2KCWA

Solution structure of apo-form yjab from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
147
Chain Sequence
b'MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDPDVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLAYVGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized acetyltransferase yjaB
publication title Solution structure of Apo-YjaB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 147
sequence length 147
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2kcwA00
1S5KA 2G3TA 5HH1A 1CJWA 1QSMA 2Q7BA 4IUSA 2ATRA 3CXQA 3R9EA 3P2HA 3IWGA 4HNYB 5I0CA 3B8GA 4KZTA 3CXSA 4UA3A 5J8CA 3D3SA 3S6KA 3V8IA 5C88A 1XE4A 4XPLA 4XPKA 2OZGA 2Q4YA 4QBJA 2GANA 4QUSA 1KZFA 3W91A 1M4GA 3D2PA 4E8OA 4YFJA 2B4DB 2WPXA 3TO6A 1B6BA 4H89A 2GIVA 3OWCA 1B87A 2J8NA 2ZW5A 2HQYA 2HUZA 1M44A 4XNHC 3R9FA 3QAHA 1S7FA 4MJ8A 2CNTA 4FD7A 2P6GA 4AVBA 4KOWA 3TO9A 1RXTA 3RYOA 4L89A 1Y9KA 2OU2A 3R96A 4U9ZA 5IB0A 1IYLA 5EC4A 3W6XA 4FD5A 4RI1A 4H6UA 1SQHA 1TIQA 1YX0A 1NE9A 3VWEA 2R7HA 2FS5A 1YR0A 4R3KA 4F6AA 1MJ9A 3UY5A 2NMTA 1S7LA 4Y49B 2VEZA 4AVAA 1KUVA 4HNWB 1XEBA 3KKWA 4KOTA 5H84A 3R9GA 2G3AA 1I21A 1BO4A 1MK4A 2C27A 2P6EA 4KOXA 4OADA 4PV6A 4KVOE 4CAVA 4FD4A 4JD6A 3G8WA 1M1DA 5IX3A 4KLWA 4MBUA 4CRZB 2H5MA 4KOUA 4FD6A 4QB9A 3BJ7A 1U6MA 3F5BA 1J4JA 1Y9WA 1IYKA 1VHSA 5DWMA 4CAXA 2DXQA 5E96A 3PP9A 2P6FA 1XIXA 1RO5A 2VQYA 4YGOA 2PC1A 3F0AA 2OB0A 4NEXA 5ISVA 1NMTA 1Y7RA 3SXNA 3G3SA 4KOVA 4QC6A 1OZPA 3I9SA 4I49A 3JVNA 2VZZA 1FY7A 2FL4A 3VWDA 4L8AA 1QSTA 2EVNA 2ZW6A 4R9MA 4HNXB 3EFAA 4KOYA 3EO4A 4X5KA 2BL1A 1NSLA 3LD2A 2P0WA 4B5PA 3ZJ0A 4OAEA 3TT2A 4XPDC 5GCNA 4UBRA 2J8MA 2HV2A 3DSBA 3SXOA 1XMTA 1IIDA 4JLYA 5J8FA 3IGRA 4XNHB 3D8PA 4U9YA 1IICA 3FYNA 1L0CA 1LRZA 2I79A 4HKFA 1VKCA 3T9YA 4J3GA 4JWPA 2B5GB 2I00A 2PR1A 2VI7A 1QSNA 2JEVA 4M3SA 5FVJA 3GYAA 4UWIA 2BEIA 1M4IA 4F0YA 3DNSA 5F47A 2CNMA 2Q44A 3FBUA 2PR8A 5F49A 1GHEA 4UWJA 4JXRA 2JLMA 3FXTA 2D4OA 3TE4A 2X7BA 4R87A 4LUAA 4MI4A 2G0BA 4CAWA 5IV0A 3D2MA 2GE3A 5HMNA 1I1DA 4R57A 4R3LA 2FE7A 2JDCA 3BJ8A 3JUWA 4CRYB 1YK3A 1MJAA 3N7ZA 2Y0MA 4MHDA 3BLNA 1YGHA 2BUEA 4KOSA 1YREA 1QSOA 2FXFA 3I3GA 3NE7A 1KUYA 2Z0ZA 2IL4A 2FIAA 4ONUA 3FNCA 1R57A 2B58A 4KUBA 3DR8A 4IF5A 2BSWA 2QECA 2PQ8A 1XF8A 2RC4A 4KVME 4MY0A 2A4NA 2REFA 1M4DA 2VBQA 5JQ4A 1Q2DA 2ZW4A 4ZBGA 4E2AA 2REEA 3K9UA 5DWNA 3PGPA 3S6GA 2ARHA 3GY9A 2OZHA 3SHPA 4DNCA 3FB3A 5JPHA 2QMLA 5EBVA 1YVKA 1YLEA 4PK2A 4XPDB 2K5TA 2ZPAA 4AB7A 2FIWA 1Z4RA 4CS0B 1N71A 4GS4A 4E0AA 2Z11A 5CNPA 2R8VA 4PSWA 2ZXVA 3LODA 3PZJA 4KUAA 2PDOA 2B4DA 1ON0A 1K4JA 3TCVA 3CXPA 3E0KA 4PSXA 4BMHA 1IB1E 2O28A 1Z4EA 4NF1A 2Q4VA 2FT0A 4H6ZA 3EXNA 2B5GA 4B5OA 4B5PB 4MY3A 2R1IA 2D4PA 3GKRA 4U5YA 3WR7A 1V0CA 4II9A 2B3VA 4K30A 1KUXA 3EY5A 4NSQA 4NCZA 5H86A 3QB8A 2AJ6A 2Z10A 3MGDA 1S7NA 2EUIA 3TOBA 4OLLA 1QSRA 2PSWA 4JJXA 4KVXA 4AVCA 2WPWA 3R1KA 1WWZA 2OZUA 3R95A 4KORA 2KCWA 2VZYA 4KLVA 4NXYA 4PK3A 1S60A 5KTCA 3W6SA 3H4QA 3TO7A 1S7KA 3P2FA 1Q2CA 1P0HA 5F46A 1MJBA 3TTHA 4AG7A 1PU9A 4M85A 4RS2A 4LX9A 3EC4A 3FIXA 3S6FA 2J8RA 2ZW7A 3C26A 1WK4A 3S6HA 2R98A 2B4BA 2VXKA 2CY2A 2Q04A 1I12A 3F8KA 4AG9A 2QIRA 5KTDA 4Y49C 5C82A 1P4NA 1CM0A 1UFHA 3DR6A 5KTAA 5F48A 4YRHA 3DDDA 2AE6A 4ORFA 2JDDA 2FSRA 2CNSA 1Z9UA 1YVOA 1Q2YA 3ZZIA 4QVTA 2B3UA 2PRBA 4EVYA 3TOAA 2FCKA 3FRMA 2OH1A 3TFYA 1S3ZA 2Q0YA 3T90A 2F5IA 4JXQA 1BOBA 1PUAA
chains in the Genus database with same CATH superfamily
1S5KA 1ZLIA 2HB6A 3JTKA 2G3TA 3PB6X 4PXEA 3H8GA 4OC4A 4UCMA 5ELYA 5HH1A 3GB0A 3D7DA 1CJWA 1XMBA 3B3CA 4KSFA 1QSMA 2BO9A 4CGOA 2Q7BA 4IUSA 2Z3NA 3PBEA 4R76A 2ATRA 1YQEA 3CXQA 3NH4A 3FJUA 2Z3LA 3R9EA 3P2HA 3IWGA 4HNYB 5I0CA 3B8GA 4YWYA 4KZTA 2AFUA 4NGTA 3CXSA 3KI9A 2Q51A 4UA3A 3D3SA 3S6KA 3ISXA 2RFHA 3S9MA 3V8IA 4EWTA 5C88A 5J8CA 3QAYA 1XE4A 3PBBA 2Z3OA 3IO1A 4XPLA 4XPKA 2OZGA 4A37A 3H8FA 4C2XA 4NGRA 2Q4YA 5D29A 5G1ZA 3BI0A 4QBJA 2GANA 3D7FA 2C6CA 4QUSA 1KZFA 1R3NA 3W91A 3B35A 1IOIA 4CYPA 4LQGA 2CTBA 1IGBA 2WZNA 4IHMA 4CGPA 2Q43A 1FNOA 2PJ8A 1M4GA 3D2PA 4E8OA 4YFJA 4HPSA 2B4DB 4CYOA 3WABA 2WPXA 3TO6A 2JBJA 2PIYA 4NGNA 1B6BA 4CGLA 4H89A 4AXVA 2YNCA 5G22A 4X2TA 2GIVA 1LAPA 4OMEA 4ZX9A 4MHZA 3OWCA 1B87A 1EE3P 2J8NA 1HDQA 4KSIA 1BPMA 4MXUA 5F09A 5K8OA 2ZW5A 2HQYA 2HUZA 5J1QA 1XOVA 1M44A 2PVWA 2ZEPA 4XNHC 2EK9A 3R9FA 3QAHA 3WC6A 4GXHA 1S7FA 4MJ8A 1NSAA 5AGEA 2CNTA 4FD7A 2P6GA 4AVBA 4KOWA 3TO9A 1RXTA 3KHXA 3RYOA 2C6PA 2ZEOA 4ZY0A 2GLJA 4L89A 1Y9KA 4EMEA 3KR4A 3PFEA 2OU2A 1JQGA 2WUUA 3GUXA 2VL1A 4U9ZA 3R96A 4DYOA 5IB0A 1IYLA 4PPZA 1AUGA 5EC4A 2I3CA 3W6XA 2NSMA 4FD5A 5LYLA 4P44A 1Q7LA 4H6UA 1SQHA 4NGSA 4RI1A 1TIQA 2PJAA 4P4BA 1YX0A 1NE9A 3BI1A 3VWEA 2R7HA 2FS5A 4FWUA 4BD9A 1YR0A 4R3KA 4F6AA 1XRYA 1MJ9A 4OC2A 2NMTA 3UY5A 6CPAA 5JH9A 1S7LA 4MFKA 4Y49B 2VEZA 2YNCC 5AG5A 4AVAA 1KUVA 4HNWB 4A94A 1XEBA 1TF9A 3QNVA 4Q7AA 3IU1A 5K8PA 3KKWA 4KOTA 2PRQA 4A38A 1TKFA 2PJ4A 5H84A 4C7IA 3R9GA 2GU2A 2G3AA 1I21A 1BO4A 4JZ0A 5AG7A 4EFDA 1MK4A 4PXBA 5HVGA 2C27A 2P6EA 4KOXA 4OADA 4PV6A 4Z65A 4KVOE 4CAVA 4FD4A 1FT7A 3B3VA 4R6TA 2ZEDA 2IJZA 4JD6A 3G8WA 1M1DA 2BOAA 5CPAA 5IX3A 3B3WA 2F8HA 4KLWA 4MBUA 4CRZB 2H5MA 3WT4A 2ANPA 2AFXA 2EWBA 4RN7A 2ZEEA 4X8IA 4KOUA 4FD6A 4QB9A 3BJ7A 4P4EA 1U6MA 8CPAA 3F5BA 2OOTA 4MCPA 1J4JA 1CBXA 1Y9WA 3GLJA 4ZI6A 3B7IA 1IYKA 1VHSA 1ZG7A 2AFSA 5DWMA 4CAXA 2DXQA 4A95A 5E96A 3TX8A 3PP9A 1ZG8A 2P6FA 3CDXA 4M6IA 1XIXA 1RO5A 2VQYA 2YGWA 2PC1A 3FEEA 4YGOA 1OBRA 1Y0YA 4C2YA 5A28A 1HDUA 3F0AA 3DLJA 2EBJA 2OB0A 3LACA 4NEXA 5ISVA 4ZX8A 1NMTA 1Y7RA 3A9LA 4ZY2A 3SXNA 3G3SA 1ZLHA 5D8NA 3IIBA 2G9DA 3D68A 4PXDA 3CPAA 4KOVA 4P4JA 1OZPA 4QC6A 2CIJA 5HVFA 4FAIA 3I9SA 3ISZA 4UCNA 4B10A 4CGMA 4FUUA 4P4DA 2FVGA 4I49A 3LWUA 1H8LA 1AMPA 2PIZA 3JVNA 2VZZA 1X12A 4R7MA 5LYDA 2WYRA 4MCSA 3FF3A 3RZAA 1FY7A 1R43A 2DPTA 2FL4A 4L8AA 3VWDA 1HEEA 1QSTA 2EVNA 2PE3A 4UEFA 4O23A 1ARMA 2ZW6A 3FEDA 4R9MA 4HNXB 4UCPA 3EFAA 2XEGA 4W9YA 4KOYA 2IMOA 3EO4A 3PB9X 1VGYA 2BL1A 1DTDA 4X5KA 1NSLA 3LD2A 2P0WA 4B5PA 3ZJ0A 1CPSA 4NJQA 5THWA 4OAEA 3TT2A 4XPDC 1YMEA 1TKHA 5GCNA 2IQ6A 4UBRA 2PJ0A 2J8MA 2HV2A 4UFXA 3DSBA 4X3RA 3TC8A 1F57A 3SI0A 3SXOA 2PJBA 1CG2A 4MRIA 1XMTA 5I4MA 1CP6A 1IIDA 4JLYA 1XJOA 4UIAA 5J8FA 3LMSA 3IGRA 4XNHB 5HVHA 3D8PA 5BWAB 4WWVA 4NGQA 3IWWA 3D7HA 4U9YA 4F9UA 1IICA 4UEEA 2AFMA 3FYNA 1L0CA 1LRZA 2RB7A 2ZENA 1ELMP 2I79A 1Z5RA 2DPSA 2PJ6A 3NFZA 3IWEA 1VKCA 2V8VA 3H5ZA 4HKFA 3T9YA 4J3GA 4JWPA 4ZGYB 7CPAA 2B5GB 2I00A 2ZEMA 5HXDA 1X10A 3CPXA 3VATA 1Z8XA 2PR1A 4KSAA 5LRJA 2VI7A 1UWYA 4B12A 3V7ZA 4MMOA 1QSNA 2JEVA 2PJ3A 4M3SA 5FVJA 3GYAA 1Z8TA 3FECA 4FBEA 3CZXA 5LYFA 4UWIA 2BEIA 1M4IA 3RBUA 4F0YA 3DNSA 5F47A 2Z3PA 4MCRA 4CPAA 5JGFA 1F2PA 2CNMA 2Q44A 2ZOFA 3FBUA 2PR8A 5F49A 2ZEGA 1LOKA 2Z3MA 3HLPA 1GHEA 4OC3A 4UWJA 4IK2A 4JXRA 3D66A 4BINA 1CX8A 2JLMA 3FXTA 4UIBA 2D4OA 3MN8A 4P4FA 4A30A 4B6ZA 5IB9A 4OC1A 3TE4A 1ARLA 2X7BA 4R87A 2V77A 2PJ5A 3IU2A 3BHXA 4LUAA 4MI4A 1ZO0A 2G0BA 4MFLA 4CAWA 5IV0A 4C2ZA 3D4UA 1QQ9A 3D2MA 2HC9A 4IAVA 4MHYA 2GE3A 2PJCA 4GM5A 5G21A 4JYWA 5HMNA 1I1DA 3WC5A 4R57A 4ZYQA 4R3LA 2FE7A 1XBUA 3FVLA 3PFOA 1Y0RA 1LANA 2V8HA 1VHEA 2JDCA 2QJ8A 3BJ8A 3JUWA 4CRYB 1YK3A 1MJAA 1JWQA 3N7ZA 2V8GA 2EO8A 4RUHA 2V8DA 2Y0MA 1KWMA 3BLNA 3N5FA 4MHDA 3KL9A 1YGHA 1F2OA 2BUEA 4KOSA 2ODFA 1YREA 1QSOA 3IEHA 2FXFA 3I3GA 3SI2A 3NE7A 1KUYA 2Z0ZA 2IL4A 2FIAA 4ONUA 3FNCA 1R57A 3PB4X 2B58A 3IFEA 4CAFA 4KUBA 3FH4A 3DR8A 2CXAA 4IF5A 2BSWA 2QECA 2YNDA 4NJRA 4A31A 4UEZA 2PQ8A 4UFWA 1XF8A 2RC4A 4KVME 1Y7EA 1TKJA 4MY0A 2A4NA 4TWEA 2REFA 4MHNA 1M4DA 2XEFA 3PB7X 3JRUA 2ZOGA 2VBQA 2PVVA 1BPNA 2Q4ZA 3PB8X 4A33A 5JQ4A 1Q2DA 1Z8LA 5JM6A 2Q7SA 2ZW4A 2XEJA 3IC1A 4ZBGA 3CT9A 4E2AA 2ZEFA 2REEA 3K9UA 3SJGA 1M4LA 5DWNA 3PGPA 4NGPA 3S6GA 2ARHA 3L2NA 4R8FA 3GY9A 2OZHA 1LFWA 1TF8A 3SHPA 4ZY1A 4DNCA 3FB3A 5JPHA 2PJ2A 2QMLA 4UF4A 3B3TA 5EBVA 5K8MA 4OC5A 1YVKA 1YLEA 1ELLP 1DE4C 2O53A 2PJ1A 4PK2A 2K5TA 4UFVA 2ZPAA 4XPDB 2FIWA 4AB7A 1Z4RA 2JEWA 1Z2LA 4CS0B 2QVPA 3S9NA 1N71A 4GS4A 4OIDA 4DUKA 4E0AA 5A27A 2BCOA 2Z11A 5CNPA 2R8VA 3PEIA 4OC0A 4PSWA 4Q36A 3V38A 4G1PA 2ZXVA 2GREA 3FMCA 3LODA 3PZJA 2PDOA 4KUAA 4ONWA 2B4DA 1ON0A 2Z3KA 2C1CA 1K4JA 3H8EA 3TCVA 4PXCA 2OR4A 4MFPA 3CXPA 3E0KA 4PSXA 3RO0A 4BBHA 3RNZA 3NE8A 4PQAA 1RTQA 4A39A 1LCPA 2GFQA 1IB1E 4B14A 2O28A 3SJXA 4BMHA 2GLFA 1Z4EA 4NF1A 2Q4VA 4CGNA 1CP7A 2FT0A 2DF5A 2ZEHA 3DGVA 5LRKA 1A2ZA 4H6ZA 3NA6A 3EXNA 4P6YA 2B5GA 4B5OA 3BXMA 2PJ7A 1VIXA 3D67A 2AFZA 4MFQA 4MY3A 2R1IA 4B5PB 2D4PA 3GKRA 3K2KA 4U5YA 4MCQA 4MFZA 3KGQA 3WR7A 1V0CA 4MHPA 4II9A 1ZG9A 2B3VA 4K30A 1KUXA 2O4HA 3EY5A 3T8WA 2JBKA 3D7GA 3IJ3A 3PRTA 3I1UA 2PJ9A 4OKOA 4NSQA 4C68A 3NH8A 5LYIA 4NCZA 4NFRA 1LAMA 3HUVA 5H86A 3FX6A 3QB8A 2AJ6A 2Z10A 3MGDA 3S9LA 4F9VA 1S7NA 2EUIA 4M6HA 2F7VA 2QYVA 2AFWA 3TOBA 4OLLA 1QSRA 2PSWA 4JJXA 2C6GA 4KVXA 4P10A 4P45A 4AVCA 2WPWA 4F0XA 3R1KA 4B11A 3VH9A 1WWZA 2OZUA 3R95A 3RAMA 2DEAA 4KORA 2KCWA 2CTCA 2VZYA 4KLVA 5G20A 5CBMA 2YNEA 1IY7A 4NXYA 4PK3A 1S60A 3K9TA 3MRUA 5KTCA 2NYQA 1YSJA 3W6SA 3H4QA 4OIWA 3TO7A 1S7KA 3P2FA 2XEIA 3KQZA 1Q2CA 1P0HA 3GIUA 3VARA 5F46A 3KASA 1MJBA 1IU8A 3TTHA 1AYEA 1XFOA 4WJBA 4A32A 4AG7A 1PU9A 2ZELA 4K3NA 4M85A 3KZWA 4RS2A 4LX9A 2EK8A 4LQ6A 4MFJA 4CYNA 4KS9A 3SI1A 2CF4A 1IOFA 3B2YA 3EC4A 3FIXA 3S6FA 2J8RA 2ZW7A 1VHOA 4F8ZA 3C26A 1BLLE 4OP4A 1WK4A 3S6HA 2R98A 2B4BA 4C7HA 2VXKA 1Z8WA 1YLOA 2CY2A 2Q04A 2WSAA 2ABZA 4NGMA 1I12A 1PCAA 3F8KA 2QIRA 4TNUA 4AG9A 4CYQA 1YW6A 5KTDA 4Y49C 5C82A 5AG6A 1P4NA 1CM0A 1UFHA 3DR6A 1TXRA 5KTAA 5F48A 4YRHA 2AFOA 5K8NA 5EMIA 3DDDA 2AE6A 2J9AA 3KHZA 4ORFA 2JDDA 5AG4A 2FSRA 2CNSA 4A2ZA 4M6GA 1Z9UA 1YVOA 1Q2YA 3B3SA 1CPXA 3ZZIA 3NH5A 1PYTB 1GYTA 2PCUA 3SJFA 4QVTA 4B13A 2B3UA 2PRBA 3KQXA 3KR5A 4YU9A 4EVYA 3TOAA 4DJLA 2FCKA 3FRMA 2POKA 2OH1A 3TFYA 4CAEA 1S3ZA 2Q0YA 3T90A 3SJEA 2F5IA 4P4IA 4JXQA 4Q38A 1QMUA 3WC7A 1BOBA 1PUAA 1BAVA 1YW4A 5DS0A 5LRGA 4H2KA
chains in the Genus database with same CATH topology
1S5KA 3JTKA 2G3TA 4UCMA 5HH1A 1CJWA 4KSFA 4CGOA 1QSMA 2Q7BA 4IUSA 2Z3NA 2ATRA 3CXQA 2Z3LA 3R9EA 3P2HA 3IWGA 4HNYB 5I0CA 3B8GA 4KZTA 3CXSA 4UA3A 5J8CA 3D3SA 3S6KA 3V8IA 5C88A 1XE4A 2Z3OA 4XPLA 4XPKA 2OZGA 4C2XA 2Q4YA 5G1ZA 4QBJA 2GANA 4QUSA 1KZFA 3W91A 4CYPA 4CGPA 1M4GA 3D2PA 4E8OA 4YFJA 2B4DB 4CYOA 2WPXA 3TO6A 1B6BA 4CGLA 4H89A 2YNCA 5G22A 2GIVA 3OWCA 1B87A 2J8NA 2ZW5A 2HQYA 2HUZA 1M44A 4XNHC 3R9FA 3QAHA 1S7FA 4MJ8A 5AGEA 2CNTA 4FD7A 2P6GA 4AVBA 4KOWA 3TO9A 1RXTA 3RYOA 4L89A 1Y9KA 2OU2A 2WUUA 3R96A 4U9ZA 5IB0A 1IYLA 5EC4A 3W6XA 4FD5A 4RI1A 4H6UA 1SQHA 1TIQA 1YX0A 1NE9A 3VWEA 2R7HA 2FS5A 1YR0A 4R3KA 4F6AA 1MJ9A 3UY5A 2NMTA 1S7LA 4MFKA 4Y49B 2VEZA 2YNCC 5AG5A 4AVAA 1KUVA 4HNWB 1XEBA 3IU1A 3KKWA 4KOTA 5H84A 4C7IA 3R9GA 5AG7A 2G3AA 1I21A 1BO4A 1MK4A 2C27A 2P6EA 4KOXA 4OADA 4PV6A 4KVOE 4CAVA 4FD4A 4JD6A 3G8WA 1M1DA 5IX3A 4KLWA 4MBUA 4CRZB 2H5MA 4KOUA 4FD6A 4QB9A 3BJ7A 1U6MA 3F5BA 1J4JA 1Y9WA 1IYKA 1VHSA 5DWMA 4CAXA 2DXQA 4A95A 5E96A 3PP9A 2P6FA 1XIXA 1RO5A 2VQYA 2YGWA 2PC1A 4YGOA 4C2YA 5A28A 3F0AA 2OB0A 4NEXA 5ISVA 1NMTA 1Y7RA 3A9LA 3SXNA 3G3SA 4KOVA 4QC6A 1OZPA 3I9SA 4UCNA 4B10A 4CGMA 4I49A 3JVNA 2VZZA 1FY7A 2DPTA 2FL4A 3VWDA 4L8AA 1QSTA 2EVNA 2ZW6A 4R9MA 4HNXB 4UCPA 3EFAA 4KOYA 3EO4A 4X5KA 2BL1A 1NSLA 3LD2A 2P0WA 4B5PA 3ZJ0A 4OAEA 3TT2A 4XPDC 5GCNA 4UBRA 2J8MA 2HV2A 4UFXA 3DSBA 3SXOA 1XMTA 1IIDA 4JLYA 5J8FA 3IGRA 4XNHB 3D8PA 5BWAB 4U9YA 1IICA 3FYNA 1L0CA 1LRZA 2I79A 2DPSA 4HKFA 3IWEA 1VKCA 3H5ZA 3T9YA 4J3GA 4JWPA 4ZGYB 2B5GB 2I00A 2PR1A 4KSAA 2VI7A 4B12A 1QSNA 2JEVA 4M3SA 5FVJA 3GYAA 4UWIA 2BEIA 1M4IA 4F0YA 3DNSA 5F47A 2Z3PA 2CNMA 2Q44A 3FBUA 2PR8A 5F49A 2Z3MA 1GHEA 4UWJA 4JXRA 2JLMA 3FXTA 4A30A 2D4OA 3TE4A 2X7BA 4R87A 3IU2A 4LUAA 4MI4A 1ZO0A 2G0BA 4MFLA 4CAWA 5IV0A 4C2ZA 3D2MA 5G21A 2GE3A 5HMNA 1I1DA 4R57A 4R3LA 2FE7A 2JDCA 3BJ8A 3JUWA 4CRYB 1YK3A 1MJAA 3N7ZA 2Y0MA 4MHDA 3BLNA 1YGHA 2BUEA 4KOSA 1YREA 1QSOA 2FXFA 3I3GA 3NE7A 1KUYA 2Z0ZA 2IL4A 2FIAA 4ONUA 3FNCA 1R57A 2B58A 4CAFA 4KUBA 3DR8A 4IF5A 2CXAA 2BSWA 2QECA 2YNDA 4A31A 2PQ8A 4UFWA 1XF8A 2RC4A 4KVME 4MY0A 2A4NA 2REFA 1M4DA 2VBQA 4A33A 5JQ4A 1Q2DA 2ZW4A 4ZBGA 4E2AA 2REEA 3K9UA 5DWNA 3PGPA 3S6GA 2ARHA 3GY9A 2OZHA 3SHPA 4DNCA 3FB3A 5JPHA 2QMLA 5EBVA 1YVKA 1YLEA 4PK2A 4XPDB 2K5TA 4UFVA 2ZPAA 4AB7A 2FIWA 1Z4RA 4CS0B 1N71A 4GS4A 4E0AA 5A27A 2Z11A 5CNPA 2R8VA 4PSWA 4Q36A 2ZXVA 3LODA 3PZJA 4KUAA 2PDOA 2B4DA 1ON0A 2Z3KA 1K4JA 3TCVA 4MFPA 3CXPA 3E0KA 4PSXA 4BBHA 4BMHA 1IB1E 4B14A 2O28A 1Z4EA 4NF1A 2Q4VA 4CGNA 2FT0A 4H6ZA 3EXNA 2B5GA 4B5OA 4B5PB 4MY3A 4MFQA 2R1IA 2D4PA 3GKRA 4U5YA 4MFZA 3WR7A 1V0CA 4II9A 2B3VA 4K30A 1KUXA 3EY5A 4C68A 4NSQA 4NCZA 5H86A 3QB8A 2AJ6A 2Z10A 3MGDA 1S7NA 2EUIA 3TOBA 4OLLA 1QSRA 2PSWA 4JJXA 4F0XA 4KVXA 4AVCA 2WPWA 3R1KA 4B11A 1WWZA 2OZUA 3R95A 4KORA 2KCWA 2VZYA 4KLVA 5G20A 2YNEA 4NXYA 4PK3A 1S60A 5KTCA 3W6SA 3H4QA 3TO7A 1S7KA 3P2FA 1Q2CA 1P0HA 5F46A 1MJBA 3TTHA 4A32A 4AG7A 1PU9A 4M85A 4RS2A 4LX9A 4MFJA 4CYNA 4KS9A 3EC4A 3FIXA 3S6FA 2J8RA 2ZW7A 3C26A 1WK4A 3S6HA 2R98A 2B4BA 4C7HA 2VXKA 2CY2A 2Q04A 2WSAA 1I12A 3F8KA 4AG9A 2QIRA 4CYQA 5KTDA 4Y49C 5C82A 5AG6A 1P4NA 1CM0A 1UFHA 3DR6A 5KTAA 5F48A 4YRHA 3DDDA 2AE6A 4ORFA 2JDDA 5AG4A 2FSRA 2CNSA 4A2ZA 1Z9UA 1YVOA 1Q2YA 3ZZIA 4QVTA 4B13A 2B3UA 2PRBA 4EVYA 3TOAA 2FCKA 3FRMA 2OH1A 3TFYA 4CAEA 1S3ZA 2Q0YA 3T90A 2F5IA 4JXQA 4Q38A 1BOBA 1PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5K A;  2G3T A;  5HH1 A;  1CJW A;  1QSM A;  2Q7B A;  4IUS A;  2ATR A;  3CXQ A;  3R9E A;  3P2H A;  3IWG A;  4HNY B;  5I0C A;  3B8G A;  4KZT A;  3CXS A;  4UA3 A;  5J8C A;  3D3S A;  3S6K A;  3V8I A;  5C88 A;  1XE4 A;  4XPL A;  4XPK A;  2OZG A;  2Q4Y A;  4QBJ A;  2GAN A;  4QUS A;  1KZF A;  3W91 A;  1M4G A;  3D2P A;  4E8O A;  4YFJ A;  2B4D B;  2WPX A;  3TO6 A;  1B6B A;  4H89 A;  2GIV A;  3OWC A;  1B87 A;  2J8N A;  2ZW5 A;  2HQY A;  2HUZ A;  1M44 A;  4XNH C;  3R9F A;  3QAH A;  1S7F A;  4MJ8 A;  2CNT A;  4FD7 A;  2P6G A;  4AVB A;  4KOW A;  3TO9 A;  1RXT A;  3RYO A;  4L89 A;  1Y9K A;  2OU2 A;  3R96 A;  4U9Z A;  5IB0 A;  1IYL A;  5EC4 A;  3W6X A;  4FD5 A;  4RI1 A;  4H6U A;  1SQH A;  1TIQ A;  1YX0 A;  1NE9 A;  3VWE A;  2R7H A;  2FS5 A;  1YR0 A;  4R3K A;  4F6A A;  1MJ9 A;  3UY5 A;  2NMT A;  1S7L A;  4Y49 B;  2VEZ A;  4AVA A;  1KUV A;  4HNW B;  1XEB A;  3KKW A;  4KOT A;  5H84 A;  3R9G A;  2G3A A;  1I21 A;  1BO4 A;  1MK4 A;  2C27 A;  2P6E A;  4KOX A;  4OAD A;  4PV6 A;  4KVO E;  4CAV A;  4FD4 A;  4JD6 A;  3G8W A;  1M1D A;  5IX3 A;  4KLW A;  4MBU A;  4CRZ B;  2H5M A;  4KOU A;  4FD6 A;  4QB9 A;  3BJ7 A;  1U6M A;  3F5B A;  1J4J A;  1Y9W A;  1IYK A;  1VHS A;  5DWM A;  4CAX A;  2DXQ A;  5E96 A;  3PP9 A;  2P6F A;  1XIX A;  1RO5 A;  2VQY A;  4YGO A;  2PC1 A;  3F0A A;  2OB0 A;  4NEX A;  5ISV A;  1NMT A;  1Y7R A;  3SXN A;  3G3S A;  4KOV A;  4QC6 A;  1OZP A;  3I9S A;  4I49 A;  3JVN A;  2VZZ A;  1FY7 A;  2FL4 A;  3VWD A;  4L8A A;  1QST A;  2EVN A;  2ZW6 A;  4R9M A;  4HNX B;  3EFA A;  4KOY A;  3EO4 A;  4X5K A;  2BL1 A;  1NSL A;  3LD2 A;  2P0W A;  4B5P A;  3ZJ0 A;  4OAE A;  3TT2 A;  4XPD C;  5GCN A;  4UBR A;  2J8M A;  2HV2 A;  3DSB A;  3SXO A;  1XMT A;  1IID A;  4JLY A;  5J8F A;  3IGR A;  4XNH B;  3D8P A;  4U9Y A;  1IIC A;  3FYN A;  1L0C A;  1LRZ A;  2I79 A;  4HKF A;  1VKC A;  3T9Y A;  4J3G A;  4JWP A;  2B5G B;  2I00 A;  2PR1 A;  2VI7 A;  1QSN A;  2JEV A;  4M3S A;  5FVJ A;  3GYA A;  4UWI A;  2BEI A;  1M4I A;  4F0Y A;  3DNS A;  5F47 A;  2CNM A;  2Q44 A;  3FBU A;  2PR8 A;  5F49 A;  1GHE A;  4UWJ A;  4JXR A;  2JLM A;  3FXT A;  2D4O A;  3TE4 A;  2X7B A;  4R87 A;  4LUA A;  4MI4 A;  2G0B A;  4CAW A;  5IV0 A;  3D2M A;  2GE3 A;  5HMN A;  1I1D A;  4R57 A;  4R3L A;  2FE7 A;  2JDC A;  3BJ8 A;  3JUW A;  4CRY B;  1YK3 A;  1MJA A;  3N7Z A;  2Y0M A;  4MHD A;  3BLN A;  1YGH A;  2BUE A;  4KOS A;  1YRE A;  1QSO A;  2FXF A;  3I3G A;  3NE7 A;  1KUY A;  2Z0Z A;  2IL4 A;  2FIA A;  4ONU A;  3FNC A;  1R57 A;  2B58 A;  4KUB A;  3DR8 A;  4IF5 A;  2BSW A;  2QEC A;  2PQ8 A;  1XF8 A;  2RC4 A;  4KVM E;  4MY0 A;  2A4N A;  2REF A;  1M4D A;  2VBQ A;  5JQ4 A;  1Q2D A;  2ZW4 A;  4ZBG A;  4E2A A;  2REE A;  3K9U A;  5DWN A;  3PGP A;  3S6G A;  2ARH A;  3GY9 A;  2OZH A;  3SHP A;  4DNC A;  3FB3 A;  5JPH A;  2QML A;  5EBV A;  1YVK A;  1YLE A;  4PK2 A;  4XPD B;  2K5T A;  2ZPA A;  4AB7 A;  2FIW A;  1Z4R A;  4CS0 B;  1N71 A;  4GS4 A;  4E0A A;  2Z11 A;  5CNP A;  2R8V A;  4PSW A;  2ZXV A;  3LOD A;  3PZJ A;  4KUA A;  2PDO A;  2B4D A;  1ON0 A;  1K4J A;  3TCV A;  3CXP A;  3E0K A;  4PSX A;  4BMH A;  1IB1 E;  2O28 A;  1Z4E A;  4NF1 A;  2Q4V A;  2FT0 A;  4H6Z A;  3EXN A;  2B5G A;  4B5O A;  4B5P B;  4MY3 A;  2R1I A;  2D4P A;  3GKR A;  4U5Y A;  3WR7 A;  1V0C A;  4II9 A;  2B3V A;  4K30 A;  1KUX A;  3EY5 A;  4NSQ A;  4NCZ A;  5H86 A;  3QB8 A;  2AJ6 A;  2Z10 A;  3MGD A;  1S7N A;  2EUI A;  3TOB A;  4OLL A;  1QSR A;  2PSW A;  4JJX A;  4KVX A;  4AVC A;  2WPW A;  3R1K A;  1WWZ A;  2OZU A;  3R95 A;  4KOR A;  2KCW A;  2VZY A;  4KLV A;  4NXY A;  4PK3 A;  1S60 A;  5KTC A;  3W6S A;  3H4Q A;  3TO7 A;  1S7K A;  3P2F A;  1Q2C A;  1P0H A;  5F46 A;  1MJB A;  3TTH A;  4AG7 A;  1PU9 A;  4M85 A;  4RS2 A;  4LX9 A;  3EC4 A;  3FIX A;  3S6F A;  2J8R A;  2ZW7 A;  3C26 A;  1WK4 A;  3S6H A;  2R98 A;  2B4B A;  2VXK A;  2CY2 A;  2Q04 A;  1I12 A;  3F8K A;  4AG9 A;  2QIR A;  5KTD A;  4Y49 C;  5C82 A;  1P4N A;  1CM0 A;  1UFH A;  3DR6 A;  5KTA A;  5F48 A;  4YRH A;  3DDD A;  2AE6 A;  4ORF A;  2JDD A;  2FSR A;  2CNS A;  1Z9U A;  1YVO A;  1Q2Y A;  3ZZI A;  4QVT A;  2B3U A;  2PRB A;  4EVY A;  3TOA A;  2FCK A;  3FRM A;  2OH1 A;  3TFY A;  1S3Z A;  2Q0Y A;  3T90 A;  2F5I A;  4JXQ A;  1BOB A;  1PUA A; 
#chains in the Genus database with same CATH topology
 1S5K A;  1ZLI A;  2HB6 A;  3JTK A;  2G3T A;  3PB6 X;  4PXE A;  3H8G A;  4OC4 A;  4UCM A;  5ELY A;  5HH1 A;  3GB0 A;  3D7D A;  1CJW A;  1XMB A;  3B3C A;  4KSF A;  1QSM A;  2BO9 A;  4CGO A;  2Q7B A;  4IUS A;  2Z3N A;  3PBE A;  4R76 A;  2ATR A;  1YQE A;  3CXQ A;  3NH4 A;  3FJU A;  2Z3L A;  3R9E A;  3P2H A;  3IWG A;  4HNY B;  5I0C A;  3B8G A;  4YWY A;  4KZT A;  2AFU A;  4NGT A;  3CXS A;  3KI9 A;  2Q51 A;  4UA3 A;  3D3S A;  3S6K A;  3ISX A;  2RFH A;  3S9M A;  3V8I A;  4EWT A;  5C88 A;  5J8C A;  3QAY A;  1XE4 A;  3PBB A;  2Z3O A;  3IO1 A;  4XPL A;  4XPK A;  2OZG A;  4A37 A;  3H8F A;  4C2X A;  4NGR A;  2Q4Y A;  5D29 A;  5G1Z A;  3BI0 A;  4QBJ A;  2GAN A;  3D7F A;  2C6C A;  4QUS A;  1KZF A;  1R3N A;  3W91 A;  3B35 A;  1IOI A;  4CYP A;  4LQG A;  2CTB A;  1IGB A;  2WZN A;  4IHM A;  4CGP A;  2Q43 A;  1FNO A;  2PJ8 A;  1M4G A;  3D2P A;  4E8O A;  4YFJ A;  4HPS A;  2B4D B;  4CYO A;  3WAB A;  2WPX A;  3TO6 A;  2JBJ A;  2PIY A;  4NGN A;  1B6B A;  4CGL A;  4H89 A;  4AXV A;  2YNC A;  5G22 A;  4X2T A;  2GIV A;  1LAP A;  4OME A;  4ZX9 A;  4MHZ A;  3OWC A;  1B87 A;  1EE3 P;  2J8N A;  1HDQ A;  4KSI A;  1BPM A;  4MXU A;  5F09 A;  5K8O A;  2ZW5 A;  2HQY A;  2HUZ A;  5J1Q A;  1XOV A;  1M44 A;  2PVW A;  2ZEP A;  4XNH C;  2EK9 A;  3R9F A;  3QAH A;  3WC6 A;  4GXH A;  1S7F A;  4MJ8 A;  1NSA A;  5AGE A;  2CNT A;  4FD7 A;  2P6G A;  4AVB A;  4KOW A;  3TO9 A;  1RXT A;  3KHX A;  3RYO A;  2C6P A;  2ZEO A;  4ZY0 A;  2GLJ A;  4L89 A;  1Y9K A;  4EME A;  3KR4 A;  3PFE A;  2OU2 A;  1JQG A;  2WUU A;  3GUX A;  2VL1 A;  4U9Z A;  3R96 A;  4DYO A;  5IB0 A;  1IYL A;  4PPZ A;  1AUG A;  5EC4 A;  2I3C A;  3W6X A;  2NSM A;  4FD5 A;  5LYL A;  4P44 A;  1Q7L A;  4H6U A;  1SQH A;  4NGS A;  4RI1 A;  1TIQ A;  2PJA A;  4P4B A;  1YX0 A;  1NE9 A;  3BI1 A;  3VWE A;  2R7H A;  2FS5 A;  4FWU A;  4BD9 A;  1YR0 A;  4R3K A;  4F6A A;  1XRY A;  1MJ9 A;  4OC2 A;  2NMT A;  3UY5 A;  6CPA A;  5JH9 A;  1S7L A;  4MFK A;  4Y49 B;  2VEZ A;  2YNC C;  5AG5 A;  4AVA A;  1KUV A;  4HNW B;  4A94 A;  1XEB A;  1TF9 A;  3QNV A;  4Q7A A;  3IU1 A;  5K8P A;  3KKW A;  4KOT A;  2PRQ A;  4A38 A;  1TKF A;  2PJ4 A;  5H84 A;  4C7I A;  3R9G A;  2GU2 A;  2G3A A;  1I21 A;  1BO4 A;  4JZ0 A;  5AG7 A;  4EFD A;  1MK4 A;  4PXB A;  5HVG A;  2C27 A;  2P6E A;  4KOX A;  4OAD A;  4PV6 A;  4Z65 A;  4KVO E;  4CAV A;  4FD4 A;  1FT7 A;  3B3V A;  4R6T A;  2ZED A;  2IJZ A;  4JD6 A;  3G8W A;  1M1D A;  2BOA A;  5CPA A;  5IX3 A;  3B3W A;  2F8H A;  4KLW A;  4MBU A;  4CRZ B;  2H5M A;  3WT4 A;  2ANP A;  2AFX A;  2EWB A;  4RN7 A;  2ZEE A;  4X8I A;  4KOU A;  4FD6 A;  4QB9 A;  3BJ7 A;  4P4E A;  1U6M A;  8CPA A;  3F5B A;  2OOT A;  4MCP A;  1J4J A;  1CBX A;  1Y9W A;  3GLJ A;  4ZI6 A;  3B7I A;  1IYK A;  1VHS A;  1ZG7 A;  2AFS A;  5DWM A;  4CAX A;  2DXQ A;  4A95 A;  5E96 A;  3TX8 A;  3PP9 A;  1ZG8 A;  2P6F A;  3CDX A;  4M6I A;  1XIX A;  1RO5 A;  2VQY A;  2YGW A;  2PC1 A;  3FEE A;  4YGO A;  1OBR A;  1Y0Y A;  4C2Y A;  5A28 A;  1HDU A;  3F0A A;  3DLJ A;  2EBJ A;  2OB0 A;  3LAC A;  4NEX A;  5ISV A;  4ZX8 A;  1NMT A;  1Y7R A;  3A9L A;  4ZY2 A;  3SXN A;  3G3S A;  1ZLH A;  5D8N A;  3IIB A;  2G9D A;  3D68 A;  4PXD A;  3CPA A;  4KOV A;  4P4J A;  1OZP A;  4QC6 A;  2CIJ A;  5HVF A;  4FAI A;  3I9S A;  3ISZ A;  4UCN A;  4B10 A;  4CGM A;  4FUU A;  4P4D A;  2FVG A;  4I49 A;  3LWU A;  1H8L A;  1AMP A;  2PIZ A;  3JVN A;  2VZZ A;  1X12 A;  4R7M A;  5LYD A;  2WYR A;  4MCS A;  3FF3 A;  3RZA A;  1FY7 A;  1R43 A;  2DPT A;  2FL4 A;  4L8A A;  3VWD A;  1HEE A;  1QST A;  2EVN A;  2PE3 A;  4UEF A;  4O23 A;  1ARM A;  2ZW6 A;  3FED A;  4R9M A;  4HNX B;  4UCP A;  3EFA A;  2XEG A;  4W9Y A;  4KOY A;  2IMO A;  3EO4 A;  3PB9 X;  1VGY A;  2BL1 A;  1DTD A;  4X5K A;  1NSL A;  3LD2 A;  2P0W A;  4B5P A;  3ZJ0 A;  1CPS A;  4NJQ A;  5THW A;  4OAE A;  3TT2 A;  4XPD C;  1YME A;  1TKH A;  5GCN A;  2IQ6 A;  4UBR A;  2PJ0 A;  2J8M A;  2HV2 A;  4UFX A;  3DSB A;  4X3R A;  3TC8 A;  1F57 A;  3SI0 A;  3SXO A;  2PJB A;  1CG2 A;  4MRI A;  1XMT A;  5I4M A;  1CP6 A;  1IID A;  4JLY A;  1XJO A;  4UIA A;  5J8F A;  3LMS A;  3IGR A;  4XNH B;  5HVH A;  3D8P A;  5BWA B;  4WWV A;  4NGQ A;  3IWW A;  3D7H A;  4U9Y A;  4F9U A;  1IIC A;  4UEE A;  2AFM A;  3FYN A;  1L0C A;  1LRZ A;  2RB7 A;  2ZEN A;  1ELM P;  2I79 A;  1Z5R A;  2DPS A;  2PJ6 A;  3NFZ A;  3IWE A;  1VKC A;  2V8V A;  3H5Z A;  4HKF A;  3T9Y A;  4J3G A;  4JWP A;  4ZGY B;  7CPA A;  2B5G B;  2I00 A;  2ZEM A;  5HXD A;  1X10 A;  3CPX A;  3VAT A;  1Z8X A;  2PR1 A;  4KSA A;  5LRJ A;  2VI7 A;  1UWY A;  4B12 A;  3V7Z A;  4MMO A;  1QSN A;  2JEV A;  2PJ3 A;  4M3S A;  5FVJ A;  3GYA A;  1Z8T A;  3FEC A;  4FBE A;  3CZX A;  5LYF A;  4UWI A;  2BEI A;  1M4I A;  3RBU A;  4F0Y A;  3DNS A;  5F47 A;  2Z3P A;  4MCR A;  4CPA A;  5JGF A;  1F2P A;  2CNM A;  2Q44 A;  2ZOF A;  3FBU A;  2PR8 A;  5F49 A;  2ZEG A;  1LOK A;  2Z3M A;  3HLP A;  1GHE A;  4OC3 A;  4UWJ A;  4IK2 A;  4JXR A;  3D66 A;  4BIN A;  1CX8 A;  2JLM A;  3FXT A;  4UIB A;  2D4O A;  3MN8 A;  4P4F A;  4A30 A;  4B6Z A;  5IB9 A;  4OC1 A;  3TE4 A;  1ARL A;  2X7B A;  4R87 A;  2V77 A;  2PJ5 A;  3IU2 A;  3BHX A;  4LUA A;  4MI4 A;  1ZO0 A;  2G0B A;  4MFL A;  4CAW A;  5IV0 A;  4C2Z A;  3D4U A;  1QQ9 A;  3D2M A;  2HC9 A;  4IAV A;  4MHY A;  2GE3 A;  2PJC A;  4GM5 A;  5G21 A;  4JYW A;  5HMN A;  1I1D A;  3WC5 A;  4R57 A;  4ZYQ A;  4R3L A;  2FE7 A;  1XBU A;  3FVL A;  3PFO A;  1Y0R A;  1LAN A;  2V8H A;  1VHE A;  2JDC A;  2QJ8 A;  3BJ8 A;  3JUW A;  4CRY B;  1YK3 A;  1MJA A;  1JWQ A;  3N7Z A;  2V8G A;  2EO8 A;  4RUH A;  2V8D A;  2Y0M A;  1KWM A;  3BLN A;  3N5F A;  4MHD A;  3KL9 A;  1YGH A;  1F2O A;  2BUE A;  4KOS A;  2ODF A;  1YRE A;  1QSO A;  3IEH A;  2FXF A;  3I3G A;  3SI2 A;  3NE7 A;  1KUY A;  2Z0Z A;  2IL4 A;  2FIA A;  4ONU A;  3FNC A;  1R57 A;  3PB4 X;  2B58 A;  3IFE A;  4CAF A;  4KUB A;  3FH4 A;  3DR8 A;  2CXA A;  4IF5 A;  2BSW A;  2QEC A;  2YND A;  4NJR A;  4A31 A;  4UEZ A;  2PQ8 A;  4UFW A;  1XF8 A;  2RC4 A;  4KVM E;  1Y7E A;  1TKJ A;  4MY0 A;  2A4N A;  4TWE A;  2REF A;  4MHN A;  1M4D A;  2XEF A;  3PB7 X;  3JRU A;  2ZOG A;  2VBQ A;  2PVV A;  1BPN A;  2Q4Z A;  3PB8 X;  4A33 A;  5JQ4 A;  1Q2D A;  1Z8L A;  5JM6 A;  2Q7S A;  2ZW4 A;  2XEJ A;  3IC1 A;  4ZBG A;  3CT9 A;  4E2A A;  2ZEF A;  2REE A;  3K9U A;  3SJG A;  1M4L A;  5DWN A;  3PGP A;  4NGP A;  3S6G A;  2ARH A;  3L2N A;  4R8F A;  3GY9 A;  2OZH A;  1LFW A;  1TF8 A;  3SHP A;  4ZY1 A;  4DNC A;  3FB3 A;  5JPH A;  2PJ2 A;  2QML A;  4UF4 A;  3B3T A;  5EBV A;  5K8M A;  4OC5 A;  1YVK A;  1YLE A;  1ELL P;  1DE4 C;  2O53 A;  2PJ1 A;  4PK2 A;  2K5T A;  4UFV A;  2ZPA A;  4XPD B;  2FIW A;  4AB7 A;  1Z4R A;  2JEW A;  1Z2L A;  4CS0 B;  2QVP A;  3S9N A;  1N71 A;  4GS4 A;  4OID A;  4DUK A;  4E0A A;  5A27 A;  2BCO A;  2Z11 A;  5CNP A;  2R8V A;  3PEI A;  4OC0 A;  4PSW A;  4Q36 A;  3V38 A;  4G1P A;  2ZXV A;  2GRE A;  3FMC A;  3LOD A;  3PZJ A;  2PDO A;  4KUA A;  4ONW A;  2B4D A;  1ON0 A;  2Z3K A;  2C1C A;  1K4J A;  3H8E A;  3TCV A;  4PXC A;  2OR4 A;  4MFP A;  3CXP A;  3E0K A;  4PSX A;  3RO0 A;  4BBH A;  3RNZ A;  3NE8 A;  4PQA A;  1RTQ A;  4A39 A;  1LCP A;  2GFQ A;  1IB1 E;  4B14 A;  2O28 A;  3SJX A;  4BMH A;  2GLF A;  1Z4E A;  4NF1 A;  2Q4V A;  4CGN A;  1CP7 A;  2FT0 A;  2DF5 A;  2ZEH A;  3DGV A;  5LRK A;  1A2Z A;  4H6Z A;  3NA6 A;  3EXN A;  4P6Y A;  2B5G A;  4B5O A;  3BXM A;  2PJ7 A;  1VIX A;  3D67 A;  2AFZ A;  4MFQ A;  4MY3 A;  2R1I A;  4B5P B;  2D4P A;  3GKR A;  3K2K A;  4U5Y A;  4MCQ A;  4MFZ A;  3KGQ A;  3WR7 A;  1V0C A;  4MHP A;  4II9 A;  1ZG9 A;  2B3V A;  4K30 A;  1KUX A;  2O4H A;  3EY5 A;  3T8W A;  2JBK A;  3D7G A;  3IJ3 A;  3PRT A;  3I1U A;  2PJ9 A;  4OKO A;  4NSQ A;  4C68 A;  3NH8 A;  5LYI A;  4NCZ A;  4NFR A;  1LAM A;  3HUV A;  5H86 A;  3FX6 A;  3QB8 A;  2AJ6 A;  2Z10 A;  3MGD A;  3S9L A;  4F9V A;  1S7N A;  2EUI A;  4M6H A;  2F7V A;  2QYV A;  2AFW A;  3TOB A;  4OLL A;  1QSR A;  2PSW A;  4JJX A;  2C6G A;  4KVX A;  4P10 A;  4P45 A;  4AVC A;  2WPW A;  4F0X A;  3R1K A;  4B11 A;  3VH9 A;  1WWZ A;  2OZU A;  3R95 A;  3RAM A;  2DEA A;  4KOR A;  2KCW A;  2CTC A;  2VZY A;  4KLV A;  5G20 A;  5CBM A;  2YNE A;  1IY7 A;  4NXY A;  4PK3 A;  1S60 A;  3K9T A;  3MRU A;  5KTC A;  2NYQ A;  1YSJ A;  3W6S A;  3H4Q A;  4OIW A;  3TO7 A;  1S7K A;  3P2F A;  2XEI A;  3KQZ A;  1Q2C A;  1P0H A;  3GIU A;  3VAR A;  5F46 A;  3KAS A;  1MJB A;  1IU8 A;  3TTH A;  1AYE A;  1XFO A;  4WJB A;  4A32 A;  4AG7 A;  1PU9 A;  2ZEL A;  4K3N A;  4M85 A;  3KZW A;  4RS2 A;  4LX9 A;  2EK8 A;  4LQ6 A;  4MFJ A;  4CYN A;  4KS9 A;  3SI1 A;  2CF4 A;  1IOF A;  3B2Y A;  3EC4 A;  3FIX A;  3S6F A;  2J8R A;  2ZW7 A;  1VHO A;  4F8Z A;  3C26 A;  1BLL E;  4OP4 A;  1WK4 A;  3S6H A;  2R98 A;  2B4B A;  4C7H A;  2VXK A;  1Z8W A;  1YLO A;  2CY2 A;  2Q04 A;  2WSA A;  2ABZ A;  4NGM A;  1I12 A;  1PCA A;  3F8K A;  2QIR A;  4TNU A;  4AG9 A;  4CYQ A;  1YW6 A;  5KTD A;  4Y49 C;  5C82 A;  5AG6 A;  1P4N A;  1CM0 A;  1UFH A;  3DR6 A;  1TXR A;  5KTA A;  5F48 A;  4YRH A;  2AFO A;  5K8N A;  5EMI A;  3DDD A;  2AE6 A;  2J9A A;  3KHZ A;  4ORF A;  2JDD A;  5AG4 A;  2FSR A;  2CNS A;  4A2Z A;  4M6G A;  1Z9U A;  1YVO A;  1Q2Y A;  3B3S A;  1CPX A;  3ZZI A;  3NH5 A;  1PYT B;  1GYT A;  2PCU A;  3SJF A;  4QVT A;  4B13 A;  2B3U A;  2PRB A;  3KQX A;  3KR5 A;  4YU9 A;  4EVY A;  3TOA A;  4DJL A;  2FCK A;  3FRM A;  2POK A;  2OH1 A;  3TFY A;  4CAE A;  1S3Z A;  2Q0Y A;  3T90 A;  3SJE A;  2F5I A;  4P4I A;  4JXQ A;  4Q38 A;  1QMU A;  3WC7 A;  1BOB A;  1PUA A;  1BAV A;  1YW4 A;  5DS0 A;  5LRG A;  4H2K A; 
#chains in the Genus database with same CATH homology
 1S5K A;  3JTK A;  2G3T A;  4UCM A;  5HH1 A;  1CJW A;  4KSF A;  4CGO A;  1QSM A;  2Q7B A;  4IUS A;  2Z3N A;  2ATR A;  3CXQ A;  2Z3L A;  3R9E A;  3P2H A;  3IWG A;  4HNY B;  5I0C A;  3B8G A;  4KZT A;  3CXS A;  4UA3 A;  5J8C A;  3D3S A;  3S6K A;  3V8I A;  5C88 A;  1XE4 A;  2Z3O A;  4XPL A;  4XPK A;  2OZG A;  4C2X A;  2Q4Y A;  5G1Z A;  4QBJ A;  2GAN A;  4QUS A;  1KZF A;  3W91 A;  4CYP A;  4CGP A;  1M4G A;  3D2P A;  4E8O A;  4YFJ A;  2B4D B;  4CYO A;  2WPX A;  3TO6 A;  1B6B A;  4CGL A;  4H89 A;  2YNC A;  5G22 A;  2GIV A;  3OWC A;  1B87 A;  2J8N A;  2ZW5 A;  2HQY A;  2HUZ A;  1M44 A;  4XNH C;  3R9F A;  3QAH A;  1S7F A;  4MJ8 A;  5AGE A;  2CNT A;  4FD7 A;  2P6G A;  4AVB A;  4KOW A;  3TO9 A;  1RXT A;  3RYO A;  4L89 A;  1Y9K A;  2OU2 A;  2WUU A;  3R96 A;  4U9Z A;  5IB0 A;  1IYL A;  5EC4 A;  3W6X A;  4FD5 A;  4RI1 A;  4H6U A;  1SQH A;  1TIQ A;  1YX0 A;  1NE9 A;  3VWE A;  2R7H A;  2FS5 A;  1YR0 A;  4R3K A;  4F6A A;  1MJ9 A;  3UY5 A;  2NMT A;  1S7L A;  4MFK A;  4Y49 B;  2VEZ A;  2YNC C;  5AG5 A;  4AVA A;  1KUV A;  4HNW B;  1XEB A;  3IU1 A;  3KKW A;  4KOT A;  5H84 A;  4C7I A;  3R9G A;  5AG7 A;  2G3A A;  1I21 A;  1BO4 A;  1MK4 A;  2C27 A;  2P6E A;  4KOX A;  4OAD A;  4PV6 A;  4KVO E;  4CAV A;  4FD4 A;  4JD6 A;  3G8W A;  1M1D A;  5IX3 A;  4KLW A;  4MBU A;  4CRZ B;  2H5M A;  4KOU A;  4FD6 A;  4QB9 A;  3BJ7 A;  1U6M A;  3F5B A;  1J4J A;  1Y9W A;  1IYK A;  1VHS A;  5DWM A;  4CAX A;  2DXQ A;  4A95 A;  5E96 A;  3PP9 A;  2P6F A;  1XIX A;  1RO5 A;  2VQY A;  2YGW A;  2PC1 A;  4YGO A;  4C2Y A;  5A28 A;  3F0A A;  2OB0 A;  4NEX A;  5ISV A;  1NMT A;  1Y7R A;  3A9L A;  3SXN A;  3G3S A;  4KOV A;  4QC6 A;  1OZP A;  3I9S A;  4UCN A;  4B10 A;  4CGM A;  4I49 A;  3JVN A;  2VZZ A;  1FY7 A;  2DPT A;  2FL4 A;  3VWD A;  4L8A A;  1QST A;  2EVN A;  2ZW6 A;  4R9M A;  4HNX B;  4UCP A;  3EFA A;  4KOY A;  3EO4 A;  4X5K A;  2BL1 A;  1NSL A;  3LD2 A;  2P0W A;  4B5P A;  3ZJ0 A;  4OAE A;  3TT2 A;  4XPD C;  5GCN A;  4UBR A;  2J8M A;  2HV2 A;  4UFX A;  3DSB A;  3SXO A;  1XMT A;  1IID A;  4JLY A;  5J8F A;  3IGR A;  4XNH B;  3D8P A;  5BWA B;  4U9Y A;  1IIC A;  3FYN A;  1L0C A;  1LRZ A;  2I79 A;  2DPS A;  4HKF A;  3IWE A;  1VKC A;  3H5Z A;  3T9Y A;  4J3G A;  4JWP A;  4ZGY B;  2B5G B;  2I00 A;  2PR1 A;  4KSA A;  2VI7 A;  4B12 A;  1QSN A;  2JEV A;  4M3S A;  5FVJ A;  3GYA A;  4UWI A;  2BEI A;  1M4I A;  4F0Y A;  3DNS A;  5F47 A;  2Z3P A;  2CNM A;  2Q44 A;  3FBU A;  2PR8 A;  5F49 A;  2Z3M A;  1GHE A;  4UWJ A;  4JXR A;  2JLM A;  3FXT A;  4A30 A;  2D4O A;  3TE4 A;  2X7B A;  4R87 A;  3IU2 A;  4LUA A;  4MI4 A;  1ZO0 A;  2G0B A;  4MFL A;  4CAW A;  5IV0 A;  4C2Z A;  3D2M A;  5G21 A;  2GE3 A;  5HMN A;  1I1D A;  4R57 A;  4R3L A;  2FE7 A;  2JDC A;  3BJ8 A;  3JUW A;  4CRY B;  1YK3 A;  1MJA A;  3N7Z A;  2Y0M A;  4MHD A;  3BLN A;  1YGH A;  2BUE A;  4KOS A;  1YRE A;  1QSO A;  2FXF A;  3I3G A;  3NE7 A;  1KUY A;  2Z0Z A;  2IL4 A;  2FIA A;  4ONU A;  3FNC A;  1R57 A;  2B58 A;  4CAF A;  4KUB A;  3DR8 A;  4IF5 A;  2CXA A;  2BSW A;  2QEC A;  2YND A;  4A31 A;  2PQ8 A;  4UFW A;  1XF8 A;  2RC4 A;  4KVM E;  4MY0 A;  2A4N A;  2REF A;  1M4D A;  2VBQ A;  4A33 A;  5JQ4 A;  1Q2D A;  2ZW4 A;  4ZBG A;  4E2A A;  2REE A;  3K9U A;  5DWN A;  3PGP A;  3S6G A;  2ARH A;  3GY9 A;  2OZH A;  3SHP A;  4DNC A;  3FB3 A;  5JPH A;  2QML A;  5EBV A;  1YVK A;  1YLE A;  4PK2 A;  4XPD B;  2K5T A;  4UFV A;  2ZPA A;  4AB7 A;  2FIW A;  1Z4R A;  4CS0 B;  1N71 A;  4GS4 A;  4E0A A;  5A27 A;  2Z11 A;  5CNP A;  2R8V A;  4PSW A;  4Q36 A;  2ZXV A;  3LOD A;  3PZJ A;  4KUA A;  2PDO A;  2B4D A;  1ON0 A;  2Z3K A;  1K4J A;  3TCV A;  4MFP A;  3CXP A;  3E0K A;  4PSX A;  4BBH A;  4BMH A;  1IB1 E;  4B14 A;  2O28 A;  1Z4E A;  4NF1 A;  2Q4V A;  4CGN A;  2FT0 A;  4H6Z A;  3EXN A;  2B5G A;  4B5O A;  4B5P B;  4MY3 A;  4MFQ A;  2R1I A;  2D4P A;  3GKR A;  4U5Y A;  4MFZ A;  3WR7 A;  1V0C A;  4II9 A;  2B3V A;  4K30 A;  1KUX A;  3EY5 A;  4C68 A;  4NSQ A;  4NCZ A;  5H86 A;  3QB8 A;  2AJ6 A;  2Z10 A;  3MGD A;  1S7N A;  2EUI A;  3TOB A;  4OLL A;  1QSR A;  2PSW A;  4JJX A;  4F0X A;  4KVX A;  4AVC A;  2WPW A;  3R1K A;  4B11 A;  1WWZ A;  2OZU A;  3R95 A;  4KOR A;  2KCW A;  2VZY A;  4KLV A;  5G20 A;  2YNE A;  4NXY A;  4PK3 A;  1S60 A;  5KTC A;  3W6S A;  3H4Q A;  3TO7 A;  1S7K A;  3P2F A;  1Q2C A;  1P0H A;  5F46 A;  1MJB A;  3TTH A;  4A32 A;  4AG7 A;  1PU9 A;  4M85 A;  4RS2 A;  4LX9 A;  4MFJ A;  4CYN A;  4KS9 A;  3EC4 A;  3FIX A;  3S6F A;  2J8R A;  2ZW7 A;  3C26 A;  1WK4 A;  3S6H A;  2R98 A;  2B4B A;  4C7H A;  2VXK A;  2CY2 A;  2Q04 A;  2WSA A;  1I12 A;  3F8K A;  4AG9 A;  2QIR A;  4CYQ A;  5KTD A;  4Y49 C;  5C82 A;  5AG6 A;  1P4N A;  1CM0 A;  1UFH A;  3DR6 A;  5KTA A;  5F48 A;  4YRH A;  3DDD A;  2AE6 A;  4ORF A;  2JDD A;  5AG4 A;  2FSR A;  2CNS A;  4A2Z A;  1Z9U A;  1YVO A;  1Q2Y A;  3ZZI A;  4QVT A;  4B13 A;  2B3U A;  2PRB A;  4EVY A;  3TOA A;  2FCK A;  3FRM A;  2OH1 A;  3TFY A;  4CAE A;  1S3Z A;  2Q0Y A;  3T90 A;  2F5I A;  4JXQ A;  4Q38 A;  1BOB A;  1PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...