2ATRA

Acetyltransferase, gnat family protein sp0256 from streptococcus pneumoniae tigr4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
132
Chain Sequence
MITIKKQEIVKLEDVLHLYQAVGWTNEMLEQALSHSLVIYLALDGDAVVGLIRLVGDGFSSVFVQDLIVLPSYQRQGIGSSLMKEALGNFKEAYQVQLATEETEKNVGFYRSMGFEILSTYDCTGMIWINRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords acetyltransferase, GNAT family
total genus 27
structure length 132
sequence length 137
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2atrA00
4KOYA 4II9A 1WK4A 2RC4A 3CXPA 4LUAA 4PK3A 2Q04A 1MJBA 2EVNA 2CY2A 3P2FA 3W6XA 4X5KA 1PU9A 3OWCA 1MK4A 4RI1A 1UFHA 2P6EA 4PSWA 1QSRA 2J8RA 4CAWA 1B6BA 2K5TA 2OH1A 2C27A 4B5PA 2HV2A 3RYOA 3SXOA 3CXQA 3DSBA 4YFJA 5C82A 2ARHA 4RS2A 4KOXA 2OZUA 2R1IA 1S7LA 4CRYB 2PR8A 4JXQA 4UBRA 2NMTA 3DR6A 2FIAA 5JPHA 4I49A 1BOBA 3C26A 1YR0A 4KLWA 2CNTA 2OU2A 4QC6A 3GYAA 1KUVA 4NXYA 1IIDA 3QAHA 2CNSA 4L89A 3S6FA 5KTDA 3DR8A 1IYKA 3TO7A 2O28A 4U9YA 1M1DA 1RXTA 4FD5A 3JVNA 2BUEA 2REEA 4QVTA 3F5BA 4BMHA 1Q2DA 3B8GA 4FD6A 4OLLA 2B4DB 3F8KA 2Q44A 3D3SA 1NSLA 4MI4A 4KOTA 4AG7A 3S6GA 1U6MA 3JUWA 3IGRA 3VWEA 3BJ7A 3ZZIA 3D8PA 3I3GA 2ZXVA 3KKWA 2GE3A 4GS4A 2Y0MA 5ISVA 5JQ4A 1FY7A 2BSWA 5EC4A 4L8AA 1S60A 2BL1A 1B87A 4HNYB 1XIXA 3EC4A 5DWMA 3TO6A 2VQYA 2FE7A 4CS0B 3DNSA 3TTHA 3SHPA 2J8NA 3TOAA 1NMTA 1YREA 3TCVA 1Y9WA 2DXQA 1S7KA 2D4PA 1CM0A 5IB0A 3UY5A 2QIRA 1Q2YA 3T9YA 2PDOA 1IYLA 2R8VA 3PGPA 2Z10A 4JD6A 3MGDA 3VWDA 4KZTA 4KOWA 4R87A 4J3GA 4IF5A 2Z11A 3CXSA 4UWJA 4R9MA 2FCKA 4NF1A 4XNHB 5KTCA 4PK2A 2VEZA 3LD2A 2ZW5A 2VBQA 1P0HA 4NSQA 3T90A 2OB0A 2FS5A 5F48A 4KOUA 4U5YA 1KUXA 2FIWA 2F5IA 3TO9A 4KLVA 2GANA 4M3SA 4AVBA 4AVAA 1IB1E 3PP9A 4JJXA 4JLYA 4KOVA 4XPDC 1VHSA 3FYNA 4YRHA 5J8FA 4DNCA 4JXRA 4PV6A 4CAVA 2Z0ZA 2GIVA 3TOBA 4KUBA 3BLNA 5DWNA 1OZPA 4H6UA 2Q4VA 3FIXA 1M4DA 4KVXA 1S3ZA 4MJ8A 2QECA 4ORFA 1SQHA 2WPWA 2KCWA 3EXNA 3K9UA 2VI7A 4OADA 2JEVA 2VZYA 5H84A 4CAXA 4LX9A 2Q0YA 2P6FA 2JDDA 3EFAA 4HKFA 1M44A 3ZJ0A 5F49A 2IL4A 1Z9UA 1S7FA 3FNCA 2JLMA 2VZZA 1M4GA 2PQ8A 3V8IA 3QB8A 4OAEA 1VKCA 4E0AA 2FSRA 2CNMA 3FBUA 4KVOE 3FB3A 3R95A 5EBVA 4QBJA 3D2PA 2REFA 3P2HA 1XEBA 3S6HA 5J8CA 5I0CA 3PZJA 2P0WA 3I9SA 3F0AA 2H5MA 1YGHA 2G3TA 1QSOA 4R3KA 1YK3A 1K4JA 1S7NA 4Y49C 3G3SA 4KUAA 1KUYA 3GY9A 4R3LA 4M85A 5KTAA 1GHEA 4KOSA 3BJ8A 1MJAA 2HUZA 4JWPA 2ZPAA 4H89A 2Q4YA 5HMNA 3D2MA 3S6KA 4AB7A 5GCNA 1LRZA 3R9FA 4QUSA 2A4NA 3FRMA 3TT2A 2ZW6A 3R9EA 2PR1A 4MHDA 1QSMA 2WPXA 4UA3A 1BO4A 1Y9KA 3R9GA 4K30A 3EY5A 3R1KA 2ATRA 1Z4EA 1QSTA 5F46A 2G3AA 3R96A 4F0YA 4PSXA 4IUSA 4MY3A 4E2AA 4NEXA 1M4IA 5H86A 1PUAA 4FD4A 2D4OA 4HNWB 4UWIA 2PC1A 5FVJA 4EVYA 3W91A 1J4JA 4FD7A 1KZFA 2I79A 2J8MA 1YX0A 3N7ZA 1Q2CA 4ONUA 4E8OA 1Y7RA 2FT0A 4B5OA 4MBUA 1YVKA 2B58A 4R57A 2B3UA 5C88A 3W6SA 1XF8A 2B3VA 2HQYA 3EO4A 1L0CA 2P6GA 2QMLA 4B5PB 3H4QA 3WR7A 4XNHC 5CNPA 2B5GB 2ZW4A 1Z4RA 1XMTA 2FXFA 4HNXB 4H6ZA 5HH1A 4U9ZA 1S5KA 4Y49B 2PSWA 2VXKA 4F6AA 1CJWA 4ZBGA 4QB9A 5E96A 1XE4A 5IX3A 1IICA 2FL4A 3NE7A 2AE6A 1NE9A 2OZHA 3G8WA 4NCZA 3IWGA 1N71A 3GKRA 3TE4A 1TIQA 1I21A 5IV0A 2PRBA 4AG9A 2B5GA 5F47A 3TFYA 3E0KA 2X7BA 1YVOA 1R57A 4KORA 3LODA 2R98A 3FXTA 4YGOA 1P4NA 1WWZA 2B4DA 2B4BA 2ZW7A 4CRZB 2OZGA 2R7HA 1YLEA 1ON0A 4XPKA 2G0BA 2AJ6A 1V0CA 3DDDA 4AVCA 2EUIA 4XPDB 2Q7BA 1I1DA 2JDCA 1RO5A 2I00A 4MY0A 3SXNA 1I12A 4XPLA 2BEIA 1QSNA 1MJ9A 4KVME
chains in the Genus database with same CATH superfamily
2Z3PA 4K3NA 4KOYA 4P6YA 3L2NA 4II9A 2C1CA 3D66A 4B6ZA 1WK4A 5K8NA 2ZEEA 2RC4A 3NH5A 4C68A 5DS0A 3CXPA 3D67A 4LUAA 4PK3A 1A2ZA 2Q04A 4ZYQA 1YW4A 4DJLA 1MJBA 2EVNA 5LRGA 2YNEA 4CGPA 2CY2A 2ZEMA 3P2FA 3W6XA 4X5KA 3H8GA 1XJOA 1PU9A 2BO9A 3OWCA 5J1QA 5A28A 4P4FA 1MK4A 3IFEA 1UFHA 2P6EA 4PSWA 4RI1A 1QSRA 1QQ9A 2F7VA 3BI1A 1LFWA 5I4MA 2J8RA 4MCPA 4CAWA 4MFLA 1B6BA 2K5TA 2OH1A 1YQEA 2C27A 2QVPA 4M6GA 5AGEA 4B5PA 2HV2A 3RAMA 3RYOA 3SXOA 1BLLE 3CXQA 2WZNA 3DSBA 4YFJA 2ZOGA 2Q4ZA 5C82A 1YMEA 2ARHA 4RS2A 3GLJA 4KOXA 2OZUA 4EMEA 2R1IA 1S7LA 2DPTA 3KASA 4CRYB 4A37A 2PR8A 3IU1A 5A27A 2RFHA 4JXQA 3FX6A 3KR4A 2NMTA 4UBRA 3DR6A 3VH9A 2FIAA 5JPHA 5F09A 4I49A 1BOBA 3C26A 2AFSA 5AG4A 1YR0A 5LYFA 4KLWA 2CNTA 2OU2A 4QC6A 3WC5A 4P45A 3GYAA 1KUVA 4NXYA 5LYLA 4MRIA 1IIDA 3QAHA 2CNSA 2YNCA 4L89A 3S6FA 1VGYA 2C6GA 3DR8A 4R7MA 5KTDA 2QJ8A 1TKJA 3NA6A 4XNHB 1IYKA 3TO7A 2O28A 4PQAA 3IEHA 4U9YA 1JQGA 2PJ0A 4EWTA 4IK2A 1M1DA 2XEIA 2ZENA 1RXTA 4FD5A 3B3VA 1LANA 3JVNA 2DPSA 2BUEA 2REEA 5LRJA 4QVTA 2OR4A 5AG7A 3F5BA 4BMHA 7CPAA 3A9LA 3KQZA 1Q2DA 3B8GA 4FD6A 4OLLA 5D29A 4A31A 2B4DB 4TWEA 3SJFA 3IC1A 3ISXA 3F8KA 1BAVA 2PIYA 4OMEA 1XOVA 2Q44A 2AFXA 2IMOA 3D3SA 4NJQA 1NSLA 4MFKA 3TC8A 3V7ZA 4MI4A 4A94A 4KOTA 4AG7A 2ABZA 2WYRA 3S6GA 3KZWA 1U6MA 3JUWA 3IGRA 3IWWA 3VWEA 3BJ7A 2ZEDA 3ZZIA 3D8PA 3I3GA 2ZXVA 4MHPA 2CXAA 3KKWA 4Q38A 5EMIA 1XBUA 2GE3A 4GS4A 4BINA 1PCAA 2Y0MA 4OIDA 5ISVA 2F8HA 2WSAA 5JQ4A 4UCNA 1FY7A 1LCPA 4R6TA 1BPNA 2BSWA 1XRYA 5EC4A 3MN8A 3NFZA 1S60A 4L8AA 5THWA 2BL1A 2AFZA 1B87A 3CPAA 2Z3OA 4HNYB 1XIXA 2DEAA 5G22A 2GFQA 2YNCC 2DF5A 1AMPA 4NGQA 3EC4A 5DWMA 3TO6A 2VQYA 2FE7A 4UEEA 2EK9A 4CS0B 3DNSA 3D7GA 2PJ1A 3B3WA 3H8FA 1ZLHA 1CP7A 3SHPA 4MCSA 3TTHA 2J8NA 1AUGA 3TOAA 2V8HA 1NMTA 1YREA 5CPAA 3TCVA 1Y9WA 2ZOFA 4ZI6A 3FMCA 2DXQA 1S7KA 2D4PA 1CM0A 5IB0A 3TX8A 3B2YA 3IWEA 1Z2LA 2QIRA 1Q2YA 3UY5A 2BOAA 1R43A 4OKOA 3WC6A 2Z3NA 3S9LA 3SI2A 2PDOA 2PJ4A 3T9YA 1IYLA 1TF9A 2R8VA 3GUXA 3PGPA 5G21A 2Z10A 2PJAA 4JD6A 3SI0A 4JYWA 3MGDA 3VWDA 4KZTA 1ELLP 1CPXA 3BI0A 4KOWA 2VL1A 4R87A 3PFEA 4ZY0A 4J3GA 4IF5A 2Z11A 3CXSA 4CGMA 2ZEHA 2EK8A 1Z5RA 1IU8A 4UWJA 2AFUA 3V38A 4R9MA 2PVWA 2FCKA 4NF1A 1TKFA 4OC5A 1EE3P 3PB4X 4P10A 3FEDA 4M6HA 1ZO0A 4TNUA 3GIUA 4IAVA 4PK2A 3RBUA 4B12A 5K8OA 5KTCA 4OC4A 5HVFA 1IY7A 2EO8A 2I3CA 2VEZA 3LD2A 2ZW5A 2VBQA 1P0HA 4NSQA 3T90A 2O53A 3KL9A 2OB0A 4UEFA 1QMUA 2FS5A 4UFWA 5F48A 1Z8WA 4KOUA 2XEGA 4U5YA 1KUXA 2FIWA 1OBRA 4C2ZA 2F5IA 2CF4A 3TO9A 4KLVA 2GANA 2JBJA 4M3SA 2PVVA 5JGFA 1VIXA 4C7IA 1YW6A 4AVBA 3N5FA 4AVAA 1IB1E 3PP9A 4R76A 4JJXA 2YNDA 2PCUA 4JLYA 4KOVA 4P4JA 4XPDC 1VHSA 3FYNA 4YRHA 5J8FA 1ARMA 4CGOA 4DNCA 4JXRA 2ZELA 4NGTA 2PE3A 4DUKA 4X3RA 3GB0A 3CT9A 3D68A 4NGNA 4PV6A 4B11A 4CAVA 4EFDA 2Z0ZA 3SI1A 2IJZA 2ZEGA 2GIVA 4A95A 3PB7X 3TOBA 4KUBA 5LYIA 3QAYA 3BLNA 4B10A 5DWNA 4MHNA 4OC1A 4F8ZA 2C6CA 3FVLA 1LAPA 4BBHA 1OZPA 4H6UA 5LYDA 4UF4A 4MFQA 4MFJA 1UWYA 4JZ0A 2CTCA 2Q4VA 3FIXA 4AXVA 6CPAA 1M4DA 4KVXA 2PJBA 2C6PA 1S3ZA 4CYNA 4MJ8A 2QECA 4FBEA 3DLJA 1F57A 1FNOA 3KR5A 4ORFA 3NE8A 1SQHA 1HEEA 2WPWA 4CAEA 2ZEFA 3LWUA 2KCWA 3EXNA 3K9UA 2RB7A 2VI7A 4OADA 2JEVA 2GLFA 2VZYA 5H84A 4LX9A 4CAXA 2PRQA 5JH9A 5BWAB 4F9VA 2V8DA 2Z3LA 2Q0YA 4NGSA 3T8WA 4M6IA 3NH8A 2P6FA 2JDDA 2CTBA 4C2XA 2WUUA 3MRUA 4WJBA 3EFAA 2IQ6A 4GM5A 4HKFA 1PYTB 4YWYA 1M44A 2Z3MA 3FEEA 4ONWA 3ZJ0A 5LRKA 5F49A 4H2KA 4GXHA 2IL4A 5CBMA 1Z9UA 1S7FA 3FNCA 2JLMA 2VZZA 3IO1A 4CYOA 1M4GA 2PQ8A 4KSIA 3V8IA 1VHOA 2GREA 3QB8A 2J9AA 4OAEA 1VKCA 3SJGA 1LAMA 4E0AA 2FSRA 1X12A 2CNMA 3FBUA 4CAFA 4KVOE 1TXRA 4X2TA 3LMSA 3WT4A 3FB3A 1F2PA 5EBVA 3R95A 4QBJA 4P4EA 1CG2A 4ZX9A 3PB9X 2NYQA 4G1PA 3D2PA 2REFA 2V8GA 3P2HA 1XEBA 3S6HA 2POKA 1M4LA 1VHEA 5J8CA 4P4DA 4CYPA 4B14A 3KI9A 5I0CA 4HPSA 3PZJA 5G20A 2Q51A 2P0WA 1R3NA 3I9SA 4C2YA 2O4HA 4FUUA 4CYQA 2BCOA 3F0AA 4C7HA 2PJCA 2H5MA 1YGHA 2PIZA 2G3TA 1QSOA 2V77A 4R3KA 1YK3A 2Z3KA 1K4JA 3K9TA 3VATA 1IOFA 2PJ3A 1S7NA 4Y49C 3JRUA 8CPAA 2AFMA 3CZXA 3G3SA 4KUAA 1ARLA 1AYEA 1KUYA 5AG5A 3GY9A 4R3LA 4A2ZA 4A33A 4M85A 5KTAA 1DTDA 1GHEA 2GLJA 4KOSA 3BJ8A 1MJAA 2HUZA 4JWPA 4BD9A 2V8VA 2ZPAA 4H89A 5JM6A 2Q4YA 5HMNA 3D2MA 3KHXA 3S6KA 4AB7A 4NGPA 4ZGYB 5GCNA 1LRZA 3R9FA 2Q7SA 4QUSA 1HDQA 2A4NA 2EWBA 3FRMA 3LACA 1XMBA 4LQGA 3WABA 1ZG7A 3TT2A 2ZW6A 3R9EA 4B13A 5IB9A 1IOIA 1Y0YA 2PR1A 4PXDA 3SJEA 4MHDA 2CIJA 2PJ2A 1QSMA 2WPXA 4UA3A 1BO4A 1Y9KA 3R9GA 4K30A 4MMOA 3EY5A 3R1KA 4Z65A 1IGBA 2ATRA 3H5ZA 1Z4EA 4NGMA 1QSTA 4ZY2A 2PJ8A 5F46A 3D7DA 2G3AA 3KHZA 3R96A 4DYOA 1Y0RA 1GYTA 1KWMA 4PSXA 4F0YA 1TKHA 4X8IA 4P44A 4IUSA 4MY3A 1ZLIA 3D7HA 3S9NA 3JTKA 4PXCA 4E2AA 2YGWA 1M4IA 1Z8LA 4NEXA 5H86A 1PUAA 4RUHA 2PJ5A 4FD4A 2D4OA 2HB6A 4HNWB 3VARA 4UWIA 2PC1A 5FVJA 5G1ZA 3RZAA 4FAIA 5K8MA 5HVGA 1CPSA 4NJRA 4EVYA 3W91A 1J4JA 5ELYA 1LOKA 1X10A 4FD7A 4PXBA 1KZFA 4F0XA 5HVHA 4ZY1A 2I79A 2J8MA 4UIAA 1YX0A 3N7ZA 1Q2CA 4ONUA 3D7FA 1F2OA 1Y7RA 4E8OA 4CPAA 2PJ9A 4MCQA 1ELMP 1TF8A 2FT0A 2JEWA 4MBUA 4B5OA 5HXDA 1H8LA 4KSAA 1YVKA 2B58A 4R57A 4NGRA 2B3UA 2ANPA 4OC2A 4PPZA 5C88A 2QYVA 3IIBA 4LQ6A 3W6SA 1XF8A 2B3VA 2HQYA 3EO4A 4MHZA 1Q7LA 1L0CA 2P6GA 1HDUA 3I1UA 1Y7EA 2QMLA 4P4BA 3B7IA 4B5PB 1CX8A 1DE4C 3BXMA 3H4QA 3WR7A 4XNHC 5CNPA 2B5GB 2NSMA 2ZW4A 1Z4RA 1XMTA 2FXFA 2PJ6A 2ZEPA 1BPMA 4MHYA 4Q7AA 4UFVA 3IJ3A 4HNXB 3CDXA 4H6ZA 1ZG9A 5HH1A 4UEZA 4U9ZA 1S5KA 4O23A 4Y49B 4MCRA 2PSWA 4OP4A 2VXKA 4F6AA 1CJWA 2XEFA 2HC9A 4ZBGA 3ISZA 4QB9A 5AG6A 1XE4A 5E96A 4Q36A 5IX3A 1IICA 2FL4A 3NE7A 2AE6A 4A39A 1NE9A 2OZHA 3G8WA 3NH4A 4NCZA 3HUVA 3IU2A 1ZG8A 2PJ7A 3IWGA 1N71A 3CPXA 2GU2A 3GKRA 3PEIA 4KS9A 4R8FA 4WWVA 2AFWA 1TIQA 1I21A 5IV0A 3TE4A 3FJUA 3FH4A 2PRBA 2ZEOA 3BHXA 2G9DA 3FF3A 4MFZA 3B3CA 3B3SA 3RNZA 2JBKA 2B5GA 5F47A 4AG9A 3SJXA 3TFYA 4OC3A 4A38A 3E0KA 4PXEA 1CP6A 3FECA 4OIWA 3HLPA 2X7BA 1YVOA 1R57A 4KORA 3LODA 4UCMA 1XFOA 2R98A 3FXTA 4YGOA 4A30A 1P4NA 1RTQA 3RO0A 4CGNA 5K8PA 1WWZA 1Z8TA 4FWUA 2B4DA 2B4BA 2ZW7A 4CRZB 1FT7A 2OZGA 2R7HA 3KQXA 1YLEA 4W9YA 3H8EA 1ON0A 3PRTA 4RN7A 4XPKA 2G0BA 2AJ6A 2AFOA 3B3TA 1CBXA 3PB6X 1NSAA 4ZX8A 3PBBA 5D8NA 3WC7A 2OOTA 4YU9A 4A32A 3S9MA 1V0CA 3PB8X 3PBEA 3DGVA 4KSFA 3DDDA 4NFRA 4AVCA 2EUIA 4XPDB 2Q7BA 4UFXA 3K2KA 4IHMA 1I1DA 2JDCA 4UIBA 1RO5A 1YLOA 3PFOA 1JWQA 2I00A 4MY0A 4F9UA 2Q43A 1YSJA 3SXNA 4UCPA 1I12A 3D4UA 2XEJA 4XPLA 4OC0A 2EBJA 2BEIA 2FVGA 1QSNA 1MJ9A 3QNVA 4P4IA 1Z8XA 4KVME 3B35A 4MXUA 3KGQA 4MFPA 4CGLA 2ODFA
chains in the Genus database with same CATH topology
2Z3PA 4KOYA 4II9A 1WK4A 2RC4A 4C68A 3CXPA 4LUAA 4PK3A 2Q04A 1MJBA 2EVNA 2YNEA 4CGPA 2CY2A 3P2FA 3W6XA 4X5KA 1PU9A 3OWCA 5A28A 1MK4A 4RI1A 1UFHA 2P6EA 4PSWA 1QSRA 2J8RA 4CAWA 4MFLA 1B6BA 2K5TA 2OH1A 2C27A 4B5PA 5AGEA 2HV2A 3RYOA 3SXOA 3CXQA 3DSBA 4YFJA 5C82A 2ARHA 4RS2A 4KOXA 2OZUA 2R1IA 1S7LA 2DPTA 4CRYB 2PR8A 3IU1A 5A27A 4JXQA 4UBRA 2NMTA 3DR6A 2FIAA 5JPHA 4I49A 1BOBA 3C26A 5AG4A 1YR0A 4KLWA 2CNTA 2OU2A 4QC6A 3GYAA 1KUVA 4NXYA 1IIDA 3QAHA 2CNSA 2YNCA 4L89A 3S6FA 3DR8A 5KTDA 1IYKA 3TO7A 2O28A 4U9YA 1M1DA 1RXTA 4FD5A 3JVNA 2DPSA 2BUEA 2REEA 4QVTA 5AG7A 3F5BA 4BMHA 3A9LA 1Q2DA 3B8GA 4FD6A 4OLLA 4A31A 2B4DB 3F8KA 2Q44A 3D3SA 1NSLA 4MFKA 4MI4A 4KOTA 4AG7A 3S6GA 1U6MA 3JUWA 3IGRA 3VWEA 3BJ7A 3ZZIA 3D8PA 3I3GA 2ZXVA 2CXAA 3KKWA 4Q38A 2GE3A 4GS4A 2Y0MA 5ISVA 2WSAA 5JQ4A 4UCNA 1FY7A 2BSWA 5EC4A 4L8AA 1S60A 2BL1A 1B87A 4HNYB 2Z3OA 1XIXA 5G22A 3EC4A 5DWMA 3TO6A 2VQYA 2FE7A 4CS0B 3DNSA 3TTHA 3SHPA 2J8NA 3TOAA 1NMTA 1YREA 3TCVA 1Y9WA 2DXQA 1S7KA 2D4PA 1CM0A 5IB0A 3IWEA 3UY5A 2QIRA 1Q2YA 2Z3NA 3T9YA 2PDOA 1IYLA 2R8VA 3PGPA 5G21A 2Z10A 4JD6A 3MGDA 3VWDA 4KZTA 4KOWA 4R87A 4J3GA 4IF5A 2Z11A 3CXSA 4CGMA 4UWJA 4R9MA 2FCKA 4NF1A 4UCPA 4XNHB 5KTCA 1ZO0A 4B12A 4PK2A 2VEZA 3LD2A 2ZW5A 2VBQA 1P0HA 4NSQA 3T90A 2OB0A 2FS5A 5F48A 4UFWA 4KOUA 4U5YA 1KUXA 2FIWA 4C2ZA 2F5IA 3TO9A 4KLVA 2GANA 4M3SA 4C7IA 4AVBA 4AVAA 1IB1E 3PP9A 4JJXA 2YNDA 4JLYA 4KOVA 4XPDC 1VHSA 3FYNA 4YRHA 5J8FA 4CGOA 4DNCA 4JXRA 4PV6A 4B11A 4CAVA 2Z0ZA 2GIVA 4A95A 3TOBA 4KUBA 4B10A 3BLNA 5DWNA 4BBHA 1OZPA 4H6UA 4MFQA 4MFJA 2Q4VA 3FIXA 1M4DA 4KVXA 1S3ZA 4CYNA 4MJ8A 2QECA 4ORFA 1SQHA 2WPWA 4CAEA 2KCWA 3EXNA 3K9UA 2VI7A 4OADA 2JEVA 2VZYA 5H84A 4CAXA 4LX9A 5BWAB 2Z3LA 2Q0YA 2P6FA 2JDDA 4C2XA 2WUUA 3EFAA 4HKFA 1M44A 2Z3MA 3ZJ0A 5F49A 2IL4A 1Z9UA 1S7FA 3FNCA 2JLMA 2VZZA 4CYOA 1M4GA 2PQ8A 3V8IA 3QB8A 4OAEA 1VKCA 4E0AA 2FSRA 2CNMA 3FBUA 4CAFA 4KVOE 3FB3A 3R95A 5EBVA 4QBJA 3D2PA 2REFA 3P2HA 1XEBA 3S6HA 5J8CA 4CYPA 4B14A 5I0CA 3PZJA 5G20A 2P0WA 3I9SA 4C2YA 3F0AA 4C7HA 2H5MA 1YGHA 2G3TA 1QSOA 4R3KA 1YK3A 2Z3KA 1K4JA 1S7NA 4Y49C 3G3SA 4KUAA 1KUYA 5AG5A 3GY9A 4R3LA 4A2ZA 4A33A 4M85A 5KTAA 1GHEA 4KOSA 3BJ8A 1MJAA 2HUZA 4JWPA 2ZPAA 4H89A 2Q4YA 5HMNA 3D2MA 3S6KA 4AB7A 4ZGYB 5GCNA 1LRZA 3R9FA 4QUSA 2A4NA 3FRMA 3TT2A 2ZW6A 3R9EA 4B13A 2PR1A 4MHDA 1QSMA 2WPXA 4UA3A 1BO4A 1Y9KA 3R9GA 4K30A 3EY5A 3R1KA 3H5ZA 2ATRA 1Z4EA 1QSTA 5F46A 2G3AA 3R96A 4F0YA 4PSXA 4IUSA 4MY3A 3JTKA 4E2AA 2YGWA 1M4IA 4NEXA 5H86A 1PUAA 4FD4A 2D4OA 4HNWB 4UWIA 2PC1A 5FVJA 5G1ZA 4EVYA 3W91A 1J4JA 4FD7A 4F0XA 1KZFA 2I79A 2J8MA 1YX0A 3N7ZA 1Q2CA 4ONUA 4E8OA 1Y7RA 2FT0A 4B5OA 4MBUA 4KSAA 1YVKA 2B58A 4R57A 2B3UA 5C88A 3W6SA 1XF8A 2B3VA 2HQYA 3EO4A 1L0CA 2P6GA 2QMLA 4B5PB 3H4QA 3WR7A 4XNHC 5CNPA 2B5GB 2ZW4A 1Z4RA 1XMTA 2FXFA 4UFVA 4HNXB 4H6ZA 5HH1A 4U9ZA 1S5KA 4Y49B 2PSWA 2VXKA 4F6AA 1CJWA 4ZBGA 4QB9A 5AG6A 5E96A 1XE4A 5IX3A 4Q36A 1IICA 2FL4A 3NE7A 2AE6A 1NE9A 2OZHA 3G8WA 4NCZA 3IU2A 3IWGA 4CYQA 1N71A 3GKRA 4KS9A 3TE4A 1TIQA 1I21A 5IV0A 2PRBA 4MFZA 4AG9A 2B5GA 5F47A 3TFYA 3E0KA 2X7BA 1YVOA 1R57A 4KORA 3LODA 4UCMA 2R98A 3FXTA 4YGOA 4A30A 1P4NA 4CGNA 1WWZA 2B4DA 2B4BA 2ZW7A 4CRZB 2OZGA 2R7HA 1YLEA 1ON0A 4XPKA 2G0BA 2AJ6A 4A32A 1V0CA 4KSFA 3DDDA 4AVCA 2EUIA 4XPDB 2Q7BA 4UFXA 1I1DA 2JDCA 1RO5A 2I00A 4MY0A 3SXNA 1I12A 4XPLA 2BEIA 1QSNA 1MJ9A 4KVME 4MFPA 4CGLA 2YNCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOY A;  4II9 A;  1WK4 A;  2RC4 A;  3CXP A;  4LUA A;  4PK3 A;  2Q04 A;  1MJB A;  2EVN A;  2CY2 A;  3P2F A;  3W6X A;  4X5K A;  1PU9 A;  3OWC A;  1MK4 A;  4RI1 A;  1UFH A;  2P6E A;  4PSW A;  1QSR A;  2J8R A;  4CAW A;  1B6B A;  2K5T A;  2OH1 A;  2C27 A;  4B5P A;  2HV2 A;  3RYO A;  3SXO A;  3CXQ A;  3DSB A;  4YFJ A;  5C82 A;  2ARH A;  4RS2 A;  4KOX A;  2OZU A;  2R1I A;  1S7L A;  4CRY B;  2PR8 A;  4JXQ A;  4UBR A;  2NMT A;  3DR6 A;  2FIA A;  5JPH A;  4I49 A;  1BOB A;  3C26 A;  1YR0 A;  4KLW A;  2CNT A;  2OU2 A;  4QC6 A;  3GYA A;  1KUV A;  4NXY A;  1IID A;  3QAH A;  2CNS A;  4L89 A;  3S6F A;  5KTD A;  3DR8 A;  1IYK A;  3TO7 A;  2O28 A;  4U9Y A;  1M1D A;  1RXT A;  4FD5 A;  3JVN A;  2BUE A;  2REE A;  4QVT A;  3F5B A;  4BMH A;  1Q2D A;  3B8G A;  4FD6 A;  4OLL A;  2B4D B;  3F8K A;  2Q44 A;  3D3S A;  1NSL A;  4MI4 A;  4KOT A;  4AG7 A;  3S6G A;  1U6M A;  3JUW A;  3IGR A;  3VWE A;  3BJ7 A;  3ZZI A;  3D8P A;  3I3G A;  2ZXV A;  3KKW A;  2GE3 A;  4GS4 A;  2Y0M A;  5ISV A;  5JQ4 A;  1FY7 A;  2BSW A;  5EC4 A;  4L8A A;  1S60 A;  2BL1 A;  1B87 A;  4HNY B;  1XIX A;  3EC4 A;  5DWM A;  3TO6 A;  2VQY A;  2FE7 A;  4CS0 B;  3DNS A;  3TTH A;  3SHP A;  2J8N A;  3TOA A;  1NMT A;  1YRE A;  3TCV A;  1Y9W A;  2DXQ A;  1S7K A;  2D4P A;  1CM0 A;  5IB0 A;  3UY5 A;  2QIR A;  1Q2Y A;  3T9Y A;  2PDO A;  1IYL A;  2R8V A;  3PGP A;  2Z10 A;  4JD6 A;  3MGD A;  3VWD A;  4KZT A;  4KOW A;  4R87 A;  4J3G A;  4IF5 A;  2Z11 A;  3CXS A;  4UWJ A;  4R9M A;  2FCK A;  4NF1 A;  4XNH B;  5KTC A;  4PK2 A;  2VEZ A;  3LD2 A;  2ZW5 A;  2VBQ A;  1P0H A;  4NSQ A;  3T90 A;  2OB0 A;  2FS5 A;  5F48 A;  4KOU A;  4U5Y A;  1KUX A;  2FIW A;  2F5I A;  3TO9 A;  4KLV A;  2GAN A;  4M3S A;  4AVB A;  4AVA A;  1IB1 E;  3PP9 A;  4JJX A;  4JLY A;  4KOV A;  4XPD C;  1VHS A;  3FYN A;  4YRH A;  5J8F A;  4DNC A;  4JXR A;  4PV6 A;  4CAV A;  2Z0Z A;  2GIV A;  3TOB A;  4KUB A;  3BLN A;  5DWN A;  1OZP A;  4H6U A;  2Q4V A;  3FIX A;  1M4D A;  4KVX A;  1S3Z A;  4MJ8 A;  2QEC A;  4ORF A;  1SQH A;  2WPW A;  2KCW A;  3EXN A;  3K9U A;  2VI7 A;  4OAD A;  2JEV A;  2VZY A;  5H84 A;  4CAX A;  4LX9 A;  2Q0Y A;  2P6F A;  2JDD A;  3EFA A;  4HKF A;  1M44 A;  3ZJ0 A;  5F49 A;  2IL4 A;  1Z9U A;  1S7F A;  3FNC A;  2JLM A;  2VZZ A;  1M4G A;  2PQ8 A;  3V8I A;  3QB8 A;  4OAE A;  1VKC A;  4E0A A;  2FSR A;  2CNM A;  3FBU A;  4KVO E;  3FB3 A;  3R95 A;  5EBV A;  4QBJ A;  3D2P A;  2REF A;  3P2H A;  1XEB A;  3S6H A;  5J8C A;  5I0C A;  3PZJ A;  2P0W A;  3I9S A;  3F0A A;  2H5M A;  1YGH A;  2G3T A;  1QSO A;  4R3K A;  1YK3 A;  1K4J A;  1S7N A;  4Y49 C;  3G3S A;  4KUA A;  1KUY A;  3GY9 A;  4R3L A;  4M85 A;  5KTA A;  1GHE A;  4KOS A;  3BJ8 A;  1MJA A;  2HUZ A;  4JWP A;  2ZPA A;  4H89 A;  2Q4Y A;  5HMN A;  3D2M A;  3S6K A;  4AB7 A;  5GCN A;  1LRZ A;  3R9F A;  4QUS A;  2A4N A;  3FRM A;  3TT2 A;  2ZW6 A;  3R9E A;  2PR1 A;  4MHD A;  1QSM A;  2WPX A;  4UA3 A;  1BO4 A;  1Y9K A;  3R9G A;  4K30 A;  3EY5 A;  3R1K A;  2ATR A;  1Z4E A;  1QST A;  5F46 A;  2G3A A;  3R96 A;  4F0Y A;  4PSX A;  4IUS A;  4MY3 A;  4E2A A;  4NEX A;  1M4I A;  5H86 A;  1PUA A;  4FD4 A;  2D4O A;  4HNW B;  4UWI A;  2PC1 A;  5FVJ A;  4EVY A;  3W91 A;  1J4J A;  4FD7 A;  1KZF A;  2I79 A;  2J8M A;  1YX0 A;  3N7Z A;  1Q2C A;  4ONU A;  4E8O A;  1Y7R A;  2FT0 A;  4B5O A;  4MBU A;  1YVK A;  2B58 A;  4R57 A;  2B3U A;  5C88 A;  3W6S A;  1XF8 A;  2B3V A;  2HQY A;  3EO4 A;  1L0C A;  2P6G A;  2QML A;  4B5P B;  3H4Q A;  3WR7 A;  4XNH C;  5CNP A;  2B5G B;  2ZW4 A;  1Z4R A;  1XMT A;  2FXF A;  4HNX B;  4H6Z A;  5HH1 A;  4U9Z A;  1S5K A;  4Y49 B;  2PSW A;  2VXK A;  4F6A A;  1CJW A;  4ZBG A;  4QB9 A;  5E96 A;  1XE4 A;  5IX3 A;  1IIC A;  2FL4 A;  3NE7 A;  2AE6 A;  1NE9 A;  2OZH A;  3G8W A;  4NCZ A;  3IWG A;  1N71 A;  3GKR A;  3TE4 A;  1TIQ A;  1I21 A;  5IV0 A;  2PRB A;  4AG9 A;  2B5G A;  5F47 A;  3TFY A;  3E0K A;  2X7B A;  1YVO A;  1R57 A;  4KOR A;  3LOD A;  2R98 A;  3FXT A;  4YGO A;  1P4N A;  1WWZ A;  2B4D A;  2B4B A;  2ZW7 A;  4CRZ B;  2OZG A;  2R7H A;  1YLE A;  1ON0 A;  4XPK A;  2G0B A;  2AJ6 A;  1V0C A;  3DDD A;  4AVC A;  2EUI A;  4XPD B;  2Q7B A;  1I1D A;  2JDC A;  1RO5 A;  2I00 A;  4MY0 A;  3SXN A;  1I12 A;  4XPL A;  2BEI A;  1QSN A;  1MJ9 A;  4KVM E; 
#chains in the Genus database with same CATH topology
 2Z3P A;  4K3N A;  4KOY A;  4P6Y A;  3L2N A;  4II9 A;  2C1C A;  3D66 A;  4B6Z A;  1WK4 A;  5K8N A;  2ZEE A;  2RC4 A;  3NH5 A;  4C68 A;  5DS0 A;  3CXP A;  3D67 A;  4LUA A;  4PK3 A;  1A2Z A;  2Q04 A;  4ZYQ A;  1YW4 A;  4DJL A;  1MJB A;  2EVN A;  5LRG A;  2YNE A;  4CGP A;  2CY2 A;  2ZEM A;  3P2F A;  3W6X A;  4X5K A;  3H8G A;  1XJO A;  1PU9 A;  2BO9 A;  3OWC A;  5J1Q A;  5A28 A;  4P4F A;  1MK4 A;  3IFE A;  1UFH A;  2P6E A;  4PSW A;  4RI1 A;  1QSR A;  1QQ9 A;  2F7V A;  3BI1 A;  1LFW A;  5I4M A;  2J8R A;  4MCP A;  4CAW A;  4MFL A;  1B6B A;  2K5T A;  2OH1 A;  1YQE A;  2C27 A;  2QVP A;  4M6G A;  5AGE A;  4B5P A;  2HV2 A;  3RAM A;  3RYO A;  3SXO A;  1BLL E;  3CXQ A;  2WZN A;  3DSB A;  4YFJ A;  2ZOG A;  2Q4Z A;  5C82 A;  1YME A;  2ARH A;  4RS2 A;  3GLJ A;  4KOX A;  2OZU A;  4EME A;  2R1I A;  1S7L A;  2DPT A;  3KAS A;  4CRY B;  4A37 A;  2PR8 A;  3IU1 A;  5A27 A;  2RFH A;  4JXQ A;  3FX6 A;  3KR4 A;  2NMT A;  4UBR A;  3DR6 A;  3VH9 A;  2FIA A;  5JPH A;  5F09 A;  4I49 A;  1BOB A;  3C26 A;  2AFS A;  5AG4 A;  1YR0 A;  5LYF A;  4KLW A;  2CNT A;  2OU2 A;  4QC6 A;  3WC5 A;  4P45 A;  3GYA A;  1KUV A;  4NXY A;  5LYL A;  4MRI A;  1IID A;  3QAH A;  2CNS A;  2YNC A;  4L89 A;  3S6F A;  1VGY A;  2C6G A;  3DR8 A;  4R7M A;  5KTD A;  2QJ8 A;  1TKJ A;  3NA6 A;  4XNH B;  1IYK A;  3TO7 A;  2O28 A;  4PQA A;  3IEH A;  4U9Y A;  1JQG A;  2PJ0 A;  4EWT A;  4IK2 A;  1M1D A;  2XEI A;  2ZEN A;  1RXT A;  4FD5 A;  3B3V A;  1LAN A;  3JVN A;  2DPS A;  2BUE A;  2REE A;  5LRJ A;  4QVT A;  2OR4 A;  5AG7 A;  3F5B A;  4BMH A;  7CPA A;  3A9L A;  3KQZ A;  1Q2D A;  3B8G A;  4FD6 A;  4OLL A;  5D29 A;  4A31 A;  2B4D B;  4TWE A;  3SJF A;  3IC1 A;  3ISX A;  3F8K A;  1BAV A;  2PIY A;  4OME A;  1XOV A;  2Q44 A;  2AFX A;  2IMO A;  3D3S A;  4NJQ A;  1NSL A;  4MFK A;  3TC8 A;  3V7Z A;  4MI4 A;  4A94 A;  4KOT A;  4AG7 A;  2ABZ A;  2WYR A;  3S6G A;  3KZW A;  1U6M A;  3JUW A;  3IGR A;  3IWW A;  3VWE A;  3BJ7 A;  2ZED A;  3ZZI A;  3D8P A;  3I3G A;  2ZXV A;  4MHP A;  2CXA A;  3KKW A;  4Q38 A;  5EMI A;  1XBU A;  2GE3 A;  4GS4 A;  4BIN A;  1PCA A;  2Y0M A;  4OID A;  5ISV A;  2F8H A;  2WSA A;  5JQ4 A;  4UCN A;  1FY7 A;  1LCP A;  4R6T A;  1BPN A;  2BSW A;  1XRY A;  5EC4 A;  3MN8 A;  3NFZ A;  1S60 A;  4L8A A;  5THW A;  2BL1 A;  2AFZ A;  1B87 A;  3CPA A;  2Z3O A;  4HNY B;  1XIX A;  2DEA A;  5G22 A;  2GFQ A;  2YNC C;  2DF5 A;  1AMP A;  4NGQ A;  3EC4 A;  5DWM A;  3TO6 A;  2VQY A;  2FE7 A;  4UEE A;  2EK9 A;  4CS0 B;  3DNS A;  3D7G A;  2PJ1 A;  3B3W A;  3H8F A;  1ZLH A;  1CP7 A;  3SHP A;  4MCS A;  3TTH A;  2J8N A;  1AUG A;  3TOA A;  2V8H A;  1NMT A;  1YRE A;  5CPA A;  3TCV A;  1Y9W A;  2ZOF A;  4ZI6 A;  3FMC A;  2DXQ A;  1S7K A;  2D4P A;  1CM0 A;  5IB0 A;  3TX8 A;  3B2Y A;  3IWE A;  1Z2L A;  2QIR A;  1Q2Y A;  3UY5 A;  2BOA A;  1R43 A;  4OKO A;  3WC6 A;  2Z3N A;  3S9L A;  3SI2 A;  2PDO A;  2PJ4 A;  3T9Y A;  1IYL A;  1TF9 A;  2R8V A;  3GUX A;  3PGP A;  5G21 A;  2Z10 A;  2PJA A;  4JD6 A;  3SI0 A;  4JYW A;  3MGD A;  3VWD A;  4KZT A;  1ELL P;  1CPX A;  3BI0 A;  4KOW A;  2VL1 A;  4R87 A;  3PFE A;  4ZY0 A;  4J3G A;  4IF5 A;  2Z11 A;  3CXS A;  4CGM A;  2ZEH A;  2EK8 A;  1Z5R A;  1IU8 A;  4UWJ A;  2AFU A;  3V38 A;  4R9M A;  2PVW A;  2FCK A;  4NF1 A;  1TKF A;  4OC5 A;  1EE3 P;  3PB4 X;  4P10 A;  3FED A;  4M6H A;  1ZO0 A;  4TNU A;  3GIU A;  4IAV A;  4PK2 A;  3RBU A;  4B12 A;  5K8O A;  5KTC A;  4OC4 A;  5HVF A;  1IY7 A;  2EO8 A;  2I3C A;  2VEZ A;  3LD2 A;  2ZW5 A;  2VBQ A;  1P0H A;  4NSQ A;  3T90 A;  2O53 A;  3KL9 A;  2OB0 A;  4UEF A;  1QMU A;  2FS5 A;  4UFW A;  5F48 A;  1Z8W A;  4KOU A;  2XEG A;  4U5Y A;  1KUX A;  2FIW A;  1OBR A;  4C2Z A;  2F5I A;  2CF4 A;  3TO9 A;  4KLV A;  2GAN A;  2JBJ A;  4M3S A;  2PVV A;  5JGF A;  1VIX A;  4C7I A;  1YW6 A;  4AVB A;  3N5F A;  4AVA A;  1IB1 E;  3PP9 A;  4R76 A;  4JJX A;  2YND A;  2PCU A;  4JLY A;  4KOV A;  4P4J A;  4XPD C;  1VHS A;  3FYN A;  4YRH A;  5J8F A;  1ARM A;  4CGO A;  4DNC A;  4JXR A;  2ZEL A;  4NGT A;  2PE3 A;  4DUK A;  4X3R A;  3GB0 A;  3CT9 A;  3D68 A;  4NGN A;  4PV6 A;  4B11 A;  4CAV A;  4EFD A;  2Z0Z A;  3SI1 A;  2IJZ A;  2ZEG A;  2GIV A;  4A95 A;  3PB7 X;  3TOB A;  4KUB A;  5LYI A;  3QAY A;  3BLN A;  4B10 A;  5DWN A;  4MHN A;  4OC1 A;  4F8Z A;  2C6C A;  3FVL A;  1LAP A;  4BBH A;  1OZP A;  4H6U A;  5LYD A;  4UF4 A;  4MFQ A;  4MFJ A;  1UWY A;  4JZ0 A;  2CTC A;  2Q4V A;  3FIX A;  4AXV A;  6CPA A;  1M4D A;  4KVX A;  2PJB A;  2C6P A;  1S3Z A;  4CYN A;  4MJ8 A;  2QEC A;  4FBE A;  3DLJ A;  1F57 A;  1FNO A;  3KR5 A;  4ORF A;  3NE8 A;  1SQH A;  1HEE A;  2WPW A;  4CAE A;  2ZEF A;  3LWU A;  2KCW A;  3EXN A;  3K9U A;  2RB7 A;  2VI7 A;  4OAD A;  2JEV A;  2GLF A;  2VZY A;  5H84 A;  4LX9 A;  4CAX A;  2PRQ A;  5JH9 A;  5BWA B;  4F9V A;  2V8D A;  2Z3L A;  2Q0Y A;  4NGS A;  3T8W A;  4M6I A;  3NH8 A;  2P6F A;  2JDD A;  2CTB A;  4C2X A;  2WUU A;  3MRU A;  4WJB A;  3EFA A;  2IQ6 A;  4GM5 A;  4HKF A;  1PYT B;  4YWY A;  1M44 A;  2Z3M A;  3FEE A;  4ONW A;  3ZJ0 A;  5LRK A;  5F49 A;  4H2K A;  4GXH A;  2IL4 A;  5CBM A;  1Z9U A;  1S7F A;  3FNC A;  2JLM A;  2VZZ A;  3IO1 A;  4CYO A;  1M4G A;  2PQ8 A;  4KSI A;  3V8I A;  1VHO A;  2GRE A;  3QB8 A;  2J9A A;  4OAE A;  1VKC A;  3SJG A;  1LAM A;  4E0A A;  2FSR A;  1X12 A;  2CNM A;  3FBU A;  4CAF A;  4KVO E;  1TXR A;  4X2T A;  3LMS A;  3WT4 A;  3FB3 A;  1F2P A;  5EBV A;  3R95 A;  4QBJ A;  4P4E A;  1CG2 A;  4ZX9 A;  3PB9 X;  2NYQ A;  4G1P A;  3D2P A;  2REF A;  2V8G A;  3P2H A;  1XEB A;  3S6H A;  2POK A;  1M4L A;  1VHE A;  5J8C A;  4P4D A;  4CYP A;  4B14 A;  3KI9 A;  5I0C A;  4HPS A;  3PZJ A;  5G20 A;  2Q51 A;  2P0W A;  1R3N A;  3I9S A;  4C2Y A;  2O4H A;  4FUU A;  4CYQ A;  2BCO A;  3F0A A;  4C7H A;  2PJC A;  2H5M A;  1YGH A;  2PIZ A;  2G3T A;  1QSO A;  2V77 A;  4R3K A;  1YK3 A;  2Z3K A;  1K4J A;  3K9T A;  3VAT A;  1IOF A;  2PJ3 A;  1S7N A;  4Y49 C;  3JRU A;  8CPA A;  2AFM A;  3CZX A;  3G3S A;  4KUA A;  1ARL A;  1AYE A;  1KUY A;  5AG5 A;  3GY9 A;  4R3L A;  4A2Z A;  4A33 A;  4M85 A;  5KTA A;  1DTD A;  1GHE A;  2GLJ A;  4KOS A;  3BJ8 A;  1MJA A;  2HUZ A;  4JWP A;  4BD9 A;  2V8V A;  2ZPA A;  4H89 A;  5JM6 A;  2Q4Y A;  5HMN A;  3D2M A;  3KHX A;  3S6K A;  4AB7 A;  4NGP A;  4ZGY B;  5GCN A;  1LRZ A;  3R9F A;  2Q7S A;  4QUS A;  1HDQ A;  2A4N A;  2EWB A;  3FRM A;  3LAC A;  1XMB A;  4LQG A;  3WAB A;  1ZG7 A;  3TT2 A;  2ZW6 A;  3R9E A;  4B13 A;  5IB9 A;  1IOI A;  1Y0Y A;  2PR1 A;  4PXD A;  3SJE A;  4MHD A;  2CIJ A;  2PJ2 A;  1QSM A;  2WPX A;  4UA3 A;  1BO4 A;  1Y9K A;  3R9G A;  4K30 A;  4MMO A;  3EY5 A;  3R1K A;  4Z65 A;  1IGB A;  2ATR A;  3H5Z A;  1Z4E A;  4NGM A;  1QST A;  4ZY2 A;  2PJ8 A;  5F46 A;  3D7D A;  2G3A A;  3KHZ A;  3R96 A;  4DYO A;  1Y0R A;  1GYT A;  1KWM A;  4PSX A;  4F0Y A;  1TKH A;  4X8I A;  4P44 A;  4IUS A;  4MY3 A;  1ZLI A;  3D7H A;  3S9N A;  3JTK A;  4PXC A;  4E2A A;  2YGW A;  1M4I A;  1Z8L A;  4NEX A;  5H86 A;  1PUA A;  4RUH A;  2PJ5 A;  4FD4 A;  2D4O A;  2HB6 A;  4HNW B;  3VAR A;  4UWI A;  2PC1 A;  5FVJ A;  5G1Z A;  3RZA A;  4FAI A;  5K8M A;  5HVG A;  1CPS A;  4NJR A;  4EVY A;  3W91 A;  1J4J A;  5ELY A;  1LOK A;  1X10 A;  4FD7 A;  4PXB A;  1KZF A;  4F0X A;  5HVH A;  4ZY1 A;  2I79 A;  2J8M A;  4UIA A;  1YX0 A;  3N7Z A;  1Q2C A;  4ONU A;  3D7F A;  1F2O A;  1Y7R A;  4E8O A;  4CPA A;  2PJ9 A;  4MCQ A;  1ELM P;  1TF8 A;  2FT0 A;  2JEW A;  4MBU A;  4B5O A;  5HXD A;  1H8L A;  4KSA A;  1YVK A;  2B58 A;  4R57 A;  4NGR A;  2B3U A;  2ANP A;  4OC2 A;  4PPZ A;  5C88 A;  2QYV A;  3IIB A;  4LQ6 A;  3W6S A;  1XF8 A;  2B3V A;  2HQY A;  3EO4 A;  4MHZ A;  1Q7L A;  1L0C A;  2P6G A;  1HDU A;  3I1U A;  1Y7E A;  2QML A;  4P4B A;  3B7I A;  4B5P B;  1CX8 A;  1DE4 C;  3BXM A;  3H4Q A;  3WR7 A;  4XNH C;  5CNP A;  2B5G B;  2NSM A;  2ZW4 A;  1Z4R A;  1XMT A;  2FXF A;  2PJ6 A;  2ZEP A;  1BPM A;  4MHY A;  4Q7A A;  4UFV A;  3IJ3 A;  4HNX B;  3CDX A;  4H6Z A;  1ZG9 A;  5HH1 A;  4UEZ A;  4U9Z A;  1S5K A;  4O23 A;  4Y49 B;  4MCR A;  2PSW A;  4OP4 A;  2VXK A;  4F6A A;  1CJW A;  2XEF A;  2HC9 A;  4ZBG A;  3ISZ A;  4QB9 A;  5AG6 A;  1XE4 A;  5E96 A;  4Q36 A;  5IX3 A;  1IIC A;  2FL4 A;  3NE7 A;  2AE6 A;  4A39 A;  1NE9 A;  2OZH A;  3G8W A;  3NH4 A;  4NCZ A;  3HUV A;  3IU2 A;  1ZG8 A;  2PJ7 A;  3IWG A;  1N71 A;  3CPX A;  2GU2 A;  3GKR A;  3PEI A;  4KS9 A;  4R8F A;  4WWV A;  2AFW A;  1TIQ A;  1I21 A;  5IV0 A;  3TE4 A;  3FJU A;  3FH4 A;  2PRB A;  2ZEO A;  3BHX A;  2G9D A;  3FF3 A;  4MFZ A;  3B3C A;  3B3S A;  3RNZ A;  2JBK A;  2B5G A;  5F47 A;  4AG9 A;  3SJX A;  3TFY A;  4OC3 A;  4A38 A;  3E0K A;  4PXE A;  1CP6 A;  3FEC A;  4OIW A;  3HLP A;  2X7B A;  1YVO A;  1R57 A;  4KOR A;  3LOD A;  4UCM A;  1XFO A;  2R98 A;  3FXT A;  4YGO A;  4A30 A;  1P4N A;  1RTQ A;  3RO0 A;  4CGN A;  5K8P A;  1WWZ A;  1Z8T A;  4FWU A;  2B4D A;  2B4B A;  2ZW7 A;  4CRZ B;  1FT7 A;  2OZG A;  2R7H A;  3KQX A;  1YLE A;  4W9Y A;  3H8E A;  1ON0 A;  3PRT A;  4RN7 A;  4XPK A;  2G0B A;  2AJ6 A;  2AFO A;  3B3T A;  1CBX A;  3PB6 X;  1NSA A;  4ZX8 A;  3PBB A;  5D8N A;  3WC7 A;  2OOT A;  4YU9 A;  4A32 A;  3S9M A;  1V0C A;  3PB8 X;  3PBE A;  3DGV A;  4KSF A;  3DDD A;  4NFR A;  4AVC A;  2EUI A;  4XPD B;  2Q7B A;  4UFX A;  3K2K A;  4IHM A;  1I1D A;  2JDC A;  4UIB A;  1RO5 A;  1YLO A;  3PFO A;  1JWQ A;  2I00 A;  4MY0 A;  4F9U A;  2Q43 A;  1YSJ A;  3SXN A;  4UCP A;  1I12 A;  3D4U A;  2XEJ A;  4XPL A;  4OC0 A;  2EBJ A;  2BEI A;  2FVG A;  1QSN A;  1MJ9 A;  3QNV A;  4P4I A;  1Z8X A;  4KVM E;  3B35 A;  4MXU A;  3KGQ A;  4MFP A;  4CGL A;  2ODF A; 
#chains in the Genus database with same CATH homology
 2Z3P A;  4KOY A;  4II9 A;  1WK4 A;  2RC4 A;  4C68 A;  3CXP A;  4LUA A;  4PK3 A;  2Q04 A;  1MJB A;  2EVN A;  2YNE A;  4CGP A;  2CY2 A;  3P2F A;  3W6X A;  4X5K A;  1PU9 A;  3OWC A;  5A28 A;  1MK4 A;  4RI1 A;  1UFH A;  2P6E A;  4PSW A;  1QSR A;  2J8R A;  4CAW A;  4MFL A;  1B6B A;  2K5T A;  2OH1 A;  2C27 A;  4B5P A;  5AGE A;  2HV2 A;  3RYO A;  3SXO A;  3CXQ A;  3DSB A;  4YFJ A;  5C82 A;  2ARH A;  4RS2 A;  4KOX A;  2OZU A;  2R1I A;  1S7L A;  2DPT A;  4CRY B;  2PR8 A;  3IU1 A;  5A27 A;  4JXQ A;  4UBR A;  2NMT A;  3DR6 A;  2FIA A;  5JPH A;  4I49 A;  1BOB A;  3C26 A;  5AG4 A;  1YR0 A;  4KLW A;  2CNT A;  2OU2 A;  4QC6 A;  3GYA A;  1KUV A;  4NXY A;  1IID A;  3QAH A;  2CNS A;  2YNC A;  4L89 A;  3S6F A;  3DR8 A;  5KTD A;  1IYK A;  3TO7 A;  2O28 A;  4U9Y A;  1M1D A;  1RXT A;  4FD5 A;  3JVN A;  2DPS A;  2BUE A;  2REE A;  4QVT A;  5AG7 A;  3F5B A;  4BMH A;  3A9L A;  1Q2D A;  3B8G A;  4FD6 A;  4OLL A;  4A31 A;  2B4D B;  3F8K A;  2Q44 A;  3D3S A;  1NSL A;  4MFK A;  4MI4 A;  4KOT A;  4AG7 A;  3S6G A;  1U6M A;  3JUW A;  3IGR A;  3VWE A;  3BJ7 A;  3ZZI A;  3D8P A;  3I3G A;  2ZXV A;  2CXA A;  3KKW A;  4Q38 A;  2GE3 A;  4GS4 A;  2Y0M A;  5ISV A;  2WSA A;  5JQ4 A;  4UCN A;  1FY7 A;  2BSW A;  5EC4 A;  4L8A A;  1S60 A;  2BL1 A;  1B87 A;  4HNY B;  2Z3O A;  1XIX A;  5G22 A;  3EC4 A;  5DWM A;  3TO6 A;  2VQY A;  2FE7 A;  4CS0 B;  3DNS A;  3TTH A;  3SHP A;  2J8N A;  3TOA A;  1NMT A;  1YRE A;  3TCV A;  1Y9W A;  2DXQ A;  1S7K A;  2D4P A;  1CM0 A;  5IB0 A;  3IWE A;  3UY5 A;  2QIR A;  1Q2Y A;  2Z3N A;  3T9Y A;  2PDO A;  1IYL A;  2R8V A;  3PGP A;  5G21 A;  2Z10 A;  4JD6 A;  3MGD A;  3VWD A;  4KZT A;  4KOW A;  4R87 A;  4J3G A;  4IF5 A;  2Z11 A;  3CXS A;  4CGM A;  4UWJ A;  4R9M A;  2FCK A;  4NF1 A;  4UCP A;  4XNH B;  5KTC A;  1ZO0 A;  4B12 A;  4PK2 A;  2VEZ A;  3LD2 A;  2ZW5 A;  2VBQ A;  1P0H A;  4NSQ A;  3T90 A;  2OB0 A;  2FS5 A;  5F48 A;  4UFW A;  4KOU A;  4U5Y A;  1KUX A;  2FIW A;  4C2Z A;  2F5I A;  3TO9 A;  4KLV A;  2GAN A;  4M3S A;  4C7I A;  4AVB A;  4AVA A;  1IB1 E;  3PP9 A;  4JJX A;  2YND A;  4JLY A;  4KOV A;  4XPD C;  1VHS A;  3FYN A;  4YRH A;  5J8F A;  4CGO A;  4DNC A;  4JXR A;  4PV6 A;  4B11 A;  4CAV A;  2Z0Z A;  2GIV A;  4A95 A;  3TOB A;  4KUB A;  4B10 A;  3BLN A;  5DWN A;  4BBH A;  1OZP A;  4H6U A;  4MFQ A;  4MFJ A;  2Q4V A;  3FIX A;  1M4D A;  4KVX A;  1S3Z A;  4CYN A;  4MJ8 A;  2QEC A;  4ORF A;  1SQH A;  2WPW A;  4CAE A;  2KCW A;  3EXN A;  3K9U A;  2VI7 A;  4OAD A;  2JEV A;  2VZY A;  5H84 A;  4CAX A;  4LX9 A;  5BWA B;  2Z3L A;  2Q0Y A;  2P6F A;  2JDD A;  4C2X A;  2WUU A;  3EFA A;  4HKF A;  1M44 A;  2Z3M A;  3ZJ0 A;  5F49 A;  2IL4 A;  1Z9U A;  1S7F A;  3FNC A;  2JLM A;  2VZZ A;  4CYO A;  1M4G A;  2PQ8 A;  3V8I A;  3QB8 A;  4OAE A;  1VKC A;  4E0A A;  2FSR A;  2CNM A;  3FBU A;  4CAF A;  4KVO E;  3FB3 A;  3R95 A;  5EBV A;  4QBJ A;  3D2P A;  2REF A;  3P2H A;  1XEB A;  3S6H A;  5J8C A;  4CYP A;  4B14 A;  5I0C A;  3PZJ A;  5G20 A;  2P0W A;  3I9S A;  4C2Y A;  3F0A A;  4C7H A;  2H5M A;  1YGH A;  2G3T A;  1QSO A;  4R3K A;  1YK3 A;  2Z3K A;  1K4J A;  1S7N A;  4Y49 C;  3G3S A;  4KUA A;  1KUY A;  5AG5 A;  3GY9 A;  4R3L A;  4A2Z A;  4A33 A;  4M85 A;  5KTA A;  1GHE A;  4KOS A;  3BJ8 A;  1MJA A;  2HUZ A;  4JWP A;  2ZPA A;  4H89 A;  2Q4Y A;  5HMN A;  3D2M A;  3S6K A;  4AB7 A;  4ZGY B;  5GCN A;  1LRZ A;  3R9F A;  4QUS A;  2A4N A;  3FRM A;  3TT2 A;  2ZW6 A;  3R9E A;  4B13 A;  2PR1 A;  4MHD A;  1QSM A;  2WPX A;  4UA3 A;  1BO4 A;  1Y9K A;  3R9G A;  4K30 A;  3EY5 A;  3R1K A;  3H5Z A;  2ATR A;  1Z4E A;  1QST A;  5F46 A;  2G3A A;  3R96 A;  4F0Y A;  4PSX A;  4IUS A;  4MY3 A;  3JTK A;  4E2A A;  2YGW A;  1M4I A;  4NEX A;  5H86 A;  1PUA A;  4FD4 A;  2D4O A;  4HNW B;  4UWI A;  2PC1 A;  5FVJ A;  5G1Z A;  4EVY A;  3W91 A;  1J4J A;  4FD7 A;  4F0X A;  1KZF A;  2I79 A;  2J8M A;  1YX0 A;  3N7Z A;  1Q2C A;  4ONU A;  4E8O A;  1Y7R A;  2FT0 A;  4B5O A;  4MBU A;  4KSA A;  1YVK A;  2B58 A;  4R57 A;  2B3U A;  5C88 A;  3W6S A;  1XF8 A;  2B3V A;  2HQY A;  3EO4 A;  1L0C A;  2P6G A;  2QML A;  4B5P B;  3H4Q A;  3WR7 A;  4XNH C;  5CNP A;  2B5G B;  2ZW4 A;  1Z4R A;  1XMT A;  2FXF A;  4UFV A;  4HNX B;  4H6Z A;  5HH1 A;  4U9Z A;  1S5K A;  4Y49 B;  2PSW A;  2VXK A;  4F6A A;  1CJW A;  4ZBG A;  4QB9 A;  5AG6 A;  5E96 A;  1XE4 A;  5IX3 A;  4Q36 A;  1IIC A;  2FL4 A;  3NE7 A;  2AE6 A;  1NE9 A;  2OZH A;  3G8W A;  4NCZ A;  3IU2 A;  3IWG A;  4CYQ A;  1N71 A;  3GKR A;  4KS9 A;  3TE4 A;  1TIQ A;  1I21 A;  5IV0 A;  2PRB A;  4MFZ A;  4AG9 A;  2B5G A;  5F47 A;  3TFY A;  3E0K A;  2X7B A;  1YVO A;  1R57 A;  4KOR A;  3LOD A;  4UCM A;  2R98 A;  3FXT A;  4YGO A;  4A30 A;  1P4N A;  4CGN A;  1WWZ A;  2B4D A;  2B4B A;  2ZW7 A;  4CRZ B;  2OZG A;  2R7H A;  1YLE A;  1ON0 A;  4XPK A;  2G0B A;  2AJ6 A;  4A32 A;  1V0C A;  4KSF A;  3DDD A;  4AVC A;  2EUI A;  4XPD B;  2Q7B A;  4UFX A;  1I1D A;  2JDC A;  1RO5 A;  2I00 A;  4MY0 A;  3SXN A;  1I12 A;  4XPL A;  2BEI A;  1QSN A;  1MJ9 A;  4KVM E;  4MFP A;  4CGL A;  2YNC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...