3IWGA

Acetyltransferase from gnat family from colwellia psychrerythraea.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
268
Chain Sequence
FKIKTIESLSDLTQLKKAYFDSSIVPLDGMWHFGFAPMAKHFGFYVNKNLVGFCCVNDDGYLLQYYLQPEFQLCSQELFTLISQQNSSVIGEVKGAFVSTAELNYQALCLDNSATFKVNSLMYQHNTKLANLEMIDMQIAGTEQLTAFVTFAAANIGAPEQWLTQYYGNLIERKELFGYWHKGKLLAAGECRLFDQYQTEYADLGMIVAQSNRGQGIAKKVLTFLTKHAATQGLTSICSTESNNVAAQKAIAHAGFTSAHRIVQFEFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title X-ray crystal structure of Acetyltransferase from GNAT family from Colwellia psychrerythraea.
rcsb
source organism Colwellia psychrerythraea
molecule tags Transferase
total genus 78
structure length 268
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF18015 Acetyltransf_19 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA02
3.40.630.80 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA01
2A4NA 4QB9A 3S6FA 4OADA 5E96A 5DWNA 2AJ6A 2K5TA 4FD4A 5F48A 3TOAA 2VEZA 4U9YA 1YREA 2FIWA 5JPHA 5C88A 2NMTA 2B5GA 4JWPA 2G3AA 4LX9A 2RC4A 1S7FA 4ZBGA 2R1IA 3KKWA 4E8OA 3SXNA 1OZPA 2P6GA 1RO5A 1S7LA 1IIDA 1QSOA 1J4JA 2WPWA 2R8VA 2Q0YA 5F49A 4HNWB 4KLVA 1MJBA 3D2PA 2F5IA 4QC6A 3D3SA 1MJAA 2CNSA 3CXQA 4KVXA 4RS2A 3ZZIA 3F0AA 1BO4A 2HUZA 5KTCA 1U6MA 4KOXA 2H5MA 2ZXVA 4KOWA 5CNPA 1WWZA 3MGDA 4XPDC 3TT2A 3R9FA 3R95A 1IYLA 1Y9KA 4XPDB 1S3ZA 2PRBA 3QB8A 1UFHA 2ATRA 4AVAA 4KOSA 1LRZA 4JJXA 2Z0ZA 2JEVA 3E0KA 4KORA 4ORFA 4QVTA 1R57A 5EC4A 1YVOA 3FIXA 4UA3A 2VZZA 4H6ZA 3TCVA 4XNHC 4NF1A 2ZW4A 4OAEA 4XNHB 1CM0A 5J8FA 4R3LA 1P0HA 3VWEA 1Q2CA 2P6EA 4MY3A 1QSTA 1S7NA 4MY0A 2PQ8A 3FB3A 4UWJA 5F47A 3F8KA 2B5GB 4PK2A 1Z4RA 1PU9A 1Q2YA 2GANA 1M44A 4MHDA 4UWIA 4NCZA 4LUAA 1GHEA 2OH1A 3R96A 1VHSA 3H4QA 4XPLA 4QBJA 4JXQA 1I21A 2VZYA 4Y49C 5GCNA 2FSRA 1S60A 2FE7A 3B8GA 2B58A 4PK3A 2EVNA 3W6XA 2O28A 2QIRA 3BJ8A 4OLLA 4KVOE 4B5PA 4AB7A 1Q2DA 2J8MA 5EBVA 5KTDA 2JDCA 3EC4A 2OZUA 5H86A 4KUAA 2GIVA 4PSXA 1KUXA 3FBUA 2R7HA 4L8AA 3EO4A 4R87A 3FYNA 3V8IA 4KOUA 1XEBA 5IV0A 2B4BA 2FXFA 3TFYA 3GY9A 1Y7RA 4AVBA 4BMHA 2BL1A 1Z4EA 4QUSA 4ONUA 3TO9A 3DSBA 1B87A 2DXQA 3F5BA 2FIAA 1TIQA 3D2MA 3PZJA 1M1DA 2QMLA 2REEA 2PDOA 3PGPA 3SXOA 2I00A 1N71A 2Q4YA 5H84A 4II9A 4UBRA 3FXTA 3I9SA 4NEXA 4HNXB 3QAHA 4R3KA 4FD5A 3IWGA 2HQYA 2Q44A 3N7ZA 4H89A 1V0CA 1YR0A 4KLWA 1KUYA 2PR1A 4MI4A 1MK4A 2ZW7A 3EXNA 3W91A 2R98A 5JQ4A 4F0YA 1QSRA 3FNCA 1QSNA 2Q4VA 2REFA 2ZW6A 4B5OA 3CXSA 5ISVA 2OU2A 1QSMA 3LD2A 1FY7A 1SQHA 4FD6A 4R9MA 2B3VA 5HMNA 2OB0A 3G8WA 3T9YA 1I1DA 2EUIA 1I12A 3EFAA 4JD6A 2BEIA 1YLEA 3G3SA 3CXPA 3TO6A 5C82A 4B5PB 3IGRA 1MJ9A 1M4GA 4KOTA 1YVKA 2PC1A 3ZJ0A 4AG9A 4CRYB 2VBQA 4H6UA 4CS0B 3RYOA 3BLNA 3SHPA 1P4NA 4XPKA 3C26A 2B3UA 2G3TA 3DDDA 3DR6A 1IYKA 2VI7A 4U5YA 3EY5A 1KUVA 4KUBA 4PSWA 2Q04A 4AVCA 3S6HA 1VKCA 4JLYA 4Y49B 4KVME 1B6BA 4I49A 3GYAA 2CY2A 4J3GA 2FL4A 1S5KA 4PV6A 2J8RA 2QECA 3PP9A 4FD7A 3K9UA 4KOVA 2JDDA 4EVYA 1PUAA 1S7KA 3DR8A 5DWMA 5I0CA 2IL4A 1NSLA 3UY5A 3TTHA 3LODA 5IX3A 3TO7A 2B4DA 3P2HA 4M3SA 3S6KA 1XE4A 3P2FA 2X7BA 4HNYB 2VXKA 1WK4A 4CRZB 2FCKA 2PSWA 2BSWA 2WPXA 3DNSA 3JUWA 4CAXA 4MJ8A 3VWDA 4E2AA 3W6SA 2G0BA 1IICA 1NE9A 2Y0MA 2CNTA 2Z11A 4KZTA 4IUSA 2Z10A 1Z9UA 2OZGA 4YFJA 2ZPAA 1K4JA 2JLMA 3GKRA 3NE7A 5KTAA 3JVNA 2HV2A 4CAVA 2FT0A 3T90A 4L89A 4NXYA 1IB1E 4RI1A 1BOBA 4F6AA 1RXTA 3I3GA 4CAWA 2P6FA 1M4DA 4HKFA 2I79A 1XF8A 4YRHA 3S6GA 3WR7A 1XMTA 1KZFA 1ON0A 3R1KA 5IB0A 3TE4A 2OZHA 2BUEA 1YK3A 3R9EA 1M4IA 1YGHA 4AG7A 2AE6A 1Y9WA 1XIXA 2D4PA 2C27A 2GE3A 4M85A 2P0WA 4X5KA 2FS5A 2CNMA 1NMTA 1YX0A 3BJ7A 4KOYA 4R57A 5J8CA 2ARHA 1L0CA 4E0AA 4DNCA 5FVJA 4NSQA 3FRMA 2D4OA 2J8NA 4IF5A 2KCWA 2Q7BA 5HH1A 3TOBA 2VQYA 4U9ZA 4GS4A 3R9GA 2B4DB 4YGOA 4K30A 3D8PA 1CJWA 2PR8A 3OWCA 4MBUA 2ZW5A 5F46A 4JXRA
chains in the Genus database with same CATH superfamily
1HEEA 2A4NA 2EWBA 3VATA 4QB9A 4DJLA 3S6FA 3NH8A 4OADA 5E96A 3RAMA 3SJGA 5DWNA 2AJ6A 5HXDA 2K5TA 1JQGA 4MHYA 4ZX9A 2FVGA 3CT9A 4CGLA 1HDQA 1JWQA 4C68A 4OC1A 3H8EA 4P4EA 4C2ZA 3IC1A 4FD4A 5F48A 3TOAA 3FEEA 4C2YA 2VEZA 4U9YA 2PJ4A 1AMPA 1QMUA 2V8HA 1YREA 1Z5RA 2FIWA 4X3RA 5JPHA 5C88A 2NMTA 2B5GA 2RB7A 3D67A 4JWPA 2G3AA 4LX9A 3WC5A 2Q7SA 4Q38A 2RC4A 5CBMA 3GIUA 3VH9A 5J1QA 1IY7A 1S7FA 2F8HA 4ZBGA 2R1IA 4OIDA 3KKWA 4E8OA 3SXNA 3B3VA 2Z3MA 4R6TA 1OZPA 1LAMA 2P6GA 1RO5A 4MFPA 1S7LA 3MN8A 1IIDA 4P4JA 1QSOA 4R76A 4C2XA 1J4JA 3MRUA 2WPWA 2R8VA 5G20A 3IO1A 2Q0YA 5F49A 4HNWB 4KLVA 1MJBA 5CPAA 4MFLA 3SJFA 3D2PA 1CP6A 2Z3NA 5LRGA 4MRIA 2F5IA 4QC6A 3D3SA 1MJAA 2PJ5A 3S9NA 2PIZA 2CNSA 3CXQA 1M4LA 4JYWA 4KVXA 3V7ZA 4RS2A 3ZZIA 2HB6A 1HDUA 4A37A 2AFWA 3VARA 3F0AA 1BO4A 2HUZA 4UIBA 3B2YA 5KTCA 1U6MA 4OC0A 1YMEA 4KOXA 3QNVA 1LOKA 4MMOA 3V38A 2H5MA 2ZXVA 3PB8X 2ZEHA 4HPSA 4KOWA 4FAIA 5K8OA 3GLJA 5CNPA 1WWZA 1X10A 3MGDA 2IMOA 1XFOA 2BOAA 4MHZA 4XPDC 4C7HA 4UEFA 3TT2A 2CXAA 1FNOA 3R9FA 3R95A 4CAFA 5HVHA 1IYLA 4MFKA 1Y9KA 1TKFA 3DGVA 4XPDB 3S9LA 1S3ZA 2PJ7A 4BINA 2PRBA 3H8FA 3QB8A 4C7IA 4LQ6A 1UFHA 3IU2A 2ZEDA 3GUXA 4NJRA 2C6GA 2AFMA 2O4HA 2RFHA 1AYEA 2ATRA 4AVAA 1KWMA 4KOSA 4MFQA 2ZEPA 4CGPA 1EE3P 3GB0A 1LRZA 3WT4A 4JJXA 2Z0ZA 1ZLHA 5ELYA 1Y0YA 1YW6A 2JEVA 3E0KA 4KORA 4ORFA 4KS9A 4QVTA 2CTBA 1R57A 5EC4A 1YVOA 3FIXA 4CYNA 2I3CA 2C6CA 4UA3A 2VZZA 4H6ZA 5LYLA 3TCVA 2BCOA 4XNHC 2ZEOA 4NF1A 2ZW4A 2ZEEA 4OAEA 3HLPA 4XNHB 1CM0A 3WC6A 5J8FA 4R3LA 3KR5A 1P0HA 3JTKA 4ONWA 3VWEA 2F7VA 4A94A 4ZGYB 1Q2CA 1YQEA 2P6EA 3PEIA 4MY3A 1QSTA 1S7NA 4KSIA 4KSAA 5D29A 4PXDA 5G21A 4B14A 4BD9A 4MY0A 4Q36A 2PQ8A 3FB3A 2IJZA 4UWJA 3D7HA 5F47A 3KGQA 1LFWA 3F8KA 3CPXA 2B5GB 4PK2A 2XEJA 1Z4RA 1PU9A 1Q2YA 2GANA 1M44A 1X12A 2ZEGA 5A28A 2PRQA 4MHDA 4OC2A 3FMCA 4UWIA 4CGMA 4NCZA 1BAVA 4LUAA 1GHEA 3RBUA 1IGBA 3KI9A 2OH1A 3R96A 1VHSA 3H4QA 4X2TA 3H5ZA 4XPLA 2XEGA 4QBJA 3K2KA 1F2OA 4EWTA 4F9VA 1BPNA 1CPXA 1I21A 4JXQA 2Z3OA 2VZYA 4Y49C 5GCNA 3PB6X 4EMEA 3IEHA 2FSRA 4UCPA 1S60A 2FE7A 4WWVA 2PJ2A 4CAEA 3B8GA 1YLOA 4PQAA 1BPMA 2ZOFA 2B58A 2PJ1A 4NGPA 3B3TA 2EVNA 4PK3A 3W6XA 2O28A 2QIRA 3B35A 3BJ8A 4OLLA 3SJEA 1XBUA 3CDXA 4KVOE 4B13A 4B5PA 1H8LA 3PB4X 1OBRA 4AB7A 1XMBA 3B7IA 3TC8A 1Q2DA 2ABZA 4OC5A 4DUKA 4UCMA 4ZY2A 2J8MA 1F2PA 4CYPA 3HUVA 4NGQA 5EBVA 1Z2LA 5KTDA 2JDCA 3EC4A 1TF8A 2OZUA 3IU1A 5H86A 5AG6A 2ZOGA 4KUAA 4OC4A 3D7FA 2GIVA 4EFDA 4PSXA 1KUXA 5K8PA 3FBUA 3B3SA 1DTDA 4MFJA 2GU2A 2R7HA 1UWYA 4OP4A 4B11A 3FF3A 3I1UA 4IAVA 4L8AA 4A30A 4ZI6A 3BI0A 4MCQA 4AXVA 3SI2A 3EO4A 4CYQA 1BLLE 4JZ0A 3FYNA 4R87A 4IK2A 3V8IA 4CPAA 4KOUA 3T8WA 1XEBA 5IV0A 2B4BA 4PXBA 2FXFA 3TFYA 3CPAA 1ZG7A 2JBJA 3WC7A 1Q7LA 3GY9A 4M6HA 4NGRA 1Y7RA 4AVBA 2WSAA 4TWEA 1R43A 4OC3A 2BL1A 4UIAA 4MHNA 4BMHA 4KSFA 1Z4EA 7CPAA 4QUSA 2YNDA 4MCRA 4ONUA 4P45A 3TO9A 4ZYQA 3DSBA 1B87A 2DXQA 3D7GA 4RN7A 3F5BA 2FIAA 1VHOA 1VIXA 1TIQA 4P4BA 3D2MA 4UEEA 5HVGA 3PZJA 1DE4C 1M1DA 2PJBA 2QMLA 1ARLA 4G1PA 2REEA 2GREA 2J9AA 2PDOA 2ANPA 3B3CA 3PGPA 4F8ZA 3SXOA 3NH4A 2I00A 1ELLP 3PFOA 3B3WA 2PCUA 1N71A 4Z65A 3RZAA 2Q4YA 5H84A 1ZG8A 3D66A 4II9A 4UBRA 4UFVA 3FXTA 3D4UA 2PIYA 3I9SA 2Q43A 1CPSA 4NEXA 4P44A 3KHXA 4HNXB 3QAHA 3FVLA 4R3KA 4FD5A 3S9MA 3IWGA 2QJ8A 3LMSA 2Z3KA 3KQXA 2DPTA 2HQYA 2Q44A 3FX6A 4P4DA 1Z8LA 3N7ZA 2GLFA 1CG2A 1V0CA 2QYVA 2WUUA 1AUGA 1VHEA 1YR0A 4H89A 4KLWA 4X8IA 5G1ZA 1KUYA 2PR1A 4MI4A 4A32A 1MK4A 2C6PA 3JRUA 1IU8A 3FECA 1Y0RA 2ZW7A 3DLJA 4R8FA 4A31A 3EXNA 2PJ8A 3W91A 2PJ6A 2AFSA 2R98A 2PE3A 5JQ4A 3L2NA 3KASA 5HVFA 2ZEFA 4Q7AA 4F0XA 4F0YA 1A2ZA 4P4FA 4RUHA 1QSRA 3IWEA 2ZELA 3CZXA 3FNCA 1QSNA 1YW4A 2Q4VA 2AFUA 2REFA 3BI1A 3PBEA 2ZW6A 3ISZA 5AG7A 4B5OA 2PJ3A 3CXSA 5ISVA 2OU2A 1ZO0A 1QSMA 3LD2A 1FY7A 1SQHA 4FD6A 4R9MA 4A39A 1TXRA 2B3VA 2XEIA 5HMNA 5IB9A 2OB0A 3G8WA 4M6GA 1LAPA 4CYOA 3T9YA 4FBEA 1I1DA 2EUIA 1I12A 2WZNA 3EFAA 4JD6A 2BEIA 1YLEA 3G3SA 3CXPA 1FT7A 3TO6A 2PJ9A 1XRYA 5C82A 4B5PB 8CPAA 2ODFA 3IGRA 1M4GA 1MJ9A 2BO9A 3KZWA 1YVKA 3FH4A 4KOTA 4UFWA 2PC1A 3ZJ0A 4AG9A 4CRYB 2VBQA 3PB7X 3KL9A 4H6UA 4P10A 4CS0B 3RYOA 3BLNA 3SHPA 3SI1A 1P4NA 4FWUA 3C26A 4XPKA 4H2KA 2B3UA 2G3TA 2EO8A 2YNCA 3DDDA 5AG5A 4ZY0A 3DR6A 1IYKA 2VI7A 4U5YA 3EY5A 1KUVA 4CGNA 3PRTA 4KUBA 1TKJA 4DYOA 4PSWA 2Q04A 1CX8A 4AVCA 3S6HA 1VKCA 2AFOA 4JLYA 3IIBA 4GM5A 4Y49B 4KVME 3PB9X 3NFZA 1B6BA 4I49A 5LYIA 3GYAA 5LRKA 2CY2A 1LCPA 2FL4A 1PYTB 1S5KA 1ARMA 2PVVA 4J3GA 4PV6A 4PXEA 3TX8A 2JEWA 4O23A 1XOVA 2EK9A 2J8RA 2QECA 3BHXA 3PP9A 2NSMA 4FD7A 3K9UA 2GFQA 2JDDA 4KOVA 4EVYA 1PUAA 3N5FA 5K8NA 1S7KA 3DR8A 4M6IA 5DWMA 4FUUA 5I0CA 5JGFA 2IL4A 3LWUA 1XJOA 1NSLA 3UY5A 3SI0A 3TTHA 3LODA 1VGYA 4UEZA 5IX3A 3QAYA 2PJAA 4PXCA 5LRJA 3TO7A 4B6ZA 2B4DA 3P2HA 4M3SA 3S6KA 5K8MA 3SJXA 4WJBA 3NH5A 3D68A 4MCSA 1XE4A 4A2ZA 3P2FA 2X7BA 1Z8XA 4HNYB 2VXKA 1WK4A 1YSJA 4CRZB 2QVPA 5D8NA 3H8GA 2FCKA 2CTCA 5EMIA 2PSWA 1LANA 3FEDA 4P4IA 2C1CA 1IOIA 2BSWA 2WPXA 3DNSA 2ZEMA 3JUWA 5F09A 4CAXA 1F57A 4MJ8A 3VWDA 5A27A 4A33A 4E2AA 3W6SA 2G0BA 1IICA 1NE9A 2Y0MA 2HC9A 2CNTA 2Z11A 4OIWA 4KZTA 4OMEA 4IUSA 3NE8A 2Z10A 2Z3LA 5AG4A 1Z9UA 2OZGA 4YFJA 2PVWA 2ZPAA 1K4JA 2JLMA 3GKRA 3NE7A 5LYDA 2OOTA 3JVNA 5KTAA 2HV2A 4CAVA 2EK8A 2V8GA 2FT0A 5JM6A 2IQ6A 3PFEA 4A95A 1Z8TA 4L89A 3T90A 4YWYA 4NXYA 1Y7EA 3IJ3A 1IB1E 5G22A 4RI1A 3KQZA 2DEAA 4NFRA 1BOBA 4F6AA 3WABA 3D7DA 1RXTA 3I3GA 4CAWA 2P6FA 5JH9A 2ZENA 5I4MA 1TKHA 2WYRA 4BBHA 2NYQA 1M4DA 3IWWA 4HKFA 5THWA 4K3NA 4UF4A 2I79A 1XF8A 4YRHA 3S6GA 3WR7A 4NGNA 1XMTA 1KZFA 2YNEA 1ON0A 3IFEA 4MXUA 2V8DA 1CP7A 3KR4A 3NA6A 3R1KA 5IB0A 3TE4A 2OZHA 4B10A 2BUEA 6CPAA 1YK3A 2V77A 4PPZA 2YGWA 3R9EA 2DPSA 1IOFA 1M4IA 1YGHA 1ZG9A 1ZLIA 2CIJA 3FJUA 1CBXA 2AE6A 4AG7A 4MFZA 1Y9WA 2CF4A 2YNCC 1XIXA 4F9UA 2XEFA 4IHMA 3LACA 2D4PA 2C27A 2GE3A 1RTQA 4M85A 2V8VA 2OR4A 5AGEA 2P0WA 4NGSA 4X5KA 4ZX8A 1QQ9A 1GYTA 2FS5A 4MHPA 4MCPA 2CNMA 4NGMA 2JBKA 1NMTA 1YX0A 3BJ7A 4KOYA 1PCAA 4R57A 4ZY1A 5J8CA 4GXHA 4A38A 2G9DA 2ARHA 1L0CA 3K9TA 4E0AA 5LYFA 2POKA 3BXMA 5FVJA 4NSQA 2O53A 4DNCA 3FRMA 3PBBA 2VL1A 2D4OA 2J8NA 2PJCA 4IF5A 4UFXA 2KCWA 4OKOA 4LQGA 4W9YA 5HH1A 3ISXA 2Q7BA 3RNZA 4NGTA 3TOBA 2AFXA 2Q4ZA 2VQYA 4UCNA 2GLJA 4U9ZA 1ELMP 1TF9A 4GS4A 1R3NA 4YU9A 2Z3PA 5DS0A 3R9GA 2B4DB 4YGOA 4K30A 3D8PA 2EBJA 1CJWA 4NJQA 2PR8A 2PJ0A 4CGOA 3KHZA 4P6YA 5BWAB 3OWCA 4B12A 4MBUA 4TNUA 2AFZA 2DF5A 2ZW5A 5F46A 3A9LA 3RO0A 4R7MA 1NSAA 2Q51A 4JXRA 1Z8WA
chains in the Genus database with same CATH topology
2A4NA 4QB9A 3S6FA 4OADA 5E96A 5DWNA 2AJ6A 2K5TA 4CGLA 4C68A 4C2ZA 4FD4A 5F48A 3TOAA 4C2YA 2VEZA 4U9YA 1YREA 2FIWA 5JPHA 5C88A 2NMTA 2B5GA 4JWPA 2G3AA 4LX9A 4Q38A 2RC4A 1S7FA 4ZBGA 2R1IA 3KKWA 4E8OA 3SXNA 2Z3MA 1OZPA 2P6GA 1RO5A 4MFPA 1S7LA 1IIDA 4C2XA 1QSOA 1J4JA 2WPWA 2R8VA 5G20A 2Q0YA 5F49A 4HNWB 4KLVA 1MJBA 4MFLA 3D2PA 2Z3NA 2F5IA 4QC6A 3D3SA 1MJAA 2CNSA 3CXQA 4KVXA 4RS2A 3ZZIA 3F0AA 1BO4A 2HUZA 5KTCA 1U6MA 4KOXA 2H5MA 2ZXVA 4KOWA 5CNPA 1WWZA 3MGDA 4XPDC 4C7HA 3TT2A 2CXAA 3R9FA 4CAFA 3R95A 1IYLA 4MFKA 1Y9KA 4XPDB 1S3ZA 2PRBA 3QB8A 4C7IA 1UFHA 3IU2A 2ATRA 4AVAA 4KOSA 4MFQA 1LRZA 4JJXA 2Z0ZA 2JEVA 3E0KA 4KORA 4ORFA 4KS9A 4QVTA 1R57A 5EC4A 1YVOA 3FIXA 4CYNA 4UA3A 2VZZA 4H6ZA 3TCVA 4XNHC 4NF1A 2ZW4A 4OAEA 4XNHB 1CM0A 5J8FA 4R3LA 1P0HA 3JTKA 4ZGYB 3VWEA 1Q2CA 2P6EA 4MY3A 1QSTA 1S7NA 4KSAA 4B14A 5G21A 4MY0A 4Q36A 2PQ8A 3FB3A 4UWJA 5F47A 3F8KA 2B5GB 4PK2A 1Z4RA 1PU9A 1Q2YA 2GANA 1M44A 5A28A 4MHDA 4UWIA 4CGMA 4NCZA 4LUAA 1GHEA 2OH1A 3R96A 1VHSA 3H4QA 4XPLA 3H5ZA 4QBJA 4JXQA 1I21A 2Z3OA 2VZYA 4Y49C 5GCNA 2FSRA 4UCPA 1S60A 2FE7A 4CAEA 3B8GA 2B58A 4PK3A 2EVNA 3W6XA 2O28A 2QIRA 3BJ8A 4OLLA 4KVOE 4B13A 4B5PA 4AB7A 1Q2DA 4UCMA 2J8MA 4CYPA 5EBVA 5KTDA 2JDCA 3EC4A 2OZUA 3IU1A 5H86A 5AG6A 4KUAA 2GIVA 4PSXA 1KUXA 3FBUA 4MFJA 2R7HA 4B11A 4L8AA 4A30A 3EO4A 4CYQA 4R87A 3FYNA 3V8IA 4KOUA 1XEBA 5IV0A 2B4BA 2FXFA 3TFYA 3GY9A 1Y7RA 4AVBA 2WSAA 4BMHA 2BL1A 4KSFA 1Z4EA 4QUSA 2YNDA 4ONUA 3TO9A 3DSBA 1B87A 2DXQA 3F5BA 2FIAA 1TIQA 3D2MA 3PZJA 1M1DA 2QMLA 2REEA 2PDOA 3PGPA 3SXOA 2I00A 1N71A 2Q4YA 5H84A 4II9A 4UBRA 4UFVA 3FXTA 3I9SA 4NEXA 4HNXB 3QAHA 4R3KA 4FD5A 3IWGA 2Z3KA 2DPTA 2HQYA 2Q44A 3N7ZA 4H89A 1V0CA 2WUUA 5G1ZA 1YR0A 4KLWA 4A32A 1KUYA 2PR1A 4MI4A 1MK4A 2ZW7A 4A31A 3EXNA 3W91A 2R98A 5JQ4A 4F0XA 4F0YA 1QSRA 3IWEA 3FNCA 1QSNA 2Q4VA 4CGPA 2REFA 5AG7A 2ZW6A 4B5OA 3CXSA 5ISVA 2OU2A 1ZO0A 1QSMA 3LD2A 1FY7A 1SQHA 4FD6A 4R9MA 2B3VA 5HMNA 2OB0A 3G8WA 4CYOA 3T9YA 1I1DA 2EUIA 1I12A 3EFAA 4JD6A 2BEIA 1YLEA 3G3SA 3CXPA 3TO6A 5C82A 4B5PB 3IGRA 1MJ9A 1M4GA 4KOTA 1YVKA 4UFWA 2PC1A 3ZJ0A 4AG9A 4CRYB 2VBQA 4H6UA 4CS0B 3RYOA 3BLNA 3SHPA 1P4NA 4XPKA 3C26A 5AG5A 2B3UA 2G3TA 2YNCA 3DDDA 3DR6A 1IYKA 2VI7A 4U5YA 3EY5A 1KUVA 4CGNA 4KUBA 4PSWA 2Q04A 4AVCA 3S6HA 1VKCA 4JLYA 4Y49B 4KVME 1B6BA 4I49A 3GYAA 2CY2A 4J3GA 2FL4A 1S5KA 4PV6A 2J8RA 2QECA 3PP9A 4FD7A 3K9UA 4KOVA 2JDDA 4EVYA 1PUAA 1S7KA 3DR8A 5DWMA 5I0CA 2IL4A 1NSLA 3UY5A 3TTHA 3LODA 5IX3A 3TO7A 2B4DA 3P2HA 4M3SA 3S6KA 1XE4A 4A2ZA 3P2FA 2X7BA 4HNYB 2VXKA 1WK4A 4CRZB 2FCKA 2PSWA 2BSWA 2WPXA 3DNSA 3JUWA 4CAXA 4MJ8A 3VWDA 5A27A 4A33A 4E2AA 3W6SA 2G0BA 1IICA 1NE9A 2Y0MA 2CNTA 2Z11A 4KZTA 4IUSA 2Z10A 2Z3LA 5AG4A 1Z9UA 2OZGA 4YFJA 2ZPAA 1K4JA 2JLMA 3GKRA 3NE7A 5KTAA 3JVNA 2HV2A 4CAVA 2FT0A 4A95A 3T90A 4L89A 4NXYA 1IB1E 5G22A 4RI1A 1BOBA 4F6AA 1RXTA 3I3GA 4CAWA 2P6FA 4BBHA 1M4DA 4HKFA 2I79A 1XF8A 4YRHA 3S6GA 3WR7A 1XMTA 1KZFA 2YNEA 1ON0A 3R1KA 5IB0A 3TE4A 2OZHA 4B10A 2BUEA 1YK3A 2YGWA 3R9EA 2DPSA 1M4IA 1YGHA 4AG7A 2AE6A 4MFZA 1Y9WA 2YNCC 1XIXA 2D4PA 2C27A 2GE3A 4M85A 5AGEA 2P0WA 4X5KA 2FS5A 2CNMA 1NMTA 1YX0A 3BJ7A 4KOYA 4R57A 5J8CA 2ARHA 1L0CA 4E0AA 4DNCA 5FVJA 4NSQA 3FRMA 2D4OA 2J8NA 4IF5A 4UFXA 2KCWA 2Q7BA 5HH1A 3TOBA 2VQYA 4UCNA 4U9ZA 4GS4A 2Z3PA 3R9GA 2B4DB 4YGOA 4K30A 3D8PA 1CJWA 2PR8A 4CGOA 5BWAB 3OWCA 4B12A 4MBUA 2ZW5A 5F46A 3A9LA 4JXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4N A;  4QB9 A;  3S6F A;  4OAD A;  5E96 A;  5DWN A;  2AJ6 A;  2K5T A;  4FD4 A;  5F48 A;  3TOA A;  2VEZ A;  4U9Y A;  1YRE A;  2FIW A;  5JPH A;  5C88 A;  2NMT A;  2B5G A;  4JWP A;  2G3A A;  4LX9 A;  2RC4 A;  1S7F A;  4ZBG A;  2R1I A;  3KKW A;  4E8O A;  3SXN A;  1OZP A;  2P6G A;  1RO5 A;  1S7L A;  1IID A;  1QSO A;  1J4J A;  2WPW A;  2R8V A;  2Q0Y A;  5F49 A;  4HNW B;  4KLV A;  1MJB A;  3D2P A;  2F5I A;  4QC6 A;  3D3S A;  1MJA A;  2CNS A;  3CXQ A;  4KVX A;  4RS2 A;  3ZZI A;  3F0A A;  1BO4 A;  2HUZ A;  5KTC A;  1U6M A;  4KOX A;  2H5M A;  2ZXV A;  4KOW A;  5CNP A;  1WWZ A;  3MGD A;  4XPD C;  3TT2 A;  3R9F A;  3R95 A;  1IYL A;  1Y9K A;  4XPD B;  1S3Z A;  2PRB A;  3QB8 A;  1UFH A;  2ATR A;  4AVA A;  4KOS A;  1LRZ A;  4JJX A;  2Z0Z A;  2JEV A;  3E0K A;  4KOR A;  4ORF A;  4QVT A;  1R57 A;  5EC4 A;  1YVO A;  3FIX A;  4UA3 A;  2VZZ A;  4H6Z A;  3TCV A;  4XNH C;  4NF1 A;  2ZW4 A;  4OAE A;  4XNH B;  1CM0 A;  5J8F A;  4R3L A;  1P0H A;  3VWE A;  1Q2C A;  2P6E A;  4MY3 A;  1QST A;  1S7N A;  4MY0 A;  2PQ8 A;  3FB3 A;  4UWJ A;  5F47 A;  3F8K A;  2B5G B;  4PK2 A;  1Z4R A;  1PU9 A;  1Q2Y A;  2GAN A;  1M44 A;  4MHD A;  4UWI A;  4NCZ A;  4LUA A;  1GHE A;  2OH1 A;  3R96 A;  1VHS A;  3H4Q A;  4XPL A;  4QBJ A;  4JXQ A;  1I21 A;  2VZY A;  4Y49 C;  5GCN A;  2FSR A;  1S60 A;  2FE7 A;  3B8G A;  2B58 A;  4PK3 A;  2EVN A;  3W6X A;  2O28 A;  2QIR A;  3BJ8 A;  4OLL A;  4KVO E;  4B5P A;  4AB7 A;  1Q2D A;  2J8M A;  5EBV A;  5KTD A;  2JDC A;  3EC4 A;  2OZU A;  5H86 A;  4KUA A;  2GIV A;  4PSX A;  1KUX A;  3FBU A;  2R7H A;  4L8A A;  3EO4 A;  4R87 A;  3FYN A;  3V8I A;  4KOU A;  1XEB A;  5IV0 A;  2B4B A;  2FXF A;  3TFY A;  3GY9 A;  1Y7R A;  4AVB A;  4BMH A;  2BL1 A;  1Z4E A;  4QUS A;  4ONU A;  3TO9 A;  3DSB A;  1B87 A;  2DXQ A;  3F5B A;  2FIA A;  1TIQ A;  3D2M A;  3PZJ A;  1M1D A;  2QML A;  2REE A;  2PDO A;  3PGP A;  3SXO A;  2I00 A;  1N71 A;  2Q4Y A;  5H84 A;  4II9 A;  4UBR A;  3FXT A;  3I9S A;  4NEX A;  4HNX B;  3QAH A;  4R3K A;  4FD5 A;  3IWG A;  2HQY A;  2Q44 A;  3N7Z A;  4H89 A;  1V0C A;  1YR0 A;  4KLW A;  1KUY A;  2PR1 A;  4MI4 A;  1MK4 A;  2ZW7 A;  3EXN A;  3W91 A;  2R98 A;  5JQ4 A;  4F0Y A;  1QSR A;  3FNC A;  1QSN A;  2Q4V A;  2REF A;  2ZW6 A;  4B5O A;  3CXS A;  5ISV A;  2OU2 A;  1QSM A;  3LD2 A;  1FY7 A;  1SQH A;  4FD6 A;  4R9M A;  2B3V A;  5HMN A;  2OB0 A;  3G8W A;  3T9Y A;  1I1D A;  2EUI A;  1I12 A;  3EFA A;  4JD6 A;  2BEI A;  1YLE A;  3G3S A;  3CXP A;  3TO6 A;  5C82 A;  4B5P B;  3IGR A;  1MJ9 A;  1M4G A;  4KOT A;  1YVK A;  2PC1 A;  3ZJ0 A;  4AG9 A;  4CRY B;  2VBQ A;  4H6U A;  4CS0 B;  3RYO A;  3BLN A;  3SHP A;  1P4N A;  4XPK A;  3C26 A;  2B3U A;  2G3T A;  3DDD A;  3DR6 A;  1IYK A;  2VI7 A;  4U5Y A;  3EY5 A;  1KUV A;  4KUB A;  4PSW A;  2Q04 A;  4AVC A;  3S6H A;  1VKC A;  4JLY A;  4Y49 B;  4KVM E;  1B6B A;  4I49 A;  3GYA A;  2CY2 A;  4J3G A;  2FL4 A;  1S5K A;  4PV6 A;  2J8R A;  2QEC A;  3PP9 A;  4FD7 A;  3K9U A;  4KOV A;  2JDD A;  4EVY A;  1PUA A;  1S7K A;  3DR8 A;  5DWM A;  5I0C A;  2IL4 A;  1NSL A;  3UY5 A;  3TTH A;  3LOD A;  5IX3 A;  3TO7 A;  2B4D A;  3P2H A;  4M3S A;  3S6K A;  1XE4 A;  3P2F A;  2X7B A;  4HNY B;  2VXK A;  1WK4 A;  4CRZ B;  2FCK A;  2PSW A;  2BSW A;  2WPX A;  3DNS A;  3JUW A;  4CAX A;  4MJ8 A;  3VWD A;  4E2A A;  3W6S A;  2G0B A;  1IIC A;  1NE9 A;  2Y0M A;  2CNT A;  2Z11 A;  4KZT A;  4IUS A;  2Z10 A;  1Z9U A;  2OZG A;  4YFJ A;  2ZPA A;  1K4J A;  2JLM A;  3GKR A;  3NE7 A;  5KTA A;  3JVN A;  2HV2 A;  4CAV A;  2FT0 A;  3T90 A;  4L89 A;  4NXY A;  1IB1 E;  4RI1 A;  1BOB A;  4F6A A;  1RXT A;  3I3G A;  4CAW A;  2P6F A;  1M4D A;  4HKF A;  2I79 A;  1XF8 A;  4YRH A;  3S6G A;  3WR7 A;  1XMT A;  1KZF A;  1ON0 A;  3R1K A;  5IB0 A;  3TE4 A;  2OZH A;  2BUE A;  1YK3 A;  3R9E A;  1M4I A;  1YGH A;  4AG7 A;  2AE6 A;  1Y9W A;  1XIX A;  2D4P A;  2C27 A;  2GE3 A;  4M85 A;  2P0W A;  4X5K A;  2FS5 A;  2CNM A;  1NMT A;  1YX0 A;  3BJ7 A;  4KOY A;  4R57 A;  5J8C A;  2ARH A;  1L0C A;  4E0A A;  4DNC A;  5FVJ A;  4NSQ A;  3FRM A;  2D4O A;  2J8N A;  4IF5 A;  2KCW A;  2Q7B A;  5HH1 A;  3TOB A;  2VQY A;  4U9Z A;  4GS4 A;  3R9G A;  2B4D B;  4YGO A;  4K30 A;  3D8P A;  1CJW A;  2PR8 A;  3OWC A;  4MBU A;  2ZW5 A;  5F46 A;  4JXR A; 
#chains in the Genus database with same CATH topology
 1HEE A;  2A4N A;  2EWB A;  3VAT A;  4QB9 A;  4DJL A;  3S6F A;  3NH8 A;  4OAD A;  5E96 A;  3RAM A;  3SJG A;  5DWN A;  2AJ6 A;  5HXD A;  2K5T A;  1JQG A;  4MHY A;  4ZX9 A;  2FVG A;  3CT9 A;  4CGL A;  1HDQ A;  1JWQ A;  4C68 A;  4OC1 A;  3H8E A;  4P4E A;  4C2Z A;  3IC1 A;  4FD4 A;  5F48 A;  3TOA A;  3FEE A;  4C2Y A;  2VEZ A;  4U9Y A;  2PJ4 A;  1AMP A;  1QMU A;  2V8H A;  1YRE A;  1Z5R A;  2FIW A;  4X3R A;  5JPH A;  5C88 A;  2NMT A;  2B5G A;  2RB7 A;  3D67 A;  4JWP A;  2G3A A;  4LX9 A;  3WC5 A;  2Q7S A;  4Q38 A;  2RC4 A;  5CBM A;  3GIU A;  3VH9 A;  5J1Q A;  1IY7 A;  1S7F A;  2F8H A;  4ZBG A;  2R1I A;  4OID A;  3KKW A;  4E8O A;  3SXN A;  3B3V A;  2Z3M A;  4R6T A;  1OZP A;  1LAM A;  2P6G A;  1RO5 A;  4MFP A;  1S7L A;  3MN8 A;  1IID A;  4P4J A;  1QSO A;  4R76 A;  4C2X A;  1J4J A;  3MRU A;  2WPW A;  2R8V A;  5G20 A;  3IO1 A;  2Q0Y A;  5F49 A;  4HNW B;  4KLV A;  1MJB A;  5CPA A;  4MFL A;  3SJF A;  3D2P A;  1CP6 A;  2Z3N A;  5LRG A;  4MRI A;  2F5I A;  4QC6 A;  3D3S A;  1MJA A;  2PJ5 A;  3S9N A;  2PIZ A;  2CNS A;  3CXQ A;  1M4L A;  4JYW A;  4KVX A;  3V7Z A;  4RS2 A;  3ZZI A;  2HB6 A;  1HDU A;  4A37 A;  2AFW A;  3VAR A;  3F0A A;  1BO4 A;  2HUZ A;  4UIB A;  3B2Y A;  5KTC A;  1U6M A;  4OC0 A;  1YME A;  4KOX A;  3QNV A;  1LOK A;  4MMO A;  3V38 A;  2H5M A;  2ZXV A;  3PB8 X;  2ZEH A;  4HPS A;  4KOW A;  4FAI A;  5K8O A;  3GLJ A;  5CNP A;  1WWZ A;  1X10 A;  3MGD A;  2IMO A;  1XFO A;  2BOA A;  4MHZ A;  4XPD C;  4C7H A;  4UEF A;  3TT2 A;  2CXA A;  1FNO A;  3R9F A;  3R95 A;  4CAF A;  5HVH A;  1IYL A;  4MFK A;  1Y9K A;  1TKF A;  3DGV A;  4XPD B;  3S9L A;  1S3Z A;  2PJ7 A;  4BIN A;  2PRB A;  3H8F A;  3QB8 A;  4C7I A;  4LQ6 A;  1UFH A;  3IU2 A;  2ZED A;  3GUX A;  4NJR A;  2C6G A;  2AFM A;  2O4H A;  2RFH A;  1AYE A;  2ATR A;  4AVA A;  1KWM A;  4KOS A;  4MFQ A;  2ZEP A;  4CGP A;  1EE3 P;  3GB0 A;  1LRZ A;  3WT4 A;  4JJX A;  2Z0Z A;  1ZLH A;  5ELY A;  1Y0Y A;  1YW6 A;  2JEV A;  3E0K A;  4KOR A;  4ORF A;  4KS9 A;  4QVT A;  2CTB A;  1R57 A;  5EC4 A;  1YVO A;  3FIX A;  4CYN A;  2I3C A;  2C6C A;  4UA3 A;  2VZZ A;  4H6Z A;  5LYL A;  3TCV A;  2BCO A;  4XNH C;  2ZEO A;  4NF1 A;  2ZW4 A;  2ZEE A;  4OAE A;  3HLP A;  4XNH B;  1CM0 A;  3WC6 A;  5J8F A;  4R3L A;  3KR5 A;  1P0H A;  3JTK A;  4ONW A;  3VWE A;  2F7V A;  4A94 A;  4ZGY B;  1Q2C A;  1YQE A;  2P6E A;  3PEI A;  4MY3 A;  1QST A;  1S7N A;  4KSI A;  4KSA A;  5D29 A;  4PXD A;  5G21 A;  4B14 A;  4BD9 A;  4MY0 A;  4Q36 A;  2PQ8 A;  3FB3 A;  2IJZ A;  4UWJ A;  3D7H A;  5F47 A;  3KGQ A;  1LFW A;  3F8K A;  3CPX A;  2B5G B;  4PK2 A;  2XEJ A;  1Z4R A;  1PU9 A;  1Q2Y A;  2GAN A;  1M44 A;  1X12 A;  2ZEG A;  5A28 A;  2PRQ A;  4MHD A;  4OC2 A;  3FMC A;  4UWI A;  4CGM A;  4NCZ A;  1BAV A;  4LUA A;  1GHE A;  3RBU A;  1IGB A;  3KI9 A;  2OH1 A;  3R96 A;  1VHS A;  3H4Q A;  4X2T A;  3H5Z A;  4XPL A;  2XEG A;  4QBJ A;  3K2K A;  1F2O A;  4EWT A;  4F9V A;  1BPN A;  1CPX A;  1I21 A;  4JXQ A;  2Z3O A;  2VZY A;  4Y49 C;  5GCN A;  3PB6 X;  4EME A;  3IEH A;  2FSR A;  4UCP A;  1S60 A;  2FE7 A;  4WWV A;  2PJ2 A;  4CAE A;  3B8G A;  1YLO A;  4PQA A;  1BPM A;  2ZOF A;  2B58 A;  2PJ1 A;  4NGP A;  3B3T A;  2EVN A;  4PK3 A;  3W6X A;  2O28 A;  2QIR A;  3B35 A;  3BJ8 A;  4OLL A;  3SJE A;  1XBU A;  3CDX A;  4KVO E;  4B13 A;  4B5P A;  1H8L A;  3PB4 X;  1OBR A;  4AB7 A;  1XMB A;  3B7I A;  3TC8 A;  1Q2D A;  2ABZ A;  4OC5 A;  4DUK A;  4UCM A;  4ZY2 A;  2J8M A;  1F2P A;  4CYP A;  3HUV A;  4NGQ A;  5EBV A;  1Z2L A;  5KTD A;  2JDC A;  3EC4 A;  1TF8 A;  2OZU A;  3IU1 A;  5H86 A;  5AG6 A;  2ZOG A;  4KUA A;  4OC4 A;  3D7F A;  2GIV A;  4EFD A;  4PSX A;  1KUX A;  5K8P A;  3FBU A;  3B3S A;  1DTD A;  4MFJ A;  2GU2 A;  2R7H A;  1UWY A;  4OP4 A;  4B11 A;  3FF3 A;  3I1U A;  4IAV A;  4L8A A;  4A30 A;  4ZI6 A;  3BI0 A;  4MCQ A;  4AXV A;  3SI2 A;  3EO4 A;  4CYQ A;  1BLL E;  4JZ0 A;  3FYN A;  4R87 A;  4IK2 A;  3V8I A;  4CPA A;  4KOU A;  3T8W A;  1XEB A;  5IV0 A;  2B4B A;  4PXB A;  2FXF A;  3TFY A;  3CPA A;  1ZG7 A;  2JBJ A;  3WC7 A;  1Q7L A;  3GY9 A;  4M6H A;  4NGR A;  1Y7R A;  4AVB A;  2WSA A;  4TWE A;  1R43 A;  4OC3 A;  2BL1 A;  4UIA A;  4MHN A;  4BMH A;  4KSF A;  1Z4E A;  7CPA A;  4QUS A;  2YND A;  4MCR A;  4ONU A;  4P45 A;  3TO9 A;  4ZYQ A;  3DSB A;  1B87 A;  2DXQ A;  3D7G A;  4RN7 A;  3F5B A;  2FIA A;  1VHO A;  1VIX A;  1TIQ A;  4P4B A;  3D2M A;  4UEE A;  5HVG A;  3PZJ A;  1DE4 C;  1M1D A;  2PJB A;  2QML A;  1ARL A;  4G1P A;  2REE A;  2GRE A;  2J9A A;  2PDO A;  2ANP A;  3B3C A;  3PGP A;  4F8Z A;  3SXO A;  3NH4 A;  2I00 A;  1ELL P;  3PFO A;  3B3W A;  2PCU A;  1N71 A;  4Z65 A;  3RZA A;  2Q4Y A;  5H84 A;  1ZG8 A;  3D66 A;  4II9 A;  4UBR A;  4UFV A;  3FXT A;  3D4U A;  2PIY A;  3I9S A;  2Q43 A;  1CPS A;  4NEX A;  4P44 A;  3KHX A;  4HNX B;  3QAH A;  3FVL A;  4R3K A;  4FD5 A;  3S9M A;  3IWG A;  2QJ8 A;  3LMS A;  2Z3K A;  3KQX A;  2DPT A;  2HQY A;  2Q44 A;  3FX6 A;  4P4D A;  1Z8L A;  3N7Z A;  2GLF A;  1CG2 A;  1V0C A;  2QYV A;  2WUU A;  1AUG A;  1VHE A;  1YR0 A;  4H89 A;  4KLW A;  4X8I A;  5G1Z A;  1KUY A;  2PR1 A;  4MI4 A;  4A32 A;  1MK4 A;  2C6P A;  3JRU A;  1IU8 A;  3FEC A;  1Y0R A;  2ZW7 A;  3DLJ A;  4R8F A;  4A31 A;  3EXN A;  2PJ8 A;  3W91 A;  2PJ6 A;  2AFS A;  2R98 A;  2PE3 A;  5JQ4 A;  3L2N A;  3KAS A;  5HVF A;  2ZEF A;  4Q7A A;  4F0X A;  4F0Y A;  1A2Z A;  4P4F A;  4RUH A;  1QSR A;  3IWE A;  2ZEL A;  3CZX A;  3FNC A;  1QSN A;  1YW4 A;  2Q4V A;  2AFU A;  2REF A;  3BI1 A;  3PBE A;  2ZW6 A;  3ISZ A;  5AG7 A;  4B5O A;  2PJ3 A;  3CXS A;  5ISV A;  2OU2 A;  1ZO0 A;  1QSM A;  3LD2 A;  1FY7 A;  1SQH A;  4FD6 A;  4R9M A;  4A39 A;  1TXR A;  2B3V A;  2XEI A;  5HMN A;  5IB9 A;  2OB0 A;  3G8W A;  4M6G A;  1LAP A;  4CYO A;  3T9Y A;  4FBE A;  1I1D A;  2EUI A;  1I12 A;  2WZN A;  3EFA A;  4JD6 A;  2BEI A;  1YLE A;  3G3S A;  3CXP A;  1FT7 A;  3TO6 A;  2PJ9 A;  1XRY A;  5C82 A;  4B5P B;  8CPA A;  2ODF A;  3IGR A;  1M4G A;  1MJ9 A;  2BO9 A;  3KZW A;  1YVK A;  3FH4 A;  4KOT A;  4UFW A;  2PC1 A;  3ZJ0 A;  4AG9 A;  4CRY B;  2VBQ A;  3PB7 X;  3KL9 A;  4H6U A;  4P10 A;  4CS0 B;  3RYO A;  3BLN A;  3SHP A;  3SI1 A;  1P4N A;  4FWU A;  3C26 A;  4XPK A;  4H2K A;  2B3U A;  2G3T A;  2EO8 A;  2YNC A;  3DDD A;  5AG5 A;  4ZY0 A;  3DR6 A;  1IYK A;  2VI7 A;  4U5Y A;  3EY5 A;  1KUV A;  4CGN A;  3PRT A;  4KUB A;  1TKJ A;  4DYO A;  4PSW A;  2Q04 A;  1CX8 A;  4AVC A;  3S6H A;  1VKC A;  2AFO A;  4JLY A;  3IIB A;  4GM5 A;  4Y49 B;  4KVM E;  3PB9 X;  3NFZ A;  1B6B A;  4I49 A;  5LYI A;  3GYA A;  5LRK A;  2CY2 A;  1LCP A;  2FL4 A;  1PYT B;  1S5K A;  1ARM A;  2PVV A;  4J3G A;  4PV6 A;  4PXE A;  3TX8 A;  2JEW A;  4O23 A;  1XOV A;  2EK9 A;  2J8R A;  2QEC A;  3BHX A;  3PP9 A;  2NSM A;  4FD7 A;  3K9U A;  2GFQ A;  2JDD A;  4KOV A;  4EVY A;  1PUA A;  3N5F A;  5K8N A;  1S7K A;  3DR8 A;  4M6I A;  5DWM A;  4FUU A;  5I0C A;  5JGF A;  2IL4 A;  3LWU A;  1XJO A;  1NSL A;  3UY5 A;  3SI0 A;  3TTH A;  3LOD A;  1VGY A;  4UEZ A;  5IX3 A;  3QAY A;  2PJA A;  4PXC A;  5LRJ A;  3TO7 A;  4B6Z A;  2B4D A;  3P2H A;  4M3S A;  3S6K A;  5K8M A;  3SJX A;  4WJB A;  3NH5 A;  3D68 A;  4MCS A;  1XE4 A;  4A2Z A;  3P2F A;  2X7B A;  1Z8X A;  4HNY B;  2VXK A;  1WK4 A;  1YSJ A;  4CRZ B;  2QVP A;  5D8N A;  3H8G A;  2FCK A;  2CTC A;  5EMI A;  2PSW A;  1LAN A;  3FED A;  4P4I A;  2C1C A;  1IOI A;  2BSW A;  2WPX A;  3DNS A;  2ZEM A;  3JUW A;  5F09 A;  4CAX A;  1F57 A;  4MJ8 A;  3VWD A;  5A27 A;  4A33 A;  4E2A A;  3W6S A;  2G0B A;  1IIC A;  1NE9 A;  2Y0M A;  2HC9 A;  2CNT A;  2Z11 A;  4OIW A;  4KZT A;  4OME A;  4IUS A;  3NE8 A;  2Z10 A;  2Z3L A;  5AG4 A;  1Z9U A;  2OZG A;  4YFJ A;  2PVW A;  2ZPA A;  1K4J A;  2JLM A;  3GKR A;  3NE7 A;  5LYD A;  2OOT A;  3JVN A;  5KTA A;  2HV2 A;  4CAV A;  2EK8 A;  2V8G A;  2FT0 A;  5JM6 A;  2IQ6 A;  3PFE A;  4A95 A;  1Z8T A;  4L89 A;  3T90 A;  4YWY A;  4NXY A;  1Y7E A;  3IJ3 A;  1IB1 E;  5G22 A;  4RI1 A;  3KQZ A;  2DEA A;  4NFR A;  1BOB A;  4F6A A;  3WAB A;  3D7D A;  1RXT A;  3I3G A;  4CAW A;  2P6F A;  5JH9 A;  2ZEN A;  5I4M A;  1TKH A;  2WYR A;  4BBH A;  2NYQ A;  1M4D A;  3IWW A;  4HKF A;  5THW A;  4K3N A;  4UF4 A;  2I79 A;  1XF8 A;  4YRH A;  3S6G A;  3WR7 A;  4NGN A;  1XMT A;  1KZF A;  2YNE A;  1ON0 A;  3IFE A;  4MXU A;  2V8D A;  1CP7 A;  3KR4 A;  3NA6 A;  3R1K A;  5IB0 A;  3TE4 A;  2OZH A;  4B10 A;  2BUE A;  6CPA A;  1YK3 A;  2V77 A;  4PPZ A;  2YGW A;  3R9E A;  2DPS A;  1IOF A;  1M4I A;  1YGH A;  1ZG9 A;  1ZLI A;  2CIJ A;  3FJU A;  1CBX A;  2AE6 A;  4AG7 A;  4MFZ A;  1Y9W A;  2CF4 A;  2YNC C;  1XIX A;  4F9U A;  2XEF A;  4IHM A;  3LAC A;  2D4P A;  2C27 A;  2GE3 A;  1RTQ A;  4M85 A;  2V8V A;  2OR4 A;  5AGE A;  2P0W A;  4NGS A;  4X5K A;  4ZX8 A;  1QQ9 A;  1GYT A;  2FS5 A;  4MHP A;  4MCP A;  2CNM A;  4NGM A;  2JBK A;  1NMT A;  1YX0 A;  3BJ7 A;  4KOY A;  1PCA A;  4R57 A;  4ZY1 A;  5J8C A;  4GXH A;  4A38 A;  2G9D A;  2ARH A;  1L0C A;  3K9T A;  4E0A A;  5LYF A;  2POK A;  3BXM A;  5FVJ A;  4NSQ A;  2O53 A;  4DNC A;  3FRM A;  3PBB A;  2VL1 A;  2D4O A;  2J8N A;  2PJC A;  4IF5 A;  4UFX A;  2KCW A;  4OKO A;  4LQG A;  4W9Y A;  5HH1 A;  3ISX A;  2Q7B A;  3RNZ A;  4NGT A;  3TOB A;  2AFX A;  2Q4Z A;  2VQY A;  4UCN A;  2GLJ A;  4U9Z A;  1ELM P;  1TF9 A;  4GS4 A;  1R3N A;  4YU9 A;  2Z3P A;  5DS0 A;  3R9G A;  2B4D B;  4YGO A;  4K30 A;  3D8P A;  2EBJ A;  1CJW A;  4NJQ A;  2PR8 A;  2PJ0 A;  4CGO A;  3KHZ A;  4P6Y A;  5BWA B;  3OWC A;  4B12 A;  4MBU A;  4TNU A;  2AFZ A;  2DF5 A;  2ZW5 A;  5F46 A;  3A9L A;  3RO0 A;  4R7M A;  1NSA A;  2Q51 A;  4JXR A;  1Z8W A; 
#chains in the Genus database with same CATH homology
 2A4N A;  4QB9 A;  3S6F A;  4OAD A;  5E96 A;  5DWN A;  2AJ6 A;  2K5T A;  4CGL A;  4C68 A;  4C2Z A;  4FD4 A;  5F48 A;  3TOA A;  4C2Y A;  2VEZ A;  4U9Y A;  1YRE A;  2FIW A;  5JPH A;  5C88 A;  2NMT A;  2B5G A;  4JWP A;  2G3A A;  4LX9 A;  4Q38 A;  2RC4 A;  1S7F A;  4ZBG A;  2R1I A;  3KKW A;  4E8O A;  3SXN A;  2Z3M A;  1OZP A;  2P6G A;  1RO5 A;  4MFP A;  1S7L A;  1IID A;  4C2X A;  1QSO A;  1J4J A;  2WPW A;  2R8V A;  5G20 A;  2Q0Y A;  5F49 A;  4HNW B;  4KLV A;  1MJB A;  4MFL A;  3D2P A;  2Z3N A;  2F5I A;  4QC6 A;  3D3S A;  1MJA A;  2CNS A;  3CXQ A;  4KVX A;  4RS2 A;  3ZZI A;  3F0A A;  1BO4 A;  2HUZ A;  5KTC A;  1U6M A;  4KOX A;  2H5M A;  2ZXV A;  4KOW A;  5CNP A;  1WWZ A;  3MGD A;  4XPD C;  4C7H A;  3TT2 A;  2CXA A;  3R9F A;  4CAF A;  3R95 A;  1IYL A;  4MFK A;  1Y9K A;  4XPD B;  1S3Z A;  2PRB A;  3QB8 A;  4C7I A;  1UFH A;  3IU2 A;  2ATR A;  4AVA A;  4KOS A;  4MFQ A;  1LRZ A;  4JJX A;  2Z0Z A;  2JEV A;  3E0K A;  4KOR A;  4ORF A;  4KS9 A;  4QVT A;  1R57 A;  5EC4 A;  1YVO A;  3FIX A;  4CYN A;  4UA3 A;  2VZZ A;  4H6Z A;  3TCV A;  4XNH C;  4NF1 A;  2ZW4 A;  4OAE A;  4XNH B;  1CM0 A;  5J8F A;  4R3L A;  1P0H A;  3JTK A;  4ZGY B;  3VWE A;  1Q2C A;  2P6E A;  4MY3 A;  1QST A;  1S7N A;  4KSA A;  4B14 A;  5G21 A;  4MY0 A;  4Q36 A;  2PQ8 A;  3FB3 A;  4UWJ A;  5F47 A;  3F8K A;  2B5G B;  4PK2 A;  1Z4R A;  1PU9 A;  1Q2Y A;  2GAN A;  1M44 A;  5A28 A;  4MHD A;  4UWI A;  4CGM A;  4NCZ A;  4LUA A;  1GHE A;  2OH1 A;  3R96 A;  1VHS A;  3H4Q A;  4XPL A;  3H5Z A;  4QBJ A;  4JXQ A;  1I21 A;  2Z3O A;  2VZY A;  4Y49 C;  5GCN A;  2FSR A;  4UCP A;  1S60 A;  2FE7 A;  4CAE A;  3B8G A;  2B58 A;  4PK3 A;  2EVN A;  3W6X A;  2O28 A;  2QIR A;  3BJ8 A;  4OLL A;  4KVO E;  4B13 A;  4B5P A;  4AB7 A;  1Q2D A;  4UCM A;  2J8M A;  4CYP A;  5EBV A;  5KTD A;  2JDC A;  3EC4 A;  2OZU A;  3IU1 A;  5H86 A;  5AG6 A;  4KUA A;  2GIV A;  4PSX A;  1KUX A;  3FBU A;  4MFJ A;  2R7H A;  4B11 A;  4L8A A;  4A30 A;  3EO4 A;  4CYQ A;  4R87 A;  3FYN A;  3V8I A;  4KOU A;  1XEB A;  5IV0 A;  2B4B A;  2FXF A;  3TFY A;  3GY9 A;  1Y7R A;  4AVB A;  2WSA A;  4BMH A;  2BL1 A;  4KSF A;  1Z4E A;  4QUS A;  2YND A;  4ONU A;  3TO9 A;  3DSB A;  1B87 A;  2DXQ A;  3F5B A;  2FIA A;  1TIQ A;  3D2M A;  3PZJ A;  1M1D A;  2QML A;  2REE A;  2PDO A;  3PGP A;  3SXO A;  2I00 A;  1N71 A;  2Q4Y A;  5H84 A;  4II9 A;  4UBR A;  4UFV A;  3FXT A;  3I9S A;  4NEX A;  4HNX B;  3QAH A;  4R3K A;  4FD5 A;  3IWG A;  2Z3K A;  2DPT A;  2HQY A;  2Q44 A;  3N7Z A;  4H89 A;  1V0C A;  2WUU A;  5G1Z A;  1YR0 A;  4KLW A;  4A32 A;  1KUY A;  2PR1 A;  4MI4 A;  1MK4 A;  2ZW7 A;  4A31 A;  3EXN A;  3W91 A;  2R98 A;  5JQ4 A;  4F0X A;  4F0Y A;  1QSR A;  3IWE A;  3FNC A;  1QSN A;  2Q4V A;  4CGP A;  2REF A;  5AG7 A;  2ZW6 A;  4B5O A;  3CXS A;  5ISV A;  2OU2 A;  1ZO0 A;  1QSM A;  3LD2 A;  1FY7 A;  1SQH A;  4FD6 A;  4R9M A;  2B3V A;  5HMN A;  2OB0 A;  3G8W A;  4CYO A;  3T9Y A;  1I1D A;  2EUI A;  1I12 A;  3EFA A;  4JD6 A;  2BEI A;  1YLE A;  3G3S A;  3CXP A;  3TO6 A;  5C82 A;  4B5P B;  3IGR A;  1MJ9 A;  1M4G A;  4KOT A;  1YVK A;  4UFW A;  2PC1 A;  3ZJ0 A;  4AG9 A;  4CRY B;  2VBQ A;  4H6U A;  4CS0 B;  3RYO A;  3BLN A;  3SHP A;  1P4N A;  4XPK A;  3C26 A;  5AG5 A;  2B3U A;  2G3T A;  2YNC A;  3DDD A;  3DR6 A;  1IYK A;  2VI7 A;  4U5Y A;  3EY5 A;  1KUV A;  4CGN A;  4KUB A;  4PSW A;  2Q04 A;  4AVC A;  3S6H A;  1VKC A;  4JLY A;  4Y49 B;  4KVM E;  1B6B A;  4I49 A;  3GYA A;  2CY2 A;  4J3G A;  2FL4 A;  1S5K A;  4PV6 A;  2J8R A;  2QEC A;  3PP9 A;  4FD7 A;  3K9U A;  4KOV A;  2JDD A;  4EVY A;  1PUA A;  1S7K A;  3DR8 A;  5DWM A;  5I0C A;  2IL4 A;  1NSL A;  3UY5 A;  3TTH A;  3LOD A;  5IX3 A;  3TO7 A;  2B4D A;  3P2H A;  4M3S A;  3S6K A;  1XE4 A;  4A2Z A;  3P2F A;  2X7B A;  4HNY B;  2VXK A;  1WK4 A;  4CRZ B;  2FCK A;  2PSW A;  2BSW A;  2WPX A;  3DNS A;  3JUW A;  4CAX A;  4MJ8 A;  3VWD A;  5A27 A;  4A33 A;  4E2A A;  3W6S A;  2G0B A;  1IIC A;  1NE9 A;  2Y0M A;  2CNT A;  2Z11 A;  4KZT A;  4IUS A;  2Z10 A;  2Z3L A;  5AG4 A;  1Z9U A;  2OZG A;  4YFJ A;  2ZPA A;  1K4J A;  2JLM A;  3GKR A;  3NE7 A;  5KTA A;  3JVN A;  2HV2 A;  4CAV A;  2FT0 A;  4A95 A;  3T90 A;  4L89 A;  4NXY A;  1IB1 E;  5G22 A;  4RI1 A;  1BOB A;  4F6A A;  1RXT A;  3I3G A;  4CAW A;  2P6F A;  4BBH A;  1M4D A;  4HKF A;  2I79 A;  1XF8 A;  4YRH A;  3S6G A;  3WR7 A;  1XMT A;  1KZF A;  2YNE A;  1ON0 A;  3R1K A;  5IB0 A;  3TE4 A;  2OZH A;  4B10 A;  2BUE A;  1YK3 A;  2YGW A;  3R9E A;  2DPS A;  1M4I A;  1YGH A;  4AG7 A;  2AE6 A;  4MFZ A;  1Y9W A;  2YNC C;  1XIX A;  2D4P A;  2C27 A;  2GE3 A;  4M85 A;  5AGE A;  2P0W A;  4X5K A;  2FS5 A;  2CNM A;  1NMT A;  1YX0 A;  3BJ7 A;  4KOY A;  4R57 A;  5J8C A;  2ARH A;  1L0C A;  4E0A A;  4DNC A;  5FVJ A;  4NSQ A;  3FRM A;  2D4O A;  2J8N A;  4IF5 A;  4UFX A;  2KCW A;  2Q7B A;  5HH1 A;  3TOB A;  2VQY A;  4UCN A;  4U9Z A;  4GS4 A;  2Z3P A;  3R9G A;  2B4D B;  4YGO A;  4K30 A;  3D8P A;  1CJW A;  2PR8 A;  4CGO A;  5BWA B;  3OWC A;  4B12 A;  4MBU A;  2ZW5 A;  5F46 A;  3A9L A;  4JXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...