2ATRA

Acetyltransferase, gnat family protein sp0256 from streptococcus pneumoniae tigr4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
132
Chain Sequence
MITIKKQEIVKLEDVLHLYQAVGWTNEMLEQALSHSLVIYLALDGDAVVGLIRLVGDGFSSVFVQDLIVLPSYQRQGIGSSLMKEALGNFKEAYQVQLATEETEKNVGFYRSMGFEILSTYDCTGMIWINRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase, GNAT family
publication title Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 27
structure length 132
sequence length 137
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2atrA00
4MJ8A 3FNCA 2FE7A 4ORFA 3ZZIA 3K9UA 4OADA 2Q04A 3TO9A 1L0CA 4KORA 2AE6A 1FY7A 4I49A 3TCVA 3TT2A 2P6EA 4XPDC 1Y9KA 2P0WA 2O28A 4Y49B 2PDOA 5JPHA 3N7ZA 2RC4A 3TE4A 1NE9A 3FB3A 2Y0MA 3EY5A 1RXTA 4KOWA 2OZGA 1M44A 3FBUA 4R3LA 5ISVA 3LD2A 3JUWA 2Q0YA 5FVJA 4GS4A 4M3SA 3MGDA 2JDDA 2WPWA 4JWPA 3H4QA 1R57A 2P6GA 4RS2A 3QAHA 4YFJA 1KUYA 2OZUA 3TFYA 4FD7A 4MHDA 4UWIA 1IICA 2A4NA 4CS0B 1XE4A 2BL1A 4AVBA 4KOVA 1QSOA 2I00A 5C82A 1Q2CA 1M4DA 4KUAA 4PK2A 5EC4A 1S7KA 3SHPA 4CRZB 4KOYA 5JQ4A 4L8AA 2BUEA 3G3SA 3LODA 3GKRA 3W6XA 5CNPA 4QVTA 4H6UA 3BLNA 3JVNA 3PP9A 4JLYA 1WWZA 4KLWA 3S6HA 3W91A 1WK4A 4UWJA 4U9ZA 3DR8A 2PSWA 3S6KA 2VXKA 4AVCA 4IUSA 2B3VA 1TIQA 1MK4A 1IYKA 1QSTA 1M4IA 3TO6A 5C88A 2PR8A 2F5IA 4PK3A 1CM0A 3CXQA 4KOTA 1K4JA 4RI1A 3P2HA 2QMLA 1I21A 1GHEA 2OZHA 3T9YA 4NSQA 4Y49C 3D2MA 5H84A 2Q7BA 2FIWA 4ZBGA 4MI4A 2R98A 1PU9A 3SXOA 3EXNA 2D4OA 4F6AA 4NCZA 2FIAA 3WR7A 1S3ZA 1S5KA 5GCNA 3PGPA 2X7BA 1Z4EA 1YK3A 3BJ8A 4AVAA 2PRBA 5IB0A 3D8PA 4PSXA 3R9EA 4R57A 3R9GA 3PZJA 5IX3A 1YREA 4B5OA 2R7HA 2FT0A 4KVXA 4CAWA 2J8RA 4II9A 4LUAA 5H86A 2CNMA 2EVNA 4HNYB 1QSRA 2WPXA 4KOUA 2FSRA 1NMTA 2VZYA 2REEA 2DXQA 2FXFA 2B4BA 2FCKA 3F0AA 3UY5A 5J8CA 3DNSA 1IIDA 4MY3A 1CJWA 3G8WA 3EO4A 5F48A 1B6BA 5DWMA 1N71A 4AG7A 1KUVA 1RO5A 5KTAA 2KCWA 5E96A 3EFAA 4EVYA 1P4NA 4E0AA 3P2FA 2GE3A 1XEBA 4JJXA 1UFHA 2HUZA 4MY0A 5KTCA 1QSMA 5KTDA 1I12A 1KUXA 5I0CA 4ONUA 4U5YA 5F47A 1I1DA 4X5KA 2B5GB 1NSLA 1VKCA 2CNSA 4U9YA 4XNHB 3V8IA 1Y7RA 4KLVA 5HMNA 1IB1E 2OB0A 2QIRA 2NMTA 4AG9A 4KOXA 3IGRA 3TOBA 4HKFA 1P0HA 1MJAA 2AJ6A 3GY9A 4F0YA 3SXNA 2J8NA 3S6GA 3VWEA 2G3TA 4R9MA 2EUIA 4H6ZA 1LRZA 1MJ9A 3BJ7A 3E0KA 3QB8A 2R1IA 2VEZA 3GYAA 1XIXA 1Y9WA 2FS5A 4XPKA 4HNWB 2Q4VA 2D4PA 4CRYB 4NF1A 4L89A 4OLLA 3TO7A 1S7NA 2VQYA 1IYLA 3FXTA 3I9SA 3VWDA 3CXPA 1Q2YA 1Z4RA 2G3AA 4H89A 4B5PA 2R8VA 3R96A 3FYNA 5F49A 2BSWA 2PR1A 4QUSA 4IF5A 4B5PB 2JDCA 4OAEA 1Q2DA 1MJBA 1QSNA 2B4DA 2HV2A 1B87A 3T90A 2OU2A 2B4DB 4R3KA 2Q4YA 2GANA 3DR6A 2Z11A 1YVOA 5DWNA 4J3GA 1YX0A 3ZJ0A 1M1DA 4YRHA 1SQHA 4KVOE 4FD6A 2B58A 4LX9A 2ZXVA 1S7FA 2PC1A 1XF8A 1S7LA 4XNHC 2C27A 2H5MA 3KKWA 3C26A 4KOSA 4MBUA 2CNTA 1YGHA 2OH1A 4HNXB 2ATRA 2Z10A 4QB9A 1ON0A 3R9FA 1S60A 2ZW4A 2VBQA 2B5GA 3IWGA 2ZW5A 3F8KA 4PV6A 3DSBA 2BEIA 4XPDB 4CAVA 5IV0A 2G0BA 2K5TA 4JXRA 4KVME 2VI7A 4AB7A 3DDDA 1YR0A 4JD6A 4JXQA 2FL4A 1BOBA 3R95A 1M4GA 4KZTA 2HQYA 1XMTA 4CAXA 1KZFA 2IL4A 2ZW7A 2REFA 1PUAA 2Q44A 2JEVA 4BMHA 5EBVA 2J8MA 3EC4A 4K30A 4YGOA 4UA3A 3S6FA 2I79A 2JLMA 4E8OA 4XPLA 5J8FA 3W6SA 4NEXA 3B8GA 2P6FA 3D3SA 2QECA 3NE7A 1BO4A 4FD4A 4KUBA 4DNCA 1VHSA 4UBRA 4NXYA 5F46A 1OZPA 3D2PA 2B3UA 4R87A 5HH1A 3FIXA 3I3GA 1Z9UA 2VZZA 1J4JA 2Z0ZA 3F5BA 2ZW6A 1U6MA 3FRMA 2ZPAA 4FD5A 4E2AA 2GIVA 3OWCA 1YVKA 4M85A 3CXSA 3R1KA 3TTHA 2PQ8A 1V0CA 3TOAA 2CY2A 4QC6A 3RYOA 4PSWA 1YLEA 2ARHA 4QBJA
chains in the Genus database with same CATH superfamily
4MJ8A 3FNCA 2FE7A 4ORFA 3ZZIA 1H8LA 3K9UA 2RB7A 2CIJA 3FX6A 2Q04A 4OADA 3TO9A 4OC1A 1ARMA 1L0CA 4MCRA 5G22A 4KORA 1Z8TA 2AE6A 3RO0A 1FY7A 4I49A 4GXHA 2IQ6A 5LYDA 3IU2A 3TCVA 3KL9A 2VL1A 3TT2A 5AG4A 1Q7LA 2P6EA 4UFWA 4XPDC 2YNCC 1Y9KA 3PB7X 2P0WA 3S9LA 2O28A 4C2YA 1AUGA 4Y49B 4P45A 4ZGYB 1ZG8A 4CGOA 2PDOA 3D67A 3IWEA 3KZWA 4CPAA 4Q7AA 5JPHA 1EE3P 3N7ZA 4B14A 2RC4A 3TE4A 3MRUA 1NE9A 1YW4A 4P4JA 2OOTA 1CBXA 4DYOA 3FB3A 2Y0MA 2CF4A 3EY5A 4OP4A 1RXTA 4KOWA 2OZGA 1M44A 2Z3OA 3K2KA 3FBUA 4R3LA 5ISVA 2O53A 3LD2A 3NH4A 3JUWA 1X12A 2ODFA 4NGNA 4KS9A 4ONWA 4JYWA 3H5ZA 2Q0YA 4UEEA 4GS4A 5FVJA 4B13A 4M3SA 3MGDA 3SJEA 2JDDA 2WPWA 4JWPA 4ZY1A 3B2YA 2ZEFA 4FWUA 3H4QA 1R57A 2P6GA 1JWQA 4RS2A 3IC1A 5LRKA 5G20A 2PJ6A 3QAHA 4YFJA 1KUYA 4F9UA 2OZUA 4KSIA 3TFYA 1DTDA 1Z8WA 2O4HA 4FD7A 4MHDA 5I4MA 3K9TA 4OMEA 1LANA 2J9AA 1IICA 4UWIA 1GYTA 2A4NA 4CS0B 1XE4A 2BL1A 4AVBA 4KOVA 1ZLHA 3FMCA 4NGMA 4A32A 1QSOA 1IU8A 4M6IA 2I00A 5C82A 2C6PA 3NE8A 4MFJA 2PJ3A 1Q2CA 4UFXA 5LRGA 1M4DA 4A37A 1AMPA 1XBUA 2AFZA 4KUAA 4PK2A 5EC4A 1XFOA 3SI1A 3PB8X 1S7KA 3SHPA 4TWEA 1YMEA 2C6CA 3CDXA 4KOYA 4L8AA 4CRZB 5JQ4A 3TC8A 2BUEA 1VHEA 3G3SA 3LODA 3GKRA 3GB0A 5AGEA 4ZI6A 3W6XA 5CNPA 4NJRA 4QVTA 2ZEDA 1HDUA 2C6GA 3H8GA 1ARLA 1PCAA 4H6UA 3BLNA 1Z8LA 4CAEA 3JVNA 4NFRA 4CYQA 2F8HA 3A9LA 3PP9A 5THWA 1Y0YA 4JLYA 2ZEMA 3TX8A 1WWZA 4KLWA 3S6HA 3D7GA 3QNVA 1WK4A 3W91A 4UWJA 2CTBA 3D7FA 4U9ZA 2Q51A 2V8HA 3DR8A 4ZY0A 2PSWA 3S6KA 2VXKA 4AVCA 4IUSA 4R6TA 5IB9A 2B3VA 4A2ZA 1TIQA 1TXRA 3B3CA 4RN7A 1MK4A 2BCOA 2PJAA 4UCNA 1F2OA 1IYKA 1Z2LA 2DPSA 1QSTA 2PJ8A 1M4IA 3TO6A 3VATA 4C2ZA 5C88A 4MCPA 2PR8A 2F5IA 1Y7EA 2HC9A 1TKJA 4PK3A 1CM0A 3CXQA 3GLJA 3LACA 4KOTA 1K4JA 4RI1A 4A33A 1Z5RA 5D8NA 2ZELA 4EWTA 3P2HA 4F8ZA 4TNUA 2QMLA 1BPNA 1I21A 4Q36A 3D68A 1GHEA 4MFQA 3GUXA 2OZHA 3T9YA 4OC4A 4NSQA 1X10A 2V8DA 3FECA 4Y49C 3SJGA 3D2MA 1F57A 4UCMA 2FIWA 2AFWA 4MI4A 4ZBGA 5H84A 2Q7BA 1ZLIA 2R98A 1PU9A 4M6HA 3SXOA 5CBMA 2PIYA 3EXNA 2D4OA 1F2PA 5EMIA 4F6AA 2Z3PA 4NCZA 2EK8A 3WC6A 2FIAA 4C68A 3PEIA 4CYNA 2ABZA 3IJ3A 1PYTB 3WR7A 1S3ZA 3KHXA 1S5KA 5GCNA 3PGPA 2X7BA 1Z4EA 4OC5A 1YK3A 3BJ8A 3D7DA 3KR5A 5K8NA 1CP6A 2Z3LA 4IAVA 2PRBA 4P10A 3PB4X 4R76A 4AVAA 3D8PA 5BWAB 1QMUA 3D4UA 4PSXA 5IB0A 3ISZA 3R9EA 4M6GA 4R57A 4ZYQA 3R9GA 3PZJA 2ZEEA 5IX3A 3LMSA 1YREA 2ZEPA 4OC3A 4B5OA 1CG2A 5A28A 2EBJA 2R7HA 2FT0A 1Z8XA 3HLPA 4KVXA 3JRUA 4NGPA 5DS0A 1VHOA 1VGYA 2J8RA 3RZAA 4CAWA 4LUAA 5H86A 4II9A 2CNMA 2DPTA 2EVNA 4HNYB 2RFHA 3V7ZA 4BBHA 1QSRA 2WPXA 4KOUA 3T8WA 2FSRA 1ZG7A 1NMTA 1DE4C 2REEA 2DXQA 2FXFA 2VZYA 2XEJA 3B3SA 4W9YA 2B4BA 3IO1A 2PRQA 3NA6A 3BI1A 3BI0A 2FCKA 2PJ5A 4P4IA 1AYEA 3F0AA 4C7HA 3NFZA 3UY5A 5J8CA 5J1QA 4P6YA 3DNSA 1IIDA 3B3WA 1CJWA 4MY3A 4B11A 3G8WA 5F09A 3EO4A 3B3VA 5F48A 1B6BA 3IWWA 5DWMA 4YWYA 1N71A 4AG7A 3FEDA 1KUVA 1RO5A 2ZEHA 5KTAA 4PXCA 4MRIA 4PPZA 4WWVA 2KCWA 1TF8A 4PXDA 5E96A 3EFAA 4EVYA 1P4NA 4E0AA 1QQ9A 3P2FA 3KASA 2GE3A 5AG5A 1XEBA 4UF4A 4YU9A 4JJXA 2YGWA 5HVGA 2ZOFA 2PIZA 3PB9X 1UFHA 2HUZA 1IY7A 4MY0A 2OR4A 4UIBA 3IEHA 5KTCA 1QSMA 3JTKA 5KTDA 3CPAA 1I12A 1KUXA 5I0CA 4R7MA 4ONUA 2ZEGA 3QAYA 4P4DA 4U5YA 5F47A 1I1DA 2PJ4A 2POKA 4X5KA 2B5GB 3B3TA 1LFWA 1NSLA 2EWBA 4UIAA 1VKCA 2CNSA 4U9YA 4XNHB 3V8IA 2GREA 1Y7RA 5AG7A 1TKFA 3NH5A 4KLVA 2JBJA 2BOAA 5HMNA 1IB1E 1XOVA 2OB0A 2QIRA 4B12A 3D66A 4FAIA 4MHZA 2NMTA 4AG9A 4KOXA 3IGRA 2PJ7A 3TOBA 1YW6A 3SJFA 4HKFA 1P0HA 1MJAA 4CGMA 2AJ6A 2HB6A 3GY9A 2Z3NA 2NSMA 3PFOA 2XEIA 4MHNA 4F0YA 5HVFA 3SXNA 2J8NA 3S6GA 3VWEA 2G3TA 4R9MA 2DF5A 2EUIA 4MFKA 4LQGA 1HDQA 2ZENA 4C7IA 4H6ZA 1LRZA 2AFOA 4KSFA 1MJ9A 5LYFA 3BJ7A 3ISXA 3E0KA 3QB8A 4MFPA 2R1IA 2WUUA 3FEEA 2VEZA 3IU1A 3GYAA 4NGQA 1XIXA 2WYRA 3IIBA 1IGBA 4UEZA 4C2XA 1LAPA 1Y9WA 2FS5A 4XPKA 3WT4A 3BXMA 5A27A 3FF3A 4HNWB 2Q4VA 1XRYA 2D4PA 3GIUA 1XMBA 4CRYB 4MCQA 4NF1A 4L89A 4MFLA 3RNZA 4OLLA 1A2ZA 3TO7A 4MHPA 4CYPA 2PJBA 1S7NA 2VQYA 5K8PA 1IYLA 3FXTA 3I9SA 1HEEA 4PXBA 2GLJA 4X2TA 3VWDA 4H2KA 3CXPA 5LYLA 4OIDA 1Q2YA 1Z4RA 2G3AA 4H89A 4B10A 3KQXA 4B5PA 4X3RA 4IK2A 2PJ9A 2R8VA 3H8FA 3R96A 3VH9A 4P4FA 3FYNA 5F49A 5JGFA 2BSWA 2PR1A 4QUSA 4IF5A 5G1ZA 2CTCA 4B5PB 4B6ZA 1YSJA 1M4LA 2JDCA 2ANPA 1ELMP 4OAEA 4A94A 4P44A 3S9NA 2V8VA 3LWUA 1Q2DA 3D7HA 3FJUA 1MJBA 2PE3A 2QYVA 2EO8A 1QSNA 2B4DA 2HV2A 1B87A 2DEAA 2OU2A 3SJXA 3T90A 2Z3KA 4A31A 3FH4A 4ZY2A 2PVWA 4OC2A 4CGPA 5D29A 1LCPA 2B4DB 1ZO0A 1VIXA 2AFSA 3CT9A 4R3KA 2Q4YA 1IOFA 2GANA 4BD9A 3DR6A 2Z11A 1YVOA 2Z3MA 5DWNA 4LQ6A 4J3GA 5HXDA 3PFEA 1YX0A 1R43A 1CPXA 2JEWA 3IFEA 4Q38A 5JM6A 3ZJ0A 1M1DA 5LRJA 4YRHA 1SQHA 1FNOA 4KVOE 4A38A 2Q7SA 2XEGA 4FD6A 2B58A 2BO9A 3WC7A 2QVPA 4LX9A 1UWYA 2ZXVA 4KSAA 3KQZA 4A30A 4JZ0A 4NGRA 1S7FA 2PC1A 4UCPA 2C1CA 1XF8A 1S7LA 4A39A 7CPAA 4XNHC 4EFDA 2C27A 1ZG9A 1BAVA 2XEFA 2H5MA 3KKWA 3C26A 2PCUA 1CPSA 4KOSA 4MBUA 2CNTA 4A95A 2AFMA 4RUHA 1YGHA 2OH1A 4HNXB 2ATRA 4X8IA 4GM5A 2I3CA 1RTQA 2Z10A 1KWMA 4QB9A 2PJ1A 1ON0A 4FBEA 3R9FA 1S60A 2NYQA 2ZEOA 4CGLA 2ZW4A 2V77A 4MFZA 2QJ8A 3KGQA 4MCSA 2AFXA 2YNCA 4NJQA 2Q4ZA 4CYOA 2VBQA 3B35A 2B5GA 3IWGA 2JBKA 2ZW5A 3F8KA 3PRTA 4PV6A 3DSBA 2BEIA 2GLFA 4XPDB 4CAVA 2PVVA 3PB6X 2IMOA 2F7VA 4HPSA 5IV0A 2G0BA 2K5TA 4JXRA 4KVME 2VI7A 1IOIA 3L2NA 4AB7A 2PJCA 3DDDA 1YR0A 3PBEA 3DLJA 3CZXA 4JD6A 4JXQA 2FL4A 4FUUA 1JQGA 1BOBA 2G9DA 3HUVA 2WSAA 3KI9A 3R95A 3V38A 1R3NA 4NGSA 1LOKA 1M4GA 3KHZA 4KZTA 4CAFA 2HQYA 1CP7A 1XMTA 4CAXA 1KZFA 2IL4A 2ZW7A 2REFA 1PUAA 2PJ0A 2Q44A 2JEVA 4OC0A 4PQAA 4BMHA 5EBVA 2ZOGA 2WZNA 3DGVA 4OKOA 3WC5A 4UEFA 2J8MA 5CPAA 3EC4A 3SI2A 4K30A 5G21A 4YGOA 4BINA 4CGNA 4UA3A 3S6FA 2I79A 2JLMA 4E8OA 3MN8A 4XPLA 2YNDA 4OIWA 5J8FA 3N5FA 4WJBA 1Y0RA 3W6SA 4NEXA 2CXAA 3B8GA 2P6FA 4Z65A 3D3SA 3RAMA 2QECA 3NE7A 1BPMA 1BO4A 4FD4A 4ZX8A 4K3NA 4KUBA 4EMEA 1ELLP 1LAMA 4DNCA 1VHSA 4UBRA 4AXVA 2Q43A 4NGTA 4NXYA 4DUKA 5F46A 3FVLA 1OZPA 3SI0A 3D2PA 2B3UA 4R87A 3PBBA 3FIXA 3I3GA 2AFUA 4ZX9A 1Z9UA 5HH1A 5LYIA 4P4BA 2EK9A 5AG6A 4F0XA 1YLOA 2GFQA 2VZZA 1CX8A 3H8EA 1J4JA 2Z0ZA 3F5BA 2ZW6A 1U6MA 1BLLE 3FRMA 2ZPAA 1TF9A 4FD5A 4E2AA 2GIVA 4IHMA 3WABA 3CPXA 3OWCA 4G1PA 4F9VA 1YVKA 2V8GA 3B7IA 2IJZA 4M85A 3S9MA 3VARA 1OBRA 4MXUA 1YQEA 3CXSA 4P4EA 4R8FA 3R1KA 2PJ2A 4MMOA 3TTHA 1TKHA 6CPAA 1XJOA 5HVHA 2PQ8A 5ELYA 1V0CA 3KR4A 3TOAA 4MHYA 4UFVA 8CPAA 2CY2A 4QC6A 3RYOA 4O23A 2YNEA 4PSWA 1NSAA 1YLEA 3BHXA 5JH9A 1FT7A 2FVGA 3NH8A 3RBUA 2ARHA 4DJLA 5K8OA 5K8MA 4PXEA 2GU2A 4QBJA 3I1UA
chains in the Genus database with same CATH topology
4MJ8A 3FNCA 2FE7A 4ORFA 3ZZIA 3K9UA 4OADA 2Q04A 3TO9A 1L0CA 5G22A 4KORA 2AE6A 1FY7A 4I49A 3IU2A 3TCVA 3TT2A 5AG4A 2P6EA 4UFWA 4XPDC 2YNCC 1Y9KA 2P0WA 2O28A 4C2YA 4Y49B 4ZGYB 4CGOA 2PDOA 3IWEA 5JPHA 3N7ZA 4B14A 2RC4A 3TE4A 1NE9A 3FB3A 2Y0MA 3EY5A 1RXTA 4KOWA 2OZGA 1M44A 2Z3OA 3FBUA 4R3LA 5ISVA 3LD2A 3JUWA 4KS9A 3H5ZA 2Q0YA 5FVJA 4GS4A 4B13A 4M3SA 3MGDA 2JDDA 2WPWA 4JWPA 3H4QA 1R57A 2P6GA 4RS2A 5G20A 3QAHA 4YFJA 1KUYA 2OZUA 3TFYA 4FD7A 4MHDA 4UWIA 1IICA 2A4NA 4CS0B 1XE4A 2BL1A 4AVBA 4KOVA 4A32A 1QSOA 2I00A 5C82A 4MFJA 1Q2CA 4UFXA 1M4DA 4KUAA 4PK2A 5EC4A 1S7KA 3SHPA 4CRZB 4KOYA 5JQ4A 4L8AA 2BUEA 3G3SA 3LODA 3GKRA 5AGEA 3W6XA 5CNPA 4QVTA 4H6UA 3BLNA 4CAEA 3JVNA 4CYQA 3A9LA 3PP9A 4JLYA 1WWZA 4KLWA 3S6HA 3W91A 1WK4A 4UWJA 4U9ZA 3DR8A 2PSWA 3S6KA 2VXKA 4AVCA 4IUSA 2B3VA 4A2ZA 1TIQA 1MK4A 4UCNA 1IYKA 2DPSA 1QSTA 4C2ZA 1M4IA 3TO6A 5C88A 2PR8A 2F5IA 4PK3A 1CM0A 3CXQA 4KOTA 1K4JA 4RI1A 4A33A 3P2HA 2QMLA 1I21A 4Q36A 4MFQA 1GHEA 2OZHA 3T9YA 4NSQA 4Y49C 3D2MA 4UCMA 5H84A 2FIWA 4ZBGA 4MI4A 2Q7BA 2R98A 1PU9A 3SXOA 3EXNA 2D4OA 4F6AA 2Z3PA 4NCZA 2FIAA 4C68A 4CYNA 3WR7A 1S3ZA 1S5KA 5GCNA 3PGPA 2X7BA 1Z4EA 1YK3A 3BJ8A 2Z3LA 4AVAA 2PRBA 5BWAB 3D8PA 5IB0A 4PSXA 3R9EA 4R57A 3R9GA 3PZJA 5IX3A 1YREA 4B5OA 5A28A 2R7HA 2FT0A 4KVXA 4CAWA 2J8RA 4II9A 4LUAA 5H86A 2CNMA 2DPTA 2EVNA 4HNYB 4BBHA 1QSRA 2WPXA 4KOUA 2FSRA 1NMTA 2VZYA 2REEA 2DXQA 2FXFA 2B4BA 2FCKA 3F0AA 4C7HA 3UY5A 5J8CA 3DNSA 1IIDA 4MY3A 1CJWA 4B11A 3G8WA 3EO4A 5F48A 1B6BA 5DWMA 1N71A 4AG7A 1KUVA 1RO5A 5KTAA 2KCWA 5E96A 3EFAA 4EVYA 1P4NA 4E0AA 3P2FA 2GE3A 5AG5A 1XEBA 4JJXA 2YGWA 1UFHA 2HUZA 4MY0A 5KTCA 1QSMA 3JTKA 5KTDA 1I12A 1KUXA 5I0CA 4ONUA 4U5YA 5F47A 1I1DA 4X5KA 2B5GB 1NSLA 1VKCA 2CNSA 4U9YA 4XNHB 3V8IA 1Y7RA 5AG7A 4KLVA 5HMNA 1IB1E 2OB0A 2QIRA 4B12A 2NMTA 4AG9A 4KOXA 3IGRA 3TOBA 4HKFA 1P0HA 1MJAA 4CGMA 2AJ6A 3GY9A 2Z3NA 4F0YA 3SXNA 2J8NA 3S6GA 3VWEA 2G3TA 4R9MA 4MFKA 2EUIA 4C7IA 4H6ZA 1LRZA 4KSFA 1MJ9A 3BJ7A 3E0KA 3QB8A 4MFPA 2R1IA 2WUUA 2VEZA 3IU1A 3GYAA 1XIXA 4C2XA 1Y9WA 2FS5A 4XPKA 5A27A 4HNWB 2Q4VA 2D4PA 4CRYB 4NF1A 4L89A 4MFLA 4OLLA 3TO7A 4CYPA 1S7NA 2VQYA 1IYLA 3FXTA 3I9SA 3VWDA 3CXPA 1Q2YA 1Z4RA 2G3AA 4H89A 4B10A 4B5PA 2R8VA 3R96A 3FYNA 5F49A 2BSWA 2PR1A 4QUSA 4IF5A 5G1ZA 4B5PB 2JDCA 4OAEA 1Q2DA 1MJBA 1QSNA 2B4DA 2HV2A 1B87A 3T90A 2OU2A 2Z3KA 4A31A 4CGPA 2B4DB 1ZO0A 4R3KA 2Q4YA 2GANA 3DR6A 2Z11A 1YVOA 2Z3MA 5DWNA 4J3GA 1YX0A 4Q38A 3ZJ0A 1M1DA 4YRHA 1SQHA 4KVOE 4FD6A 2B58A 4LX9A 2ZXVA 4KSAA 4A30A 1S7FA 2PC1A 4UCPA 1XF8A 1S7LA 4XNHC 2C27A 2H5MA 3KKWA 3C26A 4KOSA 4A95A 4MBUA 2CNTA 1YGHA 2OH1A 4HNXB 2ATRA 2Z10A 4QB9A 1ON0A 3R9FA 1S60A 4CGLA 2ZW4A 4MFZA 2YNCA 4CYOA 2VBQA 2B5GA 3IWGA 2ZW5A 3F8KA 4PV6A 3DSBA 2BEIA 4XPDB 4CAVA 5IV0A 2G0BA 2K5TA 4JXRA 4KVME 2VI7A 4AB7A 3DDDA 1YR0A 4JD6A 4JXQA 2FL4A 1BOBA 3R95A 2WSAA 1M4GA 4KZTA 4CAFA 2HQYA 1XMTA 4CAXA 1KZFA 2IL4A 2ZW7A 2REFA 1PUAA 2Q44A 2JEVA 4BMHA 5EBVA 2J8MA 3EC4A 4K30A 5G21A 4YGOA 4CGNA 4UA3A 3S6FA 2I79A 2JLMA 4E8OA 4XPLA 2YNDA 5J8FA 3W6SA 4NEXA 2CXAA 3B8GA 2P6FA 3D3SA 2QECA 3NE7A 1BO4A 4FD4A 4KUBA 4DNCA 1VHSA 4UBRA 4NXYA 5F46A 1OZPA 3D2PA 2B3UA 4R87A 5HH1A 3FIXA 3I3GA 1Z9UA 5AG6A 4F0XA 2VZZA 1J4JA 2Z0ZA 3F5BA 2ZW6A 1U6MA 3FRMA 2ZPAA 4FD5A 4E2AA 2GIVA 3OWCA 1YVKA 4M85A 3CXSA 3R1KA 3TTHA 2PQ8A 1V0CA 3TOAA 4UFVA 2CY2A 4QC6A 3RYOA 2YNEA 4PSWA 1YLEA 2ARHA 4QBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJ8 A;  3FNC A;  2FE7 A;  4ORF A;  3ZZI A;  3K9U A;  4OAD A;  2Q04 A;  3TO9 A;  1L0C A;  4KOR A;  2AE6 A;  1FY7 A;  4I49 A;  3TCV A;  3TT2 A;  2P6E A;  4XPD C;  1Y9K A;  2P0W A;  2O28 A;  4Y49 B;  2PDO A;  5JPH A;  3N7Z A;  2RC4 A;  3TE4 A;  1NE9 A;  3FB3 A;  2Y0M A;  3EY5 A;  1RXT A;  4KOW A;  2OZG A;  1M44 A;  3FBU A;  4R3L A;  5ISV A;  3LD2 A;  3JUW A;  2Q0Y A;  5FVJ A;  4GS4 A;  4M3S A;  3MGD A;  2JDD A;  2WPW A;  4JWP A;  3H4Q A;  1R57 A;  2P6G A;  4RS2 A;  3QAH A;  4YFJ A;  1KUY A;  2OZU A;  3TFY A;  4FD7 A;  4MHD A;  4UWI A;  1IIC A;  2A4N A;  4CS0 B;  1XE4 A;  2BL1 A;  4AVB A;  4KOV A;  1QSO A;  2I00 A;  5C82 A;  1Q2C A;  1M4D A;  4KUA A;  4PK2 A;  5EC4 A;  1S7K A;  3SHP A;  4CRZ B;  4KOY A;  5JQ4 A;  4L8A A;  2BUE A;  3G3S A;  3LOD A;  3GKR A;  3W6X A;  5CNP A;  4QVT A;  4H6U A;  3BLN A;  3JVN A;  3PP9 A;  4JLY A;  1WWZ A;  4KLW A;  3S6H A;  3W91 A;  1WK4 A;  4UWJ A;  4U9Z A;  3DR8 A;  2PSW A;  3S6K A;  2VXK A;  4AVC A;  4IUS A;  2B3V A;  1TIQ A;  1MK4 A;  1IYK A;  1QST A;  1M4I A;  3TO6 A;  5C88 A;  2PR8 A;  2F5I A;  4PK3 A;  1CM0 A;  3CXQ A;  4KOT A;  1K4J A;  4RI1 A;  3P2H A;  2QML A;  1I21 A;  1GHE A;  2OZH A;  3T9Y A;  4NSQ A;  4Y49 C;  3D2M A;  5H84 A;  2Q7B A;  2FIW A;  4ZBG A;  4MI4 A;  2R98 A;  1PU9 A;  3SXO A;  3EXN A;  2D4O A;  4F6A A;  4NCZ A;  2FIA A;  3WR7 A;  1S3Z A;  1S5K A;  5GCN A;  3PGP A;  2X7B A;  1Z4E A;  1YK3 A;  3BJ8 A;  4AVA A;  2PRB A;  5IB0 A;  3D8P A;  4PSX A;  3R9E A;  4R57 A;  3R9G A;  3PZJ A;  5IX3 A;  1YRE A;  4B5O A;  2R7H A;  2FT0 A;  4KVX A;  4CAW A;  2J8R A;  4II9 A;  4LUA A;  5H86 A;  2CNM A;  2EVN A;  4HNY B;  1QSR A;  2WPX A;  4KOU A;  2FSR A;  1NMT A;  2VZY A;  2REE A;  2DXQ A;  2FXF A;  2B4B A;  2FCK A;  3F0A A;  3UY5 A;  5J8C A;  3DNS A;  1IID A;  4MY3 A;  1CJW A;  3G8W A;  3EO4 A;  5F48 A;  1B6B A;  5DWM A;  1N71 A;  4AG7 A;  1KUV A;  1RO5 A;  5KTA A;  2KCW A;  5E96 A;  3EFA A;  4EVY A;  1P4N A;  4E0A A;  3P2F A;  2GE3 A;  1XEB A;  4JJX A;  1UFH A;  2HUZ A;  4MY0 A;  5KTC A;  1QSM A;  5KTD A;  1I12 A;  1KUX A;  5I0C A;  4ONU A;  4U5Y A;  5F47 A;  1I1D A;  4X5K A;  2B5G B;  1NSL A;  1VKC A;  2CNS A;  4U9Y A;  4XNH B;  3V8I A;  1Y7R A;  4KLV A;  5HMN A;  1IB1 E;  2OB0 A;  2QIR A;  2NMT A;  4AG9 A;  4KOX A;  3IGR A;  3TOB A;  4HKF A;  1P0H A;  1MJA A;  2AJ6 A;  3GY9 A;  4F0Y A;  3SXN A;  2J8N A;  3S6G A;  3VWE A;  2G3T A;  4R9M A;  2EUI A;  4H6Z A;  1LRZ A;  1MJ9 A;  3BJ7 A;  3E0K A;  3QB8 A;  2R1I A;  2VEZ A;  3GYA A;  1XIX A;  1Y9W A;  2FS5 A;  4XPK A;  4HNW B;  2Q4V A;  2D4P A;  4CRY B;  4NF1 A;  4L89 A;  4OLL A;  3TO7 A;  1S7N A;  2VQY A;  1IYL A;  3FXT A;  3I9S A;  3VWD A;  3CXP A;  1Q2Y A;  1Z4R A;  2G3A A;  4H89 A;  4B5P A;  2R8V A;  3R96 A;  3FYN A;  5F49 A;  2BSW A;  2PR1 A;  4QUS A;  4IF5 A;  4B5P B;  2JDC A;  4OAE A;  1Q2D A;  1MJB A;  1QSN A;  2B4D A;  2HV2 A;  1B87 A;  3T90 A;  2OU2 A;  2B4D B;  4R3K A;  2Q4Y A;  2GAN A;  3DR6 A;  2Z11 A;  1YVO A;  5DWN A;  4J3G A;  1YX0 A;  3ZJ0 A;  1M1D A;  4YRH A;  1SQH A;  4KVO E;  4FD6 A;  2B58 A;  4LX9 A;  2ZXV A;  1S7F A;  2PC1 A;  1XF8 A;  1S7L A;  4XNH C;  2C27 A;  2H5M A;  3KKW A;  3C26 A;  4KOS A;  4MBU A;  2CNT A;  1YGH A;  2OH1 A;  4HNX B;  2ATR A;  2Z10 A;  4QB9 A;  1ON0 A;  3R9F A;  1S60 A;  2ZW4 A;  2VBQ A;  2B5G A;  3IWG A;  2ZW5 A;  3F8K A;  4PV6 A;  3DSB A;  2BEI A;  4XPD B;  4CAV A;  5IV0 A;  2G0B A;  2K5T A;  4JXR A;  4KVM E;  2VI7 A;  4AB7 A;  3DDD A;  1YR0 A;  4JD6 A;  4JXQ A;  2FL4 A;  1BOB A;  3R95 A;  1M4G A;  4KZT A;  2HQY A;  1XMT A;  4CAX A;  1KZF A;  2IL4 A;  2ZW7 A;  2REF A;  1PUA A;  2Q44 A;  2JEV A;  4BMH A;  5EBV A;  2J8M A;  3EC4 A;  4K30 A;  4YGO A;  4UA3 A;  3S6F A;  2I79 A;  2JLM A;  4E8O A;  4XPL A;  5J8F A;  3W6S A;  4NEX A;  3B8G A;  2P6F A;  3D3S A;  2QEC A;  3NE7 A;  1BO4 A;  4FD4 A;  4KUB A;  4DNC A;  1VHS A;  4UBR A;  4NXY A;  5F46 A;  1OZP A;  3D2P A;  2B3U A;  4R87 A;  5HH1 A;  3FIX A;  3I3G A;  1Z9U A;  2VZZ A;  1J4J A;  2Z0Z A;  3F5B A;  2ZW6 A;  1U6M A;  3FRM A;  2ZPA A;  4FD5 A;  4E2A A;  2GIV A;  3OWC A;  1YVK A;  4M85 A;  3CXS A;  3R1K A;  3TTH A;  2PQ8 A;  1V0C A;  3TOA A;  2CY2 A;  4QC6 A;  3RYO A;  4PSW A;  1YLE A;  2ARH A;  4QBJ A; 
#chains in the Genus database with same CATH topology
 4MJ8 A;  3FNC A;  2FE7 A;  4ORF A;  3ZZI A;  1H8L A;  3K9U A;  2RB7 A;  2CIJ A;  3FX6 A;  2Q04 A;  4OAD A;  3TO9 A;  4OC1 A;  1ARM A;  1L0C A;  4MCR A;  5G22 A;  4KOR A;  1Z8T A;  2AE6 A;  3RO0 A;  1FY7 A;  4I49 A;  4GXH A;  2IQ6 A;  5LYD A;  3IU2 A;  3TCV A;  3KL9 A;  2VL1 A;  3TT2 A;  5AG4 A;  1Q7L A;  2P6E A;  4UFW A;  4XPD C;  2YNC C;  1Y9K A;  3PB7 X;  2P0W A;  3S9L A;  2O28 A;  4C2Y A;  1AUG A;  4Y49 B;  4P45 A;  4ZGY B;  1ZG8 A;  4CGO A;  2PDO A;  3D67 A;  3IWE A;  3KZW A;  4CPA A;  4Q7A A;  5JPH A;  1EE3 P;  3N7Z A;  4B14 A;  2RC4 A;  3TE4 A;  3MRU A;  1NE9 A;  1YW4 A;  4P4J A;  2OOT A;  1CBX A;  4DYO A;  3FB3 A;  2Y0M A;  2CF4 A;  3EY5 A;  4OP4 A;  1RXT A;  4KOW A;  2OZG A;  1M44 A;  2Z3O A;  3K2K A;  3FBU A;  4R3L A;  5ISV A;  2O53 A;  3LD2 A;  3NH4 A;  3JUW A;  1X12 A;  2ODF A;  4NGN A;  4KS9 A;  4ONW A;  4JYW A;  3H5Z A;  2Q0Y A;  4UEE A;  4GS4 A;  5FVJ A;  4B13 A;  4M3S A;  3MGD A;  3SJE A;  2JDD A;  2WPW A;  4JWP A;  4ZY1 A;  3B2Y A;  2ZEF A;  4FWU A;  3H4Q A;  1R57 A;  2P6G A;  1JWQ A;  4RS2 A;  3IC1 A;  5LRK A;  5G20 A;  2PJ6 A;  3QAH A;  4YFJ A;  1KUY A;  4F9U A;  2OZU A;  4KSI A;  3TFY A;  1DTD A;  1Z8W A;  2O4H A;  4FD7 A;  4MHD A;  5I4M A;  3K9T A;  4OME A;  1LAN A;  2J9A A;  1IIC A;  4UWI A;  1GYT A;  2A4N A;  4CS0 B;  1XE4 A;  2BL1 A;  4AVB A;  4KOV A;  1ZLH A;  3FMC A;  4NGM A;  4A32 A;  1QSO A;  1IU8 A;  4M6I A;  2I00 A;  5C82 A;  2C6P A;  3NE8 A;  4MFJ A;  2PJ3 A;  1Q2C A;  4UFX A;  5LRG A;  1M4D A;  4A37 A;  1AMP A;  1XBU A;  2AFZ A;  4KUA A;  4PK2 A;  5EC4 A;  1XFO A;  3SI1 A;  3PB8 X;  1S7K A;  3SHP A;  4TWE A;  1YME A;  2C6C A;  3CDX A;  4KOY A;  4L8A A;  4CRZ B;  5JQ4 A;  3TC8 A;  2BUE A;  1VHE A;  3G3S A;  3LOD A;  3GKR A;  3GB0 A;  5AGE A;  4ZI6 A;  3W6X A;  5CNP A;  4NJR A;  4QVT A;  2ZED A;  1HDU A;  2C6G A;  3H8G A;  1ARL A;  1PCA A;  4H6U A;  3BLN A;  1Z8L A;  4CAE A;  3JVN A;  4NFR A;  4CYQ A;  2F8H A;  3A9L A;  3PP9 A;  5THW A;  1Y0Y A;  4JLY A;  2ZEM A;  3TX8 A;  1WWZ A;  4KLW A;  3S6H A;  3D7G A;  3QNV A;  1WK4 A;  3W91 A;  4UWJ A;  2CTB A;  3D7F A;  4U9Z A;  2Q51 A;  2V8H A;  3DR8 A;  4ZY0 A;  2PSW A;  3S6K A;  2VXK A;  4AVC A;  4IUS A;  4R6T A;  5IB9 A;  2B3V A;  4A2Z A;  1TIQ A;  1TXR A;  3B3C A;  4RN7 A;  1MK4 A;  2BCO A;  2PJA A;  4UCN A;  1F2O A;  1IYK A;  1Z2L A;  2DPS A;  1QST A;  2PJ8 A;  1M4I A;  3TO6 A;  3VAT A;  4C2Z A;  5C88 A;  4MCP A;  2PR8 A;  2F5I A;  1Y7E A;  2HC9 A;  1TKJ A;  4PK3 A;  1CM0 A;  3CXQ A;  3GLJ A;  3LAC A;  4KOT A;  1K4J A;  4RI1 A;  4A33 A;  1Z5R A;  5D8N A;  2ZEL A;  4EWT A;  3P2H A;  4F8Z A;  4TNU A;  2QML A;  1BPN A;  1I21 A;  4Q36 A;  3D68 A;  1GHE A;  4MFQ A;  3GUX A;  2OZH A;  3T9Y A;  4OC4 A;  4NSQ A;  1X10 A;  2V8D A;  3FEC A;  4Y49 C;  3SJG A;  3D2M A;  1F57 A;  4UCM A;  2FIW A;  2AFW A;  4MI4 A;  4ZBG A;  5H84 A;  2Q7B A;  1ZLI A;  2R98 A;  1PU9 A;  4M6H A;  3SXO A;  5CBM A;  2PIY A;  3EXN A;  2D4O A;  1F2P A;  5EMI A;  4F6A A;  2Z3P A;  4NCZ A;  2EK8 A;  3WC6 A;  2FIA A;  4C68 A;  3PEI A;  4CYN A;  2ABZ A;  3IJ3 A;  1PYT B;  3WR7 A;  1S3Z A;  3KHX A;  1S5K A;  5GCN A;  3PGP A;  2X7B A;  1Z4E A;  4OC5 A;  1YK3 A;  3BJ8 A;  3D7D A;  3KR5 A;  5K8N A;  1CP6 A;  2Z3L A;  4IAV A;  2PRB A;  4P10 A;  3PB4 X;  4R76 A;  4AVA A;  3D8P A;  5BWA B;  1QMU A;  3D4U A;  4PSX A;  5IB0 A;  3ISZ A;  3R9E A;  4M6G A;  4R57 A;  4ZYQ A;  3R9G A;  3PZJ A;  2ZEE A;  5IX3 A;  3LMS A;  1YRE A;  2ZEP A;  4OC3 A;  4B5O A;  1CG2 A;  5A28 A;  2EBJ A;  2R7H A;  2FT0 A;  1Z8X A;  3HLP A;  4KVX A;  3JRU A;  4NGP A;  5DS0 A;  1VHO A;  1VGY A;  2J8R A;  3RZA A;  4CAW A;  4LUA A;  5H86 A;  4II9 A;  2CNM A;  2DPT A;  2EVN A;  4HNY B;  2RFH A;  3V7Z A;  4BBH A;  1QSR A;  2WPX A;  4KOU A;  3T8W A;  2FSR A;  1ZG7 A;  1NMT A;  1DE4 C;  2REE A;  2DXQ A;  2FXF A;  2VZY A;  2XEJ A;  3B3S A;  4W9Y A;  2B4B A;  3IO1 A;  2PRQ A;  3NA6 A;  3BI1 A;  3BI0 A;  2FCK A;  2PJ5 A;  4P4I A;  1AYE A;  3F0A A;  4C7H A;  3NFZ A;  3UY5 A;  5J8C A;  5J1Q A;  4P6Y A;  3DNS A;  1IID A;  3B3W A;  1CJW A;  4MY3 A;  4B11 A;  3G8W A;  5F09 A;  3EO4 A;  3B3V A;  5F48 A;  1B6B A;  3IWW A;  5DWM A;  4YWY A;  1N71 A;  4AG7 A;  3FED A;  1KUV A;  1RO5 A;  2ZEH A;  5KTA A;  4PXC A;  4MRI A;  4PPZ A;  4WWV A;  2KCW A;  1TF8 A;  4PXD A;  5E96 A;  3EFA A;  4EVY A;  1P4N A;  4E0A A;  1QQ9 A;  3P2F A;  3KAS A;  2GE3 A;  5AG5 A;  1XEB A;  4UF4 A;  4YU9 A;  4JJX A;  2YGW A;  5HVG A;  2ZOF A;  2PIZ A;  3PB9 X;  1UFH A;  2HUZ A;  1IY7 A;  4MY0 A;  2OR4 A;  4UIB A;  3IEH A;  5KTC A;  1QSM A;  3JTK A;  5KTD A;  3CPA A;  1I12 A;  1KUX A;  5I0C A;  4R7M A;  4ONU A;  2ZEG A;  3QAY A;  4P4D A;  4U5Y A;  5F47 A;  1I1D A;  2PJ4 A;  2POK A;  4X5K A;  2B5G B;  3B3T A;  1LFW A;  1NSL A;  2EWB A;  4UIA A;  1VKC A;  2CNS A;  4U9Y A;  4XNH B;  3V8I A;  2GRE A;  1Y7R A;  5AG7 A;  1TKF A;  3NH5 A;  4KLV A;  2JBJ A;  2BOA A;  5HMN A;  1IB1 E;  1XOV A;  2OB0 A;  2QIR A;  4B12 A;  3D66 A;  4FAI A;  4MHZ A;  2NMT A;  4AG9 A;  4KOX A;  3IGR A;  2PJ7 A;  3TOB A;  1YW6 A;  3SJF A;  4HKF A;  1P0H A;  1MJA A;  4CGM A;  2AJ6 A;  2HB6 A;  3GY9 A;  2Z3N A;  2NSM A;  3PFO A;  2XEI A;  4MHN A;  4F0Y A;  5HVF A;  3SXN A;  2J8N A;  3S6G A;  3VWE A;  2G3T A;  4R9M A;  2DF5 A;  2EUI A;  4MFK A;  4LQG A;  1HDQ A;  2ZEN A;  4C7I A;  4H6Z A;  1LRZ A;  2AFO A;  4KSF A;  1MJ9 A;  5LYF A;  3BJ7 A;  3ISX A;  3E0K A;  3QB8 A;  4MFP A;  2R1I A;  2WUU A;  3FEE A;  2VEZ A;  3IU1 A;  3GYA A;  4NGQ A;  1XIX A;  2WYR A;  3IIB A;  1IGB A;  4UEZ A;  4C2X A;  1LAP A;  1Y9W A;  2FS5 A;  4XPK A;  3WT4 A;  3BXM A;  5A27 A;  3FF3 A;  4HNW B;  2Q4V A;  1XRY A;  2D4P A;  3GIU A;  1XMB A;  4CRY B;  4MCQ A;  4NF1 A;  4L89 A;  4MFL A;  3RNZ A;  4OLL A;  1A2Z A;  3TO7 A;  4MHP A;  4CYP A;  2PJB A;  1S7N A;  2VQY A;  5K8P A;  1IYL A;  3FXT A;  3I9S A;  1HEE A;  4PXB A;  2GLJ A;  4X2T A;  3VWD A;  4H2K A;  3CXP A;  5LYL A;  4OID A;  1Q2Y A;  1Z4R A;  2G3A A;  4H89 A;  4B10 A;  3KQX A;  4B5P A;  4X3R A;  4IK2 A;  2PJ9 A;  2R8V A;  3H8F A;  3R96 A;  3VH9 A;  4P4F A;  3FYN A;  5F49 A;  5JGF A;  2BSW A;  2PR1 A;  4QUS A;  4IF5 A;  5G1Z A;  2CTC A;  4B5P B;  4B6Z A;  1YSJ A;  1M4L A;  2JDC A;  2ANP A;  1ELM P;  4OAE A;  4A94 A;  4P44 A;  3S9N A;  2V8V A;  3LWU A;  1Q2D A;  3D7H A;  3FJU A;  1MJB A;  2PE3 A;  2QYV A;  2EO8 A;  1QSN A;  2B4D A;  2HV2 A;  1B87 A;  2DEA A;  2OU2 A;  3SJX A;  3T90 A;  2Z3K A;  4A31 A;  3FH4 A;  4ZY2 A;  2PVW A;  4OC2 A;  4CGP A;  5D29 A;  1LCP A;  2B4D B;  1ZO0 A;  1VIX A;  2AFS A;  3CT9 A;  4R3K A;  2Q4Y A;  1IOF A;  2GAN A;  4BD9 A;  3DR6 A;  2Z11 A;  1YVO A;  2Z3M A;  5DWN A;  4LQ6 A;  4J3G A;  5HXD A;  3PFE A;  1YX0 A;  1R43 A;  1CPX A;  2JEW A;  3IFE A;  4Q38 A;  5JM6 A;  3ZJ0 A;  1M1D A;  5LRJ A;  4YRH A;  1SQH A;  1FNO A;  4KVO E;  4A38 A;  2Q7S A;  2XEG A;  4FD6 A;  2B58 A;  2BO9 A;  3WC7 A;  2QVP A;  4LX9 A;  1UWY A;  2ZXV A;  4KSA A;  3KQZ A;  4A30 A;  4JZ0 A;  4NGR A;  1S7F A;  2PC1 A;  4UCP A;  2C1C A;  1XF8 A;  1S7L A;  4A39 A;  7CPA A;  4XNH C;  4EFD A;  2C27 A;  1ZG9 A;  1BAV A;  2XEF A;  2H5M A;  3KKW A;  3C26 A;  2PCU A;  1CPS A;  4KOS A;  4MBU A;  2CNT A;  4A95 A;  2AFM A;  4RUH A;  1YGH A;  2OH1 A;  4HNX B;  2ATR A;  4X8I A;  4GM5 A;  2I3C A;  1RTQ A;  2Z10 A;  1KWM A;  4QB9 A;  2PJ1 A;  1ON0 A;  4FBE A;  3R9F A;  1S60 A;  2NYQ A;  2ZEO A;  4CGL A;  2ZW4 A;  2V77 A;  4MFZ A;  2QJ8 A;  3KGQ A;  4MCS A;  2AFX A;  2YNC A;  4NJQ A;  2Q4Z A;  4CYO A;  2VBQ A;  3B35 A;  2B5G A;  3IWG A;  2JBK A;  2ZW5 A;  3F8K A;  3PRT A;  4PV6 A;  3DSB A;  2BEI A;  2GLF A;  4XPD B;  4CAV A;  2PVV A;  3PB6 X;  2IMO A;  2F7V A;  4HPS A;  5IV0 A;  2G0B A;  2K5T A;  4JXR A;  4KVM E;  2VI7 A;  1IOI A;  3L2N A;  4AB7 A;  2PJC A;  3DDD A;  1YR0 A;  3PBE A;  3DLJ A;  3CZX A;  4JD6 A;  4JXQ A;  2FL4 A;  4FUU A;  1JQG A;  1BOB A;  2G9D A;  3HUV A;  2WSA A;  3KI9 A;  3R95 A;  3V38 A;  1R3N A;  4NGS A;  1LOK A;  1M4G A;  3KHZ A;  4KZT A;  4CAF A;  2HQY A;  1CP7 A;  1XMT A;  4CAX A;  1KZF A;  2IL4 A;  2ZW7 A;  2REF A;  1PUA A;  2PJ0 A;  2Q44 A;  2JEV A;  4OC0 A;  4PQA A;  4BMH A;  5EBV A;  2ZOG A;  2WZN A;  3DGV A;  4OKO A;  3WC5 A;  4UEF A;  2J8M A;  5CPA A;  3EC4 A;  3SI2 A;  4K30 A;  5G21 A;  4YGO A;  4BIN A;  4CGN A;  4UA3 A;  3S6F A;  2I79 A;  2JLM A;  4E8O A;  3MN8 A;  4XPL A;  2YND A;  4OIW A;  5J8F A;  3N5F A;  4WJB A;  1Y0R A;  3W6S A;  4NEX A;  2CXA A;  3B8G A;  2P6F A;  4Z65 A;  3D3S A;  3RAM A;  2QEC A;  3NE7 A;  1BPM A;  1BO4 A;  4FD4 A;  4ZX8 A;  4K3N A;  4KUB A;  4EME A;  1ELL P;  1LAM A;  4DNC A;  1VHS A;  4UBR A;  4AXV A;  2Q43 A;  4NGT A;  4NXY A;  4DUK A;  5F46 A;  3FVL A;  1OZP A;  3SI0 A;  3D2P A;  2B3U A;  4R87 A;  3PBB A;  3FIX A;  3I3G A;  2AFU A;  4ZX9 A;  1Z9U A;  5HH1 A;  5LYI A;  4P4B A;  2EK9 A;  5AG6 A;  4F0X A;  1YLO A;  2GFQ A;  2VZZ A;  1CX8 A;  3H8E A;  1J4J A;  2Z0Z A;  3F5B A;  2ZW6 A;  1U6M A;  1BLL E;  3FRM A;  2ZPA A;  1TF9 A;  4FD5 A;  4E2A A;  2GIV A;  4IHM A;  3WAB A;  3CPX A;  3OWC A;  4G1P A;  4F9V A;  1YVK A;  2V8G A;  3B7I A;  2IJZ A;  4M85 A;  3S9M A;  3VAR A;  1OBR A;  4MXU A;  1YQE A;  3CXS A;  4P4E A;  4R8F A;  3R1K A;  2PJ2 A;  4MMO A;  3TTH A;  1TKH A;  6CPA A;  1XJO A;  5HVH A;  2PQ8 A;  5ELY A;  1V0C A;  3KR4 A;  3TOA A;  4MHY A;  4UFV A;  8CPA A;  2CY2 A;  4QC6 A;  3RYO A;  4O23 A;  2YNE A;  4PSW A;  1NSA A;  1YLE A;  3BHX A;  5JH9 A;  1FT7 A;  2FVG A;  3NH8 A;  3RBU A;  2ARH A;  4DJL A;  5K8O A;  5K8M A;  4PXE A;  2GU2 A;  4QBJ A;  3I1U A; 
#chains in the Genus database with same CATH homology
 4MJ8 A;  3FNC A;  2FE7 A;  4ORF A;  3ZZI A;  3K9U A;  4OAD A;  2Q04 A;  3TO9 A;  1L0C A;  5G22 A;  4KOR A;  2AE6 A;  1FY7 A;  4I49 A;  3IU2 A;  3TCV A;  3TT2 A;  5AG4 A;  2P6E A;  4UFW A;  4XPD C;  2YNC C;  1Y9K A;  2P0W A;  2O28 A;  4C2Y A;  4Y49 B;  4ZGY B;  4CGO A;  2PDO A;  3IWE A;  5JPH A;  3N7Z A;  4B14 A;  2RC4 A;  3TE4 A;  1NE9 A;  3FB3 A;  2Y0M A;  3EY5 A;  1RXT A;  4KOW A;  2OZG A;  1M44 A;  2Z3O A;  3FBU A;  4R3L A;  5ISV A;  3LD2 A;  3JUW A;  4KS9 A;  3H5Z A;  2Q0Y A;  5FVJ A;  4GS4 A;  4B13 A;  4M3S A;  3MGD A;  2JDD A;  2WPW A;  4JWP A;  3H4Q A;  1R57 A;  2P6G A;  4RS2 A;  5G20 A;  3QAH A;  4YFJ A;  1KUY A;  2OZU A;  3TFY A;  4FD7 A;  4MHD A;  4UWI A;  1IIC A;  2A4N A;  4CS0 B;  1XE4 A;  2BL1 A;  4AVB A;  4KOV A;  4A32 A;  1QSO A;  2I00 A;  5C82 A;  4MFJ A;  1Q2C A;  4UFX A;  1M4D A;  4KUA A;  4PK2 A;  5EC4 A;  1S7K A;  3SHP A;  4CRZ B;  4KOY A;  5JQ4 A;  4L8A A;  2BUE A;  3G3S A;  3LOD A;  3GKR A;  5AGE A;  3W6X A;  5CNP A;  4QVT A;  4H6U A;  3BLN A;  4CAE A;  3JVN A;  4CYQ A;  3A9L A;  3PP9 A;  4JLY A;  1WWZ A;  4KLW A;  3S6H A;  3W91 A;  1WK4 A;  4UWJ A;  4U9Z A;  3DR8 A;  2PSW A;  3S6K A;  2VXK A;  4AVC A;  4IUS A;  2B3V A;  4A2Z A;  1TIQ A;  1MK4 A;  4UCN A;  1IYK A;  2DPS A;  1QST A;  4C2Z A;  1M4I A;  3TO6 A;  5C88 A;  2PR8 A;  2F5I A;  4PK3 A;  1CM0 A;  3CXQ A;  4KOT A;  1K4J A;  4RI1 A;  4A33 A;  3P2H A;  2QML A;  1I21 A;  4Q36 A;  4MFQ A;  1GHE A;  2OZH A;  3T9Y A;  4NSQ A;  4Y49 C;  3D2M A;  4UCM A;  5H84 A;  2FIW A;  4ZBG A;  4MI4 A;  2Q7B A;  2R98 A;  1PU9 A;  3SXO A;  3EXN A;  2D4O A;  4F6A A;  2Z3P A;  4NCZ A;  2FIA A;  4C68 A;  4CYN A;  3WR7 A;  1S3Z A;  1S5K A;  5GCN A;  3PGP A;  2X7B A;  1Z4E A;  1YK3 A;  3BJ8 A;  2Z3L A;  4AVA A;  2PRB A;  5BWA B;  3D8P A;  5IB0 A;  4PSX A;  3R9E A;  4R57 A;  3R9G A;  3PZJ A;  5IX3 A;  1YRE A;  4B5O A;  5A28 A;  2R7H A;  2FT0 A;  4KVX A;  4CAW A;  2J8R A;  4II9 A;  4LUA A;  5H86 A;  2CNM A;  2DPT A;  2EVN A;  4HNY B;  4BBH A;  1QSR A;  2WPX A;  4KOU A;  2FSR A;  1NMT A;  2VZY A;  2REE A;  2DXQ A;  2FXF A;  2B4B A;  2FCK A;  3F0A A;  4C7H A;  3UY5 A;  5J8C A;  3DNS A;  1IID A;  4MY3 A;  1CJW A;  4B11 A;  3G8W A;  3EO4 A;  5F48 A;  1B6B A;  5DWM A;  1N71 A;  4AG7 A;  1KUV A;  1RO5 A;  5KTA A;  2KCW A;  5E96 A;  3EFA A;  4EVY A;  1P4N A;  4E0A A;  3P2F A;  2GE3 A;  5AG5 A;  1XEB A;  4JJX A;  2YGW A;  1UFH A;  2HUZ A;  4MY0 A;  5KTC A;  1QSM A;  3JTK A;  5KTD A;  1I12 A;  1KUX A;  5I0C A;  4ONU A;  4U5Y A;  5F47 A;  1I1D A;  4X5K A;  2B5G B;  1NSL A;  1VKC A;  2CNS A;  4U9Y A;  4XNH B;  3V8I A;  1Y7R A;  5AG7 A;  4KLV A;  5HMN A;  1IB1 E;  2OB0 A;  2QIR A;  4B12 A;  2NMT A;  4AG9 A;  4KOX A;  3IGR A;  3TOB A;  4HKF A;  1P0H A;  1MJA A;  4CGM A;  2AJ6 A;  3GY9 A;  2Z3N A;  4F0Y A;  3SXN A;  2J8N A;  3S6G A;  3VWE A;  2G3T A;  4R9M A;  4MFK A;  2EUI A;  4C7I A;  4H6Z A;  1LRZ A;  4KSF A;  1MJ9 A;  3BJ7 A;  3E0K A;  3QB8 A;  4MFP A;  2R1I A;  2WUU A;  2VEZ A;  3IU1 A;  3GYA A;  1XIX A;  4C2X A;  1Y9W A;  2FS5 A;  4XPK A;  5A27 A;  4HNW B;  2Q4V A;  2D4P A;  4CRY B;  4NF1 A;  4L89 A;  4MFL A;  4OLL A;  3TO7 A;  4CYP A;  1S7N A;  2VQY A;  1IYL A;  3FXT A;  3I9S A;  3VWD A;  3CXP A;  1Q2Y A;  1Z4R A;  2G3A A;  4H89 A;  4B10 A;  4B5P A;  2R8V A;  3R96 A;  3FYN A;  5F49 A;  2BSW A;  2PR1 A;  4QUS A;  4IF5 A;  5G1Z A;  4B5P B;  2JDC A;  4OAE A;  1Q2D A;  1MJB A;  1QSN A;  2B4D A;  2HV2 A;  1B87 A;  3T90 A;  2OU2 A;  2Z3K A;  4A31 A;  4CGP A;  2B4D B;  1ZO0 A;  4R3K A;  2Q4Y A;  2GAN A;  3DR6 A;  2Z11 A;  1YVO A;  2Z3M A;  5DWN A;  4J3G A;  1YX0 A;  4Q38 A;  3ZJ0 A;  1M1D A;  4YRH A;  1SQH A;  4KVO E;  4FD6 A;  2B58 A;  4LX9 A;  2ZXV A;  4KSA A;  4A30 A;  1S7F A;  2PC1 A;  4UCP A;  1XF8 A;  1S7L A;  4XNH C;  2C27 A;  2H5M A;  3KKW A;  3C26 A;  4KOS A;  4A95 A;  4MBU A;  2CNT A;  1YGH A;  2OH1 A;  4HNX B;  2ATR A;  2Z10 A;  4QB9 A;  1ON0 A;  3R9F A;  1S60 A;  4CGL A;  2ZW4 A;  4MFZ A;  2YNC A;  4CYO A;  2VBQ A;  2B5G A;  3IWG A;  2ZW5 A;  3F8K A;  4PV6 A;  3DSB A;  2BEI A;  4XPD B;  4CAV A;  5IV0 A;  2G0B A;  2K5T A;  4JXR A;  4KVM E;  2VI7 A;  4AB7 A;  3DDD A;  1YR0 A;  4JD6 A;  4JXQ A;  2FL4 A;  1BOB A;  3R95 A;  2WSA A;  1M4G A;  4KZT A;  4CAF A;  2HQY A;  1XMT A;  4CAX A;  1KZF A;  2IL4 A;  2ZW7 A;  2REF A;  1PUA A;  2Q44 A;  2JEV A;  4BMH A;  5EBV A;  2J8M A;  3EC4 A;  4K30 A;  5G21 A;  4YGO A;  4CGN A;  4UA3 A;  3S6F A;  2I79 A;  2JLM A;  4E8O A;  4XPL A;  2YND A;  5J8F A;  3W6S A;  4NEX A;  2CXA A;  3B8G A;  2P6F A;  3D3S A;  2QEC A;  3NE7 A;  1BO4 A;  4FD4 A;  4KUB A;  4DNC A;  1VHS A;  4UBR A;  4NXY A;  5F46 A;  1OZP A;  3D2P A;  2B3U A;  4R87 A;  5HH1 A;  3FIX A;  3I3G A;  1Z9U A;  5AG6 A;  4F0X A;  2VZZ A;  1J4J A;  2Z0Z A;  3F5B A;  2ZW6 A;  1U6M A;  3FRM A;  2ZPA A;  4FD5 A;  4E2A A;  2GIV A;  3OWC A;  1YVK A;  4M85 A;  3CXS A;  3R1K A;  3TTH A;  2PQ8 A;  1V0C A;  3TOA A;  4UFV A;  2CY2 A;  4QC6 A;  3RYO A;  2YNE A;  4PSW A;  1YLE A;  2ARH A;  4QBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...