2KCWA

Solution structure of apo-form yjab from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
147
Chain Sequence
MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDPDVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLAYVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized acetyltransferase yjaB
publication title Solution structure of Apo-YjaB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 147
sequence length 147
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2kcwA00
4KZTA 1QSNA 1Q2YA 1WWZA 1ON0A 2K5TA 3F8KA 3WR7A 4II9A 3TE4A 3TOAA 4F0YA 4XNHC 4YRHA 2AE6A 3FIXA 2FL4A 2B5GA 4CAXA 1M4IA 1BO4A 3D8PA 3D2PA 2NMTA 5H84A 5H86A 2Z0ZA 2EVNA 2BUEA 1YLEA 4OAEA 3MGDA 4AVCA 4FD5A 4KUAA 4KVME 2OU2A 2OH1A 3P2FA 4E2AA 4Y49B 2F5IA 3G8WA 2CNSA 4QVTA 1M4DA 4I49A 1OZPA 2R7HA 1Z4RA 1P0HA 3TCVA 2QIRA 1MJBA 1UFHA 3VWEA 2Q7BA 4UBRA 4MJ8A 1LRZA 1KZFA 4E0AA 1Y9WA 4H6ZA 1WK4A 3P2HA 2B3UA 2P0WA 3ZZIA 2OB0A 3IWGA 4LUAA 4NF1A 3EFAA 2EUIA 4GS4A 2WPWA 4NXYA 2PC1A 3EO4A 1M44A 3R9GA 4XPDB 4B5OA 3SXNA 2AJ6A 2I79A 3TTHA 4QC6A 2D4OA 2KCWA 2G3AA 2R98A 1V0CA 3W6SA 3BJ7A 2ZXVA 2Q0YA 4IUSA 2ZW4A 1Z9UA 1Q2DA 1XMTA 4OADA 1U6MA 4PV6A 2D4PA 1YR0A 4R9MA 4KOYA 2DXQA 1J4JA 1IICA 3TT2A 2J8MA 3S6HA 4BMHA 1P4NA 2FXFA 4KOVA 1S5KA 1S7NA 4K30A 1S7KA 4FD7A 3FXTA 3ZJ0A 2VZZA 4XPKA 2VQYA 3K9UA 4EVYA 4PSXA 3G3SA 2OZHA 4NEXA 4RI1A 1Z4EA 5JPHA 1BOBA 3DSBA 4XNHB 2PR1A 2CNMA 2R8VA 2R1IA 5F49A 1VHSA 3R9EA 1FY7A 1YVOA 2Q04A 5IV0A 4JJXA 1S7FA 2HV2A 2O28A 4HNYB 2C27A 3W6XA 4IF5A 2B3VA 4Y49C 3T90A 2JDDA 4MBUA 5KTDA 4R3LA 4H89A 2FIWA 4NSQA 5KTAA 3V8IA 1R57A 2B5GB 1IB1E 3KKWA 2J8NA 2VEZA 1KUXA 3TOBA 2P6FA 3T9YA 4JLYA 4ZBGA 3N7ZA 4R87A 4KVXA 3DDDA 5CNPA 4B5PA 2CNTA 2FE7A 5DWNA 3D3SA 4AG9A 3BJ8A 2B4DA 2JLMA 4R57A 3CXQA 1M4GA 4CRZB 2Z11A 4U9YA 1CJWA 2ZW6A 5EC4A 3C26A 4JWPA 1KUVA 4KLVA 3DR8A 3R1KA 2RC4A 3F5BA 5HH1A 4U9ZA 5IX3A 4UWIA 3R96A 3OWCA 4KOXA 3D2MA 1PUAA 3RYOA 3R95A 2G0BA 1MJ9A 2P6GA 2FSRA 4JD6A 2ARHA 4B5PB 3TO7A 2ATRA 2Q4YA 4JXQA 1K4JA 4AVBA 2A4NA 1S3ZA 3LD2A 3EY5A 3GY9A 1B6BA 4L89A 5J8CA 5KTCA 3FBUA 5DWMA 3I9SA 4KOWA 3VWDA 2FIAA 3FRMA 4JXRA 4ONUA 4PK2A 4KUBA 4E8OA 5JQ4A 1QSOA 1TIQA 4H6UA 1QSMA 1GHEA 3FNCA 4M85A 2I00A 4XPLA 1S60A 4RS2A 2X7BA 3JVNA 3QAHA 4M3SA 3DR6A 1RO5A 2VZYA 4MY0A 1L0CA 1RXTA 3IGRA 4CRYB 4KORA 3GKRA 3TO6A 1I21A 1SQHA 3S6GA 2GANA 1XF8A 2FCKA 2Y0MA 2P6EA 3DNSA 4CAVA 4UWJA 3NE7A 2WPXA 3S6FA 1PU9A 4PK3A 3EC4A 4QBJA 1NMTA 1MK4A 3SHPA 1XE4A 1CM0A 4HNWB 2ZW7A 2REFA 2ZW5A 1YX0A 2BL1A 3PZJA 4UA3A 4QB9A 1YK3A 4AVAA 5F48A 2VXKA 1N71A 3UY5A 3QB8A 2PDOA 3PP9A 4KOUA 1XIXA 1B87A 2FS5A 1QSTA 2H5MA 3E0KA 2BEIA 5I0CA 5F46A 4X5KA 2OZUA 1NSLA 4CS0B 1YVKA 2Z10A 1NE9A 2FT0A 5ISVA 3JUWA 1I12A 4DNCA 2QMLA 2VBQA 2B4BA 1S7LA 2G3TA 2ZPAA 4KOSA 4NCZA 5IB0A 4FD6A 1IIDA 1M1DA 2PRBA 4MY3A 4QUSA 1Y7RA 1VKCA 2CY2A 2HQYA 5E96A 4XPDC 2B58A 1YGHA 5EBVA 3SXOA 4KOTA 1IYLA 2Q44A 1KUYA 4R3KA 4OLLA 4YFJA 3FYNA 2JDCA 4AB7A 3LODA 3GYAA 2JEVA 4KLWA 4KVOE 4AG7A 1XEBA 2QECA 3W91A 2REEA 3F0AA 1MJAA 5FVJA 3PGPA 3I3GA 4J3GA 2GIVA 2HUZA 2IL4A 2OZGA 1Y9KA 2J8RA 5C82A 2B4DB 5GCNA 1QSRA 3S6KA 1YREA 5J8FA 1IYKA 4FD4A 4ORFA 4MHDA 3TO9A 5C88A 5F47A 2PQ8A 3EXNA 3R9FA 4LX9A 4PSWA 4HKFA 3H4QA 4CAWA 2VI7A 4L8AA 4F6AA 5HMNA 3BLNA 1I1DA 2PR8A 4U5YA 3B8GA 3CXPA 3FB3A 2BSWA 4YGOA 2Q4VA 3TFYA 2PSWA 3CXSA 4MI4A 2GE3A 4HNXB 1Q2CA
chains in the Genus database with same CATH superfamily
1LOKA 4BBHA 4KZTA 1QSNA 1Q2YA 2CIJA 1WWZA 1ON0A 3SJFA 2K5TA 3F8KA 3WR7A 4II9A 2PJ1A 3WC7A 4Q36A 4CGPA 3TOAA 2RB7A 3PFEA 4UCMA 5AG5A 4F0YA 4XNHC 2CTCA 3QAYA 4YRHA 1PCAA 2AE6A 1CBXA 4B12A 3D7DA 3FIXA 2FL4A 2YNCA 2ANPA 2B5GA 4CAXA 1UWYA 4A94A 1M4IA 1BO4A 3D8PA 4B10A 5HVFA 3D2PA 3PBEA 2NMTA 5LRGA 5AG4A 2EK8A 5H84A 5H86A 2ZOGA 2Z0ZA 2EVNA 2OR4A 5J1QA 2BUEA 3RNZA 4KSIA 1Z5RA 2ZENA 2Q7SA 1YLEA 4OAEA 3MGDA 4NGTA 4AVCA 3QNVA 4FD5A 4F9VA 4KUAA 1IOIA 3VH9A 2DPTA 4KVME 4BD9A 1FNOA 4MHZA 4NGNA 4P44A 4FWUA 4C2YA 4OC3A 2OU2A 2OH1A 3P2FA 4E2AA 4Y49B 2F5IA 3KGQA 3G8WA 4B14A 3B3CA 2IJZA 2CNSA 4ZX8A 4OKOA 4QVTA 1M4DA 4P6YA 4I49A 3B3WA 1OZPA 3D7HA 2R7HA 2GLFA 4MMOA 1Z4RA 4MFPA 1P0HA 1R43A 3TCVA 2QIRA 4GXHA 3S9MA 1MJBA 3K9TA 4OC5A 1UFHA 3LMSA 3VARA 5K8PA 4NGPA 4X3RA 3VWEA 4OC0A 1ZG7A 2Q7BA 2PIYA 3KR4A 4JZ0A 4UBRA 4MJ8A 1LRZA 2DEAA 1KZFA 4E0AA 1Y9WA 4H6ZA 5JGFA 4PXDA 1WK4A 3P2HA 2B3UA 3IWWA 2P0WA 2AFOA 1R3NA 4A32A 3ZZIA 3PFOA 2OB0A 2DF5A 3IWGA 1CP6A 3PEIA 2ODFA 5LYIA 3HUVA 1XOVA 4ZGYB 4IHMA 4LUAA 4NF1A 3EFAA 2EUIA 4NJQA 2AFUA 4GS4A 2WPWA 4KSAA 4NXYA 2PC1A 3EO4A 1M44A 3T8WA 3R9GA 3CPXA 4PPZA 4XPDB 2PJ9A 3PBBA 5G1ZA 3SXNA 2AJ6A 3D68A 4B5OA 1HEEA 3GUXA 4A31A 2BOAA 2I79A 4G1PA 4M6HA 1F2PA 4R7MA 3IIBA 1Q7LA 1H8LA 1VGYA 3TTHA 1VIXA 3A9LA 3SJXA 3LACA 5D29A 2V8VA 4QC6A 5IB9A 3B3TA 2D4OA 2JEWA 2KCWA 2G3AA 4P45A 2R98A 1OBRA 2WSAA 4B6ZA 4Z65A 2PJ0A 4OC4A 3D4UA 1V0CA 4MFQA 3W6SA 3BJ7A 2ZXVA 3WC5A 5K8MA 4ZX9A 2F8HA 1FT7A 2Q0YA 4IUSA 4OC2A 3WC6A 4C2XA 2ZW4A 3D67A 3IO1A 4UFWA 4UFVA 4PXEA 1Z9UA 7CPAA 3KQZA 1Q2DA 4DUKA 1XMTA 2XEFA 3KHXA 4MCRA 4OADA 4OIDA 1U6MA 1LAPA 2G9DA 4PV6A 2D4PA 2Q51A 3IEHA 3NH5A 2PVWA 1XMBA 4P4JA 1ELMP 1YR0A 4LQGA 4Q7AA 4R9MA 3SJEA 2WYRA 4MFLA 3SI1A 4KOYA 2DXQA 1J4JA 3NFZA 1IICA 3TT2A 3FF3A 4P10A 5CPAA 2J8MA 3N5FA 2PVVA 1LANA 2F7VA 3KASA 3S6HA 4PXCA 4ZY2A 4BMHA 2PJ6A 1P4NA 4TNUA 2FXFA 4AB7A 2CXAA 2ZEFA 4GM5A 4KOVA 4A38A 2PJ4A 1VHOA 2PIZA 3RAMA 3ISZA 1S5KA 1S7NA 2V77A 2V8HA 1BAVA 2XEGA 4K30A 1S7KA 2JBKA 4KS9A 4FD7A 4MCSA 4A30A 3FXTA 3ZJ0A 4OMEA 2VZZA 3MRUA 4XPKA 1ARLA 1IGBA 2VQYA 3K9UA 4CYPA 4PSXA 4EVYA 5BWAB 4M6GA 3G3SA 5D8NA 1LAMA 3BI0A 4CGOA 2OZHA 4NFRA 4NEXA 4RI1A 1Z4EA 4CYQA 5JPHA 3NE8A 1BOBA 1ZG9A 3DSBA 4XNHB 5F09A 4EMEA 2PR1A 2CNMA 2PJ7A 2R8VA 4A33A 2I3CA 4HPSA 2R1IA 3JRUA 2PRQA 3TE4A 4A37A 5F49A 4UCPA 2NSMA 5AG7A 4ZY0A 1VHSA 3R9EA 4UIAA 1FY7A 1YVOA 2Q04A 5IV0A 3D7GA 4JJXA 2ZEHA 1XRYA 4OP4A 3GIUA 1S7FA 5DS0A 2HV2A 1BPNA 2O28A 4HNYB 2C27A 4Q38A 1Y7EA 3W6XA 4DYOA 4IF5A 2B3VA 4Y49C 1IOFA 3T90A 4WJBA 5G20A 1ZLHA 3RO0A 2JDDA 4MBUA 2GLJA 5KTDA 4R3LA 4P4EA 3FVLA 3K2KA 4H89A 2FIWA 4NGMA 4NSQA 5KTAA 1TXRA 1QQ9A 3V8IA 1R57A 2B5GB 5LYDA 1IB1E 3KKWA 1XFOA 2WUUA 3V38A 2J8NA 2VEZA 5ELYA 1KUXA 4ZYQA 3TOBA 8CPAA 2P6FA 3T9YA 4JLYA 5A28A 4C68A 2AFWA 3I1UA 3PB6X 4ZBGA 3N7ZA 4R87A 2ZEDA 4KVXA 4C7IA 3DDDA 3RBUA 5CNPA 4B5PA 4NJRA 2IQ6A 3IC1A 5AGEA 2CNTA 1Z8LA 2EO8A 6CPAA 2FE7A 3D66A 5LRJA 5DWNA 3D3SA 2HB6A 3KL9A 3KZWA 4AG9A 3BJ8A 2B4DA 2PJ5A 2JLMA 2BCOA 2BO9A 4R57A 3CXQA 3LWUA 4KSFA 4R8FA 4A95A 1KWMA 4ZY1A 1M4GA 4P4BA 4CPAA 3WT4A 3CZXA 5A27A 4CRZB 2Z11A 2EWBA 1CJWA 2IMOA 2ZW6A 2YNEA 4U9YA 4F8ZA 5EC4A 3C26A 4JWPA 4W9YA 1KUVA 5K8NA 1AMPA 4KLVA 3BI1A 2YGWA 1XJOA 3DR8A 1YSJA 1F2OA 3R1KA 2RC4A 2CTBA 3F5BA 3KQXA 5HH1A 4C7HA 1ELLP 4U9ZA 5IX3A 4UWIA 3R96A 4X2TA 3OWCA 4KOXA 3D2MA 4UEFA 1YMEA 1IY7A 3B3SA 4MXUA 1PUAA 3RYOA 1LFWA 3R95A 2G0BA 1MJ9A 1YW6A 1ZG8A 2POKA 2P6GA 2FSRA 4JD6A 2ARHA 1VHEA 4B5PB 2PJBA 3TO7A 5LYFA 2YNDA 2ATRA 2Q4YA 2Z3LA 4JXQA 2ZEPA 1K4JA 4O23A 2GREA 4AVBA 4WWVA 2A4NA 1S3ZA 2DPSA 3HLPA 3LD2A 3EY5A 3GY9A 4C2ZA 1B6BA 4L89A 2Z3MA 5G22A 2AFXA 5HVHA 4RUHA 5J8CA 5KTCA 3FBUA 4FAIA 2ZEOA 4R6TA 2C6CA 3TC8A 5DWMA 3PB7X 3WABA 3I9SA 4KOWA 3VWDA 2FIAA 3FRMA 4JXRA 2ZEEA 4ONUA 5G21A 4PK2A 4R76A 4EWTA 2PJ3A 4KUBA 3PRTA 4E8OA 5JQ4A 3VATA 1QSOA 1BPMA 1TIQA 3SI2A 4H6UA 2ZEMA 3FECA 1QSMA 1GHEA 2Q4ZA 3FNCA 4K3NA 1CP7A 2EBJA 2V8GA 4M85A 3KHZA 2I00A 4XPLA 3TX8A 2CF4A 1S60A 4RS2A 2X7BA 3JVNA 3QAHA 4M3SA 3DR6A 1RO5A 1Z2LA 3H8EA 2VZYA 4MY0A 3JTKA 4A39A 5LYLA 1L0CA 1RXTA 3H5ZA 3IGRA 3IU2A 4CRYB 3PB4X 4KORA 3GKRA 3TO6A 1CPXA 1I21A 1SQHA 1TKJA 3S6GA 3S9LA 2GANA 1XF8A 2FCKA 2Y0MA 2P6EA 1ARMA 4B11A 1F57A 3DNSA 4H2KA 1HDQA 4CAVA 3NH4A 5I4MA 1YLOA 4CYOA 4MCQA 4UWJA 2C1CA 3NE7A 2WPXA 4DJLA 4CYNA 3S6FA 2XEIA 4PQAA 1YW4A 1PU9A 4PK3A 3EC4A 4QBJA 1NMTA 4NGRA 4OIWA 1MK4A 3SHPA 1XE4A 2Z3KA 1CM0A 4A2ZA 4HNWB 2ZW7A 2REFA 2ZW5A 2EK9A 3FEDA 1YX0A 4ONWA 2BL1A 4ZI6A 1TF9A 2AFZA 3PZJA 3SJGA 1XBUA 1RTQA 1ZLIA 4CAFA 1DE4C 4UA3A 4QB9A 1YK3A 1A2ZA 3L2NA 4MHYA 4AVAA 5LRKA 4YU9A 5F48A 2VXKA 1N71A 2V8DA 4P4DA 2QYVA 3UY5A 3CT9A 2PDOA 3QB8A 3PP9A 3S9NA 4KOUA 1M4LA 5CBMA 1XIXA 3FJUA 5HVGA 1B87A 3IJ3A 2FS5A 1CPSA 1QSTA 2H5MA 3E0KA 3IWEA 5K8OA 1AYEA 2BEIA 2VL1A 4IAVA 5I0CA 5F46A 2ZEGA 4X5KA 1DTDA 4M6IA 2OZUA 3CDXA 4MRIA 1NSLA 1YVKA 4CS0B 2Z10A 1BLLE 4MFZA 1TKHA 3RZAA 5HXDA 4NGSA 2YNCC 1CG2A 2QVPA 4F0XA 1IU8A 1YQEA 2C6GA 1NE9A 2PJ2A 2FT0A 2JBJA 5ISVA 3H8GA 3JUWA 1Y0YA 1I12A 2ZOFA 4DNCA 2QMLA 2VBQA 3BHXA 3NH8A 2B4BA 1S7LA 2G3TA 2QJ8A 2ZPAA 3GB0A 4CGNA 4KOSA 4MHPA 4NCZA 4UEZA 5IB0A 2Z3PA 4FD6A 1IIDA 1M1DA 3B3VA 2PRBA 3GLJA 2PJ8A 4MY3A 1JQGA 2PJCA 4NGQA 4QUSA 4YWYA 2J9AA 4RN7A 4PXBA 1Y7RA 1VKCA 2CY2A 3BXMA 2HQYA 4UIBA 4XPDC 1AUGA 1QMUA 5E96A 5EMIA 2B58A 1YGHA 5EBVA 1TF8A 1X12A 4KOTA 4MFJA 3B35A 3SXOA 1IYLA 2FVGA 1KUYA 2Q44A 3V7ZA 4FBEA 1TKFA 4R3KA 1ZO0A 4OLLA 4JYWA 2GU2A 2PJAA 3FYNA 4YFJA 3SI0A 2JDCA 3IFEA 4MHNA 2PCUA 3CPAA 3LODA 3GYAA 1PYTB 2O4HA 2JEVA 3FMCA 4KLWA 2Q43A 4KVOE 4UCNA 4AG7A 1Z8XA 3B7IA 1XEBA 2QECA 4UF4A 3W91A 2REEA 3F0AA 3FEEA 3H8FA 4MCPA 1MJAA 5THWA 1EE3P 4EFDA 1CX8A 5FVJA 3NA6A 3FH4A 3FX6A 3PGPA 3MN8A 3I3GA 4MFKA 2Z3OA 4J3GA 2PE3A 2AFMA 2Z3NA 2ZELA 2HUZA 2GIVA 1X10A 1Z8TA 2ABZA 2IL4A 2OZGA 4LQ6A 5JH9A 1Y9KA 4CAEA 2J8RA 1NSAA 5C82A 2B4DB 4UFXA 4X8IA 5GCNA 4BINA 2NYQA 1QSRA 3ISXA 3S6KA 5AG6A 1LCPA 1YREA 3KI9A 4CGLA 3IU1A 1JWQA 5J8FA 4TWEA 2WZNA 1IYKA 4FD4A 3PB8X 4MHDA 4ORFA 4IK2A 3TO9A 4AXVA 5C88A 4OC1A 5JM6A 5F47A 4P4FA 2PQ8A 3EXNA 3R9FA 4LX9A 2HC9A 4PSWA 4HKFA 1HDUA 3H4QA 4CAWA 2VI7A 4L8AA 1Y0RA 1GYTA 3B2YA 3PB9X 4F6AA 5HMNA 3BLNA 2OOTA 1I1DA 2PR8A 4U5YA 3B8GA 3CXPA 2RFHA 2AFSA 3KR5A 3FB3A 2XEJA 1Z8WA 3D7FA 4FUUA 2BSWA 4F9UA 4YGOA 2Q4VA 3TFYA 2C6PA 2PSWA 3DLJA 4CGMA 2GFQA 3CXSA 4P4IA 4UEEA 4MI4A 2GE3A 4HNXB 2O53A 1Q2CA 4B13A 3DGVA
chains in the Genus database with same CATH topology
4BBHA 4KZTA 1QSNA 1Q2YA 1WWZA 1ON0A 2K5TA 3F8KA 3WR7A 4II9A 4Q36A 4CGPA 3TOAA 3TE4A 4UCMA 5AG5A 4F0YA 4XNHC 4YRHA 2AE6A 4B12A 3FIXA 2FL4A 2YNCA 2B5GA 4CAXA 1M4IA 1BO4A 3D8PA 4B10A 3D2PA 5AG4A 2NMTA 5H84A 5H86A 2Z0ZA 2EVNA 2BUEA 1YLEA 4OAEA 3MGDA 4AVCA 4FD5A 4KUAA 2DPTA 4KVME 4C2YA 2OU2A 2OH1A 3P2FA 4E2AA 4Y49B 2F5IA 3G8WA 4B14A 2CNSA 4QVTA 1M4DA 4I49A 1OZPA 2R7HA 1Z4RA 4MFPA 1P0HA 3TCVA 2QIRA 1MJBA 1UFHA 3VWEA 2Q7BA 4UBRA 4MJ8A 1LRZA 1KZFA 4E0AA 1Y9WA 4H6ZA 1WK4A 3P2HA 2B3UA 2P0WA 4A32A 3ZZIA 2OB0A 3IWGA 4ZGYB 4LUAA 4NF1A 3EFAA 2EUIA 4GS4A 2WPWA 4KSAA 4NXYA 2PC1A 3EO4A 1M44A 3R9GA 4XPDB 4B5OA 5G1ZA 3SXNA 2AJ6A 4A31A 2I79A 3TTHA 3A9LA 4QC6A 2D4OA 2KCWA 2G3AA 2R98A 2WSAA 4MFQA 1V0CA 3W6SA 3BJ7A 2ZXVA 2Q0YA 4IUSA 4C2XA 2ZW4A 4UFWA 4UFVA 1Z9UA 1Q2DA 1XMTA 4OADA 1U6MA 4PV6A 2D4PA 1YR0A 4R9MA 4MFLA 4KOYA 2DXQA 1J4JA 1IICA 3TT2A 2J8MA 3S6HA 4BMHA 1P4NA 2FXFA 2CXAA 4KOVA 1S5KA 1S7NA 4K30A 1S7KA 4KS9A 4A30A 4FD7A 3FXTA 3ZJ0A 2VZZA 4XPKA 4CYPA 2VQYA 3K9UA 4EVYA 4PSXA 5BWAB 3G3SA 4CGOA 2OZHA 4NEXA 4RI1A 1Z4EA 4CYQA 5JPHA 1BOBA 3DSBA 4XNHB 2PR1A 2CNMA 2R8VA 4A33A 2R1IA 5F49A 4UCPA 5AG7A 1VHSA 3R9EA 1FY7A 1YVOA 2Q04A 5IV0A 4JJXA 1S7FA 2HV2A 2O28A 4HNYB 2C27A 4Q38A 3W6XA 4IF5A 2B3VA 4Y49C 3T90A 5G20A 2JDDA 4MBUA 5KTDA 4R3LA 4H89A 2FIWA 4NSQA 5KTAA 3V8IA 1R57A 2B5GB 1IB1E 3KKWA 2WUUA 2J8NA 2VEZA 1KUXA 3TOBA 2P6FA 3T9YA 4JLYA 5A28A 4C68A 4ZBGA 3N7ZA 4R87A 4KVXA 4C7IA 3DDDA 5CNPA 4B5PA 5AGEA 2CNTA 2FE7A 5DWNA 3D3SA 4AG9A 3BJ8A 2B4DA 2JLMA 4R57A 3CXQA 4KSFA 4A95A 1M4GA 5A27A 4CRZB 2Z11A 4U9YA 1CJWA 2ZW6A 2YNEA 5EC4A 3C26A 4JWPA 1KUVA 4KLVA 2YGWA 3DR8A 3R1KA 2RC4A 3F5BA 5HH1A 4C7HA 4U9ZA 5IX3A 4UWIA 3R96A 3OWCA 4KOXA 3D2MA 1PUAA 3RYOA 3R95A 2G0BA 1MJ9A 2P6GA 2FSRA 4JD6A 2ARHA 4B5PB 3TO7A 2YNDA 2ATRA 2Q4YA 2Z3LA 4JXQA 1K4JA 4AVBA 2A4NA 1S3ZA 2DPSA 3LD2A 3EY5A 3GY9A 4C2ZA 1B6BA 4L89A 2Z3MA 5G22A 5J8CA 5KTCA 3FBUA 5DWMA 3I9SA 4KOWA 3VWDA 2FIAA 3FRMA 4JXRA 4ONUA 5G21A 4PK2A 4KUBA 4E8OA 5JQ4A 1QSOA 1TIQA 4H6UA 1QSMA 1GHEA 3FNCA 4M85A 2I00A 4XPLA 1S60A 4RS2A 2X7BA 3JVNA 3QAHA 4M3SA 3DR6A 1RO5A 2VZYA 4MY0A 3JTKA 1L0CA 1RXTA 3H5ZA 3IGRA 3IU2A 4CRYB 4KORA 3GKRA 3TO6A 1I21A 1SQHA 3S6GA 2GANA 1XF8A 2FCKA 2Y0MA 2P6EA 4B11A 3DNSA 4CAVA 4CYOA 4UWJA 3NE7A 2WPXA 4CYNA 3S6FA 1PU9A 4PK3A 3EC4A 4QBJA 1NMTA 1MK4A 3SHPA 1XE4A 2Z3KA 1CM0A 4A2ZA 4HNWB 2ZW7A 2REFA 2ZW5A 1YX0A 2BL1A 3PZJA 4CAFA 4UA3A 4QB9A 1YK3A 4AVAA 5F48A 2VXKA 1N71A 3UY5A 3QB8A 2PDOA 3PP9A 4KOUA 1XIXA 1B87A 2FS5A 1QSTA 2H5MA 3E0KA 3IWEA 2BEIA 5I0CA 5F46A 4X5KA 2OZUA 1NSLA 4CS0B 1YVKA 2Z10A 4MFZA 2YNCC 4F0XA 1NE9A 2FT0A 5ISVA 3JUWA 1I12A 4DNCA 2QMLA 2VBQA 2B4BA 1S7LA 2G3TA 2ZPAA 4CGNA 4KOSA 4NCZA 5IB0A 2Z3PA 4FD6A 1IIDA 1M1DA 2PRBA 4MY3A 4QUSA 1Y7RA 1VKCA 2CY2A 2HQYA 5E96A 4XPDC 2B58A 1YGHA 5EBVA 3SXOA 4MFJA 4KOTA 1IYLA 2Q44A 1KUYA 4R3KA 1ZO0A 4OLLA 4YFJA 3FYNA 2JDCA 4AB7A 3LODA 3GYAA 2JEVA 4KLWA 4KVOE 4UCNA 4AG7A 1XEBA 2QECA 3W91A 2REEA 3F0AA 1MJAA 5FVJA 3PGPA 3I3GA 4MFKA 2Z3OA 4J3GA 2Z3NA 2GIVA 2HUZA 2IL4A 2OZGA 1Y9KA 4CAEA 2J8RA 5C82A 2B4DB 4UFXA 5GCNA 1QSRA 3S6KA 5AG6A 1YREA 4CGLA 3IU1A 5J8FA 1IYKA 4FD4A 4ORFA 4MHDA 3TO9A 5C88A 5F47A 2PQ8A 3EXNA 3R9FA 4LX9A 4PSWA 4HKFA 3H4QA 4CAWA 2VI7A 4L8AA 4F6AA 5HMNA 3BLNA 1I1DA 2PR8A 4U5YA 3B8GA 3CXPA 3FB3A 2BSWA 4YGOA 2Q4VA 3TFYA 2PSWA 4CGMA 3CXSA 4MI4A 2GE3A 4HNXB 1Q2CA 4B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZT A;  1QSN A;  1Q2Y A;  1WWZ A;  1ON0 A;  2K5T A;  3F8K A;  3WR7 A;  4II9 A;  3TE4 A;  3TOA A;  4F0Y A;  4XNH C;  4YRH A;  2AE6 A;  3FIX A;  2FL4 A;  2B5G A;  4CAX A;  1M4I A;  1BO4 A;  3D8P A;  3D2P A;  2NMT A;  5H84 A;  5H86 A;  2Z0Z A;  2EVN A;  2BUE A;  1YLE A;  4OAE A;  3MGD A;  4AVC A;  4FD5 A;  4KUA A;  4KVM E;  2OU2 A;  2OH1 A;  3P2F A;  4E2A A;  4Y49 B;  2F5I A;  3G8W A;  2CNS A;  4QVT A;  1M4D A;  4I49 A;  1OZP A;  2R7H A;  1Z4R A;  1P0H A;  3TCV A;  2QIR A;  1MJB A;  1UFH A;  3VWE A;  2Q7B A;  4UBR A;  4MJ8 A;  1LRZ A;  1KZF A;  4E0A A;  1Y9W A;  4H6Z A;  1WK4 A;  3P2H A;  2B3U A;  2P0W A;  3ZZI A;  2OB0 A;  3IWG A;  4LUA A;  4NF1 A;  3EFA A;  2EUI A;  4GS4 A;  2WPW A;  4NXY A;  2PC1 A;  3EO4 A;  1M44 A;  3R9G A;  4XPD B;  4B5O A;  3SXN A;  2AJ6 A;  2I79 A;  3TTH A;  4QC6 A;  2D4O A;  2KCW A;  2G3A A;  2R98 A;  1V0C A;  3W6S A;  3BJ7 A;  2ZXV A;  2Q0Y A;  4IUS A;  2ZW4 A;  1Z9U A;  1Q2D A;  1XMT A;  4OAD A;  1U6M A;  4PV6 A;  2D4P A;  1YR0 A;  4R9M A;  4KOY A;  2DXQ A;  1J4J A;  1IIC A;  3TT2 A;  2J8M A;  3S6H A;  4BMH A;  1P4N A;  2FXF A;  4KOV A;  1S5K A;  1S7N A;  4K30 A;  1S7K A;  4FD7 A;  3FXT A;  3ZJ0 A;  2VZZ A;  4XPK A;  2VQY A;  3K9U A;  4EVY A;  4PSX A;  3G3S A;  2OZH A;  4NEX A;  4RI1 A;  1Z4E A;  5JPH A;  1BOB A;  3DSB A;  4XNH B;  2PR1 A;  2CNM A;  2R8V A;  2R1I A;  5F49 A;  1VHS A;  3R9E A;  1FY7 A;  1YVO A;  2Q04 A;  5IV0 A;  4JJX A;  1S7F A;  2HV2 A;  2O28 A;  4HNY B;  2C27 A;  3W6X A;  4IF5 A;  2B3V A;  4Y49 C;  3T90 A;  2JDD A;  4MBU A;  5KTD A;  4R3L A;  4H89 A;  2FIW A;  4NSQ A;  5KTA A;  3V8I A;  1R57 A;  2B5G B;  1IB1 E;  3KKW A;  2J8N A;  2VEZ A;  1KUX A;  3TOB A;  2P6F A;  3T9Y A;  4JLY A;  4ZBG A;  3N7Z A;  4R87 A;  4KVX A;  3DDD A;  5CNP A;  4B5P A;  2CNT A;  2FE7 A;  5DWN A;  3D3S A;  4AG9 A;  3BJ8 A;  2B4D A;  2JLM A;  4R57 A;  3CXQ A;  1M4G A;  4CRZ B;  2Z11 A;  4U9Y A;  1CJW A;  2ZW6 A;  5EC4 A;  3C26 A;  4JWP A;  1KUV A;  4KLV A;  3DR8 A;  3R1K A;  2RC4 A;  3F5B A;  5HH1 A;  4U9Z A;  5IX3 A;  4UWI A;  3R96 A;  3OWC A;  4KOX A;  3D2M A;  1PUA A;  3RYO A;  3R95 A;  2G0B A;  1MJ9 A;  2P6G A;  2FSR A;  4JD6 A;  2ARH A;  4B5P B;  3TO7 A;  2ATR A;  2Q4Y A;  4JXQ A;  1K4J A;  4AVB A;  2A4N A;  1S3Z A;  3LD2 A;  3EY5 A;  3GY9 A;  1B6B A;  4L89 A;  5J8C A;  5KTC A;  3FBU A;  5DWM A;  3I9S A;  4KOW A;  3VWD A;  2FIA A;  3FRM A;  4JXR A;  4ONU A;  4PK2 A;  4KUB A;  4E8O A;  5JQ4 A;  1QSO A;  1TIQ A;  4H6U A;  1QSM A;  1GHE A;  3FNC A;  4M85 A;  2I00 A;  4XPL A;  1S60 A;  4RS2 A;  2X7B A;  3JVN A;  3QAH A;  4M3S A;  3DR6 A;  1RO5 A;  2VZY A;  4MY0 A;  1L0C A;  1RXT A;  3IGR A;  4CRY B;  4KOR A;  3GKR A;  3TO6 A;  1I21 A;  1SQH A;  3S6G A;  2GAN A;  1XF8 A;  2FCK A;  2Y0M A;  2P6E A;  3DNS A;  4CAV A;  4UWJ A;  3NE7 A;  2WPX A;  3S6F A;  1PU9 A;  4PK3 A;  3EC4 A;  4QBJ A;  1NMT A;  1MK4 A;  3SHP A;  1XE4 A;  1CM0 A;  4HNW B;  2ZW7 A;  2REF A;  2ZW5 A;  1YX0 A;  2BL1 A;  3PZJ A;  4UA3 A;  4QB9 A;  1YK3 A;  4AVA A;  5F48 A;  2VXK A;  1N71 A;  3UY5 A;  3QB8 A;  2PDO A;  3PP9 A;  4KOU A;  1XIX A;  1B87 A;  2FS5 A;  1QST A;  2H5M A;  3E0K A;  2BEI A;  5I0C A;  5F46 A;  4X5K A;  2OZU A;  1NSL A;  4CS0 B;  1YVK A;  2Z10 A;  1NE9 A;  2FT0 A;  5ISV A;  3JUW A;  1I12 A;  4DNC A;  2QML A;  2VBQ A;  2B4B A;  1S7L A;  2G3T A;  2ZPA A;  4KOS A;  4NCZ A;  5IB0 A;  4FD6 A;  1IID A;  1M1D A;  2PRB A;  4MY3 A;  4QUS A;  1Y7R A;  1VKC A;  2CY2 A;  2HQY A;  5E96 A;  4XPD C;  2B58 A;  1YGH A;  5EBV A;  3SXO A;  4KOT A;  1IYL A;  2Q44 A;  1KUY A;  4R3K A;  4OLL A;  4YFJ A;  3FYN A;  2JDC A;  4AB7 A;  3LOD A;  3GYA A;  2JEV A;  4KLW A;  4KVO E;  4AG7 A;  1XEB A;  2QEC A;  3W91 A;  2REE A;  3F0A A;  1MJA A;  5FVJ A;  3PGP A;  3I3G A;  4J3G A;  2GIV A;  2HUZ A;  2IL4 A;  2OZG A;  1Y9K A;  2J8R A;  5C82 A;  2B4D B;  5GCN A;  1QSR A;  3S6K A;  1YRE A;  5J8F A;  1IYK A;  4FD4 A;  4ORF A;  4MHD A;  3TO9 A;  5C88 A;  5F47 A;  2PQ8 A;  3EXN A;  3R9F A;  4LX9 A;  4PSW A;  4HKF A;  3H4Q A;  4CAW A;  2VI7 A;  4L8A A;  4F6A A;  5HMN A;  3BLN A;  1I1D A;  2PR8 A;  4U5Y A;  3B8G A;  3CXP A;  3FB3 A;  2BSW A;  4YGO A;  2Q4V A;  3TFY A;  2PSW A;  3CXS A;  4MI4 A;  2GE3 A;  4HNX B;  1Q2C A; 
#chains in the Genus database with same CATH topology
 1LOK A;  4BBH A;  4KZT A;  1QSN A;  1Q2Y A;  2CIJ A;  1WWZ A;  1ON0 A;  3SJF A;  2K5T A;  3F8K A;  3WR7 A;  4II9 A;  2PJ1 A;  3WC7 A;  4Q36 A;  4CGP A;  3TOA A;  2RB7 A;  3PFE A;  4UCM A;  5AG5 A;  4F0Y A;  4XNH C;  2CTC A;  3QAY A;  4YRH A;  1PCA A;  2AE6 A;  1CBX A;  4B12 A;  3D7D A;  3FIX A;  2FL4 A;  2YNC A;  2ANP A;  2B5G A;  4CAX A;  1UWY A;  4A94 A;  1M4I A;  1BO4 A;  3D8P A;  4B10 A;  5HVF A;  3D2P A;  3PBE A;  2NMT A;  5LRG A;  5AG4 A;  2EK8 A;  5H84 A;  5H86 A;  2ZOG A;  2Z0Z A;  2EVN A;  2OR4 A;  5J1Q A;  2BUE A;  3RNZ A;  4KSI A;  1Z5R A;  2ZEN A;  2Q7S A;  1YLE A;  4OAE A;  3MGD A;  4NGT A;  4AVC A;  3QNV A;  4FD5 A;  4F9V A;  4KUA A;  1IOI A;  3VH9 A;  2DPT A;  4KVM E;  4BD9 A;  1FNO A;  4MHZ A;  4NGN A;  4P44 A;  4FWU A;  4C2Y A;  4OC3 A;  2OU2 A;  2OH1 A;  3P2F A;  4E2A A;  4Y49 B;  2F5I A;  3KGQ A;  3G8W A;  4B14 A;  3B3C A;  2IJZ A;  2CNS A;  4ZX8 A;  4OKO A;  4QVT A;  1M4D A;  4P6Y A;  4I49 A;  3B3W A;  1OZP A;  3D7H A;  2R7H A;  2GLF A;  4MMO A;  1Z4R A;  4MFP A;  1P0H A;  1R43 A;  3TCV A;  2QIR A;  4GXH A;  3S9M A;  1MJB A;  3K9T A;  4OC5 A;  1UFH A;  3LMS A;  3VAR A;  5K8P A;  4NGP A;  4X3R A;  3VWE A;  4OC0 A;  1ZG7 A;  2Q7B A;  2PIY A;  3KR4 A;  4JZ0 A;  4UBR A;  4MJ8 A;  1LRZ A;  2DEA A;  1KZF A;  4E0A A;  1Y9W A;  4H6Z A;  5JGF A;  4PXD A;  1WK4 A;  3P2H A;  2B3U A;  3IWW A;  2P0W A;  2AFO A;  1R3N A;  4A32 A;  3ZZI A;  3PFO A;  2OB0 A;  2DF5 A;  3IWG A;  1CP6 A;  3PEI A;  2ODF A;  5LYI A;  3HUV A;  1XOV A;  4ZGY B;  4IHM A;  4LUA A;  4NF1 A;  3EFA A;  2EUI A;  4NJQ A;  2AFU A;  4GS4 A;  2WPW A;  4KSA A;  4NXY A;  2PC1 A;  3EO4 A;  1M44 A;  3T8W A;  3R9G A;  3CPX A;  4PPZ A;  4XPD B;  2PJ9 A;  3PBB A;  5G1Z A;  3SXN A;  2AJ6 A;  3D68 A;  4B5O A;  1HEE A;  3GUX A;  4A31 A;  2BOA A;  2I79 A;  4G1P A;  4M6H A;  1F2P A;  4R7M A;  3IIB A;  1Q7L A;  1H8L A;  1VGY A;  3TTH A;  1VIX A;  3A9L A;  3SJX A;  3LAC A;  5D29 A;  2V8V A;  4QC6 A;  5IB9 A;  3B3T A;  2D4O A;  2JEW A;  2KCW A;  2G3A A;  4P45 A;  2R98 A;  1OBR A;  2WSA A;  4B6Z A;  4Z65 A;  2PJ0 A;  4OC4 A;  3D4U A;  1V0C A;  4MFQ A;  3W6S A;  3BJ7 A;  2ZXV A;  3WC5 A;  5K8M A;  4ZX9 A;  2F8H A;  1FT7 A;  2Q0Y A;  4IUS A;  4OC2 A;  3WC6 A;  4C2X A;  2ZW4 A;  3D67 A;  3IO1 A;  4UFW A;  4UFV A;  4PXE A;  1Z9U A;  7CPA A;  3KQZ A;  1Q2D A;  4DUK A;  1XMT A;  2XEF A;  3KHX A;  4MCR A;  4OAD A;  4OID A;  1U6M A;  1LAP A;  2G9D A;  4PV6 A;  2D4P A;  2Q51 A;  3IEH A;  3NH5 A;  2PVW A;  1XMB A;  4P4J A;  1ELM P;  1YR0 A;  4LQG A;  4Q7A A;  4R9M A;  3SJE A;  2WYR A;  4MFL A;  3SI1 A;  4KOY A;  2DXQ A;  1J4J A;  3NFZ A;  1IIC A;  3TT2 A;  3FF3 A;  4P10 A;  5CPA A;  2J8M A;  3N5F A;  2PVV A;  1LAN A;  2F7V A;  3KAS A;  3S6H A;  4PXC A;  4ZY2 A;  4BMH A;  2PJ6 A;  1P4N A;  4TNU A;  2FXF A;  4AB7 A;  2CXA A;  2ZEF A;  4GM5 A;  4KOV A;  4A38 A;  2PJ4 A;  1VHO A;  2PIZ A;  3RAM A;  3ISZ A;  1S5K A;  1S7N A;  2V77 A;  2V8H A;  1BAV A;  2XEG A;  4K30 A;  1S7K A;  2JBK A;  4KS9 A;  4FD7 A;  4MCS A;  4A30 A;  3FXT A;  3ZJ0 A;  4OME A;  2VZZ A;  3MRU A;  4XPK A;  1ARL A;  1IGB A;  2VQY A;  3K9U A;  4CYP A;  4PSX A;  4EVY A;  5BWA B;  4M6G A;  3G3S A;  5D8N A;  1LAM A;  3BI0 A;  4CGO A;  2OZH A;  4NFR A;  4NEX A;  4RI1 A;  1Z4E A;  4CYQ A;  5JPH A;  3NE8 A;  1BOB A;  1ZG9 A;  3DSB A;  4XNH B;  5F09 A;  4EME A;  2PR1 A;  2CNM A;  2PJ7 A;  2R8V A;  4A33 A;  2I3C A;  4HPS A;  2R1I A;  3JRU A;  2PRQ A;  3TE4 A;  4A37 A;  5F49 A;  4UCP A;  2NSM A;  5AG7 A;  4ZY0 A;  1VHS A;  3R9E A;  4UIA A;  1FY7 A;  1YVO A;  2Q04 A;  5IV0 A;  3D7G A;  4JJX A;  2ZEH A;  1XRY A;  4OP4 A;  3GIU A;  1S7F A;  5DS0 A;  2HV2 A;  1BPN A;  2O28 A;  4HNY B;  2C27 A;  4Q38 A;  1Y7E A;  3W6X A;  4DYO A;  4IF5 A;  2B3V A;  4Y49 C;  1IOF A;  3T90 A;  4WJB A;  5G20 A;  1ZLH A;  3RO0 A;  2JDD A;  4MBU A;  2GLJ A;  5KTD A;  4R3L A;  4P4E A;  3FVL A;  3K2K A;  4H89 A;  2FIW A;  4NGM A;  4NSQ A;  5KTA A;  1TXR A;  1QQ9 A;  3V8I A;  1R57 A;  2B5G B;  5LYD A;  1IB1 E;  3KKW A;  1XFO A;  2WUU A;  3V38 A;  2J8N A;  2VEZ A;  5ELY A;  1KUX A;  4ZYQ A;  3TOB A;  8CPA A;  2P6F A;  3T9Y A;  4JLY A;  5A28 A;  4C68 A;  2AFW A;  3I1U A;  3PB6 X;  4ZBG A;  3N7Z A;  4R87 A;  2ZED A;  4KVX A;  4C7I A;  3DDD A;  3RBU A;  5CNP A;  4B5P A;  4NJR A;  2IQ6 A;  3IC1 A;  5AGE A;  2CNT A;  1Z8L A;  2EO8 A;  6CPA A;  2FE7 A;  3D66 A;  5LRJ A;  5DWN A;  3D3S A;  2HB6 A;  3KL9 A;  3KZW A;  4AG9 A;  3BJ8 A;  2B4D A;  2PJ5 A;  2JLM A;  2BCO A;  2BO9 A;  4R57 A;  3CXQ A;  3LWU A;  4KSF A;  4R8F A;  4A95 A;  1KWM A;  4ZY1 A;  1M4G A;  4P4B A;  4CPA A;  3WT4 A;  3CZX A;  5A27 A;  4CRZ B;  2Z11 A;  2EWB A;  1CJW A;  2IMO A;  2ZW6 A;  2YNE A;  4U9Y A;  4F8Z A;  5EC4 A;  3C26 A;  4JWP A;  4W9Y A;  1KUV A;  5K8N A;  1AMP A;  4KLV A;  3BI1 A;  2YGW A;  1XJO A;  3DR8 A;  1YSJ A;  1F2O A;  3R1K A;  2RC4 A;  2CTB A;  3F5B A;  3KQX A;  5HH1 A;  4C7H A;  1ELL P;  4U9Z A;  5IX3 A;  4UWI A;  3R96 A;  4X2T A;  3OWC A;  4KOX A;  3D2M A;  4UEF A;  1YME A;  1IY7 A;  3B3S A;  4MXU A;  1PUA A;  3RYO A;  1LFW A;  3R95 A;  2G0B A;  1MJ9 A;  1YW6 A;  1ZG8 A;  2POK A;  2P6G A;  2FSR A;  4JD6 A;  2ARH A;  1VHE A;  4B5P B;  2PJB A;  3TO7 A;  5LYF A;  2YND A;  2ATR A;  2Q4Y A;  2Z3L A;  4JXQ A;  2ZEP A;  1K4J A;  4O23 A;  2GRE A;  4AVB A;  4WWV A;  2A4N A;  1S3Z A;  2DPS A;  3HLP A;  3LD2 A;  3EY5 A;  3GY9 A;  4C2Z A;  1B6B A;  4L89 A;  2Z3M A;  5G22 A;  2AFX A;  5HVH A;  4RUH A;  5J8C A;  5KTC A;  3FBU A;  4FAI A;  2ZEO A;  4R6T A;  2C6C A;  3TC8 A;  5DWM A;  3PB7 X;  3WAB A;  3I9S A;  4KOW A;  3VWD A;  2FIA A;  3FRM A;  4JXR A;  2ZEE A;  4ONU A;  5G21 A;  4PK2 A;  4R76 A;  4EWT A;  2PJ3 A;  4KUB A;  3PRT A;  4E8O A;  5JQ4 A;  3VAT A;  1QSO A;  1BPM A;  1TIQ A;  3SI2 A;  4H6U A;  2ZEM A;  3FEC A;  1QSM A;  1GHE A;  2Q4Z A;  3FNC A;  4K3N A;  1CP7 A;  2EBJ A;  2V8G A;  4M85 A;  3KHZ A;  2I00 A;  4XPL A;  3TX8 A;  2CF4 A;  1S60 A;  4RS2 A;  2X7B A;  3JVN A;  3QAH A;  4M3S A;  3DR6 A;  1RO5 A;  1Z2L A;  3H8E A;  2VZY A;  4MY0 A;  3JTK A;  4A39 A;  5LYL A;  1L0C A;  1RXT A;  3H5Z A;  3IGR A;  3IU2 A;  4CRY B;  3PB4 X;  4KOR A;  3GKR A;  3TO6 A;  1CPX A;  1I21 A;  1SQH A;  1TKJ A;  3S6G A;  3S9L A;  2GAN A;  1XF8 A;  2FCK A;  2Y0M A;  2P6E A;  1ARM A;  4B11 A;  1F57 A;  3DNS A;  4H2K A;  1HDQ A;  4CAV A;  3NH4 A;  5I4M A;  1YLO A;  4CYO A;  4MCQ A;  4UWJ A;  2C1C A;  3NE7 A;  2WPX A;  4DJL A;  4CYN A;  3S6F A;  2XEI A;  4PQA A;  1YW4 A;  1PU9 A;  4PK3 A;  3EC4 A;  4QBJ A;  1NMT A;  4NGR A;  4OIW A;  1MK4 A;  3SHP A;  1XE4 A;  2Z3K A;  1CM0 A;  4A2Z A;  4HNW B;  2ZW7 A;  2REF A;  2ZW5 A;  2EK9 A;  3FED A;  1YX0 A;  4ONW A;  2BL1 A;  4ZI6 A;  1TF9 A;  2AFZ A;  3PZJ A;  3SJG A;  1XBU A;  1RTQ A;  1ZLI A;  4CAF A;  1DE4 C;  4UA3 A;  4QB9 A;  1YK3 A;  1A2Z A;  3L2N A;  4MHY A;  4AVA A;  5LRK A;  4YU9 A;  5F48 A;  2VXK A;  1N71 A;  2V8D A;  4P4D A;  2QYV A;  3UY5 A;  3CT9 A;  2PDO A;  3QB8 A;  3PP9 A;  3S9N A;  4KOU A;  1M4L A;  5CBM A;  1XIX A;  3FJU A;  5HVG A;  1B87 A;  3IJ3 A;  2FS5 A;  1CPS A;  1QST A;  2H5M A;  3E0K A;  3IWE A;  5K8O A;  1AYE A;  2BEI A;  2VL1 A;  4IAV A;  5I0C A;  5F46 A;  2ZEG A;  4X5K A;  1DTD A;  4M6I A;  2OZU A;  3CDX A;  4MRI A;  1NSL A;  1YVK A;  4CS0 B;  2Z10 A;  1BLL E;  4MFZ A;  1TKH A;  3RZA A;  5HXD A;  4NGS A;  2YNC C;  1CG2 A;  2QVP A;  4F0X A;  1IU8 A;  1YQE A;  2C6G A;  1NE9 A;  2PJ2 A;  2FT0 A;  2JBJ A;  5ISV A;  3H8G A;  3JUW A;  1Y0Y A;  1I12 A;  2ZOF A;  4DNC A;  2QML A;  2VBQ A;  3BHX A;  3NH8 A;  2B4B A;  1S7L A;  2G3T A;  2QJ8 A;  2ZPA A;  3GB0 A;  4CGN A;  4KOS A;  4MHP A;  4NCZ A;  4UEZ A;  5IB0 A;  2Z3P A;  4FD6 A;  1IID A;  1M1D A;  3B3V A;  2PRB A;  3GLJ A;  2PJ8 A;  4MY3 A;  1JQG A;  2PJC A;  4NGQ A;  4QUS A;  4YWY A;  2J9A A;  4RN7 A;  4PXB A;  1Y7R A;  1VKC A;  2CY2 A;  3BXM A;  2HQY A;  4UIB A;  4XPD C;  1AUG A;  1QMU A;  5E96 A;  5EMI A;  2B58 A;  1YGH A;  5EBV A;  1TF8 A;  1X12 A;  4KOT A;  4MFJ A;  3B35 A;  3SXO A;  1IYL A;  2FVG A;  1KUY A;  2Q44 A;  3V7Z A;  4FBE A;  1TKF A;  4R3K A;  1ZO0 A;  4OLL A;  4JYW A;  2GU2 A;  2PJA A;  3FYN A;  4YFJ A;  3SI0 A;  2JDC A;  3IFE A;  4MHN A;  2PCU A;  3CPA A;  3LOD A;  3GYA A;  1PYT B;  2O4H A;  2JEV A;  3FMC A;  4KLW A;  2Q43 A;  4KVO E;  4UCN A;  4AG7 A;  1Z8X A;  3B7I A;  1XEB A;  2QEC A;  4UF4 A;  3W91 A;  2REE A;  3F0A A;  3FEE A;  3H8F A;  4MCP A;  1MJA A;  5THW A;  1EE3 P;  4EFD A;  1CX8 A;  5FVJ A;  3NA6 A;  3FH4 A;  3FX6 A;  3PGP A;  3MN8 A;  3I3G A;  4MFK A;  2Z3O A;  4J3G A;  2PE3 A;  2AFM A;  2Z3N A;  2ZEL A;  2HUZ A;  2GIV A;  1X10 A;  1Z8T A;  2ABZ A;  2IL4 A;  2OZG A;  4LQ6 A;  5JH9 A;  1Y9K A;  4CAE A;  2J8R A;  1NSA A;  5C82 A;  2B4D B;  4UFX A;  4X8I A;  5GCN A;  4BIN A;  2NYQ A;  1QSR A;  3ISX A;  3S6K A;  5AG6 A;  1LCP A;  1YRE A;  3KI9 A;  4CGL A;  3IU1 A;  1JWQ A;  5J8F A;  4TWE A;  2WZN A;  1IYK A;  4FD4 A;  3PB8 X;  4MHD A;  4ORF A;  4IK2 A;  3TO9 A;  4AXV A;  5C88 A;  4OC1 A;  5JM6 A;  5F47 A;  4P4F A;  2PQ8 A;  3EXN A;  3R9F A;  4LX9 A;  2HC9 A;  4PSW A;  4HKF A;  1HDU A;  3H4Q A;  4CAW A;  2VI7 A;  4L8A A;  1Y0R A;  1GYT A;  3B2Y A;  3PB9 X;  4F6A A;  5HMN A;  3BLN A;  2OOT A;  1I1D A;  2PR8 A;  4U5Y A;  3B8G A;  3CXP A;  2RFH A;  2AFS A;  3KR5 A;  3FB3 A;  2XEJ A;  1Z8W A;  3D7F A;  4FUU A;  2BSW A;  4F9U A;  4YGO A;  2Q4V A;  3TFY A;  2C6P A;  2PSW A;  3DLJ A;  4CGM A;  2GFQ A;  3CXS A;  4P4I A;  4UEE A;  4MI4 A;  2GE3 A;  4HNX B;  2O53 A;  1Q2C A;  4B13 A;  3DGV A; 
#chains in the Genus database with same CATH homology
 4BBH A;  4KZT A;  1QSN A;  1Q2Y A;  1WWZ A;  1ON0 A;  2K5T A;  3F8K A;  3WR7 A;  4II9 A;  4Q36 A;  4CGP A;  3TOA A;  3TE4 A;  4UCM A;  5AG5 A;  4F0Y A;  4XNH C;  4YRH A;  2AE6 A;  4B12 A;  3FIX A;  2FL4 A;  2YNC A;  2B5G A;  4CAX A;  1M4I A;  1BO4 A;  3D8P A;  4B10 A;  3D2P A;  5AG4 A;  2NMT A;  5H84 A;  5H86 A;  2Z0Z A;  2EVN A;  2BUE A;  1YLE A;  4OAE A;  3MGD A;  4AVC A;  4FD5 A;  4KUA A;  2DPT A;  4KVM E;  4C2Y A;  2OU2 A;  2OH1 A;  3P2F A;  4E2A A;  4Y49 B;  2F5I A;  3G8W A;  4B14 A;  2CNS A;  4QVT A;  1M4D A;  4I49 A;  1OZP A;  2R7H A;  1Z4R A;  4MFP A;  1P0H A;  3TCV A;  2QIR A;  1MJB A;  1UFH A;  3VWE A;  2Q7B A;  4UBR A;  4MJ8 A;  1LRZ A;  1KZF A;  4E0A A;  1Y9W A;  4H6Z A;  1WK4 A;  3P2H A;  2B3U A;  2P0W A;  4A32 A;  3ZZI A;  2OB0 A;  3IWG A;  4ZGY B;  4LUA A;  4NF1 A;  3EFA A;  2EUI A;  4GS4 A;  2WPW A;  4KSA A;  4NXY A;  2PC1 A;  3EO4 A;  1M44 A;  3R9G A;  4XPD B;  4B5O A;  5G1Z A;  3SXN A;  2AJ6 A;  4A31 A;  2I79 A;  3TTH A;  3A9L A;  4QC6 A;  2D4O A;  2KCW A;  2G3A A;  2R98 A;  2WSA A;  4MFQ A;  1V0C A;  3W6S A;  3BJ7 A;  2ZXV A;  2Q0Y A;  4IUS A;  4C2X A;  2ZW4 A;  4UFW A;  4UFV A;  1Z9U A;  1Q2D A;  1XMT A;  4OAD A;  1U6M A;  4PV6 A;  2D4P A;  1YR0 A;  4R9M A;  4MFL A;  4KOY A;  2DXQ A;  1J4J A;  1IIC A;  3TT2 A;  2J8M A;  3S6H A;  4BMH A;  1P4N A;  2FXF A;  2CXA A;  4KOV A;  1S5K A;  1S7N A;  4K30 A;  1S7K A;  4KS9 A;  4A30 A;  4FD7 A;  3FXT A;  3ZJ0 A;  2VZZ A;  4XPK A;  4CYP A;  2VQY A;  3K9U A;  4EVY A;  4PSX A;  5BWA B;  3G3S A;  4CGO A;  2OZH A;  4NEX A;  4RI1 A;  1Z4E A;  4CYQ A;  5JPH A;  1BOB A;  3DSB A;  4XNH B;  2PR1 A;  2CNM A;  2R8V A;  4A33 A;  2R1I A;  5F49 A;  4UCP A;  5AG7 A;  1VHS A;  3R9E A;  1FY7 A;  1YVO A;  2Q04 A;  5IV0 A;  4JJX A;  1S7F A;  2HV2 A;  2O28 A;  4HNY B;  2C27 A;  4Q38 A;  3W6X A;  4IF5 A;  2B3V A;  4Y49 C;  3T90 A;  5G20 A;  2JDD A;  4MBU A;  5KTD A;  4R3L A;  4H89 A;  2FIW A;  4NSQ A;  5KTA A;  3V8I A;  1R57 A;  2B5G B;  1IB1 E;  3KKW A;  2WUU A;  2J8N A;  2VEZ A;  1KUX A;  3TOB A;  2P6F A;  3T9Y A;  4JLY A;  5A28 A;  4C68 A;  4ZBG A;  3N7Z A;  4R87 A;  4KVX A;  4C7I A;  3DDD A;  5CNP A;  4B5P A;  5AGE A;  2CNT A;  2FE7 A;  5DWN A;  3D3S A;  4AG9 A;  3BJ8 A;  2B4D A;  2JLM A;  4R57 A;  3CXQ A;  4KSF A;  4A95 A;  1M4G A;  5A27 A;  4CRZ B;  2Z11 A;  4U9Y A;  1CJW A;  2ZW6 A;  2YNE A;  5EC4 A;  3C26 A;  4JWP A;  1KUV A;  4KLV A;  2YGW A;  3DR8 A;  3R1K A;  2RC4 A;  3F5B A;  5HH1 A;  4C7H A;  4U9Z A;  5IX3 A;  4UWI A;  3R96 A;  3OWC A;  4KOX A;  3D2M A;  1PUA A;  3RYO A;  3R95 A;  2G0B A;  1MJ9 A;  2P6G A;  2FSR A;  4JD6 A;  2ARH A;  4B5P B;  3TO7 A;  2YND A;  2ATR A;  2Q4Y A;  2Z3L A;  4JXQ A;  1K4J A;  4AVB A;  2A4N A;  1S3Z A;  2DPS A;  3LD2 A;  3EY5 A;  3GY9 A;  4C2Z A;  1B6B A;  4L89 A;  2Z3M A;  5G22 A;  5J8C A;  5KTC A;  3FBU A;  5DWM A;  3I9S A;  4KOW A;  3VWD A;  2FIA A;  3FRM A;  4JXR A;  4ONU A;  5G21 A;  4PK2 A;  4KUB A;  4E8O A;  5JQ4 A;  1QSO A;  1TIQ A;  4H6U A;  1QSM A;  1GHE A;  3FNC A;  4M85 A;  2I00 A;  4XPL A;  1S60 A;  4RS2 A;  2X7B A;  3JVN A;  3QAH A;  4M3S A;  3DR6 A;  1RO5 A;  2VZY A;  4MY0 A;  3JTK A;  1L0C A;  1RXT A;  3H5Z A;  3IGR A;  3IU2 A;  4CRY B;  4KOR A;  3GKR A;  3TO6 A;  1I21 A;  1SQH A;  3S6G A;  2GAN A;  1XF8 A;  2FCK A;  2Y0M A;  2P6E A;  4B11 A;  3DNS A;  4CAV A;  4CYO A;  4UWJ A;  3NE7 A;  2WPX A;  4CYN A;  3S6F A;  1PU9 A;  4PK3 A;  3EC4 A;  4QBJ A;  1NMT A;  1MK4 A;  3SHP A;  1XE4 A;  2Z3K A;  1CM0 A;  4A2Z A;  4HNW B;  2ZW7 A;  2REF A;  2ZW5 A;  1YX0 A;  2BL1 A;  3PZJ A;  4CAF A;  4UA3 A;  4QB9 A;  1YK3 A;  4AVA A;  5F48 A;  2VXK A;  1N71 A;  3UY5 A;  3QB8 A;  2PDO A;  3PP9 A;  4KOU A;  1XIX A;  1B87 A;  2FS5 A;  1QST A;  2H5M A;  3E0K A;  3IWE A;  2BEI A;  5I0C A;  5F46 A;  4X5K A;  2OZU A;  1NSL A;  4CS0 B;  1YVK A;  2Z10 A;  4MFZ A;  2YNC C;  4F0X A;  1NE9 A;  2FT0 A;  5ISV A;  3JUW A;  1I12 A;  4DNC A;  2QML A;  2VBQ A;  2B4B A;  1S7L A;  2G3T A;  2ZPA A;  4CGN A;  4KOS A;  4NCZ A;  5IB0 A;  2Z3P A;  4FD6 A;  1IID A;  1M1D A;  2PRB A;  4MY3 A;  4QUS A;  1Y7R A;  1VKC A;  2CY2 A;  2HQY A;  5E96 A;  4XPD C;  2B58 A;  1YGH A;  5EBV A;  3SXO A;  4MFJ A;  4KOT A;  1IYL A;  2Q44 A;  1KUY A;  4R3K A;  1ZO0 A;  4OLL A;  4YFJ A;  3FYN A;  2JDC A;  4AB7 A;  3LOD A;  3GYA A;  2JEV A;  4KLW A;  4KVO E;  4UCN A;  4AG7 A;  1XEB A;  2QEC A;  3W91 A;  2REE A;  3F0A A;  1MJA A;  5FVJ A;  3PGP A;  3I3G A;  4MFK A;  2Z3O A;  4J3G A;  2Z3N A;  2GIV A;  2HUZ A;  2IL4 A;  2OZG A;  1Y9K A;  4CAE A;  2J8R A;  5C82 A;  2B4D B;  4UFX A;  5GCN A;  1QSR A;  3S6K A;  5AG6 A;  1YRE A;  4CGL A;  3IU1 A;  5J8F A;  1IYK A;  4FD4 A;  4ORF A;  4MHD A;  3TO9 A;  5C88 A;  5F47 A;  2PQ8 A;  3EXN A;  3R9F A;  4LX9 A;  4PSW A;  4HKF A;  3H4Q A;  4CAW A;  2VI7 A;  4L8A A;  4F6A A;  5HMN A;  3BLN A;  1I1D A;  2PR8 A;  4U5Y A;  3B8G A;  3CXP A;  3FB3 A;  2BSW A;  4YGO A;  2Q4V A;  3TFY A;  2PSW A;  4CGM A;  3CXS A;  4MI4 A;  2GE3 A;  4HNX B;  1Q2C A;  4B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...