3IWGA

Acetyltransferase from gnat family from colwellia psychrerythraea.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
268
Chain Sequence
b'FKIKTIESLSDLTQLKKAYFDSSIVPLDGMWHFGFAPMAKHFGFYVNKNLVGFCCVNDDGYLLQYYLQPEFQLCSQELFTLISQQNSSVIGEVKGAFVSTAELNYQALCLDNSATFKVNSLMYQHNTKLANLEMIDMQIAGTEQLTAFVTFAAANIGAPEQWLTQYYGNLIERKELFGYWHKGKLLAAGECRLFDQYQTEYADLGMIVAQSNRGQGIAKKVLTFLTKHAATQGLTSICSTESNNVAAQKAIAHAGFTSAHRIVQFEFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title X-ray crystal structure of Acetyltransferase from GNAT family from Colwellia psychrerythraea.
rcsb
source organism Colwellia psychrerythraea
molecule tags Transferase
total genus 78
structure length 268
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF18015 Acetyltransf_19 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA02
3.40.630.80 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA01
4Y49C 2F5IA 2ZW7A 2J8RA 5ISVA 2I00A 4KLVA 1XEBA 3WR7A 4M3SA 2B3VA 4IF5A 2B4DB 4PK2A 3EO4A 3MGDA 2Q4VA 2O28A 2ZXVA 4GS4A 2B4DA 2JEVA 2ZW6A 3H4QA 2B58A 1ON0A 3R1KA 4B5OA 2BSWA 2GE3A 3K9UA 4CS0B 4OADA 4CRYB 4CAWA 4I49A 3T90A 2R8VA 3FYNA 1VHSA 3W91A 2ZPAA 3G3SA 4R3KA 1MK4A 2CNTA 1J4JA 1QSOA 3D2PA 1YLEA 4QC6A 3IGRA 1RO5A 3C26A 3ZZIA 1SQHA 4K30A 4KOTA 4AG9A 4MI4A 3W6SA 1XE4A 2H5MA 2VQYA 5H86A 3P2FA 1YK3A 3I9SA 3F0AA 2CNMA 4LUAA 2DXQA 5E96A 2R98A 1FY7A 1B87A 2KCWA 4KORA 3SXNA 2G3AA 3R96A 4RS2A 2GANA 1S3ZA 2FE7A 3SHPA 1KUXA 2CY2A 4MJ8A 5CNPA 3D2MA 3R9GA 4YRHA 2R1IA 4KOWA 1VKCA 4ZBGA 1XIXA 1Y9WA 4BMHA 2P6FA 2Q44A 4LX9A 1CM0A 1P4NA 2B4BA 4R57A 2VBQA 2VXKA 3PGPA 1YREA 3TCVA 2Q4YA 5EBVA 2HQYA 2WPWA 4JXRA 2FIWA 4HNYB 4KOVA 3FRMA 4XPLA 2FL4A 5FVJA 3EC4A 2K5TA 3PZJA 2FS5A 2FCKA 4PSWA 4U9YA 3N7ZA 2PQ8A 4XPKA 1B6BA 4E0AA 1L0CA 3VWDA 3R9EA 3TFYA 4MHDA 1WWZA 1PU9A 3F5BA 1R57A 3CXQA 4M85A 4J3GA 1YVKA 4KOYA 1IICA 4R9MA 3IWGA 1Z4EA 2OH1A 3UY5A 4NSQA 5KTAA 2VI7A 3ZJ0A 5IB0A 4XPDC 4QUSA 2C27A 2REEA 5C82A 1S7NA 2FXFA 2OZUA 3F8KA 4F6AA 1PUAA 1U6MA 1I12A 3V8IA 4UWJA 2Z11A 2HV2A 2X7BA 2OZHA 2EVNA 3S6HA 3T9YA 1QSTA 2OB0A 3S6FA 2JDCA 2AE6A 2CNSA 3FXTA 3TT2A 1V0CA 5DWMA 4R87A 3JVNA 2FT0A 3R9FA 2B5GB 2WPXA 4AB7A 5F48A 1TIQA 2PDOA 2B5GA 2R7HA 2JDDA 1M4GA 1S60A 4NCZA 4QBJA 1WK4A 1MJBA 3JUWA 1S7FA 4CRZB 1KUYA 1N71A 3BLNA 4HNWB 4YGOA 3D3SA 5JPHA 1Y9KA 5GCNA 2AJ6A 1S7KA 4OLLA 5I0CA 2BL1A 3BJ8A 5HH1A 4PV6A 4KVOE 4H89A 2QECA 3LODA 4H6UA 1LRZA 4E2AA 2G3TA 5EC4A 3GYAA 3P2HA 4U9ZA 4PK3A 1MJ9A 1UFHA 2HUZA 3W6XA 1K4JA 3QAHA 2D4PA 3FIXA 4NEXA 3I3GA 2RC4A 2QIRA 4QB9A 4XNHC 2ARHA 1YVOA 3TOAA 2GIVA 2Y0MA 4F0YA 4KUAA 3KKWA 5C88A 3E0KA 2FSRA 2PR1A 4KVXA 1CJWA 3NE7A 1OZPA 4HKFA 4JJXA 3TOBA 4Y49B 3TO6A 1P0HA 4MY0A 5KTCA 3EXNA 4KOXA 2P6EA 4JWPA 2A4NA 5F47A 2OU2A 5IX3A 1KZFA 1S7LA 2REFA 4NXYA 4R3LA 3EY5A 2J8NA 4X5KA 4XPDB 4HNXB 2EUIA 1Q2YA 3SXOA 3DDDA 2Q0YA 4EVYA 3EFAA 5IV0A 4YFJA 4ORFA 1IYKA 1RXTA 1Z9UA 1M1DA 2I79A 5F46A 1M4DA 1M4IA 4JLYA 4KZTA 1XF8A 4CAXA 2PSWA 1GHEA 1IYLA 3FNCA 4PSXA 1MJAA 2G0BA 4DNCA 4MY3A 4AG7A 5J8FA 4RI1A 5F49A 3TTHA 4L89A 1BO4A 3CXSA 4FD7A 2BEIA 3DSBA 4B5PB 1IB1E 3DR8A 4AVBA 4UBRA 1M44A 4B5PA 1Y7RA 4L8AA 5KTDA 4KOUA 2OZGA 1Q2DA 4KLWA 2NMTA 4NF1A 3OWCA 2P0WA 4H6ZA 4IUSA 4ONUA 3DR6A 3VWEA 1Z4RA 4FD5A 1I21A 2Q7BA 2PR8A 4E8OA 2ZW4A 3GKRA 4CAVA 2JLMA 1YR0A 2VZZA 3G8WA 1XMTA 1BOBA 2VEZA 2D4OA 4OAEA 1KUVA 1Q2CA 2IL4A 2Z10A 3PP9A 4FD4A 1NE9A 3TE4A 4JD6A 2P6GA 5JQ4A 3TO7A 5HMNA 2BUEA 4AVAA 4JXQA 2Q04A 4II9A 2ATRA 3FB3A 3QB8A 3D8PA 1YGHA 3TO9A 4UA3A 4AVCA 1I1DA 2PC1A 5J8CA 1S5KA 1NSLA 2QMLA 4UWIA 1YX0A 4U5YA 2PRBA 1QSMA 5H84A 3GY9A 4XNHB 2Z0ZA 2VZYA 4FD6A 2B3UA 5DWNA 3R95A 1NMTA 3FBUA 3S6KA 1IIDA 3B8GA 1QSNA 4KVME 1QSRA 4KOSA 4KUBA 3CXPA 2ZW5A 3S6GA 3LD2A 3BJ7A 4MBUA 2FIAA 3RYOA 3DNSA 2J8MA 4QVTA
chains in the Genus database with same CATH superfamily
5AGEA 2C6CA 3PRTA 4ZY0A 2BOAA 4Y49C 7CPAA 1Z5RA 1TKFA 3VARA 3B35A 2F5IA 4B13A 4R8FA 2ZW7A 2J8RA 5EMIA 2GLFA 5ISVA 3H8GA 5LYLA 2G9DA 2I00A 3NFZA 1XEBA 4KLVA 4NFRA 5D8NA 1HDUA 4MFLA 4OC1A 5CBMA 2EK9A 2Z3NA 3PB7X 3WR7A 2ZOFA 5G1ZA 3HLPA 1R3NA 3NH8A 4M3SA 5HVGA 1M4LA 1XJOA 1TXRA 4KSIA 2B3VA 4IF5A 5I4MA 2DEAA 2B4DB 4PK2A 4UIBA 4YU9A 3EO4A 2PRQA 3MGDA 2HC9A 4LQGA 2Q4VA 2O28A 1ARLA 3KHZA 2ZXVA 1AUGA 1TF9A 4GS4A 4MCSA 2B4DA 2JEVA 2PJBA 3D67A 2ZW6A 2PVVA 3H4QA 2B58A 1ON0A 4CPAA 5JM6A 3R1KA 4B5OA 2BSWA 2GE3A 3K9UA 4CS0B 4OADA 4CRYB 4CAWA 4NGTA 1LAMA 2BCOA 3IJ3A 1ZLHA 4I49A 3T90A 2AFUA 3D7GA 2R8VA 1VIXA 4OIDA 3FYNA 1VHSA 1YW4A 4BBHA 3W91A 2ZPAA 1IY7A 3G3SA 4R3KA 2O4HA 4H2KA 1MK4A 1PCAA 1YW6A 1A2ZA 3IWWA 4MFKA 2YNCA 2CNTA 1J4JA 1QSOA 3D2PA 1VHOA 4MFQA 4P4IA 1YLEA 4RN7A 4QC6A 3IGRA 1RO5A 3C26A 3ZZIA 1SQHA 4UEEA 3WC7A 3CT9A 3H8EA 3H8FA 4K30A 4KOTA 4AG9A 4MI4A 3W6SA 1XE4A 2H5MA 4BINA 2VQYA 5H86A 2PJ0A 5LYDA 3HUVA 1YK3A 3I9SA 3KI9A 3P2FA 5A28A 3F0AA 1F2OA 2CNMA 3H5ZA 4Z65A 4F9VA 3WT4A 3B3VA 4YWYA 4LUAA 1LFWA 2DXQA 2PJ5A 4MHYA 5E96A 2R98A 3KQXA 1FT7A 1FY7A 1R43A 4UFVA 3SJXA 4KSAA 4P45A 1B87A 4NGMA 4A32A 2KCWA 1RTQA 4B11A 4KORA 3SXNA 4AXVA 2AFMA 2G3AA 3LWUA 1KWMA 5LYIA 3R96A 2ZOGA 4RS2A 4M6IA 3BI0A 1UWYA 5G22A 2GANA 1S3ZA 2FE7A 5J1QA 3SHPA 2HB6A 1KUXA 2CY2A 4MJ8A 4P44A 5CNPA 3D2MA 3IFEA 3FF3A 3R9GA 4YRHA 3IEHA 3ISXA 2R1IA 4KOWA 1VKCA 4ZBGA 3WC6A 4UCPA 4Q38A 1XIXA 2YGWA 4P4BA 2EBJA 1Y9WA 3JRUA 4MMOA 4WJBA 4BMHA 4C68A 4C7IA 2P6FA 2Q44A 2Z3LA 4HPSA 1CM0A 4LX9A 3KASA 1P4NA 2QVPA 4EWTA 2B4BA 4R57A 4CGNA 2VBQA 2VXKA 1Y7EA 2PJ6A 4R7MA 4ZYQA 3PGPA 1CPSA 2PCUA 1YREA 2ZELA 3IU1A 3TCVA 2Q4YA 2XEFA 4CYPA 3PBBA 1ARMA 2PJ4A 3GLJA 2AFZA 5EBVA 2ABZA 5LRJA 3D7FA 4B12A 4DYOA 2WYRA 4MFJA 4R6TA 2HQYA 2WPWA 1ELLP 4JXRA 5DS0A 2POKA 1TKJA 2FIWA 3FEEA 2IQ6A 4HNYB 1XRYA 4KOVA 1CP6A 2C6GA 3FRMA 2XEIA 4XPLA 2FL4A 4A38A 5FVJA 3EC4A 4FUUA 2K5TA 2PVWA 3PZJA 2FS5A 2FCKA 4A30A 3BI1A 3RO0A 4CGMA 4PSWA 5JGFA 5HVHA 2IMOA 4U9YA 3N7ZA 1HEEA 2AFXA 1LOKA 2PQ8A 4LQ6A 4UF4A 4XPKA 4OKOA 4ZY1A 3CPXA 3KR5A 3KQZA 1B6BA 4CAEA 4E0AA 1L0CA 3VWDA 4PQAA 3R9EA 4C2XA 2JBJA 4MHDA 4X2TA 3TFYA 4UCNA 2C1CA 3RAMA 3K9TA 1ZG7A 1WWZA 4KS9A 1PU9A 3F5BA 1R57A 3B3TA 3CXQA 2GLJA 2GREA 5D29A 3SJEA 2IJZA 3PEIA 1IGBA 4MFPA 4M85A 4J3GA 4UFXA 1YVKA 4KOYA 4WWVA 4P4EA 1IICA 3B7IA 3L2NA 4R9MA 3IWGA 2VL1A 3WC5A 4F0XA 1Z4EA 2OH1A 3UY5A 1LAPA 4NSQA 3MN8A 2Q51A 5KTAA 2VI7A 2RB7A 4NGSA 2NSMA 3ZJ0A 4IHMA 4A2ZA 5G20A 5K8OA 3KL9A 5IB0A 1BPNA 2C6PA 3IO1A 4XPDC 2AFWA 4QUSA 2C27A 2REEA 5C82A 1S7NA 2FXFA 3RBUA 2OZUA 2CXAA 4OIWA 2CIJA 4MCRA 4KSFA 4EFDA 8CPAA 3PB4X 3F8KA 4B10A 4F6AA 3GB0A 1PUAA 2J9AA 1I12A 1U6MA 4G1PA 3V8IA 1JWQA 4UWJA 2BO9A 2Z11A 3PB8X 2HV2A 2X7BA 2OZHA 2EVNA 4A95A 3S6HA 3T9YA 1QSTA 3KGQA 2OB0A 3S6FA 4PXBA 2JDCA 2AE6A 4M6HA 4UFWA 4ZX8A 4P4FA 2CNSA 3FXTA 4GM5A 1V0CA 1XOVA 3TT2A 5F09A 5AG4A 4FWUA 4TWEA 5DWMA 3D68A 3FMCA 4R87A 3T8WA 3JVNA 4R76A 2FT0A 5AG7A 3R9FA 2B5GB 2WPXA 4AB7A 5F48A 3IC1A 1TIQA 2PDOA 2B5GA 5AG5A 2R7HA 3IU2A 2JDDA 1Q7LA 1M4GA 5BWAB 1S60A 4OP4A 4NCZA 4QBJA 1WK4A 1MJBA 2Q4ZA 3JUWA 1S7FA 4CRZB 1KUYA 3IWEA 2EO8A 1ELMP 1N71A 3BLNA 4HNWB 3V7ZA 4YGOA 5K8NA 3D3SA 4C7HA 3NA6A 1F2PA 3SJGA 5AG6A 4NGQA 2CF4A 5JPHA 2ZEDA 1Y9KA 5GCNA 2AJ6A 1S7KA 4OLLA 5I0CA 5K8MA 2BL1A 3BJ8A 1ZLIA 3K2KA 4GXHA 4CAFA 5LRKA 1NSAA 4PV6A 4KVOE 4H89A 5HH1A 1Y0YA 2QECA 3LODA 4H6UA 2PJ7A 3WABA 4OC2A 4Q7AA 5IB9A 1LRZA 3NH4A 4E2AA 1Z8XA 2G3TA 3S9MA 1IU8A 1ZG9A 2AFOA 5EC4A 5ELYA 3CDXA 1VHEA 3GYAA 3P2HA 3PB9X 3N5FA 4U9ZA 4PK3A 2ZEOA 1MJ9A 2PIYA 3PBEA 2V77A 1TKHA 1UFHA 2HUZA 3QAYA 4MHZA 3MRUA 4CGPA 3W6XA 3ISZA 1K4JA 3D66A 4O23A 3QAHA 3VATA 5A27A 2D4PA 1BPMA 3FIXA 2WZNA 4NEXA 4A39A 3S9NA 2JEWA 3I3GA 2RC4A 2QIRA 3BHXA 4QB9A 2EK8A 4XNHC 2ARHA 1FNOA 1Z8TA 1YVOA 2GU2A 3TOAA 2GIVA 3PFEA 2Y0MA 3IIBA 4DJLA 1CG2A 1XBUA 4BD9A 4F0YA 4CGOA 4KUAA 3KKWA 5C88A 3E0KA 4P6YA 2FSRA 1JQGA 4PXEA 2PJAA 2PR1A 1CJWA 3BXMA 4KVXA 4MHNA 1X12A 3NE7A 3D7DA 2CTCA 4A31A 1OZPA 4HKFA 4JJXA 3TOBA 4X3RA 2AFSA 4Y49B 6CPAA 3TO6A 1P0HA 3RNZA 1IOFA 4MY0A 5KTCA 3EXNA 4KOXA 3NH5A 2P6EA 4PPZA 1EE3P 4JWPA 2A4NA 3FH4A 4OC4A 1VGYA 2ZENA 5F47A 4OC5A 2O53A 2OU2A 4IAVA 5IX3A 1KZFA 1S7LA 2REFA 3DLJA 4NXYA 1BLLE 4A37A 1XMBA 2WSAA 4ZI6A 2JBKA 4MFZA 4K3NA 4R3LA 3EY5A 4EMEA 1LCPA 2QJ8A 3B3CA 2J8NA 2PJ9A 4X5KA 2Z3OA 4XPDB 1AYEA 4HNXB 3RZAA 2ODFA 2YNDA 3B2YA 2EUIA 3GIUA 1Q2YA 3SXOA 3DDDA 3S9LA 1YQEA 2Q0YA 4MCQA 3EFAA 4EVYA 4YFJA 1AMPA 2YNEA 4MRIA 1IYKA 4ORFA 1RXTA 1Z9UA 4X8IA 1OBRA 4OMEA 1M1DA 3JTKA 4UEZA 2ZEHA 2V8VA 1X10A 3SI1A 3NE8A 4FAIA 2I79A 5F46A 5HVFA 1M4DA 1CPXA 4CYOA 1YMEA 2Z3PA 1YLOA 1CX8A 1M4IA 2PJ3A 4JLYA 4KZTA 1XF8A 4CAXA 1TF8A 2ZEFA 2PSWA 1GHEA 4NJRA 1IYLA 4PXDA 3FNCA 3A9LA 3SI0A 4PSXA 2RFHA 4MCPA 4PXCA 4Q36A 4B6ZA 4NJQA 1MJAA 2G0BA 3FJUA 4DNCA 4NGRA 4MY3A 4AG7A 5J8FA 1ZO0A 4C2ZA 2YNCC 4RI1A 5F49A 3TTHA 3TX8A 3FEDA 3CPAA 4L89A 1BO4A 2OR4A 3CXSA 2ZEMA 4FD7A 3PFOA 2BEIA 3DSBA 2F7VA 4B5PB 1DE4C 4C2YA 4CYNA 1IB1E 3VH9A 2ZEGA 3DR8A 4AVBA 5IV0A 5THWA 3D7HA 3B3SA 1M44A 4UBRA 4B5PA 3SJFA 1Y7RA 4L8AA 5KTDA 1ZG8A 4KOUA 2OZGA 4OC3A 1Q2DA 2PJ2A 2NMTA 4KLWA 4NGNA 1GYTA 4JZ0A 3OWCA 4NF1A 3GUXA 2P0WA 4H6ZA 4IUSA 4B14A 4ONUA 4F9UA 4ZX9A 4MHPA 3DR6A 3VWEA 1Z4RA 4FD5A 3LMSA 1IOIA 1I21A 4UCMA 2PR8A 2Q7BA 4E8OA 5JH9A 2ZW4A 4W9YA 2CTBA 3GKRA 3SI2A 4CAVA 2JLMA 1YR0A 2VZZA 1XFOA 2DPTA 2GFQA 2PJCA 3G8WA 4TNUA 1XMTA 1BOBA 1F57A 1Y0RA 2DF5A 2QYVA 4F8ZA 2VEZA 2D4OA 3I1UA 1KUVA 1Q2CA 4OAEA 4CYQA 2IL4A 4UEFA 2F8HA 2FVGA 2Q7SA 2Z10A 3PP9A 1NE9A 4FD4A 2PJ8A 4A94A 3TE4A 1DTDA 4JD6A 2ZEEA 3D4UA 2P6GA 5JQ4A 3LACA 3TO7A 2Z3MA 3KR4A 4FBEA 1HDQA 5HMNA 2BUEA 2PIZA 4MXUA 4AVAA 3FX6A 4RUHA 4JXQA 5LYFA 2Q04A 4II9A 4IK2A 2ATRA 3FB3A 3QB8A 3D8PA 4P4JA 1YGHA 2EWBA 4UA3A 3TO9A 4AVCA 5HXDA 1I1DA 4ZGYB 4OC0A 4M6GA 2PC1A 1BAVA 3PB6X 1QMUA 5G21A 5J8CA 1Z2LA 1S5KA 4P10A 4DUKA 4NGPA 1NSLA 4A33A 2QMLA 4UWIA 1CBXA 1YSJA 1YX0A 4U5YA 2PRBA 2V8GA 1QSMA 3FVLA 3GY9A 2PJ1A 4XNHB 5H84A 2Z0ZA 2VZYA 3CZXA 2ANPA 4FD6A 2B3UA 5DWNA 3FECA 3R95A 1Z8WA 2PE3A 1NMTA 4JYWA 3FBUA 3S6KA 1IIDA 3B8GA 1QSNA 4KVME 2Q43A 2XEJA 4UIAA 1QSRA 1QQ9A 5CPAA 4KOSA 2OOTA 4KUBA 3CXPA 2XEGA 4ZY2A 4CGLA 2ZW5A 4P4DA 1H8LA 2V8HA 3S6GA 3KHXA 3QNVA 3LD2A 1PYTB 5LRGA 3TC8A 1CP7A 3BJ7A 4MBUA 2DPSA 2NYQA 2V8DA 4ONWA 5K8PA 2FIAA 3RYOA 1Z8LA 2I3CA 3DNSA 2Z3KA 3DGVA 2J8MA 2WUUA 2ZEPA 3V38A 3B3WA 1LANA 3KZWA 4QVTA
chains in the Genus database with same CATH topology
5AGEA 4Y49C 4B13A 2F5IA 2ZW7A 2J8RA 5ISVA 2I00A 4KLVA 1XEBA 4MFLA 2Z3NA 3WR7A 5G1ZA 4M3SA 2B3VA 4IF5A 2B4DB 4PK2A 3EO4A 3MGDA 2Q4VA 2O28A 2ZXVA 4GS4A 2B4DA 2JEVA 2ZW6A 3H4QA 2B58A 1ON0A 3R1KA 4B5OA 2BSWA 2GE3A 3K9UA 4CS0B 4OADA 4CRYB 4CAWA 4I49A 3T90A 2R8VA 3FYNA 1VHSA 4BBHA 3W91A 2ZPAA 3G3SA 4R3KA 1MK4A 4MFKA 4MFQA 2YNCA 2CNTA 1J4JA 1QSOA 3D2PA 1YLEA 4QC6A 3IGRA 1RO5A 3C26A 3ZZIA 1SQHA 4K30A 4KOTA 4AG9A 4MI4A 3W6SA 1XE4A 2H5MA 2VQYA 5H86A 3P2FA 1YK3A 3I9SA 5A28A 3F0AA 2CNMA 3H5ZA 4LUAA 2DXQA 5E96A 2R98A 1FY7A 4UFVA 4KSAA 1B87A 4A32A 2KCWA 4B11A 4KORA 3SXNA 2G3AA 3R96A 4RS2A 5G22A 2GANA 1S3ZA 2FE7A 3SHPA 1KUXA 2CY2A 4MJ8A 5CNPA 3D2MA 3R9GA 4YRHA 2R1IA 4KOWA 1VKCA 4ZBGA 4UCPA 4Q38A 1XIXA 2YGWA 4C68A 1Y9WA 4BMHA 4C7IA 2P6FA 2Q44A 2Z3LA 4LX9A 1CM0A 1P4NA 2B4BA 4R57A 4CGNA 2VBQA 2VXKA 3PGPA 1YREA 3IU1A 3TCVA 2Q4YA 4CYPA 5EBVA 4B12A 4MFJA 2HQYA 2WPWA 4JXRA 2FIWA 4HNYB 4KOVA 3FRMA 4XPLA 2FL4A 5FVJA 3EC4A 2K5TA 3PZJA 2FS5A 2FCKA 4A30A 4CGMA 4PSWA 4U9YA 3N7ZA 2PQ8A 4XPKA 4CAEA 1B6BA 4E0AA 1L0CA 3VWDA 3R9EA 3TFYA 4C2XA 4MHDA 4UCNA 1WWZA 1PU9A 3F5BA 1R57A 3CXQA 4MFPA 4M85A 4J3GA 4UFXA 1YVKA 4KOYA 1IICA 4R9MA 3IWGA 4F0XA 1Z4EA 2OH1A 3UY5A 4NSQA 5KTAA 2VI7A 3ZJ0A 4A2ZA 5G20A 5IB0A 4XPDC 4QUSA 2C27A 2REEA 5C82A 1S7NA 2FXFA 2OZUA 2CXAA 4KSFA 4B10A 3F8KA 4F6AA 1PUAA 1U6MA 1I12A 3V8IA 4UWJA 2Z11A 2HV2A 2X7BA 2OZHA 2EVNA 4A95A 3S6HA 3T9YA 1QSTA 2OB0A 3S6FA 2JDCA 2AE6A 4UFWA 2CNSA 3FXTA 3TT2A 1V0CA 5AG4A 5DWMA 4R87A 3JVNA 2FT0A 5AG7A 3R9FA 2B5GB 2WPXA 4AB7A 5F48A 1TIQA 2PDOA 2B5GA 5AG5A 2R7HA 3IU2A 2JDDA 1M4GA 5BWAB 1S60A 4NCZA 4QBJA 1WK4A 1MJBA 3JUWA 1S7FA 4CRZB 1KUYA 3IWEA 1N71A 3BLNA 4HNWB 4YGOA 3D3SA 4C7HA 5AG6A 5JPHA 1Y9KA 5GCNA 2AJ6A 1S7KA 4OLLA 5I0CA 2BL1A 3BJ8A 4CAFA 5HH1A 4PV6A 4KVOE 4H89A 2QECA 3LODA 4H6UA 1LRZA 4E2AA 2G3TA 5EC4A 3GYAA 3P2HA 4U9ZA 4PK3A 1MJ9A 1UFHA 2HUZA 4CGPA 3W6XA 1K4JA 3QAHA 5A27A 2D4PA 3FIXA 4NEXA 3I3GA 2RC4A 2QIRA 4QB9A 4XNHC 2ARHA 1YVOA 3TOAA 2GIVA 2Y0MA 4F0YA 4CGOA 4KUAA 3KKWA 5C88A 3E0KA 2FSRA 2PR1A 4KVXA 1CJWA 3NE7A 4A31A 1OZPA 4HKFA 4JJXA 3TOBA 4Y49B 3TO6A 1P0HA 4MY0A 5KTCA 3EXNA 4KOXA 2P6EA 4JWPA 2A4NA 5F47A 2OU2A 5IX3A 1KZFA 1S7LA 2REFA 4NXYA 2WSAA 4MFZA 4R3LA 3EY5A 2J8NA 4X5KA 4XPDB 2Z3OA 4HNXB 2YNDA 2EUIA 1Q2YA 3SXOA 3DDDA 2Q0YA 4EVYA 3EFAA 5IV0A 4YFJA 2YNEA 4ORFA 1IYKA 1RXTA 1Z9UA 1M1DA 3JTKA 2I79A 5F46A 1M4DA 4CYOA 2Z3PA 1M4IA 4JLYA 4KZTA 1XF8A 4CAXA 2PSWA 1GHEA 1IYLA 3FNCA 3A9LA 4PSXA 4Q36A 1MJAA 2G0BA 4DNCA 4MY3A 4AG7A 5J8FA 1ZO0A 4C2ZA 2YNCC 4RI1A 5F49A 3TTHA 4L89A 1BO4A 3CXSA 4FD7A 2BEIA 3DSBA 4B5PB 4CYNA 4C2YA 1IB1E 3DR8A 4AVBA 4UBRA 1M44A 4B5PA 1Y7RA 4L8AA 5KTDA 4KOUA 2OZGA 1Q2DA 4KLWA 2NMTA 4NF1A 3OWCA 2P0WA 4H6ZA 4IUSA 4B14A 4ONUA 3DR6A 3VWEA 1Z4RA 4FD5A 1I21A 4UCMA 2PR8A 2Q7BA 4E8OA 2ZW4A 3GKRA 4CAVA 2JLMA 1YR0A 2VZZA 2DPTA 3G8WA 1XMTA 1BOBA 2VEZA 2D4OA 4OAEA 1KUVA 1Q2CA 4CYQA 2IL4A 2Z10A 3PP9A 4FD4A 1NE9A 3TE4A 4JD6A 2P6GA 5JQ4A 3TO7A 2Z3MA 5HMNA 2BUEA 4AVAA 4JXQA 2Q04A 4II9A 2ATRA 3FB3A 3QB8A 3D8PA 1YGHA 3TO9A 4UA3A 4AVCA 1I1DA 4ZGYB 2PC1A 5G21A 5J8CA 1S5KA 1NSLA 4A33A 2QMLA 4UWIA 1YX0A 4U5YA 2PRBA 1QSMA 5H84A 3GY9A 4XNHB 2Z0ZA 2VZYA 4FD6A 2B3UA 5DWNA 3R95A 1NMTA 3FBUA 3S6KA 1IIDA 3B8GA 1QSNA 4KVME 1QSRA 4KOSA 4KUBA 3CXPA 4CGLA 2ZW5A 3S6GA 3LD2A 3BJ7A 4MBUA 2DPSA 2FIAA 3RYOA 3DNSA 2Z3KA 2J8MA 2WUUA 4KS9A 4QVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y49 C;  2F5I A;  2ZW7 A;  2J8R A;  5ISV A;  2I00 A;  4KLV A;  1XEB A;  3WR7 A;  4M3S A;  2B3V A;  4IF5 A;  2B4D B;  4PK2 A;  3EO4 A;  3MGD A;  2Q4V A;  2O28 A;  2ZXV A;  4GS4 A;  2B4D A;  2JEV A;  2ZW6 A;  3H4Q A;  2B58 A;  1ON0 A;  3R1K A;  4B5O A;  2BSW A;  2GE3 A;  3K9U A;  4CS0 B;  4OAD A;  4CRY B;  4CAW A;  4I49 A;  3T90 A;  2R8V A;  3FYN A;  1VHS A;  3W91 A;  2ZPA A;  3G3S A;  4R3K A;  1MK4 A;  2CNT A;  1J4J A;  1QSO A;  3D2P A;  1YLE A;  4QC6 A;  3IGR A;  1RO5 A;  3C26 A;  3ZZI A;  1SQH A;  4K30 A;  4KOT A;  4AG9 A;  4MI4 A;  3W6S A;  1XE4 A;  2H5M A;  2VQY A;  5H86 A;  3P2F A;  1YK3 A;  3I9S A;  3F0A A;  2CNM A;  4LUA A;  2DXQ A;  5E96 A;  2R98 A;  1FY7 A;  1B87 A;  2KCW A;  4KOR A;  3SXN A;  2G3A A;  3R96 A;  4RS2 A;  2GAN A;  1S3Z A;  2FE7 A;  3SHP A;  1KUX A;  2CY2 A;  4MJ8 A;  5CNP A;  3D2M A;  3R9G A;  4YRH A;  2R1I A;  4KOW A;  1VKC A;  4ZBG A;  1XIX A;  1Y9W A;  4BMH A;  2P6F A;  2Q44 A;  4LX9 A;  1CM0 A;  1P4N A;  2B4B A;  4R57 A;  2VBQ A;  2VXK A;  3PGP A;  1YRE A;  3TCV A;  2Q4Y A;  5EBV A;  2HQY A;  2WPW A;  4JXR A;  2FIW A;  4HNY B;  4KOV A;  3FRM A;  4XPL A;  2FL4 A;  5FVJ A;  3EC4 A;  2K5T A;  3PZJ A;  2FS5 A;  2FCK A;  4PSW A;  4U9Y A;  3N7Z A;  2PQ8 A;  4XPK A;  1B6B A;  4E0A A;  1L0C A;  3VWD A;  3R9E A;  3TFY A;  4MHD A;  1WWZ A;  1PU9 A;  3F5B A;  1R57 A;  3CXQ A;  4M85 A;  4J3G A;  1YVK A;  4KOY A;  1IIC A;  4R9M A;  3IWG A;  1Z4E A;  2OH1 A;  3UY5 A;  4NSQ A;  5KTA A;  2VI7 A;  3ZJ0 A;  5IB0 A;  4XPD C;  4QUS A;  2C27 A;  2REE A;  5C82 A;  1S7N A;  2FXF A;  2OZU A;  3F8K A;  4F6A A;  1PUA A;  1U6M A;  1I12 A;  3V8I A;  4UWJ A;  2Z11 A;  2HV2 A;  2X7B A;  2OZH A;  2EVN A;  3S6H A;  3T9Y A;  1QST A;  2OB0 A;  3S6F A;  2JDC A;  2AE6 A;  2CNS A;  3FXT A;  3TT2 A;  1V0C A;  5DWM A;  4R87 A;  3JVN A;  2FT0 A;  3R9F A;  2B5G B;  2WPX A;  4AB7 A;  5F48 A;  1TIQ A;  2PDO A;  2B5G A;  2R7H A;  2JDD A;  1M4G A;  1S60 A;  4NCZ A;  4QBJ A;  1WK4 A;  1MJB A;  3JUW A;  1S7F A;  4CRZ B;  1KUY A;  1N71 A;  3BLN A;  4HNW B;  4YGO A;  3D3S A;  5JPH A;  1Y9K A;  5GCN A;  2AJ6 A;  1S7K A;  4OLL A;  5I0C A;  2BL1 A;  3BJ8 A;  5HH1 A;  4PV6 A;  4KVO E;  4H89 A;  2QEC A;  3LOD A;  4H6U A;  1LRZ A;  4E2A A;  2G3T A;  5EC4 A;  3GYA A;  3P2H A;  4U9Z A;  4PK3 A;  1MJ9 A;  1UFH A;  2HUZ A;  3W6X A;  1K4J A;  3QAH A;  2D4P A;  3FIX A;  4NEX A;  3I3G A;  2RC4 A;  2QIR A;  4QB9 A;  4XNH C;  2ARH A;  1YVO A;  3TOA A;  2GIV A;  2Y0M A;  4F0Y A;  4KUA A;  3KKW A;  5C88 A;  3E0K A;  2FSR A;  2PR1 A;  4KVX A;  1CJW A;  3NE7 A;  1OZP A;  4HKF A;  4JJX A;  3TOB A;  4Y49 B;  3TO6 A;  1P0H A;  4MY0 A;  5KTC A;  3EXN A;  4KOX A;  2P6E A;  4JWP A;  2A4N A;  5F47 A;  2OU2 A;  5IX3 A;  1KZF A;  1S7L A;  2REF A;  4NXY A;  4R3L A;  3EY5 A;  2J8N A;  4X5K A;  4XPD B;  4HNX B;  2EUI A;  1Q2Y A;  3SXO A;  3DDD A;  2Q0Y A;  4EVY A;  3EFA A;  5IV0 A;  4YFJ A;  4ORF A;  1IYK A;  1RXT A;  1Z9U A;  1M1D A;  2I79 A;  5F46 A;  1M4D A;  1M4I A;  4JLY A;  4KZT A;  1XF8 A;  4CAX A;  2PSW A;  1GHE A;  1IYL A;  3FNC A;  4PSX A;  1MJA A;  2G0B A;  4DNC A;  4MY3 A;  4AG7 A;  5J8F A;  4RI1 A;  5F49 A;  3TTH A;  4L89 A;  1BO4 A;  3CXS A;  4FD7 A;  2BEI A;  3DSB A;  4B5P B;  1IB1 E;  3DR8 A;  4AVB A;  4UBR A;  1M44 A;  4B5P A;  1Y7R A;  4L8A A;  5KTD A;  4KOU A;  2OZG A;  1Q2D A;  4KLW A;  2NMT A;  4NF1 A;  3OWC A;  2P0W A;  4H6Z A;  4IUS A;  4ONU A;  3DR6 A;  3VWE A;  1Z4R A;  4FD5 A;  1I21 A;  2Q7B A;  2PR8 A;  4E8O A;  2ZW4 A;  3GKR A;  4CAV A;  2JLM A;  1YR0 A;  2VZZ A;  3G8W A;  1XMT A;  1BOB A;  2VEZ A;  2D4O A;  4OAE A;  1KUV A;  1Q2C A;  2IL4 A;  2Z10 A;  3PP9 A;  4FD4 A;  1NE9 A;  3TE4 A;  4JD6 A;  2P6G A;  5JQ4 A;  3TO7 A;  5HMN A;  2BUE A;  4AVA A;  4JXQ A;  2Q04 A;  4II9 A;  2ATR A;  3FB3 A;  3QB8 A;  3D8P A;  1YGH A;  3TO9 A;  4UA3 A;  4AVC A;  1I1D A;  2PC1 A;  5J8C A;  1S5K A;  1NSL A;  2QML A;  4UWI A;  1YX0 A;  4U5Y A;  2PRB A;  1QSM A;  5H84 A;  3GY9 A;  4XNH B;  2Z0Z A;  2VZY A;  4FD6 A;  2B3U A;  5DWN A;  3R95 A;  1NMT A;  3FBU A;  3S6K A;  1IID A;  3B8G A;  1QSN A;  4KVM E;  1QSR A;  4KOS A;  4KUB A;  3CXP A;  2ZW5 A;  3S6G A;  3LD2 A;  3BJ7 A;  4MBU A;  2FIA A;  3RYO A;  3DNS A;  2J8M A;  4QVT A; 
#chains in the Genus database with same CATH topology
 5AGE A;  2C6C A;  3PRT A;  4ZY0 A;  2BOA A;  4Y49 C;  7CPA A;  1Z5R A;  1TKF A;  3VAR A;  3B35 A;  2F5I A;  4B13 A;  4R8F A;  2ZW7 A;  2J8R A;  5EMI A;  2GLF A;  5ISV A;  3H8G A;  5LYL A;  2G9D A;  2I00 A;  3NFZ A;  1XEB A;  4KLV A;  4NFR A;  5D8N A;  1HDU A;  4MFL A;  4OC1 A;  5CBM A;  2EK9 A;  2Z3N A;  3PB7 X;  3WR7 A;  2ZOF A;  5G1Z A;  3HLP A;  1R3N A;  3NH8 A;  4M3S A;  5HVG A;  1M4L A;  1XJO A;  1TXR A;  4KSI A;  2B3V A;  4IF5 A;  5I4M A;  2DEA A;  2B4D B;  4PK2 A;  4UIB A;  4YU9 A;  3EO4 A;  2PRQ A;  3MGD A;  2HC9 A;  4LQG A;  2Q4V A;  2O28 A;  1ARL A;  3KHZ A;  2ZXV A;  1AUG A;  1TF9 A;  4GS4 A;  4MCS A;  2B4D A;  2JEV A;  2PJB A;  3D67 A;  2ZW6 A;  2PVV A;  3H4Q A;  2B58 A;  1ON0 A;  4CPA A;  5JM6 A;  3R1K A;  4B5O A;  2BSW A;  2GE3 A;  3K9U A;  4CS0 B;  4OAD A;  4CRY B;  4CAW A;  4NGT A;  1LAM A;  2BCO A;  3IJ3 A;  1ZLH A;  4I49 A;  3T90 A;  2AFU A;  3D7G A;  2R8V A;  1VIX A;  4OID A;  3FYN A;  1VHS A;  1YW4 A;  4BBH A;  3W91 A;  2ZPA A;  1IY7 A;  3G3S A;  4R3K A;  2O4H A;  4H2K A;  1MK4 A;  1PCA A;  1YW6 A;  1A2Z A;  3IWW A;  4MFK A;  2YNC A;  2CNT A;  1J4J A;  1QSO A;  3D2P A;  1VHO A;  4MFQ A;  4P4I A;  1YLE A;  4RN7 A;  4QC6 A;  3IGR A;  1RO5 A;  3C26 A;  3ZZI A;  1SQH A;  4UEE A;  3WC7 A;  3CT9 A;  3H8E A;  3H8F A;  4K30 A;  4KOT A;  4AG9 A;  4MI4 A;  3W6S A;  1XE4 A;  2H5M A;  4BIN A;  2VQY A;  5H86 A;  2PJ0 A;  5LYD A;  3HUV A;  1YK3 A;  3I9S A;  3KI9 A;  3P2F A;  5A28 A;  3F0A A;  1F2O A;  2CNM A;  3H5Z A;  4Z65 A;  4F9V A;  3WT4 A;  3B3V A;  4YWY A;  4LUA A;  1LFW A;  2DXQ A;  2PJ5 A;  4MHY A;  5E96 A;  2R98 A;  3KQX A;  1FT7 A;  1FY7 A;  1R43 A;  4UFV A;  3SJX A;  4KSA A;  4P45 A;  1B87 A;  4NGM A;  4A32 A;  2KCW A;  1RTQ A;  4B11 A;  4KOR A;  3SXN A;  4AXV A;  2AFM A;  2G3A A;  3LWU A;  1KWM A;  5LYI A;  3R96 A;  2ZOG A;  4RS2 A;  4M6I A;  3BI0 A;  1UWY A;  5G22 A;  2GAN A;  1S3Z A;  2FE7 A;  5J1Q A;  3SHP A;  2HB6 A;  1KUX A;  2CY2 A;  4MJ8 A;  4P44 A;  5CNP A;  3D2M A;  3IFE A;  3FF3 A;  3R9G A;  4YRH A;  3IEH A;  3ISX A;  2R1I A;  4KOW A;  1VKC A;  4ZBG A;  3WC6 A;  4UCP A;  4Q38 A;  1XIX A;  2YGW A;  4P4B A;  2EBJ A;  1Y9W A;  3JRU A;  4MMO A;  4WJB A;  4BMH A;  4C68 A;  4C7I A;  2P6F A;  2Q44 A;  2Z3L A;  4HPS A;  1CM0 A;  4LX9 A;  3KAS A;  1P4N A;  2QVP A;  4EWT A;  2B4B A;  4R57 A;  4CGN A;  2VBQ A;  2VXK A;  1Y7E A;  2PJ6 A;  4R7M A;  4ZYQ A;  3PGP A;  1CPS A;  2PCU A;  1YRE A;  2ZEL A;  3IU1 A;  3TCV A;  2Q4Y A;  2XEF A;  4CYP A;  3PBB A;  1ARM A;  2PJ4 A;  3GLJ A;  2AFZ A;  5EBV A;  2ABZ A;  5LRJ A;  3D7F A;  4B12 A;  4DYO A;  2WYR A;  4MFJ A;  4R6T A;  2HQY A;  2WPW A;  1ELL P;  4JXR A;  5DS0 A;  2POK A;  1TKJ A;  2FIW A;  3FEE A;  2IQ6 A;  4HNY B;  1XRY A;  4KOV A;  1CP6 A;  2C6G A;  3FRM A;  2XEI A;  4XPL A;  2FL4 A;  4A38 A;  5FVJ A;  3EC4 A;  4FUU A;  2K5T A;  2PVW A;  3PZJ A;  2FS5 A;  2FCK A;  4A30 A;  3BI1 A;  3RO0 A;  4CGM A;  4PSW A;  5JGF A;  5HVH A;  2IMO A;  4U9Y A;  3N7Z A;  1HEE A;  2AFX A;  1LOK A;  2PQ8 A;  4LQ6 A;  4UF4 A;  4XPK A;  4OKO A;  4ZY1 A;  3CPX A;  3KR5 A;  3KQZ A;  1B6B A;  4CAE A;  4E0A A;  1L0C A;  3VWD A;  4PQA A;  3R9E A;  4C2X A;  2JBJ A;  4MHD A;  4X2T A;  3TFY A;  4UCN A;  2C1C A;  3RAM A;  3K9T A;  1ZG7 A;  1WWZ A;  4KS9 A;  1PU9 A;  3F5B A;  1R57 A;  3B3T A;  3CXQ A;  2GLJ A;  2GRE A;  5D29 A;  3SJE A;  2IJZ A;  3PEI A;  1IGB A;  4MFP A;  4M85 A;  4J3G A;  4UFX A;  1YVK A;  4KOY A;  4WWV A;  4P4E A;  1IIC A;  3B7I A;  3L2N A;  4R9M A;  3IWG A;  2VL1 A;  3WC5 A;  4F0X A;  1Z4E A;  2OH1 A;  3UY5 A;  1LAP A;  4NSQ A;  3MN8 A;  2Q51 A;  5KTA A;  2VI7 A;  2RB7 A;  4NGS A;  2NSM A;  3ZJ0 A;  4IHM A;  4A2Z A;  5G20 A;  5K8O A;  3KL9 A;  5IB0 A;  1BPN A;  2C6P A;  3IO1 A;  4XPD C;  2AFW A;  4QUS A;  2C27 A;  2REE A;  5C82 A;  1S7N A;  2FXF A;  3RBU A;  2OZU A;  2CXA A;  4OIW A;  2CIJ A;  4MCR A;  4KSF A;  4EFD A;  8CPA A;  3PB4 X;  3F8K A;  4B10 A;  4F6A A;  3GB0 A;  1PUA A;  2J9A A;  1I12 A;  1U6M A;  4G1P A;  3V8I A;  1JWQ A;  4UWJ A;  2BO9 A;  2Z11 A;  3PB8 X;  2HV2 A;  2X7B A;  2OZH A;  2EVN A;  4A95 A;  3S6H A;  3T9Y A;  1QST A;  3KGQ A;  2OB0 A;  3S6F A;  4PXB A;  2JDC A;  2AE6 A;  4M6H A;  4UFW A;  4ZX8 A;  4P4F A;  2CNS A;  3FXT A;  4GM5 A;  1V0C A;  1XOV A;  3TT2 A;  5F09 A;  5AG4 A;  4FWU A;  4TWE A;  5DWM A;  3D68 A;  3FMC A;  4R87 A;  3T8W A;  3JVN A;  4R76 A;  2FT0 A;  5AG7 A;  3R9F A;  2B5G B;  2WPX A;  4AB7 A;  5F48 A;  3IC1 A;  1TIQ A;  2PDO A;  2B5G A;  5AG5 A;  2R7H A;  3IU2 A;  2JDD A;  1Q7L A;  1M4G A;  5BWA B;  1S60 A;  4OP4 A;  4NCZ A;  4QBJ A;  1WK4 A;  1MJB A;  2Q4Z A;  3JUW A;  1S7F A;  4CRZ B;  1KUY A;  3IWE A;  2EO8 A;  1ELM P;  1N71 A;  3BLN A;  4HNW B;  3V7Z A;  4YGO A;  5K8N A;  3D3S A;  4C7H A;  3NA6 A;  1F2P A;  3SJG A;  5AG6 A;  4NGQ A;  2CF4 A;  5JPH A;  2ZED A;  1Y9K A;  5GCN A;  2AJ6 A;  1S7K A;  4OLL A;  5I0C A;  5K8M A;  2BL1 A;  3BJ8 A;  1ZLI A;  3K2K A;  4GXH A;  4CAF A;  5LRK A;  1NSA A;  4PV6 A;  4KVO E;  4H89 A;  5HH1 A;  1Y0Y A;  2QEC A;  3LOD A;  4H6U A;  2PJ7 A;  3WAB A;  4OC2 A;  4Q7A A;  5IB9 A;  1LRZ A;  3NH4 A;  4E2A A;  1Z8X A;  2G3T A;  3S9M A;  1IU8 A;  1ZG9 A;  2AFO A;  5EC4 A;  5ELY A;  3CDX A;  1VHE A;  3GYA A;  3P2H A;  3PB9 X;  3N5F A;  4U9Z A;  4PK3 A;  2ZEO A;  1MJ9 A;  2PIY A;  3PBE A;  2V77 A;  1TKH A;  1UFH A;  2HUZ A;  3QAY A;  4MHZ A;  3MRU A;  4CGP A;  3W6X A;  3ISZ A;  1K4J A;  3D66 A;  4O23 A;  3QAH A;  3VAT A;  5A27 A;  2D4P A;  1BPM A;  3FIX A;  2WZN A;  4NEX A;  4A39 A;  3S9N A;  2JEW A;  3I3G A;  2RC4 A;  2QIR A;  3BHX A;  4QB9 A;  2EK8 A;  4XNH C;  2ARH A;  1FNO A;  1Z8T A;  1YVO A;  2GU2 A;  3TOA A;  2GIV A;  3PFE A;  2Y0M A;  3IIB A;  4DJL A;  1CG2 A;  1XBU A;  4BD9 A;  4F0Y A;  4CGO A;  4KUA A;  3KKW A;  5C88 A;  3E0K A;  4P6Y A;  2FSR A;  1JQG A;  4PXE A;  2PJA A;  2PR1 A;  1CJW A;  3BXM A;  4KVX A;  4MHN A;  1X12 A;  3NE7 A;  3D7D A;  2CTC A;  4A31 A;  1OZP A;  4HKF A;  4JJX A;  3TOB A;  4X3R A;  2AFS A;  4Y49 B;  6CPA A;  3TO6 A;  1P0H A;  3RNZ A;  1IOF A;  4MY0 A;  5KTC A;  3EXN A;  4KOX A;  3NH5 A;  2P6E A;  4PPZ A;  1EE3 P;  4JWP A;  2A4N A;  3FH4 A;  4OC4 A;  1VGY A;  2ZEN A;  5F47 A;  4OC5 A;  2O53 A;  2OU2 A;  4IAV A;  5IX3 A;  1KZF A;  1S7L A;  2REF A;  3DLJ A;  4NXY A;  1BLL E;  4A37 A;  1XMB A;  2WSA A;  4ZI6 A;  2JBK A;  4MFZ A;  4K3N A;  4R3L A;  3EY5 A;  4EME A;  1LCP A;  2QJ8 A;  3B3C A;  2J8N A;  2PJ9 A;  4X5K A;  2Z3O A;  4XPD B;  1AYE A;  4HNX B;  3RZA A;  2ODF A;  2YND A;  3B2Y A;  2EUI A;  3GIU A;  1Q2Y A;  3SXO A;  3DDD A;  3S9L A;  1YQE A;  2Q0Y A;  4MCQ A;  3EFA A;  4EVY A;  4YFJ A;  1AMP A;  2YNE A;  4MRI A;  1IYK A;  4ORF A;  1RXT A;  1Z9U A;  4X8I A;  1OBR A;  4OME A;  1M1D A;  3JTK A;  4UEZ A;  2ZEH A;  2V8V A;  1X10 A;  3SI1 A;  3NE8 A;  4FAI A;  2I79 A;  5F46 A;  5HVF A;  1M4D A;  1CPX A;  4CYO A;  1YME A;  2Z3P A;  1YLO A;  1CX8 A;  1M4I A;  2PJ3 A;  4JLY A;  4KZT A;  1XF8 A;  4CAX A;  1TF8 A;  2ZEF A;  2PSW A;  1GHE A;  4NJR A;  1IYL A;  4PXD A;  3FNC A;  3A9L A;  3SI0 A;  4PSX A;  2RFH A;  4MCP A;  4PXC A;  4Q36 A;  4B6Z A;  4NJQ A;  1MJA A;  2G0B A;  3FJU A;  4DNC A;  4NGR A;  4MY3 A;  4AG7 A;  5J8F A;  1ZO0 A;  4C2Z A;  2YNC C;  4RI1 A;  5F49 A;  3TTH A;  3TX8 A;  3FED A;  3CPA A;  4L89 A;  1BO4 A;  2OR4 A;  3CXS A;  2ZEM A;  4FD7 A;  3PFO A;  2BEI A;  3DSB A;  2F7V A;  4B5P B;  1DE4 C;  4C2Y A;  4CYN A;  1IB1 E;  3VH9 A;  2ZEG A;  3DR8 A;  4AVB A;  5IV0 A;  5THW A;  3D7H A;  3B3S A;  1M44 A;  4UBR A;  4B5P A;  3SJF A;  1Y7R A;  4L8A A;  5KTD A;  1ZG8 A;  4KOU A;  2OZG A;  4OC3 A;  1Q2D A;  2PJ2 A;  2NMT A;  4KLW A;  4NGN A;  1GYT A;  4JZ0 A;  3OWC A;  4NF1 A;  3GUX A;  2P0W A;  4H6Z A;  4IUS A;  4B14 A;  4ONU A;  4F9U A;  4ZX9 A;  4MHP A;  3DR6 A;  3VWE A;  1Z4R A;  4FD5 A;  3LMS A;  1IOI A;  1I21 A;  4UCM A;  2PR8 A;  2Q7B A;  4E8O A;  5JH9 A;  2ZW4 A;  4W9Y A;  2CTB A;  3GKR A;  3SI2 A;  4CAV A;  2JLM A;  1YR0 A;  2VZZ A;  1XFO A;  2DPT A;  2GFQ A;  2PJC A;  3G8W A;  4TNU A;  1XMT A;  1BOB A;  1F57 A;  1Y0R A;  2DF5 A;  2QYV A;  4F8Z A;  2VEZ A;  2D4O A;  3I1U A;  1KUV A;  1Q2C A;  4OAE A;  4CYQ A;  2IL4 A;  4UEF A;  2F8H A;  2FVG A;  2Q7S A;  2Z10 A;  3PP9 A;  1NE9 A;  4FD4 A;  2PJ8 A;  4A94 A;  3TE4 A;  1DTD A;  4JD6 A;  2ZEE A;  3D4U A;  2P6G A;  5JQ4 A;  3LAC A;  3TO7 A;  2Z3M A;  3KR4 A;  4FBE A;  1HDQ A;  5HMN A;  2BUE A;  2PIZ A;  4MXU A;  4AVA A;  3FX6 A;  4RUH A;  4JXQ A;  5LYF A;  2Q04 A;  4II9 A;  4IK2 A;  2ATR A;  3FB3 A;  3QB8 A;  3D8P A;  4P4J A;  1YGH A;  2EWB A;  4UA3 A;  3TO9 A;  4AVC A;  5HXD A;  1I1D A;  4ZGY B;  4OC0 A;  4M6G A;  2PC1 A;  1BAV A;  3PB6 X;  1QMU A;  5G21 A;  5J8C A;  1Z2L A;  1S5K A;  4P10 A;  4DUK A;  4NGP A;  1NSL A;  4A33 A;  2QML A;  4UWI A;  1CBX A;  1YSJ A;  1YX0 A;  4U5Y A;  2PRB A;  2V8G A;  1QSM A;  3FVL A;  3GY9 A;  2PJ1 A;  4XNH B;  5H84 A;  2Z0Z A;  2VZY A;  3CZX A;  2ANP A;  4FD6 A;  2B3U A;  5DWN A;  3FEC A;  3R95 A;  1Z8W A;  2PE3 A;  1NMT A;  4JYW A;  3FBU A;  3S6K A;  1IID A;  3B8G A;  1QSN A;  4KVM E;  2Q43 A;  2XEJ A;  4UIA A;  1QSR A;  1QQ9 A;  5CPA A;  4KOS A;  2OOT A;  4KUB A;  3CXP A;  2XEG A;  4ZY2 A;  4CGL A;  2ZW5 A;  4P4D A;  1H8L A;  2V8H A;  3S6G A;  3KHX A;  3QNV A;  3LD2 A;  1PYT B;  5LRG A;  3TC8 A;  1CP7 A;  3BJ7 A;  4MBU A;  2DPS A;  2NYQ A;  2V8D A;  4ONW A;  5K8P A;  2FIA A;  3RYO A;  1Z8L A;  2I3C A;  3DNS A;  2Z3K A;  3DGV A;  2J8M A;  2WUU A;  2ZEP A;  3V38 A;  3B3W A;  1LAN A;  3KZW A;  4QVT A; 
#chains in the Genus database with same CATH homology
 5AGE A;  4Y49 C;  4B13 A;  2F5I A;  2ZW7 A;  2J8R A;  5ISV A;  2I00 A;  4KLV A;  1XEB A;  4MFL A;  2Z3N A;  3WR7 A;  5G1Z A;  4M3S A;  2B3V A;  4IF5 A;  2B4D B;  4PK2 A;  3EO4 A;  3MGD A;  2Q4V A;  2O28 A;  2ZXV A;  4GS4 A;  2B4D A;  2JEV A;  2ZW6 A;  3H4Q A;  2B58 A;  1ON0 A;  3R1K A;  4B5O A;  2BSW A;  2GE3 A;  3K9U A;  4CS0 B;  4OAD A;  4CRY B;  4CAW A;  4I49 A;  3T90 A;  2R8V A;  3FYN A;  1VHS A;  4BBH A;  3W91 A;  2ZPA A;  3G3S A;  4R3K A;  1MK4 A;  4MFK A;  4MFQ A;  2YNC A;  2CNT A;  1J4J A;  1QSO A;  3D2P A;  1YLE A;  4QC6 A;  3IGR A;  1RO5 A;  3C26 A;  3ZZI A;  1SQH A;  4K30 A;  4KOT A;  4AG9 A;  4MI4 A;  3W6S A;  1XE4 A;  2H5M A;  2VQY A;  5H86 A;  3P2F A;  1YK3 A;  3I9S A;  5A28 A;  3F0A A;  2CNM A;  3H5Z A;  4LUA A;  2DXQ A;  5E96 A;  2R98 A;  1FY7 A;  4UFV A;  4KSA A;  1B87 A;  4A32 A;  2KCW A;  4B11 A;  4KOR A;  3SXN A;  2G3A A;  3R96 A;  4RS2 A;  5G22 A;  2GAN A;  1S3Z A;  2FE7 A;  3SHP A;  1KUX A;  2CY2 A;  4MJ8 A;  5CNP A;  3D2M A;  3R9G A;  4YRH A;  2R1I A;  4KOW A;  1VKC A;  4ZBG A;  4UCP A;  4Q38 A;  1XIX A;  2YGW A;  4C68 A;  1Y9W A;  4BMH A;  4C7I A;  2P6F A;  2Q44 A;  2Z3L A;  4LX9 A;  1CM0 A;  1P4N A;  2B4B A;  4R57 A;  4CGN A;  2VBQ A;  2VXK A;  3PGP A;  1YRE A;  3IU1 A;  3TCV A;  2Q4Y A;  4CYP A;  5EBV A;  4B12 A;  4MFJ A;  2HQY A;  2WPW A;  4JXR A;  2FIW A;  4HNY B;  4KOV A;  3FRM A;  4XPL A;  2FL4 A;  5FVJ A;  3EC4 A;  2K5T A;  3PZJ A;  2FS5 A;  2FCK A;  4A30 A;  4CGM A;  4PSW A;  4U9Y A;  3N7Z A;  2PQ8 A;  4XPK A;  4CAE A;  1B6B A;  4E0A A;  1L0C A;  3VWD A;  3R9E A;  3TFY A;  4C2X A;  4MHD A;  4UCN A;  1WWZ A;  1PU9 A;  3F5B A;  1R57 A;  3CXQ A;  4MFP A;  4M85 A;  4J3G A;  4UFX A;  1YVK A;  4KOY A;  1IIC A;  4R9M A;  3IWG A;  4F0X A;  1Z4E A;  2OH1 A;  3UY5 A;  4NSQ A;  5KTA A;  2VI7 A;  3ZJ0 A;  4A2Z A;  5G20 A;  5IB0 A;  4XPD C;  4QUS A;  2C27 A;  2REE A;  5C82 A;  1S7N A;  2FXF A;  2OZU A;  2CXA A;  4KSF A;  4B10 A;  3F8K A;  4F6A A;  1PUA A;  1U6M A;  1I12 A;  3V8I A;  4UWJ A;  2Z11 A;  2HV2 A;  2X7B A;  2OZH A;  2EVN A;  4A95 A;  3S6H A;  3T9Y A;  1QST A;  2OB0 A;  3S6F A;  2JDC A;  2AE6 A;  4UFW A;  2CNS A;  3FXT A;  3TT2 A;  1V0C A;  5AG4 A;  5DWM A;  4R87 A;  3JVN A;  2FT0 A;  5AG7 A;  3R9F A;  2B5G B;  2WPX A;  4AB7 A;  5F48 A;  1TIQ A;  2PDO A;  2B5G A;  5AG5 A;  2R7H A;  3IU2 A;  2JDD A;  1M4G A;  5BWA B;  1S60 A;  4NCZ A;  4QBJ A;  1WK4 A;  1MJB A;  3JUW A;  1S7F A;  4CRZ B;  1KUY A;  3IWE A;  1N71 A;  3BLN A;  4HNW B;  4YGO A;  3D3S A;  4C7H A;  5AG6 A;  5JPH A;  1Y9K A;  5GCN A;  2AJ6 A;  1S7K A;  4OLL A;  5I0C A;  2BL1 A;  3BJ8 A;  4CAF A;  5HH1 A;  4PV6 A;  4KVO E;  4H89 A;  2QEC A;  3LOD A;  4H6U A;  1LRZ A;  4E2A A;  2G3T A;  5EC4 A;  3GYA A;  3P2H A;  4U9Z A;  4PK3 A;  1MJ9 A;  1UFH A;  2HUZ A;  4CGP A;  3W6X A;  1K4J A;  3QAH A;  5A27 A;  2D4P A;  3FIX A;  4NEX A;  3I3G A;  2RC4 A;  2QIR A;  4QB9 A;  4XNH C;  2ARH A;  1YVO A;  3TOA A;  2GIV A;  2Y0M A;  4F0Y A;  4CGO A;  4KUA A;  3KKW A;  5C88 A;  3E0K A;  2FSR A;  2PR1 A;  4KVX A;  1CJW A;  3NE7 A;  4A31 A;  1OZP A;  4HKF A;  4JJX A;  3TOB A;  4Y49 B;  3TO6 A;  1P0H A;  4MY0 A;  5KTC A;  3EXN A;  4KOX A;  2P6E A;  4JWP A;  2A4N A;  5F47 A;  2OU2 A;  5IX3 A;  1KZF A;  1S7L A;  2REF A;  4NXY A;  2WSA A;  4MFZ A;  4R3L A;  3EY5 A;  2J8N A;  4X5K A;  4XPD B;  2Z3O A;  4HNX B;  2YND A;  2EUI A;  1Q2Y A;  3SXO A;  3DDD A;  2Q0Y A;  4EVY A;  3EFA A;  5IV0 A;  4YFJ A;  2YNE A;  4ORF A;  1IYK A;  1RXT A;  1Z9U A;  1M1D A;  3JTK A;  2I79 A;  5F46 A;  1M4D A;  4CYO A;  2Z3P A;  1M4I A;  4JLY A;  4KZT A;  1XF8 A;  4CAX A;  2PSW A;  1GHE A;  1IYL A;  3FNC A;  3A9L A;  4PSX A;  4Q36 A;  1MJA A;  2G0B A;  4DNC A;  4MY3 A;  4AG7 A;  5J8F A;  1ZO0 A;  4C2Z A;  2YNC C;  4RI1 A;  5F49 A;  3TTH A;  4L89 A;  1BO4 A;  3CXS A;  4FD7 A;  2BEI A;  3DSB A;  4B5P B;  4CYN A;  4C2Y A;  1IB1 E;  3DR8 A;  4AVB A;  4UBR A;  1M44 A;  4B5P A;  1Y7R A;  4L8A A;  5KTD A;  4KOU A;  2OZG A;  1Q2D A;  4KLW A;  2NMT A;  4NF1 A;  3OWC A;  2P0W A;  4H6Z A;  4IUS A;  4B14 A;  4ONU A;  3DR6 A;  3VWE A;  1Z4R A;  4FD5 A;  1I21 A;  4UCM A;  2PR8 A;  2Q7B A;  4E8O A;  2ZW4 A;  3GKR A;  4CAV A;  2JLM A;  1YR0 A;  2VZZ A;  2DPT A;  3G8W A;  1XMT A;  1BOB A;  2VEZ A;  2D4O A;  4OAE A;  1KUV A;  1Q2C A;  4CYQ A;  2IL4 A;  2Z10 A;  3PP9 A;  4FD4 A;  1NE9 A;  3TE4 A;  4JD6 A;  2P6G A;  5JQ4 A;  3TO7 A;  2Z3M A;  5HMN A;  2BUE A;  4AVA A;  4JXQ A;  2Q04 A;  4II9 A;  2ATR A;  3FB3 A;  3QB8 A;  3D8P A;  1YGH A;  3TO9 A;  4UA3 A;  4AVC A;  1I1D A;  4ZGY B;  2PC1 A;  5G21 A;  5J8C A;  1S5K A;  1NSL A;  4A33 A;  2QML A;  4UWI A;  1YX0 A;  4U5Y A;  2PRB A;  1QSM A;  5H84 A;  3GY9 A;  4XNH B;  2Z0Z A;  2VZY A;  4FD6 A;  2B3U A;  5DWN A;  3R95 A;  1NMT A;  3FBU A;  3S6K A;  1IID A;  3B8G A;  1QSN A;  4KVM E;  1QSR A;  4KOS A;  4KUB A;  3CXP A;  4CGL A;  2ZW5 A;  3S6G A;  3LD2 A;  3BJ7 A;  4MBU A;  2DPS A;  2FIA A;  3RYO A;  3DNS A;  2Z3K A;  2J8M A;  2WUU A;  4KS9 A;  4QVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...