2ATRA

Acetyltransferase, gnat family protein sp0256 from streptococcus pneumoniae tigr4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
132
Chain Sequence
b'MITIKKQEIVKLEDVLHLYQAVGWTNEMLEQALSHSLVIYLALDGDAVVGLIRLVGDGFSSVFVQDLIVLPSYQRQGIGSSLMKEALGNFKEAYQVQLATEETEKNVGFYRSMGFEILSTYDCTGMIWINRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase, GNAT family
publication title Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 27
structure length 132
sequence length 137
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2atrA00
4U9ZA 1WK4A 2Z10A 2VQYA 4CRYB 2ATRA 1Z9UA 2B3VA 5J8FA 1M4DA 3TE4A 2ZW4A 5C88A 2Q44A 4B5OA 3V8IA 1S7NA 1M4IA 2OH1A 4L8AA 1S7FA 1Z4RA 3N7ZA 2CNMA 5KTAA 1YVOA 2WPXA 4UA3A 3R9EA 1YK3A 4XPLA 5F49A 2Z11A 3TOAA 1VHSA 3S6HA 4JWPA 1WWZA 4YFJA 3ZJ0A 1BO4A 3QB8A 4NF1A 4KOYA 2ZW5A 3T9YA 4E8OA 5GCNA 1TIQA 5HH1A 3T90A 3PGPA 4OLLA 3FBUA 3DNSA 2DXQA 3BJ8A 2NMTA 2Q04A 1YX0A 4KOUA 4H89A 4JLYA 5F47A 2IL4A 4MJ8A 2BSWA 3EY5A 2BEIA 1P4NA 1QSNA 4CAXA 4LUAA 4HNXB 2I00A 3TO9A 4KOVA 2H5MA 1YGHA 2FCKA 2GANA 1J4JA 1S7KA 2BL1A 4F6AA 1NSLA 4MBUA 1S5KA 2J8MA 3FNCA 4AVBA 1CJWA 3LODA 4YGOA 4AG7A 2PC1A 4R3LA 1R57A 3IGRA 2D4OA 3GY9A 2B3UA 2HQYA 1QSOA 1YVKA 4Y49B 5JPHA 3F8KA 3TT2A 3NE7A 3R1KA 4MY3A 2REFA 1MJ9A 3PP9A 5H84A 1IB1E 2CNSA 4E0AA 2KCWA 3FB3A 3OWCA 4JXQA 5HMNA 2J8NA 3VWDA 3EC4A 3IWGA 2RC4A 1NE9A 4I49A 1YR0A 5EC4A 3TCVA 4R9MA 4KVXA 1UFHA 4B5PA 1Z4EA 1XMTA 1XF8A 2R98A 1KUYA 1VKCA 3S6GA 2AJ6A 2B5GB 4AG9A 4FD4A 3GYAA 3FIXA 5ISVA 4PV6A 4JD6A 3CXQA 4KOTA 3MGDA 4CAVA 2P6EA 4XPDB 2PR1A 3D2PA 2OB0A 1M44A 3P2HA 1KUVA 1QSRA 1RO5A 3F0AA 3JVNA 4K30A 3WR7A 2OZGA 4KUAA 4KVOE 3W6SA 3PZJA 5C82A 5H86A 2PDOA 4KOWA 2CY2A 4UBRA 4AB7A 4HNWB 4XPDC 3BJ7A 3TTHA 3SXNA 1K4JA 3SHPA 2R1IA 4RS2A 3G3SA 2FT0A 2R8VA 4RI1A 4PK2A 1SQHA 5IB0A 2JDCA 5KTCA 2OZHA 2GE3A 2X7BA 1M1DA 1QSMA 2P0WA 1IYKA 3P2FA 2B4BA 3FXTA 4PSXA 2QIRA 5I0CA 4ONUA 1Q2DA 3I3GA 3K9UA 5DWMA 2VEZA 1U6MA 4IF5A 3EFAA 3F5BA 3EO4A 2OZUA 3EXNA 3FYNA 3R9GA 4ZBGA 2AE6A 2Z0ZA 4BMHA 4MI4A 3R9FA 2J8RA 2Q7BA 5EBVA 4AVCA 1YREA 2FL4A 2F5IA 1S60A 4QUSA 1ON0A 4HKFA 1XIXA 4KORA 3W91A 2B58A 3SXOA 2EUIA 4XNHB 2JLMA 1IYLA 2PQ8A 3G8WA 3R96A 3D3SA 3LD2A 4X5KA 2P6FA 1RXTA 4KVME 3I9SA 3D2MA 4OAEA 2Y0MA 3W6XA 2G3TA 4Y49C 4R3KA 2I79A 4PSWA 2EVNA 1PU9A 2FE7A 4ORFA 1B6BA 3VWEA 4XNHC 4AVAA 5FVJA 2PRBA 4NXYA 3TO7A 4KZTA 1Y9WA 4MHDA 3B8GA 5IX3A 1KZFA 4FD5A 2ZW6A 1CM0A 4H6ZA 3ZZIA 4QBJA 4KOXA 2K5TA 1KUXA 1PUAA 2ZW7A 2B4DA 3UY5A 2WPWA 3DSBA 4JJXA 1NMTA 4M85A 4M3SA 1OZPA 3DDDA 4R87A 3C26A 2GIVA 3CXSA 2BUEA 4H6UA 4DNCA 4HNYB 2ZPAA 4KOSA 2VZZA 2PSWA 5JQ4A 4CRZB 1I1DA 1XE4A 1Q2CA 1Q2YA 4YRHA 2Q4YA 3E0KA 1FY7A 2P6GA 3TFYA 2VXKA 2ARHA 2OU2A 4UWJA 3TO6A 2VI7A 2A4NA 2O28A 4B5PB 2D4PA 1GHEA 3S6FA 1LRZA 4FD6A 4CAWA 4L89A 2Q0YA 5KTDA 1V0CA 5CNPA 3D8PA 4QVTA 4J3GA 4QB9A 4XPKA 4NCZA 2B4DB 2R7HA 1BOBA 3GKRA 4QC6A 1P0HA 2REEA 5DWNA 1I21A 2C27A 1IIDA 2PR8A 1YLEA 3DR6A 4MY0A 4F0YA 5F48A 2HUZA 1B87A 1QSTA 1XEBA 3R95A 2FXFA 2ZXVA 4GS4A 3RYOA 2JDDA 1IICA 5J8CA 3DR8A 1L0CA 4IUSA 2VZYA 1MJBA 1Y7RA 1MK4A 2B5GA 1Y9KA 5IV0A 3CXPA 1I12A 2FIWA 3FRMA 4NSQA 2G3AA 3JUWA 4UWIA 4KLWA 4PK3A 5E96A 4LX9A 4OADA 1S3ZA 4U5YA 2QMLA 5F46A 1M4GA 3TOBA 4KUBA 4R57A 4U9YA 2FIAA 4EVYA 2G0BA 4FD7A 4E2AA 2QECA 3S6KA 2VBQA 2Q4VA 2FS5A 2CNTA 4KLVA 2JEVA 4II9A 1MJAA 2FSRA 3BLNA 4NEXA 3QAHA 3KKWA 2HV2A 4JXRA 1N71A 1S7LA 3H4QA 4CS0B
chains in the Genus database with same CATH superfamily
4U9ZA 2BO9A 1WK4A 1LAPA 2Z10A 4W9YA 2VQYA 3MN8A 4MXUA 2F7VA 3T8WA 4CRYB 2ATRA 1FT7A 2RB7A 1F2OA 3SI1A 1Z9UA 1IOFA 2B3VA 1F2PA 5J8FA 4ZY2A 3KQZA 1M4DA 3D68A 4MHNA 3TE4A 2HC9A 2ZW4A 5C88A 2Q44A 4B5OA 3V8IA 1S7NA 1M4IA 2G9DA 2OH1A 4L8AA 3BI0A 1S7FA 1Z4RA 4CYOA 3N7ZA 2CNMA 5KTAA 3IC1A 2V8VA 4RN7A 1YVOA 2WPXA 3VARA 4UA3A 3NA6A 2EWBA 3R9EA 1YK3A 4OP4A 4F0XA 3H8GA 4XPLA 4C2YA 1LFWA 4MCSA 1Z8LA 5F49A 1LANA 2CXAA 2Z11A 5G1ZA 1VHSA 3KZWA 3TOAA 1YW6A 3S6HA 4PXDA 2BOAA 4ZY0A 4WWVA 4JWPA 2YNCC 3KHZA 1ZG7A 2DF5A 2PVVA 1WWZA 1LAMA 4MHYA 4YFJA 4MCRA 2I3CA 3ZJ0A 3NH8A 1BO4A 3QB8A 4M6GA 2Q51A 1QMUA 3GIUA 2AFUA 4NF1A 3I1UA 2GREA 4KOYA 2ZW5A 2PJ7A 3FMCA 3FEDA 5GCNA 2XEGA 4MFQA 1TIQA 1Y0YA 3K9TA 3T9YA 2O4HA 5HH1A 3T90A 2IQ6A 5LRJA 4Q38A 3KI9A 2Q43A 3PGPA 4OLLA 1Z5RA 2ZEOA 3DNSA 3FBUA 2DXQA 3BJ8A 2NMTA 2Q04A 1M4LA 1YX0A 2QJ8A 3KR4A 4KOUA 4UFVA 4B11A 4H89A 4JLYA 5F47A 2JEWA 2IL4A 2ZENA 3D67A 4MJ8A 4X3RA 2BSWA 3S9NA 2PRQA 3EY5A 4FWUA 2BEIA 1P4NA 1QSNA 4CAXA 4LUAA 4HNXB 2NSMA 2I00A 3H8EA 4IAVA 3TO9A 3PB6X 4KOVA 2H5MA 5LYIA 1YGHA 4A95A 1VGYA 2DPSA 2FCKA 2GANA 1J4JA 1S7KA 4R8FA 2BL1A 4KSIA 4F6AA 1NSLA 3QNVA 4MBUA 3D7HA 1S5KA 2J8MA 2YNDA 3FNCA 4AVBA 1CJWA 5LYFA 3LODA 1TKJA 1IOIA 4YGOA 4AG7A 2PC1A 5HVHA 4C7IA 4R3LA 1R57A 3IGRA 4KSFA 1Y0RA 2D4OA 2Z3LA 4NGRA 3GY9A 3RNZA 3V38A 2B3UA 5K8NA 1AUGA 4CGLA 3BI1A 2HQYA 4UF4A 1QSOA 3VH9A 5LYLA 4LQ6A 1YVKA 2CF4A 2OR4A 2AFWA 3B7IA 4Y49B 4E8OA 5HXDA 3NH5A 4P4JA 4P4BA 4MFPA 5JPHA 3F8KA 3TT2A 2IJZA 3NE7A 3R1KA 5K8OA 4MY3A 2EK8A 2V8DA 2DEAA 2REFA 1MJ9A 2DPTA 3PBBA 1CP6A 3PP9A 5H84A 1IB1E 2CNSA 2YNCA 4MHZA 4A30A 2KCWA 4OC0A 4OC5A 3FJUA 4E0AA 3FB3A 3PB8X 4ONWA 3CZXA 2ODFA 5EMIA 3OWCA 1PYTB 4JXQA 4NFRA 5HMNA 4F9VA 3IEHA 2V8HA 4CYQA 4Q36A 4UCPA 2J8NA 3VWDA 3CPXA 3EC4A 3IWGA 2RC4A 4CGOA 1NE9A 4I49A 4MHPA 2Z3PA 3D7FA 3QAYA 1ZLIA 2Q7SA 1YR0A 4P6YA 4OC4A 4R76A 5EC4A 3TCVA 4R9MA 4KVXA 5G22A 2OOTA 1UFHA 4B5PA 1Z4EA 3FECA 1XMTA 1VIXA 1XF8A 4A38A 2R98A 4NGSA 1KUYA 1VKCA 1Z8XA 3S6GA 5J1QA 2AJ6A 2B5GB 3IIBA 1ZLHA 6CPAA 4AG9A 4FD4A 3GYAA 2PJAA 3FIXA 4OMEA 4ZI6A 4X2TA 5ISVA 3KQXA 4PV6A 1JWQA 4JD6A 4FAIA 4RUHA 3CXQA 4KOTA 3MGDA 4UIBA 2GLFA 4CAVA 2P6EA 4XPDB 3WC6A 3FEEA 2Z3NA 3PFOA 3LMSA 2PR1A 1YLOA 2RFHA 3D2PA 4NGQA 1ARLA 4TWEA 2OB0A 4MCQA 4OIDA 1M44A 4IHMA 1A2ZA 3V7ZA 3P2HA 3PFEA 4CAFA 1KUVA 1QSRA 4B13A 1RO5A 1RTQA 3F0AA 4P44A 4C2ZA 1BAVA 3JVNA 4K30A 4A94A 3WR7A 2OZGA 4UEFA 2GU2A 4KUAA 4KVOE 1BPMA 2XEIA 4PXEA 3PZJA 3W6SA 5H86A 5C82A 3CPAA 1XMBA 1ZG9A 2PDOA 2CIJA 4GM5A 3B2YA 4KOWA 4PXBA 2CY2A 3FVLA 4EMEA 4UBRA 2V77A 2VL1A 4AB7A 4HNWB 4B14A 2PIYA 1TF8A 4CAEA 3RO0A 3B35A 2ANPA 4OKOA 4XPDC 3BJ7A 1VHOA 3TTHA 4P4IA 2AFOA 7CPAA 3IO1A 4OC3A 3SXNA 1K4JA 3SHPA 2R1IA 4RS2A 3G3SA 2FT0A 4C7HA 5JGFA 4NJRA 3D7GA 1HDQA 5AG7A 4UFXA 2R8VA 4LQGA 4F8ZA 2AFSA 4RI1A 4PK2A 1SQHA 5IB0A 1AMPA 1TXRA 2JDCA 2PJ3A 2OZHA 5KTCA 2GE3A 2X7BA 1TKHA 1DE4C 1GYTA 4ZY1A 1M1DA 1KWMA 3PEIA 3PBEA 1QSMA 1XBUA 2P0WA 3GB0A 1IYKA 3B3TA 3PB4X 4YU9A 3P2FA 2F8HA 3H8FA 2B4BA 2PIZA 1DTDA 1ELLP 3FXTA 2PCUA 2QIRA 4PSXA 4ONUA 5I0CA 1CPXA 4P45A 5D8NA 1Q2DA 3I3GA 3K9UA 4M6HA 4MFJA 2VEZA 1U6MA 4IF5A 4MCPA 5DWMA 4Z65A 3EFAA 3F5BA 2WZNA 4ZX8A 3EO4A 2OZUA 3EXNA 5BWAB 2Z3KA 2YNEA 3FYNA 3ISZA 4ZBGA 2AE6A 2Z0ZA 3R9GA 4BMHA 4MI4A 1IGBA 4C2XA 3R9FA 4EWTA 2GFQA 2HB6A 2J8RA 2PJ2A 2Q7BA 1X10A 4NGPA 5K8MA 1Z2LA 5EBVA 4BINA 4AVCA 1YREA 2FL4A 2Z3MA 2F5IA 3IWEA 1S60A 4B10A 5F09A 5LRKA 4EFDA 1BPNA 4QUSA 2PJ9A 1ON0A 4HKFA 1FNOA 1ZG8A 2AFMA 1XIXA 3RZAA 4A31A 4P4DA 4KORA 1IY7A 1AYEA 2ABZA 3A9LA 3D66A 5HVFA 3W91A 5HVGA 2B58A 4HPSA 3SXOA 3L2NA 2EBJA 4PXCA 2EUIA 4XNHB 4A39A 4R7MA 1LCPA 1HDUA 2JLMA 1IYLA 1CX8A 1YW4A 2PQ8A 3G8WA 1XRYA 3R96A 3KHXA 3DGVA 3D3SA 3DLJA 3LD2A 4X5KA 2P6FA 1RXTA 2ZOFA 2IMOA 2V8GA 5IB9A 1R43A 4KVME 3I9SA 3K2KA 4FUUA 3NFZA 2ZEHA 3D2MA 4OAEA 2Y0MA 4UCNA 2EO8A 1NSAA 3W6XA 1XFOA 2ZEMA 3CDXA 3N5FA 3NE8A 4PQAA 2XEFA 2G3TA 2NYQA 4Y49C 4R3KA 2I79A 2PJ5A 4PSWA 2EVNA 1ARMA 1PU9A 2FVGA 2FE7A 4ORFA 1YMEA 1B6BA 3VWEA 3TC8A 3B3CA 4TNUA 4XNHC 4AVAA 5FVJA 2PRBA 4NXYA 3IU2A 3IWWA 4Q7AA 3TO7A 1BLLE 2YGWA 1Y9WA 4KZTA 3B8GA 2POKA 4MHDA 5IX3A 5JH9A 1KZFA 4FD5A 4A33A 2ZW6A 4CGMA 1CM0A 5A28A 4OC2A 4H6ZA 2PJ1A 3ZZIA 4KOXA 2K5TA 3FX6A 4QBJA 1KUXA 2PJCA 1PUAA 2ZW7A 4MFZA 2B4DA 3S9MA 4P4EA 4UFWA 3UY5A 4C68A 2WPWA 3DSBA 4JJXA 1NMTA 4M85A 4P10A 4WJBA 4M3SA 1OZPA 5ELYA 3DDDA 2Q4ZA 4R87A 3C26A 3KL9A 1QQ9A 2GIVA 3CXSA 4B12A 3IFEA 2WSAA 1XJOA 5AG5A 4ZX9A 2BUEA 2JBKA 4IK2A 5JM6A 4H6UA 4DNCA 4HNYB 3D7DA 2ZPAA 4A37A 4KOSA 2GLJA 2VZZA 4JYWA 2PSWA 3KGQA 1JQGA 4G1PA 5JQ4A 4CRZB 2PJ8A 1I1DA 4DJLA 1XE4A 4KSAA 3IJ3A 3SJGA 1Q2CA 1Q2YA 4YRHA 2Q4YA 2ZEFA 3E0KA 3HUVA 1FY7A 5I4MA 1Z8WA 2P6GA 3TFYA 2VXKA 5LYDA 1IU8A 4CYPA 5CBMA 2ARHA 4A32A 2OU2A 4UWJA 1CG2A 1X12A 2BCOA 3TO6A 2VI7A 3D4UA 4BBHA 2A4NA 2CTCA 2O28A 4FBEA 4B5PB 2D4PA 1GHEA 4UEEA 1Q7LA 3S6FA 1LRZA 2C1CA 4FD6A 4L89A 4MFKA 3SI0A 4CAWA 4M6IA 3MRUA 2Q0YA 4CGPA 5KTDA 4OIWA 4JZ0A 1OBRA 2CTBA 1V0CA 5CNPA 3JRUA 3D8PA 4MFLA 2QVPA 4QVTA 4J3GA 4QB9A 3WC7A 4XPKA 4NCZA 4F9UA 5G21A 3FF3A 2ZEGA 4ZGYB 2B4DB 2R7HA 2PVWA 1BOBA 1EE3P 1LOKA 3GKRA 3PRTA 4QC6A 1P0HA 3NH4A 2REEA 2O53A 2J9AA 5DWNA 3RAMA 5AG4A 1I21A 4DUKA 2C27A 4UEZA 1IIDA 2XEJA 3KR5A 4MRIA 3GLJA 5G20A 2ZOGA 4O23A 2PR8A 3BHXA 1YLEA 3DR6A 3PB7X 1UWYA 4MMOA 1CBXA 4MY0A 2HUZA 1TKFA 5F48A 4F0YA 8CPAA 2PJ4A 1B87A 1QSTA 1XEBA 2C6CA 3BXMA 3R95A 3H5ZA 3SJXA 1YQEA 4CPAA 5THWA 2FXFA 2ZXVA 4GS4A 4CYNA 3RYOA 3B3WA 2ZEPA 2JDDA 1IICA 4DYOA 5J8CA 3DR8A 1CP7A 3RBUA 1ELMP 2QYVA 3ISXA 1CPSA 3LACA 4NJQA 5LRGA 1L0CA 4R6TA 3WABA 2VZYA 1MJBA 4IUSA 1Y7RA 1MK4A 4AXVA 2WUUA 2B5GA 2JBJA 1F57A 1Y9KA 5IV0A 3TX8A 1YSJA 1Z8TA 3CXPA 1I12A 2FIWA 3FRMA 5AGEA 5A27A 2Z3OA 4NSQA 2G3AA 3JUWA 4UWIA 1VHEA 2AFXA 4KLWA 5D29A 3VATA 4PK3A 5E96A 4H2KA 4LX9A 3SJFA 4UIAA 4OADA 1S3ZA 3WC5A 4U5YA 2C6PA 2PJBA 2QMLA 3SJEA 5F46A 1M4GA 2AFZA 5CPAA 4P4FA 4NGMA 3TOBA 3WT4A 4B6ZA 4UCMA 4KUBA 4CGNA 5DS0A 4GXHA 1PCAA 4R57A 3S9LA 1XOVA 2EK9A 2C6GA 4YWYA 4X8IA 1Y7EA 1R3NA 4U9YA 2ZELA 2FIAA 4EVYA 3CT9A 4K3NA 2G0BA 4KS9A 5AG6A 3PB9X 4FD7A 4E2AA 4NGNA 2PJ0A 2QECA 2WYRA 3S6KA 2VBQA 2Q4VA 2FS5A 1HEEA 1TF9A 2CNTA 2ZEEA 3SI2A 4PPZA 4KLVA 2JEVA 1H8LA 4II9A 2PE3A 1ZO0A 1MJAA 4NGTA 4A2ZA 2FSRA 4BD9A 3BLNA 4NEXA 2PJ6A 3LWUA 3KKWA 3QAHA 4OC1A 5K8PA 3GUXA 3B3VA 2HV2A 3FH4A 4JXRA 1N71A 3B3SA 1S7LA 2ZEDA 3JTKA 3HLPA 3KASA 3IU1A 3H4QA 4CS0B 4ZYQA
chains in the Genus database with same CATH topology
4U9ZA 1WK4A 2Z10A 2VQYA 4CRYB 2ATRA 1Z9UA 2B3VA 5J8FA 1M4DA 3TE4A 2ZW4A 5C88A 2Q44A 4B5OA 3V8IA 1S7NA 1M4IA 2OH1A 4L8AA 1S7FA 1Z4RA 4CYOA 3N7ZA 2CNMA 5KTAA 1YVOA 2WPXA 4UA3A 3R9EA 1YK3A 4F0XA 4C2YA 4XPLA 5F49A 2CXAA 2Z11A 5G1ZA 3TOAA 1VHSA 3S6HA 4JWPA 2YNCC 1WWZA 4YFJA 3ZJ0A 1BO4A 3QB8A 4NF1A 4KOYA 2ZW5A 3T9YA 4E8OA 5GCNA 4MFQA 1TIQA 5HH1A 3T90A 4Q38A 3PGPA 4OLLA 3FBUA 3DNSA 2DXQA 3BJ8A 2NMTA 2Q04A 1YX0A 4KOUA 4UFVA 4B11A 4H89A 4JLYA 5F47A 2IL4A 4MJ8A 2BSWA 3EY5A 2BEIA 1P4NA 1QSNA 4CAXA 4LUAA 4HNXB 2I00A 3TO9A 4KOVA 2H5MA 1YGHA 4A95A 2DPSA 2FCKA 2GANA 1J4JA 1S7KA 2BL1A 4F6AA 1NSLA 4MBUA 1S5KA 2J8MA 2YNDA 3FNCA 4AVBA 1CJWA 3LODA 4YGOA 4AG7A 2PC1A 4R3LA 1R57A 3IGRA 4KSFA 2D4OA 2Z3LA 3GY9A 2B3UA 4CGLA 2HQYA 1QSOA 1YVKA 4Y49B 4MFPA 5JPHA 3F8KA 3TT2A 3NE7A 3R1KA 4MY3A 2REFA 1MJ9A 2DPTA 3PP9A 5H84A 4A30A 4C7IA 1IB1E 2CNSA 2YNCA 4E0AA 2KCWA 3FB3A 3OWCA 4JXQA 5HMNA 4CYQA 4Q36A 4UCPA 2J8NA 3VWDA 3EC4A 3IWGA 2RC4A 4CGOA 1NE9A 4I49A 2Z3PA 1YR0A 5EC4A 3TCVA 4R9MA 4KVXA 5G22A 1UFHA 4B5PA 1Z4EA 1XMTA 1XF8A 2R98A 1KUYA 1VKCA 3S6GA 2AJ6A 2B5GB 4AG9A 4FD4A 3GYAA 3FIXA 5ISVA 4PV6A 4JD6A 3CXQA 4KOTA 3MGDA 4CAVA 2P6EA 4XPDB 2Z3NA 2PR1A 3D2PA 2OB0A 1M44A 4CAFA 3P2HA 1KUVA 1QSRA 4B13A 1RO5A 3F0AA 4C2ZA 3JVNA 4K30A 3WR7A 2OZGA 4KUAA 4KVOE 3W6SA 3PZJA 5C82A 5H86A 2PDOA 4KOWA 2CY2A 4UBRA 4AB7A 4B14A 4HNWB 4CAEA 4XPDC 3BJ7A 3TTHA 3SXNA 1K4JA 3SHPA 2R1IA 4RS2A 3G3SA 2FT0A 4C7HA 5AG7A 4UFXA 2R8VA 4RI1A 4PK2A 1SQHA 5IB0A 2JDCA 5KTCA 2OZHA 2GE3A 2X7BA 1M1DA 1QSMA 2P0WA 1IYKA 3P2FA 2B4BA 3FXTA 4PSXA 2QIRA 5I0CA 4ONUA 1Q2DA 3I3GA 3K9UA 4MFJA 5DWMA 2VEZA 1U6MA 4IF5A 3EFAA 3F5BA 3EO4A 2OZUA 3EXNA 5BWAB 2Z3KA 2YNEA 3FYNA 3R9GA 4ZBGA 2AE6A 2Z0ZA 4C2XA 4BMHA 4MI4A 3R9FA 2J8RA 2Q7BA 5EBVA 4AVCA 1YREA 2FL4A 2Z3MA 2F5IA 3IWEA 1S60A 4B10A 4QUSA 4A31A 1ON0A 4HKFA 1XIXA 4KORA 3A9LA 3W91A 2B58A 3SXOA 2EUIA 4XNHB 2JLMA 1IYLA 2PQ8A 3G8WA 3R96A 3D3SA 3LD2A 4X5KA 2P6FA 1RXTA 4KVME 3I9SA 3D2MA 4OAEA 2Y0MA 4UCNA 3W6XA 2G3TA 4Y49C 4R3KA 2I79A 4PSWA 2EVNA 1PU9A 2FE7A 4ORFA 1B6BA 3VWEA 4XNHC 4AVAA 5FVJA 2PRBA 4NXYA 3IU2A 3TO7A 2YGWA 1Y9WA 4KZTA 3B8GA 4MHDA 5IX3A 1KZFA 4FD5A 4A33A 2ZW6A 4CGMA 1CM0A 5A28A 4H6ZA 3ZZIA 4QBJA 4KOXA 2K5TA 1KUXA 1PUAA 2ZW7A 4MFZA 2B4DA 4UFWA 3UY5A 4C68A 2WPWA 3DSBA 4JJXA 1NMTA 4M85A 4M3SA 1OZPA 3DDDA 4R87A 3C26A 2GIVA 3CXSA 4B12A 2WSAA 5AG5A 2BUEA 4H6UA 4DNCA 4HNYB 2ZPAA 4KOSA 2VZZA 2PSWA 5JQ4A 4CRZB 1I1DA 1XE4A 4KSAA 1Q2CA 1Q2YA 4YRHA 2Q4YA 3E0KA 1FY7A 2P6GA 3TFYA 2VXKA 4CYPA 2ARHA 4A32A 2OU2A 4UWJA 3TO6A 2VI7A 4BBHA 2A4NA 2O28A 4B5PB 2D4PA 1GHEA 3S6FA 1LRZA 4FD6A 4CAWA 4L89A 4MFKA 2Q0YA 4CGPA 5KTDA 1V0CA 5CNPA 3D8PA 4MFLA 4QVTA 4J3GA 4QB9A 4XPKA 4NCZA 5G21A 4ZGYB 2B4DB 2R7HA 1BOBA 3GKRA 4QC6A 1P0HA 2REEA 5DWNA 5AG4A 1I21A 2C27A 1IIDA 5G20A 2PR8A 1YLEA 3DR6A 4MY0A 4F0YA 5F48A 2HUZA 1B87A 1QSTA 1XEBA 3R95A 3H5ZA 2FXFA 2ZXVA 4GS4A 4CYNA 3RYOA 2JDDA 1IICA 5J8CA 3DR8A 1L0CA 4IUSA 2VZYA 1MJBA 1Y7RA 1MK4A 2WUUA 2B5GA 1Y9KA 5IV0A 3CXPA 1I12A 2FIWA 3FRMA 5AGEA 5A27A 2Z3OA 4NSQA 2G3AA 3JUWA 4UWIA 4KLWA 4PK3A 5E96A 4LX9A 4OADA 1S3ZA 4U5YA 2QMLA 5F46A 1M4GA 3TOBA 4CGNA 4UCMA 4KUBA 4R57A 4U9YA 2FIAA 4EVYA 2G0BA 4KS9A 5AG6A 4FD7A 4E2AA 2QECA 3S6KA 2VBQA 2Q4VA 2FS5A 2CNTA 4KLVA 2JEVA 4II9A 1ZO0A 1MJAA 4A2ZA 2FSRA 3BLNA 4NEXA 3QAHA 3KKWA 2HV2A 4JXRA 1N71A 1S7LA 3JTKA 3IU1A 3H4QA 4CS0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Z A;  1WK4 A;  2Z10 A;  2VQY A;  4CRY B;  2ATR A;  1Z9U A;  2B3V A;  5J8F A;  1M4D A;  3TE4 A;  2ZW4 A;  5C88 A;  2Q44 A;  4B5O A;  3V8I A;  1S7N A;  1M4I A;  2OH1 A;  4L8A A;  1S7F A;  1Z4R A;  3N7Z A;  2CNM A;  5KTA A;  1YVO A;  2WPX A;  4UA3 A;  3R9E A;  1YK3 A;  4XPL A;  5F49 A;  2Z11 A;  3TOA A;  1VHS A;  3S6H A;  4JWP A;  1WWZ A;  4YFJ A;  3ZJ0 A;  1BO4 A;  3QB8 A;  4NF1 A;  4KOY A;  2ZW5 A;  3T9Y A;  4E8O A;  5GCN A;  1TIQ A;  5HH1 A;  3T90 A;  3PGP A;  4OLL A;  3FBU A;  3DNS A;  2DXQ A;  3BJ8 A;  2NMT A;  2Q04 A;  1YX0 A;  4KOU A;  4H89 A;  4JLY A;  5F47 A;  2IL4 A;  4MJ8 A;  2BSW A;  3EY5 A;  2BEI A;  1P4N A;  1QSN A;  4CAX A;  4LUA A;  4HNX B;  2I00 A;  3TO9 A;  4KOV A;  2H5M A;  1YGH A;  2FCK A;  2GAN A;  1J4J A;  1S7K A;  2BL1 A;  4F6A A;  1NSL A;  4MBU A;  1S5K A;  2J8M A;  3FNC A;  4AVB A;  1CJW A;  3LOD A;  4YGO A;  4AG7 A;  2PC1 A;  4R3L A;  1R57 A;  3IGR A;  2D4O A;  3GY9 A;  2B3U A;  2HQY A;  1QSO A;  1YVK A;  4Y49 B;  5JPH A;  3F8K A;  3TT2 A;  3NE7 A;  3R1K A;  4MY3 A;  2REF A;  1MJ9 A;  3PP9 A;  5H84 A;  1IB1 E;  2CNS A;  4E0A A;  2KCW A;  3FB3 A;  3OWC A;  4JXQ A;  5HMN A;  2J8N A;  3VWD A;  3EC4 A;  3IWG A;  2RC4 A;  1NE9 A;  4I49 A;  1YR0 A;  5EC4 A;  3TCV A;  4R9M A;  4KVX A;  1UFH A;  4B5P A;  1Z4E A;  1XMT A;  1XF8 A;  2R98 A;  1KUY A;  1VKC A;  3S6G A;  2AJ6 A;  2B5G B;  4AG9 A;  4FD4 A;  3GYA A;  3FIX A;  5ISV A;  4PV6 A;  4JD6 A;  3CXQ A;  4KOT A;  3MGD A;  4CAV A;  2P6E A;  4XPD B;  2PR1 A;  3D2P A;  2OB0 A;  1M44 A;  3P2H A;  1KUV A;  1QSR A;  1RO5 A;  3F0A A;  3JVN A;  4K30 A;  3WR7 A;  2OZG A;  4KUA A;  4KVO E;  3W6S A;  3PZJ A;  5C82 A;  5H86 A;  2PDO A;  4KOW A;  2CY2 A;  4UBR A;  4AB7 A;  4HNW B;  4XPD C;  3BJ7 A;  3TTH A;  3SXN A;  1K4J A;  3SHP A;  2R1I A;  4RS2 A;  3G3S A;  2FT0 A;  2R8V A;  4RI1 A;  4PK2 A;  1SQH A;  5IB0 A;  2JDC A;  5KTC A;  2OZH A;  2GE3 A;  2X7B A;  1M1D A;  1QSM A;  2P0W A;  1IYK A;  3P2F A;  2B4B A;  3FXT A;  4PSX A;  2QIR A;  5I0C A;  4ONU A;  1Q2D A;  3I3G A;  3K9U A;  5DWM A;  2VEZ A;  1U6M A;  4IF5 A;  3EFA A;  3F5B A;  3EO4 A;  2OZU A;  3EXN A;  3FYN A;  3R9G A;  4ZBG A;  2AE6 A;  2Z0Z A;  4BMH A;  4MI4 A;  3R9F A;  2J8R A;  2Q7B A;  5EBV A;  4AVC A;  1YRE A;  2FL4 A;  2F5I A;  1S60 A;  4QUS A;  1ON0 A;  4HKF A;  1XIX A;  4KOR A;  3W91 A;  2B58 A;  3SXO A;  2EUI A;  4XNH B;  2JLM A;  1IYL A;  2PQ8 A;  3G8W A;  3R96 A;  3D3S A;  3LD2 A;  4X5K A;  2P6F A;  1RXT A;  4KVM E;  3I9S A;  3D2M A;  4OAE A;  2Y0M A;  3W6X A;  2G3T A;  4Y49 C;  4R3K A;  2I79 A;  4PSW A;  2EVN A;  1PU9 A;  2FE7 A;  4ORF A;  1B6B A;  3VWE A;  4XNH C;  4AVA A;  5FVJ A;  2PRB A;  4NXY A;  3TO7 A;  4KZT A;  1Y9W A;  4MHD A;  3B8G A;  5IX3 A;  1KZF A;  4FD5 A;  2ZW6 A;  1CM0 A;  4H6Z A;  3ZZI A;  4QBJ A;  4KOX A;  2K5T A;  1KUX A;  1PUA A;  2ZW7 A;  2B4D A;  3UY5 A;  2WPW A;  3DSB A;  4JJX A;  1NMT A;  4M85 A;  4M3S A;  1OZP A;  3DDD A;  4R87 A;  3C26 A;  2GIV A;  3CXS A;  2BUE A;  4H6U A;  4DNC A;  4HNY B;  2ZPA A;  4KOS A;  2VZZ A;  2PSW A;  5JQ4 A;  4CRZ B;  1I1D A;  1XE4 A;  1Q2C A;  1Q2Y A;  4YRH A;  2Q4Y A;  3E0K A;  1FY7 A;  2P6G A;  3TFY A;  2VXK A;  2ARH A;  2OU2 A;  4UWJ A;  3TO6 A;  2VI7 A;  2A4N A;  2O28 A;  4B5P B;  2D4P A;  1GHE A;  3S6F A;  1LRZ A;  4FD6 A;  4CAW A;  4L89 A;  2Q0Y A;  5KTD A;  1V0C A;  5CNP A;  3D8P A;  4QVT A;  4J3G A;  4QB9 A;  4XPK A;  4NCZ A;  2B4D B;  2R7H A;  1BOB A;  3GKR A;  4QC6 A;  1P0H A;  2REE A;  5DWN A;  1I21 A;  2C27 A;  1IID A;  2PR8 A;  1YLE A;  3DR6 A;  4MY0 A;  4F0Y A;  5F48 A;  2HUZ A;  1B87 A;  1QST A;  1XEB A;  3R95 A;  2FXF A;  2ZXV A;  4GS4 A;  3RYO A;  2JDD A;  1IIC A;  5J8C A;  3DR8 A;  1L0C A;  4IUS A;  2VZY A;  1MJB A;  1Y7R A;  1MK4 A;  2B5G A;  1Y9K A;  5IV0 A;  3CXP A;  1I12 A;  2FIW A;  3FRM A;  4NSQ A;  2G3A A;  3JUW A;  4UWI A;  4KLW A;  4PK3 A;  5E96 A;  4LX9 A;  4OAD A;  1S3Z A;  4U5Y A;  2QML A;  5F46 A;  1M4G A;  3TOB A;  4KUB A;  4R57 A;  4U9Y A;  2FIA A;  4EVY A;  2G0B A;  4FD7 A;  4E2A A;  2QEC A;  3S6K A;  2VBQ A;  2Q4V A;  2FS5 A;  2CNT A;  4KLV A;  2JEV A;  4II9 A;  1MJA A;  2FSR A;  3BLN A;  4NEX A;  3QAH A;  3KKW A;  2HV2 A;  4JXR A;  1N71 A;  1S7L A;  3H4Q A;  4CS0 B; 
#chains in the Genus database with same CATH topology
 4U9Z A;  2BO9 A;  1WK4 A;  1LAP A;  2Z10 A;  4W9Y A;  2VQY A;  3MN8 A;  4MXU A;  2F7V A;  3T8W A;  4CRY B;  2ATR A;  1FT7 A;  2RB7 A;  1F2O A;  3SI1 A;  1Z9U A;  1IOF A;  2B3V A;  1F2P A;  5J8F A;  4ZY2 A;  3KQZ A;  1M4D A;  3D68 A;  4MHN A;  3TE4 A;  2HC9 A;  2ZW4 A;  5C88 A;  2Q44 A;  4B5O A;  3V8I A;  1S7N A;  1M4I A;  2G9D A;  2OH1 A;  4L8A A;  3BI0 A;  1S7F A;  1Z4R A;  4CYO A;  3N7Z A;  2CNM A;  5KTA A;  3IC1 A;  2V8V A;  4RN7 A;  1YVO A;  2WPX A;  3VAR A;  4UA3 A;  3NA6 A;  2EWB A;  3R9E A;  1YK3 A;  4OP4 A;  4F0X A;  3H8G A;  4XPL A;  4C2Y A;  1LFW A;  4MCS A;  1Z8L A;  5F49 A;  1LAN A;  2CXA A;  2Z11 A;  5G1Z A;  1VHS A;  3KZW A;  3TOA A;  1YW6 A;  3S6H A;  4PXD A;  2BOA A;  4ZY0 A;  4WWV A;  4JWP A;  2YNC C;  3KHZ A;  1ZG7 A;  2DF5 A;  2PVV A;  1WWZ A;  1LAM A;  4MHY A;  4YFJ A;  4MCR A;  2I3C A;  3ZJ0 A;  3NH8 A;  1BO4 A;  3QB8 A;  4M6G A;  2Q51 A;  1QMU A;  3GIU A;  2AFU A;  4NF1 A;  3I1U A;  2GRE A;  4KOY A;  2ZW5 A;  2PJ7 A;  3FMC A;  3FED A;  5GCN A;  2XEG A;  4MFQ A;  1TIQ A;  1Y0Y A;  3K9T A;  3T9Y A;  2O4H A;  5HH1 A;  3T90 A;  2IQ6 A;  5LRJ A;  4Q38 A;  3KI9 A;  2Q43 A;  3PGP A;  4OLL A;  1Z5R A;  2ZEO A;  3DNS A;  3FBU A;  2DXQ A;  3BJ8 A;  2NMT A;  2Q04 A;  1M4L A;  1YX0 A;  2QJ8 A;  3KR4 A;  4KOU A;  4UFV A;  4B11 A;  4H89 A;  4JLY A;  5F47 A;  2JEW A;  2IL4 A;  2ZEN A;  3D67 A;  4MJ8 A;  4X3R A;  2BSW A;  3S9N A;  2PRQ A;  3EY5 A;  4FWU A;  2BEI A;  1P4N A;  1QSN A;  4CAX A;  4LUA A;  4HNX B;  2NSM A;  2I00 A;  3H8E A;  4IAV A;  3TO9 A;  3PB6 X;  4KOV A;  2H5M A;  5LYI A;  1YGH A;  4A95 A;  1VGY A;  2DPS A;  2FCK A;  2GAN A;  1J4J A;  1S7K A;  4R8F A;  2BL1 A;  4KSI A;  4F6A A;  1NSL A;  3QNV A;  4MBU A;  3D7H A;  1S5K A;  2J8M A;  2YND A;  3FNC A;  4AVB A;  1CJW A;  5LYF A;  3LOD A;  1TKJ A;  1IOI A;  4YGO A;  4AG7 A;  2PC1 A;  5HVH A;  4C7I A;  4R3L A;  1R57 A;  3IGR A;  4KSF A;  1Y0R A;  2D4O A;  2Z3L A;  4NGR A;  3GY9 A;  3RNZ A;  3V38 A;  2B3U A;  5K8N A;  1AUG A;  4CGL A;  3BI1 A;  2HQY A;  4UF4 A;  1QSO A;  3VH9 A;  5LYL A;  4LQ6 A;  1YVK A;  2CF4 A;  2OR4 A;  2AFW A;  3B7I A;  4Y49 B;  4E8O A;  5HXD A;  3NH5 A;  4P4J A;  4P4B A;  4MFP A;  5JPH A;  3F8K A;  3TT2 A;  2IJZ A;  3NE7 A;  3R1K A;  5K8O A;  4MY3 A;  2EK8 A;  2V8D A;  2DEA A;  2REF A;  1MJ9 A;  2DPT A;  3PBB A;  1CP6 A;  3PP9 A;  5H84 A;  1IB1 E;  2CNS A;  2YNC A;  4MHZ A;  4A30 A;  2KCW A;  4OC0 A;  4OC5 A;  3FJU A;  4E0A A;  3FB3 A;  3PB8 X;  4ONW A;  3CZX A;  2ODF A;  5EMI A;  3OWC A;  1PYT B;  4JXQ A;  4NFR A;  5HMN A;  4F9V A;  3IEH A;  2V8H A;  4CYQ A;  4Q36 A;  4UCP A;  2J8N A;  3VWD A;  3CPX A;  3EC4 A;  3IWG A;  2RC4 A;  4CGO A;  1NE9 A;  4I49 A;  4MHP A;  2Z3P A;  3D7F A;  3QAY A;  1ZLI A;  2Q7S A;  1YR0 A;  4P6Y A;  4OC4 A;  4R76 A;  5EC4 A;  3TCV A;  4R9M A;  4KVX A;  5G22 A;  2OOT A;  1UFH A;  4B5P A;  1Z4E A;  3FEC A;  1XMT A;  1VIX A;  1XF8 A;  4A38 A;  2R98 A;  4NGS A;  1KUY A;  1VKC A;  1Z8X A;  3S6G A;  5J1Q A;  2AJ6 A;  2B5G B;  3IIB A;  1ZLH A;  6CPA A;  4AG9 A;  4FD4 A;  3GYA A;  2PJA A;  3FIX A;  4OME A;  4ZI6 A;  4X2T A;  5ISV A;  3KQX A;  4PV6 A;  1JWQ A;  4JD6 A;  4FAI A;  4RUH A;  3CXQ A;  4KOT A;  3MGD A;  4UIB A;  2GLF A;  4CAV A;  2P6E A;  4XPD B;  3WC6 A;  3FEE A;  2Z3N A;  3PFO A;  3LMS A;  2PR1 A;  1YLO A;  2RFH A;  3D2P A;  4NGQ A;  1ARL A;  4TWE A;  2OB0 A;  4MCQ A;  4OID A;  1M44 A;  4IHM A;  1A2Z A;  3V7Z A;  3P2H A;  3PFE A;  4CAF A;  1KUV A;  1QSR A;  4B13 A;  1RO5 A;  1RTQ A;  3F0A A;  4P44 A;  4C2Z A;  1BAV A;  3JVN A;  4K30 A;  4A94 A;  3WR7 A;  2OZG A;  4UEF A;  2GU2 A;  4KUA A;  4KVO E;  1BPM A;  2XEI A;  4PXE A;  3PZJ A;  3W6S A;  5H86 A;  5C82 A;  3CPA A;  1XMB A;  1ZG9 A;  2PDO A;  2CIJ A;  4GM5 A;  3B2Y A;  4KOW A;  4PXB A;  2CY2 A;  3FVL A;  4EME A;  4UBR A;  2V77 A;  2VL1 A;  4AB7 A;  4HNW B;  4B14 A;  2PIY A;  1TF8 A;  4CAE A;  3RO0 A;  3B35 A;  2ANP A;  4OKO A;  4XPD C;  3BJ7 A;  1VHO A;  3TTH A;  4P4I A;  2AFO A;  7CPA A;  3IO1 A;  4OC3 A;  3SXN A;  1K4J A;  3SHP A;  2R1I A;  4RS2 A;  3G3S A;  2FT0 A;  4C7H A;  5JGF A;  4NJR A;  3D7G A;  1HDQ A;  5AG7 A;  4UFX A;  2R8V A;  4LQG A;  4F8Z A;  2AFS A;  4RI1 A;  4PK2 A;  1SQH A;  5IB0 A;  1AMP A;  1TXR A;  2JDC A;  2PJ3 A;  2OZH A;  5KTC A;  2GE3 A;  2X7B A;  1TKH A;  1DE4 C;  1GYT A;  4ZY1 A;  1M1D A;  1KWM A;  3PEI A;  3PBE A;  1QSM A;  1XBU A;  2P0W A;  3GB0 A;  1IYK A;  3B3T A;  3PB4 X;  4YU9 A;  3P2F A;  2F8H A;  3H8F A;  2B4B A;  2PIZ A;  1DTD A;  1ELL P;  3FXT A;  2PCU A;  2QIR A;  4PSX A;  4ONU A;  5I0C A;  1CPX A;  4P45 A;  5D8N A;  1Q2D A;  3I3G A;  3K9U A;  4M6H A;  4MFJ A;  2VEZ A;  1U6M A;  4IF5 A;  4MCP A;  5DWM A;  4Z65 A;  3EFA A;  3F5B A;  2WZN A;  4ZX8 A;  3EO4 A;  2OZU A;  3EXN A;  5BWA B;  2Z3K A;  2YNE A;  3FYN A;  3ISZ A;  4ZBG A;  2AE6 A;  2Z0Z A;  3R9G A;  4BMH A;  4MI4 A;  1IGB A;  4C2X A;  3R9F A;  4EWT A;  2GFQ A;  2HB6 A;  2J8R A;  2PJ2 A;  2Q7B A;  1X10 A;  4NGP A;  5K8M A;  1Z2L A;  5EBV A;  4BIN A;  4AVC A;  1YRE A;  2FL4 A;  2Z3M A;  2F5I A;  3IWE A;  1S60 A;  4B10 A;  5F09 A;  5LRK A;  4EFD A;  1BPN A;  4QUS A;  2PJ9 A;  1ON0 A;  4HKF A;  1FNO A;  1ZG8 A;  2AFM A;  1XIX A;  3RZA A;  4A31 A;  4P4D A;  4KOR A;  1IY7 A;  1AYE A;  2ABZ A;  3A9L A;  3D66 A;  5HVF A;  3W91 A;  5HVG A;  2B58 A;  4HPS A;  3SXO A;  3L2N A;  2EBJ A;  4PXC A;  2EUI A;  4XNH B;  4A39 A;  4R7M A;  1LCP A;  1HDU A;  2JLM A;  1IYL A;  1CX8 A;  1YW4 A;  2PQ8 A;  3G8W A;  1XRY A;  3R96 A;  3KHX A;  3DGV A;  3D3S A;  3DLJ A;  3LD2 A;  4X5K A;  2P6F A;  1RXT A;  2ZOF A;  2IMO A;  2V8G A;  5IB9 A;  1R43 A;  4KVM E;  3I9S A;  3K2K A;  4FUU A;  3NFZ A;  2ZEH A;  3D2M A;  4OAE A;  2Y0M A;  4UCN A;  2EO8 A;  1NSA A;  3W6X A;  1XFO A;  2ZEM A;  3CDX A;  3N5F A;  3NE8 A;  4PQA A;  2XEF A;  2G3T A;  2NYQ A;  4Y49 C;  4R3K A;  2I79 A;  2PJ5 A;  4PSW A;  2EVN A;  1ARM A;  1PU9 A;  2FVG A;  2FE7 A;  4ORF A;  1YME A;  1B6B A;  3VWE A;  3TC8 A;  3B3C A;  4TNU A;  4XNH C;  4AVA A;  5FVJ A;  2PRB A;  4NXY A;  3IU2 A;  3IWW A;  4Q7A A;  3TO7 A;  1BLL E;  2YGW A;  1Y9W A;  4KZT A;  3B8G A;  2POK A;  4MHD A;  5IX3 A;  5JH9 A;  1KZF A;  4FD5 A;  4A33 A;  2ZW6 A;  4CGM A;  1CM0 A;  5A28 A;  4OC2 A;  4H6Z A;  2PJ1 A;  3ZZI A;  4KOX A;  2K5T A;  3FX6 A;  4QBJ A;  1KUX A;  2PJC A;  1PUA A;  2ZW7 A;  4MFZ A;  2B4D A;  3S9M A;  4P4E A;  4UFW A;  3UY5 A;  4C68 A;  2WPW A;  3DSB A;  4JJX A;  1NMT A;  4M85 A;  4P10 A;  4WJB A;  4M3S A;  1OZP A;  5ELY A;  3DDD A;  2Q4Z A;  4R87 A;  3C26 A;  3KL9 A;  1QQ9 A;  2GIV A;  3CXS A;  4B12 A;  3IFE A;  2WSA A;  1XJO A;  5AG5 A;  4ZX9 A;  2BUE A;  2JBK A;  4IK2 A;  5JM6 A;  4H6U A;  4DNC A;  4HNY B;  3D7D A;  2ZPA A;  4A37 A;  4KOS A;  2GLJ A;  2VZZ A;  4JYW A;  2PSW A;  3KGQ A;  1JQG A;  4G1P A;  5JQ4 A;  4CRZ B;  2PJ8 A;  1I1D A;  4DJL A;  1XE4 A;  4KSA A;  3IJ3 A;  3SJG A;  1Q2C A;  1Q2Y A;  4YRH A;  2Q4Y A;  2ZEF A;  3E0K A;  3HUV A;  1FY7 A;  5I4M A;  1Z8W A;  2P6G A;  3TFY A;  2VXK A;  5LYD A;  1IU8 A;  4CYP A;  5CBM A;  2ARH A;  4A32 A;  2OU2 A;  4UWJ A;  1CG2 A;  1X12 A;  2BCO A;  3TO6 A;  2VI7 A;  3D4U A;  4BBH A;  2A4N A;  2CTC A;  2O28 A;  4FBE A;  4B5P B;  2D4P A;  1GHE A;  4UEE A;  1Q7L A;  3S6F A;  1LRZ A;  2C1C A;  4FD6 A;  4L89 A;  4MFK A;  3SI0 A;  4CAW A;  4M6I A;  3MRU A;  2Q0Y A;  4CGP A;  5KTD A;  4OIW A;  4JZ0 A;  1OBR A;  2CTB A;  1V0C A;  5CNP A;  3JRU A;  3D8P A;  4MFL A;  2QVP A;  4QVT A;  4J3G A;  4QB9 A;  3WC7 A;  4XPK A;  4NCZ A;  4F9U A;  5G21 A;  3FF3 A;  2ZEG A;  4ZGY B;  2B4D B;  2R7H A;  2PVW A;  1BOB A;  1EE3 P;  1LOK A;  3GKR A;  3PRT A;  4QC6 A;  1P0H A;  3NH4 A;  2REE A;  2O53 A;  2J9A A;  5DWN A;  3RAM A;  5AG4 A;  1I21 A;  4DUK A;  2C27 A;  4UEZ A;  1IID A;  2XEJ A;  3KR5 A;  4MRI A;  3GLJ A;  5G20 A;  2ZOG A;  4O23 A;  2PR8 A;  3BHX A;  1YLE A;  3DR6 A;  3PB7 X;  1UWY A;  4MMO A;  1CBX A;  4MY0 A;  2HUZ A;  1TKF A;  5F48 A;  4F0Y A;  8CPA A;  2PJ4 A;  1B87 A;  1QST A;  1XEB A;  2C6C A;  3BXM A;  3R95 A;  3H5Z A;  3SJX A;  1YQE A;  4CPA A;  5THW A;  2FXF A;  2ZXV A;  4GS4 A;  4CYN A;  3RYO A;  3B3W A;  2ZEP A;  2JDD A;  1IIC A;  4DYO A;  5J8C A;  3DR8 A;  1CP7 A;  3RBU A;  1ELM P;  2QYV A;  3ISX A;  1CPS A;  3LAC A;  4NJQ A;  5LRG A;  1L0C A;  4R6T A;  3WAB A;  2VZY A;  1MJB A;  4IUS A;  1Y7R A;  1MK4 A;  4AXV A;  2WUU A;  2B5G A;  2JBJ A;  1F57 A;  1Y9K A;  5IV0 A;  3TX8 A;  1YSJ A;  1Z8T A;  3CXP A;  1I12 A;  2FIW A;  3FRM A;  5AGE A;  5A27 A;  2Z3O A;  4NSQ A;  2G3A A;  3JUW A;  4UWI A;  1VHE A;  2AFX A;  4KLW A;  5D29 A;  3VAT A;  4PK3 A;  5E96 A;  4H2K A;  4LX9 A;  3SJF A;  4UIA A;  4OAD A;  1S3Z A;  3WC5 A;  4U5Y A;  2C6P A;  2PJB A;  2QML A;  3SJE A;  5F46 A;  1M4G A;  2AFZ A;  5CPA A;  4P4F A;  4NGM A;  3TOB A;  3WT4 A;  4B6Z A;  4UCM A;  4KUB A;  4CGN A;  5DS0 A;  4GXH A;  1PCA A;  4R57 A;  3S9L A;  1XOV A;  2EK9 A;  2C6G A;  4YWY A;  4X8I A;  1Y7E A;  1R3N A;  4U9Y A;  2ZEL A;  2FIA A;  4EVY A;  3CT9 A;  4K3N A;  2G0B A;  4KS9 A;  5AG6 A;  3PB9 X;  4FD7 A;  4E2A A;  4NGN A;  2PJ0 A;  2QEC A;  2WYR A;  3S6K A;  2VBQ A;  2Q4V A;  2FS5 A;  1HEE A;  1TF9 A;  2CNT A;  2ZEE A;  3SI2 A;  4PPZ A;  4KLV A;  2JEV A;  1H8L A;  4II9 A;  2PE3 A;  1ZO0 A;  1MJA A;  4NGT A;  4A2Z A;  2FSR A;  4BD9 A;  3BLN A;  4NEX A;  2PJ6 A;  3LWU A;  3KKW A;  3QAH A;  4OC1 A;  5K8P A;  3GUX A;  3B3V A;  2HV2 A;  3FH4 A;  4JXR A;  1N71 A;  3B3S A;  1S7L A;  2ZED A;  3JTK A;  3HLP A;  3KAS A;  3IU1 A;  3H4Q A;  4CS0 B;  4ZYQ A; 
#chains in the Genus database with same CATH homology
 4U9Z A;  1WK4 A;  2Z10 A;  2VQY A;  4CRY B;  2ATR A;  1Z9U A;  2B3V A;  5J8F A;  1M4D A;  3TE4 A;  2ZW4 A;  5C88 A;  2Q44 A;  4B5O A;  3V8I A;  1S7N A;  1M4I A;  2OH1 A;  4L8A A;  1S7F A;  1Z4R A;  4CYO A;  3N7Z A;  2CNM A;  5KTA A;  1YVO A;  2WPX A;  4UA3 A;  3R9E A;  1YK3 A;  4F0X A;  4C2Y A;  4XPL A;  5F49 A;  2CXA A;  2Z11 A;  5G1Z A;  3TOA A;  1VHS A;  3S6H A;  4JWP A;  2YNC C;  1WWZ A;  4YFJ A;  3ZJ0 A;  1BO4 A;  3QB8 A;  4NF1 A;  4KOY A;  2ZW5 A;  3T9Y A;  4E8O A;  5GCN A;  4MFQ A;  1TIQ A;  5HH1 A;  3T90 A;  4Q38 A;  3PGP A;  4OLL A;  3FBU A;  3DNS A;  2DXQ A;  3BJ8 A;  2NMT A;  2Q04 A;  1YX0 A;  4KOU A;  4UFV A;  4B11 A;  4H89 A;  4JLY A;  5F47 A;  2IL4 A;  4MJ8 A;  2BSW A;  3EY5 A;  2BEI A;  1P4N A;  1QSN A;  4CAX A;  4LUA A;  4HNX B;  2I00 A;  3TO9 A;  4KOV A;  2H5M A;  1YGH A;  4A95 A;  2DPS A;  2FCK A;  2GAN A;  1J4J A;  1S7K A;  2BL1 A;  4F6A A;  1NSL A;  4MBU A;  1S5K A;  2J8M A;  2YND A;  3FNC A;  4AVB A;  1CJW A;  3LOD A;  4YGO A;  4AG7 A;  2PC1 A;  4R3L A;  1R57 A;  3IGR A;  4KSF A;  2D4O A;  2Z3L A;  3GY9 A;  2B3U A;  4CGL A;  2HQY A;  1QSO A;  1YVK A;  4Y49 B;  4MFP A;  5JPH A;  3F8K A;  3TT2 A;  3NE7 A;  3R1K A;  4MY3 A;  2REF A;  1MJ9 A;  2DPT A;  3PP9 A;  5H84 A;  4A30 A;  4C7I A;  1IB1 E;  2CNS A;  2YNC A;  4E0A A;  2KCW A;  3FB3 A;  3OWC A;  4JXQ A;  5HMN A;  4CYQ A;  4Q36 A;  4UCP A;  2J8N A;  3VWD A;  3EC4 A;  3IWG A;  2RC4 A;  4CGO A;  1NE9 A;  4I49 A;  2Z3P A;  1YR0 A;  5EC4 A;  3TCV A;  4R9M A;  4KVX A;  5G22 A;  1UFH A;  4B5P A;  1Z4E A;  1XMT A;  1XF8 A;  2R98 A;  1KUY A;  1VKC A;  3S6G A;  2AJ6 A;  2B5G B;  4AG9 A;  4FD4 A;  3GYA A;  3FIX A;  5ISV A;  4PV6 A;  4JD6 A;  3CXQ A;  4KOT A;  3MGD A;  4CAV A;  2P6E A;  4XPD B;  2Z3N A;  2PR1 A;  3D2P A;  2OB0 A;  1M44 A;  4CAF A;  3P2H A;  1KUV A;  1QSR A;  4B13 A;  1RO5 A;  3F0A A;  4C2Z A;  3JVN A;  4K30 A;  3WR7 A;  2OZG A;  4KUA A;  4KVO E;  3W6S A;  3PZJ A;  5C82 A;  5H86 A;  2PDO A;  4KOW A;  2CY2 A;  4UBR A;  4AB7 A;  4B14 A;  4HNW B;  4CAE A;  4XPD C;  3BJ7 A;  3TTH A;  3SXN A;  1K4J A;  3SHP A;  2R1I A;  4RS2 A;  3G3S A;  2FT0 A;  4C7H A;  5AG7 A;  4UFX A;  2R8V A;  4RI1 A;  4PK2 A;  1SQH A;  5IB0 A;  2JDC A;  5KTC A;  2OZH A;  2GE3 A;  2X7B A;  1M1D A;  1QSM A;  2P0W A;  1IYK A;  3P2F A;  2B4B A;  3FXT A;  4PSX A;  2QIR A;  5I0C A;  4ONU A;  1Q2D A;  3I3G A;  3K9U A;  4MFJ A;  5DWM A;  2VEZ A;  1U6M A;  4IF5 A;  3EFA A;  3F5B A;  3EO4 A;  2OZU A;  3EXN A;  5BWA B;  2Z3K A;  2YNE A;  3FYN A;  3R9G A;  4ZBG A;  2AE6 A;  2Z0Z A;  4C2X A;  4BMH A;  4MI4 A;  3R9F A;  2J8R A;  2Q7B A;  5EBV A;  4AVC A;  1YRE A;  2FL4 A;  2Z3M A;  2F5I A;  3IWE A;  1S60 A;  4B10 A;  4QUS A;  4A31 A;  1ON0 A;  4HKF A;  1XIX A;  4KOR A;  3A9L A;  3W91 A;  2B58 A;  3SXO A;  2EUI A;  4XNH B;  2JLM A;  1IYL A;  2PQ8 A;  3G8W A;  3R96 A;  3D3S A;  3LD2 A;  4X5K A;  2P6F A;  1RXT A;  4KVM E;  3I9S A;  3D2M A;  4OAE A;  2Y0M A;  4UCN A;  3W6X A;  2G3T A;  4Y49 C;  4R3K A;  2I79 A;  4PSW A;  2EVN A;  1PU9 A;  2FE7 A;  4ORF A;  1B6B A;  3VWE A;  4XNH C;  4AVA A;  5FVJ A;  2PRB A;  4NXY A;  3IU2 A;  3TO7 A;  2YGW A;  1Y9W A;  4KZT A;  3B8G A;  4MHD A;  5IX3 A;  1KZF A;  4FD5 A;  4A33 A;  2ZW6 A;  4CGM A;  1CM0 A;  5A28 A;  4H6Z A;  3ZZI A;  4QBJ A;  4KOX A;  2K5T A;  1KUX A;  1PUA A;  2ZW7 A;  4MFZ A;  2B4D A;  4UFW A;  3UY5 A;  4C68 A;  2WPW A;  3DSB A;  4JJX A;  1NMT A;  4M85 A;  4M3S A;  1OZP A;  3DDD A;  4R87 A;  3C26 A;  2GIV A;  3CXS A;  4B12 A;  2WSA A;  5AG5 A;  2BUE A;  4H6U A;  4DNC A;  4HNY B;  2ZPA A;  4KOS A;  2VZZ A;  2PSW A;  5JQ4 A;  4CRZ B;  1I1D A;  1XE4 A;  4KSA A;  1Q2C A;  1Q2Y A;  4YRH A;  2Q4Y A;  3E0K A;  1FY7 A;  2P6G A;  3TFY A;  2VXK A;  4CYP A;  2ARH A;  4A32 A;  2OU2 A;  4UWJ A;  3TO6 A;  2VI7 A;  4BBH A;  2A4N A;  2O28 A;  4B5P B;  2D4P A;  1GHE A;  3S6F A;  1LRZ A;  4FD6 A;  4CAW A;  4L89 A;  4MFK A;  2Q0Y A;  4CGP A;  5KTD A;  1V0C A;  5CNP A;  3D8P A;  4MFL A;  4QVT A;  4J3G A;  4QB9 A;  4XPK A;  4NCZ A;  5G21 A;  4ZGY B;  2B4D B;  2R7H A;  1BOB A;  3GKR A;  4QC6 A;  1P0H A;  2REE A;  5DWN A;  5AG4 A;  1I21 A;  2C27 A;  1IID A;  5G20 A;  2PR8 A;  1YLE A;  3DR6 A;  4MY0 A;  4F0Y A;  5F48 A;  2HUZ A;  1B87 A;  1QST A;  1XEB A;  3R95 A;  3H5Z A;  2FXF A;  2ZXV A;  4GS4 A;  4CYN A;  3RYO A;  2JDD A;  1IIC A;  5J8C A;  3DR8 A;  1L0C A;  4IUS A;  2VZY A;  1MJB A;  1Y7R A;  1MK4 A;  2WUU A;  2B5G A;  1Y9K A;  5IV0 A;  3CXP A;  1I12 A;  2FIW A;  3FRM A;  5AGE A;  5A27 A;  2Z3O A;  4NSQ A;  2G3A A;  3JUW A;  4UWI A;  4KLW A;  4PK3 A;  5E96 A;  4LX9 A;  4OAD A;  1S3Z A;  4U5Y A;  2QML A;  5F46 A;  1M4G A;  3TOB A;  4CGN A;  4UCM A;  4KUB A;  4R57 A;  4U9Y A;  2FIA A;  4EVY A;  2G0B A;  4KS9 A;  5AG6 A;  4FD7 A;  4E2A A;  2QEC A;  3S6K A;  2VBQ A;  2Q4V A;  2FS5 A;  2CNT A;  4KLV A;  2JEV A;  4II9 A;  1ZO0 A;  1MJA A;  4A2Z A;  2FSR A;  3BLN A;  4NEX A;  3QAH A;  3KKW A;  2HV2 A;  4JXR A;  1N71 A;  1S7L A;  3JTK A;  3IU1 A;  3H4Q A;  4CS0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...