA 4YU9A 1M4LA 3A9LA 1IOIA 3OWCA 3EC4A 5AGEA 3E0KA 5G1ZA 4NGRA 4A38A 4YFJA 5A27A 4BMHA 3IIBA 3IEHA 3DR6A 4EFDA 4R76A 4UCPA 3D7HA 3LMSA 4ZGYB 4P6YA 2EBJA 3BLNA 4E8OA 3I1UA 1CPXA 3BXMA 3IFEA 5H84A 3R9GA 4ZX9A 1Y7EA 4CPAA 5LRGA 2BCOA 2BUEA 5LYFA 1Z8LA 4MHZA 1FT7A 4PXEA 3RZAA 5CBMA 1YR0A 3B35A 3I3GA 4KOXA 4JLYA 4XPLA 3RAMA 4NGNA 2P6GA 4UCMA 5LRJA 1TF9A 1M4DA 2O28A 1L0CA 4XNHB 1VHSA 1F57A 4H89A 4NFRA 1F2PA 3V8IA 1XIXA 3NH8A 2VXKA 1YW4A 2P0WA 4F8ZA 4CGPA 2QVPA 3D4UA 3PBEA 1Z8XA 3IGRA 1UFHA 5I4MA 1FNOA 2Q44A 2C1CA 4R87A 5C88A 1J4JA 5ISVA 2EVNA 4MI4A 3FXTA 2AFUA 3NH4A 4EWTA 2JEVA 2J8MA 4DNCA 3R1KA 3VARA 4CS0B 1BO4A 5G20A 1XBUA 1ZG8A 2J8RA 3KKWA 3D8PA
chains in the Genus database with same CATH topology
1MK4A 2OB0A 4EVYA 4YRHA 2DPSA 2WSAA 4XNHC 2KCWA 3FIXA 1NE9A 3R9FA 3BJ8A 4XPDB 1S7NA 2VZZA 2CXAA 1P4NA 3DNSA 3F0AA 4KOSA 2VI7A 4A32A 2B3UA 4U5YA 2H5MA 2B5GB 3FBUA 2Z3KA 1WWZA 4QBJA 2REEA 2PDOA 4JXRA 4UWIA 4PV6A 4KS9A 5F46A 4UA3A 4XPDC 4CRYB 2R7HA 5IB0A 1MJ9A 3TOBA 2VZYA 2GIVA 4KUAA 3P2HA 2Z0ZA 1S7KA 1IYKA 4C2YA 4II9A 1S3ZA 1KUXA 5C82A 1KZFA 5J8CA 4B10A 3LODA 1M4GA 2ZPAA 2VQYA 3W6SA 5JPHA 4B5PA 4HNYB 5JQ4A 3R96A 4CAXA 1IIDA 1Q2CA 2Y0MA 3MGDA 2J8NA 1KUVA 1RXTA 3EXNA 4QUSA 2Q7BA 4C2ZA 3EY5A 2HQYA 3TO6A 2OZUA 3H4QA 3JVNA 3K9UA 3S6KA 1LRZA 1I12A 1PU9A 3JTKA 4KUBA 1XEBA 2HV2A 4LUAA 2B58A 2B5GA 2Z10A 2Q4VA 4CYNA 3VWEA 4CGLA 4J3GA 2BL1A 4KOTA 1Q2DA 2AE6A 1U6MA 2ZW5A 1RO5A 2Q04A 4JWPA 4KORA 1YVOA 2A4NA 2ZW6A 2GE3A 4IUSA 4FD7A 4AVBA 4R9MA 5I0CA 4IF5A 4ZBGA 4FD6A 3P2FA 3NE7A 1XMTA 1XF8A 3CXQA 4HKFA 3LD2A 5H86A 4NXYA 2X7BA 5AG6A 2FXFA 2ZXVA 4OAEA 4I49A 4QB9A 2B3VA 4CYQA 4PSXA 2ATRA 5G22A 2G3TA 5AG7A 3D2MA 2NMTA 4CAFA 4OADA 1IYLA 2PRBA 3TT2A 4GS4A 2QMLA 4B5PB 1YX0A 1Z4RA 2Z3PA 3R9EA 3GYAA 4UFXA 2PSWA 5IV0A 4KLWA 4MBUA 3ZZIA 4Y49B 1B87A 1S60A 2F5IA 2FS5A 2PQ8A 1CM0A 4PK2A 2RC4A 1S7FA 4A30A 4C7HA 3TOAA 4Q36A 1IICA 4XPKA 2JDCA 4A2ZA 3TO7A 3SXOA 2WPXA 4F6AA 5KTAA 4MFZA 2GANA 2P6FA 4K30A 3TE4A 1S7LA 3JUWA 3QB8A 2OH1A 4KOUA 2VEZA 2FIAA 3DSBA 4KLVA 4MY3A 4CGNA 1N71A 2QIRA 4Y49C 2Q4YA 5A28A 3G8WA 4MFPA 2D4PA 1I1DA 2QECA 4UCNA 2Z11A 3DR8A 1FY7A 3SXNA 2PR1A 3EFAA 3ZJ0A 4Q38A 4RS2A 2R98A 4A95A 4A33A 3CXSA 4NF1A 4X5KA 2BEIA 4F0YA 4QC6A 4OLLA 2R8VA 4UFWA 2B4DA 4UFVA 2I79A 2OZGA 3FRMA 4LX9A 1S5KA 1P0HA 1YK3A 5HMNA 4JD6A 5DWNA 1NMTA 2WUUA 4KSFA 3G3SA 1ON0A 4R57A 2Z3OA 3S6HA 2Z3MA 3D2PA 1Y9KA 4KSAA 4CAVA 1WK4A 1GHEA 4L8AA 2D4OA 4MFKA 4ORFA 3FNCA 2CNTA 3PZJA 2FT0A 4CGMA 2CNMA 1Z4EA 3EO4A 1R57A 4AG9A 3FB3A 1PUAA 2WPWA 5EBVA 5FVJA 2EUIA 3N7ZA 1VKCA 1Z9UA 4MFLA 1NSLA 1XE4A 2B4BA 3W6XA 4PSWA 3F5BA 4CGOA 5KTCA 4E0AA 3F8KA 4CAWA 3W91A 4NSQA 5CNPA 5BWAB 1V0CA 4MFQA 1OZPA 4A31A 1M4IA 4KOYA 4RI1A 4MHDA 1CJWA 2FCKA 4CAEA 2BSWA 2YNEA 3QAHA 4KZTA 3TO9A 3WR7A 5J8FA 1QSOA 2OU2A 4C7IA 4QVTA 4ONUA 1SQHA 1QSRA 2G0BA 4E2AA 4L89A 1KUYA 4C2XA 5F48A 2AJ6A 4B12A 1YVKA 4NCZA 3SHPA 2CNSA 1Y9WA 3PGPA 2Z3LA 2B4DB 5G21A 4MJ8A 2YNCA 4KVOE 5HH1A 3BJ7A 4PK3A 5F47A 2G3AA 2JLMA 3IWGA 4AG7A 2FL4A 1MJBA 1Q2YA 3VWDA 4FD4A 3B8GA 4JJXA 4KVME 4AVAA 4UBRA 5F49A 4AB7A 3T90A 4M85A 1QSTA 2R1IA 3TTHA 3CXPA 1QSMA 2YNDA 1YREA 3I9SA 2I00A 2JDDA 2VBQA 4CYOA 1ZO0A 3D3SA 2FSRA 4YGOA 1B6BA 5DWMA 4MY0A 2DXQA 1M44A 3GKRA 4R3LA 4U9YA 2K5TA 1Y7RA 4C68A 3IWEA 3T9YA 2IL4A 5E96A 2Z3NA 4F0XA 2PR8A 1I21A 2FIWA 3GY9A 5AG4A 1MJAA 5EC4A 4AVCA 4R3KA 4JXQA 4CRZB 2REFA 2Q0YA 4B5OA 3PP9A 3IU1A 1YLEA 1BOBA 2C27A 4HNXB 2ARHA 4MFJA 1QSNA 1YGHA 2DPTA 4B11A 4KOVA 2P6EA 3RYOA 4H6ZA 2HUZA 3S6GA 1IB1E 3H5ZA 2ZW7A 5KTDA 5AG5A 4U9ZA 4B14A 3C26A 4KVXA 2YGWA 1M1DA 3IU2A 4BBHA 4NEXA 4KOWA 3DDDA 2OZHA 2PC1A 3S6FA 4H6UA 3UY5A 4B13A 1TIQA 4FD5A 2FE7A 5IX3A 3R95A 2YNCC 5GCNA 2ZW4A 4HNWB 3TCVA 3FYNA 4CYPA 4UWJA 3TFYA 1K4JA 4M3SA 2CY2A 3A9LA 3OWCA 3EC4A 5AGEA 3E0KA 5G1ZA 4YFJA 5A27A 4BMHA 3DR6A 4UCPA 4ZGYB 4E8OA 3BLNA 5H84A 3R9GA 2BUEA 1YR0A 3I3GA 4KOXA 4JLYA 4XPLA 2P6GA 4UCMA 1M4DA 2O28A 1L0CA 4XNHB 1VHSA 4H89A 3V8IA 1XIXA 2VXKA 2P0WA 4CGPA 3IGRA 1UFHA 5C88A 2Q44A 4R87A 1J4JA 5ISVA 2EVNA 4MI4A 3FXTA 2JEVA 2J8MA 4DNCA 3R1KA 4CS0B 1BO4A 5G20A 2J8RA 3KKWA 3D8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK4 A;  2OB0 A;  4EVY A;  4YRH A;  4XNH C;  2KCW A;  3FIX A;  1NE9 A;  3R9F A;  3BJ8 A;  4XPD B;  1S7N A;  2VZZ A;  1P4N A;  3DNS A;  3F0A A;  4KOS A;  2VI7 A;  2B3U A;  4U5Y A;  2H5M A;  2B5G B;  3FBU A;  1WWZ A;  4QBJ A;  2REE A;  2PDO A;  4JXR A;  4UWI A;  4PV6 A;  5F46 A;  4UA3 A;  4XPD C;  4CRY B;  2R7H A;  5IB0 A;  1MJ9 A;  3TOB A;  2VZY A;  2GIV A;  4KUA A;  3P2H A;  2Z0Z A;  1S7K A;  1IYK A;  4II9 A;  1S3Z A;  1KUX A;  5C82 A;  1KZF A;  5J8C A;  3LOD A;  1M4G A;  2ZPA A;  2VQY A;  3W6S A;  5JPH A;  4B5P A;  4HNY B;  5JQ4 A;  3R96 A;  4CAX A;  1IID A;  1Q2C A;  2Y0M A;  3MGD A;  2J8N A;  1KUV A;  1RXT A;  3EXN A;  4QUS A;  2Q7B A;  3EY5 A;  2HQY A;  3TO6 A;  2OZU A;  3H4Q A;  3JVN A;  3K9U A;  3S6K A;  1LRZ A;  1I12 A;  1PU9 A;  4KUB A;  1XEB A;  2HV2 A;  4LUA A;  2B58 A;  2B5G A;  2Z10 A;  2Q4V A;  3VWE A;  4J3G A;  2BL1 A;  4KOT A;  1Q2D A;  2AE6 A;  1U6M A;  2ZW5 A;  4KOR A;  1RO5 A;  2Q04 A;  4JWP A;  1YVO A;  2A4N A;  2ZW6 A;  2GE3 A;  4IUS A;  4FD7 A;  4AVB A;  4R9M A;  5I0C A;  4IF5 A;  4ZBG A;  4FD6 A;  3P2F A;  3NE7 A;  1XMT A;  1XF8 A;  3CXQ A;  4HKF A;  3LD2 A;  5H86 A;  4NXY A;  2X7B A;  2FXF A;  2ZXV A;  4OAE A;  4I49 A;  4QB9 A;  2B3V A;  4PSX A;  2ATR A;  2G3T A;  3D2M A;  2NMT A;  4OAD A;  1IYL A;  2PRB A;  3TT2 A;  4GS4 A;  2QML A;  4B5P B;  1YX0 A;  1Z4R A;  3R9E A;  3GYA A;  2PSW A;  5IV0 A;  4KLW A;  4MBU A;  3ZZI A;  4Y49 B;  1B87 A;  1S60 A;  2F5I A;  2FS5 A;  2PQ8 A;  1CM0 A;  4PK2 A;  2RC4 A;  1S7F A;  3TOA A;  1IIC A;  4XPK A;  2JDC A;  3TO7 A;  3SXO A;  2WPX A;  4F6A A;  5KTA A;  2GAN A;  2P6F A;  4K30 A;  3TE4 A;  1S7L A;  3JUW A;  3QB8 A;  2OH1 A;  4KOU A;  2VEZ A;  2FIA A;  3DSB A;  4KLV A;  4MY3 A;  1N71 A;  2QIR A;  4Y49 C;  2Q4Y A;  3G8W A;  2D4P A;  1I1D A;  2QEC A;  2Z11 A;  3DR8 A;  1FY7 A;  3SXN A;  2PR1 A;  3EFA A;  3ZJ0 A;  4RS2 A;  2R98 A;  3CXS A;  4NF1 A;  4X5K A;  2BEI A;  4F0Y A;  4QC6 A;  4OLL A;  2R8V A;  2B4D A;  2I79 A;  2OZG A;  3FRM A;  4LX9 A;  1S5K A;  1P0H A;  1YK3 A;  5HMN A;  4JD6 A;  5DWN A;  1NMT A;  3G3S A;  1ON0 A;  4R57 A;  3S6H A;  3D2P A;  1Y9K A;  4CAV A;  1WK4 A;  1GHE A;  4L8A A;  2D4O A;  4ORF A;  3FNC A;  2CNT A;  3PZJ A;  2FT0 A;  2CNM A;  1Z4E A;  3EO4 A;  1R57 A;  4AG9 A;  3FB3 A;  1PUA A;  2WPW A;  5EBV A;  5FVJ A;  2EUI A;  3N7Z A;  1VKC A;  1Z9U A;  1NSL A;  1XE4 A;  2B4B A;  3W6X A;  4PSW A;  3F5B A;  5KTC A;  4E0A A;  3F8K A;  4CAW A;  3W91 A;  4NSQ A;  5CNP A;  1V0C A;  1OZP A;  1M4I A;  4KOY A;  4RI1 A;  4MHD A;  1CJW A;  2FCK A;  2BSW A;  3WR7 A;  3QAH A;  4KZT A;  3TO9 A;  5J8F A;  1QSO A;  2OU2 A;  4QVT A;  4ONU A;  1SQH A;  1QSR A;  2G0B A;  4E2A A;  4L89 A;  1KUY A;  5F48 A;  2AJ6 A;  1YVK A;  4NCZ A;  3SHP A;  2CNS A;  1Y9W A;  3PGP A;  2B4D B;  4MJ8 A;  4KVO E;  5HH1 A;  3BJ7 A;  4PK3 A;  5F47 A;  2G3A A;  2JLM A;  3IWG A;  4AG7 A;  2FL4 A;  1MJB A;  1Q2Y A;  3VWD A;  4FD4 A;  3B8G A;  4JJX A;  4KVM E;  4AVA A;  4UBR A;  5F49 A;  4AB7 A;  3T90 A;  4M85 A;  1QST A;  2R1I A;  3TTH A;  3CXP A;  1QSM A;  1YRE A;  3I9S A;  2I00 A;  2JDD A;  2VBQ A;  3D3S A;  2FSR A;  4YGO A;  1B6B A;  5DWM A;  4MY0 A;  2DXQ A;  1M44 A;  3GKR A;  4R3L A;  4U9Y A;  2K5T A;  1Y7R A;  3T9Y A;  2IL4 A;  5E96 A;  2PR8 A;  1I21 A;  2FIW A;  3GY9 A;  1MJA A;  5EC4 A;  4AVC A;  4R3K A;  4JXQ A;  4CRZ B;  2REF A;  2Q0Y A;  4B5O A;  3PP9 A;  1YLE A;  1BOB A;  2C27 A;  4HNX B;  2ARH A;  1QSN A;  1YGH A;  4KOV A;  2P6E A;  3RYO A;  4H6Z A;  2HUZ A;  3S6G A;  1IB1 E;  2ZW7 A;  5KTD A;  4U9Z A;  3C26 A;  4KVX A;  1M1D A;  4NEX A;  4KOW A;  3DDD A;  2OZH A;  2PC1 A;  3S6F A;  4H6U A;  3UY5 A;  1TIQ A;  4FD5 A;  2FE7 A;  5IX3 A;  3R95 A;  5GCN A;  2ZW4 A;  4HNW B;  3TCV A;  3FYN A;  4UWJ A;  3TFY A;  1K4J A;  4M3S A;  2CY2 A;  3OWC A;  3EC4 A;  3E0K A;  4YFJ A;  4BMH A;  3DR6 A;  4E8O A;  3BLN A;  5H84 A;  3R9G A;  2BUE A;  1YR0 A;  3I3G A;  4KOX A;  4JLY A;  4XPL A;  2P6G A;  1M4D A;  2O28 A;  1L0C A;  4XNH B;  1VHS A;  4H89 A;  3V8I A;  1XIX A;  2VXK A;  2P0W A;  3IGR A;  1UFH A;  5C88 A;  2Q44 A;  4R87 A;  1J4J A;  5ISV A;  2EVN A;  4MI4 A;  3FXT A;  2JEV A;  2J8M A;  4DNC A;  3R1K A;  4CS0 B;  1BO4 A;  2J8R A;  3KKW A;  3D8P A; 
#chains in the Genus database with same CATH topology
 4FUU A;  1MK4 A;  2HB6 A;  1KWM A;  1HDU A;  2OB0 A;  4BD9 A;  4EVY A;  4YRH A;  5THW A;  5LYD A;  2DPS A;  3FED A;  1UWY A;  5HMN A;  5DS0 A;  1Q7L A;  2WSA A;  4CYN A;  4R8F A;  4XNH C;  2KCW A;  3FIX A;  4UIB A;  5HVF A;  1NE9 A;  3R9F A;  1XRY A;  1CG2 A;  2QYV A;  1S7N A;  3BJ8 A;  4P10 A;  2VZZ A;  1QMU A;  2CF4 A;  3FMC A;  4XPD B;  2CXA A;  2ZEE A;  1OBR A;  1P4N A;  3DNS A;  3F0A A;  4KOS A;  4NJR A;  2VI7 A;  4A32 A;  2B3U A;  2ZEO A;  4PXC A;  4U5Y A;  3HUV A;  4AXV A;  2AFM A;  2JBJ A;  3SJG A;  3FEC A;  2H5M A;  5K8P A;  2ODF A;  2B5G B;  3FBU A;  3NE8 A;  2PRQ A;  5HVH A;  5CPA A;  2Z3K A;  3D68 A;  2OOT A;  2ABZ A;  1WWZ A;  3B2Y A;  4QBJ A;  2C6P A;  2XEJ A;  4P4J A;  4RUH A;  4YWY A;  1IOF A;  3PRT A;  1LAN A;  1LFW A;  2REE A;  2PDO A;  4JXR A;  4UWI A;  1CP6 A;  3NA6 A;  3QAY A;  4PV6 A;  4P4I A;  4KS9 A;  5F46 A;  2V8G A;  4UA3 A;  3CPX A;  2NSM A;  4G1P A;  4XPD C;  4CRY B;  3PB8 X;  3SI1 A;  3S9M A;  2R7H A;  5IB0 A;  2V77 A;  1MJ9 A;  1BPN A;  2WYR A;  3TOB A;  7CPA A;  2VZY A;  5HVG A;  1PCA A;  2GIV A;  4KUA A;  2ZOF A;  3P2H A;  2Z0Z A;  1IYK A;  1S7K A;  4C2Y A;  4II9 A;  1KUX A;  1S3Z A;  1GYT A;  3H8F A;  5C82 A;  1KZF A;  5J8C A;  4B10 A;  3LOD A;  1JWQ A;  4O23 A;  1M4G A;  1XMB A;  3ISX A;  5D8N A;  4R6T A;  2ZPA A;  4MHN A;  4F9V A;  2VQY A;  3W6S A;  5JPH A;  4B5P A;  3KR5 A;  4HNY B;  5JQ4 A;  4B6Z A;  2PVW A;  3R96 A;  1HEE A;  4CAX A;  1TKH A;  4OC2 A;  1IID A;  4LQG A;  4LQ6 A;  1Q2C A;  2Y0M A;  3MGD A;  2J8N A;  1KUV A;  1RXT A;  3EXN A;  2Q51 A;  4QUS A;  2Q7B A;  4C2Z A;  4DJL A;  3EY5 A;  2HQY A;  3TO6 A;  3V38 A;  2OZU A;  3H4Q A;  3JVN A;  3K9U A;  4WJB A;  4ZX8 A;  3S6K A;  1LRZ A;  1TKF A;  2C6C A;  2V8V A;  1I12 A;  4NJQ A;  1PU9 A;  4OC4 A;  3JTK A;  2XEF A;  4KUB A;  1XEB A;  2HV2 A;  4LUA A;  2B58 A;  2B5G A;  2O4H A;  2Z10 A;  3FX6 A;  1R43 A;  2Q4V A;  4MXU A;  2F8H A;  3CPA A;  1A2Z A;  2WZN A;  3VWE A;  3LAC A;  2ZEF A;  2BL1 A;  4J3G A;  4KOT A;  4NGT A;  4CGL A;  1Q2D A;  2AE6 A;  1Z5R A;  3D66 A;  1U6M A;  1CP7 A;  2VL1 A;  2ZW5 A;  4MCQ A;  4P4E A;  1RO5 A;  2Q04 A;  4JWP A;  4KOR A;  2AFO A;  2ZEP A;  3KQZ A;  4UEE A;  1YVO A;  4TNU A;  2A4N A;  2ZW6 A;  2GE3 A;  4IUS A;  3SJF A;  3FF3 A;  4FD7 A;  4AVB A;  4R9M A;  1TXR A;  3WC6 A;  5I0C A;  3DGV A;  3S9L A;  4IF5 A;  4ZBG A;  4FD6 A;  3P2F A;  3NE7 A;  1XMT A;  1ELM P;  3PB4 X;  1XF8 A;  3CXQ A;  4HKF A;  1IU8 A;  1JQG A;  2ZEH A;  3LD2 A;  1Z8T A;  5H86 A;  4NXY A;  2X7B A;  5AG6 A;  4OC5 A;  5ELY A;  2PJ2 A;  2FXF A;  2ZXV A;  4OAE A;  4I49 A;  4MHP A;  1VIX A;  1CX8 A;  4OKO A;  4QB9 A;  2B3V A;  1Y0Y A;  4CYQ A;  3KHX A;  4PSX A;  2ATR A;  5G22 A;  1LAM A;  2G3T A;  3KL9 A;  1ZLI A;  5AG7 A;  4MMO A;  3GUX A;  4X3R A;  1VHE A;  2V8D A;  2NMT A;  1Z8W A;  3D2M A;  5EMI A;  3CZX A;  4CAF A;  4OAD A;  3BI1 A;  1IYL A;  2PRB A;  3TT2 A;  1BLL E;  1BAV A;  4GS4 A;  2QML A;  3KGQ A;  4B5P B;  1YX0 A;  1Z4R A;  4PXD A;  4X8I A;  2Z3P A;  3R9E A;  3VH9 A;  3GYA A;  4UFX A;  2PSW A;  5IV0 A;  1ZG7 A;  1YQE A;  3QNV A;  4KLW A;  4OP4 A;  4MBU A;  4DUK A;  3ZZI A;  4Y49 B;  1B87 A;  1S60 A;  2F5I A;  2FS5 A;  2PQ8 A;  1CM0 A;  4MHY A;  4Z65 A;  4PK2 A;  2RC4 A;  4RN7 A;  4OC3 A;  3SI2 A;  1S7F A;  4A30 A;  4C7H A;  2PE3 A;  3TOA A;  4Q36 A;  1IIC A;  4XPK A;  3FVL A;  4MCR A;  4UIA A;  2JDC A;  4IHM A;  4A2Z A;  3TO7 A;  2I3C A;  3L2N A;  2RB7 A;  4R7M A;  3SXO A;  2WPX A;  4F6A A;  4TWE A;  5KTA A;  4MFZ A;  4K3N A;  4X2T A;  1YLO A;  2GAN A;  2PJ3 A;  2ZEG A;  4FWU A;  4GM5 A;  1F2O A;  2P6F A;  3JRU A;  2GU2 A;  4K30 A;  3TE4 A;  1S7L A;  4JZ0 A;  1ZG9 A;  3JUW A;  3QB8 A;  2OH1 A;  4KOU A;  2J9A A;  2VEZ A;  3KHZ A;  4P4F A;  2FIA A;  5J1Q A;  3DSB A;  4KLV A;  4MY3 A;  4CGN A;  4ZY0 A;  1N71 A;  2QIR A;  3KQX A;  2PJB A;  4Y49 C;  2Q4Y A;  5A28 A;  3G8W A;  4MFP A;  2O53 A;  3SJE A;  2D4P A;  1I1D A;  3WC5 A;  2EWB A;  2QEC A;  3IC1 A;  2Z11 A;  4UCN A;  3DLJ A;  3DR8 A;  5HXD A;  1FY7 A;  2AFS A;  3SXN A;  2IMO A;  2PR1 A;  3K2K A;  2ZEL A;  3EFA A;  1AUG A;  3ZJ0 A;  4Q38 A;  3GB0 A;  2PJ4 A;  4RS2 A;  2R98 A;  4DYO A;  4OC0 A;  4A95 A;  4A33 A;  3CXS A;  4NF1 A;  4X5K A;  2CIJ A;  2BEI A;  3B3C A;  1XJO A;  4F0Y A;  3KAS A;  4FAI A;  4QC6 A;  4OLL A;  2PJ6 A;  2R8V A;  2PJ9 A;  4UFW A;  4KSI A;  2B4D A;  4UFV A;  3WAB A;  3FJU A;  2PIY A;  4H2K A;  2I79 A;  3ISZ A;  2OZG A;  3NH5 A;  2POK A;  3FRM A;  3NFZ A;  4LX9 A;  1S5K A;  1CPS A;  1P0H A;  1YK3 A;  2AFZ A;  4JD6 A;  5DWN A;  1NMT A;  2WUU A;  3GLJ A;  3KI9 A;  4KSF A;  3G3S A;  1ON0 A;  1YW6 A;  5D29 A;  4R57 A;  2EO8 A;  2Z3O A;  3S6H A;  4P44 A;  1LCP A;  2Z3M A;  3D2P A;  1Y9K A;  4KSA A;  1IGB A;  4A39 A;  4CAV A;  3B7I A;  1WK4 A;  1EE3 P;  1GHE A;  4F9U A;  4L8A A;  4GXH A;  4MRI A;  2D4O A;  1YSJ A;  4MFK A;  4ORF A;  3FNC A;  2CNT A;  3D7F A;  3PZJ A;  3VAT A;  5F09 A;  1DE4 C;  2FT0 A;  4CGM A;  4P4B A;  5LRK A;  2CNM A;  1Z4E A;  3EO4 A;  1X12 A;  1R57 A;  2V8H A;  4AG9 A;  5K8M A;  1X10 A;  2PJ0 A;  3FB3 A;  1PUA A;  2WPW A;  5EBV A;  5FVJ A;  1YME A;  2EUI A;  1VKC A;  2ZEN A;  3N7Z A;  3TC8 A;  3WC7 A;  1Z9U A;  3PB9 X;  4MFL A;  1NSL A;  3B3W A;  3T8W A;  4P4D A;  1XE4 A;  4JYW A;  2B4B A;  3W6X A;  4WWV A;  4PSW A;  3F5B A;  4CGO A;  4OC1 A;  5KTC A;  4E0A A;  4OID A;  3F8K A;  4CAW A;  3W91 A;  3FH4 A;  4M6I A;  4MCS A;  4NSQ A;  5CNP A;  5BWA B;  1V0C A;  3PBB A;  3PFO A;  4MFQ A;  1OZP A;  4A31 A;  1M4I A;  4KOY A;  4RI1 A;  3RO0 A;  4A37 A;  4MHD A;  1CJW A;  2FCK A;  4CAE A;  2BSW A;  2YNE A;  3QAH A;  4KZT A;  3TO9 A;  3WR7 A;  5J8F A;  1QSO A;  2PJA A;  3HLP A;  5JGF A;  2OU2 A;  4C7I A;  2Q43 A;  2AFX A;  4QVT A;  4ONU A;  1SQH A;  1QSR A;  2G0B A;  4E2A A;  4L89 A;  4PXB A;  1KUY A;  1Y0R A;  4C2X A;  5F48 A;  3D7D A;  2AJ6 A;  4B12 A;  3SI0 A;  1YVK A;  3MN8 A;  4NCZ A;  3IO1 A;  2CNS A;  3SHP A;  2PJ8 A;  4IK2 A;  3B3V A;  3B3S A;  3SJX A;  1Y9W A;  3PGP A;  2ZED A;  2Z3L A;  2AFW A;  2B4D B;  2GFQ A;  5G21 A;  4HPS A;  4MJ8 A;  2YNC A;  4KVO E;  3TX8 A;  1VHO A;  3PFE A;  5HH1 A;  3KZW A;  1ARL A;  3BJ7 A;  4A94 A;  2BOA A;  4PK3 A;  5F47 A;  1QQ9 A;  2G3A A;  2F7V A;  2JLM A;  3H8E A;  2RFH A;  3IWG A;  3B3T A;  4ZY1 A;  4AG7 A;  2FL4 A;  1DTD A;  1MJB A;  2OR4 A;  5JM6 A;  1Q2Y A;  2BO9 A;  2XEI A;  3VWD A;  2XEG A;  4FD4 A;  1ARM A;  3B8G A;  4JJX A;  4KVM E;  4AVA A;  4UBR A;  5F49 A;  4OME A;  4AB7 A;  1CBX A;  2Q4Z A;  5K8N A;  4M6G A;  4NGM A;  3T90 A;  3D7G A;  4ZY2 A;  4M85 A;  4FBE A;  1QST A;  4EME A;  2R1I A;  3TTH A;  3CXP A;  1QSM A;  1H8L A;  4M6H A;  8CPA A;  2JBK A;  3BI0 A;  2YND A;  2EK8 A;  2IQ6 A;  1VGY A;  1YRE A;  3I9S A;  2I00 A;  2DEA A;  2PJ5 A;  2PVV A;  2JDD A;  2VBQ A;  4OIW A;  4CYO A;  1ZO0 A;  3BHX A;  3D3S A;  3RBU A;  3RNZ A;  4ONW A;  2FSR A;  3GIU A;  4YGO A;  3V7Z A;  1B6B A;  2ZOG A;  5DWM A;  4ZYQ A;  4MY0 A;  2DXQ A;  1M44 A;  3PB7 X;  4P45 A;  4W9Y A;  3CT9 A;  3GKR A;  5IB9 A;  4R3L A;  4U9Y A;  1NSA A;  2K5T A;  2ZEM A;  6CPA A;  4NGQ A;  1Y7R A;  4NGP A;  3S9N A;  4C68 A;  3IWE A;  2ANP A;  2FVG A;  3T9Y A;  2IL4 A;  3FEE A;  3KR4 A;  4PQA A;  5K8O A;  5E96 A;  3N5F A;  4ZI6 A;  5LYL A;  2Z3N A;  4F0X A;  1BPM A;  2CTB A;  2PR8 A;  3K9T A;  3PB6 X;  1I21 A;  2FIW A;  4UF4 A;  3WT4 A;  3GY9 A;  5AG4 A;  3PEI A;  1ZLH A;  1MJA A;  2PJ1 A;  5EC4 A;  4AVC A;  4R3K A;  4JXQ A;  4BIN A;  1Z2L A;  2Q7S A;  4CRZ B;  2REF A;  2Q0Y A;  4B5O A;  2G9D A;  3PP9 A;  3IU1 A;  3D67 A;  1YLE A;  2JEW A;  2GLJ A;  1BOB A;  1R3N A;  2C27 A;  4MCP A;  1LOK A;  2PJC A;  4NGS A;  4HNX B;  4UEF A;  2PCU A;  4IAV A;  2PIZ A;  2ARH A;  2QJ8 A;  4MFJ A;  1QSN A;  1YGH A;  2DPT A;  1HDQ A;  4B11 A;  2NYQ A;  4PPZ A;  2HC9 A;  4KOV A;  2P6E A;  3RYO A;  4H6Z A;  2DF5 A;  2HUZ A;  2GRE A;  1LAP A;  3S6G A;  1IB1 E;  3H5Z A;  2ZW7 A;  5KTD A;  1PYT B;  5AG5 A;  3IWW A;  4U9Z A;  2CTC A;  3C26 A;  4B14 A;  4KVX A;  5JH9 A;  2YGW A;  1M1D A;  3H8G A;  3IU2 A;  4BBH A;  1ELL P;  2GLF A;  3IJ3 A;  4NEX A;  1IY7 A;  3DDD A;  1TKJ A;  2EK9 A;  4KOW A;  2OZH A;  2PC1 A;  3S6F A;  1AMP A;  2C6G A;  3MRU A;  4H6U A;  1XFO A;  3UY5 A;  2PJ7 A;  5LYI A;  4B13 A;  1TIQ A;  4FD5 A;  3LWU A;  2IJZ A;  2FE7 A;  4Q7A A;  3CDX A;  3R95 A;  5IX3 A;  2YNC C;  5GCN A;  2ZW4 A;  4HNW B;  3TCV A;  3FYN A;  1XOV A;  4CYP A;  4UWJ A;  3TFY A;  1RTQ A;  1AYE A;  1K4J A;  4M3S A;  1TF8 A;  2CY2 A;  4UEZ A;  4YU9 A;  1M4L A;  3A9L A;  1IOI A;  3OWC A;  3EC4 A;  5AGE A;  3E0K A;  5G1Z A;  4NGR A;  4A38 A;  4YFJ A;  5A27 A;  4BMH A;  3IIB A;  3IEH A;  3DR6 A;  4EFD A;  4R76 A;  4UCP A;  3D7H A;  3LMS A;  4ZGY B;  4P6Y A;  2EBJ A;  3BLN A;  4E8O A;  3I1U A;  1CPX A;  3BXM A;  3IFE A;  5H84 A;  3R9G A;  4ZX9 A;  1Y7E A;  4CPA A;  5LRG A;  2BCO A;  2BUE A;  5LYF A;  1Z8L A;  4MHZ A;  1FT7 A;  4PXE A;  3RZA A;  5CBM A;  1YR0 A;  3B35 A;  3I3G A;  4KOX A;  4JLY A;  4XPL A;  3RAM A;  4NGN A;  2P6G A;  4UCM A;  5LRJ A;  1TF9 A;  1M4D A;  2O28 A;  1L0C A;  4XNH B;  1VHS A;  1F57 A;  4H89 A;  4NFR A;  1F2P A;  3V8I A;  1XIX A;  3NH8 A;  2VXK A;  1YW4 A;  2P0W A;  4F8Z A;  4CGP A;  2QVP A;  3D4U A;  3PBE A;  1Z8X A;  3IGR A;  1UFH A;  5I4M A;  1FNO A;  2Q44 A;  2C1C A;  4R87 A;  5C88 A;  1J4J A;  5ISV A;  2EVN A;  4MI4 A;  3FXT A;  2AFU A;  3NH4 A;  4EWT A;  2JEV A;  2J8M A;  4DNC A;  3R1K A;  3VAR A;  4CS0 B;  1BO4 A;  5G20 A;  1XBU A;  1ZG8 A;  2J8R A;  3KKW A;  3D8P A; 
#chains in the Genus database with same CATH homology
 1MK4 A;  2OB0 A;  4EVY A;  4YRH A;  2DPS A;  2WSA A;  4XNH C;  2KCW A;  3FIX A;  1NE9 A;  3R9F A;  3BJ8 A;  4XPD B;  1S7N A;  2VZZ A;  2CXA A;  1P4N A;  3DNS A;  3F0A A;  4KOS A;  2VI7 A;  4A32 A;  2B3U A;  4U5Y A;  2H5M A;  2B5G B;  3FBU A;  2Z3K A;  1WWZ A;  4QBJ A;  2REE A;  2PDO A;  4JXR A;  4UWI A;  4PV6 A;  4KS9 A;  5F46 A;  4UA3 A;  4XPD C;  4CRY B;  2R7H A;  5IB0 A;  1MJ9 A;  3TOB A;  2VZY A;  2GIV A;  4KUA A;  3P2H A;  2Z0Z A;  1S7K A;  1IYK A;  4C2Y A;  4II9 A;  1S3Z A;  1KUX A;  5C82 A;  1KZF A;  5J8C A;  4B10 A;  3LOD A;  1M4G A;  2ZPA A;  2VQY A;  3W6S A;  5JPH A;  4B5P A;  4HNY B;  5JQ4 A;  3R96 A;  4CAX A;  1IID A;  1Q2C A;  2Y0M A;  3MGD A;  2J8N A;  1KUV A;  1RXT A;  3EXN A;  4QUS A;  2Q7B A;  4C2Z A;  3EY5 A;  2HQY A;  3TO6 A;  2OZU A;  3H4Q A;  3JVN A;  3K9U A;  3S6K A;  1LRZ A;  1I12 A;  1PU9 A;  3JTK A;  4KUB A;  1XEB A;  2HV2 A;  4LUA A;  2B58 A;  2B5G A;  2Z10 A;  2Q4V A;  4CYN A;  3VWE A;  4CGL A;  4J3G A;  2BL1 A;  4KOT A;  1Q2D A;  2AE6 A;  1U6M A;  2ZW5 A;  1RO5 A;  2Q04 A;  4JWP A;  4KOR A;  1YVO A;  2A4N A;  2ZW6 A;  2GE3 A;  4IUS A;  4FD7 A;  4AVB A;  4R9M A;  5I0C A;  4IF5 A;  4ZBG A;  4FD6 A;  3P2F A;  3NE7 A;  1XMT A;  1XF8 A;  3CXQ A;  4HKF A;  3LD2 A;  5H86 A;  4NXY A;  2X7B A;  5AG6 A;  2FXF A;  2ZXV A;  4OAE A;  4I49 A;  4QB9 A;  2B3V A;  4CYQ A;  4PSX A;  2ATR A;  5G22 A;  2G3T A;  5AG7 A;  3D2M A;  2NMT A;  4CAF A;  4OAD A;  1IYL A;  2PRB A;  3TT2 A;  4GS4 A;  2QML A;  4B5P B;  1YX0 A;  1Z4R A;  2Z3P A;  3R9E A;  3GYA A;  4UFX A;  2PSW A;  5IV0 A;  4KLW A;  4MBU A;  3ZZI A;  4Y49 B;  1B87 A;  1S60 A;  2F5I A;  2FS5 A;  2PQ8 A;  1CM0 A;  4PK2 A;  2RC4 A;  1S7F A;  4A30 A;  4C7H A;  3TOA A;  4Q36 A;  1IIC A;  4XPK A;  2JDC A;  4A2Z A;  3TO7 A;  3SXO A;  2WPX A;  4F6A A;  5KTA A;  4MFZ A;  2GAN A;  2P6F A;  4K30 A;  3TE4 A;  1S7L A;  3JUW A;  3QB8 A;  2OH1 A;  4KOU A;  2VEZ A;  2FIA A;  3DSB A;  4KLV A;  4MY3 A;  4CGN A;  1N71 A;  2QIR A;  4Y49 C;  2Q4Y A;  5A28 A;  3G8W A;  4MFP A;  2D4P A;  1I1D A;  2QEC A;  4UCN A;  2Z11 A;  3DR8 A;  1FY7 A;  3SXN A;  2PR1 A;  3EFA A;  3ZJ0 A;  4Q38 A;  4RS2 A;  2R98 A;  4A95 A;  4A33 A;  3CXS A;  4NF1 A;  4X5K A;  2BEI A;  4F0Y A;  4QC6 A;  4OLL A;  2R8V A;  4UFW A;  2B4D A;  4UFV A;  2I79 A;  2OZG A;  3FRM A;  4LX9 A;  1S5K A;  1P0H A;  1YK3 A;  5HMN A;  4JD6 A;  5DWN A;  1NMT A;  2WUU A;  4KSF A;  3G3S A;  1ON0 A;  4R57 A;  2Z3O A;  3S6H A;  2Z3M A;  3D2P A;  1Y9K A;  4KSA A;  4CAV A;  1WK4 A;  1GHE A;  4L8A A;  2D4O A;  4MFK A;  4ORF A;  3FNC A;  2CNT A;  3PZJ A;  2FT0 A;  4CGM A;  2CNM A;  1Z4E A;  3EO4 A;  1R57 A;  4AG9 A;  3FB3 A;  1PUA A;  2WPW A;  5EBV A;  5FVJ A;  2EUI A;  3N7Z A;  1VKC A;  1Z9U A;  4MFL A;  1NSL A;  1XE4 A;  2B4B A;  3W6X A;  4PSW A;  3F5B A;  4CGO A;  5KTC A;  4E0A A;  3F8K A;  4CAW A;  3W91 A;  4NSQ A;  5CNP A;  5BWA B;  1V0C A;  4MFQ A;  1OZP A;  4A31 A;  1M4I A;  4KOY A;  4RI1 A;  4MHD A;  1CJW A;  2FCK A;  4CAE A;  2BSW A;  2YNE A;  3QAH A;  4KZT A;  3TO9 A;  3WR7 A;  5J8F A;  1QSO A;  2OU2 A;  4C7I A;  4QVT A;  4ONU A;  1SQH A;  1QSR A;  2G0B A;  4E2A A;  4L89 A;  1KUY A;  4C2X A;  5F48 A;  2AJ6 A;  4B12 A;  1YVK A;  4NCZ A;  3SHP A;  2CNS A;  1Y9W A;  3PGP A;  2Z3L A;  2B4D B;  5G21 A;  4MJ8 A;  2YNC A;  4KVO E;  5HH1 A;  3BJ7 A;  4PK3 A;  5F47 A;  2G3A A;  2JLM A;  3IWG A;  4AG7 A;  2FL4 A;  1MJB A;  1Q2Y A;  3VWD A;  4FD4 A;  3B8G A;  4JJX A;  4KVM E;  4AVA A;  4UBR A;  5F49 A;  4AB7 A;  3T90 A;  4M85 A;  1QST A;  2R1I A;  3TTH A;  3CXP A;  1QSM A;  2YND A;  1YRE A;  3I9S A;  2I00 A;  2JDD A;  2VBQ A;  4CYO A;  1ZO0 A;  3D3S A;  2FSR A;  4YGO A;  1B6B A;  5DWM A;  4MY0 A;  2DXQ A;  1M44 A;  3GKR A;  4R3L A;  4U9Y A;  2K5T A;  1Y7R A;  4C68 A;  3IWE A;  3T9Y A;  2IL4 A;  5E96 A;  2Z3N A;  4F0X A;  2PR8 A;  1I21 A;  2FIW A;  3GY9 A;  5AG4 A;  1MJA A;  5EC4 A;  4AVC A;  4R3K A;  4JXQ A;  4CRZ B;  2REF A;  2Q0Y A;  4B5O A;  3PP9 A;  3IU1 A;  1YLE A;  1BOB A;  2C27 A;  4HNX B;  2ARH A;  4MFJ A;  1QSN A;  1YGH A;  2DPT A;  4B11 A;  4KOV A;  2P6E A;  3RYO A;  4H6Z A;  2HUZ A;  3S6G A;  1IB1 E;  3H5Z A;  2ZW7 A;  5KTD A;  5AG5 A;  4U9Z A;  4B14 A;  3C26 A;  4KVX A;  2YGW A;  1M1D A;  3IU2 A;  4BBH A;  4NEX A;  4KOW A;  3DDD A;  2OZH A;  2PC1 A;  3S6F A;  4H6U A;  3UY5 A;  4B13 A;  1TIQ A;  4FD5 A;  2FE7 A;  5IX3 A;  3R95 A;  2YNC C;  5GCN A;  2ZW4 A;  4HNW B;  3TCV A;  3FYN A;  4CYP A;  4UWJ A;  3TFY A;  1K4J A;  4M3S A;  2CY2 A;  3A9L A;  3OWC A;  3EC4 A;  5AGE A;  3E0K A;  5G1Z A;  4YFJ A;  5A27 A;  4BMH A;  3DR6 A;  4UCP A;  4ZGY B;  4E8O A;  3BLN A;  5H84 A;  3R9G A;  2BUE A;  1YR0 A;  3I3G A;  4KOX A;  4JLY A;  4XPL A;  2P6G A;  4UCM A;  1M4D A;  2O28 A;  1L0C A;  4XNH B;  1VHS A;  4H89 A;  3V8I A;  1XIX A;  2VXK A;  2P0W A;  4CGP A;  3IGR A;  1UFH A;  5C88 A;  2Q44 A;  4R87 A;  1J4J A;  5ISV A;  2EVN A;  4MI4 A;  3FXT A;  2JEV A;  2J8M A;  4DNC A;  3R1K A;  4CS0 B;  1BO4 A;  5G20 A;  2J8R A;  3KKW A;  3D8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...