1KUXA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
molecule keywords Serotonin N-acetyltransferase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuxA00
4F0YA 1IICA 1KUVA 4MBUA 2B5GA 4KOUA 1IB1E 5HH1A 4X5KA 3SXNA 2Y0MA 1N71A 2G3TA 2OZGA 2WPWA 3TFYA 1CJWA 3C26A 5J8CA 4JLYA 1R57A 3F8KA 3TCVA 2CNMA 3FBUA 3S6GA 2PR8A 3H4QA 3F5BA 3GKRA 5KTCA 4KUAA 3OWCA 3P2HA 4KLVA 4UA3A 3I9SA 3S6KA 4ZBGA 2B4BA 2Z11A 1K4JA 2K5TA 4U9YA 3JVNA 5DWMA 3G3SA 1U6MA 1XE4A 1XF8A 5EBVA 5ISVA 2R1IA 4KLWA 2X7BA 4QVTA 1P0HA 4YFJA 1M4GA 4Y49B 1Y7RA 3S6FA 1YX0A 2PRBA 1S7NA 4MY0A 4CAXA 3FXTA 5F46A 2WPXA 2B4DA 1WK4A 2FT0A 4K30A 1YVOA 2P6GA 3PP9A 4KUBA 1QSOA 4XNHC 4E0AA 5C88A 1YREA 1QSTA 1NSLA 3GY9A 2FIAA 3T90A 4PSWA 4ORFA 4I49A 4AG9A 2OH1A 4E8OA 2B5GB 2P0WA 1FY7A 2R8VA 3FB3A 3JUWA 3W91A 1MK4A 4QC6A 4U5YA 1VHSA 3F0AA 4Y49C 3DDDA 1QSRA 2F5IA 4PK2A 2GANA 1Y9KA 1S60A 3FIXA 3TT2A 1I12A 3DSBA 2AE6A 4R87A 1KUYA 2HV2A 4MY3A 3SXOA 4MHDA 3LODA 2BL1A 2B3VA 3GYAA 3K9UA 4R9MA 2PQ8A 2FS5A 1SQHA 2VEZA 2ZW4A 3TO6A 3TE4A 2I79A 5FVJA 1P4NA 1YR0A 4KOXA 5IV0A 4L8AA 2NMTA 3VWEA 2FXFA 3G8WA 1MJBA 4NF1A 4KOYA 2D4OA 3CXPA 4AVBA 1M44A 4CS0B 5KTAA 4U9ZA 4CAWA 2A4NA 4AVCA 3IGRA 4UWJA 4KOVA 3R9EA 1Q2DA 2PDOA 2Q04A 1YLEA 1YGHA 5J8FA 2ZW6A 5I0CA 3D2PA 4KVOE 2EUIA 1B6BA 4XPLA 1I21A 2PC1A 4E2AA 2OU2A 2PR1A 3EO4A 4HKFA 2RC4A 3V8IA 2OZHA 3PGPA 4CRZB 4DNCA 2JEVA 4R3KA 3W6XA 1PU9A 2CNTA 2HQYA 1YVKA 3P2FA 3R95A 2CNSA 5IX3A 1CM0A 1QSNA 2D4PA 4KOTA 3EC4A 1IYKA 3R9FA 2CY2A 2I00A 5C82A 1OZPA 3EFAA 3QAHA 1S7LA 4R57A 4B5PB 1VKCA 4BMHA 4FD4A 2OB0A 5H86A 3BJ8A 2QMLA 5F47A 3DR8A 3KKWA 2FL4A 4XNHB 2FE7A 2FSRA 3I3GA 5HMNA 2ZPAA 4CRYB 2J8RA 4KVXA 4HNWB 4KOWA 2JDDA 3S6HA 4LUAA 2Q4VA 4JD6A 3R96A 2ZW5A 2PSWA 1S7KA 2VI7A 4HNXB 4JXQA 4PK3A 3RYOA 1RO5A 2VBQA 4NEXA 2FIWA 3IWGA 2ZXVA 4F6AA 5GCNA 3PZJA 2B4DB 4QBJA 4OADA 4B5OA 1KUXA 2JLMA 2QIRA 3CXQA 3EY5A 2VXKA 1XMTA 1M4DA 3UY5A 2GIVA 1I1DA 1B87A 4ONUA 4LX9A 4GS4A 4IUSA 4FD5A 5E96A 3TO7A 3EXNA 3WR7A 4JJXA 1M4IA 4HNYB 3W6SA 3B8GA 5DWNA 3FNCA 4QB9A 2ZW7A 5EC4A 2REEA 3TO9A 4II9A 4FD7A 4AG7A 2ARHA 4NXYA 2BEIA 2J8NA 4KVME 1IIDA 1PUAA 2B58A 2R7HA 4NSQA 4M3SA 2C27A 2VZZA 3TTHA 4KOSA 1S3ZA 2P6EA 4JXRA 3FRMA 3MGDA 3DR6A 4OLLA 4PV6A 1S5KA 2OZUA 4AB7A 1Z4RA 2REFA 1M1DA 2R98A 4KZTA 3D2MA 4AVAA 4JWPA 4RI1A 2G0BA 4EVYA 3LD2A 1Q2YA 2Q44A 2IL4A 3DNSA 1LRZA 5IB0A 3R9GA 3T9YA 4L89A 2EVNA 4OAEA 4YGOA 3E0KA 1NMTA 1V0CA 3VWDA 1UFHA 1BOBA 4YRHA 5KTDA 4NCZA 3TOBA 2AJ6A 3NE7A 1Y9WA 1Z4EA 5H84A 1YK3A 1Q2CA 1NE9A 3BJ7A 2KCWA 1S7FA 2VZYA 4MJ8A 1WWZA 3FYNA 2B3UA 2GE3A 3TOAA 4FD6A 2Q7BA 1Z9UA 2Q4YA 2J8MA 4XPDC 2JDCA 4XPKA 3SHPA 4B5PA 2QECA 2DXQA 4H6ZA 5F49A 1XEBA 3D8PA 3ZJ0A 4H89A 1TIQA 4IF5A 4UWIA 5CNPA 3R1KA 2ATRA 4R3LA 2G3AA 5JPHA 1RXTA 1QSMA 1XIXA 3N7ZA 3ZZIA 2Z0ZA 2VQYA 2BUEA 2H5MA 1MJAA 4RS2A 4UBRA 1IYLA 2O28A 4QUSA 2BSWA 4XPDB 1J4JA 4PSXA 1MJ9A 1GHEA 5F48A 1BO4A 2HUZA 3D3SA 3CXSA 4H6UA 4KORA 4MI4A 4CAVA 4J3GA 5JQ4A 2P6FA 3BLNA 4M85A 2Q0YA 1L0CA 1ON0A 2Z10A 3QB8A 2FCKA 1KZFA
chains in the Genus database with same CATH superfamily
1LAMA 4F0YA 4WJBA 1IICA 1KUVA 3IC1A 1HDUA 4MBUA 1ARMA 2F8HA 4NGRA 3BXMA 1BAVA 2B5GA 4KOUA 4KS9A 1IB1E 5HH1A 2CXAA 4X5KA 3GB0A 3SXNA 4K3NA 2Y0MA 2V8HA 4OP4A 1N71A 4B14A 2PJ1A 2G3TA 2OZGA 2Q51A 2DPSA 2WPWA 4C2XA 1ZLHA 3PEIA 1CJWA 3TFYA 3C26A 3WC6A 3BHXA 1X12A 1YSJA 4A94A 5J8CA 4A95A 3MN8A 5LRJA 4JLYA 5F09A 3FEEA 1R57A 3F8KA 5THWA 4CYOA 2XEGA 3TCVA 2CNMA 3FBUA 3S6GA 2PR8A 5D29A 3H4QA 4A39A 1ZG8A 4C2ZA 3D7DA 2XEFA 3F5BA 3FX6A 3CPAA 2EK9A 3GKRA 5KTCA 4KUAA 4YWYA 1XMBA 2NSMA 2Z3OA 3OWCA 3P2HA 4UEZA 4ZX8A 4CGLA 4KLVA 1VGYA 4C7HA 2RB7A 3B35A 4UA3A 2PIYA 3I9SA 3JRUA 2YNCC 3S6KA 4ZBGA 2B4BA 2CIJA 2Z11A 4ZY0A 4YU9A 2AFSA 3VATA 4NGQA 4M6GA 1K4JA 3IU2A 2Q43A 3K9TA 3SJXA 2HB6A 4A31A 2K5TA 1TF8A 4U9YA 3JVNA 5DWMA 3G3SA 4OC0A 1U6MA 2AFXA 1XE4A 1LOKA 1XF8A 5EBVA 4P45A 2R1IA 5ISVA 3H8GA 4KLWA 4B11A 2X7BA 5AG4A 4B13A 4QVTA 3RBUA 1P0HA 2WSAA 2Z3LA 4YFJA 3SI1A 1TKJA 1Y0YA 3CPXA 1Z8LA 1M4GA 4EMEA 4Y49B 1Y7RA 1NSAA 3CZXA 3GUXA 3S6FA 1YX0A 5G21A 1ZG9A 1DTDA 2PRBA 4A37A 1S7NA 4MY0A 4CAXA 3PFOA 3FXTA 4MFJA 4KSAA 4P10A 4P4BA 5F46A 1Z8TA 2EO8A 2BOAA 3BI1A 2WPXA 4ONWA 2B4DA 4B12A 3RAMA 4C2YA 3VH9A 2PJ2A 3B7IA 4UCPA 1WK4A 4JYWA 2FT0A 2OR4A 1OBRA 1YVOA 4K30A 2P6GA 3PP9A 4KUBA 1QSOA 4XNHC 4E0AA 4CPAA 5C88A 1QSTA 1YREA 1NSLA 3GY9A 4DJLA 2FIAA 4OC2A 1BPNA 4ZY2A 3T90A 1CBXA 4PSWA 4ORFA 1ZG7A 4I49A 1AUGA 3H8EA 4AG9A 1AYEA 2OH1A 3ISZA 1JQGA 1H8LA 4E8OA 2B5GB 2QYVA 4LQGA 2CTCA 4A30A 2P0WA 5DS0A 5LYIA 1FY7A 5A28A 2R8VA 2GLJA 3FB3A 3JUWA 3W91A 1MK4A 1LANA 4QC6A 4U5YA 5CPAA 1IU8A 1RTQA 1PCAA 1VHSA 4M6IA 2WZNA 3F0AA 4Y49C 1XRYA 2ODFA 3DDDA 4B6ZA 1QSRA 3D7HA 2WUUA 2F5IA 2PJ5A 4HPSA 3D66A 1Y9KA 2GANA 4PK2A 4NGSA 1DE4C 1S60A 4FAIA 1TF9A 3FIXA 3NFZA 4UFWA 3WC5A 2QVPA 3PRTA 3TT2A 1I12A 2V8VA 3DSBA 2AE6A 3PFEA 2DF5A 2VL1A 4R87A 1KUYA 2HV2A 4MY3A 2AFWA 3SXOA 4MHDA 3FECA 3LODA 3D4UA 1UWYA 2BO9A 3IFEA 2IQ6A 2BL1A 2GLFA 2B3VA 2ZELA 3GYAA 3NH4A 4CGMA 3K9UA 4R9MA 4UIAA 2PQ8A 2OOTA 1X10A 2FS5A 1SQHA 2PJ6A 5K8OA 2EBJA 2ZOFA 2VEZA 2YGWA 2ZW4A 2PE3A 1CP7A 3TO6A 5AG6A 3TE4A 5LYDA 1FNOA 4P4FA 6CPAA 4NGPA 2I79A 5FVJA 2Z3KA 3N5FA 5J1QA 1P4NA 3FVLA 1YR0A 4OC1A 1Z5RA 2PVVA 3PB8X 1QMUA 4KOXA 4MCSA 3S9MA 5IV0A 4L8AA 1VHEA 3SJGA 5HVHA 2NMTA 3VWEA 2FXFA 3G8WA 1MJBA 4NF1A 4KOYA 5JGFA 5HVFA 5AG7A 3PB7X 2D4OA 3CXPA 3K2KA 4R8FA 4CYPA 4AVBA 5EMIA 1M44A 4MFPA 8CPAA 2PJ3A 3PB6X 1JWQA 4CS0B 5KTAA 4U9ZA 4PPZA 4CAWA 1CPSA 2ZOGA 2A4NA 4AVCA 4F8ZA 1Z8WA 3VARA 3IGRA 4TNUA 3RO0A 3IIBA 4UWJA 4KOVA 4R6TA 4F9UA 3R9EA 1GYTA 1Q2DA 2GFQA 2PDOA 4GXHA 2Q04A 1ARLA 1CG2A 1YLEA 2ZEGA 4Z65A 1YGHA 4MCPA 4M6HA 3HLPA 5J8FA 2ZW6A 4DYOA 5I0CA 3D2PA 2F7VA 4KVOE 3KHXA 3LACA 4UIBA 3TC8A 4A38A 2EUIA 4OMEA 1B6BA 4MCRA 2C6GA 4P4IA 2PJ4A 4XPLA 1I21A 2PC1A 3FF3A 4E2AA 2OU2A 2PR1A 2IMOA 2V8DA 2AFMA 2AFOA 3EO4A 2ZEDA 2RC4A 4HKFA 3V8IA 2OZHA 3PGPA 4CRZB 4DNCA 2JEVA 4OC3A 2YNEA 4R3KA 3A9LA 4GM5A 4MFQA 5BWAB 1Q7LA 3W6XA 4CGNA 1PU9A 4WWVA 2CNTA 2HQYA 4UEEA 5LYFA 1ELMP 1YVKA 5I4MA 3P2FA 3HUVA 2CNSA 3R95A 5IX3A 4CAEA 1CM0A 3FJUA 4CYQA 4OC4A 1QSNA 2D4PA 4KOTA 1VIXA 3EC4A 1IYKA 4X3RA 2EWBA 1F2OA 3KZWA 3R9FA 5LYLA 3KQZA 2CY2A 4RUHA 2I00A 3PB4X 5C82A 4CAFA 1OZPA 2JBKA 3EFAA 2PJ8A 3QAHA 1KWMA 1S7LA 1XFOA 4PXDA 4R57A 2ZEOA 4B5PB 4EWTA 1VKCA 4BMHA 4FD4A 3KGQA 2OB0A 5H86A 5HVGA 3B3WA 3BJ8A 2QMLA 4MHNA 4NGMA 5F47A 3DR8A 3KKWA 2ANPA 3IJ3A 2FL4A 2ZEHA 4XNHB 3CT9A 4A2ZA 5JM6A 2FE7A 2FSRA 2G9DA 2PJBA 3I3GA 3QAYA 4PXEA 1BLLE 4PXCA 5HMNA 2ZPAA 5JH9A 4CRYB 2J8RA 1XOVA 2PJ7A 4KVXA 4HNWB 4KOWA 2JDDA 4MHZA 4LUAA 3S6HA 2Q4VA 4JD6A 3SJEA 5D8NA 1M4LA 3IU1A 5A27A 3R96A 4EFDA 2ZW5A 4X8IA 2PSWA 5HXDA 1S7KA 5LRKA 3PBBA 2VI7A 2XEIA 4HNXB 4JXQA 4OC5A 4PK3A 3S9LA 3RYOA 2QJ8A 4RN7A 1RO5A 2VBQA 4NEXA 2C6CA 4MFLA 4IK2A 2FIWA 2FVGA 3IWGA 2ZXVA 2PIZA 4F6AA 1YMEA 5GCNA 3PZJA 2B4DB 4Q36A 4QBJA 3CDXA 3T8WA 5K8NA 4OADA 4UFVA 1KUXA 2JLMA 2PRQA 2QIRA 3CXQA 4P4JA 3EY5A 4B5OA 2V77A 2PJAA 2VXKA 1XMTA 4BBHA 3V7ZA 1M4DA 3UY5A 2Q4ZA 2GIVA 3WT4A 1I1DA 4UEFA 2JBJA 4O23A 2AFUA 2RFHA 4PQAA 4C68A 1B87A 4ONUA 4LX9A 1Z8XA 3I1UA 4A33A 4GS4A 4IUSA 3D68A 4Q7AA 2YNCA 4FD5A 3H5ZA 5E96A 3TO7A 3EXNA 4DUKA 3WR7A 2ZEMA 4F9VA 4JJXA 3SI2A 2J9AA 3SJFA 3IO1A 1M4IA 1QQ9A 4HNYB 4TWEA 1IY7A 4BD9A 3RZAA 1F2PA 3W6SA 3B8GA 5DWNA 3FNCA 4QB9A 4W9YA 3KHZA 2JEWA 2ZW7A 5EC4A 5IB9A 3GIUA 2REEA 3TO9A 4II9A 4FD7A 4AG7A 1YW6A 3NH5A 2ARHA 4NXYA 2BEIA 4R7MA 1VHOA 2J8NA 4KVME 1IIDA 2CTBA 3D7FA 3H8FA 1PUAA 2B58A 2R7HA 1IGBA 4NSQA 4M3SA 4NJQA 2C27A 2VZZA 1R43A 2HC9A 3TTHA 4P4EA 4KOSA 1S3ZA 1YQEA 1XJOA 2ABZA 2P6EA 4JXRA 3ISXA 3FRMA 4BINA 3MGDA 3KR5A 3FMCA 3DR6A 4MHYA 4MMOA 4OLLA 1FT7A 4PXBA 4MXUA 4PV6A 1S5KA 3B3SA 2OZUA 3IEHA 4AB7A 5G20A 3LMSA 4NFRA 2Z3NA 2CF4A 1Z4RA 2REFA 1M1DA 2R98A 4KZTA 3WABA 2PJ9A 3D2MA 4AVAA 2Q7SA 4JWPA 4RI1A 2G0BA 5ELYA 4CGOA 4ZY1A 3IWWA 3NE8A 4EVYA 4NGTA 3LD2A 1A2ZA 1HDQA 4A32A 3SI0A 1Q2YA 2Q44A 4UCMA 1EE3P 2BCOA 1F57A 4CGPA 2I3CA 2IL4A 3DNSA 1LRZA 5G22A 2GU2A 2XEJA 2Z3PA 5IB0A 5AGEA 3R9GA 3T9YA 1IOIA 4L89A 2PCUA 4Q38A 1HEEA 2EVNA 4JZ0A 1LAPA 4OAEA 5LRGA 4YGOA 3E0KA 2O4HA 1NMTA 4NGNA 1ELLP 1V0CA 3VWDA 1UFHA 1BOBA 3JTKA 4YRHA 4X2TA 4MFZA 5KTDA 3WC7A 2ZEFA 3KL9A 4NCZA 3KQXA 3TOBA 2AJ6A 3NE7A 1Y9WA 1IOFA 1Z4EA 4UF4A 5H84A 1Q2CA 1NE9A 1YK3A 2AFZA 3BJ7A 2KCWA 4P6YA 1S7FA 1CX8A 1TKFA 2VZYA 4MJ8A 1WWZA 3FYNA 2B3UA 3B2YA 2YNDA 2GE3A 3TOAA 4FD6A 2Q7BA 4C7IA 1Y0RA 4AXVA 1Z9UA 2Q4YA 4R76A 2DEAA 4KSIA 2J8MA 2PJ0A 4XPDC 2JDCA 3DGVA 4IHMA 4ZYQA 2O53A 4XPKA 3SHPA 3NA6A 2C6PA 4B5PA 2QECA 3S9NA 2DXQA 3PBEA 4FWUA 4H6ZA 3D7GA 3FEDA 2DPTA 1AMPA 3GLJA 7CPAA 5F49A 4MCQA 1ZO0A 4MHPA 1XEBA 3D8PA 3ZJ0A 4H89A 1XBUA 2IJZA 3KASA 1YW4A 1LFWA 3BI0A 3TX8A 2ZEPA 1TIQA 4UFXA 3L2NA 5AG5A 2NYQA 4IF5A 4UWIA 5CNPA 4P44A 3R1KA 4B10A 4MRIA 2ATRA 3DLJA 3QNVA 4R3LA 5CBMA 2G3AA 4KSFA 5JPHA 1RXTA 1QSMA 1XIXA 2C1CA 2PVWA 4IAVA 1TKHA 2WYRA 3FH4A 3N7ZA 3ZZIA 2Z0ZA 3B3CA 1CP6A 2VQYA 4UCNA 3LWUA 2BUEA 2H5MA 3PB9X 1MJAA 3IWEA 4H2KA 5G1ZA 4LQ6A 4RS2A 4UBRA 2GREA 4P4DA 3RNZA 1IYLA 1YLOA 1Z2LA 2O28A 2BSWA 3D67A 2PJCA 4OIWA 4QUSA 4XPDB 1J4JA 1R3NA 4PSXA 4ZGYB 1MJ9A 1GHEA 3MRUA 4FUUA 5F48A 2ZEEA 3V38A 4MFKA 4F0XA 4ZI6A 1BO4A 1Y7EA 4G1PA 2HUZA 2POKA 1BPMA 2Z3MA 3D3SA 4FBEA 2ZENA 3CXSA 4OIDA 4H6UA 4KORA 4MI4A 4CAVA 2EK8A 4J3GA 5JQ4A 2P6FA 5K8MA 5K8PA 3BLNA 4M85A 3B3TA 2Q0YA 1CPXA 1L0CA 1ZLIA 3KR4A 4NJRA 1ON0A 3B3VA 1PYTB 3NH8A 1LCPA 2Z10A 4OKOA 3QB8A 2V8GA 2FCKA 1KZFA 1TXRA 3KI9A 4CYNA 4ZX9A
chains in the Genus database with same CATH topology
4F0YA 1IICA 1KUVA 4MBUA 2B5GA 4KOUA 4KS9A 1IB1E 5HH1A 2CXAA 4X5KA 3SXNA 2Y0MA 1N71A 4B14A 2G3TA 2OZGA 2WPWA 2DPSA 4C2XA 3TFYA 1CJWA 3C26A 5J8CA 4A95A 4JLYA 1R57A 3F8KA 4CYOA 3TCVA 2CNMA 3FBUA 3S6GA 2PR8A 3H4QA 4C2ZA 3F5BA 3GKRA 5KTCA 4KUAA 2Z3OA 3OWCA 3P2HA 4CGLA 4KLVA 4C7HA 4UA3A 3I9SA 2YNCC 3S6KA 4ZBGA 2B4BA 2Z11A 1K4JA 3IU2A 4A31A 2K5TA 4U9YA 3JVNA 5DWMA 3G3SA 1U6MA 1XE4A 1XF8A 5EBVA 5ISVA 2R1IA 4KLWA 4B11A 2X7BA 5AG4A 4B13A 4QVTA 1P0HA 2WSAA 2Z3LA 4YFJA 1M4GA 4Y49B 1Y7RA 3S6FA 1YX0A 5G21A 2PRBA 1S7NA 4MY0A 4CAXA 3FXTA 4MFJA 4KSAA 5F46A 2WPXA 2B4DA 4B12A 4C2YA 4UCPA 1WK4A 2FT0A 4K30A 1YVOA 2P6GA 3PP9A 4KUBA 1QSOA 4XNHC 4E0AA 5C88A 1YREA 1QSTA 1NSLA 3GY9A 2FIAA 3T90A 4PSWA 4ORFA 4I49A 4AG9A 2OH1A 4E8OA 2B5GB 4A30A 2P0WA 1FY7A 5A28A 2R8VA 3FB3A 3JUWA 3W91A 1MK4A 4QC6A 4U5YA 1VHSA 3F0AA 4Y49C 3DDDA 1QSRA 2WUUA 2F5IA 1Y9KA 2GANA 4PK2A 1S60A 3FIXA 4UFWA 3TT2A 1I12A 3DSBA 2AE6A 4R87A 1KUYA 2HV2A 4MY3A 3SXOA 4MHDA 3LODA 2BL1A 4CGMA 2B3VA 3GYAA 3K9UA 4R9MA 2PQ8A 2FS5A 1SQHA 2VEZA 2YGWA 2ZW4A 3TO6A 5AG6A 3TE4A 2I79A 5FVJA 2Z3KA 1P4NA 1YR0A 4KOXA 5IV0A 4L8AA 2NMTA 3VWEA 2FXFA 3G8WA 1MJBA 4NF1A 4KOYA 5AG7A 2D4OA 3CXPA 4CYPA 4AVBA 1M44A 4MFPA 4CS0B 5KTAA 4U9ZA 4CAWA 2A4NA 4AVCA 3IGRA 4UWJA 4KOVA 3R9EA 1Q2DA 2PDOA 2Q04A 1YLEA 1YGHA 5J8FA 2ZW6A 5I0CA 3D2PA 4KVOE 2EUIA 1B6BA 4XPLA 1I21A 2PC1A 4E2AA 2OU2A 2PR1A 3EO4A 4HKFA 2RC4A 3V8IA 2OZHA 3PGPA 4CRZB 4DNCA 2JEVA 2YNEA 4R3KA 3A9LA 4MFQA 5BWAB 3W6XA 4CGNA 1PU9A 2CNTA 2HQYA 1YVKA 3P2FA 3R95A 2CNSA 5IX3A 4CAEA 1CM0A 4CYQA 1QSNA 2D4PA 4KOTA 3EC4A 1IYKA 3R9FA 2CY2A 2I00A 5C82A 4CAFA 1OZPA 3EFAA 3QAHA 1S7LA 4R57A 4B5PB 1VKCA 4BMHA 4FD4A 2OB0A 5H86A 3BJ8A 2QMLA 5F47A 3DR8A 3KKWA 2FL4A 4XNHB 4A2ZA 2FE7A 2FSRA 3I3GA 5HMNA 2ZPAA 4CRYB 2J8RA 4KVXA 4HNWB 4KOWA 2JDDA 3S6HA 4LUAA 2Q4VA 4JD6A 3IU1A 5A27A 3R96A 2ZW5A 2PSWA 1S7KA 2VI7A 4HNXB 4JXQA 4PK3A 3RYOA 1RO5A 2VBQA 4NEXA 4MFLA 2FIWA 3IWGA 2ZXVA 4F6AA 5GCNA 3PZJA 2B4DB 4Q36A 4QBJA 4OADA 4UFVA 1KUXA 2JLMA 2QIRA 3CXQA 4B5OA 3EY5A 2VXKA 1XMTA 4BBHA 1M4DA 3UY5A 2GIVA 1I1DA 4C68A 1B87A 4ONUA 4LX9A 4A33A 4GS4A 4IUSA 2YNCA 4FD5A 3H5ZA 5E96A 3TO7A 3EXNA 3WR7A 4JJXA 1M4IA 4HNYB 3W6SA 3B8GA 5DWNA 3FNCA 4QB9A 2ZW7A 5EC4A 2REEA 3TO9A 4II9A 4FD7A 4AG7A 2ARHA 4NXYA 2BEIA 2J8NA 4KVME 1IIDA 1PUAA 2B58A 2R7HA 4NSQA 4M3SA 2C27A 2VZZA 3TTHA 4KOSA 1S3ZA 2P6EA 4JXRA 3FRMA 3MGDA 3DR6A 4OLLA 4PV6A 1S5KA 2OZUA 4AB7A 5G20A 2Z3NA 1Z4RA 2REFA 1M1DA 2R98A 4KZTA 3D2MA 4AVAA 4JWPA 4RI1A 2G0BA 4CGOA 4EVYA 3LD2A 4A32A 1Q2YA 2Q44A 4UCMA 4CGPA 2IL4A 3DNSA 1LRZA 5G22A 2Z3PA 5IB0A 5AGEA 3R9GA 3T9YA 4L89A 4Q38A 2EVNA 4OAEA 4YGOA 3E0KA 1NMTA 1V0CA 3VWDA 1UFHA 1BOBA 3JTKA 4YRHA 4MFZA 5KTDA 4NCZA 3TOBA 2AJ6A 3NE7A 1Y9WA 1Z4EA 5H84A 1YK3A 1Q2CA 1NE9A 3BJ7A 2KCWA 1S7FA 2VZYA 4MJ8A 1WWZA 3FYNA 2B3UA 2YNDA 2GE3A 3TOAA 4FD6A 2Q7BA 4C7IA 1Z9UA 2Q4YA 2J8MA 4XPDC 2JDCA 4XPKA 3SHPA 4B5PA 2QECA 2DXQA 4H6ZA 2DPTA 5F49A 1ZO0A 1XEBA 3D8PA 3ZJ0A 4H89A 1TIQA 4UFXA 5AG5A 4IF5A 4UWIA 5CNPA 4B10A 3R1KA 2ATRA 4R3LA 2G3AA 4KSFA 5JPHA 1RXTA 1QSMA 1XIXA 3N7ZA 3ZZIA 2Z0ZA 2VQYA 4UCNA 2BUEA 2H5MA 1MJAA 3IWEA 5G1ZA 4RS2A 4UBRA 1IYLA 2O28A 2BSWA 4QUSA 4XPDB 1J4JA 4PSXA 4ZGYB 1MJ9A 1GHEA 5F48A 4F0XA 4MFKA 1BO4A 2HUZA 2Z3MA 3D3SA 3CXSA 4H6UA 4KORA 4MI4A 4CAVA 4J3GA 5JQ4A 2P6FA 3BLNA 4M85A 2Q0YA 1L0CA 1ON0A 2Z10A 3QB8A 2FCKA 1KZFA 4CYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0Y A;  1IIC A;  1KUV A;  4MBU A;  2B5G A;  4KOU A;  1IB1 E;  5HH1 A;  4X5K A;  3SXN A;  2Y0M A;  1N71 A;  2G3T A;  2OZG A;  2WPW A;  3TFY A;  1CJW A;  3C26 A;  5J8C A;  4JLY A;  1R57 A;  3F8K A;  3TCV A;  2CNM A;  3FBU A;  3S6G A;  2PR8 A;  3H4Q A;  3F5B A;  3GKR A;  5KTC A;  4KUA A;  3OWC A;  3P2H A;  4KLV A;  4UA3 A;  3I9S A;  3S6K A;  4ZBG A;  2B4B A;  2Z11 A;  1K4J A;  2K5T A;  4U9Y A;  3JVN A;  5DWM A;  3G3S A;  1U6M A;  1XE4 A;  1XF8 A;  5EBV A;  5ISV A;  2R1I A;  4KLW A;  2X7B A;  4QVT A;  1P0H A;  4YFJ A;  1M4G A;  4Y49 B;  1Y7R A;  3S6F A;  1YX0 A;  2PRB A;  1S7N A;  4MY0 A;  4CAX A;  3FXT A;  5F46 A;  2WPX A;  2B4D A;  1WK4 A;  2FT0 A;  4K30 A;  1YVO A;  2P6G A;  3PP9 A;  4KUB A;  1QSO A;  4XNH C;  4E0A A;  5C88 A;  1YRE A;  1QST A;  1NSL A;  3GY9 A;  2FIA A;  3T90 A;  4PSW A;  4ORF A;  4I49 A;  4AG9 A;  2OH1 A;  4E8O A;  2B5G B;  2P0W A;  1FY7 A;  2R8V A;  3FB3 A;  3JUW A;  3W91 A;  1MK4 A;  4QC6 A;  4U5Y A;  1VHS A;  3F0A A;  4Y49 C;  3DDD A;  1QSR A;  2F5I A;  4PK2 A;  2GAN A;  1Y9K A;  1S60 A;  3FIX A;  3TT2 A;  1I12 A;  3DSB A;  2AE6 A;  4R87 A;  1KUY A;  2HV2 A;  4MY3 A;  3SXO A;  4MHD A;  3LOD A;  2BL1 A;  2B3V A;  3GYA A;  3K9U A;  4R9M A;  2PQ8 A;  2FS5 A;  1SQH A;  2VEZ A;  2ZW4 A;  3TO6 A;  3TE4 A;  2I79 A;  5FVJ A;  1P4N A;  1YR0 A;  4KOX A;  5IV0 A;  4L8A A;  2NMT A;  3VWE A;  2FXF A;  3G8W A;  1MJB A;  4NF1 A;  4KOY A;  2D4O A;  3CXP A;  4AVB A;  1M44 A;  4CS0 B;  5KTA A;  4U9Z A;  4CAW A;  2A4N A;  4AVC A;  3IGR A;  4UWJ A;  4KOV A;  3R9E A;  1Q2D A;  2PDO A;  2Q04 A;  1YLE A;  1YGH A;  5J8F A;  2ZW6 A;  5I0C A;  3D2P A;  4KVO E;  2EUI A;  1B6B A;  4XPL A;  1I21 A;  2PC1 A;  4E2A A;  2OU2 A;  2PR1 A;  3EO4 A;  4HKF A;  2RC4 A;  3V8I A;  2OZH A;  3PGP A;  4CRZ B;  4DNC A;  2JEV A;  4R3K A;  3W6X A;  1PU9 A;  2CNT A;  2HQY A;  1YVK A;  3P2F A;  3R95 A;  2CNS A;  5IX3 A;  1CM0 A;  1QSN A;  2D4P A;  4KOT A;  3EC4 A;  1IYK A;  3R9F A;  2CY2 A;  2I00 A;  5C82 A;  1OZP A;  3EFA A;  3QAH A;  1S7L A;  4R57 A;  4B5P B;  1VKC A;  4BMH A;  4FD4 A;  2OB0 A;  5H86 A;  3BJ8 A;  2QML A;  5F47 A;  3DR8 A;  3KKW A;  2FL4 A;  4XNH B;  2FE7 A;  2FSR A;  3I3G A;  5HMN A;  2ZPA A;  4CRY B;  2J8R A;  4KVX A;  4HNW B;  4KOW A;  2JDD A;  3S6H A;  4LUA A;  2Q4V A;  4JD6 A;  3R96 A;  2ZW5 A;  2PSW A;  1S7K A;  2VI7 A;  4HNX B;  4JXQ A;  4PK3 A;  3RYO A;  1RO5 A;  2VBQ A;  4NEX A;  2FIW A;  3IWG A;  2ZXV A;  4F6A A;  5GCN A;  3PZJ A;  2B4D B;  4QBJ A;  4OAD A;  4B5O A;  1KUX A;  2JLM A;  2QIR A;  3CXQ A;  3EY5 A;  2VXK A;  1XMT A;  1M4D A;  3UY5 A;  2GIV A;  1I1D A;  1B87 A;  4ONU A;  4LX9 A;  4GS4 A;  4IUS A;  4FD5 A;  5E96 A;  3TO7 A;  3EXN A;  3WR7 A;  4JJX A;  1M4I A;  4HNY B;  3W6S A;  3B8G A;  5DWN A;  3FNC A;  4QB9 A;  2ZW7 A;  5EC4 A;  2REE A;  3TO9 A;  4II9 A;  4FD7 A;  4AG7 A;  2ARH A;  4NXY A;  2BEI A;  2J8N A;  4KVM E;  1IID A;  1PUA A;  2B58 A;  2R7H A;  4NSQ A;  4M3S A;  2C27 A;  2VZZ A;  3TTH A;  4KOS A;  1S3Z A;  2P6E A;  4JXR A;  3FRM A;  3MGD A;  3DR6 A;  4OLL A;  4PV6 A;  1S5K A;  2OZU A;  4AB7 A;  1Z4R A;  2REF A;  1M1D A;  2R98 A;  4KZT A;  3D2M A;  4AVA A;  4JWP A;  4RI1 A;  2G0B A;  4EVY A;  3LD2 A;  1Q2Y A;  2Q44 A;  2IL4 A;  3DNS A;  1LRZ A;  5IB0 A;  3R9G A;  3T9Y A;  4L89 A;  2EVN A;  4OAE A;  4YGO A;  3E0K A;  1NMT A;  1V0C A;  3VWD A;  1UFH A;  1BOB A;  4YRH A;  5KTD A;  4NCZ A;  3TOB A;  2AJ6 A;  3NE7 A;  1Y9W A;  1Z4E A;  5H84 A;  1YK3 A;  1Q2C A;  1NE9 A;  3BJ7 A;  2KCW A;  1S7F A;  2VZY A;  4MJ8 A;  1WWZ A;  3FYN A;  2B3U A;  2GE3 A;  3TOA A;  4FD6 A;  2Q7B A;  1Z9U A;  2Q4Y A;  2J8M A;  4XPD C;  2JDC A;  4XPK A;  3SHP A;  4B5P A;  2QEC A;  2DXQ A;  4H6Z A;  5F49 A;  1XEB A;  3D8P A;  3ZJ0 A;  4H89 A;  1TIQ A;  4IF5 A;  4UWI A;  5CNP A;  3R1K A;  2ATR A;  4R3L A;  2G3A A;  5JPH A;  1RXT A;  1QSM A;  1XIX A;  3N7Z A;  3ZZI A;  2Z0Z A;  2VQY A;  2BUE A;  2H5M A;  1MJA A;  4RS2 A;  4UBR A;  1IYL A;  2O28 A;  4QUS A;  2BSW A;  4XPD B;  1J4J A;  4PSX A;  1MJ9 A;  1GHE A;  5F48 A;  1BO4 A;  2HUZ A;  3D3S A;  3CXS A;  4H6U A;  4KOR A;  4MI4 A;  4CAV A;  4J3G A;  5JQ4 A;  2P6F A;  3BLN A;  4M85 A;  2Q0Y A;  1L0C A;  1ON0 A;  2Z10 A;  3QB8 A;  2FCK A;  1KZF A; 
#chains in the Genus database with same CATH topology
 1LAM A;  4F0Y A;  4WJB A;  1IIC A;  1KUV A;  3IC1 A;  1HDU A;  4MBU A;  1ARM A;  2F8H A;  4NGR A;  3BXM A;  1BAV A;  2B5G A;  4KOU A;  4KS9 A;  1IB1 E;  5HH1 A;  2CXA A;  4X5K A;  3GB0 A;  3SXN A;  4K3N A;  2Y0M A;  2V8H A;  4OP4 A;  1N71 A;  4B14 A;  2PJ1 A;  2G3T A;  2OZG A;  2Q51 A;  2DPS A;  2WPW A;  4C2X A;  1ZLH A;  3PEI A;  1CJW A;  3TFY A;  3C26 A;  3WC6 A;  3BHX A;  1X12 A;  1YSJ A;  4A94 A;  5J8C A;  4A95 A;  3MN8 A;  5LRJ A;  4JLY A;  5F09 A;  3FEE A;  1R57 A;  3F8K A;  5THW A;  4CYO A;  2XEG A;  3TCV A;  2CNM A;  3FBU A;  3S6G A;  2PR8 A;  5D29 A;  3H4Q A;  4A39 A;  1ZG8 A;  4C2Z A;  3D7D A;  2XEF A;  3F5B A;  3FX6 A;  3CPA A;  2EK9 A;  3GKR A;  5KTC A;  4KUA A;  4YWY A;  1XMB A;  2NSM A;  2Z3O A;  3OWC A;  3P2H A;  4UEZ A;  4ZX8 A;  4CGL A;  4KLV A;  1VGY A;  4C7H A;  2RB7 A;  3B35 A;  4UA3 A;  2PIY A;  3I9S A;  3JRU A;  2YNC C;  3S6K A;  4ZBG A;  2B4B A;  2CIJ A;  2Z11 A;  4ZY0 A;  4YU9 A;  2AFS A;  3VAT A;  4NGQ A;  4M6G A;  1K4J A;  3IU2 A;  2Q43 A;  3K9T A;  3SJX A;  2HB6 A;  4A31 A;  2K5T A;  1TF8 A;  4U9Y A;  3JVN A;  5DWM A;  3G3S A;  4OC0 A;  1U6M A;  2AFX A;  1XE4 A;  1LOK A;  1XF8 A;  5EBV A;  4P45 A;  2R1I A;  5ISV A;  3H8G A;  4KLW A;  4B11 A;  2X7B A;  5AG4 A;  4B13 A;  4QVT A;  3RBU A;  1P0H A;  2WSA A;  2Z3L A;  4YFJ A;  3SI1 A;  1TKJ A;  1Y0Y A;  3CPX A;  1Z8L A;  1M4G A;  4EME A;  4Y49 B;  1Y7R A;  1NSA A;  3CZX A;  3GUX A;  3S6F A;  1YX0 A;  5G21 A;  1ZG9 A;  1DTD A;  2PRB A;  4A37 A;  1S7N A;  4MY0 A;  4CAX A;  3PFO A;  3FXT A;  4MFJ A;  4KSA A;  4P10 A;  4P4B A;  5F46 A;  1Z8T A;  2EO8 A;  2BOA A;  3BI1 A;  2WPX A;  4ONW A;  2B4D A;  4B12 A;  3RAM A;  4C2Y A;  3VH9 A;  2PJ2 A;  3B7I A;  4UCP A;  1WK4 A;  4JYW A;  2FT0 A;  2OR4 A;  1OBR A;  1YVO A;  4K30 A;  2P6G A;  3PP9 A;  4KUB A;  1QSO A;  4XNH C;  4E0A A;  4CPA A;  5C88 A;  1QST A;  1YRE A;  1NSL A;  3GY9 A;  4DJL A;  2FIA A;  4OC2 A;  1BPN A;  4ZY2 A;  3T90 A;  1CBX A;  4PSW A;  4ORF A;  1ZG7 A;  4I49 A;  1AUG A;  3H8E A;  4AG9 A;  1AYE A;  2OH1 A;  3ISZ A;  1JQG A;  1H8L A;  4E8O A;  2B5G B;  2QYV A;  4LQG A;  2CTC A;  4A30 A;  2P0W A;  5DS0 A;  5LYI A;  1FY7 A;  5A28 A;  2R8V A;  2GLJ A;  3FB3 A;  3JUW A;  3W91 A;  1MK4 A;  1LAN A;  4QC6 A;  4U5Y A;  5CPA A;  1IU8 A;  1RTQ A;  1PCA A;  1VHS A;  4M6I A;  2WZN A;  3F0A A;  4Y49 C;  1XRY A;  2ODF A;  3DDD A;  4B6Z A;  1QSR A;  3D7H A;  2WUU A;  2F5I A;  2PJ5 A;  4HPS A;  3D66 A;  1Y9K A;  2GAN A;  4PK2 A;  4NGS A;  1DE4 C;  1S60 A;  4FAI A;  1TF9 A;  3FIX A;  3NFZ A;  4UFW A;  3WC5 A;  2QVP A;  3PRT A;  3TT2 A;  1I12 A;  2V8V A;  3DSB A;  2AE6 A;  3PFE A;  2DF5 A;  2VL1 A;  4R87 A;  1KUY A;  2HV2 A;  4MY3 A;  2AFW A;  3SXO A;  4MHD A;  3FEC A;  3LOD A;  3D4U A;  1UWY A;  2BO9 A;  3IFE A;  2IQ6 A;  2BL1 A;  2GLF A;  2B3V A;  2ZEL A;  3GYA A;  3NH4 A;  4CGM A;  3K9U A;  4R9M A;  4UIA A;  2PQ8 A;  2OOT A;  1X10 A;  2FS5 A;  1SQH A;  2PJ6 A;  5K8O A;  2EBJ A;  2ZOF A;  2VEZ A;  2YGW A;  2ZW4 A;  2PE3 A;  1CP7 A;  3TO6 A;  5AG6 A;  3TE4 A;  5LYD A;  1FNO A;  4P4F A;  6CPA A;  4NGP A;  2I79 A;  5FVJ A;  2Z3K A;  3N5F A;  5J1Q A;  1P4N A;  3FVL A;  1YR0 A;  4OC1 A;  1Z5R A;  2PVV A;  3PB8 X;  1QMU A;  4KOX A;  4MCS A;  3S9M A;  5IV0 A;  4L8A A;  1VHE A;  3SJG A;  5HVH A;  2NMT A;  3VWE A;  2FXF A;  3G8W A;  1MJB A;  4NF1 A;  4KOY A;  5JGF A;  5HVF A;  5AG7 A;  3PB7 X;  2D4O A;  3CXP A;  3K2K A;  4R8F A;  4CYP A;  4AVB A;  5EMI A;  1M44 A;  4MFP A;  8CPA A;  2PJ3 A;  3PB6 X;  1JWQ A;  4CS0 B;  5KTA A;  4U9Z A;  4PPZ A;  4CAW A;  1CPS A;  2ZOG A;  2A4N A;  4AVC A;  4F8Z A;  1Z8W A;  3VAR A;  3IGR A;  4TNU A;  3RO0 A;  3IIB A;  4UWJ A;  4KOV A;  4R6T A;  4F9U A;  3R9E A;  1GYT A;  1Q2D A;  2GFQ A;  2PDO A;  4GXH A;  2Q04 A;  1ARL A;  1CG2 A;  1YLE A;  2ZEG A;  4Z65 A;  1YGH A;  4MCP A;  4M6H A;  3HLP A;  5J8F A;  2ZW6 A;  4DYO A;  5I0C A;  3D2P A;  2F7V A;  4KVO E;  3KHX A;  3LAC A;  4UIB A;  3TC8 A;  4A38 A;  2EUI A;  4OME A;  1B6B A;  4MCR A;  2C6G A;  4P4I A;  2PJ4 A;  4XPL A;  1I21 A;  2PC1 A;  3FF3 A;  4E2A A;  2OU2 A;  2PR1 A;  2IMO A;  2V8D A;  2AFM A;  2AFO A;  3EO4 A;  2ZED A;  2RC4 A;  4HKF A;  3V8I A;  2OZH A;  3PGP A;  4CRZ B;  4DNC A;  2JEV A;  4OC3 A;  2YNE A;  4R3K A;  3A9L A;  4GM5 A;  4MFQ A;  5BWA B;  1Q7L A;  3W6X A;  4CGN A;  1PU9 A;  4WWV A;  2CNT A;  2HQY A;  4UEE A;  5LYF A;  1ELM P;  1YVK A;  5I4M A;  3P2F A;  3HUV A;  2CNS A;  3R95 A;  5IX3 A;  4CAE A;  1CM0 A;  3FJU A;  4CYQ A;  4OC4 A;  1QSN A;  2D4P A;  4KOT A;  1VIX A;  3EC4 A;  1IYK A;  4X3R A;  2EWB A;  1F2O A;  3KZW A;  3R9F A;  5LYL A;  3KQZ A;  2CY2 A;  4RUH A;  2I00 A;  3PB4 X;  5C82 A;  4CAF A;  1OZP A;  2JBK A;  3EFA A;  2PJ8 A;  3QAH A;  1KWM A;  1S7L A;  1XFO A;  4PXD A;  4R57 A;  2ZEO A;  4B5P B;  4EWT A;  1VKC A;  4BMH A;  4FD4 A;  3KGQ A;  2OB0 A;  5H86 A;  5HVG A;  3B3W A;  3BJ8 A;  2QML A;  4MHN A;  4NGM A;  5F47 A;  3DR8 A;  3KKW A;  2ANP A;  3IJ3 A;  2FL4 A;  2ZEH A;  4XNH B;  3CT9 A;  4A2Z A;  5JM6 A;  2FE7 A;  2FSR A;  2G9D A;  2PJB A;  3I3G A;  3QAY A;  4PXE A;  1BLL E;  4PXC A;  5HMN A;  2ZPA A;  5JH9 A;  4CRY B;  2J8R A;  1XOV A;  2PJ7 A;  4KVX A;  4HNW B;  4KOW A;  2JDD A;  4MHZ A;  4LUA A;  3S6H A;  2Q4V A;  4JD6 A;  3SJE A;  5D8N A;  1M4L A;  3IU1 A;  5A27 A;  3R96 A;  4EFD A;  2ZW5 A;  4X8I A;  2PSW A;  5HXD A;  1S7K A;  5LRK A;  3PBB A;  2VI7 A;  2XEI A;  4HNX B;  4JXQ A;  4OC5 A;  4PK3 A;  3S9L A;  3RYO A;  2QJ8 A;  4RN7 A;  1RO5 A;  2VBQ A;  4NEX A;  2C6C A;  4MFL A;  4IK2 A;  2FIW A;  2FVG A;  3IWG A;  2ZXV A;  2PIZ A;  4F6A A;  1YME A;  5GCN A;  3PZJ A;  2B4D B;  4Q36 A;  4QBJ A;  3CDX A;  3T8W A;  5K8N A;  4OAD A;  4UFV A;  1KUX A;  2JLM A;  2PRQ A;  2QIR A;  3CXQ A;  4P4J A;  3EY5 A;  4B5O A;  2V77 A;  2PJA A;  2VXK A;  1XMT A;  4BBH A;  3V7Z A;  1M4D A;  3UY5 A;  2Q4Z A;  2GIV A;  3WT4 A;  1I1D A;  4UEF A;  2JBJ A;  4O23 A;  2AFU A;  2RFH A;  4PQA A;  4C68 A;  1B87 A;  4ONU A;  4LX9 A;  1Z8X A;  3I1U A;  4A33 A;  4GS4 A;  4IUS A;  3D68 A;  4Q7A A;  2YNC A;  4FD5 A;  3H5Z A;  5E96 A;  3TO7 A;  3EXN A;  4DUK A;  3WR7 A;  2ZEM A;  4F9V A;  4JJX A;  3SI2 A;  2J9A A;  3SJF A;  3IO1 A;  1M4I A;  1QQ9 A;  4HNY B;  4TWE A;  1IY7 A;  4BD9 A;  3RZA A;  1F2P A;  3W6S A;  3B8G A;  5DWN A;  3FNC A;  4QB9 A;  4W9Y A;  3KHZ A;  2JEW A;  2ZW7 A;  5EC4 A;  5IB9 A;  3GIU A;  2REE A;  3TO9 A;  4II9 A;  4FD7 A;  4AG7 A;  1YW6 A;  3NH5 A;  2ARH A;  4NXY A;  2BEI A;  4R7M A;  1VHO A;  2J8N A;  4KVM E;  1IID A;  2CTB A;  3D7F A;  3H8F A;  1PUA A;  2B58 A;  2R7H A;  1IGB A;  4NSQ A;  4M3S A;  4NJQ A;  2C27 A;  2VZZ A;  1R43 A;  2HC9 A;  3TTH A;  4P4E A;  4KOS A;  1S3Z A;  1YQE A;  1XJO A;  2ABZ A;  2P6E A;  4JXR A;  3ISX A;  3FRM A;  4BIN A;  3MGD A;  3KR5 A;  3FMC A;  3DR6 A;  4MHY A;  4MMO A;  4OLL A;  1FT7 A;  4PXB A;  4MXU A;  4PV6 A;  1S5K A;  3B3S A;  2OZU A;  3IEH A;  4AB7 A;  5G20 A;  3LMS A;  4NFR A;  2Z3N A;  2CF4 A;  1Z4R A;  2REF A;  1M1D A;  2R98 A;  4KZT A;  3WAB A;  2PJ9 A;  3D2M A;  4AVA A;  2Q7S A;  4JWP A;  4RI1 A;  2G0B A;  5ELY A;  4CGO A;  4ZY1 A;  3IWW A;  3NE8 A;  4EVY A;  4NGT A;  3LD2 A;  1A2Z A;  1HDQ A;  4A32 A;  3SI0 A;  1Q2Y A;  2Q44 A;  4UCM A;  1EE3 P;  2BCO A;  1F57 A;  4CGP A;  2I3C A;  2IL4 A;  3DNS A;  1LRZ A;  5G22 A;  2GU2 A;  2XEJ A;  2Z3P A;  5IB0 A;  5AGE A;  3R9G A;  3T9Y A;  1IOI A;  4L89 A;  2PCU A;  4Q38 A;  1HEE A;  2EVN A;  4JZ0 A;  1LAP A;  4OAE A;  5LRG A;  4YGO A;  3E0K A;  2O4H A;  1NMT A;  4NGN A;  1ELL P;  1V0C A;  3VWD A;  1UFH A;  1BOB A;  3JTK A;  4YRH A;  4X2T A;  4MFZ A;  5KTD A;  3WC7 A;  2ZEF A;  3KL9 A;  4NCZ A;  3KQX A;  3TOB A;  2AJ6 A;  3NE7 A;  1Y9W A;  1IOF A;  1Z4E A;  4UF4 A;  5H84 A;  1Q2C A;  1NE9 A;  1YK3 A;  2AFZ A;  3BJ7 A;  2KCW A;  4P6Y A;  1S7F A;  1CX8 A;  1TKF A;  2VZY A;  4MJ8 A;  1WWZ A;  3FYN A;  2B3U A;  3B2Y A;  2YND A;  2GE3 A;  3TOA A;  4FD6 A;  2Q7B A;  4C7I A;  1Y0R A;  4AXV A;  1Z9U A;  2Q4Y A;  4R76 A;  2DEA A;  4KSI A;  2J8M A;  2PJ0 A;  4XPD C;  2JDC A;  3DGV A;  4IHM A;  4ZYQ A;  2O53 A;  4XPK A;  3SHP A;  3NA6 A;  2C6P A;  4B5P A;  2QEC A;  3S9N A;  2DXQ A;  3PBE A;  4FWU A;  4H6Z A;  3D7G A;  3FED A;  2DPT A;  1AMP A;  3GLJ A;  7CPA A;  5F49 A;  4MCQ A;  1ZO0 A;  4MHP A;  1XEB A;  3D8P A;  3ZJ0 A;  4H89 A;  1XBU A;  2IJZ A;  3KAS A;  1YW4 A;  1LFW A;  3BI0 A;  3TX8 A;  2ZEP A;  1TIQ A;  4UFX A;  3L2N A;  5AG5 A;  2NYQ A;  4IF5 A;  4UWI A;  5CNP A;  4P44 A;  3R1K A;  4B10 A;  4MRI A;  2ATR A;  3DLJ A;  3QNV A;  4R3L A;  5CBM A;  2G3A A;  4KSF A;  5JPH A;  1RXT A;  1QSM A;  1XIX A;  2C1C A;  2PVW A;  4IAV A;  1TKH A;  2WYR A;  3FH4 A;  3N7Z A;  3ZZI A;  2Z0Z A;  3B3C A;  1CP6 A;  2VQY A;  4UCN A;  3LWU A;  2BUE A;  2H5M A;  3PB9 X;  1MJA A;  3IWE A;  4H2K A;  5G1Z A;  4LQ6 A;  4RS2 A;  4UBR A;  2GRE A;  4P4D A;  3RNZ A;  1IYL A;  1YLO A;  1Z2L A;  2O28 A;  2BSW A;  3D67 A;  2PJC A;  4OIW A;  4QUS A;  4XPD B;  1J4J A;  1R3N A;  4PSX A;  4ZGY B;  1MJ9 A;  1GHE A;  3MRU A;  4FUU A;  5F48 A;  2ZEE A;  3V38 A;  4MFK A;  4F0X A;  4ZI6 A;  1BO4 A;  1Y7E A;  4G1P A;  2HUZ A;  2POK A;  1BPM A;  2Z3M A;  3D3S A;  4FBE A;  2ZEN A;  3CXS A;  4OID A;  4H6U A;  4KOR A;  4MI4 A;  4CAV A;  2EK8 A;  4J3G A;  5JQ4 A;  2P6F A;  5K8M A;  5K8P A;  3BLN A;  4M85 A;  3B3T A;  2Q0Y A;  1CPX A;  1L0C A;  1ZLI A;  3KR4 A;  4NJR A;  1ON0 A;  3B3V A;  1PYT B;  3NH8 A;  1LCP A;  2Z10 A;  4OKO A;  3QB8 A;  2V8G A;  2FCK A;  1KZF A;  1TXR A;  3KI9 A;  4CYN A;  4ZX9 A; 
#chains in the Genus database with same CATH homology
 4F0Y A;  1IIC A;  1KUV A;  4MBU A;  2B5G A;  4KOU A;  4KS9 A;  1IB1 E;  5HH1 A;  2CXA A;  4X5K A;  3SXN A;  2Y0M A;  1N71 A;  4B14 A;  2G3T A;  2OZG A;  2WPW A;  2DPS A;  4C2X A;  3TFY A;  1CJW A;  3C26 A;  5J8C A;  4A95 A;  4JLY A;  1R57 A;  3F8K A;  4CYO A;  3TCV A;  2CNM A;  3FBU A;  3S6G A;  2PR8 A;  3H4Q A;  4C2Z A;  3F5B A;  3GKR A;  5KTC A;  4KUA A;  2Z3O A;  3OWC A;  3P2H A;  4CGL A;  4KLV A;  4C7H A;  4UA3 A;  3I9S A;  2YNC C;  3S6K A;  4ZBG A;  2B4B A;  2Z11 A;  1K4J A;  3IU2 A;  4A31 A;  2K5T A;  4U9Y A;  3JVN A;  5DWM A;  3G3S A;  1U6M A;  1XE4 A;  1XF8 A;  5EBV A;  5ISV A;  2R1I A;  4KLW A;  4B11 A;  2X7B A;  5AG4 A;  4B13 A;  4QVT A;  1P0H A;  2WSA A;  2Z3L A;  4YFJ A;  1M4G A;  4Y49 B;  1Y7R A;  3S6F A;  1YX0 A;  5G21 A;  2PRB A;  1S7N A;  4MY0 A;  4CAX A;  3FXT A;  4MFJ A;  4KSA A;  5F46 A;  2WPX A;  2B4D A;  4B12 A;  4C2Y A;  4UCP A;  1WK4 A;  2FT0 A;  4K30 A;  1YVO A;  2P6G A;  3PP9 A;  4KUB A;  1QSO A;  4XNH C;  4E0A A;  5C88 A;  1YRE A;  1QST A;  1NSL A;  3GY9 A;  2FIA A;  3T90 A;  4PSW A;  4ORF A;  4I49 A;  4AG9 A;  2OH1 A;  4E8O A;  2B5G B;  4A30 A;  2P0W A;  1FY7 A;  5A28 A;  2R8V A;  3FB3 A;  3JUW A;  3W91 A;  1MK4 A;  4QC6 A;  4U5Y A;  1VHS A;  3F0A A;  4Y49 C;  3DDD A;  1QSR A;  2WUU A;  2F5I A;  1Y9K A;  2GAN A;  4PK2 A;  1S60 A;  3FIX A;  4UFW A;  3TT2 A;  1I12 A;  3DSB A;  2AE6 A;  4R87 A;  1KUY A;  2HV2 A;  4MY3 A;  3SXO A;  4MHD A;  3LOD A;  2BL1 A;  4CGM A;  2B3V A;  3GYA A;  3K9U A;  4R9M A;  2PQ8 A;  2FS5 A;  1SQH A;  2VEZ A;  2YGW A;  2ZW4 A;  3TO6 A;  5AG6 A;  3TE4 A;  2I79 A;  5FVJ A;  2Z3K A;  1P4N A;  1YR0 A;  4KOX A;  5IV0 A;  4L8A A;  2NMT A;  3VWE A;  2FXF A;  3G8W A;  1MJB A;  4NF1 A;  4KOY A;  5AG7 A;  2D4O A;  3CXP A;  4CYP A;  4AVB A;  1M44 A;  4MFP A;  4CS0 B;  5KTA A;  4U9Z A;  4CAW A;  2A4N A;  4AVC A;  3IGR A;  4UWJ A;  4KOV A;  3R9E A;  1Q2D A;  2PDO A;  2Q04 A;  1YLE A;  1YGH A;  5J8F A;  2ZW6 A;  5I0C A;  3D2P A;  4KVO E;  2EUI A;  1B6B A;  4XPL A;  1I21 A;  2PC1 A;  4E2A A;  2OU2 A;  2PR1 A;  3EO4 A;  4HKF A;  2RC4 A;  3V8I A;  2OZH A;  3PGP A;  4CRZ B;  4DNC A;  2JEV A;  2YNE A;  4R3K A;  3A9L A;  4MFQ A;  5BWA B;  3W6X A;  4CGN A;  1PU9 A;  2CNT A;  2HQY A;  1YVK A;  3P2F A;  3R95 A;  2CNS A;  5IX3 A;  4CAE A;  1CM0 A;  4CYQ A;  1QSN A;  2D4P A;  4KOT A;  3EC4 A;  1IYK A;  3R9F A;  2CY2 A;  2I00 A;  5C82 A;  4CAF A;  1OZP A;  3EFA A;  3QAH A;  1S7L A;  4R57 A;  4B5P B;  1VKC A;  4BMH A;  4FD4 A;  2OB0 A;  5H86 A;  3BJ8 A;  2QML A;  5F47 A;  3DR8 A;  3KKW A;  2FL4 A;  4XNH B;  4A2Z A;  2FE7 A;  2FSR A;  3I3G A;  5HMN A;  2ZPA A;  4CRY B;  2J8R A;  4KVX A;  4HNW B;  4KOW A;  2JDD A;  3S6H A;  4LUA A;  2Q4V A;  4JD6 A;  3IU1 A;  5A27 A;  3R96 A;  2ZW5 A;  2PSW A;  1S7K A;  2VI7 A;  4HNX B;  4JXQ A;  4PK3 A;  3RYO A;  1RO5 A;  2VBQ A;  4NEX A;  4MFL A;  2FIW A;  3IWG A;  2ZXV A;  4F6A A;  5GCN A;  3PZJ A;  2B4D B;  4Q36 A;  4QBJ A;  4OAD A;  4UFV A;  1KUX A;  2JLM A;  2QIR A;  3CXQ A;  4B5O A;  3EY5 A;  2VXK A;  1XMT A;  4BBH A;  1M4D A;  3UY5 A;  2GIV A;  1I1D A;  4C68 A;  1B87 A;  4ONU A;  4LX9 A;  4A33 A;  4GS4 A;  4IUS A;  2YNC A;  4FD5 A;  3H5Z A;  5E96 A;  3TO7 A;  3EXN A;  3WR7 A;  4JJX A;  1M4I A;  4HNY B;  3W6S A;  3B8G A;  5DWN A;  3FNC A;  4QB9 A;  2ZW7 A;  5EC4 A;  2REE A;  3TO9 A;  4II9 A;  4FD7 A;  4AG7 A;  2ARH A;  4NXY A;  2BEI A;  2J8N A;  4KVM E;  1IID A;  1PUA A;  2B58 A;  2R7H A;  4NSQ A;  4M3S A;  2C27 A;  2VZZ A;  3TTH A;  4KOS A;  1S3Z A;  2P6E A;  4JXR A;  3FRM A;  3MGD A;  3DR6 A;  4OLL A;  4PV6 A;  1S5K A;  2OZU A;  4AB7 A;  5G20 A;  2Z3N A;  1Z4R A;  2REF A;  1M1D A;  2R98 A;  4KZT A;  3D2M A;  4AVA A;  4JWP A;  4RI1 A;  2G0B A;  4CGO A;  4EVY A;  3LD2 A;  4A32 A;  1Q2Y A;  2Q44 A;  4UCM A;  4CGP A;  2IL4 A;  3DNS A;  1LRZ A;  5G22 A;  2Z3P A;  5IB0 A;  5AGE A;  3R9G A;  3T9Y A;  4L89 A;  4Q38 A;  2EVN A;  4OAE A;  4YGO A;  3E0K A;  1NMT A;  1V0C A;  3VWD A;  1UFH A;  1BOB A;  3JTK A;  4YRH A;  4MFZ A;  5KTD A;  4NCZ A;  3TOB A;  2AJ6 A;  3NE7 A;  1Y9W A;  1Z4E A;  5H84 A;  1YK3 A;  1Q2C A;  1NE9 A;  3BJ7 A;  2KCW A;  1S7F A;  2VZY A;  4MJ8 A;  1WWZ A;  3FYN A;  2B3U A;  2YND A;  2GE3 A;  3TOA A;  4FD6 A;  2Q7B A;  4C7I A;  1Z9U A;  2Q4Y A;  2J8M A;  4XPD C;  2JDC A;  4XPK A;  3SHP A;  4B5P A;  2QEC A;  2DXQ A;  4H6Z A;  2DPT A;  5F49 A;  1ZO0 A;  1XEB A;  3D8P A;  3ZJ0 A;  4H89 A;  1TIQ A;  4UFX A;  5AG5 A;  4IF5 A;  4UWI A;  5CNP A;  4B10 A;  3R1K A;  2ATR A;  4R3L A;  2G3A A;  4KSF A;  5JPH A;  1RXT A;  1QSM A;  1XIX A;  3N7Z A;  3ZZI A;  2Z0Z A;  2VQY A;  4UCN A;  2BUE A;  2H5M A;  1MJA A;  3IWE A;  5G1Z A;  4RS2 A;  4UBR A;  1IYL A;  2O28 A;  2BSW A;  4QUS A;  4XPD B;  1J4J A;  4PSX A;  4ZGY B;  1MJ9 A;  1GHE A;  5F48 A;  4F0X A;  4MFK A;  1BO4 A;  2HUZ A;  2Z3M A;  3D3S A;  3CXS A;  4H6U A;  4KOR A;  4MI4 A;  4CAV A;  4J3G A;  5JQ4 A;  2P6F A;  3BLN A;  4M85 A;  2Q0Y A;  1L0C A;  1ON0 A;  2Z10 A;  3QB8 A;  2FCK A;  1KZF A;  4CYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...