2ATRA

Acetyltransferase, gnat family protein sp0256 from streptococcus pneumoniae tigr4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
132
Chain Sequence
MITIKKQEIVKLEDVLHLYQAVGWTNEMLEQALSHSLVIYLALDGDAVVGLIRLVGDGFSSVFVQDLIVLPSYQRQGIGSSLMKEALGNFKEAYQVQLATEETEKNVGFYRSMGFEILSTYDCTGMIWINRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords acetyltransferase, GNAT family
publication title Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
total genus 27
structure length 132
sequence length 137
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2atrA00
2JDCA 2I79A 3DR6A 2VEZA 3C26A 5E96A 1SQHA 5DWMA 1U6MA 4KORA 2B5GA 2VZYA 4RS2A 5IV0A 1PUAA 2PR1A 2OZUA 3G3SA 3T9YA 4AB7A 3PGPA 1NMTA 2Q44A 5FVJA 1YVKA 2Q7BA 1S7KA 3WR7A 4LUAA 2Q4VA 3W6SA 4MHDA 1J4JA 2DXQA 3TO9A 2FIAA 2VZZA 1S3ZA 3S6GA 4JXRA 3LD2A 4YRHA 2F5IA 3FYNA 2JLMA 4GS4A 3QAHA 1R57A 2REFA 3DR8A 2BUEA 3EC4A 2D4OA 3P2FA 2Z11A 3P2HA 4AVBA 4AVCA 2FIWA 2GANA 4NSQA 2CY2A 2P6FA 2ARHA 4FD4A 3TOBA 4HNXB 3FRMA 2G0BA 2R7HA 4KUBA 2AE6A 1BO4A 4Y49B 2J8NA 2WPWA 3VWEA 2FT0A 1Q2YA 2ZXVA 4UA3A 3VWDA 1VKCA 5C82A 4CRYB 3FBUA 2RC4A 3TCVA 3E0KA 1LRZA 5HMNA 1S7LA 4KOVA 2PC1A 1S5KA 1QSNA 3D2MA 1S7FA 1BOBA 1M4GA 2K5TA 2R98A 4K30A 2B3UA 4XNHB 3BJ8A 4L8AA 3KKWA 4R57A 2B3VA 2ZW6A 4YGOA 2EVNA 1YR0A 3I9SA 4UWJA 4U9YA 4NCZA 1XMTA 4LX9A 2HQYA 2Y0MA 1I1DA 1CM0A 4KOWA 3IGRA 3H4QA 4UBRA 2PQ8A 1RXTA 1K4JA 2KCWA 1IYLA 1VHSA 2NMTA 4X5KA 3CXPA 2FXFA 2FSRA 3ZJ0A 2GIVA 4JD6A 1QSRA 2FCKA 4KOUA 5KTCA 1IB1E 1QSMA 1QSTA 2CNMA 4PK2A 2CNSA 4FD6A 4F6AA 4QVTA 4PSXA 5CNPA 1S60A 3G8WA 2JEVA 2VQYA 2EUIA 3FXTA 2HV2A 4XPDC 4U5YA 5DWNA 2VBQA 5F46A 2CNTA 5EBVA 5C88A 3RYOA 4QUSA 1KUVA 4MI4A 3W91A 1P0HA 2BL1A 2Z10A 1IICA 2B4DB 3R1KA 1XEBA 2ZW4A 3R96A 2Q0YA 5F48A 1XE4A 3B8GA 1OZPA 4H89A 4MJ8A 1M4IA 1MJAA 2QIRA 2ZW5A 4R3LA 3F8KA 1Q2CA 3CXSA 1PU9A 3FNCA 4MY0A 3EO4A 2B4BA 4OADA 3D8PA 2X7BA 1IYKA 1KZFA 3S6HA 1XF8A 4QB9A 4U9ZA 4KOYA 1RO5A 4B5PB 1NSLA 3W6XA 3F0AA 3EY5A 4HNYB 5F49A 4PV6A 1YX0A 2P0WA 1B6BA 3SXNA 2OH1A 1Q2DA 5H84A 1XIXA 1QSOA 4JXQA 2REEA 2OB0A 4KVXA 2B5GB 1KUXA 1M44A 3MGDA 4AG7A 3GKRA 2VXKA 1I21A 4BMHA 5KTAA 2J8RA 2GE3A 4F0YA 1MJBA 4RI1A 4R87A 4KVME 3IWGA 4KLVA 2PR8A 1TIQA 4B5OA 4XPLA 4KOXA 4IUSA 3TFYA 1P4NA 4XNHC 2ZW7A 4NF1A 3I3GA 1S7NA 1Y7RA 4CRZB 2FE7A 1N71A 4YFJA 3GYAA 3K9UA 2I00A 4HNWB 4AVAA 1FY7A 4E8OA 3R9EA 2OZGA 3D3SA 4M3SA 3S6KA 5HH1A 2AJ6A 4B5PA 1YK3A 4IF5A 3LODA 2IL4A 2Z0ZA 3D2PA 1WK4A 1YVOA 2FL4A 3DSBA 3TOAA 4XPKA 2P6EA 2OU2A 2QECA 3F5BA 4KUAA 2WPXA 5JQ4A 2R8VA 3FB3A 4JLYA 3FIXA 5J8FA 4QC6A 3TO7A 3NE7A 4I49A 2Q4YA 3CXQA 4R3KA 2Q04A 4J3GA 1NE9A 3ZZIA 4CAVA 2BSWA 3EFAA 3GY9A 3OWCA 5H86A 2ZPAA 1YLEA 2HUZA 4CS0B 2BEIA 2A4NA 4NXYA 2B58A 4OAEA 3UY5A 5I0CA 5JPHA 4ORFA 4ZBGA 4PK3A 1Z4RA 3JUWA 2JDDA 4L89A 4H6UA 4H6ZA 5IB0A 4KZTA 2PRBA 4JJXA 3DDDA 1Z9UA 1UFHA 4E2AA 2QMLA 3TT2A 1V0CA 1YGHA 3T90A 5IX3A 3DNSA 2ATRA 3PZJA 4CAWA 4AG9A 5ISVA 2O28A 4KOSA 2H5MA 3SXOA 3R95A 1M4DA 2FS5A 1GHEA 3EXNA 3PP9A 4II9A 4Y49C 1I12A 3R9GA 4FD5A 3R9FA 2B4DA 1B87A 1M1DA 3JVNA 4KLWA 5KTDA 3TE4A 3BLNA 2C27A 3N7ZA 4QBJA 4E0AA 1WWZA 2OZHA 5F47A 2PDOA 3QB8A 1ON0A 2J8MA 4KOTA 4R9MA 5GCNA 2R1IA 3S6FA 3V8IA 4JWPA 3TO6A 2G3AA 1YREA 4OLLA 2VI7A 4FD7A 4KVOE 4UWIA 1Y9WA 4EVYA 1L0CA 1IIDA 4M85A 5EC4A 4HKFA 4XPDB 4CAXA 1CJWA 4PSWA 1Y9KA 4ONUA 3SHPA 2PSWA 4MY3A 1MK4A 2D4PA 4NEXA 2P6GA 3TTHA 4DNCA 1MJ9A 3BJ7A 4MBUA 1Z4EA 2G3TA 5J8CA 1KUYA
chains in the Genus database with same CATH superfamily
3B3WA 2JDCA 2I79A 3DR6A 2JBKA 2VEZA 1H8LA 3C26A 5E96A 1SQHA 5DWMA 1U6MA 4KORA 2B5GA 2VZYA 3D66A 3LMSA 4RS2A 1BLLE 4NGNA 5IV0A 5AG4A 2JEWA 1PUAA 2PR1A 2OZUA 3G3SA 2CTCA 2IMOA 2FVGA 1UWYA 3PGPA 1NMTA 3T9YA 2Q44A 4AB7A 4P6YA 4KSIA 5FVJA 1YVKA 2Q7BA 1S7KA 1HEEA 4PPZA 3WR7A 2EK9A 4LUAA 1Z8XA 2Z3MA 1VHOA 2Q4VA 4IHMA 2XEFA 4MHDA 3SJFA 3W6SA 1J4JA 3IWEA 3WC7A 2NYQA 3SJEA 1M4LA 1FT7A 2DXQA 4MHZA 4P10A 3TO9A 1XOVA 2FIAA 4FWUA 2V8VA 2VZZA 1FNOA 1S3ZA 3QAYA 3PB6X 3S6GA 2PIZA 4JXRA 3LD2A 4YRHA 3TX8A 2F5IA 2O4HA 3FYNA 2JLMA 3DGVA 3D7GA 4EFDA 2XEGA 3GLJA 3PBEA 1CP6A 1YLOA 3QAHA 4GS4A 1R57A 2REFA 4MHPA 4OP4A 5DS0A 4CYOA 3DR8A 2HB6A 4UFWA 2BUEA 3EC4A 3BI0A 2QJ8A 1VGYA 2D4OA 3NA6A 1AYEA 3PB7X 4C7IA 3P2FA 2Z11A 3P2HA 4AVBA 4AVCA 4UCPA 2FIWA 2GANA 3CPXA 3FEEA 2CY2A 4NSQA 2P6FA 2ARHA 4FD4A 4MCQA 3TOBA 1F57A 4HNXB 3FRMA 7CPAA 2G0BA 2R7HA 2ABZA 4KUBA 2AE6A 2WSAA 5HXDA 3PFOA 1BO4A 4Y49B 2J8NA 2WPWA 3VWEA 2FT0A 4YU9A 4K3NA 2RB7A 1Q2YA 2ZXVA 2ZENA 4UA3A 4WJBA 3VWDA 1VKCA 2GREA 5THWA 5JH9A 5C82A 4IK2A 4CRYB 3FBUA 2YNCC 2RC4A 3WC6A 4NGSA 3TCVA 3E0KA 4PXDA 5AG5A 1LRZA 2NSMA 5HMNA 1S7LA 1LFWA 4KOVA 2ZEDA 2PJ6A 3QNVA 1LAMA 2PC1A 1S5KA 1QSNA 3RAMA 3D2MA 4TWEA 1ZLIA 2WZNA 1S7FA 5AG6A 1BOBA 1M4GA 4UFVA 2PJ1A 2K5TA 2PJAA 2R98A 4K30A 2B3UA 3FEDA 4XNHB 1ZO0A 3B3TA 3BJ8A 4L8AA 3KKWA 4R57A 1Z8TA 3PRTA 2B3VA 2ZW6A 2ODFA 3PFEA 2GU2A 4YGOA 5JGFA 2EVNA 1YR0A 5G1ZA 2PJ3A 3I9SA 1IGBA 4TNUA 2YNEA 2ZEEA 3KHZA 4UWJA 4OIWA 4ZY2A 4U9YA 4NCZA 1XMTA 2Z3LA 3RZAA 1Y7EA 4A33A 3FJUA 4P4JA 3PB8X 2HQYA 1ELMP 2Y0MA 4LX9A 5BWAB 4F0XA 4R7MA 1I1DA 2PJ5A 3KHXA 1CM0A 4NGQA 4FBEA 2JBJA 4KOWA 4KS9A 3IGRA 3H4QA 4UBRA 2PQ8A 3SI1A 1RXTA 2AFMA 2AFWA 1K4JA 2C6PA 2KCWA 2PRQA 1IYLA 4ZI6A 4ZY1A 1VHSA 3WC5A 1ARLA 1BPMA 2NMTA 4EMEA 2AFZA 3IFEA 4B11A 4MFPA 4X5KA 2PJ0A 3CXPA 4M6IA 2FXFA 2FSRA 3IJ3A 4CGPA 3ZJ0A 2GIVA 2DEAA 4JD6A 1QSRA 4P4FA 2FCKA 4KOUA 4LQGA 4BD9A 3SI2A 2Q4ZA 1QMUA 5KTCA 1IB1E 1QSMA 1QSTA 2AFXA 2CNMA 3FMCA 4PK2A 1CX8A 4Q36A 2CNSA 4CGNA 4UEEA 1Q7LA 2PE3A 4FD6A 4F6AA 3BXMA 4CGMA 4QVTA 4PSXA 5CNPA 1TXRA 1S60A 3G8WA 3FH4A 2JEVA 2C6GA 4A38A 2VQYA 4OKOA 2EUIA 4MFQA 2DF5A 3FXTA 1CG2A 2HV2A 3HUVA 4U5YA 4XPDC 5DWNA 2VBQA 5F46A 2CNTA 5EBVA 2ANPA 2WUUA 4MCSA 4C7HA 2PJ2A 5C88A 5LRKA 3RYOA 1DTDA 4QUSA 4MFLA 1KUVA 1TKFA 1LOKA 1JWQA 2PJCA 1QQ9A 1P0HA 4MI4A 5ELYA 4FUUA 3W91A 3WABA 4ZY0A 1XJOA 2BL1A 4W9YA 3NH8A 3KGQA 2Z10A 1IICA 2B4DB 3R1KA 2V8HA 1XEBA 4G1PA 4P4IA 2ZEMA 1CPXA 2ZW4A 1AUGA 1LANA 2EWBA 3R96A 2Q0YA 4A30A 5F48A 1Z5RA 2GLFA 5HVHA 1TF9A 1XE4A 2Z3KA 2XEJA 1F2OA 5I4MA 1A2ZA 4X3RA 3B8GA 3JRUA 4UCNA 1OZPA 4DUKA 4A32A 1Z8WA 4H89A 4MJ8A 3B3SA 4OC2A 1TF8A 2WYRA 3RO0A 1M4IA 3KQXA 4CGLA 3N5FA 1MJAA 4CAFA 2QIRA 4NGTA 2ZW5A 4R3LA 3F8KA 1IY7A 1LCPA 1Q2CA 5LYDA 2BOAA 3CXSA 3DLJA 3NH4A 1PU9A 4OC3A 1CBXA 4OIDA 3GIUA 3FNCA 4MY0A 2BO9A 1ELLP 3KR5A 5IB9A 3IU2A 3HLPA 8CPAA 3EO4A 2B4BA 2PVVA 4OADA 3D8PA 2X7BA 3ISZA 3RNZA 1IYKA 4C2XA 4RUHA 5D29A 1KZFA 4M6GA 5K8NA 4MCRA 3S6HA 3BHXA 1XF8A 2DPSA 4QB9A 4A37A 4U9ZA 3SJXA 4NJQA 3FF3A 4KOYA 1RO5A 2ZELA 4GXHA 4B5PB 1NSLA 3W6XA 4EWTA 3F0AA 3EY5A 4HNYB 5F49A 1XMBA 5LRGA 3KASA 2GLJA 3PB4X 4PV6A 1YX0A 1XRYA 2IQ6A 2P0WA 2POKA 4WWVA 1B6BA 4B10A 4DYOA 2OOTA 3SXNA 2OH1A 1Q2DA 1IOFA 2QVPA 3LWUA 5H84A 1IOIA 1XIXA 3IU1A 4HPSA 1QSOA 2PIYA 4JXQA 3VH9A 2REEA 1ZG7A 3V38A 3FX6A 3GUXA 2OB0A 4PQAA 4KVXA 2ZEGA 3ISXA 4P44A 2B5GB 1KUXA 1M44A 3MGDA 4LQ6A 4AG7A 1Z8LA 5CBMA 3GKRA 4YWYA 3RBUA 4UFXA 5HVFA 2ZOFA 2VXKA 1I21A 4BMHA 3NH5A 3A9LA 5KTAA 2J8RA 2GE3A 4F0YA 3T8WA 1YW6A 1MJBA 2EK8A 2QYVA 1X12A 4RI1A 4A94A 1PCAA 2PJ4A 4Q7AA 2OR4A 4R87A 4BINA 1YW4A 3IWGA 4KLVA 4KVME 4ZX9A 2PR8A 4RN7A 1TIQA 4B5OA 4XPLA 4KOXA 4IUSA 5G22A 5A28A 3TFYA 1P4NA 1RTQA 4XNHC 4UEZA 1VHEA 3V7ZA 1KWMA 2ZW7A 4NF1A 3I3GA 4IAVA 1S7NA 1Y7RA 2Z3OA 3CDXA 4NFRA 4CRZB 3NE8A 4NGRA 2FE7A 2PJ9A 4ZYQA 1N71A 4YFJA 3GYAA 3K9UA 2I00A 4P4EA 4HNWB 5AGEA 4AVAA 1FY7A 2PJ8A 1VIXA 2CF4A 4A95A 3S9NA 1AMPA 4E8OA 3R9EA 2OZGA 3D3SA 3KZWA 4M3SA 4UF4A 3S6KA 2PCUA 1LAPA 5HH1A 2AJ6A 4ZGYB 4B5PA 1YK3A 2Q43A 4IF5A 3LODA 2IL4A 5LYLA 2Z0ZA 3D2PA 1WK4A 4GM5A 3VARA 1YVOA 2FL4A 2O53A 4UEFA 4BBHA 2YNDA 3DSBA 3MRUA 3CT9A 3TOAA 4XPKA 4CYQA 2P6EA 2OU2A 2QECA 3PBBA 3F5BA 4MFJA 3D7HA 4PXCA 4KUAA 5F09A 2WPXA 1XBUA 2R8VA 2ZEFA 3FB3A 4MFKA 4JLYA 3D4UA 4MXUA 5JQ4A 3FIXA 2VL1A 5LYIA 5J8FA 1YMEA 1XFOA 5AG7A 3VATA 2EBJA 2J9AA 5J1QA 3SJGA 4QC6A 3TO7A 3NE7A 4I49A 2IJZA 4MHNA 1Y0YA 2Q4YA 2YGWA 2AFOA 1DE4C 1BAVA 3CXQA 1HDUA 4R3KA 4FAIA 2Q04A 2RFHA 1NE9A 3NFZA 4J3GA 3ZZIA 4CYPA 3B3VA 4CYNA 4R76A 3CPAA 4CAVA 2AFSA 2BSWA 3EFAA 3GY9A 1GYTA 3IO1A 3OWCA 5H86A 4F9VA 3S9MA 2AFUA 4MFZA 4MMOA 2ZPAA 1YLEA 2HUZA 5EMIA 2V8GA 2PJ7A 4M6HA 4NGMA 2CXAA 4KSFA 4CS0B 2BEIA 2A4NA 3KI9A 1YSJA 4NXYA 2B58A 4OAEA 5G20A 1ZG8A 3UY5A 4NGPA 5I0CA 5JPHA 4CPAA 4NJRA 2G9DA 3FVLA 4ORFA 4ZBGA 1TKHA 3KL9A 4PK3A 4P4BA 1Z4RA 3JUWA 2JDDA 4L89A 2C1CA 2EO8A 5CPAA 4B12A 4H6UA 3KR4A 4H6ZA 4O23A 4PXEA 5IB0A 3IIBA 2GFQA 3MN8A 1JQGA 4KZTA 4CGOA 2PRBA 4JJXA 4R6TA 2DPTA 4C2YA 3DDDA 1Z9UA 1UFHA 2Z3PA 2C6CA 2QMLA 5D8NA 3TT2A 4E2AA 1V0CA 3B35A 4Z65A 4ZX8A 1YGHA 4UCMA 3D7FA 1EE3P 2ZEHA 3IWWA 3T90A 6CPAA 3B2YA 3DNSA 3KQZA 5IX3A 2ATRA 2ZOGA 3D68A 3PZJA 4ONWA 1ARMA 4AG9A 4R8FA 4CAWA 5ISVA 2O28A 1ZLHA 4KOSA 3D67A 3SI0A 2H5MA 4H2KA 4C68A 3SXOA 3H8FA 3PB9X 3R95A 3LACA 1M4DA 3K9TA 3L2NA 2FS5A 4OC0A 2CIJA 1GHEA 3IEHA 4A39A 3EXNA 3FECA 3CZXA 3PP9A 4C2ZA 1HDQA 4Y49C 4II9A 1I12A 2ZEOA 4UIAA 3R9GA 4FD5A 3R9FA 2B4DA 4A31A 1B87A 1F2PA 4MRIA 4DJLA 1M1DA 3JVNA 4KLWA 5KTDA 4MCPA 3TE4A 3BLNA 2C27A 3N7ZA 4CAEA 4QBJA 2XEIA 4E0AA 4AXVA 3K2KA 3IC1A 1WWZA 2OZHA 2ZEPA 5F47A 5K8PA 2PDOA 4JZ0A 3QB8A 4F9UA 3TC8A 3B7IA 4B14A 1ON0A 2Z3NA 3B3CA 2J8MA 1CPSA 2F8HA 1IU8A 3I1UA 4KOTA 4PXBA 5K8MA 1YQEA 4R9MA 4MHYA 5GCNA 2R1IA 1BPNA 2CTBA 1Y0RA 4P4DA 3S6FA 4OMEA 3V8IA 2I3CA 3PEIA 4JWPA 1X10A 5G21A 3GB0A 3TO6A 3D7DA 2Q7SA 2G3AA 2YNCA 3BI1A 4X2TA 1R3NA 1YREA 5LYFA 4OLLA 2VI7A 5JM6A 4FD7A 1TKJA 2V8DA 4KVOE 1Y9WA 2Q51A 4UWIA 4EVYA 2HC9A 1PYTB 4KSAA 1L0CA 1IIDA 4M85A 4B6ZA 5EC4A 3H5ZA 4HKFA 5HVGA 2F7VA 1Z2LA 4XPDB 4B13A 4CAXA 1OBRA 1CJWA 1R43A 4PSWA 1NSAA 3JTKA 1Y9KA 4OC5A 4ONUA 4OC1A 3SHPA 5LRJA 2PJBA 2PSWA 4A2ZA 1CP7A 4P45A 4MY3A 4F8ZA 2PVWA 1MK4A 3S9LA 2D4PA 4NEXA 4JYWA 4UIBA 1ZG9A 2P6GA 3H8EA 4Q38A 4X8IA 3TTHA 4DNCA 1MJ9A 3BJ7A 5K8OA 4MBUA 1Z4EA 2G3TA 2V77A 4OC4A 5A27A 5J8CA 3H8GA 1KUYA 3WT4A 2BCOA
chains in the Genus database with same CATH topology
2JDCA 2I79A 3DR6A 2VEZA 3C26A 5E96A 1SQHA 5DWMA 1U6MA 4KORA 2B5GA 2VZYA 4RS2A 5IV0A 5AG4A 1PUAA 2PR1A 2OZUA 3G3SA 3T9YA 4AB7A 3PGPA 1NMTA 2Q44A 5FVJA 1YVKA 2Q7BA 1S7KA 3WR7A 4CYOA 4LUAA 2Z3MA 2Q4VA 3W6SA 4MHDA 1J4JA 3IWEA 2DXQA 3TO9A 2FIAA 2VZZA 1S3ZA 3S6GA 4JXRA 3LD2A 4YRHA 2F5IA 3FYNA 2JLMA 4GS4A 3QAHA 1R57A 2REFA 3DR8A 4UFWA 2BUEA 3EC4A 2D4OA 4C7IA 3P2FA 2Z11A 3P2HA 4AVBA 4AVCA 4UCPA 2FIWA 2GANA 4NSQA 2CY2A 2P6FA 2ARHA 4FD4A 3TOBA 4HNXB 3FRMA 2G0BA 2R7HA 4KUBA 2AE6A 2WSAA 1BO4A 4Y49B 2J8NA 2WPWA 3VWEA 2FT0A 1Q2YA 2ZXVA 4UA3A 3VWDA 1VKCA 5C82A 4CRYB 3FBUA 2YNCC 2RC4A 3TCVA 3E0KA 5AG5A 1LRZA 5HMNA 1S7LA 4KOVA 2PC1A 1S5KA 1QSNA 3D2MA 5AG6A 1S7FA 1BOBA 1M4GA 4UFVA 2K5TA 2R98A 4K30A 2B3UA 4XNHB 1ZO0A 3BJ8A 4L8AA 3KKWA 4R57A 2B3VA 2ZW6A 4YGOA 2EVNA 1YR0A 5G1ZA 3I9SA 2YNEA 4UWJA 4U9YA 4NCZA 1XMTA 2Z3LA 4A33A 4LX9A 2HQYA 2Y0MA 5BWAB 4F0XA 1I1DA 1CM0A 4KOWA 4KS9A 3IGRA 3H4QA 4UBRA 2PQ8A 1RXTA 1K4JA 2KCWA 1IYLA 1VHSA 2NMTA 4B11A 4MFPA 4X5KA 3CXPA 2FXFA 2FSRA 4CGPA 3ZJ0A 2GIVA 4JD6A 1QSRA 2FCKA 4KOUA 5KTCA 1IB1E 1QSMA 1QSTA 2CNMA 4PK2A 4Q36A 4CGNA 2CNSA 4FD6A 4F6AA 4CGMA 4QVTA 4PSXA 5CNPA 1S60A 3G8WA 2JEVA 2VQYA 2EUIA 4MFQA 3FXTA 2HV2A 4XPDC 4U5YA 5DWNA 2VBQA 5F46A 2CNTA 5EBVA 2WUUA 4C7HA 5C88A 3RYOA 4QUSA 4MFLA 1KUVA 4MI4A 3W91A 1P0HA 2BL1A 2Z10A 1IICA 2B4DB 3R1KA 1XEBA 2ZW4A 3R96A 2Q0YA 4A30A 5F48A 1XE4A 2Z3KA 3B8GA 4UCNA 1OZPA 4A32A 4H89A 4MJ8A 1M4IA 4CGLA 1MJAA 4CAFA 2QIRA 2ZW5A 4R3LA 3F8KA 1Q2CA 3CXSA 1PU9A 3FNCA 4MY0A 3IU2A 3EO4A 2B4BA 4OADA 3D8PA 2X7BA 1IYKA 4C2XA 1KZFA 3S6HA 1XF8A 2DPSA 4QB9A 4U9ZA 4KOYA 1RO5A 4B5PB 1NSLA 3W6XA 3F0AA 3EY5A 4HNYB 5F49A 4PV6A 1YX0A 2P0WA 1B6BA 4B10A 3SXNA 2OH1A 1Q2DA 5H84A 1XIXA 3IU1A 1QSOA 4JXQA 2REEA 2OB0A 4KVXA 2B5GB 1KUXA 1M44A 3MGDA 4AG7A 3GKRA 4UFXA 2VXKA 1I21A 4BMHA 3A9LA 5KTAA 2J8RA 2GE3A 4F0YA 1MJBA 4RI1A 4R87A 3IWGA 4KLVA 4KVME 2PR8A 1TIQA 4B5OA 4XPLA 4KOXA 4IUSA 5G22A 5A28A 3TFYA 1P4NA 4XNHC 2ZW7A 4NF1A 3I3GA 1S7NA 1Y7RA 2Z3OA 4CRZB 2FE7A 1N71A 4YFJA 3GYAA 3K9UA 2I00A 4HNWB 5AGEA 4AVAA 1FY7A 4A95A 4E8OA 3R9EA 2OZGA 3D3SA 4M3SA 3S6KA 5HH1A 2AJ6A 4ZGYB 4B5PA 1YK3A 4IF5A 3LODA 2IL4A 2Z0ZA 3D2PA 1WK4A 1YVOA 2FL4A 4BBHA 2YNDA 3DSBA 4CYQA 3TOAA 4XPKA 2P6EA 2OU2A 2QECA 4MFJA 3F5BA 4KUAA 2WPXA 4MFKA 2R8VA 3FB3A 5JQ4A 4JLYA 3FIXA 5J8FA 5AG7A 4QC6A 3TO7A 3NE7A 4I49A 2Q4YA 2YGWA 3CXQA 4R3KA 2Q04A 4J3GA 1NE9A 3ZZIA 4CYPA 4CYNA 4CAVA 2BSWA 3EFAA 3GY9A 3OWCA 5H86A 4MFZA 2ZPAA 1YLEA 2HUZA 2CXAA 4KSFA 4CS0B 2BEIA 2A4NA 4NXYA 2B58A 4OAEA 5G20A 3UY5A 5I0CA 5JPHA 4ORFA 4ZBGA 4PK3A 1Z4RA 3JUWA 2JDDA 4L89A 4B12A 4H6UA 4H6ZA 5IB0A 4KZTA 4CGOA 2PRBA 4JJXA 2DPTA 4C2YA 3DDDA 1Z9UA 1UFHA 2Z3PA 2QMLA 3TT2A 4E2AA 1V0CA 1YGHA 4UCMA 3T90A 5IX3A 3DNSA 2ATRA 3PZJA 4CAWA 4AG9A 5ISVA 2O28A 4KOSA 2H5MA 4C68A 3SXOA 3R95A 1M4DA 2FS5A 1GHEA 3EXNA 4C2ZA 3PP9A 4II9A 4Y49C 1I12A 3R9GA 4FD5A 3R9FA 2B4DA 4A31A 1B87A 1M1DA 3JVNA 4KLWA 5KTDA 3TE4A 3BLNA 2C27A 3N7ZA 4CAEA 4QBJA 4E0AA 1WWZA 2OZHA 5F47A 2PDOA 3QB8A 4B14A 1ON0A 2Z3NA 2J8MA 4KOTA 4R9MA 5GCNA 2R1IA 3S6FA 3V8IA 4JWPA 5G21A 3TO6A 2G3AA 2YNCA 1YREA 4OLLA 2VI7A 4FD7A 4KVOE 4UWIA 1Y9WA 4EVYA 4KSAA 1L0CA 1IIDA 4M85A 5EC4A 3H5ZA 4HKFA 4XPDB 4B13A 4CAXA 1CJWA 4PSWA 3JTKA 1Y9KA 4ONUA 3SHPA 4A2ZA 2PSWA 4MY3A 1MK4A 2D4PA 4NEXA 2P6GA 3TTHA 4DNCA 1MJ9A 3BJ7A 4MBUA 1Z4EA 2G3TA 5A27A 5J8CA 4Q38A 1KUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDC A;  2I79 A;  3DR6 A;  2VEZ A;  3C26 A;  5E96 A;  1SQH A;  5DWM A;  1U6M A;  4KOR A;  2B5G A;  2VZY A;  4RS2 A;  5IV0 A;  1PUA A;  2PR1 A;  2OZU A;  3G3S A;  3T9Y A;  4AB7 A;  3PGP A;  1NMT A;  2Q44 A;  5FVJ A;  1YVK A;  2Q7B A;  1S7K A;  3WR7 A;  4LUA A;  2Q4V A;  3W6S A;  4MHD A;  1J4J A;  2DXQ A;  3TO9 A;  2FIA A;  2VZZ A;  1S3Z A;  3S6G A;  4JXR A;  3LD2 A;  4YRH A;  2F5I A;  3FYN A;  2JLM A;  4GS4 A;  3QAH A;  1R57 A;  2REF A;  3DR8 A;  2BUE A;  3EC4 A;  2D4O A;  3P2F A;  2Z11 A;  3P2H A;  4AVB A;  4AVC A;  2FIW A;  2GAN A;  4NSQ A;  2CY2 A;  2P6F A;  2ARH A;  4FD4 A;  3TOB A;  4HNX B;  3FRM A;  2G0B A;  2R7H A;  4KUB A;  2AE6 A;  1BO4 A;  4Y49 B;  2J8N A;  2WPW A;  3VWE A;  2FT0 A;  1Q2Y A;  2ZXV A;  4UA3 A;  3VWD A;  1VKC A;  5C82 A;  4CRY B;  3FBU A;  2RC4 A;  3TCV A;  3E0K A;  1LRZ A;  5HMN A;  1S7L A;  4KOV A;  2PC1 A;  1S5K A;  1QSN A;  3D2M A;  1S7F A;  1BOB A;  1M4G A;  2K5T A;  2R98 A;  4K30 A;  2B3U A;  4XNH B;  3BJ8 A;  4L8A A;  3KKW A;  4R57 A;  2B3V A;  2ZW6 A;  4YGO A;  2EVN A;  1YR0 A;  3I9S A;  4UWJ A;  4U9Y A;  4NCZ A;  1XMT A;  4LX9 A;  2HQY A;  2Y0M A;  1I1D A;  1CM0 A;  4KOW A;  3IGR A;  3H4Q A;  4UBR A;  2PQ8 A;  1RXT A;  1K4J A;  2KCW A;  1IYL A;  1VHS A;  2NMT A;  4X5K A;  3CXP A;  2FXF A;  2FSR A;  3ZJ0 A;  2GIV A;  4JD6 A;  1QSR A;  2FCK A;  4KOU A;  5KTC A;  1IB1 E;  1QSM A;  1QST A;  2CNM A;  4PK2 A;  2CNS A;  4FD6 A;  4F6A A;  4QVT A;  4PSX A;  5CNP A;  1S60 A;  3G8W A;  2JEV A;  2VQY A;  2EUI A;  3FXT A;  2HV2 A;  4XPD C;  4U5Y A;  5DWN A;  2VBQ A;  5F46 A;  2CNT A;  5EBV A;  5C88 A;  3RYO A;  4QUS A;  1KUV A;  4MI4 A;  3W91 A;  1P0H A;  2BL1 A;  2Z10 A;  1IIC A;  2B4D B;  3R1K A;  1XEB A;  2ZW4 A;  3R96 A;  2Q0Y A;  5F48 A;  1XE4 A;  3B8G A;  1OZP A;  4H89 A;  4MJ8 A;  1M4I A;  1MJA A;  2QIR A;  2ZW5 A;  4R3L A;  3F8K A;  1Q2C A;  3CXS A;  1PU9 A;  3FNC A;  4MY0 A;  3EO4 A;  2B4B A;  4OAD A;  3D8P A;  2X7B A;  1IYK A;  1KZF A;  3S6H A;  1XF8 A;  4QB9 A;  4U9Z A;  4KOY A;  1RO5 A;  4B5P B;  1NSL A;  3W6X A;  3F0A A;  3EY5 A;  4HNY B;  5F49 A;  4PV6 A;  1YX0 A;  2P0W A;  1B6B A;  3SXN A;  2OH1 A;  1Q2D A;  5H84 A;  1XIX A;  1QSO A;  4JXQ A;  2REE A;  2OB0 A;  4KVX A;  2B5G B;  1KUX A;  1M44 A;  3MGD A;  4AG7 A;  3GKR A;  2VXK A;  1I21 A;  4BMH A;  5KTA A;  2J8R A;  2GE3 A;  4F0Y A;  1MJB A;  4RI1 A;  4R87 A;  4KVM E;  3IWG A;  4KLV A;  2PR8 A;  1TIQ A;  4B5O A;  4XPL A;  4KOX A;  4IUS A;  3TFY A;  1P4N A;  4XNH C;  2ZW7 A;  4NF1 A;  3I3G A;  1S7N A;  1Y7R A;  4CRZ B;  2FE7 A;  1N71 A;  4YFJ A;  3GYA A;  3K9U A;  2I00 A;  4HNW B;  4AVA A;  1FY7 A;  4E8O A;  3R9E A;  2OZG A;  3D3S A;  4M3S A;  3S6K A;  5HH1 A;  2AJ6 A;  4B5P A;  1YK3 A;  4IF5 A;  3LOD A;  2IL4 A;  2Z0Z A;  3D2P A;  1WK4 A;  1YVO A;  2FL4 A;  3DSB A;  3TOA A;  4XPK A;  2P6E A;  2OU2 A;  2QEC A;  3F5B A;  4KUA A;  2WPX A;  5JQ4 A;  2R8V A;  3FB3 A;  4JLY A;  3FIX A;  5J8F A;  4QC6 A;  3TO7 A;  3NE7 A;  4I49 A;  2Q4Y A;  3CXQ A;  4R3K A;  2Q04 A;  4J3G A;  1NE9 A;  3ZZI A;  4CAV A;  2BSW A;  3EFA A;  3GY9 A;  3OWC A;  5H86 A;  2ZPA A;  1YLE A;  2HUZ A;  4CS0 B;  2BEI A;  2A4N A;  4NXY A;  2B58 A;  4OAE A;  3UY5 A;  5I0C A;  5JPH A;  4ORF A;  4ZBG A;  4PK3 A;  1Z4R A;  3JUW A;  2JDD A;  4L89 A;  4H6U A;  4H6Z A;  5IB0 A;  4KZT A;  2PRB A;  4JJX A;  3DDD A;  1Z9U A;  1UFH A;  4E2A A;  2QML A;  3TT2 A;  1V0C A;  1YGH A;  3T90 A;  5IX3 A;  3DNS A;  2ATR A;  3PZJ A;  4CAW A;  4AG9 A;  5ISV A;  2O28 A;  4KOS A;  2H5M A;  3SXO A;  3R95 A;  1M4D A;  2FS5 A;  1GHE A;  3EXN A;  3PP9 A;  4II9 A;  4Y49 C;  1I12 A;  3R9G A;  4FD5 A;  3R9F A;  2B4D A;  1B87 A;  1M1D A;  3JVN A;  4KLW A;  5KTD A;  3TE4 A;  3BLN A;  2C27 A;  3N7Z A;  4QBJ A;  4E0A A;  1WWZ A;  2OZH A;  5F47 A;  2PDO A;  3QB8 A;  1ON0 A;  2J8M A;  4KOT A;  4R9M A;  5GCN A;  2R1I A;  3S6F A;  3V8I A;  4JWP A;  3TO6 A;  2G3A A;  1YRE A;  4OLL A;  2VI7 A;  4FD7 A;  4KVO E;  4UWI A;  1Y9W A;  4EVY A;  1L0C A;  1IID A;  4M85 A;  5EC4 A;  4HKF A;  4XPD B;  4CAX A;  1CJW A;  4PSW A;  1Y9K A;  4ONU A;  3SHP A;  2PSW A;  4MY3 A;  1MK4 A;  2D4P A;  4NEX A;  2P6G A;  3TTH A;  4DNC A;  1MJ9 A;  3BJ7 A;  4MBU A;  1Z4E A;  2G3T A;  5J8C A;  1KUY A; 
#chains in the Genus database with same CATH topology
 3B3W A;  2JDC A;  2I79 A;  3DR6 A;  2JBK A;  2VEZ A;  1H8L A;  3C26 A;  5E96 A;  1SQH A;  5DWM A;  1U6M A;  4KOR A;  2B5G A;  2VZY A;  3D66 A;  3LMS A;  4RS2 A;  1BLL E;  4NGN A;  5IV0 A;  5AG4 A;  2JEW A;  1PUA A;  2PR1 A;  2OZU A;  3G3S A;  2CTC A;  2IMO A;  2FVG A;  1UWY A;  3PGP A;  1NMT A;  3T9Y A;  2Q44 A;  4AB7 A;  4P6Y A;  4KSI A;  5FVJ A;  1YVK A;  2Q7B A;  1S7K A;  1HEE A;  4PPZ A;  3WR7 A;  2EK9 A;  4LUA A;  1Z8X A;  2Z3M A;  1VHO A;  2Q4V A;  4IHM A;  2XEF A;  4MHD A;  3SJF A;  3W6S A;  1J4J A;  3IWE A;  3WC7 A;  2NYQ A;  3SJE A;  1M4L A;  1FT7 A;  2DXQ A;  4MHZ A;  4P10 A;  3TO9 A;  1XOV A;  2FIA A;  4FWU A;  2V8V A;  2VZZ A;  1FNO A;  1S3Z A;  3QAY A;  3PB6 X;  3S6G A;  2PIZ A;  4JXR A;  3LD2 A;  4YRH A;  3TX8 A;  2F5I A;  2O4H A;  3FYN A;  2JLM A;  3DGV A;  3D7G A;  4EFD A;  2XEG A;  3GLJ A;  3PBE A;  1CP6 A;  1YLO A;  3QAH A;  4GS4 A;  1R57 A;  2REF A;  4MHP A;  4OP4 A;  5DS0 A;  4CYO A;  3DR8 A;  2HB6 A;  4UFW A;  2BUE A;  3EC4 A;  3BI0 A;  2QJ8 A;  1VGY A;  2D4O A;  3NA6 A;  1AYE A;  3PB7 X;  4C7I A;  3P2F A;  2Z11 A;  3P2H A;  4AVB A;  4AVC A;  4UCP A;  2FIW A;  2GAN A;  3CPX A;  3FEE A;  2CY2 A;  4NSQ A;  2P6F A;  2ARH A;  4FD4 A;  4MCQ A;  3TOB A;  1F57 A;  4HNX B;  3FRM A;  7CPA A;  2G0B A;  2R7H A;  2ABZ A;  4KUB A;  2AE6 A;  2WSA A;  5HXD A;  3PFO A;  1BO4 A;  4Y49 B;  2J8N A;  2WPW A;  3VWE A;  2FT0 A;  4YU9 A;  4K3N A;  2RB7 A;  1Q2Y A;  2ZXV A;  2ZEN A;  4UA3 A;  4WJB A;  3VWD A;  1VKC A;  2GRE A;  5THW A;  5JH9 A;  5C82 A;  4IK2 A;  4CRY B;  3FBU A;  2YNC C;  2RC4 A;  3WC6 A;  4NGS A;  3TCV A;  3E0K A;  4PXD A;  5AG5 A;  1LRZ A;  2NSM A;  5HMN A;  1S7L A;  1LFW A;  4KOV A;  2ZED A;  2PJ6 A;  3QNV A;  1LAM A;  2PC1 A;  1S5K A;  1QSN A;  3RAM A;  3D2M A;  4TWE A;  1ZLI A;  2WZN A;  1S7F A;  5AG6 A;  1BOB A;  1M4G A;  4UFV A;  2PJ1 A;  2K5T A;  2PJA A;  2R98 A;  4K30 A;  2B3U A;  3FED A;  4XNH B;  1ZO0 A;  3B3T A;  3BJ8 A;  4L8A A;  3KKW A;  4R57 A;  1Z8T A;  3PRT A;  2B3V A;  2ZW6 A;  2ODF A;  3PFE A;  2GU2 A;  4YGO A;  5JGF A;  2EVN A;  1YR0 A;  5G1Z A;  2PJ3 A;  3I9S A;  1IGB A;  4TNU A;  2YNE A;  2ZEE A;  3KHZ A;  4UWJ A;  4OIW A;  4ZY2 A;  4U9Y A;  4NCZ A;  1XMT A;  2Z3L A;  3RZA A;  1Y7E A;  4A33 A;  3FJU A;  4P4J A;  3PB8 X;  2HQY A;  1ELM P;  2Y0M A;  4LX9 A;  5BWA B;  4F0X A;  4R7M A;  1I1D A;  2PJ5 A;  3KHX A;  1CM0 A;  4NGQ A;  4FBE A;  2JBJ A;  4KOW A;  4KS9 A;  3IGR A;  3H4Q A;  4UBR A;  2PQ8 A;  3SI1 A;  1RXT A;  2AFM A;  2AFW A;  1K4J A;  2C6P A;  2KCW A;  2PRQ A;  1IYL A;  4ZI6 A;  4ZY1 A;  1VHS A;  3WC5 A;  1ARL A;  1BPM A;  2NMT A;  4EME A;  2AFZ A;  3IFE A;  4B11 A;  4MFP A;  4X5K A;  2PJ0 A;  3CXP A;  4M6I A;  2FXF A;  2FSR A;  3IJ3 A;  4CGP A;  3ZJ0 A;  2GIV A;  2DEA A;  4JD6 A;  1QSR A;  4P4F A;  2FCK A;  4KOU A;  4LQG A;  4BD9 A;  3SI2 A;  2Q4Z A;  1QMU A;  5KTC A;  1IB1 E;  1QSM A;  1QST A;  2AFX A;  2CNM A;  3FMC A;  4PK2 A;  1CX8 A;  4Q36 A;  2CNS A;  4CGN A;  4UEE A;  1Q7L A;  2PE3 A;  4FD6 A;  4F6A A;  3BXM A;  4CGM A;  4QVT A;  4PSX A;  5CNP A;  1TXR A;  1S60 A;  3G8W A;  3FH4 A;  2JEV A;  2C6G A;  4A38 A;  2VQY A;  4OKO A;  2EUI A;  4MFQ A;  2DF5 A;  3FXT A;  1CG2 A;  2HV2 A;  3HUV A;  4U5Y A;  4XPD C;  5DWN A;  2VBQ A;  5F46 A;  2CNT A;  5EBV A;  2ANP A;  2WUU A;  4MCS A;  4C7H A;  2PJ2 A;  5C88 A;  5LRK A;  3RYO A;  1DTD A;  4QUS A;  4MFL A;  1KUV A;  1TKF A;  1LOK A;  1JWQ A;  2PJC A;  1QQ9 A;  1P0H A;  4MI4 A;  5ELY A;  4FUU A;  3W91 A;  3WAB A;  4ZY0 A;  1XJO A;  2BL1 A;  4W9Y A;  3NH8 A;  3KGQ A;  2Z10 A;  1IIC A;  2B4D B;  3R1K A;  2V8H A;  1XEB A;  4G1P A;  4P4I A;  2ZEM A;  1CPX A;  2ZW4 A;  1AUG A;  1LAN A;  2EWB A;  3R96 A;  2Q0Y A;  4A30 A;  5F48 A;  1Z5R A;  2GLF A;  5HVH A;  1TF9 A;  1XE4 A;  2Z3K A;  2XEJ A;  1F2O A;  5I4M A;  1A2Z A;  4X3R A;  3B8G A;  3JRU A;  4UCN A;  1OZP A;  4DUK A;  4A32 A;  1Z8W A;  4H89 A;  4MJ8 A;  3B3S A;  4OC2 A;  1TF8 A;  2WYR A;  3RO0 A;  1M4I A;  3KQX A;  4CGL A;  3N5F A;  1MJA A;  4CAF A;  2QIR A;  4NGT A;  2ZW5 A;  4R3L A;  3F8K A;  1IY7 A;  1LCP A;  1Q2C A;  5LYD A;  2BOA A;  3CXS A;  3DLJ A;  3NH4 A;  1PU9 A;  4OC3 A;  1CBX A;  4OID A;  3GIU A;  3FNC A;  4MY0 A;  2BO9 A;  1ELL P;  3KR5 A;  5IB9 A;  3IU2 A;  3HLP A;  8CPA A;  3EO4 A;  2B4B A;  2PVV A;  4OAD A;  3D8P A;  2X7B A;  3ISZ A;  3RNZ A;  1IYK A;  4C2X A;  4RUH A;  5D29 A;  1KZF A;  4M6G A;  5K8N A;  4MCR A;  3S6H A;  3BHX A;  1XF8 A;  2DPS A;  4QB9 A;  4A37 A;  4U9Z A;  3SJX A;  4NJQ A;  3FF3 A;  4KOY A;  1RO5 A;  2ZEL A;  4GXH A;  4B5P B;  1NSL A;  3W6X A;  4EWT A;  3F0A A;  3EY5 A;  4HNY B;  5F49 A;  1XMB A;  5LRG A;  3KAS A;  2GLJ A;  3PB4 X;  4PV6 A;  1YX0 A;  1XRY A;  2IQ6 A;  2P0W A;  2POK A;  4WWV A;  1B6B A;  4B10 A;  4DYO A;  2OOT A;  3SXN A;  2OH1 A;  1Q2D A;  1IOF A;  2QVP A;  3LWU A;  5H84 A;  1IOI A;  1XIX A;  3IU1 A;  4HPS A;  1QSO A;  2PIY A;  4JXQ A;  3VH9 A;  2REE A;  1ZG7 A;  3V38 A;  3FX6 A;  3GUX A;  2OB0 A;  4PQA A;  4KVX A;  2ZEG A;  3ISX A;  4P44 A;  2B5G B;  1KUX A;  1M44 A;  3MGD A;  4LQ6 A;  4AG7 A;  1Z8L A;  5CBM A;  3GKR A;  4YWY A;  3RBU A;  4UFX A;  5HVF A;  2ZOF A;  2VXK A;  1I21 A;  4BMH A;  3NH5 A;  3A9L A;  5KTA A;  2J8R A;  2GE3 A;  4F0Y A;  3T8W A;  1YW6 A;  1MJB A;  2EK8 A;  2QYV A;  1X12 A;  4RI1 A;  4A94 A;  1PCA A;  2PJ4 A;  4Q7A A;  2OR4 A;  4R87 A;  4BIN A;  1YW4 A;  3IWG A;  4KLV A;  4KVM E;  4ZX9 A;  2PR8 A;  4RN7 A;  1TIQ A;  4B5O A;  4XPL A;  4KOX A;  4IUS A;  5G22 A;  5A28 A;  3TFY A;  1P4N A;  1RTQ A;  4XNH C;  4UEZ A;  1VHE A;  3V7Z A;  1KWM A;  2ZW7 A;  4NF1 A;  3I3G A;  4IAV A;  1S7N A;  1Y7R A;  2Z3O A;  3CDX A;  4NFR A;  4CRZ B;  3NE8 A;  4NGR A;  2FE7 A;  2PJ9 A;  4ZYQ A;  1N71 A;  4YFJ A;  3GYA A;  3K9U A;  2I00 A;  4P4E A;  4HNW B;  5AGE A;  4AVA A;  1FY7 A;  2PJ8 A;  1VIX A;  2CF4 A;  4A95 A;  3S9N A;  1AMP A;  4E8O A;  3R9E A;  2OZG A;  3D3S A;  3KZW A;  4M3S A;  4UF4 A;  3S6K A;  2PCU A;  1LAP A;  5HH1 A;  2AJ6 A;  4ZGY B;  4B5P A;  1YK3 A;  2Q43 A;  4IF5 A;  3LOD A;  2IL4 A;  5LYL A;  2Z0Z A;  3D2P A;  1WK4 A;  4GM5 A;  3VAR A;  1YVO A;  2FL4 A;  2O53 A;  4UEF A;  4BBH A;  2YND A;  3DSB A;  3MRU A;  3CT9 A;  3TOA A;  4XPK A;  4CYQ A;  2P6E A;  2OU2 A;  2QEC A;  3PBB A;  3F5B A;  4MFJ A;  3D7H A;  4PXC A;  4KUA A;  5F09 A;  2WPX A;  1XBU A;  2R8V A;  2ZEF A;  3FB3 A;  4MFK A;  4JLY A;  3D4U A;  4MXU A;  5JQ4 A;  3FIX A;  2VL1 A;  5LYI A;  5J8F A;  1YME A;  1XFO A;  5AG7 A;  3VAT A;  2EBJ A;  2J9A A;  5J1Q A;  3SJG A;  4QC6 A;  3TO7 A;  3NE7 A;  4I49 A;  2IJZ A;  4MHN A;  1Y0Y A;  2Q4Y A;  2YGW A;  2AFO A;  1DE4 C;  1BAV A;  3CXQ A;  1HDU A;  4R3K A;  4FAI A;  2Q04 A;  2RFH A;  1NE9 A;  3NFZ A;  4J3G A;  3ZZI A;  4CYP A;  3B3V A;  4CYN A;  4R76 A;  3CPA A;  4CAV A;  2AFS A;  2BSW A;  3EFA A;  3GY9 A;  1GYT A;  3IO1 A;  3OWC A;  5H86 A;  4F9V A;  3S9M A;  2AFU A;  4MFZ A;  4MMO A;  2ZPA A;  1YLE A;  2HUZ A;  5EMI A;  2V8G A;  2PJ7 A;  4M6H A;  4NGM A;  2CXA A;  4KSF A;  4CS0 B;  2BEI A;  2A4N A;  3KI9 A;  1YSJ A;  4NXY A;  2B58 A;  4OAE A;  5G20 A;  1ZG8 A;  3UY5 A;  4NGP A;  5I0C A;  5JPH A;  4CPA A;  4NJR A;  2G9D A;  3FVL A;  4ORF A;  4ZBG A;  1TKH A;  3KL9 A;  4PK3 A;  4P4B A;  1Z4R A;  3JUW A;  2JDD A;  4L89 A;  2C1C A;  2EO8 A;  5CPA A;  4B12 A;  4H6U A;  3KR4 A;  4H6Z A;  4O23 A;  4PXE A;  5IB0 A;  3IIB A;  2GFQ A;  3MN8 A;  1JQG A;  4KZT A;  4CGO A;  2PRB A;  4JJX A;  4R6T A;  2DPT A;  4C2Y A;  3DDD A;  1Z9U A;  1UFH A;  2Z3P A;  2C6C A;  2QML A;  5D8N A;  3TT2 A;  4E2A A;  1V0C A;  3B35 A;  4Z65 A;  4ZX8 A;  1YGH A;  4UCM A;  3D7F A;  1EE3 P;  2ZEH A;  3IWW A;  3T90 A;  6CPA A;  3B2Y A;  3DNS A;  3KQZ A;  5IX3 A;  2ATR A;  2ZOG A;  3D68 A;  3PZJ A;  4ONW A;  1ARM A;  4AG9 A;  4R8F A;  4CAW A;  5ISV A;  2O28 A;  1ZLH A;  4KOS A;  3D67 A;  3SI0 A;  2H5M A;  4H2K A;  4C68 A;  3SXO A;  3H8F A;  3PB9 X;  3R95 A;  3LAC A;  1M4D A;  3K9T A;  3L2N A;  2FS5 A;  4OC0 A;  2CIJ A;  1GHE A;  3IEH A;  4A39 A;  3EXN A;  3FEC A;  3CZX A;  3PP9 A;  4C2Z A;  1HDQ A;  4Y49 C;  4II9 A;  1I12 A;  2ZEO A;  4UIA A;  3R9G A;  4FD5 A;  3R9F A;  2B4D A;  4A31 A;  1B87 A;  1F2P A;  4MRI A;  4DJL A;  1M1D A;  3JVN A;  4KLW A;  5KTD A;  4MCP A;  3TE4 A;  3BLN A;  2C27 A;  3N7Z A;  4CAE A;  4QBJ A;  2XEI A;  4E0A A;  4AXV A;  3K2K A;  3IC1 A;  1WWZ A;  2OZH A;  2ZEP A;  5F47 A;  5K8P A;  2PDO A;  4JZ0 A;  3QB8 A;  4F9U A;  3TC8 A;  3B7I A;  4B14 A;  1ON0 A;  2Z3N A;  3B3C A;  2J8M A;  1CPS A;  2F8H A;  1IU8 A;  3I1U A;  4KOT A;  4PXB A;  5K8M A;  1YQE A;  4R9M A;  4MHY A;  5GCN A;  2R1I A;  1BPN A;  2CTB A;  1Y0R A;  4P4D A;  3S6F A;  4OME A;  3V8I A;  2I3C A;  3PEI A;  4JWP A;  1X10 A;  5G21 A;  3GB0 A;  3TO6 A;  3D7D A;  2Q7S A;  2G3A A;  2YNC A;  3BI1 A;  4X2T A;  1R3N A;  1YRE A;  5LYF A;  4OLL A;  2VI7 A;  5JM6 A;  4FD7 A;  1TKJ A;  2V8D A;  4KVO E;  1Y9W A;  2Q51 A;  4UWI A;  4EVY A;  2HC9 A;  1PYT B;  4KSA A;  1L0C A;  1IID A;  4M85 A;  4B6Z A;  5EC4 A;  3H5Z A;  4HKF A;  5HVG A;  2F7V A;  1Z2L A;  4XPD B;  4B13 A;  4CAX A;  1OBR A;  1CJW A;  1R43 A;  4PSW A;  1NSA A;  3JTK A;  1Y9K A;  4OC5 A;  4ONU A;  4OC1 A;  3SHP A;  5LRJ A;  2PJB A;  2PSW A;  4A2Z A;  1CP7 A;  4P45 A;  4MY3 A;  4F8Z A;  2PVW A;  1MK4 A;  3S9L A;  2D4P A;  4NEX A;  4JYW A;  4UIB A;  1ZG9 A;  2P6G A;  3H8E A;  4Q38 A;  4X8I A;  3TTH A;  4DNC A;  1MJ9 A;  3BJ7 A;  5K8O A;  4MBU A;  1Z4E A;  2G3T A;  2V77 A;  4OC4 A;  5A27 A;  5J8C A;  3H8G A;  1KUY A;  3WT4 A;  2BCO A; 
#chains in the Genus database with same CATH homology
 2JDC A;  2I79 A;  3DR6 A;  2VEZ A;  3C26 A;  5E96 A;  1SQH A;  5DWM A;  1U6M A;  4KOR A;  2B5G A;  2VZY A;  4RS2 A;  5IV0 A;  5AG4 A;  1PUA A;  2PR1 A;  2OZU A;  3G3S A;  3T9Y A;  4AB7 A;  3PGP A;  1NMT A;  2Q44 A;  5FVJ A;  1YVK A;  2Q7B A;  1S7K A;  3WR7 A;  4CYO A;  4LUA A;  2Z3M A;  2Q4V A;  3W6S A;  4MHD A;  1J4J A;  3IWE A;  2DXQ A;  3TO9 A;  2FIA A;  2VZZ A;  1S3Z A;  3S6G A;  4JXR A;  3LD2 A;  4YRH A;  2F5I A;  3FYN A;  2JLM A;  4GS4 A;  3QAH A;  1R57 A;  2REF A;  3DR8 A;  4UFW A;  2BUE A;  3EC4 A;  2D4O A;  4C7I A;  3P2F A;  2Z11 A;  3P2H A;  4AVB A;  4AVC A;  4UCP A;  2FIW A;  2GAN A;  4NSQ A;  2CY2 A;  2P6F A;  2ARH A;  4FD4 A;  3TOB A;  4HNX B;  3FRM A;  2G0B A;  2R7H A;  4KUB A;  2AE6 A;  2WSA A;  1BO4 A;  4Y49 B;  2J8N A;  2WPW A;  3VWE A;  2FT0 A;  1Q2Y A;  2ZXV A;  4UA3 A;  3VWD A;  1VKC A;  5C82 A;  4CRY B;  3FBU A;  2YNC C;  2RC4 A;  3TCV A;  3E0K A;  5AG5 A;  1LRZ A;  5HMN A;  1S7L A;  4KOV A;  2PC1 A;  1S5K A;  1QSN A;  3D2M A;  5AG6 A;  1S7F A;  1BOB A;  1M4G A;  4UFV A;  2K5T A;  2R98 A;  4K30 A;  2B3U A;  4XNH B;  1ZO0 A;  3BJ8 A;  4L8A A;  3KKW A;  4R57 A;  2B3V A;  2ZW6 A;  4YGO A;  2EVN A;  1YR0 A;  5G1Z A;  3I9S A;  2YNE A;  4UWJ A;  4U9Y A;  4NCZ A;  1XMT A;  2Z3L A;  4A33 A;  4LX9 A;  2HQY A;  2Y0M A;  5BWA B;  4F0X A;  1I1D A;  1CM0 A;  4KOW A;  4KS9 A;  3IGR A;  3H4Q A;  4UBR A;  2PQ8 A;  1RXT A;  1K4J A;  2KCW A;  1IYL A;  1VHS A;  2NMT A;  4B11 A;  4MFP A;  4X5K A;  3CXP A;  2FXF A;  2FSR A;  4CGP A;  3ZJ0 A;  2GIV A;  4JD6 A;  1QSR A;  2FCK A;  4KOU A;  5KTC A;  1IB1 E;  1QSM A;  1QST A;  2CNM A;  4PK2 A;  4Q36 A;  4CGN A;  2CNS A;  4FD6 A;  4F6A A;  4CGM A;  4QVT A;  4PSX A;  5CNP A;  1S60 A;  3G8W A;  2JEV A;  2VQY A;  2EUI A;  4MFQ A;  3FXT A;  2HV2 A;  4XPD C;  4U5Y A;  5DWN A;  2VBQ A;  5F46 A;  2CNT A;  5EBV A;  2WUU A;  4C7H A;  5C88 A;  3RYO A;  4QUS A;  4MFL A;  1KUV A;  4MI4 A;  3W91 A;  1P0H A;  2BL1 A;  2Z10 A;  1IIC A;  2B4D B;  3R1K A;  1XEB A;  2ZW4 A;  3R96 A;  2Q0Y A;  4A30 A;  5F48 A;  1XE4 A;  2Z3K A;  3B8G A;  4UCN A;  1OZP A;  4A32 A;  4H89 A;  4MJ8 A;  1M4I A;  4CGL A;  1MJA A;  4CAF A;  2QIR A;  2ZW5 A;  4R3L A;  3F8K A;  1Q2C A;  3CXS A;  1PU9 A;  3FNC A;  4MY0 A;  3IU2 A;  3EO4 A;  2B4B A;  4OAD A;  3D8P A;  2X7B A;  1IYK A;  4C2X A;  1KZF A;  3S6H A;  1XF8 A;  2DPS A;  4QB9 A;  4U9Z A;  4KOY A;  1RO5 A;  4B5P B;  1NSL A;  3W6X A;  3F0A A;  3EY5 A;  4HNY B;  5F49 A;  4PV6 A;  1YX0 A;  2P0W A;  1B6B A;  4B10 A;  3SXN A;  2OH1 A;  1Q2D A;  5H84 A;  1XIX A;  3IU1 A;  1QSO A;  4JXQ A;  2REE A;  2OB0 A;  4KVX A;  2B5G B;  1KUX A;  1M44 A;  3MGD A;  4AG7 A;  3GKR A;  4UFX A;  2VXK A;  1I21 A;  4BMH A;  3A9L A;  5KTA A;  2J8R A;  2GE3 A;  4F0Y A;  1MJB A;  4RI1 A;  4R87 A;  3IWG A;  4KLV A;  4KVM E;  2PR8 A;  1TIQ A;  4B5O A;  4XPL A;  4KOX A;  4IUS A;  5G22 A;  5A28 A;  3TFY A;  1P4N A;  4XNH C;  2ZW7 A;  4NF1 A;  3I3G A;  1S7N A;  1Y7R A;  2Z3O A;  4CRZ B;  2FE7 A;  1N71 A;  4YFJ A;  3GYA A;  3K9U A;  2I00 A;  4HNW B;  5AGE A;  4AVA A;  1FY7 A;  4A95 A;  4E8O A;  3R9E A;  2OZG A;  3D3S A;  4M3S A;  3S6K A;  5HH1 A;  2AJ6 A;  4ZGY B;  4B5P A;  1YK3 A;  4IF5 A;  3LOD A;  2IL4 A;  2Z0Z A;  3D2P A;  1WK4 A;  1YVO A;  2FL4 A;  4BBH A;  2YND A;  3DSB A;  4CYQ A;  3TOA A;  4XPK A;  2P6E A;  2OU2 A;  2QEC A;  4MFJ A;  3F5B A;  4KUA A;  2WPX A;  4MFK A;  2R8V A;  3FB3 A;  5JQ4 A;  4JLY A;  3FIX A;  5J8F A;  5AG7 A;  4QC6 A;  3TO7 A;  3NE7 A;  4I49 A;  2Q4Y A;  2YGW A;  3CXQ A;  4R3K A;  2Q04 A;  4J3G A;  1NE9 A;  3ZZI A;  4CYP A;  4CYN A;  4CAV A;  2BSW A;  3EFA A;  3GY9 A;  3OWC A;  5H86 A;  4MFZ A;  2ZPA A;  1YLE A;  2HUZ A;  2CXA A;  4KSF A;  4CS0 B;  2BEI A;  2A4N A;  4NXY A;  2B58 A;  4OAE A;  5G20 A;  3UY5 A;  5I0C A;  5JPH A;  4ORF A;  4ZBG A;  4PK3 A;  1Z4R A;  3JUW A;  2JDD A;  4L89 A;  4B12 A;  4H6U A;  4H6Z A;  5IB0 A;  4KZT A;  4CGO A;  2PRB A;  4JJX A;  2DPT A;  4C2Y A;  3DDD A;  1Z9U A;  1UFH A;  2Z3P A;  2QML A;  3TT2 A;  4E2A A;  1V0C A;  1YGH A;  4UCM A;  3T90 A;  5IX3 A;  3DNS A;  2ATR A;  3PZJ A;  4CAW A;  4AG9 A;  5ISV A;  2O28 A;  4KOS A;  2H5M A;  4C68 A;  3SXO A;  3R95 A;  1M4D A;  2FS5 A;  1GHE A;  3EXN A;  4C2Z A;  3PP9 A;  4II9 A;  4Y49 C;  1I12 A;  3R9G A;  4FD5 A;  3R9F A;  2B4D A;  4A31 A;  1B87 A;  1M1D A;  3JVN A;  4KLW A;  5KTD A;  3TE4 A;  3BLN A;  2C27 A;  3N7Z A;  4CAE A;  4QBJ A;  4E0A A;  1WWZ A;  2OZH A;  5F47 A;  2PDO A;  3QB8 A;  4B14 A;  1ON0 A;  2Z3N A;  2J8M A;  4KOT A;  4R9M A;  5GCN A;  2R1I A;  3S6F A;  3V8I A;  4JWP A;  5G21 A;  3TO6 A;  2G3A A;  2YNC A;  1YRE A;  4OLL A;  2VI7 A;  4FD7 A;  4KVO E;  4UWI A;  1Y9W A;  4EVY A;  4KSA A;  1L0C A;  1IID A;  4M85 A;  5EC4 A;  3H5Z A;  4HKF A;  4XPD B;  4B13 A;  4CAX A;  1CJW A;  4PSW A;  3JTK A;  1Y9K A;  4ONU A;  3SHP A;  4A2Z A;  2PSW A;  4MY3 A;  1MK4 A;  2D4P A;  4NEX A;  2P6G A;  3TTH A;  4DNC A;  1MJ9 A;  3BJ7 A;  4MBU A;  1Z4E A;  2G3T A;  5A27 A;  5J8C A;  4Q38 A;  1KUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...