2ATRA

Acetyltransferase, gnat family protein sp0256 from streptococcus pneumoniae tigr4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
132
Chain Sequence
MITIKKQEIVKLEDVLHLYQAVGWTNEMLEQALSHSLVIYLALDGDAVVGLIRLVGDGFSSVFVQDLIVLPSYQRQGIGSSLMKEALGNFKEAYQVQLATEETEKNVGFYRSMGFEILSTYDCTGMIWINRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase, GNAT family
publication title Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 27
structure length 132
sequence length 137
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2atrA00
2K5TA 5HH1A 3JUWA 5H86A 1XEBA 1QSMA 2FCKA 5CNPA 4I49A 3GY9A 4NSQA 4AG7A 2P6FA 3EC4A 3R9GA 1U6MA 2CNTA 2CY2A 4CRYB 2FIAA 4MJ8A 2PDOA 2PQ8A 2B4DA 3DSBA 1PUAA 4NF1A 3SHPA 4KORA 4XNHC 4YRHA 2PR1A 1IICA 2VEZA 2BUEA 3FRMA 4JXRA 2R7HA 4FD4A 3LD2A 1S60A 3FXTA 4HKFA 2D4OA 4JD6A 2G3TA 1S7KA 2C27A 1S3ZA 3VWDA 2P6GA 2HUZA 3SXNA 3SXOA 4E2AA 3FYNA 4AB7A 3R1KA 3TOAA 3DR6A 2REFA 1S5KA 5ISVA 5J8CA 1YVKA 3EO4A 4E8OA 1QSRA 2VI7A 2J8NA 3RYOA 2VQYA 2VXKA 3K9UA 4UA3A 2GIVA 3P2HA 4XPKA 1S7FA 3GYAA 1YK3A 3FBUA 4YGOA 4AVCA 4RS2A 4XPDB 4JLYA 4K30A 5JQ4A 3PP9A 4FD5A 3TTHA 2FL4A 2P0WA 4OADA 1I12A 3TO7A 5C88A 3LODA 1RO5A 3DR8A 1LRZA 2I00A 2A4NA 3TO6A 4AG9A 3TCVA 3FIXA 3H4QA 3BJ7A 2OH1A 2ZW5A 2GE3A 1Q2YA 3UY5A 4KOTA 5KTCA 5F47A 1Y9KA 5IB0A 1MJ9A 2QECA 2FIWA 1XIXA 2HV2A 2ZW6A 4KVME 1TIQA 4UWJA 2FT0A 3TO9A 2B5GB 5F48A 3TOBA 4EVYA 4HNYB 1KUVA 1IYLA 1UFHA 3BJ8A 3ZJ0A 4CS0B 2QMLA 1Z4EA 4QBJA 2Q7BA 3EFAA 2OB0A 2P6EA 3T90A 1Z9UA 4LUAA 4KOUA 4R57A 3PGPA 5I0CA 4E0AA 2JDDA 2Z0ZA 3I9SA 3V8IA 4KOSA 1NSLA 5DWMA 4PSXA 3TE4A 1CM0A 3S6GA 4XPLA 3QAHA 4KLWA 1NMTA 4NEXA 2ARHA 4B5PA 1B87A 3TFYA 2VZYA 4QUSA 1MK4A 1M1DA 3BLNA 4L89A 4XNHB 4L8AA 4U5YA 2OZUA 1N71A 2DXQA 3FNCA 2J8RA 1MJBA 2HQYA 5GCNA 1XF8A 4GS4A 2FS5A 3IWGA 3R96A 1OZPA 2O28A 2G0BA 5E96A 2B4DB 4MHDA 4R87A 3WR7A 1VHSA 4AVBA 4CRZB 3D3SA 5F49A 4HNXB 3PZJA 3B8GA 4II9A 3D8PA 3FB3A 2ZW7A 4B5PB 3OWCA 2NMTA 4KOXA 4UBRA 5HMNA 1Z4RA 2CNMA 2ZW4A 4F0YA 4KOWA 1PU9A 3D2PA 2X7BA 1Q2CA 4FD6A 4H6ZA 4MY3A 4U9ZA 4DNCA 1KUXA 4JXQA 2FSRA 1YREA 1SQHA 3KKWA 2H5MA 2Z10A 1K4JA 3R9FA 3DDDA 1I21A 1YGHA 1ON0A 4U9YA 4RI1A 3ZZIA 1Y9WA 3TT2A 2R1IA 4X5KA 4FD7A 1M4IA 3CXQA 5IX3A 2WPXA 3R95A 4IUSA 3EXNA 2REEA 2PRBA 1WWZA 3MGDA 1QSOA 4CAVA 4ZBGA 3IGRA 4OAEA 2WPWA 3CXSA 1NE9A 1QSTA 2FE7A 1YVOA 2I79A 4H89A 1BOBA 2B58A 2GANA 3D2MA 4PV6A 4CAWA 4MI4A 2Z11A 1MJAA 3G8WA 5EC4A 1KUYA 5C82A 1XMTA 1M4DA 2QIRA 2PC1A 1BO4A 1B6BA 5H84A 1J4JA 3S6KA 4KZTA 2ZPAA 3DNSA 4QB9A 4F6AA 4PK2A 4MY0A 2EUIA 2D4PA 2OZHA 2VZZA 3VWEA 2F5IA 4KOYA 3S6HA 2AJ6A 4H6UA 2JDCA 2B3UA 3R9EA 3JVNA 3C26A 3CXPA 1M4GA 1I1DA 1IB1E 4KLVA 1GHEA 4R3LA 5DWNA 5IV0A 1FY7A 1S7NA 4JWPA 4KUAA 2FXFA 4OLLA 4YFJA 3P2FA 2OZGA 2CNSA 2IL4A 4JJXA 4PSWA 4HNWB 4KUBA 1VKCA 3I3GA 4ORFA 2Q04A 3T9YA 2ZXVA 4M85A 3QB8A 1YR0A 1IIDA 2G3AA 4CAXA 1P0HA 4J3GA 2VBQA 3GKRA 2Q0YA 4Y49C 5F46A 4QC6A 2BSWA 2Q4VA 2Q4YA 3F0AA 2RC4A 4R3KA 4ONUA 2OU2A 1XE4A 3NE7A 5KTDA 1P4NA 2B4BA 2JEVA 1YLEA 4Y49B 1KZFA 4QVTA 1YX0A 2Q44A 4NCZA 4MBUA 2KCWA 3EY5A 2Y0MA 2R8VA 4XPDC 5JPHA 1CJWA 4B5OA 2B3VA 2PSWA 2BEIA 1S7LA 4BMHA 1IYKA 1Q2DA 2B5GA 3S6FA 3E0KA 2J8MA 4KOVA 3W6SA 1M44A 2R98A 3G3SA 4R9MA 5EBVA 2PR8A 1QSNA 5KTAA 4IF5A 4KVXA 3F5BA 2BL1A 1L0CA 5J8FA 1R57A 4NXYA 1WK4A 2AE6A 4M3SA 3N7ZA 4PK3A 2JLMA 3F8KA 1Y7RA 4LX9A 4UWIA 1V0CA 5FVJA 3W91A 3W6XA 2EVNA 4KVOE 1RXTA 4AVAA 2ATRA
chains in the Genus database with same CATH superfamily
3NFZA 4NFRA 1OBRA 2K5TA 2EBJA 2ZEDA 4NGQA 4ZX9A 4NGMA 3SJFA 3CPXA 4Q7AA 5HH1A 3FVLA 4UFXA 3JUWA 1QMUA 5H86A 1XEBA 1YSJA 3IJ3A 2PJ3A 1QSMA 2FCKA 5CNPA 3RZAA 4I49A 3GY9A 4NSQA 4AG7A 2P6FA 3EC4A 4F8ZA 3R9GA 5AG6A 1U6MA 4W9YA 4B10A 4BD9A 3B3TA 2CNTA 2CY2A 4CRYB 3FEDA 2FIAA 3WC6A 4OC1A 4MJ8A 3H8FA 2PDOA 4BBHA 2PQ8A 4F9VA 5K8MA 2B4DA 2Q7SA 3TX8A 4HPSA 5AGEA 4UCPA 3DSBA 1PUAA 4NF1A 2DPTA 3SHPA 4KORA 1ZO0A 5HVGA 4XNHC 4YRHA 3GUXA 2PR1A 1IICA 2VEZA 2BUEA 4C7HA 5LYFA 3FRMA 4JXRA 2R7HA 4M6IA 4FD4A 1Z2LA 2PJ8A 3LD2A 3PB7X 4DYOA 4MMOA 1S60A 3FXTA 4HKFA 2D4OA 4NGPA 4B11A 4JD6A 5J1QA 2G3TA 5HXDA 2QYVA 1HEEA 2ZEOA 1S7KA 4ZI6A 2XEFA 8CPAA 2C27A 1TF9A 1S3ZA 1ZLHA 3VWDA 2P6GA 3PB4X 4PXBA 3I1UA 1ARMA 4GXHA 2HUZA 4MRIA 2JBJA 2PJ6A 3SXNA 3SXOA 3DGVA 4E2AA 3FH4A 1YW4A 3FYNA 3NH4A 4AB7A 3RNZA 1VIXA 5JM6A 3R1KA 2DF5A 3TOAA 4OC5A 3B2YA 5F09A 2VL1A 3DR6A 2CF4A 2REFA 3B3VA 4FUUA 1ZLIA 1S5KA 5ISVA 3BI1A 5J8CA 1YVKA 3EO4A 4E8OA 1X12A 1QSRA 2GLFA 2VI7A 4M6GA 4NGSA 4PPZA 2J8NA 1IU8A 3RYOA 3NA6A 2VQYA 2NSMA 2VXKA 3PB6X 1DE4C 3K9UA 4UA3A 1CP7A 3D7FA 1KWMA 2GIVA 3P2HA 4CGOA 4XPKA 1S7FA 1AMPA 3CPAA 3GYAA 4WJBA 3D4UA 5D29A 4BINA 1YK3A 3ISZA 5LRJA 3JTKA 2CXAA 2RB7A 3VH9A 3FBUA 4YGOA 2XEIA 2Z3MA 4RS2A 4AVCA 1AYEA 2J9AA 2OR4A 4MFPA 4XPDB 4JLYA 4K30A 1TF8A 3PP9A 1Z8LA 1IOIA 1R3NA 2ZEHA 4FD5A 3TTHA 5JQ4A 2FL4A 2P0WA 3H8GA 1I12A 4OADA 3TO7A 3LODA 5C88A 3V38A 1RO5A 3DR8A 1LRZA 2V77A 2AFXA 2I00A 2A4NA 5LYLA 3VATA 3TO6A 3NH8A 4AG9A 2Q51A 3TCVA 3FIXA 3H4QA 4DJLA 4F9UA 3BJ7A 4P4DA 2OH1A 3S9MA 3B35A 2ZW5A 2GE3A 1Q2YA 4M6HA 4KOTA 5AG7A 3UY5A 5KTCA 5F47A 1Y9KA 4NJQA 5K8PA 2V8GA 5IB0A 1MJ9A 4OC0A 3SJXA 2QECA 3PFEA 1PYTB 1CP6A 4LQGA 2DEAA 2FIWA 4KSAA 1XMBA 4MFKA 4A32A 1ELMP 1XIXA 2HV2A 2PJ7A 4C2YA 5I4MA 3IEHA 2ZW6A 3PEIA 4KVME 1TIQA 5ELYA 4P4EA 5HVFA 4P4JA 4UWJA 2FT0A 3TO9A 2B5GB 4LQ6A 5F48A 3LWUA 1TKJA 3FF3A 3JRUA 4OMEA 3TOBA 2JBKA 2PJ4A 4EVYA 3A9LA 4HNYB 4X3RA 2GU2A 4PXEA 4CGMA 1KUVA 1IYLA 4EFDA 1UFHA 2Z3OA 3BJ8A 3ZJ0A 4CS0B 1F57A 1BPNA 1LCPA 2XEGA 3DLJA 1Y7EA 4P4BA 3FMCA 2QMLA 4FWUA 1Z4EA 4AXVA 4QBJA 2Q7BA 3ISXA 4ZY2A 3EFAA 2OB0A 2P6EA 3T90A 3H8EA 1Z9UA 4LUAA 4KOUA 4R57A 1XOVA 3IIBA 2PJ9A 3IU1A 3PGPA 5LYDA 7CPAA 5JH9A 5I0CA 2ZEMA 4E0AA 2JDDA 2PJBA 2Z0ZA 3MRUA 3I9SA 4NGNA 3V8IA 3PFOA 4KOSA 4CYPA 2I3CA 2WSAA 3K9TA 2QJ8A 1NSLA 5DWMA 4PSXA 3TE4A 1CM0A 1BAVA 3B3CA 3RAMA 1XBUA 2BCOA 5CBMA 2AFOA 3FEEA 3S6GA 6CPAA 4XPLA 3QAHA 4KLWA 1NMTA 4NEXA 1BPMA 2PJCA 3FX6A 2G9DA 2ARHA 4MHNA 3KQXA 4NJRA 3S9NA 2PJ2A 4Z65A 4K3NA 3L2NA 3D68A 4B5PA 1B87A 3TFYA 2VZYA 4QUSA 1MK4A 1M1DA 3IU2A 4G1PA 3BLNA 4P4FA 4L89A 4XNHB 2CTBA 4L8AA 1F2OA 1YLOA 3D7GA 4U5YA 4UF4A 2NYQA 2OZUA 2RFHA 1N71A 2DXQA 3FNCA 5BWAB 1R43A 2J8RA 3IWEA 1MJBA 4OC2A 4A94A 1RTQA 2HQYA 1XF8A 1IY7A 3K2KA 4UEFA 5GCNA 3D67A 4FBEA 4GS4A 2FS5A 4CGNA 2Z3PA 3IWGA 4CAFA 4NGRA 1VGYA 2ZEPA 2PIZA 3R96A 4MFZA 1OZPA 2O28A 2G0BA 5G22A 4ZX8A 5E96A 2B4DB 3H5ZA 1FT7A 4MHDA 4CYNA 2IJZA 3RO0A 3LMSA 1Z8TA 4R87A 4OKOA 4P4IA 3WR7A 4UIBA 4PXDA 1VHSA 4AVBA 4IAVA 4C2XA 4CRZB 3D3SA 4YWYA 4TWEA 5LRGA 2EK9A 5F49A 3BXMA 3SI1A 3HLPA 3PZJA 4HNXB 4CGLA 2AFSA 4OC3A 4WWVA 3B8GA 2WYRA 4II9A 5CPAA 3D8PA 3FB3A 3T8WA 2ZW7A 4B5PB 1A2ZA 4OIDA 3OWCA 1HDUA 2BO9A 2NMTA 4B13A 2PJ0A 2Z3NA 4R8FA 3KGQA 4KOXA 2ZEEA 3D7DA 4KSFA 1Z4RA 2CNMA 2ZW4A 4UBRA 4F0YA 5HMNA 2YGWA 4KOWA 4A31A 4X8IA 2PJAA 3GIUA 1PU9A 3D2PA 5D8NA 2X7BA 1Q2CA 2ANPA 4FD6A 4H6ZA 4MY3A 4U9ZA 3NH5A 2ZOGA 4X2TA 1KUXA 4DNCA 4JXQA 1F2PA 2FSRA 1ZG7A 4Q38A 3KHXA 1YREA 4UIAA 4MCSA 1SQHA 3KKWA 2H5MA 2Z10A 1K4JA 3KI9A 2Z3KA 1IOFA 4UEEA 3DDDA 2O53A 2ZENA 3R9FA 2OOTA 4OP4A 1I21A 5LYIA 2C1CA 1YGHA 4EMEA 2F8HA 1ZG9A 1XJOA 2C6GA 1ON0A 2ZELA 3CZXA 3QAYA 4RI1A 4P6YA 4U9YA 2QVPA 3ZZIA 1Y9WA 3TT2A 2R1IA 2YNCA 2C6CA 4X5KA 4FD7A 2AFUA 1M4IA 1Q7LA 1XRYA 2BOAA 3BHXA 4KSIA 1HDQA 5A28A 3CXQA 3D7HA 2IMOA 4A2ZA 2WPXA 3R95A 4IUSA 5IX3A 3EXNA 2REEA 3IC1A 2PRBA 1WWZA 3MGDA 1QSOA 5HVHA 4CAVA 4R6TA 3IGRA 4ZBGA 4OAEA 4PQAA 3KZWA 2WPWA 3CXSA 4RN7A 1NE9A 1QSTA 2FE7A 1YVOA 3PBEA 2I79A 4IK2A 4R7MA 4MXUA 5AG5A 4YU9A 5G20A 3WT4A 5G21A 4MFLA 3SJGA 4H89A 3NE8A 1BOBA 2B58A 2GANA 4C68A 5G1ZA 3B7IA 2YNCC 2GLJA 3WABA 3S9LA 2AFZA 1TXRA 3D2MA 3KL9A 4PV6A 2PVWA 4ZYQA 4IHMA 3V7ZA 2CTCA 3WC7A 3N5FA 4CAWA 1Z8XA 2ZOFA 4MI4A 4UCNA 2Z11A 1MJAA 2Z3LA 4EWTA 3G8WA 4P45A 5EC4A 1KUYA 5C82A 1XMTA 1M4DA 2QIRA 3IFEA 4CPAA 2PC1A 3MN8A 1BO4A 2ZEGA 1B6BA 5H84A 1J4JA 3VARA 3S6KA 4KZTA 3GLJA 4JZ0A 2ZPAA 4O23A 3DNSA 4QB9A 4F6AA 4PK2A 1LAPA 3KR5A 5DS0A 1Y0YA 4MY0A 5AG4A 2EUIA 2D4PA 1BLLE 2XEJA 2OZHA 5JGFA 1AUGA 2JEWA 2VZZA 2YNEA 5EMIA 1CX8A 3B3WA 4MFJA 2F5IA 4KOYA 3S6HA 3VWEA 1GYTA 2AJ6A 2JDCA 4H6UA 3TC8A 2B3UA 3PB8X 5K8OA 3R9EA 3JVNA 3C26A 3CXPA 1M4GA 2IQ6A 1I1DA 4B6ZA 4P44A 4CAEA 2YNDA 1IB1E 1IGBA 1X10A 2EK8A 2WZNA 3HUVA 3FJUA 4KLVA 1GHEA 4JYWA 4R3LA 5DWNA 5IV0A 1ELLP 4DUKA 1FY7A 4A39A 1S7NA 4MCRA 2Q4ZA 2WUUA 2PCUA 4JWPA 4KUAA 2FXFA 3FECA 1H8LA 4H2KA 4OLLA 4YFJA 3P2FA 2OZGA 2CNSA 1YQEA 3IO1A 2IL4A 4JJXA 4PSWA 4HNWB 1Y0RA 4KUBA 2Q43A 1FNOA 1VKCA 3I3GA 4RUHA 3PRTA 4ORFA 2Q04A 3T9YA 2ZXVA 4M85A 2GREA 1CPSA 4ZY1A 3QB8A 1YR0A 1IIDA 1LFWA 2C6PA 2POKA 2G3AA 4CAXA 1ZG8A 3QNVA 1YMEA 1LOKA 1CBXA 4NGTA 1P0HA 1JWQA 2V8VA 3GB0A 4J3GA 2VBQA 3GKRA 4B12A 2Q0YA 4Y49C 1LANA 4QC6A 5F46A 2BSWA 2Q4VA 4CGPA 1TKHA 1ARLA 2Q4YA 3F0AA 2RC4A 4R3KA 3WC5A 4ONUA 4UFWA 5THWA 2OU2A 1XE4A 2EO8A 3NE7A 5KTDA 1P4NA 3CT9A 4GM5A 2B4BA 2HB6A 2JEVA 2PE3A 1Z5RA 3SI2A 1YLEA 4Y49B 1KZFA 4ZY0A 4QVTA 3CDXA 1YX0A 4MFQA 2Q44A 4NCZA 2FVGA 4A37A 4MCQA 4MBUA 4OIWA 4UCMA 2KCWA 4ONWA 1QQ9A 3EY5A 2V8HA 4MHZA 5A27A 2O4HA 3KQZA 2Y0MA 5IB9A 4MCPA 2R8VA 2ODFA 4XPDC 4B14A 5JPHA 1Z8WA 3D66A 1CJWA 4B5OA 2AFMA 4F0XA 2B3VA 2V8DA 1M4LA 2PSWA 4PXCA 2BEIA 1S7LA 4BMHA 5LRKA 4UFVA 2F7VA 1IYKA 1JQGA 4P10A 1UWYA 2DPSA 1Q2DA 1CG2A 2B5GA 3S6FA 1YW6A 3E0KA 2J8MA 4KOVA 3KHZA 4KS9A 3W6SA 4R76A 1M44A 4FAIA 1PCAA 2R98A 4A38A 3G3SA 4CYOA 1VHEA 2PVVA 3PB9X 1XFOA 4R9MA 2CIJA 2PIYA 5EBVA 2PR8A 4ZGYB 1QSNA 1TKFA 3RBUA 4A95A 5KTAA 4TNUA 2HC9A 3KR4A 4IF5A 4KVXA 1CPXA 2PRQA 4MHYA 4Q36A 2ABZA 3KASA 3F5BA 2PJ5A 3B3SA 2BL1A 3IWWA 1L0CA 3SJEA 5J8FA 1EE3P 1R57A 4NXYA 3LACA 1WK4A 2GFQA 2AE6A 4M3SA 1DTDA 3N7ZA 4PK3A 2JLMA 3F8KA 2ZEFA 2PJ1A 1Y7RA 3SI0A 4LX9A 4UWIA 2EWBA 3BI0A 4OC4A 1VHOA 1V0CA 5FVJA 1LAMA 3W91A 3W6XA 3PBBA 2EVNA 2AFWA 4KVOE 4A30A 4C2ZA 1NSAA 4A33A 4C7IA 1RXTA 4UEZA 4MHPA 4CYQA 5K8NA 4AVAA 2ATRA
chains in the Genus database with same CATH topology
2K5TA 5HH1A 4UFXA 3JUWA 5H86A 1XEBA 1QSMA 2FCKA 5CNPA 4I49A 3GY9A 4NSQA 4AG7A 2P6FA 3EC4A 3R9GA 5AG6A 1U6MA 4B10A 2CNTA 2CY2A 4CRYB 2FIAA 4BBHA 4MJ8A 2PDOA 2PQ8A 2B4DA 5AGEA 4UCPA 3DSBA 1PUAA 4NF1A 2DPTA 3SHPA 4KORA 1ZO0A 4XNHC 4YRHA 2PR1A 1IICA 2VEZA 2BUEA 4C7HA 3FRMA 4JXRA 2R7HA 4FD4A 3LD2A 1S60A 3FXTA 4HKFA 2D4OA 4B11A 4JD6A 2G3TA 1S7KA 2C27A 1S3ZA 3VWDA 2P6GA 2HUZA 3SXNA 3SXOA 4E2AA 3FYNA 4AB7A 3R1KA 3TOAA 3DR6A 2REFA 1S5KA 5ISVA 5J8CA 1YVKA 3EO4A 4E8OA 1QSRA 2VI7A 2J8NA 3RYOA 2VQYA 2VXKA 3K9UA 4UA3A 2GIVA 3P2HA 4CGOA 4XPKA 1S7FA 3GYAA 1YK3A 3JTKA 2CXAA 3FBUA 4YGOA 4AVCA 2Z3MA 4RS2A 4MFPA 4XPDB 4JLYA 4K30A 5JQ4A 3PP9A 4FD5A 3TTHA 2FL4A 2P0WA 4OADA 1I12A 3TO7A 5C88A 3LODA 1RO5A 3DR8A 1LRZA 2I00A 2A4NA 3TO6A 4AG9A 3TCVA 3FIXA 3H4QA 3BJ7A 2OH1A 2ZW5A 2GE3A 1Q2YA 3UY5A 4KOTA 5AG7A 5KTCA 5F47A 1Y9KA 5IB0A 1MJ9A 2QECA 2FIWA 4KSAA 4MFKA 4A32A 1XIXA 2HV2A 4C2YA 2ZW6A 4KVME 1TIQA 4UWJA 2FT0A 3TO9A 2B5GB 5F48A 3TOBA 4EVYA 3A9LA 4HNYB 4CGMA 1KUVA 1IYLA 1UFHA 2Z3OA 3BJ8A 3ZJ0A 4CS0B 2QMLA 1Z4EA 4QBJA 2Q7BA 3EFAA 2OB0A 2P6EA 3T90A 1Z9UA 4LUAA 4KOUA 4R57A 3IU1A 3PGPA 5I0CA 4E0AA 2JDDA 2Z0ZA 3I9SA 3V8IA 4KOSA 4CYPA 2WSAA 1NSLA 5DWMA 4PSXA 3TE4A 1CM0A 3S6GA 4XPLA 3QAHA 4KLWA 1NMTA 4NEXA 2ARHA 4B5PA 1B87A 3TFYA 2VZYA 4QUSA 1MK4A 1M1DA 3IU2A 3BLNA 4L89A 4XNHB 4L8AA 4U5YA 2OZUA 1N71A 2DXQA 3FNCA 5BWAB 2J8RA 3IWEA 1MJBA 2HQYA 5GCNA 1XF8A 4GS4A 2FS5A 4CGNA 2Z3PA 3IWGA 4CAFA 3R96A 4MFZA 1OZPA 2O28A 2G0BA 5G22A 5E96A 2B4DB 3H5ZA 4MHDA 4CYNA 4R87A 3WR7A 1VHSA 4AVBA 4C2XA 4CRZB 3D3SA 5F49A 4CGLA 4HNXB 3PZJA 3B8GA 4II9A 3D8PA 3FB3A 2ZW7A 4B5PB 3OWCA 4B13A 2NMTA 2Z3NA 4KOXA 4KSFA 4UBRA 5HMNA 1Z4RA 2CNMA 2ZW4A 4F0YA 2YGWA 4KOWA 4A31A 1PU9A 3D2PA 2X7BA 1Q2CA 4FD6A 4H6ZA 4MY3A 4U9ZA 4DNCA 1KUXA 4JXQA 2FSRA 4Q38A 1YREA 1SQHA 3KKWA 2H5MA 2Z10A 1K4JA 2Z3KA 3R9FA 3DDDA 1I21A 1YGHA 1ON0A 4U9YA 4RI1A 3ZZIA 1Y9WA 3TT2A 2R1IA 2YNCA 4X5KA 4FD7A 1M4IA 5A28A 3CXQA 4A2ZA 5IX3A 2WPXA 3R95A 4IUSA 3EXNA 2REEA 2PRBA 1WWZA 3MGDA 1QSOA 4CAVA 4ZBGA 3IGRA 4OAEA 2WPWA 3CXSA 1NE9A 1QSTA 2FE7A 1YVOA 2I79A 5AG5A 5G20A 5G21A 4MFLA 4H89A 1BOBA 2B58A 2GANA 4C68A 5G1ZA 2YNCC 3D2MA 4PV6A 4CAWA 4MI4A 4UCNA 2Z11A 1MJAA 2Z3LA 3G8WA 5EC4A 1KUYA 5C82A 1XMTA 1M4DA 2QIRA 2PC1A 1BO4A 1B6BA 5H84A 1J4JA 3S6KA 4KZTA 2ZPAA 3DNSA 4QB9A 4F6AA 4PK2A 5AG4A 4MY0A 2EUIA 2D4PA 2OZHA 2VZZA 2YNEA 3VWEA 4MFJA 2F5IA 4KOYA 3S6HA 2AJ6A 4H6UA 2JDCA 2B3UA 3R9EA 3JVNA 3C26A 3CXPA 1M4GA 4CAEA 1I1DA 2YNDA 1IB1E 4KLVA 1GHEA 4R3LA 5DWNA 5IV0A 1FY7A 1S7NA 2WUUA 4JWPA 4KUAA 2FXFA 4OLLA 4YFJA 3P2FA 2OZGA 2CNSA 2IL4A 4JJXA 4PSWA 4HNWB 4KUBA 1VKCA 3I3GA 4ORFA 2Q04A 3T9YA 2ZXVA 4M85A 3QB8A 1YR0A 1IIDA 2G3AA 4CAXA 1P0HA 4J3GA 2VBQA 3GKRA 4B12A 2Q0YA 4Y49C 5F46A 4QC6A 2BSWA 2Q4VA 4CGPA 2Q4YA 3F0AA 2RC4A 4R3KA 4ONUA 4UFWA 2OU2A 1XE4A 3NE7A 5KTDA 1P4NA 2B4BA 2JEVA 1YLEA 4Y49B 1KZFA 4QVTA 1YX0A 4MFQA 2Q44A 4NCZA 4MBUA 4UCMA 2KCWA 3EY5A 5A27A 2Y0MA 2R8VA 4XPDC 4B14A 5JPHA 1CJWA 4B5OA 4F0XA 2B3VA 2PSWA 2BEIA 1S7LA 4BMHA 4UFVA 1IYKA 2DPSA 1Q2DA 2B5GA 3S6FA 3E0KA 2J8MA 4KOVA 4KS9A 3W6SA 1M44A 2R98A 4CYOA 3G3SA 4R9MA 5EBVA 2PR8A 4ZGYB 1QSNA 4A95A 5KTAA 4IF5A 4KVXA 4Q36A 3F5BA 2BL1A 1L0CA 5J8FA 1R57A 4NXYA 1WK4A 2AE6A 4M3SA 3N7ZA 4PK3A 2JLMA 3F8KA 1Y7RA 4LX9A 4UWIA 1V0CA 5FVJA 3W91A 3W6XA 4A30A 2EVNA 4KVOE 4C2ZA 4A33A 4C7IA 1RXTA 4CYQA 4AVAA 2ATRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5T A;  5HH1 A;  3JUW A;  5H86 A;  1XEB A;  1QSM A;  2FCK A;  5CNP A;  4I49 A;  3GY9 A;  4NSQ A;  4AG7 A;  2P6F A;  3EC4 A;  3R9G A;  1U6M A;  2CNT A;  2CY2 A;  4CRY B;  2FIA A;  4MJ8 A;  2PDO A;  2PQ8 A;  2B4D A;  3DSB A;  1PUA A;  4NF1 A;  3SHP A;  4KOR A;  4XNH C;  4YRH A;  2PR1 A;  1IIC A;  2VEZ A;  2BUE A;  3FRM A;  4JXR A;  2R7H A;  4FD4 A;  3LD2 A;  1S60 A;  3FXT A;  4HKF A;  2D4O A;  4JD6 A;  2G3T A;  1S7K A;  2C27 A;  1S3Z A;  3VWD A;  2P6G A;  2HUZ A;  3SXN A;  3SXO A;  4E2A A;  3FYN A;  4AB7 A;  3R1K A;  3TOA A;  3DR6 A;  2REF A;  1S5K A;  5ISV A;  5J8C A;  1YVK A;  3EO4 A;  4E8O A;  1QSR A;  2VI7 A;  2J8N A;  3RYO A;  2VQY A;  2VXK A;  3K9U A;  4UA3 A;  2GIV A;  3P2H A;  4XPK A;  1S7F A;  3GYA A;  1YK3 A;  3FBU A;  4YGO A;  4AVC A;  4RS2 A;  4XPD B;  4JLY A;  4K30 A;  5JQ4 A;  3PP9 A;  4FD5 A;  3TTH A;  2FL4 A;  2P0W A;  4OAD A;  1I12 A;  3TO7 A;  5C88 A;  3LOD A;  1RO5 A;  3DR8 A;  1LRZ A;  2I00 A;  2A4N A;  3TO6 A;  4AG9 A;  3TCV A;  3FIX A;  3H4Q A;  3BJ7 A;  2OH1 A;  2ZW5 A;  2GE3 A;  1Q2Y A;  3UY5 A;  4KOT A;  5KTC A;  5F47 A;  1Y9K A;  5IB0 A;  1MJ9 A;  2QEC A;  2FIW A;  1XIX A;  2HV2 A;  2ZW6 A;  4KVM E;  1TIQ A;  4UWJ A;  2FT0 A;  3TO9 A;  2B5G B;  5F48 A;  3TOB A;  4EVY A;  4HNY B;  1KUV A;  1IYL A;  1UFH A;  3BJ8 A;  3ZJ0 A;  4CS0 B;  2QML A;  1Z4E A;  4QBJ A;  2Q7B A;  3EFA A;  2OB0 A;  2P6E A;  3T90 A;  1Z9U A;  4LUA A;  4KOU A;  4R57 A;  3PGP A;  5I0C A;  4E0A A;  2JDD A;  2Z0Z A;  3I9S A;  3V8I A;  4KOS A;  1NSL A;  5DWM A;  4PSX A;  3TE4 A;  1CM0 A;  3S6G A;  4XPL A;  3QAH A;  4KLW A;  1NMT A;  4NEX A;  2ARH A;  4B5P A;  1B87 A;  3TFY A;  2VZY A;  4QUS A;  1MK4 A;  1M1D A;  3BLN A;  4L89 A;  4XNH B;  4L8A A;  4U5Y A;  2OZU A;  1N71 A;  2DXQ A;  3FNC A;  2J8R A;  1MJB A;  2HQY A;  5GCN A;  1XF8 A;  4GS4 A;  2FS5 A;  3IWG A;  3R96 A;  1OZP A;  2O28 A;  2G0B A;  5E96 A;  2B4D B;  4MHD A;  4R87 A;  3WR7 A;  1VHS A;  4AVB A;  4CRZ B;  3D3S A;  5F49 A;  4HNX B;  3PZJ A;  3B8G A;  4II9 A;  3D8P A;  3FB3 A;  2ZW7 A;  4B5P B;  3OWC A;  2NMT A;  4KOX A;  4UBR A;  5HMN A;  1Z4R A;  2CNM A;  2ZW4 A;  4F0Y A;  4KOW A;  1PU9 A;  3D2P A;  2X7B A;  1Q2C A;  4FD6 A;  4H6Z A;  4MY3 A;  4U9Z A;  4DNC A;  1KUX A;  4JXQ A;  2FSR A;  1YRE A;  1SQH A;  3KKW A;  2H5M A;  2Z10 A;  1K4J A;  3R9F A;  3DDD A;  1I21 A;  1YGH A;  1ON0 A;  4U9Y A;  4RI1 A;  3ZZI A;  1Y9W A;  3TT2 A;  2R1I A;  4X5K A;  4FD7 A;  1M4I A;  3CXQ A;  5IX3 A;  2WPX A;  3R95 A;  4IUS A;  3EXN A;  2REE A;  2PRB A;  1WWZ A;  3MGD A;  1QSO A;  4CAV A;  4ZBG A;  3IGR A;  4OAE A;  2WPW A;  3CXS A;  1NE9 A;  1QST A;  2FE7 A;  1YVO A;  2I79 A;  4H89 A;  1BOB A;  2B58 A;  2GAN A;  3D2M A;  4PV6 A;  4CAW A;  4MI4 A;  2Z11 A;  1MJA A;  3G8W A;  5EC4 A;  1KUY A;  5C82 A;  1XMT A;  1M4D A;  2QIR A;  2PC1 A;  1BO4 A;  1B6B A;  5H84 A;  1J4J A;  3S6K A;  4KZT A;  2ZPA A;  3DNS A;  4QB9 A;  4F6A A;  4PK2 A;  4MY0 A;  2EUI A;  2D4P A;  2OZH A;  2VZZ A;  3VWE A;  2F5I A;  4KOY A;  3S6H A;  2AJ6 A;  4H6U A;  2JDC A;  2B3U A;  3R9E A;  3JVN A;  3C26 A;  3CXP A;  1M4G A;  1I1D A;  1IB1 E;  4KLV A;  1GHE A;  4R3L A;  5DWN A;  5IV0 A;  1FY7 A;  1S7N A;  4JWP A;  4KUA A;  2FXF A;  4OLL A;  4YFJ A;  3P2F A;  2OZG A;  2CNS A;  2IL4 A;  4JJX A;  4PSW A;  4HNW B;  4KUB A;  1VKC A;  3I3G A;  4ORF A;  2Q04 A;  3T9Y A;  2ZXV A;  4M85 A;  3QB8 A;  1YR0 A;  1IID A;  2G3A A;  4CAX A;  1P0H A;  4J3G A;  2VBQ A;  3GKR A;  2Q0Y A;  4Y49 C;  5F46 A;  4QC6 A;  2BSW A;  2Q4V A;  2Q4Y A;  3F0A A;  2RC4 A;  4R3K A;  4ONU A;  2OU2 A;  1XE4 A;  3NE7 A;  5KTD A;  1P4N A;  2B4B A;  2JEV A;  1YLE A;  4Y49 B;  1KZF A;  4QVT A;  1YX0 A;  2Q44 A;  4NCZ A;  4MBU A;  2KCW A;  3EY5 A;  2Y0M A;  2R8V A;  4XPD C;  5JPH A;  1CJW A;  4B5O A;  2B3V A;  2PSW A;  2BEI A;  1S7L A;  4BMH A;  1IYK A;  1Q2D A;  2B5G A;  3S6F A;  3E0K A;  2J8M A;  4KOV A;  3W6S A;  1M44 A;  2R98 A;  3G3S A;  4R9M A;  5EBV A;  2PR8 A;  1QSN A;  5KTA A;  4IF5 A;  4KVX A;  3F5B A;  2BL1 A;  1L0C A;  5J8F A;  1R57 A;  4NXY A;  1WK4 A;  2AE6 A;  4M3S A;  3N7Z A;  4PK3 A;  2JLM A;  3F8K A;  1Y7R A;  4LX9 A;  4UWI A;  1V0C A;  5FVJ A;  3W91 A;  3W6X A;  2EVN A;  4KVO E;  1RXT A;  4AVA A;  2ATR A; 
#chains in the Genus database with same CATH topology
 3NFZ A;  4NFR A;  1OBR A;  2K5T A;  2EBJ A;  2ZED A;  4NGQ A;  4ZX9 A;  4NGM A;  3SJF A;  3CPX A;  4Q7A A;  5HH1 A;  3FVL A;  4UFX A;  3JUW A;  1QMU A;  5H86 A;  1XEB A;  1YSJ A;  3IJ3 A;  2PJ3 A;  1QSM A;  2FCK A;  5CNP A;  3RZA A;  4I49 A;  3GY9 A;  4NSQ A;  4AG7 A;  2P6F A;  3EC4 A;  4F8Z A;  3R9G A;  5AG6 A;  1U6M A;  4W9Y A;  4B10 A;  4BD9 A;  3B3T A;  2CNT A;  2CY2 A;  4CRY B;  3FED A;  2FIA A;  3WC6 A;  4OC1 A;  4MJ8 A;  3H8F A;  2PDO A;  4BBH A;  2PQ8 A;  4F9V A;  5K8M A;  2B4D A;  2Q7S A;  3TX8 A;  4HPS A;  5AGE A;  4UCP A;  3DSB A;  1PUA A;  4NF1 A;  2DPT A;  3SHP A;  4KOR A;  1ZO0 A;  5HVG A;  4XNH C;  4YRH A;  3GUX A;  2PR1 A;  1IIC A;  2VEZ A;  2BUE A;  4C7H A;  5LYF A;  3FRM A;  4JXR A;  2R7H A;  4M6I A;  4FD4 A;  1Z2L A;  2PJ8 A;  3LD2 A;  3PB7 X;  4DYO A;  4MMO A;  1S60 A;  3FXT A;  4HKF A;  2D4O A;  4NGP A;  4B11 A;  4JD6 A;  5J1Q A;  2G3T A;  5HXD A;  2QYV A;  1HEE A;  2ZEO A;  1S7K A;  4ZI6 A;  2XEF A;  8CPA A;  2C27 A;  1TF9 A;  1S3Z A;  1ZLH A;  3VWD A;  2P6G A;  3PB4 X;  4PXB A;  3I1U A;  1ARM A;  4GXH A;  2HUZ A;  4MRI A;  2JBJ A;  2PJ6 A;  3SXN A;  3SXO A;  3DGV A;  4E2A A;  3FH4 A;  1YW4 A;  3FYN A;  3NH4 A;  4AB7 A;  3RNZ A;  1VIX A;  5JM6 A;  3R1K A;  2DF5 A;  3TOA A;  4OC5 A;  3B2Y A;  5F09 A;  2VL1 A;  3DR6 A;  2CF4 A;  2REF A;  3B3V A;  4FUU A;  1ZLI A;  1S5K A;  5ISV A;  3BI1 A;  5J8C A;  1YVK A;  3EO4 A;  4E8O A;  1X12 A;  1QSR A;  2GLF A;  2VI7 A;  4M6G A;  4NGS A;  4PPZ A;  2J8N A;  1IU8 A;  3RYO A;  3NA6 A;  2VQY A;  2NSM A;  2VXK A;  3PB6 X;  1DE4 C;  3K9U A;  4UA3 A;  1CP7 A;  3D7F A;  1KWM A;  2GIV A;  3P2H A;  4CGO A;  4XPK A;  1S7F A;  1AMP A;  3CPA A;  3GYA A;  4WJB A;  3D4U A;  5D29 A;  4BIN A;  1YK3 A;  3ISZ A;  5LRJ A;  3JTK A;  2CXA A;  2RB7 A;  3VH9 A;  3FBU A;  4YGO A;  2XEI A;  2Z3M A;  4RS2 A;  4AVC A;  1AYE A;  2J9A A;  2OR4 A;  4MFP A;  4XPD B;  4JLY A;  4K30 A;  1TF8 A;  3PP9 A;  1Z8L A;  1IOI A;  1R3N A;  2ZEH A;  4FD5 A;  3TTH A;  5JQ4 A;  2FL4 A;  2P0W A;  3H8G A;  1I12 A;  4OAD A;  3TO7 A;  3LOD A;  5C88 A;  3V38 A;  1RO5 A;  3DR8 A;  1LRZ A;  2V77 A;  2AFX A;  2I00 A;  2A4N A;  5LYL A;  3VAT A;  3TO6 A;  3NH8 A;  4AG9 A;  2Q51 A;  3TCV A;  3FIX A;  3H4Q A;  4DJL A;  4F9U A;  3BJ7 A;  4P4D A;  2OH1 A;  3S9M A;  3B35 A;  2ZW5 A;  2GE3 A;  1Q2Y A;  4M6H A;  4KOT A;  5AG7 A;  3UY5 A;  5KTC A;  5F47 A;  1Y9K A;  4NJQ A;  5K8P A;  2V8G A;  5IB0 A;  1MJ9 A;  4OC0 A;  3SJX A;  2QEC A;  3PFE A;  1PYT B;  1CP6 A;  4LQG A;  2DEA A;  2FIW A;  4KSA A;  1XMB A;  4MFK A;  4A32 A;  1ELM P;  1XIX A;  2HV2 A;  2PJ7 A;  4C2Y A;  5I4M A;  3IEH A;  2ZW6 A;  3PEI A;  4KVM E;  1TIQ A;  5ELY A;  4P4E A;  5HVF A;  4P4J A;  4UWJ A;  2FT0 A;  3TO9 A;  2B5G B;  4LQ6 A;  5F48 A;  3LWU A;  1TKJ A;  3FF3 A;  3JRU A;  4OME A;  3TOB A;  2JBK A;  2PJ4 A;  4EVY A;  3A9L A;  4HNY B;  4X3R A;  2GU2 A;  4PXE A;  4CGM A;  1KUV A;  1IYL A;  4EFD A;  1UFH A;  2Z3O A;  3BJ8 A;  3ZJ0 A;  4CS0 B;  1F57 A;  1BPN A;  1LCP A;  2XEG A;  3DLJ A;  1Y7E A;  4P4B A;  3FMC A;  2QML A;  4FWU A;  1Z4E A;  4AXV A;  4QBJ A;  2Q7B A;  3ISX A;  4ZY2 A;  3EFA A;  2OB0 A;  2P6E A;  3T90 A;  3H8E A;  1Z9U A;  4LUA A;  4KOU A;  4R57 A;  1XOV A;  3IIB A;  2PJ9 A;  3IU1 A;  3PGP A;  5LYD A;  7CPA A;  5JH9 A;  5I0C A;  2ZEM A;  4E0A A;  2JDD A;  2PJB A;  2Z0Z A;  3MRU A;  3I9S A;  4NGN A;  3V8I A;  3PFO A;  4KOS A;  4CYP A;  2I3C A;  2WSA A;  3K9T A;  2QJ8 A;  1NSL A;  5DWM A;  4PSX A;  3TE4 A;  1CM0 A;  1BAV A;  3B3C A;  3RAM A;  1XBU A;  2BCO A;  5CBM A;  2AFO A;  3FEE A;  3S6G A;  6CPA A;  4XPL A;  3QAH A;  4KLW A;  1NMT A;  4NEX A;  1BPM A;  2PJC A;  3FX6 A;  2G9D A;  2ARH A;  4MHN A;  3KQX A;  4NJR A;  3S9N A;  2PJ2 A;  4Z65 A;  4K3N A;  3L2N A;  3D68 A;  4B5P A;  1B87 A;  3TFY A;  2VZY A;  4QUS A;  1MK4 A;  1M1D A;  3IU2 A;  4G1P A;  3BLN A;  4P4F A;  4L89 A;  4XNH B;  2CTB A;  4L8A A;  1F2O A;  1YLO A;  3D7G A;  4U5Y A;  4UF4 A;  2NYQ A;  2OZU A;  2RFH A;  1N71 A;  2DXQ A;  3FNC A;  5BWA B;  1R43 A;  2J8R A;  3IWE A;  1MJB A;  4OC2 A;  4A94 A;  1RTQ A;  2HQY A;  1XF8 A;  1IY7 A;  3K2K A;  4UEF A;  5GCN A;  3D67 A;  4FBE A;  4GS4 A;  2FS5 A;  4CGN A;  2Z3P A;  3IWG A;  4CAF A;  4NGR A;  1VGY A;  2ZEP A;  2PIZ A;  3R96 A;  4MFZ A;  1OZP A;  2O28 A;  2G0B A;  5G22 A;  4ZX8 A;  5E96 A;  2B4D B;  3H5Z A;  1FT7 A;  4MHD A;  4CYN A;  2IJZ A;  3RO0 A;  3LMS A;  1Z8T A;  4R87 A;  4OKO A;  4P4I A;  3WR7 A;  4UIB A;  4PXD A;  1VHS A;  4AVB A;  4IAV A;  4C2X A;  4CRZ B;  3D3S A;  4YWY A;  4TWE A;  5LRG A;  2EK9 A;  5F49 A;  3BXM A;  3SI1 A;  3HLP A;  3PZJ A;  4HNX B;  4CGL A;  2AFS A;  4OC3 A;  4WWV A;  3B8G A;  2WYR A;  4II9 A;  5CPA A;  3D8P A;  3FB3 A;  3T8W A;  2ZW7 A;  4B5P B;  1A2Z A;  4OID A;  3OWC A;  1HDU A;  2BO9 A;  2NMT A;  4B13 A;  2PJ0 A;  2Z3N A;  4R8F A;  3KGQ A;  4KOX A;  2ZEE A;  3D7D A;  4KSF A;  1Z4R A;  2CNM A;  2ZW4 A;  4UBR A;  4F0Y A;  5HMN A;  2YGW A;  4KOW A;  4A31 A;  4X8I A;  2PJA A;  3GIU A;  1PU9 A;  3D2P A;  5D8N A;  2X7B A;  1Q2C A;  2ANP A;  4FD6 A;  4H6Z A;  4MY3 A;  4U9Z A;  3NH5 A;  2ZOG A;  4X2T A;  1KUX A;  4DNC A;  4JXQ A;  1F2P A;  2FSR A;  1ZG7 A;  4Q38 A;  3KHX A;  1YRE A;  4UIA A;  4MCS A;  1SQH A;  3KKW A;  2H5M A;  2Z10 A;  1K4J A;  3KI9 A;  2Z3K A;  1IOF A;  4UEE A;  3DDD A;  2O53 A;  2ZEN A;  3R9F A;  2OOT A;  4OP4 A;  1I21 A;  5LYI A;  2C1C A;  1YGH A;  4EME A;  2F8H A;  1ZG9 A;  1XJO A;  2C6G A;  1ON0 A;  2ZEL A;  3CZX A;  3QAY A;  4RI1 A;  4P6Y A;  4U9Y A;  2QVP A;  3ZZI A;  1Y9W A;  3TT2 A;  2R1I A;  2YNC A;  2C6C A;  4X5K A;  4FD7 A;  2AFU A;  1M4I A;  1Q7L A;  1XRY A;  2BOA A;  3BHX A;  4KSI A;  1HDQ A;  5A28 A;  3CXQ A;  3D7H A;  2IMO A;  4A2Z A;  2WPX A;  3R95 A;  4IUS A;  5IX3 A;  3EXN A;  2REE A;  3IC1 A;  2PRB A;  1WWZ A;  3MGD A;  1QSO A;  5HVH A;  4CAV A;  4R6T A;  3IGR A;  4ZBG A;  4OAE A;  4PQA A;  3KZW A;  2WPW A;  3CXS A;  4RN7 A;  1NE9 A;  1QST A;  2FE7 A;  1YVO A;  3PBE A;  2I79 A;  4IK2 A;  4R7M A;  4MXU A;  5AG5 A;  4YU9 A;  5G20 A;  3WT4 A;  5G21 A;  4MFL A;  3SJG A;  4H89 A;  3NE8 A;  1BOB A;  2B58 A;  2GAN A;  4C68 A;  5G1Z A;  3B7I A;  2YNC C;  2GLJ A;  3WAB A;  3S9L A;  2AFZ A;  1TXR A;  3D2M A;  3KL9 A;  4PV6 A;  2PVW A;  4ZYQ A;  4IHM A;  3V7Z A;  2CTC A;  3WC7 A;  3N5F A;  4CAW A;  1Z8X A;  2ZOF A;  4MI4 A;  4UCN A;  2Z11 A;  1MJA A;  2Z3L A;  4EWT A;  3G8W A;  4P45 A;  5EC4 A;  1KUY A;  5C82 A;  1XMT A;  1M4D A;  2QIR A;  3IFE A;  4CPA A;  2PC1 A;  3MN8 A;  1BO4 A;  2ZEG A;  1B6B A;  5H84 A;  1J4J A;  3VAR A;  3S6K A;  4KZT A;  3GLJ A;  4JZ0 A;  2ZPA A;  4O23 A;  3DNS A;  4QB9 A;  4F6A A;  4PK2 A;  1LAP A;  3KR5 A;  5DS0 A;  1Y0Y A;  4MY0 A;  5AG4 A;  2EUI A;  2D4P A;  1BLL E;  2XEJ A;  2OZH A;  5JGF A;  1AUG A;  2JEW A;  2VZZ A;  2YNE A;  5EMI A;  1CX8 A;  3B3W A;  4MFJ A;  2F5I A;  4KOY A;  3S6H A;  3VWE A;  1GYT A;  2AJ6 A;  2JDC A;  4H6U A;  3TC8 A;  2B3U A;  3PB8 X;  5K8O A;  3R9E A;  3JVN A;  3C26 A;  3CXP A;  1M4G A;  2IQ6 A;  1I1D A;  4B6Z A;  4P44 A;  4CAE A;  2YND A;  1IB1 E;  1IGB A;  1X10 A;  2EK8 A;  2WZN A;  3HUV A;  3FJU A;  4KLV A;  1GHE A;  4JYW A;  4R3L A;  5DWN A;  5IV0 A;  1ELL P;  4DUK A;  1FY7 A;  4A39 A;  1S7N A;  4MCR A;  2Q4Z A;  2WUU A;  2PCU A;  4JWP A;  4KUA A;  2FXF A;  3FEC A;  1H8L A;  4H2K A;  4OLL A;  4YFJ A;  3P2F A;  2OZG A;  2CNS A;  1YQE A;  3IO1 A;  2IL4 A;  4JJX A;  4PSW A;  4HNW B;  1Y0R A;  4KUB A;  2Q43 A;  1FNO A;  1VKC A;  3I3G A;  4RUH A;  3PRT A;  4ORF A;  2Q04 A;  3T9Y A;  2ZXV A;  4M85 A;  2GRE A;  1CPS A;  4ZY1 A;  3QB8 A;  1YR0 A;  1IID A;  1LFW A;  2C6P A;  2POK A;  2G3A A;  4CAX A;  1ZG8 A;  3QNV A;  1YME A;  1LOK A;  1CBX A;  4NGT A;  1P0H A;  1JWQ A;  2V8V A;  3GB0 A;  4J3G A;  2VBQ A;  3GKR A;  4B12 A;  2Q0Y A;  4Y49 C;  1LAN A;  4QC6 A;  5F46 A;  2BSW A;  2Q4V A;  4CGP A;  1TKH A;  1ARL A;  2Q4Y A;  3F0A A;  2RC4 A;  4R3K A;  3WC5 A;  4ONU A;  4UFW A;  5THW A;  2OU2 A;  1XE4 A;  2EO8 A;  3NE7 A;  5KTD A;  1P4N A;  3CT9 A;  4GM5 A;  2B4B A;  2HB6 A;  2JEV A;  2PE3 A;  1Z5R A;  3SI2 A;  1YLE A;  4Y49 B;  1KZF A;  4ZY0 A;  4QVT A;  3CDX A;  1YX0 A;  4MFQ A;  2Q44 A;  4NCZ A;  2FVG A;  4A37 A;  4MCQ A;  4MBU A;  4OIW A;  4UCM A;  2KCW A;  4ONW A;  1QQ9 A;  3EY5 A;  2V8H A;  4MHZ A;  5A27 A;  2O4H A;  3KQZ A;  2Y0M A;  5IB9 A;  4MCP A;  2R8V A;  2ODF A;  4XPD C;  4B14 A;  5JPH A;  1Z8W A;  3D66 A;  1CJW A;  4B5O A;  2AFM A;  4F0X A;  2B3V A;  2V8D A;  1M4L A;  2PSW A;  4PXC A;  2BEI A;  1S7L A;  4BMH A;  5LRK A;  4UFV A;  2F7V A;  1IYK A;  1JQG A;  4P10 A;  1UWY A;  2DPS A;  1Q2D A;  1CG2 A;  2B5G A;  3S6F A;  1YW6 A;  3E0K A;  2J8M A;  4KOV A;  3KHZ A;  4KS9 A;  3W6S A;  4R76 A;  1M44 A;  4FAI A;  1PCA A;  2R98 A;  4A38 A;  3G3S A;  4CYO A;  1VHE A;  2PVV A;  3PB9 X;  1XFO A;  4R9M A;  2CIJ A;  2PIY A;  5EBV A;  2PR8 A;  4ZGY B;  1QSN A;  1TKF A;  3RBU A;  4A95 A;  5KTA A;  4TNU A;  2HC9 A;  3KR4 A;  4IF5 A;  4KVX A;  1CPX A;  2PRQ A;  4MHY A;  4Q36 A;  2ABZ A;  3KAS A;  3F5B A;  2PJ5 A;  3B3S A;  2BL1 A;  3IWW A;  1L0C A;  3SJE A;  5J8F A;  1EE3 P;  1R57 A;  4NXY A;  3LAC A;  1WK4 A;  2GFQ A;  2AE6 A;  4M3S A;  1DTD A;  3N7Z A;  4PK3 A;  2JLM A;  3F8K A;  2ZEF A;  2PJ1 A;  1Y7R A;  3SI0 A;  4LX9 A;  4UWI A;  2EWB A;  3BI0 A;  4OC4 A;  1VHO A;  1V0C A;  5FVJ A;  1LAM A;  3W91 A;  3W6X A;  3PBB A;  2EVN A;  2AFW A;  4KVO E;  4A30 A;  4C2Z A;  1NSA A;  4A33 A;  4C7I A;  1RXT A;  4UEZ A;  4MHP A;  4CYQ A;  5K8N A;  4AVA A;  2ATR A; 
#chains in the Genus database with same CATH homology
 2K5T A;  5HH1 A;  4UFX A;  3JUW A;  5H86 A;  1XEB A;  1QSM A;  2FCK A;  5CNP A;  4I49 A;  3GY9 A;  4NSQ A;  4AG7 A;  2P6F A;  3EC4 A;  3R9G A;  5AG6 A;  1U6M A;  4B10 A;  2CNT A;  2CY2 A;  4CRY B;  2FIA A;  4BBH A;  4MJ8 A;  2PDO A;  2PQ8 A;  2B4D A;  5AGE A;  4UCP A;  3DSB A;  1PUA A;  4NF1 A;  2DPT A;  3SHP A;  4KOR A;  1ZO0 A;  4XNH C;  4YRH A;  2PR1 A;  1IIC A;  2VEZ A;  2BUE A;  4C7H A;  3FRM A;  4JXR A;  2R7H A;  4FD4 A;  3LD2 A;  1S60 A;  3FXT A;  4HKF A;  2D4O A;  4B11 A;  4JD6 A;  2G3T A;  1S7K A;  2C27 A;  1S3Z A;  3VWD A;  2P6G A;  2HUZ A;  3SXN A;  3SXO A;  4E2A A;  3FYN A;  4AB7 A;  3R1K A;  3TOA A;  3DR6 A;  2REF A;  1S5K A;  5ISV A;  5J8C A;  1YVK A;  3EO4 A;  4E8O A;  1QSR A;  2VI7 A;  2J8N A;  3RYO A;  2VQY A;  2VXK A;  3K9U A;  4UA3 A;  2GIV A;  3P2H A;  4CGO A;  4XPK A;  1S7F A;  3GYA A;  1YK3 A;  3JTK A;  2CXA A;  3FBU A;  4YGO A;  4AVC A;  2Z3M A;  4RS2 A;  4MFP A;  4XPD B;  4JLY A;  4K30 A;  5JQ4 A;  3PP9 A;  4FD5 A;  3TTH A;  2FL4 A;  2P0W A;  4OAD A;  1I12 A;  3TO7 A;  5C88 A;  3LOD A;  1RO5 A;  3DR8 A;  1LRZ A;  2I00 A;  2A4N A;  3TO6 A;  4AG9 A;  3TCV A;  3FIX A;  3H4Q A;  3BJ7 A;  2OH1 A;  2ZW5 A;  2GE3 A;  1Q2Y A;  3UY5 A;  4KOT A;  5AG7 A;  5KTC A;  5F47 A;  1Y9K A;  5IB0 A;  1MJ9 A;  2QEC A;  2FIW A;  4KSA A;  4MFK A;  4A32 A;  1XIX A;  2HV2 A;  4C2Y A;  2ZW6 A;  4KVM E;  1TIQ A;  4UWJ A;  2FT0 A;  3TO9 A;  2B5G B;  5F48 A;  3TOB A;  4EVY A;  3A9L A;  4HNY B;  4CGM A;  1KUV A;  1IYL A;  1UFH A;  2Z3O A;  3BJ8 A;  3ZJ0 A;  4CS0 B;  2QML A;  1Z4E A;  4QBJ A;  2Q7B A;  3EFA A;  2OB0 A;  2P6E A;  3T90 A;  1Z9U A;  4LUA A;  4KOU A;  4R57 A;  3IU1 A;  3PGP A;  5I0C A;  4E0A A;  2JDD A;  2Z0Z A;  3I9S A;  3V8I A;  4KOS A;  4CYP A;  2WSA A;  1NSL A;  5DWM A;  4PSX A;  3TE4 A;  1CM0 A;  3S6G A;  4XPL A;  3QAH A;  4KLW A;  1NMT A;  4NEX A;  2ARH A;  4B5P A;  1B87 A;  3TFY A;  2VZY A;  4QUS A;  1MK4 A;  1M1D A;  3IU2 A;  3BLN A;  4L89 A;  4XNH B;  4L8A A;  4U5Y A;  2OZU A;  1N71 A;  2DXQ A;  3FNC A;  5BWA B;  2J8R A;  3IWE A;  1MJB A;  2HQY A;  5GCN A;  1XF8 A;  4GS4 A;  2FS5 A;  4CGN A;  2Z3P A;  3IWG A;  4CAF A;  3R96 A;  4MFZ A;  1OZP A;  2O28 A;  2G0B A;  5G22 A;  5E96 A;  2B4D B;  3H5Z A;  4MHD A;  4CYN A;  4R87 A;  3WR7 A;  1VHS A;  4AVB A;  4C2X A;  4CRZ B;  3D3S A;  5F49 A;  4CGL A;  4HNX B;  3PZJ A;  3B8G A;  4II9 A;  3D8P A;  3FB3 A;  2ZW7 A;  4B5P B;  3OWC A;  4B13 A;  2NMT A;  2Z3N A;  4KOX A;  4KSF A;  4UBR A;  5HMN A;  1Z4R A;  2CNM A;  2ZW4 A;  4F0Y A;  2YGW A;  4KOW A;  4A31 A;  1PU9 A;  3D2P A;  2X7B A;  1Q2C A;  4FD6 A;  4H6Z A;  4MY3 A;  4U9Z A;  4DNC A;  1KUX A;  4JXQ A;  2FSR A;  4Q38 A;  1YRE A;  1SQH A;  3KKW A;  2H5M A;  2Z10 A;  1K4J A;  2Z3K A;  3R9F A;  3DDD A;  1I21 A;  1YGH A;  1ON0 A;  4U9Y A;  4RI1 A;  3ZZI A;  1Y9W A;  3TT2 A;  2R1I A;  2YNC A;  4X5K A;  4FD7 A;  1M4I A;  5A28 A;  3CXQ A;  4A2Z A;  5IX3 A;  2WPX A;  3R95 A;  4IUS A;  3EXN A;  2REE A;  2PRB A;  1WWZ A;  3MGD A;  1QSO A;  4CAV A;  4ZBG A;  3IGR A;  4OAE A;  2WPW A;  3CXS A;  1NE9 A;  1QST A;  2FE7 A;  1YVO A;  2I79 A;  5AG5 A;  5G20 A;  5G21 A;  4MFL A;  4H89 A;  1BOB A;  2B58 A;  2GAN A;  4C68 A;  5G1Z A;  2YNC C;  3D2M A;  4PV6 A;  4CAW A;  4MI4 A;  4UCN A;  2Z11 A;  1MJA A;  2Z3L A;  3G8W A;  5EC4 A;  1KUY A;  5C82 A;  1XMT A;  1M4D A;  2QIR A;  2PC1 A;  1BO4 A;  1B6B A;  5H84 A;  1J4J A;  3S6K A;  4KZT A;  2ZPA A;  3DNS A;  4QB9 A;  4F6A A;  4PK2 A;  5AG4 A;  4MY0 A;  2EUI A;  2D4P A;  2OZH A;  2VZZ A;  2YNE A;  3VWE A;  4MFJ A;  2F5I A;  4KOY A;  3S6H A;  2AJ6 A;  4H6U A;  2JDC A;  2B3U A;  3R9E A;  3JVN A;  3C26 A;  3CXP A;  1M4G A;  4CAE A;  1I1D A;  2YND A;  1IB1 E;  4KLV A;  1GHE A;  4R3L A;  5DWN A;  5IV0 A;  1FY7 A;  1S7N A;  2WUU A;  4JWP A;  4KUA A;  2FXF A;  4OLL A;  4YFJ A;  3P2F A;  2OZG A;  2CNS A;  2IL4 A;  4JJX A;  4PSW A;  4HNW B;  4KUB A;  1VKC A;  3I3G A;  4ORF A;  2Q04 A;  3T9Y A;  2ZXV A;  4M85 A;  3QB8 A;  1YR0 A;  1IID A;  2G3A A;  4CAX A;  1P0H A;  4J3G A;  2VBQ A;  3GKR A;  4B12 A;  2Q0Y A;  4Y49 C;  5F46 A;  4QC6 A;  2BSW A;  2Q4V A;  4CGP A;  2Q4Y A;  3F0A A;  2RC4 A;  4R3K A;  4ONU A;  4UFW A;  2OU2 A;  1XE4 A;  3NE7 A;  5KTD A;  1P4N A;  2B4B A;  2JEV A;  1YLE A;  4Y49 B;  1KZF A;  4QVT A;  1YX0 A;  4MFQ A;  2Q44 A;  4NCZ A;  4MBU A;  4UCM A;  2KCW A;  3EY5 A;  5A27 A;  2Y0M A;  2R8V A;  4XPD C;  4B14 A;  5JPH A;  1CJW A;  4B5O A;  4F0X A;  2B3V A;  2PSW A;  2BEI A;  1S7L A;  4BMH A;  4UFV A;  1IYK A;  2DPS A;  1Q2D A;  2B5G A;  3S6F A;  3E0K A;  2J8M A;  4KOV A;  4KS9 A;  3W6S A;  1M44 A;  2R98 A;  4CYO A;  3G3S A;  4R9M A;  5EBV A;  2PR8 A;  4ZGY B;  1QSN A;  4A95 A;  5KTA A;  4IF5 A;  4KVX A;  4Q36 A;  3F5B A;  2BL1 A;  1L0C A;  5J8F A;  1R57 A;  4NXY A;  1WK4 A;  2AE6 A;  4M3S A;  3N7Z A;  4PK3 A;  2JLM A;  3F8K A;  1Y7R A;  4LX9 A;  4UWI A;  1V0C A;  5FVJ A;  3W91 A;  3W6X A;  4A30 A;  2EVN A;  4KVO E;  4C2Z A;  4A33 A;  4C7I A;  1RXT A;  4CYQ A;  4AVA A;  2ATR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...