2KCWA

Solution structure of apo-form yjab from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
147
structure length
147
Chain Sequence
MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDPDVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLAYVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized acetyltransferase yjaB
publication title Solution structure of Apo-YjaB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 147
sequence length 147
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2kcwA00
3H4QA 4NSQA 1IICA 3OWCA 1IIDA 3TTHA 4KZTA 4ONUA 4OAEA 4B5PB 1B87A 3CXSA 4JJXA 2Q04A 2KCWA 1BO4A 2QIRA 5H86A 4NF1A 5DWNA 4FD6A 1CM0A 2VI7A 1U6MA 2Z10A 2Q4YA 5JPHA 3DR8A 1P0HA 4AVCA 3R9GA 2JLMA 2BSWA 1N71A 1XEBA 4JXRA 4UA3A 3SHPA 4KUAA 5FVJA 5F47A 4KUBA 4KORA 2VZYA 3EC4A 5IB0A 1Q2YA 4KVOE 3B8GA 5HMNA 5KTAA 2GANA 2EUIA 2FIAA 1YR0A 4NEXA 1NSLA 3PGPA 2FXFA 2P0WA 2FCKA 2OB0A 2I00A 4DNCA 4KOVA 1YVOA 4FD7A 4UBRA 5CNPA 2JEVA 4B5PA 2JDCA 2ZW4A 3QB8A 1QSMA 4LUAA 4KOUA 4M85A 2Z11A 2VQYA 4ORFA 1I21A 2X7BA 3JUWA 2J8NA 3ZJ0A 1QSTA 4JWPA 2GIVA 3IGRA 3F8KA 2VZZA 4HNYB 2FE7A 2Q4VA 3DSBA 4NCZA 1R57A 5JQ4A 3TO6A 1S7FA 4MBUA 1S3ZA 2J8RA 4JLYA 4YGOA 1YGHA 3W6SA 1Z4EA 3IWGA 4RI1A 4X5KA 2OU2A 5E96A 4HNWB 3R9FA 4M3SA 2OH1A 3C26A 2OZUA 1KUYA 3JVNA 3N7ZA 3RYOA 1RO5A 2Y0MA 2REFA 2J8MA 4R9MA 2EVNA 4OLLA 3SXNA 3V8IA 5F49A 4R57A 4MY0A 1Z4RA 2WPXA 1K4JA 1VHSA 4KOYA 4U5YA 2A4NA 2G3AA 2VXKA 1MJ9A 1XE4A 4Y49C 2BEIA 4B5OA 2PR1A 1NMTA 1M44A 1LRZA 4CAWA 2D4OA 1KZFA 2NMTA 1IB1E 3S6KA 1I12A 5EBVA 3I3GA 3KKWA 1IYKA 3GKRA 1MJAA 2ZPAA 4PSXA 1GHEA 2PSWA 4F0YA 3BLNA 4E8OA 1S7LA 4U9ZA 2DXQA 2H5MA 3R95A 4Y49B 2I79A 1PU9A 4NXYA 5ISVA 4CRZB 2PRBA 5I0CA 3LODA 4PV6A 4QUSA 2R98A 4CRYB 3CXPA 2VEZA 3P2FA 2C27A 3DDDA 1TIQA 2VBQA 1BOBA 2JDDA 3E0KA 2PC1A 3NE7A 3EXNA 4MHDA 1M1DA 3FBUA 3DNSA 1KUVA 3TT2A 2Q7BA 1IYLA 1QSOA 5J8FA 4GS4A 3FYNA 2BUEA 2OZHA 1KUXA 1Q2CA 4BMHA 4FD5A 3D8PA 4FD4A 4AG7A 2ZW5A 2B4DB 2CNTA 5H84A 4MJ8A 5IX3A 4IF5A 2FS5A 3D2MA 5F48A 4AB7A 4CAXA 3WR7A 1S7KA 1Q2DA 1WK4A 1XF8A 3R96A 2AJ6A 3PZJA 2B3VA 1V0CA 1Z9UA 1QSNA 2G3TA 4HNXB 3W6XA 4KOXA 1S7NA 5F46A 4PK2A 1YLEA 4UWJA 3DR6A 4OADA 4JD6A 3MGDA 3TCVA 2R7HA 3SXOA 1S5KA 3S6FA 4XPDC 4QVTA 4MY3A 1YVKA 4KOWA 5GCNA 2B4BA 3TOBA 2RC4A 4I49A 4YFJA 4UWIA 3FIXA 4XPKA 5KTDA 4H89A 1YREA 4YRHA 2OZGA 3D3SA 4PK3A 1QSRA 3D2PA 1RXTA 2ZW7A 2R8VA 4AVBA 1SQHA 3G3SA 3I9SA 1ON0A 3VWDA 4L89A 2ARHA 3S6GA 3LD2A 4H6UA 1XIXA 5C88A 3G8WA 4CAVA 1Y7RA 2B3UA 1UFHA 4K30A 4XPDB 2B4DA 3EFAA 4KOTA 2B5GB 1Y9WA 4R3LA 4II9A 1WWZA 4RS2A 2O28A 1M4DA 1P4NA 3QAHA 2D4PA 2ZW6A 4AG9A 4KOSA 2PDOA 2FT0A 3FXTA 2ZXVA 3UY5A 4EVYA 3FB3A 2PQ8A 1I1DA 1M4IA 4U9YA 1MK4A 3FNCA 4QB9A 4J3GA 4LX9A 3P2HA 5C82A 1FY7A 3T90A 1YK3A 4KVXA 2P6FA 2CNSA 1Y9KA 3ZZIA 4QC6A 5J8CA 3K9UA 2HUZA 1CJWA 4KLVA 2P6EA 4H6ZA 5HH1A 4KLWA 1M4GA 2PR8A 4HKFA 3TOAA 4PSWA 4AVAA 1J4JA 1S60A 1YX0A 4E2AA 3BJ8A 4XPLA 2B58A 5DWMA 3TFYA 5EC4A 4JXQA 2Q44A 2FIWA 3F5BA 4R87A 2B5GA 2BL1A 2P6GA 2QECA 3FRMA 4L8AA 3TO9A 2GE3A 3GY9A 3GYAA 1MJBA 4XNHC 1B6BA 2F5IA 4F6AA 3R9EA 2CNMA 3S6HA 2K5TA 3EO4A 2Z0ZA 3BJ7A 2G0BA 4R3KA 2QMLA 1NE9A 2FL4A 2IL4A 4QBJA 3R1KA 4CS0B 2FSRA 3PP9A 5KTCA 2CY2A 2Q0YA 1XMTA 4KVME 2HV2A 3W91A 3TE4A 2AE6A 2HQYA 4IUSA 3EY5A 1OZPA 3T9YA 4E0AA 1PUAA 3F0AA 2REEA 2ATRA 3TO7A 4XNHB 2WPWA 4ZBGA 3CXQA 4MI4A 3VWEA 1VKCA 1L0CA 2R1IA 5IV0A
chains in the Genus database with same CATH superfamily
1GYTA 4DUKA 5JGFA 2AFZA 4BBHA 2PJ2A 2F8HA 3H4QA 3H5ZA 4NSQA 4HPSA 1IICA 3OWCA 8CPAA 4MRIA 1IIDA 3TTHA 4B10A 4B14A 2WYRA 1VIXA 4Q7AA 1YW4A 3H8EA 4KZTA 4ONUA 4OAEA 4Q38A 4OC3A 4B5PB 3BI0A 3DLJA 3GIUA 4ZGYB 1B87A 4A94A 4B13A 3CXSA 4JJXA 2Q04A 2KCWA 1XRYA 1UWYA 1BO4A 2QIRA 4H2KA 4W9YA 5H86A 4C68A 2WZNA 4ZX9A 5HVGA 4OC2A 4BINA 4UFWA 4NF1A 2OOTA 5DWNA 2Z3NA 3A9LA 3B35A 3K9TA 1CM0A 4FD6A 4M6GA 3TC8A 2VI7A 1RTQA 4CYQA 1U6MA 2Z10A 3SI2A 2Q4YA 2ZEHA 3BI1A 2PJ8A 1BAVA 5JPHA 3GUXA 1IGBA 3DR8A 4R8FA 1P0HA 2HB6A 4ZYQA 4AVCA 1OBRA 3R9GA 1AUGA 5EMIA 1ZG7A 3S9MA 2JLMA 2BSWA 1N71A 1XEBA 4OC0A 4JXRA 1XMBA 2QYVA 4UA3A 4C2ZA 4A2ZA 1LANA 3SHPA 3ISXA 4KUAA 2Z3MA 5FVJA 5F47A 4O23A 4KUBA 4P6YA 4KORA 3TX8A 2VZYA 3EC4A 3VH9A 5IB0A 1H8LA 1Q2YA 4NJRA 2JBKA 2PIZA 4KVOE 1AMPA 3B8GA 2F7VA 5HMNA 5F09A 5KTAA 1HDUA 2ANPA 3PB6X 2GANA 3RBUA 2EUIA 4X3RA 1ZLIA 2XEGA 3SI0A 2FIAA 2PVWA 3FF3A 1FT7A 1VHOA 1YR0A 4NEXA 1NSLA 3N5FA 3SI1A 1DE4C 2VL1A 3JTKA 2YNDA 1JWQA 3RNZA 2WUUA 5ELYA 2V8HA 1LFWA 3PGPA 2FXFA 2P0WA 3PB8X 4X2TA 2FCKA 2Q51A 4ZY1A 2OB0A 3KHXA 2I00A 3NE8A 4IK2A 3D7DA 5K8PA 2J9AA 1TKFA 4DNCA 4A32A 2CTCA 4KOVA 1YVOA 4R6TA 4FD7A 4UBRA 4A95A 6CPAA 5CNPA 2PVVA 2JEVA 2PJ0A 4B5PA 2JDCA 4WWVA 4ZI6A 2ZW4A 3QB8A 1QSMA 4LUAA 4NGSA 4KOUA 3FH4A 2ZEEA 3IC1A 4M85A 2Z11A 2YNCA 2VQYA 1CX8A 2AFSA 4MFQA 3IU1A 4ORFA 2ZENA 5AG6A 5D8NA 1I21A 2X7BA 3SJXA 1IY7A 1BPMA 3FEDA 3WC5A 2PJ6A 3JUWA 3PRTA 5LYLA 1Z8WA 1Z5RA 2J8NA 2EWBA 3K2KA 5KTCA 3WABA 1TKHA 3ZJ0A 5AGEA 1QSTA 4JWPA 4M6HA 2GIVA 3IGRA 3F8KA 1A2ZA 2ZOGA 1CBXA 2VZZA 3H8FA 4HNYB 4ONWA 4TNUA 3IWWA 3PB9X 2FE7A 2Q4VA 3DSBA 4LQGA 4NCZA 1R57A 5JQ4A 4UFVA 3HUVA 1S7FA 3TO6A 4C7HA 4MBUA 1AYEA 2ZEMA 1S3ZA 2J8RA 1FNOA 4JLYA 4YGOA 4A39A 1YGHA 4PXBA 4UF4A 1Z4EA 3W6SA 2ZEFA 4B12A 3IWGA 4FBEA 4RI1A 4X5KA 4PXCA 2OU2A 3D7HA 4TWEA 2PRQA 5E96A 4HNWB 4CAEA 5IB9A 3R9FA 3D66A 2PJ7A 4GM5A 4M3SA 2OH1A 4QBJA 3C26A 1YSJA 2OZUA 1KUYA 3FVLA 4P45A 4CGMA 5LYDA 3B2YA 3JVNA 3N7ZA 4JYWA 4P10A 4ZX8A 3RYOA 4F9UA 5I4MA 2I3CA 3CDXA 3RZAA 3LACA 4F9VA 2C1CA 1RO5A 2Y0MA 2REFA 2PJ3A 2J8MA 4R9MA 5BWAB 2EVNA 2PJ9A 4OLLA 4Q36A 3SXNA 3VARA 1Z8TA 2C6PA 3V8IA 5F49A 4R57A 4C7IA 4ZY2A 4EWTA 5LRKA 2HC9A 4MY0A 3PB7X 2ZEDA 1Z4RA 2WPXA 3DGVA 2Q7SA 1K4JA 1VHSA 2PJ1A 4KOYA 1LOKA 4U5YA 2A4NA 4UCMA 1ARMA 4CGOA 4MXUA 4CYNA 4EFDA 4OMEA 2G3AA 2JBJA 2VXKA 3IJ3A 1MJ9A 1CG2A 1XE4A 4Y49C 1QMUA 2BEIA 2PR1A 4B5OA 1NMTA 3B7IA 3FX6A 4MFPA 4A38A 1M44A 1LRZA 2IJZA 4CAWA 2D4OA 4K3NA 4R7MA 1KZFA 2EK8A 3LMSA 2NMTA 3PBEA 1YQEA 3B3SA 1IB1E 5D29A 5JH9A 3S6KA 4CAFA 1I12A 5EBVA 2DEAA 2AFOA 2PJ4A 2G9DA 3I3GA 3KKWA 1IYKA 3ISZA 4CGLA 3GKRA 1MJAA 2ZPAA 4A37A 3KGQA 4KS9A 4KSFA 3L2NA 4PSXA 2GLFA 1QQ9A 1GHEA 3NFZA 2PSWA 4F0YA 3BLNA 4KSIA 4E8OA 1S7LA 4U9ZA 2DXQA 2H5MA 3R95A 4MHZA 4Y49B 2I79A 1PU9A 1PCAA 2Z3LA 5G1ZA 4NXYA 5LRJA 3SJFA 1ZG9A 5ISVA 4CRZB 2PRBA 5I0CA 3WC7A 4NGNA 2O53A 2EBJA 2RB7A 3LODA 3PEIA 4PV6A 1Z8LA 4QUSA 2R98A 4CRYB 3CXPA 2VEZA 3P2FA 2C27A 4X8IA 3DDDA 3D7GA 1TIQA 5K8MA 5J1QA 2VBQA 1BOBA 2JDDA 3E0KA 2XEFA 4UFXA 2PC1A 5DS0A 3CPAA 3NE7A 3EXNA 4MHDA 5A28A 3B3TA 1M1DA 3FBUA 3DNSA 1KUVA 2Z3KA 3KL9A 3TT2A 2Q7BA 2CF4A 1IYLA 1JQGA 4A31A 1QSOA 5K8NA 5J8FA 3T8WA 5LRGA 3GLJA 4GS4A 2EK9A 1HEEA 4UIAA 3QAYA 1Z2LA 3CPXA 5LYIA 5LYFA 3FYNA 2BUEA 2OZHA 4P4FA 1KUXA 2ZEPA 3KQZA 1Q2CA 4BMHA 3NH8A 1Y7EA 4FD5A 3D8PA 4FD4A 5K8OA 4AG7A 1NSAA 2JEWA 5JM6A 4MCPA 2C6CA 3IU2A 2ZW5A 2V8GA 2B4DB 2CNTA 3RAMA 4A30A 4FWUA 5G21A 5H84A 3JRUA 4MJ8A 1CPXA 1YW6A 5IX3A 4IF5A 3B3VA 2FS5A 1ZLHA 4PXDA 5AG5A 3WC6A 3D2MA 5F48A 3MRUA 4OC5A 4FAIA 4AB7A 4CAXA 2PIYA 4IHMA 2ODFA 3WR7A 1S7KA 3SJGA 1Q2DA 4UEZA 2DPTA 3H8GA 1WK4A 4UCPA 1X12A 4CYOA 2GFQA 4YWYA 1XF8A 3R96A 2AJ6A 2V8VA 2B3VA 3PZJA 1V0CA 5CPAA 4UCNA 1Z9UA 1QSNA 2G3TA 4HNXB 3W6XA 4KOXA 2ZEOA 3D7FA 4MHNA 4EMEA 4JZ0A 4OP4A 1S7NA 5F46A 4M6IA 4PK2A 1YLEA 4P4EA 3DR6A 4UWJA 7CPAA 4OADA 4JD6A 4MCSA 4PPZA 1DTDA 4MFLA 1BLLE 3MGDA 3TCVA 4OC4A 2R7HA 4CPAA 2C6GA 3SXOA 1F57A 1S5KA 3S6FA 4XPDC 4QVTA 4C2XA 2ABZA 4MY3A 4CGPA 5THWA 1YVKA 3HLPA 2PJCA 1PYTB 4KOWA 5GCNA 2B4BA 3NA6A 3TOBA 2XEIA 2RC4A 4RUHA 1ELLP 5CBMA 4I49A 2QVPA 4YFJA 1F2OA 4UWIA 2Q43A 1Z8XA 3FIXA 4XPKA 5KTDA 4H89A 1YREA 3CZXA 4YRHA 2OZGA 2Z3PA 3D3SA 4OC1A 1QSRA 3BHXA 3BXMA 4PK3A 3D2PA 1Q7LA 3NH5A 1RXTA 2ZW7A 3I1UA 4NGRA 3RO0A 2R8VA 4AVBA 1SQHA 3G3SA 3I9SA 1ON0A 3VWDA 4L89A 5AG4A 1TKJA 1CP7A 2ARHA 3S6GA 3LD2A 3D4UA 1XIXA 1XJOA 3LWUA 4H6UA 4NJQA 3G8WA 5C88A 4MHPA 4P4BA 1Y7RA 4CAVA 3GB0A 1HDQA 2B3UA 1UFHA 2GU2A 3PFOA 2PJ5A 4K30A 2YGWA 3IWEA 4XPDB 2B4DA 2RFHA 3EFAA 2AFUA 4KOTA 2B5GB 1Y9WA 4R3LA 4II9A 1WWZA 4RS2A 4GXHA 4A33A 2O28A 4OKOA 1M4DA 3FECA 3S9LA 1P4NA 3NH4A 3QAHA 1ZG8A 2D4PA 2ZW6A 4F8ZA 1IOFA 3D67A 4AG9A 4KOSA 3IIBA 2PDOA 2FT0A 3FXTA 3B3CA 2ZXVA 3UY5A 4EVYA 4R76A 3FMCA 3FB3A 1VHEA 2PQ8A 2QJ8A 4FUUA 2PJAA 4AXVA 1I1DA 1M4IA 1TF8A 1M4LA 4U9YA 4KSAA 5HVFA 1MK4A 3FNCA 4QB9A 2POKA 4J3GA 4LX9A 4UEFA 3P2HA 1TF9A 5C82A 1X10A 2XEJA 1FY7A 2AFMA 2AFWA 3KASA 3IO1A 2NYQA 1Y0RA 4ZY0A 4NGPA 3T90A 5A27A 2NSMA 1YK3A 3B3WA 2BOAA 4KVXA 1LCPA 2P6FA 1XBUA 2CNSA 1TXRA 1Y9KA 3ZZIA 4P4DA 3WT4A 4QC6A 4B6ZA 1ELMP 4MFKA 5J8CA 1LAPA 3K9UA 3KHZA 2HUZA 1CJWA 4KLVA 2P6EA 2WSAA 4UEEA 4CGNA 4NGMA 2IMOA 4H6ZA 5HH1A 4KLWA 2YNEA 4NGQA 2O4HA 1BPNA 5HVHA 1M4GA 1Y0YA 4CYPA 2PR8A 4HKFA 3TOAA 3KI9A 4PSWA 4AVAA 1J4JA 1S60A 4PXEA 1R43A 1YX0A 1KWMA 2DF5A 4E2AA 4DYOA 4F0XA 3S9NA 3BJ8A 1ARLA 4XPLA 2B58A 5DWMA 2ZOFA 3TFYA 2ZEGA 5EC4A 2PCUA 4JXQA 2Q44A 4MFZA 2CTBA 2FIWA 3FJUA 2PE3A 3F5BA 4MCRA 2CIJA 4R87A 2B5GA 3QNVA 3IFEA 2BL1A 2CXAA 2V8DA 1R3NA 2P6GA 4P44A 3PFEA 1CP6A 4P4IA 4C2YA 1XOVA 4B11A 2QECA 2Z3OA 3FRMA 4L8AA 3TO9A 3FEEA 4LQ6A 2GE3A 3GY9A 1YMEA 3GYAA 1MJBA 3D68A 4XNHC 1IOIA 1B6BA 2F5IA 3R9EA 2IQ6A 4MFJA 4F6AA 5HXDA 4NGTA 2CNMA 1F2PA 1IU8A 2GLJA 3KZWA 4RN7A 2EO8A 4MHYA 3S6HA 2K5TA 4OIDA 2AFXA 1CPSA 3EO4A 4OIWA 2Z0ZA 3BJ7A 5G20A 4YU9A 3KR4A 2G0BA 4R3KA 3PB4X 2QMLA 3KQXA 4WJBA 3SJEA 1NE9A 5G22A 2FL4A 3VATA 2DPSA 2IL4A 2FVGA 3V38A 3R1KA 4CS0B 2FSRA 3PP9A 4G1PA 2CY2A 2Q0YA 2ZELA 4UIBA 1XMTA 4KVME 2HV2A 1ZO0A 3W91A 3TE4A 4NFRA 2AE6A 1XFOA 2HQYA 2V77A 3CT9A 1YLOA 4IUSA 3EY5A 1OZPA 3T9YA 1LAMA 2Q4ZA 4E0AA 1PUAA 3F0AA 2REEA 2YNCC 2ATRA 3TO7A 2PJBA 3MN8A 4XNHB 4P4JA 2WPWA 3IEHA 4ZBGA 3CXQA 4MMOA 3V7ZA 4MI4A 2OR4A 3VWEA 4Z65A 1VKCA 1EE3P 3KR5A 4DJLA 1L0CA 2GREA 2R1IA 4IAVA 5IV0A 2BO9A 1VGYA 5AG7A 2BCOA 4BD9A 4MCQA 3PBBA 4PQAA
chains in the Genus database with same CATH topology
4BBHA 3H4QA 3H5ZA 4NSQA 1IICA 3OWCA 1IIDA 3TTHA 4B10A 4B14A 4KZTA 4ONUA 4OAEA 4Q38A 4B5PB 4ZGYB 1B87A 4B13A 3CXSA 4JJXA 2Q04A 2KCWA 1BO4A 2QIRA 5H86A 4C68A 4UFWA 4NF1A 5DWNA 3A9LA 4FD6A 2Z3NA 1CM0A 2VI7A 4CYQA 1U6MA 2Z10A 2Q4YA 5JPHA 3DR8A 1P0HA 4AVCA 3R9GA 2JLMA 2BSWA 1N71A 1XEBA 4JXRA 4UA3A 4C2ZA 4A2ZA 3SHPA 4KUAA 2Z3MA 5FVJA 5F47A 4KUBA 4KORA 2VZYA 3EC4A 5IB0A 1Q2YA 4KVOE 3B8GA 5HMNA 5KTAA 2GANA 2EUIA 2FIAA 1YR0A 4NEXA 1NSLA 3JTKA 2YNDA 2WUUA 3PGPA 2FXFA 2P0WA 2FCKA 2OB0A 2I00A 4DNCA 4A32A 4KOVA 1YVOA 4FD7A 4UBRA 4A95A 5CNPA 2JEVA 4B5PA 2JDCA 2ZW4A 3QB8A 1QSMA 4LUAA 4KOUA 4M85A 2Z11A 2YNCA 2VQYA 4MFQA 3IU1A 4ORFA 5AG6A 1I21A 2X7BA 3JUWA 2J8NA 3ZJ0A 5AGEA 1QSTA 4JWPA 2GIVA 3IGRA 3F8KA 2VZZA 4HNYB 2FE7A 2Q4VA 3DSBA 4NCZA 1R57A 5JQ4A 4UFVA 3TO6A 1S7FA 4C7HA 4MBUA 1S3ZA 2J8RA 4JLYA 4YGOA 1YGHA 3W6SA 1Z4EA 4B12A 3IWGA 4RI1A 4X5KA 2OU2A 5E96A 4HNWB 4CAEA 3R9FA 4M3SA 2OH1A 3C26A 2OZUA 1KUYA 4CGMA 3JVNA 3N7ZA 3RYOA 1RO5A 2Y0MA 2REFA 5BWAB 2J8MA 4R9MA 2EVNA 4OLLA 4Q36A 3SXNA 4C7IA 3V8IA 5F49A 4R57A 4MY0A 1Z4RA 2WPXA 1K4JA 1VHSA 4KOYA 4UCMA 4U5YA 2A4NA 4CGOA 4CYNA 2G3AA 2VXKA 1MJ9A 1XE4A 4Y49C 2BEIA 4B5OA 2PR1A 1NMTA 4MFPA 1M44A 1LRZA 4CAWA 2D4OA 1KZFA 2NMTA 1IB1E 3S6KA 4CAFA 1I12A 5EBVA 3I3GA 3KKWA 1IYKA 4CGLA 3GKRA 1MJAA 2ZPAA 4KS9A 4KSFA 4PSXA 1GHEA 2PSWA 4F0YA 3BLNA 4E8OA 1S7LA 4U9ZA 2DXQA 2H5MA 3R95A 4Y49B 2I79A 1PU9A 2Z3LA 5G1ZA 4NXYA 5ISVA 4CRZB 2PRBA 5I0CA 3LODA 4PV6A 4QUSA 2R98A 4CRYB 3CXPA 2VEZA 3P2FA 2C27A 3DDDA 1TIQA 2VBQA 1BOBA 2JDDA 3E0KA 4UFXA 2PC1A 3NE7A 3EXNA 4MHDA 5A28A 1M1DA 3FBUA 3DNSA 1KUVA 2Z3KA 3TT2A 2Q7BA 4A31A 1IYLA 1QSOA 5J8FA 4GS4A 3FYNA 2BUEA 2OZHA 1KUXA 1Q2CA 4BMHA 4FD5A 3D8PA 4FD4A 4AG7A 3IU2A 2ZW5A 4A30A 2B4DB 2CNTA 5G21A 5H84A 4MJ8A 5IX3A 4IF5A 2FS5A 5AG5A 3D2MA 5F48A 4AB7A 4CAXA 3WR7A 1S7KA 1Q2DA 2DPTA 1WK4A 4UCPA 4CYOA 1XF8A 3R96A 2AJ6A 3PZJA 2B3VA 1V0CA 4UCNA 1Z9UA 1QSNA 2G3TA 4HNXB 3W6XA 4KOXA 1S7NA 5F46A 4PK2A 1YLEA 4UWJA 3DR6A 4OADA 4JD6A 4MFLA 3MGDA 3TCVA 2R7HA 3SXOA 1S5KA 3S6FA 4XPDC 4QVTA 4C2XA 4MY3A 4CGPA 1YVKA 4KOWA 5GCNA 2B4BA 3TOBA 2RC4A 4I49A 4YFJA 4UWIA 3FIXA 4XPKA 5KTDA 4H89A 1YREA 4YRHA 2OZGA 2Z3PA 3D3SA 4PK3A 1QSRA 3D2PA 1RXTA 2ZW7A 2R8VA 4AVBA 3I9SA 1SQHA 3G3SA 1ON0A 3VWDA 4L89A 5AG4A 2ARHA 3S6GA 3LD2A 4H6UA 1XIXA 5C88A 3G8WA 4CAVA 1Y7RA 2B3UA 1UFHA 4K30A 2YGWA 3IWEA 4XPDB 2B4DA 3EFAA 4KOTA 2B5GB 1Y9WA 4R3LA 4II9A 1WWZA 4RS2A 4A33A 2O28A 1M4DA 1P4NA 3QAHA 2D4PA 2ZW6A 4AG9A 4KOSA 2PDOA 2FT0A 3FXTA 2ZXVA 3UY5A 4EVYA 3FB3A 2PQ8A 1I1DA 1M4IA 4U9YA 4KSAA 1MK4A 3FNCA 4QB9A 4J3GA 4LX9A 3P2HA 5C82A 1FY7A 3T90A 5A27A 1YK3A 4KVXA 2P6FA 2CNSA 1Y9KA 3ZZIA 4QC6A 4MFKA 5J8CA 3K9UA 2HUZA 1CJWA 4KLVA 2P6EA 2WSAA 4CGNA 4H6ZA 5HH1A 4KLWA 2YNEA 1M4GA 4CYPA 2PR8A 4HKFA 3TOAA 4PSWA 4AVAA 1J4JA 1S60A 1YX0A 4E2AA 4F0XA 3BJ8A 4XPLA 2B58A 5DWMA 3TFYA 5EC4A 4JXQA 2Q44A 4MFZA 2FIWA 3F5BA 4R87A 2B5GA 2BL1A 2CXAA 2P6GA 4C2YA 4B11A 2QECA 2Z3OA 3FRMA 4L8AA 3TO9A 2GE3A 3GY9A 3GYAA 1MJBA 4XNHC 1B6BA 2F5IA 4F6AA 3R9EA 4MFJA 2CNMA 3S6HA 2K5TA 3EO4A 2Z0ZA 3BJ7A 5G20A 2G0BA 4R3KA 2QMLA 1NE9A 5G22A 2FL4A 2DPSA 2IL4A 4QBJA 3R1KA 4CS0B 2FSRA 3PP9A 5KTCA 2CY2A 2Q0YA 1XMTA 4KVME 2HV2A 1ZO0A 3W91A 3TE4A 2AE6A 2HQYA 4IUSA 3EY5A 1OZPA 3T9YA 4E0AA 1PUAA 3F0AA 2REEA 2YNCC 2ATRA 3TO7A 4XNHB 2WPWA 4ZBGA 3CXQA 4MI4A 3VWEA 1VKCA 1L0CA 2R1IA 5IV0A 5AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4Q A;  4NSQ A;  1IIC A;  3OWC A;  1IID A;  3TTH A;  4KZT A;  4ONU A;  4OAE A;  4B5P B;  1B87 A;  3CXS A;  4JJX A;  2Q04 A;  2KCW A;  1BO4 A;  2QIR A;  5H86 A;  4NF1 A;  5DWN A;  4FD6 A;  1CM0 A;  2VI7 A;  1U6M A;  2Z10 A;  2Q4Y A;  5JPH A;  3DR8 A;  1P0H A;  4AVC A;  3R9G A;  2JLM A;  2BSW A;  1N71 A;  1XEB A;  4JXR A;  4UA3 A;  3SHP A;  4KUA A;  5FVJ A;  5F47 A;  4KUB A;  4KOR A;  2VZY A;  3EC4 A;  5IB0 A;  1Q2Y A;  4KVO E;  3B8G A;  5HMN A;  5KTA A;  2GAN A;  2EUI A;  2FIA A;  1YR0 A;  4NEX A;  1NSL A;  3PGP A;  2FXF A;  2P0W A;  2FCK A;  2OB0 A;  2I00 A;  4DNC A;  4KOV A;  1YVO A;  4FD7 A;  4UBR A;  5CNP A;  2JEV A;  4B5P A;  2JDC A;  2ZW4 A;  3QB8 A;  1QSM A;  4LUA A;  4KOU A;  4M85 A;  2Z11 A;  2VQY A;  4ORF A;  1I21 A;  2X7B A;  3JUW A;  2J8N A;  3ZJ0 A;  1QST A;  4JWP A;  2GIV A;  3IGR A;  3F8K A;  2VZZ A;  4HNY B;  2FE7 A;  2Q4V A;  3DSB A;  4NCZ A;  1R57 A;  5JQ4 A;  3TO6 A;  1S7F A;  4MBU A;  1S3Z A;  2J8R A;  4JLY A;  4YGO A;  1YGH A;  3W6S A;  1Z4E A;  3IWG A;  4RI1 A;  4X5K A;  2OU2 A;  5E96 A;  4HNW B;  3R9F A;  4M3S A;  2OH1 A;  3C26 A;  2OZU A;  1KUY A;  3JVN A;  3N7Z A;  3RYO A;  1RO5 A;  2Y0M A;  2REF A;  2J8M A;  4R9M A;  2EVN A;  4OLL A;  3SXN A;  3V8I A;  5F49 A;  4R57 A;  4MY0 A;  1Z4R A;  2WPX A;  1K4J A;  1VHS A;  4KOY A;  4U5Y A;  2A4N A;  2G3A A;  2VXK A;  1MJ9 A;  1XE4 A;  4Y49 C;  2BEI A;  4B5O A;  2PR1 A;  1NMT A;  1M44 A;  1LRZ A;  4CAW A;  2D4O A;  1KZF A;  2NMT A;  1IB1 E;  3S6K A;  1I12 A;  5EBV A;  3I3G A;  3KKW A;  1IYK A;  3GKR A;  1MJA A;  2ZPA A;  4PSX A;  1GHE A;  2PSW A;  4F0Y A;  3BLN A;  4E8O A;  1S7L A;  4U9Z A;  2DXQ A;  2H5M A;  3R95 A;  4Y49 B;  2I79 A;  1PU9 A;  4NXY A;  5ISV A;  4CRZ B;  2PRB A;  5I0C A;  3LOD A;  4PV6 A;  4QUS A;  2R98 A;  4CRY B;  3CXP A;  2VEZ A;  3P2F A;  2C27 A;  3DDD A;  1TIQ A;  2VBQ A;  1BOB A;  2JDD A;  3E0K A;  2PC1 A;  3NE7 A;  3EXN A;  4MHD A;  1M1D A;  3FBU A;  3DNS A;  1KUV A;  3TT2 A;  2Q7B A;  1IYL A;  1QSO A;  5J8F A;  4GS4 A;  3FYN A;  2BUE A;  2OZH A;  1KUX A;  1Q2C A;  4BMH A;  4FD5 A;  3D8P A;  4FD4 A;  4AG7 A;  2ZW5 A;  2B4D B;  2CNT A;  5H84 A;  4MJ8 A;  5IX3 A;  4IF5 A;  2FS5 A;  3D2M A;  5F48 A;  4AB7 A;  4CAX A;  3WR7 A;  1S7K A;  1Q2D A;  1WK4 A;  1XF8 A;  3R96 A;  2AJ6 A;  3PZJ A;  2B3V A;  1V0C A;  1Z9U A;  1QSN A;  2G3T A;  4HNX B;  3W6X A;  4KOX A;  1S7N A;  5F46 A;  4PK2 A;  1YLE A;  4UWJ A;  3DR6 A;  4OAD A;  4JD6 A;  3MGD A;  3TCV A;  2R7H A;  3SXO A;  1S5K A;  3S6F A;  4XPD C;  4QVT A;  4MY3 A;  1YVK A;  4KOW A;  5GCN A;  2B4B A;  3TOB A;  2RC4 A;  4I49 A;  4YFJ A;  4UWI A;  3FIX A;  4XPK A;  5KTD A;  4H89 A;  1YRE A;  4YRH A;  2OZG A;  3D3S A;  4PK3 A;  1QSR A;  3D2P A;  1RXT A;  2ZW7 A;  2R8V A;  4AVB A;  1SQH A;  3G3S A;  3I9S A;  1ON0 A;  3VWD A;  4L89 A;  2ARH A;  3S6G A;  3LD2 A;  4H6U A;  1XIX A;  5C88 A;  3G8W A;  4CAV A;  1Y7R A;  2B3U A;  1UFH A;  4K30 A;  4XPD B;  2B4D A;  3EFA A;  4KOT A;  2B5G B;  1Y9W A;  4R3L A;  4II9 A;  1WWZ A;  4RS2 A;  2O28 A;  1M4D A;  1P4N A;  3QAH A;  2D4P A;  2ZW6 A;  4AG9 A;  4KOS A;  2PDO A;  2FT0 A;  3FXT A;  2ZXV A;  3UY5 A;  4EVY A;  3FB3 A;  2PQ8 A;  1I1D A;  1M4I A;  4U9Y A;  1MK4 A;  3FNC A;  4QB9 A;  4J3G A;  4LX9 A;  3P2H A;  5C82 A;  1FY7 A;  3T90 A;  1YK3 A;  4KVX A;  2P6F A;  2CNS A;  1Y9K A;  3ZZI A;  4QC6 A;  5J8C A;  3K9U A;  2HUZ A;  1CJW A;  4KLV A;  2P6E A;  4H6Z A;  5HH1 A;  4KLW A;  1M4G A;  2PR8 A;  4HKF A;  3TOA A;  4PSW A;  4AVA A;  1J4J A;  1S60 A;  1YX0 A;  4E2A A;  3BJ8 A;  4XPL A;  2B58 A;  5DWM A;  3TFY A;  5EC4 A;  4JXQ A;  2Q44 A;  2FIW A;  3F5B A;  4R87 A;  2B5G A;  2BL1 A;  2P6G A;  2QEC A;  3FRM A;  4L8A A;  3TO9 A;  2GE3 A;  3GY9 A;  3GYA A;  1MJB A;  4XNH C;  1B6B A;  2F5I A;  4F6A A;  3R9E A;  2CNM A;  3S6H A;  2K5T A;  3EO4 A;  2Z0Z A;  3BJ7 A;  2G0B A;  4R3K A;  2QML A;  1NE9 A;  2FL4 A;  2IL4 A;  4QBJ A;  3R1K A;  4CS0 B;  2FSR A;  3PP9 A;  5KTC A;  2CY2 A;  2Q0Y A;  1XMT A;  4KVM E;  2HV2 A;  3W91 A;  3TE4 A;  2AE6 A;  2HQY A;  4IUS A;  3EY5 A;  1OZP A;  3T9Y A;  4E0A A;  1PUA A;  3F0A A;  2REE A;  2ATR A;  3TO7 A;  4XNH B;  2WPW A;  4ZBG A;  3CXQ A;  4MI4 A;  3VWE A;  1VKC A;  1L0C A;  2R1I A;  5IV0 A; 
#chains in the Genus database with same CATH topology
 1GYT A;  4DUK A;  5JGF A;  2AFZ A;  4BBH A;  2PJ2 A;  2F8H A;  3H4Q A;  3H5Z A;  4NSQ A;  4HPS A;  1IIC A;  3OWC A;  8CPA A;  4MRI A;  1IID A;  3TTH A;  4B10 A;  4B14 A;  2WYR A;  1VIX A;  4Q7A A;  1YW4 A;  3H8E A;  4KZT A;  4ONU A;  4OAE A;  4Q38 A;  4OC3 A;  4B5P B;  3BI0 A;  3DLJ A;  3GIU A;  4ZGY B;  1B87 A;  4A94 A;  4B13 A;  3CXS A;  4JJX A;  2Q04 A;  2KCW A;  1XRY A;  1UWY A;  1BO4 A;  2QIR A;  4H2K A;  4W9Y A;  5H86 A;  4C68 A;  2WZN A;  4ZX9 A;  5HVG A;  4OC2 A;  4BIN A;  4UFW A;  4NF1 A;  2OOT A;  5DWN A;  2Z3N A;  3A9L A;  3B35 A;  3K9T A;  1CM0 A;  4FD6 A;  4M6G A;  3TC8 A;  2VI7 A;  1RTQ A;  4CYQ A;  1U6M A;  2Z10 A;  3SI2 A;  2Q4Y A;  2ZEH A;  3BI1 A;  2PJ8 A;  1BAV A;  5JPH A;  3GUX A;  1IGB A;  3DR8 A;  4R8F A;  1P0H A;  2HB6 A;  4ZYQ A;  4AVC A;  1OBR A;  3R9G A;  1AUG A;  5EMI A;  1ZG7 A;  3S9M A;  2JLM A;  2BSW A;  1N71 A;  1XEB A;  4OC0 A;  4JXR A;  1XMB A;  2QYV A;  4UA3 A;  4C2Z A;  4A2Z A;  1LAN A;  3SHP A;  3ISX A;  4KUA A;  2Z3M A;  5FVJ A;  5F47 A;  4O23 A;  4KUB A;  4P6Y A;  4KOR A;  3TX8 A;  2VZY A;  3EC4 A;  3VH9 A;  5IB0 A;  1H8L A;  1Q2Y A;  4NJR A;  2JBK A;  2PIZ A;  4KVO E;  1AMP A;  3B8G A;  2F7V A;  5HMN A;  5F09 A;  5KTA A;  1HDU A;  2ANP A;  3PB6 X;  2GAN A;  3RBU A;  2EUI A;  4X3R A;  1ZLI A;  2XEG A;  3SI0 A;  2FIA A;  2PVW A;  3FF3 A;  1FT7 A;  1VHO A;  1YR0 A;  4NEX A;  1NSL A;  3N5F A;  3SI1 A;  1DE4 C;  2VL1 A;  3JTK A;  2YND A;  1JWQ A;  3RNZ A;  2WUU A;  5ELY A;  2V8H A;  1LFW A;  3PGP A;  2FXF A;  2P0W A;  3PB8 X;  4X2T A;  2FCK A;  2Q51 A;  4ZY1 A;  2OB0 A;  3KHX A;  2I00 A;  3NE8 A;  4IK2 A;  3D7D A;  5K8P A;  2J9A A;  1TKF A;  4DNC A;  4A32 A;  2CTC A;  4KOV A;  1YVO A;  4R6T A;  4FD7 A;  4UBR A;  4A95 A;  6CPA A;  5CNP A;  2PVV A;  2JEV A;  2PJ0 A;  4B5P A;  2JDC A;  4WWV A;  4ZI6 A;  2ZW4 A;  3QB8 A;  1QSM A;  4LUA A;  4NGS A;  4KOU A;  3FH4 A;  2ZEE A;  3IC1 A;  4M85 A;  2Z11 A;  2YNC A;  2VQY A;  1CX8 A;  2AFS A;  4MFQ A;  3IU1 A;  4ORF A;  2ZEN A;  5AG6 A;  5D8N A;  1I21 A;  2X7B A;  3SJX A;  1IY7 A;  1BPM A;  3FED A;  3WC5 A;  2PJ6 A;  3JUW A;  3PRT A;  5LYL A;  1Z8W A;  1Z5R A;  2J8N A;  2EWB A;  3K2K A;  5KTC A;  3WAB A;  1TKH A;  3ZJ0 A;  5AGE A;  1QST A;  4JWP A;  4M6H A;  2GIV A;  3IGR A;  3F8K A;  1A2Z A;  2ZOG A;  1CBX A;  2VZZ A;  3H8F A;  4HNY B;  4ONW A;  4TNU A;  3IWW A;  3PB9 X;  2FE7 A;  2Q4V A;  3DSB A;  4LQG A;  4NCZ A;  1R57 A;  5JQ4 A;  4UFV A;  3HUV A;  1S7F A;  3TO6 A;  4C7H A;  4MBU A;  1AYE A;  2ZEM A;  1S3Z A;  2J8R A;  1FNO A;  4JLY A;  4YGO A;  4A39 A;  1YGH A;  4PXB A;  4UF4 A;  1Z4E A;  3W6S A;  2ZEF A;  4B12 A;  3IWG A;  4FBE A;  4RI1 A;  4X5K A;  4PXC A;  2OU2 A;  3D7H A;  4TWE A;  2PRQ A;  5E96 A;  4HNW B;  4CAE A;  5IB9 A;  3R9F A;  3D66 A;  2PJ7 A;  4GM5 A;  4M3S A;  2OH1 A;  4QBJ A;  3C26 A;  1YSJ A;  2OZU A;  1KUY A;  3FVL A;  4P45 A;  4CGM A;  5LYD A;  3B2Y A;  3JVN A;  3N7Z A;  4JYW A;  4P10 A;  4ZX8 A;  3RYO A;  4F9U A;  5I4M A;  2I3C A;  3CDX A;  3RZA A;  3LAC A;  4F9V A;  2C1C A;  1RO5 A;  2Y0M A;  2REF A;  2PJ3 A;  2J8M A;  4R9M A;  5BWA B;  2EVN A;  2PJ9 A;  4OLL A;  4Q36 A;  3SXN A;  3VAR A;  1Z8T A;  2C6P A;  3V8I A;  5F49 A;  4R57 A;  4C7I A;  4ZY2 A;  4EWT A;  5LRK A;  2HC9 A;  4MY0 A;  3PB7 X;  2ZED A;  1Z4R A;  2WPX A;  3DGV A;  2Q7S A;  1K4J A;  1VHS A;  2PJ1 A;  4KOY A;  1LOK A;  4U5Y A;  2A4N A;  4UCM A;  1ARM A;  4CGO A;  4MXU A;  4CYN A;  4EFD A;  4OME A;  2G3A A;  2JBJ A;  2VXK A;  3IJ3 A;  1MJ9 A;  1CG2 A;  1XE4 A;  4Y49 C;  1QMU A;  2BEI A;  2PR1 A;  4B5O A;  1NMT A;  3B7I A;  3FX6 A;  4MFP A;  4A38 A;  1M44 A;  1LRZ A;  2IJZ A;  4CAW A;  2D4O A;  4K3N A;  4R7M A;  1KZF A;  2EK8 A;  3LMS A;  2NMT A;  3PBE A;  1YQE A;  3B3S A;  1IB1 E;  5D29 A;  5JH9 A;  3S6K A;  4CAF A;  1I12 A;  5EBV A;  2DEA A;  2AFO A;  2PJ4 A;  2G9D A;  3I3G A;  3KKW A;  1IYK A;  3ISZ A;  4CGL A;  3GKR A;  1MJA A;  2ZPA A;  4A37 A;  3KGQ A;  4KS9 A;  4KSF A;  3L2N A;  4PSX A;  2GLF A;  1QQ9 A;  1GHE A;  3NFZ A;  2PSW A;  4F0Y A;  3BLN A;  4KSI A;  4E8O A;  1S7L A;  4U9Z A;  2DXQ A;  2H5M A;  3R95 A;  4MHZ A;  4Y49 B;  2I79 A;  1PU9 A;  1PCA A;  2Z3L A;  5G1Z A;  4NXY A;  5LRJ A;  3SJF A;  1ZG9 A;  5ISV A;  4CRZ B;  2PRB A;  5I0C A;  3WC7 A;  4NGN A;  2O53 A;  2EBJ A;  2RB7 A;  3LOD A;  3PEI A;  4PV6 A;  1Z8L A;  4QUS A;  2R98 A;  4CRY B;  3CXP A;  2VEZ A;  3P2F A;  2C27 A;  4X8I A;  3DDD A;  3D7G A;  1TIQ A;  5K8M A;  5J1Q A;  2VBQ A;  1BOB A;  2JDD A;  3E0K A;  2XEF A;  4UFX A;  2PC1 A;  5DS0 A;  3CPA A;  3NE7 A;  3EXN A;  4MHD A;  5A28 A;  3B3T A;  1M1D A;  3FBU A;  3DNS A;  1KUV A;  2Z3K A;  3KL9 A;  3TT2 A;  2Q7B A;  2CF4 A;  1IYL A;  1JQG A;  4A31 A;  1QSO A;  5K8N A;  5J8F A;  3T8W A;  5LRG A;  3GLJ A;  4GS4 A;  2EK9 A;  1HEE A;  4UIA A;  3QAY A;  1Z2L A;  3CPX A;  5LYI A;  5LYF A;  3FYN A;  2BUE A;  2OZH A;  4P4F A;  1KUX A;  2ZEP A;  3KQZ A;  1Q2C A;  4BMH A;  3NH8 A;  1Y7E A;  4FD5 A;  3D8P A;  4FD4 A;  5K8O A;  4AG7 A;  1NSA A;  2JEW A;  5JM6 A;  4MCP A;  2C6C A;  3IU2 A;  2ZW5 A;  2V8G A;  2B4D B;  2CNT A;  3RAM A;  4A30 A;  4FWU A;  5G21 A;  5H84 A;  3JRU A;  4MJ8 A;  1CPX A;  1YW6 A;  5IX3 A;  4IF5 A;  3B3V A;  2FS5 A;  1ZLH A;  4PXD A;  5AG5 A;  3WC6 A;  3D2M A;  5F48 A;  3MRU A;  4OC5 A;  4FAI A;  4AB7 A;  4CAX A;  2PIY A;  4IHM A;  2ODF A;  3WR7 A;  1S7K A;  3SJG A;  1Q2D A;  4UEZ A;  2DPT A;  3H8G A;  1WK4 A;  4UCP A;  1X12 A;  4CYO A;  2GFQ A;  4YWY A;  1XF8 A;  3R96 A;  2AJ6 A;  2V8V A;  2B3V A;  3PZJ A;  1V0C A;  5CPA A;  4UCN A;  1Z9U A;  1QSN A;  2G3T A;  4HNX B;  3W6X A;  4KOX A;  2ZEO A;  3D7F A;  4MHN A;  4EME A;  4JZ0 A;  4OP4 A;  1S7N A;  5F46 A;  4M6I A;  4PK2 A;  1YLE A;  4P4E A;  3DR6 A;  4UWJ A;  7CPA A;  4OAD A;  4JD6 A;  4MCS A;  4PPZ A;  1DTD A;  4MFL A;  1BLL E;  3MGD A;  3TCV A;  4OC4 A;  2R7H A;  4CPA A;  2C6G A;  3SXO A;  1F57 A;  1S5K A;  3S6F A;  4XPD C;  4QVT A;  4C2X A;  2ABZ A;  4MY3 A;  4CGP A;  5THW A;  1YVK A;  3HLP A;  2PJC A;  1PYT B;  4KOW A;  5GCN A;  2B4B A;  3NA6 A;  3TOB A;  2XEI A;  2RC4 A;  4RUH A;  1ELL P;  5CBM A;  4I49 A;  2QVP A;  4YFJ A;  1F2O A;  4UWI A;  2Q43 A;  1Z8X A;  3FIX A;  4XPK A;  5KTD A;  4H89 A;  1YRE A;  3CZX A;  4YRH A;  2OZG A;  2Z3P A;  3D3S A;  4OC1 A;  1QSR A;  3BHX A;  3BXM A;  4PK3 A;  3D2P A;  1Q7L A;  3NH5 A;  1RXT A;  2ZW7 A;  3I1U A;  4NGR A;  3RO0 A;  2R8V A;  4AVB A;  1SQH A;  3G3S A;  3I9S A;  1ON0 A;  3VWD A;  4L89 A;  5AG4 A;  1TKJ A;  1CP7 A;  2ARH A;  3S6G A;  3LD2 A;  3D4U A;  1XIX A;  1XJO A;  3LWU A;  4H6U A;  4NJQ A;  3G8W A;  5C88 A;  4MHP A;  4P4B A;  1Y7R A;  4CAV A;  3GB0 A;  1HDQ A;  2B3U A;  1UFH A;  2GU2 A;  3PFO A;  2PJ5 A;  4K30 A;  2YGW A;  3IWE A;  4XPD B;  2B4D A;  2RFH A;  3EFA A;  2AFU A;  4KOT A;  2B5G B;  1Y9W A;  4R3L A;  4II9 A;  1WWZ A;  4RS2 A;  4GXH A;  4A33 A;  2O28 A;  4OKO A;  1M4D A;  3FEC A;  3S9L A;  1P4N A;  3NH4 A;  3QAH A;  1ZG8 A;  2D4P A;  2ZW6 A;  4F8Z A;  1IOF A;  3D67 A;  4AG9 A;  4KOS A;  3IIB A;  2PDO A;  2FT0 A;  3FXT A;  3B3C A;  2ZXV A;  3UY5 A;  4EVY A;  4R76 A;  3FMC A;  3FB3 A;  1VHE A;  2PQ8 A;  2QJ8 A;  4FUU A;  2PJA A;  4AXV A;  1I1D A;  1M4I A;  1TF8 A;  1M4L A;  4U9Y A;  4KSA A;  5HVF A;  1MK4 A;  3FNC A;  4QB9 A;  2POK A;  4J3G A;  4LX9 A;  4UEF A;  3P2H A;  1TF9 A;  5C82 A;  1X10 A;  2XEJ A;  1FY7 A;  2AFM A;  2AFW A;  3KAS A;  3IO1 A;  2NYQ A;  1Y0R A;  4ZY0 A;  4NGP A;  3T90 A;  5A27 A;  2NSM A;  1YK3 A;  3B3W A;  2BOA A;  4KVX A;  1LCP A;  2P6F A;  1XBU A;  2CNS A;  1TXR A;  1Y9K A;  3ZZI A;  4P4D A;  3WT4 A;  4QC6 A;  4B6Z A;  1ELM P;  4MFK A;  5J8C A;  1LAP A;  3K9U A;  3KHZ A;  2HUZ A;  1CJW A;  4KLV A;  2P6E A;  2WSA A;  4UEE A;  4CGN A;  4NGM A;  2IMO A;  4H6Z A;  5HH1 A;  4KLW A;  2YNE A;  4NGQ A;  2O4H A;  1BPN A;  5HVH A;  1M4G A;  1Y0Y A;  4CYP A;  2PR8 A;  4HKF A;  3TOA A;  3KI9 A;  4PSW A;  4AVA A;  1J4J A;  1S60 A;  4PXE A;  1R43 A;  1YX0 A;  1KWM A;  2DF5 A;  4E2A A;  4DYO A;  4F0X A;  3S9N A;  3BJ8 A;  1ARL A;  4XPL A;  2B58 A;  5DWM A;  2ZOF A;  3TFY A;  2ZEG A;  5EC4 A;  2PCU A;  4JXQ A;  2Q44 A;  4MFZ A;  2CTB A;  2FIW A;  3FJU A;  2PE3 A;  3F5B A;  4MCR A;  2CIJ A;  4R87 A;  2B5G A;  3QNV A;  3IFE A;  2BL1 A;  2CXA A;  2V8D A;  1R3N A;  2P6G A;  4P44 A;  3PFE A;  1CP6 A;  4P4I A;  4C2Y A;  1XOV A;  4B11 A;  2QEC A;  2Z3O A;  3FRM A;  4L8A A;  3TO9 A;  3FEE A;  4LQ6 A;  2GE3 A;  3GY9 A;  1YME A;  3GYA A;  1MJB A;  3D68 A;  4XNH C;  1IOI A;  1B6B A;  2F5I A;  3R9E A;  2IQ6 A;  4MFJ A;  4F6A A;  5HXD A;  4NGT A;  2CNM A;  1F2P A;  1IU8 A;  2GLJ A;  3KZW A;  4RN7 A;  2EO8 A;  4MHY A;  3S6H A;  2K5T A;  4OID A;  2AFX A;  1CPS A;  3EO4 A;  4OIW A;  2Z0Z A;  3BJ7 A;  5G20 A;  4YU9 A;  3KR4 A;  2G0B A;  4R3K A;  3PB4 X;  2QML A;  3KQX A;  4WJB A;  3SJE A;  1NE9 A;  5G22 A;  2FL4 A;  3VAT A;  2DPS A;  2IL4 A;  2FVG A;  3V38 A;  3R1K A;  4CS0 B;  2FSR A;  3PP9 A;  4G1P A;  2CY2 A;  2Q0Y A;  2ZEL A;  4UIB A;  1XMT A;  4KVM E;  2HV2 A;  1ZO0 A;  3W91 A;  3TE4 A;  4NFR A;  2AE6 A;  1XFO A;  2HQY A;  2V77 A;  3CT9 A;  1YLO A;  4IUS A;  3EY5 A;  1OZP A;  3T9Y A;  1LAM A;  2Q4Z A;  4E0A A;  1PUA A;  3F0A A;  2REE A;  2YNC C;  2ATR A;  3TO7 A;  2PJB A;  3MN8 A;  4XNH B;  4P4J A;  2WPW A;  3IEH A;  4ZBG A;  3CXQ A;  4MMO A;  3V7Z A;  4MI4 A;  2OR4 A;  3VWE A;  4Z65 A;  1VKC A;  1EE3 P;  3KR5 A;  4DJL A;  1L0C A;  2GRE A;  2R1I A;  4IAV A;  5IV0 A;  2BO9 A;  1VGY A;  5AG7 A;  2BCO A;  4BD9 A;  4MCQ A;  3PBB A;  4PQA A; 
#chains in the Genus database with same CATH homology
 4BBH A;  3H4Q A;  3H5Z A;  4NSQ A;  1IIC A;  3OWC A;  1IID A;  3TTH A;  4B10 A;  4B14 A;  4KZT A;  4ONU A;  4OAE A;  4Q38 A;  4B5P B;  4ZGY B;  1B87 A;  4B13 A;  3CXS A;  4JJX A;  2Q04 A;  2KCW A;  1BO4 A;  2QIR A;  5H86 A;  4C68 A;  4UFW A;  4NF1 A;  5DWN A;  3A9L A;  4FD6 A;  2Z3N A;  1CM0 A;  2VI7 A;  4CYQ A;  1U6M A;  2Z10 A;  2Q4Y A;  5JPH A;  3DR8 A;  1P0H A;  4AVC A;  3R9G A;  2JLM A;  2BSW A;  1N71 A;  1XEB A;  4JXR A;  4UA3 A;  4C2Z A;  4A2Z A;  3SHP A;  4KUA A;  2Z3M A;  5FVJ A;  5F47 A;  4KUB A;  4KOR A;  2VZY A;  3EC4 A;  5IB0 A;  1Q2Y A;  4KVO E;  3B8G A;  5HMN A;  5KTA A;  2GAN A;  2EUI A;  2FIA A;  1YR0 A;  4NEX A;  1NSL A;  3JTK A;  2YND A;  2WUU A;  3PGP A;  2FXF A;  2P0W A;  2FCK A;  2OB0 A;  2I00 A;  4DNC A;  4A32 A;  4KOV A;  1YVO A;  4FD7 A;  4UBR A;  4A95 A;  5CNP A;  2JEV A;  4B5P A;  2JDC A;  2ZW4 A;  3QB8 A;  1QSM A;  4LUA A;  4KOU A;  4M85 A;  2Z11 A;  2YNC A;  2VQY A;  4MFQ A;  3IU1 A;  4ORF A;  5AG6 A;  1I21 A;  2X7B A;  3JUW A;  2J8N A;  3ZJ0 A;  5AGE A;  1QST A;  4JWP A;  2GIV A;  3IGR A;  3F8K A;  2VZZ A;  4HNY B;  2FE7 A;  2Q4V A;  3DSB A;  4NCZ A;  1R57 A;  5JQ4 A;  4UFV A;  3TO6 A;  1S7F A;  4C7H A;  4MBU A;  1S3Z A;  2J8R A;  4JLY A;  4YGO A;  1YGH A;  3W6S A;  1Z4E A;  4B12 A;  3IWG A;  4RI1 A;  4X5K A;  2OU2 A;  5E96 A;  4HNW B;  4CAE A;  3R9F A;  4M3S A;  2OH1 A;  3C26 A;  2OZU A;  1KUY A;  4CGM A;  3JVN A;  3N7Z A;  3RYO A;  1RO5 A;  2Y0M A;  2REF A;  5BWA B;  2J8M A;  4R9M A;  2EVN A;  4OLL A;  4Q36 A;  3SXN A;  4C7I A;  3V8I A;  5F49 A;  4R57 A;  4MY0 A;  1Z4R A;  2WPX A;  1K4J A;  1VHS A;  4KOY A;  4UCM A;  4U5Y A;  2A4N A;  4CGO A;  4CYN A;  2G3A A;  2VXK A;  1MJ9 A;  1XE4 A;  4Y49 C;  2BEI A;  4B5O A;  2PR1 A;  1NMT A;  4MFP A;  1M44 A;  1LRZ A;  4CAW A;  2D4O A;  1KZF A;  2NMT A;  1IB1 E;  3S6K A;  4CAF A;  1I12 A;  5EBV A;  3I3G A;  3KKW A;  1IYK A;  4CGL A;  3GKR A;  1MJA A;  2ZPA A;  4KS9 A;  4KSF A;  4PSX A;  1GHE A;  2PSW A;  4F0Y A;  3BLN A;  4E8O A;  1S7L A;  4U9Z A;  2DXQ A;  2H5M A;  3R95 A;  4Y49 B;  2I79 A;  1PU9 A;  2Z3L A;  5G1Z A;  4NXY A;  5ISV A;  4CRZ B;  2PRB A;  5I0C A;  3LOD A;  4PV6 A;  4QUS A;  2R98 A;  4CRY B;  3CXP A;  2VEZ A;  3P2F A;  2C27 A;  3DDD A;  1TIQ A;  2VBQ A;  1BOB A;  2JDD A;  3E0K A;  4UFX A;  2PC1 A;  3NE7 A;  3EXN A;  4MHD A;  5A28 A;  1M1D A;  3FBU A;  3DNS A;  1KUV A;  2Z3K A;  3TT2 A;  2Q7B A;  4A31 A;  1IYL A;  1QSO A;  5J8F A;  4GS4 A;  3FYN A;  2BUE A;  2OZH A;  1KUX A;  1Q2C A;  4BMH A;  4FD5 A;  3D8P A;  4FD4 A;  4AG7 A;  3IU2 A;  2ZW5 A;  4A30 A;  2B4D B;  2CNT A;  5G21 A;  5H84 A;  4MJ8 A;  5IX3 A;  4IF5 A;  2FS5 A;  5AG5 A;  3D2M A;  5F48 A;  4AB7 A;  4CAX A;  3WR7 A;  1S7K A;  1Q2D A;  2DPT A;  1WK4 A;  4UCP A;  4CYO A;  1XF8 A;  3R96 A;  2AJ6 A;  3PZJ A;  2B3V A;  1V0C A;  4UCN A;  1Z9U A;  1QSN A;  2G3T A;  4HNX B;  3W6X A;  4KOX A;  1S7N A;  5F46 A;  4PK2 A;  1YLE A;  4UWJ A;  3DR6 A;  4OAD A;  4JD6 A;  4MFL A;  3MGD A;  3TCV A;  2R7H A;  3SXO A;  1S5K A;  3S6F A;  4XPD C;  4QVT A;  4C2X A;  4MY3 A;  4CGP A;  1YVK A;  4KOW A;  5GCN A;  2B4B A;  3TOB A;  2RC4 A;  4I49 A;  4YFJ A;  4UWI A;  3FIX A;  4XPK A;  5KTD A;  4H89 A;  1YRE A;  4YRH A;  2OZG A;  2Z3P A;  3D3S A;  4PK3 A;  1QSR A;  3D2P A;  1RXT A;  2ZW7 A;  2R8V A;  4AVB A;  3I9S A;  1SQH A;  3G3S A;  1ON0 A;  3VWD A;  4L89 A;  5AG4 A;  2ARH A;  3S6G A;  3LD2 A;  4H6U A;  1XIX A;  5C88 A;  3G8W A;  4CAV A;  1Y7R A;  2B3U A;  1UFH A;  4K30 A;  2YGW A;  3IWE A;  4XPD B;  2B4D A;  3EFA A;  4KOT A;  2B5G B;  1Y9W A;  4R3L A;  4II9 A;  1WWZ A;  4RS2 A;  4A33 A;  2O28 A;  1M4D A;  1P4N A;  3QAH A;  2D4P A;  2ZW6 A;  4AG9 A;  4KOS A;  2PDO A;  2FT0 A;  3FXT A;  2ZXV A;  3UY5 A;  4EVY A;  3FB3 A;  2PQ8 A;  1I1D A;  1M4I A;  4U9Y A;  4KSA A;  1MK4 A;  3FNC A;  4QB9 A;  4J3G A;  4LX9 A;  3P2H A;  5C82 A;  1FY7 A;  3T90 A;  5A27 A;  1YK3 A;  4KVX A;  2P6F A;  2CNS A;  1Y9K A;  3ZZI A;  4QC6 A;  4MFK A;  5J8C A;  3K9U A;  2HUZ A;  1CJW A;  4KLV A;  2P6E A;  2WSA A;  4CGN A;  4H6Z A;  5HH1 A;  4KLW A;  2YNE A;  1M4G A;  4CYP A;  2PR8 A;  4HKF A;  3TOA A;  4PSW A;  4AVA A;  1J4J A;  1S60 A;  1YX0 A;  4E2A A;  4F0X A;  3BJ8 A;  4XPL A;  2B58 A;  5DWM A;  3TFY A;  5EC4 A;  4JXQ A;  2Q44 A;  4MFZ A;  2FIW A;  3F5B A;  4R87 A;  2B5G A;  2BL1 A;  2CXA A;  2P6G A;  4C2Y A;  4B11 A;  2QEC A;  2Z3O A;  3FRM A;  4L8A A;  3TO9 A;  2GE3 A;  3GY9 A;  3GYA A;  1MJB A;  4XNH C;  1B6B A;  2F5I A;  4F6A A;  3R9E A;  4MFJ A;  2CNM A;  3S6H A;  2K5T A;  3EO4 A;  2Z0Z A;  3BJ7 A;  5G20 A;  2G0B A;  4R3K A;  2QML A;  1NE9 A;  5G22 A;  2FL4 A;  2DPS A;  2IL4 A;  4QBJ A;  3R1K A;  4CS0 B;  2FSR A;  3PP9 A;  5KTC A;  2CY2 A;  2Q0Y A;  1XMT A;  4KVM E;  2HV2 A;  1ZO0 A;  3W91 A;  3TE4 A;  2AE6 A;  2HQY A;  4IUS A;  3EY5 A;  1OZP A;  3T9Y A;  4E0A A;  1PUA A;  3F0A A;  2REE A;  2YNC C;  2ATR A;  3TO7 A;  4XNH B;  2WPW A;  4ZBG A;  3CXQ A;  4MI4 A;  3VWE A;  1VKC A;  1L0C A;  2R1I A;  5IV0 A;  5AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...