1KUXA

X-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serotonin N-acetyltransferase
publication title X-ray crystallographic studies of serotonin N-acetyltransferase catalysis and inhibition.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1kuxA00
3T9YA 1R57A 1VHSA 4KOXA 4B5PB 4KOSA 2REFA 3CXSA 1XIXA 3CXPA 4HNYB 1B6BA 4R87A 4F0YA 4PSWA 4R3LA 1RO5A 2Q7BA 3DR6A 2P6EA 2BUEA 2PR1A 5DWMA 2DXQA 3S6KA 5F49A 4II9A 1NMTA 1FY7A 2B58A 2AE6A 3FYNA 5I0CA 3FB3A 2VXKA 4XNHB 3I3GA 1S7FA 3F5BA 3F8KA 4CS0B 2Z11A 1NSLA 4AG9A 3TOAA 1CJWA 4UWIA 1KZFA 1KUYA 4QB9A 3P2FA 4H6UA 2B3VA 2OB0A 2PR8A 2HQYA 2PRBA 3CXQA 2GANA 3SXOA 1B87A 1KUXA 2WPXA 5F47A 4PSXA 4QBJA 1P4NA 3N7ZA 4LX9A 4X5KA 3QAHA 4KOYA 4I49A 1BOBA 2ZW4A 2VEZA 2JEVA 1XEBA 4IUSA 4QC6A 3BLNA 2OZUA 3R9FA 2VQYA 2RC4A 4CAWA 4KOUA 1V0CA 1S3ZA 5F48A 2HV2A 4JJXA 3T90A 4J3GA 3PGPA 1BO4A 2H5MA 2D4OA 3D2PA 1YVOA 2Y0MA 4NEXA 2ZXVA 1Q2CA 3H4QA 1XMTA 2I00A 5E96A 2ZW6A 5JQ4A 3E0KA 1QSOA 2D4PA 2J8NA 2B3UA 1U6MA 3DNSA 4NCZA 5ISVA 1OZPA 3PP9A 3R9GA 2B4DA 4L89A 4XPDC 5KTAA 1M44A 5F46A 2WPWA 2REEA 4JLYA 2OU2A 2A4NA 4MJ8A 2BEIA 4PV6A 4E0AA 3W6SA 4BMHA 4MY0A 1Y7RA 1MJ9A 4Y49C 3DR8A 2VZZA 5FVJA 1TIQA 1XE4A 1M1DA 4OADA 3WR7A 1I21A 2Q44A 2FXFA 3GKRA 5C88A 2Q4YA 2ZPAA 4NXYA 4F6AA 4KVXA 2GE3A 2CNTA 1IYLA 4K30A 1QSRA 2OH1A 1S7KA 2GIVA 4XPDB 3IWGA 3FBUA 5C82A 3C26A 1XF8A 3EY5A 3EFAA 2R7HA 4NF1A 2NMTA 4AB7A 2J8RA 2JDCA 1IIDA 3MGDA 1CM0A 2CNSA 4KUAA 1K4JA 2PSWA 2QIRA 4RS2A 3V8IA 3KKWA 4OAEA 2FIAA 4B5PA 4U5YA 3I9SA 4CAXA 1YGHA 2P6GA 4KOWA 1Q2DA 1YX0A 1Z4EA 3D8PA 4KLVA 3PZJA 1ON0A 2PC1A 2Q0YA 4YGOA 2CY2A 2JDDA 1S60A 1I1DA 3B8GA 4U9ZA 3TCVA 3EXNA 2QMLA 4KVOE 2Q04A 5DWNA 3R1KA 3W91A 2AJ6A 4AVBA 4AVAA 2P0WA 1PUAA 4OLLA 4R9MA 4YFJA 4ZBGA 3RYOA 4KUBA 2F5IA 4AG7A 2B5GB 3DSBA 2FL4A 2Z0ZA 3W6XA 3S6HA 5GCNA 5IB0A 4H6ZA 2HUZA 5KTDA 1MJAA 1KUVA 1Y9KA 3TE4A 1IYKA 2C27A 3DDDA 2R98A 3G3SA 4KZTA 1YK3A 4KVME 5CNPA 4M85A 1M4IA 3R9EA 5H84A 1P0HA 3TO7A 2G3TA 2OZGA 4PK2A 1S7NA 3FRMA 1YREA 1PU9A 2ARHA 2G0BA 2ZW7A 1MJBA 3GYAA 4GS4A 5KTCA 2PDOA 3S6FA 2IL4A 1M4GA 4RI1A 4R3KA 4CAVA 1MK4A 4EVYA 1L0CA 1YLEA 2BSWA 3IGRA 3TOBA 4XNHC 4DNCA 5HH1A 2FCKA 4HNXB 3R96A 3D2MA 4XPKA 4JXRA 2B4BA 3BJ7A 4KOTA 5IX3A 1QSMA 4QVTA 2FE7A 5IV0A 5H86A 4JD6A 1IICA 4Y49B 2EUIA 1SQHA 4JWPA 4AVCA 5JPHA 2PQ8A 4IF5A 2I79A 4FD7A 3JUWA 3TFYA 1NE9A 2VZYA 1M4DA 2Q4VA 1YR0A 4CRZB 3ZJ0A 1S5KA 3SXNA 2O28A 2EVNA 2ZW5A 4E2AA 4B5OA 1Q2YA 4ORFA 3D3SA 4UA3A 1Z9UA 1QSNA 2BL1A 2P6FA 2R8VA 3TO6A 1RXTA 4QUSA 2FS5A 2QECA 3K9UA 2JLMA 3BJ8A 5EC4A 3F0AA 1GHEA 4H89A 5HMNA 4PK3A 4YRHA 4CRYB 4FD6A 3P2HA 2K5TA 2J8MA 2FSRA 3R95A 3OWCA 3G8WA 3SHPA 2VBQA 3FNCA 1UFHA 2KCWA 3LD2A 1I12A 2B4DB 4FD4A 4UBRA 5EBVA 2G3AA 4JXQA 4M3SA 4L8AA 3EC4A 4HKFA 1WWZA 4E8OA 1Z4RA 4XPLA 2VI7A 3ZZIA 1S7LA 1Y9WA 2FT0A 4ONUA 3UY5A 3VWEA 2ATRA 1YVKA 1QSTA 4LUAA 3TO9A 3FXTA 4NSQA 4HNWB 4KOVA 4R57A 2CNMA 4KLWA 2X7BA 5J8FA 4MI4A 1N71A 3EO4A 3GY9A 3S6GA 4KORA 3JVNA 3TTHA 3VWDA 3FIXA 4MBUA 4MY3A 4U9YA 1IB1E 3TT2A 2FIWA 3LODA 2OZHA 1J4JA 2R1IA 2Z10A 5J8CA 1VKCA 2B5GA 4MHDA 3NE7A 4UWJA 3QB8A 4FD5A 1LRZA 1WK4A
chains in the Genus database with same CATH superfamily
3T9YA 3D68A 1PYTB 1R57A 3H8GA 4NJQA 1VHSA 4B6ZA 4KOXA 4B5PB 2HC9A 1UWYA 2CIJA 4KOSA 1XOVA 2REFA 2NYQA 1XIXA 3CXSA 3CXPA 3KQXA 4W9YA 5K8MA 4C2ZA 3LACA 1B6BA 4HNYB 4R87A 3IEHA 4MCSA 3QNVA 4F0YA 1CBXA 5LYIA 2WYRA 2Z3OA 4MHYA 5LRGA 4LQGA 4PSWA 4R3LA 1RO5A 2GLFA 2Q7BA 3DR6A 3RO0A 2P6EA 1YW4A 2ZELA 2BUEA 2PR1A 1Z8LA 5DWMA 4DJLA 4P4DA 2DXQA 3WABA 2YNCC 3S6KA 2IMOA 2JEWA 4P44A 5F49A 4X3RA 4II9A 3KI9A 3S9MA 3FJUA 1NMTA 1FY7A 1TXRA 1Z5RA 2B58A 2AE6A 2AFMA 1IU8A 3FYNA 4UCMA 3SJGA 5I0CA 2CXAA 3FB3A 2VXKA 4XNHB 2XEGA 3LMSA 3I3GA 1S7FA 3F5BA 4NGQA 3F8KA 3D67A 4KS9A 4UFWA 3TX8A 5IB9A 4CS0B 2Z11A 2ODFA 2PE3A 2CTCA 4B11A 1NSLA 4JYWA 3KR4A 4AG9A 2G9DA 4OC4A 2AFOA 3TOAA 4C2XA 1CJWA 4UWIA 1KZFA 1KUYA 3CPAA 3P2FA 4H6UA 4QB9A 4ZY2A 2B3VA 2OB0A 2PR8A 3FECA 2HQYA 4A33A 2PRBA 3CXQA 2GANA 3NH5A 3SXOA 1ZG8A 4F8ZA 4ZY0A 2ZEFA 1B87A 4ZGYB 2Q51A 2DPSA 1HDUA 1KUXA 3CT9A 2WPXA 2GLJA 2QJ8A 3GB0A 4TWEA 4MFZA 5F47A 1LFWA 4PSXA 1P4NA 1ZG9A 3N7ZA 4LX9A 4X5KA 4QBJA 3QAHA 1M4LA 3SI2A 1ZLHA 4KOYA 4I49A 1BOBA 4OKOA 2ZW4A 2VEZA 2JEVA 1LCPA 1XEBA 4RUHA 2PJ5A 3B2YA 4IUSA 4M6IA 3VATA 3K9TA 4QC6A 3BLNA 2OZUA 4R76A 2VQYA 3R9FA 2RC4A 4HPSA 3B3WA 4CAWA 4IK2A 4Q38A 4Q7AA 5F09A 4KOUA 3D7GA 1LAPA 1V0CA 1Z8TA 1S3ZA 3SJFA 1F57A 5F48A 2HV2A 4JJXA 4CGOA 1X10A 3T90A 4ONWA 4J3GA 4A2ZA 3PGPA 4NGPA 4ZX9A 3D66A 5G20A 3H5ZA 1BO4A 3WC5A 4UEEA 2H5MA 2D4OA 3B3TA 3FMCA 3GUXA 5G21A 4C7HA 3D2PA 1Z8WA 1YVOA 4EWTA 1EE3P 2Y0MA 4NEXA 2C6GA 2ZXVA 1Q2CA 3H4QA 1XMTA 2I00A 1IOIA 4FWUA 5E96A 3NA6A 2ZW6A 5JGFA 1CPXA 5JQ4A 3GIUA 4ZYQA 3E0KA 1QSOA 4UF4A 4EFDA 2D4PA 4MRIA 1YW6A 4BBHA 2J8NA 1AYEA 2B3UA 4R8FA 1U6MA 4R7MA 3DNSA 3K2KA 4NCZA 4BINA 5LRJA 4IHMA 5ISVA 1OZPA 3PP9A 4P4BA 3R9GA 1Q7LA 2B4DA 3SJEA 4L89A 2HB6A 2C6CA 4XPDC 4CYNA 5KTAA 1M44A 5LYFA 4ZY1A 3DGVA 2NSMA 5F46A 2WPWA 2REEA 4JLYA 2OU2A 2A4NA 2OR4A 4MJ8A 2BEIA 3IC1A 3FVLA 4PV6A 4E0AA 2AFUA 3W6SA 4BMHA 2AFSA 4A39A 1CPSA 4MY0A 2Z3NA 1Y7RA 1ARLA 2V8VA 1MJ9A 4MFJA 4OIWA 3T8WA 4Y49C 3DR8A 2IQ6A 1ELLP 2O53A 2VZZA 3NH4A 5FVJA 1ELMP 1TIQA 2PIYA 2ZOFA 1XE4A 1R43A 1YLOA 3KHZA 5A28A 2ZEGA 1QMUA 1M1DA 1BLLE 3PB7X 4MCQA 4OADA 3WC6A 1ZG7A 3WR7A 1I21A 2Q44A 2FXFA 3B3VA 3CPXA 3FX6A 1ZLIA 4X2TA 5AGEA 3GKRA 4CGNA 4GM5A 5C88A 2Q4YA 2ZPAA 4NXYA 4F6AA 2CTBA 4KVXA 2GE3A 2CNTA 1A2ZA 1IYLA 4K30A 2ZEOA 1QSRA 4PQAA 4PXEA 3MRUA 2OH1A 4CYPA 1F2OA 1S7KA 2V8DA 2GIVA 2Q4ZA 1XMBA 4H2KA 4JZ0A 2PVVA 4OC0A 3IWGA 4XPDB 2Q43A 3FBUA 3C26A 1BAVA 5C82A 1CG2A 2ZEPA 3B3SA 1XF8A 3EY5A 4X8IA 3EFAA 2PJBA 4MCRA 2WSAA 3KL9A 4TNUA 3N5FA 2R7HA 2RB7A 3NE8A 4NF1A 3SI1A 4B10A 3PFOA 4F9VA 1F2PA 2JBJA 2NMTA 4OIDA 4AB7A 2J8RA 4F0XA 2JDCA 2V8HA 4A37A 1IIDA 5CPAA 3MGDA 3PEIA 2ZENA 3RAMA 1CM0A 2CNSA 4KUAA 3D7HA 1K4JA 1Y0RA 2PSWA 2QIRA 4RS2A 3V38A 1AMPA 4M6HA 3V8IA 3KKWA 4P10A 4OAEA 2FIAA 1TKFA 3VH9A 4B5PA 3IO1A 3KQZA 4CGLA 4U5YA 3CZXA 2QVPA 3I9SA 1FNOA 1X12A 5LYDA 4CAXA 1YGHA 2P6GA 4KOWA 4UEZA 3WT4A 5LYLA 1Q2DA 1YX0A 2ZEMA 1Z4EA 1NSAA 3D8PA 3FEDA 3HUVA 4FAIA 1QQ9A 5LRKA 4YWYA 1IOFA 2F7VA 4KLVA 4NFRA 3PZJA 1ON0A 1TKJA 2I3CA 4MXUA 2PC1A 2Q0YA 4YGOA 2CY2A 4CYOA 2JDDA 1S60A 1I1DA 3IU1A 3FH4A 4P4EA 1LAMA 3B8GA 2YNEA 4U9ZA 3TCVA 4UFVA 2PJ9A 4B12A 3EXNA 2QMLA 4KVOE 2Q04A 2QYVA 4UFXA 3R1KA 4NGRA 5DWNA 3W91A 1TF8A 2PJ2A 2AJ6A 2PJ4A 4LQ6A 4AVBA 4AVAA 5THWA 2PVWA 1XFOA 3H8FA 2P0WA 3PB4X 4NGTA 3RZAA 4CAEA 1PUAA 4OLLA 4R9MA 4UIAA 3BXMA 4YFJA 4ZBGA 5G1ZA 3BI0A 3RYOA 1VHEA 4KUBA 2F5IA 4AG7A 1DTDA 2WZNA 4MHNA 4A30A 1KWMA 1CX8A 2AFWA 2B5GB 1VGYA 4MHPA 2WUUA 3DSBA 2FL4A 1CP6A 3B35A 2Z0ZA 3W6XA 3S6HA 2ZEEA 4CGMA 4MHZA 2Z3LA 5GCNA 1FT7A 1YMEA 4B14A 5IB0A 4H6ZA 4DUKA 2HUZA 5KTDA 1MJAA 2BCOA 5I4MA 2OOTA 3ISXA 1KUVA 1Y9KA 7CPAA 3IWEA 3TE4A 1IYKA 2C27A 2YNCA 2C1CA 3DDDA 2R98A 3G3SA 4KZTA 4CAFA 3VARA 1H8LA 2EK9A 4MMOA 4WWVA 5HVHA 4Z65A 1YK3A 4KVME 2DEAA 2Z3PA 4M85A 1M4IA 4OC5A 5CNPA 1TF9A 3R9EA 4ZI6A 1XBUA 3PBEA 5H84A 1P0HA 1Z2LA 2GFQA 3TO7A 3DLJA 3KASA 2G3TA 3SI0A 3RNZA 2PJ8A 3S9NA 2OZGA 4PK2A 1S7NA 1GYTA 3FRMA 1YREA 1PU9A 2AFZA 2ARHA 2G0BA 1MJBA 2ZW7A 3GYAA 4GS4A 2PDOA 5KTCA 3S6FA 4O23A 2CF4A 5AG7A 2IL4A 3NH8A 3BHXA 1M4GA 4RI1A 3A9LA 4A95A 1Y7EA 4R3KA 4CAVA 1MK4A 4FUUA 4MFPA 4EVYA 1L0CA 4P6YA 1YLEA 2BSWA 2Z3KA 3IGRA 3BI1A 3TOBA 2EO8A 4XNHC 4DNCA 2JBKA 5HH1A 3KZWA 2FCKA 4HNXB 4PXBA 4K3NA 1BPMA 3R96A 3V7ZA 4KSAA 8CPAA 2YGWA 3D2MA 4XPKA 4JXRA 3PB6X 2B4BA 3BJ7A 5G22A 3PBBA 3H8EA 4KOTA 2BOAA 4DYOA 5IX3A 2EWBA 1QSMA 4QVTA 2FE7A 2C6PA 5HVGA 2Z3MA 5IV0A 5H86A 2PJAA 4MFQA 3JTKA 3PFEA 1DE4C 3FF3A 1VIXA 1IGBA 2F8HA 3PB8X 4NGMA 4CYQA 4JD6A 1AUGA 1IICA 4Y49B 5JH9A 2EUIA 1SQHA 3JRUA 2EBJA 4JWPA 4MFKA 4UCPA 4YU9A 4AVCA 5JPHA 4A38A 3LWUA 2PQ8A 4PXCA 4P4IA 5ELYA 4IF5A 1R3NA 2I79A 2J9AA 1VHOA 3JUWA 4FD7A 3TFYA 1NE9A 2VZYA 1M4DA 2Q4VA 1YR0A 2XEJA 4CRZB 4R6TA 1S5KA 4MFLA 3SXNA 3ZJ0A 1Z8XA 2O28A 4P4FA 2EVNA 2O4HA 2ANPA 4NGNA 2Q7SA 2ZW5A 3D7FA 5J1QA 5DS0A 1ZO0A 2PJ1A 2PJ3A 4E2AA 4B5OA 1Q2YA 2XEFA 5K8PA 3CDXA 5HVFA 3PRTA 4ORFA 4P4JA 3D3SA 3B3CA 4UA3A 2BO9A 1Z9UA 4PPZA 4OC1A 1QSNA 2BL1A 2EK8A 2P6FA 2R8VA 3KGQA 1RXTA 4QUSA 2FS5A 3TO6A 2QECA 3K9UA 2JLMA 4NGSA 3BJ8A 4A32A 4A31A 1RTQA 3FEEA 5EC4A 3F0AA 4EMEA 4BD9A 1XRYA 3QAYA 3S9LA 1GHEA 4H89A 2XEIA 5HMNA 4PK3A 2GREA 4PXDA 1JQGA 4YRHA 4FD6A 4CRYB 3P2HA 3B7IA 5K8NA 2K5TA 2J8MA 2FSRA 4Q36A 3R95A 3OWCA 3G8WA 2GU2A 5D8NA 3SHPA 4A94A 3I1UA 2VBQA 4RN7A 3FNCA 4OP4A 2V77A 3ISZA 5K8OA 4UIBA 2FVGA 1UFHA 1YQEA 2DF5A 2KCWA 2PJ7A 3IIBA 3LD2A 1I12A 2PJCA 2B4DB 3GLJA 4FD4A 4OMEA 4FBEA 2PCUA 4UBRA 5EBVA 1OBRA 2YNDA 3PB9X 4WJBA 1BPNA 3WC7A 2PIZA 3KHXA 2G3AA 4C7IA 5EMIA 4MCPA 4JXQA 4M3SA 2IJZA 4L8AA 5A27A 2ZEHA 2ZEDA 4CPAA 3EC4A 1WWZA 4HKFA 1PCAA 2PJ0A 4E8OA 1Z4RA 4XPLA 1Y0YA 4NJRA 2PRQA 2VI7A 3TC8A 4M6GA 4OC3A 2POKA 1S7LA 3RBUA 3IJ3A 3ZZIA 1Y9WA 2FT0A 3SJXA 4ONUA 2ZOGA 4GXHA 3UY5A 3VWEA 2ATRA 4P45A 4ZX8A 1YVKA 1HEEA 4UEFA 1QSTA 4LUAA 3NFZA 3TO9A 5D29A 3FXTA 4NSQA 4HNWB 4KOVA 6CPAA 1IY7A 4R57A 4OC2A 3KR5A 2CNMA 2PJ6A 3D4UA 4KLWA 1HDQA 2X7BA 5J8FA 5AG5A 4MI4A 4F9UA 5HXDA 5JM6A 2RFHA 1N71A 2AFXA 3EO4A 2ABZA 5AG6A 5BWAB 3GY9A 3S6GA 4C2YA 4KSIA 3IFEA 2DPTA 1TKHA 3IWWA 3D7DA 3JVNA 4KORA 3TTHA 4AXVA 1ARMA 5CBMA 3VWDA 3FIXA 1JWQA 4G1PA 4MBUA 4MY3A 4U9YA 1IB1E 1CP7A 3TT2A 2FIWA 3LODA 2OZHA 2VL1A 5AG4A 4B13A 1J4JA 3HLPA 2R1IA 2Z10A 2V8GA 4CGPA 4C68A 5J8CA 1LANA 1VKCA 1XJOA 2B5GA 3IU2A 1LOKA 4MHDA 3NE7A 4IAVA 4UWJA 4KSFA 3L2NA 3QB8A 3MN8A 4FD5A 4UCNA 1LRZA 1WK4A 1YSJA
chains in the Genus database with same CATH topology
3T9YA 1R57A 1VHSA 4KOXA 4B5PB 4KOSA 2REFA 3CXSA 1XIXA 3CXPA 4C2ZA 4HNYB 1B6BA 4R87A 4F0YA 2Z3OA 4PSWA 4R3LA 1RO5A 2Q7BA 3DR6A 2P6EA 2BUEA 2PR1A 5DWMA 2DXQA 2YNCC 3S6KA 5F49A 4II9A 1NMTA 1FY7A 2B58A 4UCMA 2AE6A 3FYNA 5I0CA 2CXAA 3FB3A 2VXKA 4XNHB 3I3GA 1S7FA 3F5BA 4UFWA 3F8KA 4KS9A 4CS0B 2Z11A 4B11A 1NSLA 4AG9A 3TOAA 4C2XA 1CJWA 4UWIA 1KZFA 1KUYA 4QB9A 3P2FA 4H6UA 2B3VA 2OB0A 2PR8A 2HQYA 4A33A 2PRBA 3CXQA 2GANA 3SXOA 1B87A 4ZGYB 2DPSA 1KUXA 2WPXA 4MFZA 5F47A 4PSXA 4QBJA 1P4NA 3N7ZA 4LX9A 4X5KA 3QAHA 4KOYA 4I49A 1BOBA 2ZW4A 2VEZA 2JEVA 1XEBA 4IUSA 4QC6A 3BLNA 2OZUA 3R9FA 2VQYA 2RC4A 4CAWA 4Q38A 4KOUA 1V0CA 1S3ZA 5F48A 2HV2A 4JJXA 4CGOA 3T90A 4J3GA 4A2ZA 3PGPA 5G20A 3H5ZA 1BO4A 2H5MA 2D4OA 5G21A 4C7HA 3D2PA 1YVOA 2Y0MA 4NEXA 2ZXVA 1Q2CA 3H4QA 1XMTA 2I00A 5E96A 2ZW6A 5JQ4A 3E0KA 1QSOA 2D4PA 4BBHA 2J8NA 2B3UA 1U6MA 3DNSA 4NCZA 5ISVA 1OZPA 3PP9A 3R9GA 2B4DA 4L89A 4XPDC 4CYNA 5KTAA 1M44A 5F46A 2WPWA 2REEA 4JLYA 2OU2A 2A4NA 4MJ8A 2BEIA 4PV6A 4E0AA 3W6SA 4BMHA 4MY0A 2Z3NA 1Y7RA 4MFJA 1MJ9A 4Y49C 3DR8A 2VZZA 5FVJA 1TIQA 1XE4A 5A28A 1M1DA 4OADA 3WR7A 1I21A 2Q44A 2FXFA 4CGNA 5AGEA 3GKRA 5C88A 2Q4YA 2ZPAA 4NXYA 4F6AA 4KVXA 2GE3A 2CNTA 1IYLA 4K30A 1QSRA 2OH1A 4CYPA 1S7KA 2GIVA 4XPDB 3IWGA 3FBUA 5C82A 3C26A 1XF8A 3EY5A 3EFAA 2WSAA 2R7HA 4NF1A 4B10A 2NMTA 4AB7A 4F0XA 2J8RA 2JDCA 1IIDA 3MGDA 1CM0A 2CNSA 4KUAA 1K4JA 2PSWA 2QIRA 4RS2A 3V8IA 3KKWA 4OAEA 2FIAA 4B5PA 4CGLA 4U5YA 3I9SA 4CAXA 1YGHA 2P6GA 4KOWA 1Q2DA 1YX0A 1Z4EA 3D8PA 4KLVA 3PZJA 1ON0A 2PC1A 2Q0YA 4YGOA 2CY2A 4CYOA 2JDDA 1S60A 1I1DA 3IU1A 3B8GA 2YNEA 4U9ZA 3TCVA 4UFVA 4B12A 3EXNA 2QMLA 4KVOE 2Q04A 4UFXA 5DWNA 3R1KA 3W91A 2AJ6A 4AVBA 4AVAA 2P0WA 4CAEA 1PUAA 4OLLA 4R9MA 4YFJA 4ZBGA 5G1ZA 3RYOA 4KUBA 2F5IA 4AG7A 4A30A 2B5GB 2WUUA 3DSBA 2FL4A 2Z0ZA 3W6XA 3S6HA 4CGMA 2Z3LA 5GCNA 4B14A 5IB0A 4H6ZA 2HUZA 5KTDA 1MJAA 1KUVA 1Y9KA 3IWEA 3TE4A 1IYKA 2C27A 2YNCA 3DDDA 2R98A 3G3SA 4KZTA 4CAFA 1YK3A 4KVME 2Z3PA 5CNPA 4M85A 1M4IA 3R9EA 5H84A 1P0HA 3TO7A 2G3TA 2OZGA 4PK2A 1S7NA 3FRMA 1YREA 1PU9A 2ARHA 2G0BA 2ZW7A 1MJBA 3GYAA 4GS4A 5KTCA 2PDOA 3S6FA 5AG7A 2IL4A 1M4GA 4RI1A 3A9LA 4A95A 4R3KA 4CAVA 1MK4A 4MFPA 4EVYA 1L0CA 1YLEA 2BSWA 2Z3KA 3IGRA 3TOBA 4XNHC 4DNCA 5HH1A 2FCKA 4HNXB 3R96A 4KSAA 2YGWA 3D2MA 4XPKA 4JXRA 2B4BA 3BJ7A 5G22A 4KOTA 5IX3A 1QSMA 4QVTA 2FE7A 2Z3MA 5IV0A 5H86A 4MFQA 3JTKA 4CYQA 4JD6A 1IICA 4Y49B 2EUIA 1SQHA 4JWPA 4MFKA 4UCPA 4AVCA 5JPHA 2PQ8A 4IF5A 2I79A 4FD7A 3JUWA 3TFYA 1NE9A 2VZYA 1M4DA 2Q4VA 1YR0A 4CRZB 3ZJ0A 1S5KA 4MFLA 3SXNA 2O28A 2EVNA 2ZW5A 1ZO0A 4E2AA 4B5OA 1Q2YA 4ORFA 3D3SA 4UA3A 1Z9UA 1QSNA 2BL1A 2P6FA 2R8VA 3TO6A 1RXTA 4QUSA 2FS5A 2QECA 3K9UA 2JLMA 4A32A 3BJ8A 4A31A 5EC4A 3F0AA 1GHEA 4H89A 5HMNA 4PK3A 4YRHA 4CRYB 4FD6A 3P2HA 2K5TA 2J8MA 2FSRA 4Q36A 3R95A 3OWCA 3G8WA 3SHPA 2VBQA 3FNCA 1UFHA 2KCWA 3LD2A 1I12A 2B4DB 4FD4A 4UBRA 5EBVA 2YNDA 2G3AA 4C7IA 4JXQA 4M3SA 4L8AA 5A27A 3EC4A 4HKFA 1WWZA 4E8OA 1Z4RA 4XPLA 2VI7A 3ZZIA 1S7LA 1Y9WA 2FT0A 4ONUA 3UY5A 3VWEA 2ATRA 1YVKA 1QSTA 4LUAA 3TO9A 3FXTA 4NSQA 4HNWB 4KOVA 4R57A 2CNMA 4KLWA 2X7BA 5J8FA 5AG5A 4MI4A 1N71A 3EO4A 5AG6A 5BWAB 3GY9A 3S6GA 4C2YA 2DPTA 4KORA 3JVNA 3TTHA 3VWDA 3FIXA 4MBUA 4MY3A 4U9YA 1IB1E 3TT2A 2FIWA 3LODA 2OZHA 5AG4A 4B13A 1J4JA 2R1IA 2Z10A 4CGPA 4C68A 5J8CA 1VKCA 2B5GA 3IU2A 4MHDA 3NE7A 4UWJA 4KSFA 3QB8A 4FD5A 4UCNA 1LRZA 1WK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9Y A;  1R57 A;  1VHS A;  4KOX A;  4B5P B;  4KOS A;  2REF A;  3CXS A;  1XIX A;  3CXP A;  4HNY B;  1B6B A;  4R87 A;  4F0Y A;  4PSW A;  4R3L A;  1RO5 A;  2Q7B A;  3DR6 A;  2P6E A;  2BUE A;  2PR1 A;  5DWM A;  2DXQ A;  3S6K A;  5F49 A;  4II9 A;  1NMT A;  1FY7 A;  2B58 A;  2AE6 A;  3FYN A;  5I0C A;  3FB3 A;  2VXK A;  4XNH B;  3I3G A;  1S7F A;  3F5B A;  3F8K A;  4CS0 B;  2Z11 A;  1NSL A;  4AG9 A;  3TOA A;  1CJW A;  4UWI A;  1KZF A;  1KUY A;  4QB9 A;  3P2F A;  4H6U A;  2B3V A;  2OB0 A;  2PR8 A;  2HQY A;  2PRB A;  3CXQ A;  2GAN A;  3SXO A;  1B87 A;  1KUX A;  2WPX A;  5F47 A;  4PSX A;  4QBJ A;  1P4N A;  3N7Z A;  4LX9 A;  4X5K A;  3QAH A;  4KOY A;  4I49 A;  1BOB A;  2ZW4 A;  2VEZ A;  2JEV A;  1XEB A;  4IUS A;  4QC6 A;  3BLN A;  2OZU A;  3R9F A;  2VQY A;  2RC4 A;  4CAW A;  4KOU A;  1V0C A;  1S3Z A;  5F48 A;  2HV2 A;  4JJX A;  3T90 A;  4J3G A;  3PGP A;  1BO4 A;  2H5M A;  2D4O A;  3D2P A;  1YVO A;  2Y0M A;  4NEX A;  2ZXV A;  1Q2C A;  3H4Q A;  1XMT A;  2I00 A;  5E96 A;  2ZW6 A;  5JQ4 A;  3E0K A;  1QSO A;  2D4P A;  2J8N A;  2B3U A;  1U6M A;  3DNS A;  4NCZ A;  5ISV A;  1OZP A;  3PP9 A;  3R9G A;  2B4D A;  4L89 A;  4XPD C;  5KTA A;  1M44 A;  5F46 A;  2WPW A;  2REE A;  4JLY A;  2OU2 A;  2A4N A;  4MJ8 A;  2BEI A;  4PV6 A;  4E0A A;  3W6S A;  4BMH A;  4MY0 A;  1Y7R A;  1MJ9 A;  4Y49 C;  3DR8 A;  2VZZ A;  5FVJ A;  1TIQ A;  1XE4 A;  1M1D A;  4OAD A;  3WR7 A;  1I21 A;  2Q44 A;  2FXF A;  3GKR A;  5C88 A;  2Q4Y A;  2ZPA A;  4NXY A;  4F6A A;  4KVX A;  2GE3 A;  2CNT A;  1IYL A;  4K30 A;  1QSR A;  2OH1 A;  1S7K A;  2GIV A;  4XPD B;  3IWG A;  3FBU A;  5C82 A;  3C26 A;  1XF8 A;  3EY5 A;  3EFA A;  2R7H A;  4NF1 A;  2NMT A;  4AB7 A;  2J8R A;  2JDC A;  1IID A;  3MGD A;  1CM0 A;  2CNS A;  4KUA A;  1K4J A;  2PSW A;  2QIR A;  4RS2 A;  3V8I A;  3KKW A;  4OAE A;  2FIA A;  4B5P A;  4U5Y A;  3I9S A;  4CAX A;  1YGH A;  2P6G A;  4KOW A;  1Q2D A;  1YX0 A;  1Z4E A;  3D8P A;  4KLV A;  3PZJ A;  1ON0 A;  2PC1 A;  2Q0Y A;  4YGO A;  2CY2 A;  2JDD A;  1S60 A;  1I1D A;  3B8G A;  4U9Z A;  3TCV A;  3EXN A;  2QML A;  4KVO E;  2Q04 A;  5DWN A;  3R1K A;  3W91 A;  2AJ6 A;  4AVB A;  4AVA A;  2P0W A;  1PUA A;  4OLL A;  4R9M A;  4YFJ A;  4ZBG A;  3RYO A;  4KUB A;  2F5I A;  4AG7 A;  2B5G B;  3DSB A;  2FL4 A;  2Z0Z A;  3W6X A;  3S6H A;  5GCN A;  5IB0 A;  4H6Z A;  2HUZ A;  5KTD A;  1MJA A;  1KUV A;  1Y9K A;  3TE4 A;  1IYK A;  2C27 A;  3DDD A;  2R98 A;  3G3S A;  4KZT A;  1YK3 A;  4KVM E;  5CNP A;  4M85 A;  1M4I A;  3R9E A;  5H84 A;  1P0H A;  3TO7 A;  2G3T A;  2OZG A;  4PK2 A;  1S7N A;  3FRM A;  1YRE A;  1PU9 A;  2ARH A;  2G0B A;  2ZW7 A;  1MJB A;  3GYA A;  4GS4 A;  5KTC A;  2PDO A;  3S6F A;  2IL4 A;  1M4G A;  4RI1 A;  4R3K A;  4CAV A;  1MK4 A;  4EVY A;  1L0C A;  1YLE A;  2BSW A;  3IGR A;  3TOB A;  4XNH C;  4DNC A;  5HH1 A;  2FCK A;  4HNX B;  3R96 A;  3D2M A;  4XPK A;  4JXR A;  2B4B A;  3BJ7 A;  4KOT A;  5IX3 A;  1QSM A;  4QVT A;  2FE7 A;  5IV0 A;  5H86 A;  4JD6 A;  1IIC A;  4Y49 B;  2EUI A;  1SQH A;  4JWP A;  4AVC A;  5JPH A;  2PQ8 A;  4IF5 A;  2I79 A;  4FD7 A;  3JUW A;  3TFY A;  1NE9 A;  2VZY A;  1M4D A;  2Q4V A;  1YR0 A;  4CRZ B;  3ZJ0 A;  1S5K A;  3SXN A;  2O28 A;  2EVN A;  2ZW5 A;  4E2A A;  4B5O A;  1Q2Y A;  4ORF A;  3D3S A;  4UA3 A;  1Z9U A;  1QSN A;  2BL1 A;  2P6F A;  2R8V A;  3TO6 A;  1RXT A;  4QUS A;  2FS5 A;  2QEC A;  3K9U A;  2JLM A;  3BJ8 A;  5EC4 A;  3F0A A;  1GHE A;  4H89 A;  5HMN A;  4PK3 A;  4YRH A;  4CRY B;  4FD6 A;  3P2H A;  2K5T A;  2J8M A;  2FSR A;  3R95 A;  3OWC A;  3G8W A;  3SHP A;  2VBQ A;  3FNC A;  1UFH A;  2KCW A;  3LD2 A;  1I12 A;  2B4D B;  4FD4 A;  4UBR A;  5EBV A;  2G3A A;  4JXQ A;  4M3S A;  4L8A A;  3EC4 A;  4HKF A;  1WWZ A;  4E8O A;  1Z4R A;  4XPL A;  2VI7 A;  3ZZI A;  1S7L A;  1Y9W A;  2FT0 A;  4ONU A;  3UY5 A;  3VWE A;  2ATR A;  1YVK A;  1QST A;  4LUA A;  3TO9 A;  3FXT A;  4NSQ A;  4HNW B;  4KOV A;  4R57 A;  2CNM A;  4KLW A;  2X7B A;  5J8F A;  4MI4 A;  1N71 A;  3EO4 A;  3GY9 A;  3S6G A;  4KOR A;  3JVN A;  3TTH A;  3VWD A;  3FIX A;  4MBU A;  4MY3 A;  4U9Y A;  1IB1 E;  3TT2 A;  2FIW A;  3LOD A;  2OZH A;  1J4J A;  2R1I A;  2Z10 A;  5J8C A;  1VKC A;  2B5G A;  4MHD A;  3NE7 A;  4UWJ A;  3QB8 A;  4FD5 A;  1LRZ A;  1WK4 A; 
#chains in the Genus database with same CATH topology
 3T9Y A;  3D68 A;  1PYT B;  1R57 A;  3H8G A;  4NJQ A;  1VHS A;  4B6Z A;  4KOX A;  4B5P B;  2HC9 A;  1UWY A;  2CIJ A;  4KOS A;  1XOV A;  2REF A;  2NYQ A;  1XIX A;  3CXS A;  3CXP A;  3KQX A;  4W9Y A;  5K8M A;  4C2Z A;  3LAC A;  1B6B A;  4HNY B;  4R87 A;  3IEH A;  4MCS A;  3QNV A;  4F0Y A;  1CBX A;  5LYI A;  2WYR A;  2Z3O A;  4MHY A;  5LRG A;  4LQG A;  4PSW A;  4R3L A;  1RO5 A;  2GLF A;  2Q7B A;  3DR6 A;  3RO0 A;  2P6E A;  1YW4 A;  2ZEL A;  2BUE A;  2PR1 A;  1Z8L A;  5DWM A;  4DJL A;  4P4D A;  2DXQ A;  3WAB A;  2YNC C;  3S6K A;  2IMO A;  2JEW A;  4P44 A;  5F49 A;  4X3R A;  4II9 A;  3KI9 A;  3S9M A;  3FJU A;  1NMT A;  1FY7 A;  1TXR A;  1Z5R A;  2B58 A;  2AE6 A;  2AFM A;  1IU8 A;  3FYN A;  4UCM A;  3SJG A;  5I0C A;  2CXA A;  3FB3 A;  2VXK A;  4XNH B;  2XEG A;  3LMS A;  3I3G A;  1S7F A;  3F5B A;  4NGQ A;  3F8K A;  3D67 A;  4KS9 A;  4UFW A;  3TX8 A;  5IB9 A;  4CS0 B;  2Z11 A;  2ODF A;  2PE3 A;  2CTC A;  4B11 A;  1NSL A;  4JYW A;  3KR4 A;  4AG9 A;  2G9D A;  4OC4 A;  2AFO A;  3TOA A;  4C2X A;  1CJW A;  4UWI A;  1KZF A;  1KUY A;  3CPA A;  3P2F A;  4H6U A;  4QB9 A;  4ZY2 A;  2B3V A;  2OB0 A;  2PR8 A;  3FEC A;  2HQY A;  4A33 A;  2PRB A;  3CXQ A;  2GAN A;  3NH5 A;  3SXO A;  1ZG8 A;  4F8Z A;  4ZY0 A;  2ZEF A;  1B87 A;  4ZGY B;  2Q51 A;  2DPS A;  1HDU A;  1KUX A;  3CT9 A;  2WPX A;  2GLJ A;  2QJ8 A;  3GB0 A;  4TWE A;  4MFZ A;  5F47 A;  1LFW A;  4PSX A;  1P4N A;  1ZG9 A;  3N7Z A;  4LX9 A;  4X5K A;  4QBJ A;  3QAH A;  1M4L A;  3SI2 A;  1ZLH A;  4KOY A;  4I49 A;  1BOB A;  4OKO A;  2ZW4 A;  2VEZ A;  2JEV A;  1LCP A;  1XEB A;  4RUH A;  2PJ5 A;  3B2Y A;  4IUS A;  4M6I A;  3VAT A;  3K9T A;  4QC6 A;  3BLN A;  2OZU A;  4R76 A;  2VQY A;  3R9F A;  2RC4 A;  4HPS A;  3B3W A;  4CAW A;  4IK2 A;  4Q38 A;  4Q7A A;  5F09 A;  4KOU A;  3D7G A;  1LAP A;  1V0C A;  1Z8T A;  1S3Z A;  3SJF A;  1F57 A;  5F48 A;  2HV2 A;  4JJX A;  4CGO A;  1X10 A;  3T90 A;  4ONW A;  4J3G A;  4A2Z A;  3PGP A;  4NGP A;  4ZX9 A;  3D66 A;  5G20 A;  3H5Z A;  1BO4 A;  3WC5 A;  4UEE A;  2H5M A;  2D4O A;  3B3T A;  3FMC A;  3GUX A;  5G21 A;  4C7H A;  3D2P A;  1Z8W A;  1YVO A;  4EWT A;  1EE3 P;  2Y0M A;  4NEX A;  2C6G A;  2ZXV A;  1Q2C A;  3H4Q A;  1XMT A;  2I00 A;  1IOI A;  4FWU A;  5E96 A;  3NA6 A;  2ZW6 A;  5JGF A;  1CPX A;  5JQ4 A;  3GIU A;  4ZYQ A;  3E0K A;  1QSO A;  4UF4 A;  4EFD A;  2D4P A;  4MRI A;  1YW6 A;  4BBH A;  2J8N A;  1AYE A;  2B3U A;  4R8F A;  1U6M A;  4R7M A;  3DNS A;  3K2K A;  4NCZ A;  4BIN A;  5LRJ A;  4IHM A;  5ISV A;  1OZP A;  3PP9 A;  4P4B A;  3R9G A;  1Q7L A;  2B4D A;  3SJE A;  4L89 A;  2HB6 A;  2C6C A;  4XPD C;  4CYN A;  5KTA A;  1M44 A;  5LYF A;  4ZY1 A;  3DGV A;  2NSM A;  5F46 A;  2WPW A;  2REE A;  4JLY A;  2OU2 A;  2A4N A;  2OR4 A;  4MJ8 A;  2BEI A;  3IC1 A;  3FVL A;  4PV6 A;  4E0A A;  2AFU A;  3W6S A;  4BMH A;  2AFS A;  4A39 A;  1CPS A;  4MY0 A;  2Z3N A;  1Y7R A;  1ARL A;  2V8V A;  1MJ9 A;  4MFJ A;  4OIW A;  3T8W A;  4Y49 C;  3DR8 A;  2IQ6 A;  1ELL P;  2O53 A;  2VZZ A;  3NH4 A;  5FVJ A;  1ELM P;  1TIQ A;  2PIY A;  2ZOF A;  1XE4 A;  1R43 A;  1YLO A;  3KHZ A;  5A28 A;  2ZEG A;  1QMU A;  1M1D A;  1BLL E;  3PB7 X;  4MCQ A;  4OAD A;  3WC6 A;  1ZG7 A;  3WR7 A;  1I21 A;  2Q44 A;  2FXF A;  3B3V A;  3CPX A;  3FX6 A;  1ZLI A;  4X2T A;  5AGE A;  3GKR A;  4CGN A;  4GM5 A;  5C88 A;  2Q4Y A;  2ZPA A;  4NXY A;  4F6A A;  2CTB A;  4KVX A;  2GE3 A;  2CNT A;  1A2Z A;  1IYL A;  4K30 A;  2ZEO A;  1QSR A;  4PQA A;  4PXE A;  3MRU A;  2OH1 A;  4CYP A;  1F2O A;  1S7K A;  2V8D A;  2GIV A;  2Q4Z A;  1XMB A;  4H2K A;  4JZ0 A;  2PVV A;  4OC0 A;  3IWG A;  4XPD B;  2Q43 A;  3FBU A;  3C26 A;  1BAV A;  5C82 A;  1CG2 A;  2ZEP A;  3B3S A;  1XF8 A;  3EY5 A;  4X8I A;  3EFA A;  2PJB A;  4MCR A;  2WSA A;  3KL9 A;  4TNU A;  3N5F A;  2R7H A;  2RB7 A;  3NE8 A;  4NF1 A;  3SI1 A;  4B10 A;  3PFO A;  4F9V A;  1F2P A;  2JBJ A;  2NMT A;  4OID A;  4AB7 A;  2J8R A;  4F0X A;  2JDC A;  2V8H A;  4A37 A;  1IID A;  5CPA A;  3MGD A;  3PEI A;  2ZEN A;  3RAM A;  1CM0 A;  2CNS A;  4KUA A;  3D7H A;  1K4J A;  1Y0R A;  2PSW A;  2QIR A;  4RS2 A;  3V38 A;  1AMP A;  4M6H A;  3V8I A;  3KKW A;  4P10 A;  4OAE A;  2FIA A;  1TKF A;  3VH9 A;  4B5P A;  3IO1 A;  3KQZ A;  4CGL A;  4U5Y A;  3CZX A;  2QVP A;  3I9S A;  1FNO A;  1X12 A;  5LYD A;  4CAX A;  1YGH A;  2P6G A;  4KOW A;  4UEZ A;  3WT4 A;  5LYL A;  1Q2D A;  1YX0 A;  2ZEM A;  1Z4E A;  1NSA A;  3D8P A;  3FED A;  3HUV A;  4FAI A;  1QQ9 A;  5LRK A;  4YWY A;  1IOF A;  2F7V A;  4KLV A;  4NFR A;  3PZJ A;  1ON0 A;  1TKJ A;  2I3C A;  4MXU A;  2PC1 A;  2Q0Y A;  4YGO A;  2CY2 A;  4CYO A;  2JDD A;  1S60 A;  1I1D A;  3IU1 A;  3FH4 A;  4P4E A;  1LAM A;  3B8G A;  2YNE A;  4U9Z A;  3TCV A;  4UFV A;  2PJ9 A;  4B12 A;  3EXN A;  2QML A;  4KVO E;  2Q04 A;  2QYV A;  4UFX A;  3R1K A;  4NGR A;  5DWN A;  3W91 A;  1TF8 A;  2PJ2 A;  2AJ6 A;  2PJ4 A;  4LQ6 A;  4AVB A;  4AVA A;  5THW A;  2PVW A;  1XFO A;  3H8F A;  2P0W A;  3PB4 X;  4NGT A;  3RZA A;  4CAE A;  1PUA A;  4OLL A;  4R9M A;  4UIA A;  3BXM A;  4YFJ A;  4ZBG A;  5G1Z A;  3BI0 A;  3RYO A;  1VHE A;  4KUB A;  2F5I A;  4AG7 A;  1DTD A;  2WZN A;  4MHN A;  4A30 A;  1KWM A;  1CX8 A;  2AFW A;  2B5G B;  1VGY A;  4MHP A;  2WUU A;  3DSB A;  2FL4 A;  1CP6 A;  3B35 A;  2Z0Z A;  3W6X A;  3S6H A;  2ZEE A;  4CGM A;  4MHZ A;  2Z3L A;  5GCN A;  1FT7 A;  1YME A;  4B14 A;  5IB0 A;  4H6Z A;  4DUK A;  2HUZ A;  5KTD A;  1MJA A;  2BCO A;  5I4M A;  2OOT A;  3ISX A;  1KUV A;  1Y9K A;  7CPA A;  3IWE A;  3TE4 A;  1IYK A;  2C27 A;  2YNC A;  2C1C A;  3DDD A;  2R98 A;  3G3S A;  4KZT A;  4CAF A;  3VAR A;  1H8L A;  2EK9 A;  4MMO A;  4WWV A;  5HVH A;  4Z65 A;  1YK3 A;  4KVM E;  2DEA A;  2Z3P A;  4M85 A;  1M4I A;  4OC5 A;  5CNP A;  1TF9 A;  3R9E A;  4ZI6 A;  1XBU A;  3PBE A;  5H84 A;  1P0H A;  1Z2L A;  2GFQ A;  3TO7 A;  3DLJ A;  3KAS A;  2G3T A;  3SI0 A;  3RNZ A;  2PJ8 A;  3S9N A;  2OZG A;  4PK2 A;  1S7N A;  1GYT A;  3FRM A;  1YRE A;  1PU9 A;  2AFZ A;  2ARH A;  2G0B A;  1MJB A;  2ZW7 A;  3GYA A;  4GS4 A;  2PDO A;  5KTC A;  3S6F A;  4O23 A;  2CF4 A;  5AG7 A;  2IL4 A;  3NH8 A;  3BHX A;  1M4G A;  4RI1 A;  3A9L A;  4A95 A;  1Y7E A;  4R3K A;  4CAV A;  1MK4 A;  4FUU A;  4MFP A;  4EVY A;  1L0C A;  4P6Y A;  1YLE A;  2BSW A;  2Z3K A;  3IGR A;  3BI1 A;  3TOB A;  2EO8 A;  4XNH C;  4DNC A;  2JBK A;  5HH1 A;  3KZW A;  2FCK A;  4HNX B;  4PXB A;  4K3N A;  1BPM A;  3R96 A;  3V7Z A;  4KSA A;  8CPA A;  2YGW A;  3D2M A;  4XPK A;  4JXR A;  3PB6 X;  2B4B A;  3BJ7 A;  5G22 A;  3PBB A;  3H8E A;  4KOT A;  2BOA A;  4DYO A;  5IX3 A;  2EWB A;  1QSM A;  4QVT A;  2FE7 A;  2C6P A;  5HVG A;  2Z3M A;  5IV0 A;  5H86 A;  2PJA A;  4MFQ A;  3JTK A;  3PFE A;  1DE4 C;  3FF3 A;  1VIX A;  1IGB A;  2F8H A;  3PB8 X;  4NGM A;  4CYQ A;  4JD6 A;  1AUG A;  1IIC A;  4Y49 B;  5JH9 A;  2EUI A;  1SQH A;  3JRU A;  2EBJ A;  4JWP A;  4MFK A;  4UCP A;  4YU9 A;  4AVC A;  5JPH A;  4A38 A;  3LWU A;  2PQ8 A;  4PXC A;  4P4I A;  5ELY A;  4IF5 A;  1R3N A;  2I79 A;  2J9A A;  1VHO A;  3JUW A;  4FD7 A;  3TFY A;  1NE9 A;  2VZY A;  1M4D A;  2Q4V A;  1YR0 A;  2XEJ A;  4CRZ B;  4R6T A;  1S5K A;  4MFL A;  3SXN A;  3ZJ0 A;  1Z8X A;  2O28 A;  4P4F A;  2EVN A;  2O4H A;  2ANP A;  4NGN A;  2Q7S A;  2ZW5 A;  3D7F A;  5J1Q A;  5DS0 A;  1ZO0 A;  2PJ1 A;  2PJ3 A;  4E2A A;  4B5O A;  1Q2Y A;  2XEF A;  5K8P A;  3CDX A;  5HVF A;  3PRT A;  4ORF A;  4P4J A;  3D3S A;  3B3C A;  4UA3 A;  2BO9 A;  1Z9U A;  4PPZ A;  4OC1 A;  1QSN A;  2BL1 A;  2EK8 A;  2P6F A;  2R8V A;  3KGQ A;  1RXT A;  4QUS A;  2FS5 A;  3TO6 A;  2QEC A;  3K9U A;  2JLM A;  4NGS A;  3BJ8 A;  4A32 A;  4A31 A;  1RTQ A;  3FEE A;  5EC4 A;  3F0A A;  4EME A;  4BD9 A;  1XRY A;  3QAY A;  3S9L A;  1GHE A;  4H89 A;  2XEI A;  5HMN A;  4PK3 A;  2GRE A;  4PXD A;  1JQG A;  4YRH A;  4FD6 A;  4CRY B;  3P2H A;  3B7I A;  5K8N A;  2K5T A;  2J8M A;  2FSR A;  4Q36 A;  3R95 A;  3OWC A;  3G8W A;  2GU2 A;  5D8N A;  3SHP A;  4A94 A;  3I1U A;  2VBQ A;  4RN7 A;  3FNC A;  4OP4 A;  2V77 A;  3ISZ A;  5K8O A;  4UIB A;  2FVG A;  1UFH A;  1YQE A;  2DF5 A;  2KCW A;  2PJ7 A;  3IIB A;  3LD2 A;  1I12 A;  2PJC A;  2B4D B;  3GLJ A;  4FD4 A;  4OME A;  4FBE A;  2PCU A;  4UBR A;  5EBV A;  1OBR A;  2YND A;  3PB9 X;  4WJB A;  1BPN A;  3WC7 A;  2PIZ A;  3KHX A;  2G3A A;  4C7I A;  5EMI A;  4MCP A;  4JXQ A;  4M3S A;  2IJZ A;  4L8A A;  5A27 A;  2ZEH A;  2ZED A;  4CPA A;  3EC4 A;  1WWZ A;  4HKF A;  1PCA A;  2PJ0 A;  4E8O A;  1Z4R A;  4XPL A;  1Y0Y A;  4NJR A;  2PRQ A;  2VI7 A;  3TC8 A;  4M6G A;  4OC3 A;  2POK A;  1S7L A;  3RBU A;  3IJ3 A;  3ZZI A;  1Y9W A;  2FT0 A;  3SJX A;  4ONU A;  2ZOG A;  4GXH A;  3UY5 A;  3VWE A;  2ATR A;  4P45 A;  4ZX8 A;  1YVK A;  1HEE A;  4UEF A;  1QST A;  4LUA A;  3NFZ A;  3TO9 A;  5D29 A;  3FXT A;  4NSQ A;  4HNW B;  4KOV A;  6CPA A;  1IY7 A;  4R57 A;  4OC2 A;  3KR5 A;  2CNM A;  2PJ6 A;  3D4U A;  4KLW A;  1HDQ A;  2X7B A;  5J8F A;  5AG5 A;  4MI4 A;  4F9U A;  5HXD A;  5JM6 A;  2RFH A;  1N71 A;  2AFX A;  3EO4 A;  2ABZ A;  5AG6 A;  5BWA B;  3GY9 A;  3S6G A;  4C2Y A;  4KSI A;  3IFE A;  2DPT A;  1TKH A;  3IWW A;  3D7D A;  3JVN A;  4KOR A;  3TTH A;  4AXV A;  1ARM A;  5CBM A;  3VWD A;  3FIX A;  1JWQ A;  4G1P A;  4MBU A;  4MY3 A;  4U9Y A;  1IB1 E;  1CP7 A;  3TT2 A;  2FIW A;  3LOD A;  2OZH A;  2VL1 A;  5AG4 A;  4B13 A;  1J4J A;  3HLP A;  2R1I A;  2Z10 A;  2V8G A;  4CGP A;  4C68 A;  5J8C A;  1LAN A;  1VKC A;  1XJO A;  2B5G A;  3IU2 A;  1LOK A;  4MHD A;  3NE7 A;  4IAV A;  4UWJ A;  4KSF A;  3L2N A;  3QB8 A;  3MN8 A;  4FD5 A;  4UCN A;  1LRZ A;  1WK4 A;  1YSJ A; 
#chains in the Genus database with same CATH homology
 3T9Y A;  1R57 A;  1VHS A;  4KOX A;  4B5P B;  4KOS A;  2REF A;  3CXS A;  1XIX A;  3CXP A;  4C2Z A;  4HNY B;  1B6B A;  4R87 A;  4F0Y A;  2Z3O A;  4PSW A;  4R3L A;  1RO5 A;  2Q7B A;  3DR6 A;  2P6E A;  2BUE A;  2PR1 A;  5DWM A;  2DXQ A;  2YNC C;  3S6K A;  5F49 A;  4II9 A;  1NMT A;  1FY7 A;  2B58 A;  4UCM A;  2AE6 A;  3FYN A;  5I0C A;  2CXA A;  3FB3 A;  2VXK A;  4XNH B;  3I3G A;  1S7F A;  3F5B A;  4UFW A;  3F8K A;  4KS9 A;  4CS0 B;  2Z11 A;  4B11 A;  1NSL A;  4AG9 A;  3TOA A;  4C2X A;  1CJW A;  4UWI A;  1KZF A;  1KUY A;  4QB9 A;  3P2F A;  4H6U A;  2B3V A;  2OB0 A;  2PR8 A;  2HQY A;  4A33 A;  2PRB A;  3CXQ A;  2GAN A;  3SXO A;  1B87 A;  4ZGY B;  2DPS A;  1KUX A;  2WPX A;  4MFZ A;  5F47 A;  4PSX A;  4QBJ A;  1P4N A;  3N7Z A;  4LX9 A;  4X5K A;  3QAH A;  4KOY A;  4I49 A;  1BOB A;  2ZW4 A;  2VEZ A;  2JEV A;  1XEB A;  4IUS A;  4QC6 A;  3BLN A;  2OZU A;  3R9F A;  2VQY A;  2RC4 A;  4CAW A;  4Q38 A;  4KOU A;  1V0C A;  1S3Z A;  5F48 A;  2HV2 A;  4JJX A;  4CGO A;  3T90 A;  4J3G A;  4A2Z A;  3PGP A;  5G20 A;  3H5Z A;  1BO4 A;  2H5M A;  2D4O A;  5G21 A;  4C7H A;  3D2P A;  1YVO A;  2Y0M A;  4NEX A;  2ZXV A;  1Q2C A;  3H4Q A;  1XMT A;  2I00 A;  5E96 A;  2ZW6 A;  5JQ4 A;  3E0K A;  1QSO A;  2D4P A;  4BBH A;  2J8N A;  2B3U A;  1U6M A;  3DNS A;  4NCZ A;  5ISV A;  1OZP A;  3PP9 A;  3R9G A;  2B4D A;  4L89 A;  4XPD C;  4CYN A;  5KTA A;  1M44 A;  5F46 A;  2WPW A;  2REE A;  4JLY A;  2OU2 A;  2A4N A;  4MJ8 A;  2BEI A;  4PV6 A;  4E0A A;  3W6S A;  4BMH A;  4MY0 A;  2Z3N A;  1Y7R A;  4MFJ A;  1MJ9 A;  4Y49 C;  3DR8 A;  2VZZ A;  5FVJ A;  1TIQ A;  1XE4 A;  5A28 A;  1M1D A;  4OAD A;  3WR7 A;  1I21 A;  2Q44 A;  2FXF A;  4CGN A;  5AGE A;  3GKR A;  5C88 A;  2Q4Y A;  2ZPA A;  4NXY A;  4F6A A;  4KVX A;  2GE3 A;  2CNT A;  1IYL A;  4K30 A;  1QSR A;  2OH1 A;  4CYP A;  1S7K A;  2GIV A;  4XPD B;  3IWG A;  3FBU A;  5C82 A;  3C26 A;  1XF8 A;  3EY5 A;  3EFA A;  2WSA A;  2R7H A;  4NF1 A;  4B10 A;  2NMT A;  4AB7 A;  4F0X A;  2J8R A;  2JDC A;  1IID A;  3MGD A;  1CM0 A;  2CNS A;  4KUA A;  1K4J A;  2PSW A;  2QIR A;  4RS2 A;  3V8I A;  3KKW A;  4OAE A;  2FIA A;  4B5P A;  4CGL A;  4U5Y A;  3I9S A;  4CAX A;  1YGH A;  2P6G A;  4KOW A;  1Q2D A;  1YX0 A;  1Z4E A;  3D8P A;  4KLV A;  3PZJ A;  1ON0 A;  2PC1 A;  2Q0Y A;  4YGO A;  2CY2 A;  4CYO A;  2JDD A;  1S60 A;  1I1D A;  3IU1 A;  3B8G A;  2YNE A;  4U9Z A;  3TCV A;  4UFV A;  4B12 A;  3EXN A;  2QML A;  4KVO E;  2Q04 A;  4UFX A;  5DWN A;  3R1K A;  3W91 A;  2AJ6 A;  4AVB A;  4AVA A;  2P0W A;  4CAE A;  1PUA A;  4OLL A;  4R9M A;  4YFJ A;  4ZBG A;  5G1Z A;  3RYO A;  4KUB A;  2F5I A;  4AG7 A;  4A30 A;  2B5G B;  2WUU A;  3DSB A;  2FL4 A;  2Z0Z A;  3W6X A;  3S6H A;  4CGM A;  2Z3L A;  5GCN A;  4B14 A;  5IB0 A;  4H6Z A;  2HUZ A;  5KTD A;  1MJA A;  1KUV A;  1Y9K A;  3IWE A;  3TE4 A;  1IYK A;  2C27 A;  2YNC A;  3DDD A;  2R98 A;  3G3S A;  4KZT A;  4CAF A;  1YK3 A;  4KVM E;  2Z3P A;  5CNP A;  4M85 A;  1M4I A;  3R9E A;  5H84 A;  1P0H A;  3TO7 A;  2G3T A;  2OZG A;  4PK2 A;  1S7N A;  3FRM A;  1YRE A;  1PU9 A;  2ARH A;  2G0B A;  2ZW7 A;  1MJB A;  3GYA A;  4GS4 A;  5KTC A;  2PDO A;  3S6F A;  5AG7 A;  2IL4 A;  1M4G A;  4RI1 A;  3A9L A;  4A95 A;  4R3K A;  4CAV A;  1MK4 A;  4MFP A;  4EVY A;  1L0C A;  1YLE A;  2BSW A;  2Z3K A;  3IGR A;  3TOB A;  4XNH C;  4DNC A;  5HH1 A;  2FCK A;  4HNX B;  3R96 A;  4KSA A;  2YGW A;  3D2M A;  4XPK A;  4JXR A;  2B4B A;  3BJ7 A;  5G22 A;  4KOT A;  5IX3 A;  1QSM A;  4QVT A;  2FE7 A;  2Z3M A;  5IV0 A;  5H86 A;  4MFQ A;  3JTK A;  4CYQ A;  4JD6 A;  1IIC A;  4Y49 B;  2EUI A;  1SQH A;  4JWP A;  4MFK A;  4UCP A;  4AVC A;  5JPH A;  2PQ8 A;  4IF5 A;  2I79 A;  4FD7 A;  3JUW A;  3TFY A;  1NE9 A;  2VZY A;  1M4D A;  2Q4V A;  1YR0 A;  4CRZ B;  3ZJ0 A;  1S5K A;  4MFL A;  3SXN A;  2O28 A;  2EVN A;  2ZW5 A;  1ZO0 A;  4E2A A;  4B5O A;  1Q2Y A;  4ORF A;  3D3S A;  4UA3 A;  1Z9U A;  1QSN A;  2BL1 A;  2P6F A;  2R8V A;  3TO6 A;  1RXT A;  4QUS A;  2FS5 A;  2QEC A;  3K9U A;  2JLM A;  4A32 A;  3BJ8 A;  4A31 A;  5EC4 A;  3F0A A;  1GHE A;  4H89 A;  5HMN A;  4PK3 A;  4YRH A;  4CRY B;  4FD6 A;  3P2H A;  2K5T A;  2J8M A;  2FSR A;  4Q36 A;  3R95 A;  3OWC A;  3G8W A;  3SHP A;  2VBQ A;  3FNC A;  1UFH A;  2KCW A;  3LD2 A;  1I12 A;  2B4D B;  4FD4 A;  4UBR A;  5EBV A;  2YND A;  2G3A A;  4C7I A;  4JXQ A;  4M3S A;  4L8A A;  5A27 A;  3EC4 A;  4HKF A;  1WWZ A;  4E8O A;  1Z4R A;  4XPL A;  2VI7 A;  3ZZI A;  1S7L A;  1Y9W A;  2FT0 A;  4ONU A;  3UY5 A;  3VWE A;  2ATR A;  1YVK A;  1QST A;  4LUA A;  3TO9 A;  3FXT A;  4NSQ A;  4HNW B;  4KOV A;  4R57 A;  2CNM A;  4KLW A;  2X7B A;  5J8F A;  5AG5 A;  4MI4 A;  1N71 A;  3EO4 A;  5AG6 A;  5BWA B;  3GY9 A;  3S6G A;  4C2Y A;  2DPT A;  4KOR A;  3JVN A;  3TTH A;  3VWD A;  3FIX A;  4MBU A;  4MY3 A;  4U9Y A;  1IB1 E;  3TT2 A;  2FIW A;  3LOD A;  2OZH A;  5AG4 A;  4B13 A;  1J4J A;  2R1I A;  2Z10 A;  4CGP A;  4C68 A;  5J8C A;  1VKC A;  2B5G A;  3IU2 A;  4MHD A;  3NE7 A;  4UWJ A;  4KSF A;  3QB8 A;  4FD5 A;  4UCN A;  1LRZ A;  1WK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...