3IWGA

Acetyltransferase from gnat family from colwellia psychrerythraea.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
268
Chain Sequence
FKIKTIESLSDLTQLKKAYFDSSIVPLDGMWHFGFAPMAKHFGFYVNKNLVGFCCVNDDGYLLQYYLQPEFQLCSQELFTLISQQNSSVIGEVKGAFVSTAELNYQALCLDNSATFKVNSLMYQHNTKLANLEMIDMQIAGTEQLTAFVTFAAANIGAPEQWLTQYYGNLIERKELFGYWHKGKLLAAGECRLFDQYQTEYADLGMIVAQSNRGQGIAKKVLTFLTKHAATQGLTSICSTESNNVAAQKAIAHAGFTSAHRIVQFEFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase, GNAT family
publication title X-ray crystal structure of Acetyltransferase from GNAT family from Colwellia psychrerythraea.
rcsb
source organism Colwellia psychrerythraea
total genus 78
structure length 268
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF18015 Acetyltransf_19 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA02
3.40.630.80 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA01
4R87A 1KUYA 1LRZA 4QVTA 1S3ZA 4H6UA 1BO4A 2P6GA 3SXNA 3CXQA 2GIVA 1IYKA 4HNXB 3BJ8A 4CS0B 1TIQA 2J8MA 1GHEA 2Z0ZA 2WPWA 4KZTA 3LODA 1S7NA 4B5PB 2B5GB 2B3UA 2G3TA 2CY2A 4KVME 4M3SA 3GKRA 3OWCA 2NMTA 2QECA 4KOYA 5IX3A 4JXRA 3FYNA 4YGOA 4KVXA 4NCZA 5JPHA 3TO6A 2OB0A 3S6HA 3G3SA 4AB7A 4KOXA 3TO7A 1IIDA 4AG9A 3TFYA 1IICA 5F47A 1I12A 1NMTA 2FIWA 4OADA 3R96A 3F0AA 2JLMA 3SXOA 4FD4A 4FD7A 2DXQA 1PU9A 4QUSA 3TCVA 4MY3A 4H89A 2VXKA 4KORA 1B87A 4ZBGA 2R98A 3FNCA 2OZGA 1CM0A 5EBVA 2D4OA 4GS4A 3R9GA 3EXNA 2OH1A 4U5YA 1QSTA 2FL4A 3WR7A 3F8KA 5KTDA 3C26A 3DNSA 3FBUA 2FCKA 2JDCA 2O28A 4L8AA 4F0YA 2CNSA 4CAVA 3SHPA 4JXQA 1Q2YA 1MJ9A 4LX9A 3S6GA 3PGPA 4XNHB 4IUSA 1XEBA 2B4DA 4MI4A 2VEZA 1P4NA 4R3KA 4UWJA 5IV0A 2F5IA 1YK3A 4MHDA 2EVNA 4LUAA 2HV2A 4XPLA 4MBUA 4QB9A 1V0CA 2REFA 1XF8A 4JWPA 2RC4A 3FB3A 1S7FA 5KTAA 4F6AA 1Q2DA 4HNYB 1QSMA 5ISVA 5DWMA 4R9MA 1VKCA 2WPXA 4YFJA 2Q7BA 4FD6A 1QSOA 2KCWA 2H5MA 4R3LA 2X7BA 4PSWA 2FT0A 1PUAA 1KZFA 2Q44A 2ATRA 2PRBA 4PK2A 4PK3A 2VZZA 2GE3A 1IB1E 3GYAA 4X5KA 1YVOA 2VQYA 1B6BA 4XPKA 3UY5A 1MJBA 1MJAA 3DR8A 4AG7A 4DNCA 2BUEA 1Z4RA 4FD5A 2B4BA 4JD6A 3BJ7A 4E8OA 2VBQA 1VHSA 1S60A 3JUWA 2B3VA 2P6FA 3N7ZA 2R8VA 3T9YA 2J8RA 1YGHA 2Q0YA 4XPDB 4CAXA 3QAHA 3CXSA 4R57A 2Q04A 2B4DB 2D4PA 5FVJA 2VZYA 3IGRA 3EFAA 2B58A 4HKFA 4NF1A 1Z9UA 5C82A 1K4JA 2AE6A 4XPDC 2IL4A 1NSLA 2I79A 4NEXA 3W6XA 2FS5A 2CNMA 2K5TA 2JDDA 2QIRA 3D2PA 1Q2CA 4L89A 3TT2A 3DDDA 2G3AA 2ZW5A 3ZZIA 2R7HA 2P6EA 1ON0A 4KLVA 4NSQA 5J8CA 4AVCA 4U9YA 1OZPA 3P2FA 2ZW4A 2OZUA 3QB8A 4JJXA 1S5KA 2FIAA 1M4IA 1CJWA 4HNWB 2GANA 3G8WA 2PR8A 3DSBA 5H84A 1IYLA 1XMTA 4KOUA 4OAEA 5J8FA 3NE7A 4B5OA 4UBRA 5C88A 4QBJA 2FSRA 3KKWA 4U9ZA 2FE7A 4Y49B 4OLLA 4XNHC 2A4NA 3BLNA 1U6MA 2HUZA 1KUXA 2QMLA 3PZJA 3T90A 3TOBA 3E0KA 4J3GA 4PV6A 2PDOA 2Q4YA 3VWEA 4ORFA 1S7KA 1UFHA 3R9EA 4CRYB 4NXYA 1YR0A 1S7LA 1M1DA 1RO5A 1XE4A 2OU2A 2EUIA 1MK4A 1WWZA 1M4DA 4KUAA 3B8GA 3K9UA 1Y9WA 3EO4A 4UA3A 4KOVA 2HQYA 3W6SA 4K30A 1WK4A 1L0CA 5HH1A 2I00A 1Y7RA 3S6KA 4AVBA 2C27A 5KTCA 3EY5A 2PC1A 3GY9A 5F48A 1P0HA 1R57A 2CNTA 2OZHA 2BL1A 4H6ZA 3R9FA 4QC6A 4RI1A 3V8IA 3P2HA 3JVNA 5CNPA 3DR6A 5JQ4A 3W91A 2ARHA 2PQ8A 3TTHA 1SQHA 2Q4VA 2PR1A 4EVYA 4M85A 3TO9A 3VWDA 4KUBA 1Z4EA 3FXTA 1BOBA 3F5BA 4KLWA 3I9SA 4MJ8A 1KUVA 2ZW7A 4JLYA 5H86A 4ONUA 5EC4A 3D2MA 1RXTA 1FY7A 4KOWA 2J8NA 2ZPAA 3H4QA 3TOAA 3RYOA 4E0AA 2G0BA 4II9A 3S6FA 3LD2A 5I0CA 3MGDA 5F46A 2ZW6A 4MY0A 1J4JA 2FXFA 2BEIA 4B5PA 4YRHA 2Y0MA 2B5GA 1YX0A 3IWGA 1NE9A 3PP9A 5E96A 3R95A 4KOTA 2AJ6A 1XIXA 1N71A 3TE4A 4RS2A 4PSXA 4CAWA 1M44A 1YLEA 1I21A 3R1KA 2P0WA 4CRZB 4IF5A 1YREA 4UWIA 3FIXA 3EC4A 1QSRA 1M4GA 3D3SA 3D8PA 5DWNA 4AVAA 4KOSA 5GCNA 2R1IA 4KVOE 1QSNA 2PSWA 2Z11A 2BSWA 2REEA 4Y49C 1Y9KA 2Z10A 2ZXVA 1YVKA 4I49A 4BMHA 3CXPA 1I1DA 3FRMA 3I3GA 5F49A 5IB0A 5HMNA 2VI7A 3ZJ0A 4E2AA 2JEVA
chains in the Genus database with same CATH superfamily
4R87A 3IWWA 1KUYA 3NE8A 4O23A 1LRZA 2BCOA 4QVTA 1S3ZA 2AFWA 1BO4A 4H6UA 3PEIA 4DYOA 2P6GA 3SXNA 3CXQA 2GREA 2GIVA 4UIBA 3LACA 1IYKA 4HNXB 3S9LA 2AFXA 3BJ8A 4P4JA 3DGVA 3BXMA 1TIQA 4CS0B 3H5ZA 2ZEDA 2J8MA 1GHEA 2PJ3A 2Z0ZA 3B3TA 3SJEA 2WPWA 4KZTA 3LODA 1S7NA 4B5PB 1LOKA 2B5GB 4ZY2A 4A94A 3KGQA 3SJXA 2B3UA 3KQZA 2G3TA 2CY2A 2O53A 2CXAA 3GKRA 4KVME 4M3SA 4P4BA 2PIZA 4UFVA 3OWCA 5JM6A 2NMTA 2QECA 4KOYA 5IX3A 2DEAA 3IC1A 3IJ3A 4JXRA 1JWQA 3FYNA 1LANA 3NH4A 4FUUA 2ZELA 4M6HA 4P45A 4YGOA 4KVXA 4NCZA 5JPHA 3B3SA 3IWEA 4PXCA 3TO6A 5LYLA 2OB0A 4M6IA 1Y0YA 3IFEA 3SJFA 1TF8A 3S6HA 4UCNA 3IU2A 3GUXA 3G3SA 4AB7A 2EK8A 4KOXA 3TO7A 4X3RA 5HVFA 1IIDA 4AG9A 3TFYA 1IICA 2EK9A 2QJ8A 2CF4A 5CPAA 5F47A 1I12A 1NMTA 2FIWA 4PQAA 2C1CA 4OADA 4P4EA 2EBJA 3R96A 3F0AA 2JLMA 3SXOA 4FD4A 1F2PA 1QMUA 4FD7A 2XEJA 3TX8A 2YGWA 1AMPA 3WC7A 2DXQA 3NFZA 5AGEA 1KWMA 1FNOA 1PU9A 4QUSA 1VGYA 3L2NA 3TCVA 3WABA 4MY3A 1ARMA 4MHNA 4IK2A 4P4IA 4EMEA 2F8HA 4H89A 2VXKA 3WC6A 1ZLIA 5IB9A 3N5FA 4KORA 4CGLA 5K8OA 4KS9A 1B87A 4ZBGA 2R98A 5CBMA 5F09A 2FVGA 3FNCA 2OZGA 1IOFA 4MXUA 1CM0A 5AG5A 5D29A 4ZY0A 5EBVA 2D4OA 4GS4A 3R9GA 2AFZA 2OH1A 3EXNA 4U5YA 4MMOA 5K8PA 2Z3NA 3B3VA 3H8EA 4P4FA 2J9AA 1QSTA 2FL4A 4DJLA 2V8DA 3WR7A 2YNCA 3F8KA 5KTDA 3C26A 3DNSA 4F9VA 3FBUA 4UF4A 2FCKA 2JDCA 2O28A 4L8AA 4A38A 4F0YA 2Q43A 2CNSA 3LMSA 3SHPA 4CAVA 4JXQA 1M4LA 1Q2YA 4R8FA 1MJ9A 2ZEOA 5LYFA 3KHZA 4NFRA 4LX9A 5K8MA 4EWTA 1YSJA 3VARA 3S6GA 4AXVA 2OR4A 2BO9A 3PGPA 2Z3LA 1X12A 4XNHB 4IUSA 1XEBA 2B4DA 4MI4A 2PJ0A 1P4NA 2VEZA 4R3KA 4Q36A 3PB4X 4UWJA 1IOIA 2VL1A 5IV0A 2F5IA 3D67A 4HPSA 1ZG7A 4A31A 2EO8A 1YK3A 5G22A 4MHDA 2EVNA 2PJCA 2V8GA 3FEDA 3FJUA 4LUAA 1VIXA 2HV2A 1TF9A 4XPLA 1Z5RA 4OKOA 3PB7X 4ZX8A 4KSIA 4C2XA 4MBUA 4QB9A 2Q7SA 1V0CA 2REFA 4MHPA 1XF8A 4JWPA 2RC4A 3SI1A 3FB3A 1JQGA 1S7FA 2PJAA 3IO1A 5KTAA 1XBUA 4F6AA 4MHYA 1Q2DA 4MFPA 4HNYB 2GFQA 1QSMA 3NH5A 5ISVA 5DWMA 4R9MA 5G20A 1VKCA 2WPXA 3D7FA 4YFJA 2Q7BA 3FECA 4FD6A 1Y0RA 4H2KA 1QSOA 2KCWA 2H5MA 2ODFA 1GYTA 3QNVA 4R3LA 3KR5A 4JZ0A 2X7BA 4PSWA 2FT0A 1PUAA 1KZFA 4CYQA 2Q44A 2PJ6A 1PCAA 2ATRA 2PRBA 2Q4ZA 4PK2A 4PK3A 2VZZA 4NGQA 2GE3A 2QVPA 4P4DA 1CG2A 4ZGYB 1H8LA 1Z8WA 1LFWA 2PJ5A 1IB1E 3GYAA 4CGOA 4X5KA 1YVOA 2VQYA 4B13A 5AG6A 2PVVA 1B6BA 1Z8XA 4XPKA 3UY5A 4FWUA 5HXDA 4OC4A 1BLLE 1BPMA 1MJAA 1MJBA 2Z3OA 1HDQA 4B10A 3DR8A 2YNDA 3T8WA 4UEEA 1R3NA 4M6GA 4AG7A 2PE3A 4NGMA 4DNCA 4MHZA 1OBRA 1IGBA 2DPTA 1ELLP 4Q38A 2BUEA 2PJ9A 1Z4RA 4FD5A 1RTQA 5JGFA 4BBHA 5AG7A 5J1QA 3PB9X 4TNUA 2B4BA 4BD9A 4JD6A 3BJ7A 4E8OA 2VBQA 1XRYA 1VHSA 4EFDA 1S60A 3JUWA 5AG4A 1F57A 2B3VA 2C6PA 2P6FA 2R8VA 3N7ZA 4FAIA 3ISXA 3T9YA 2J8RA 4C7HA 4W9YA 8CPAA 4MCRA 2CTCA 4JYWA 1YGHA 1DE4C 2Q0YA 3K9TA 2PJ2A 4XPDB 4CAXA 4IHMA 2PCUA 3QAHA 5DS0A 3CZXA 3CXSA 3B7IA 1ELMP 4R57A 2Q04A 3MN8A 2ABZA 2B4DB 2ZEPA 2D4PA 2YNCC 5FVJA 1A2ZA 2VZYA 4F9UA 3IGRA 3IEHA 3EFAA 2B58A 4ZI6A 2PJ4A 3FVLA 4HKFA 5D8NA 3PB8X 4NF1A 1AYEA 1Z9UA 5C82A 1K4JA 2AE6A 4WJBA 2IL4A 4XPDC 2GLFA 2I79A 2V77A 4NEXA 1NSLA 3W6XA 2FS5A 4A30A 4Q7AA 2CNMA 2K5TA 2JDDA 2QIRA 3D2PA 1BAVA 1LCPA 2F7VA 2C6GA 3SI0A 1Q2CA 2OOTA 3KHXA 4L89A 4MCSA 3DDDA 3TT2A 4C2YA 1VHOA 2G3AA 2ZW5A 3ZZIA 2R7HA 1HDUA 2P6EA 2IMOA 2AFMA 3FEEA 3K2KA 3PB6X 2NSMA 5C88A 1ON0A 4B12A 2ZOFA 4CGPA 4KLVA 2PRQA 1TKHA 3HUVA 3BHXA 4R76A 4ZX9A 4NSQA 4PXBA 5J8CA 4AVCA 4U9YA 1OZPA 1F2OA 1Z2LA 3P2FA 5A27A 2ZW4A 1YMEA 1CP6A 4OP4A 2OZUA 3QB8A 4JJXA 1S5KA 2CTBA 2FIAA 4OC1A 1TXRA 3GB0A 5HVHA 2NYQA 2ZEFA 5LRJA 5I4MA 4PXEA 3PBEA 3CPAA 3DLJA 1M4IA 6CPAA 1CJWA 2XEFA 1YLOA 3KQXA 4FBEA 4HNWB 2GANA 3G8WA 3MRUA 4B6ZA 2PR8A 4UCMA 3DSBA 4OMEA 4X8IA 5H84A 3KI9A 2GU2A 1IYLA 5A28A 3QAYA 1XMTA 4KOUA 4UEFA 4OAEA 5J8FA 3NE7A 4NGRA 4UBRA 4UIAA 4B5OA 2FSRA 1TKJA 3A9LA 3KKWA 3PBBA 2AFSA 4QBJA 3B3WA 3PRTA 4U9ZA 2FE7A 4KSAA 4Y49B 5ELYA 2Z3KA 4OLLA 5G21A 2DF5A 3H8FA 4XNHC 2A4NA 1EE3P 3BLNA 1U6MA 2HUZA 1KUXA 4YU9A 2QMLA 3PZJA 2CIJA 3KR4A 3T90A 3TOBA 3E0KA 4J3GA 4PV6A 3WC5A 4NJRA 4A95A 2G9DA 3CPXA 2PDOA 4UCPA 2Q4YA 3VWEA 1XMBA 4ORFA 4YWYA 4MFZA 2JBJA 1S7KA 1UFHA 1CP7A 1Y7EA 2RFHA 4TWEA 3R9EA 4CRYB 4NXYA 4WWVA 4A32A 4ZY1A 4OC2A 3B2YA 1YR0A 2GLJA 1S7LA 3D7HA 4OC5A 1YQEA 3CT9A 3SI2A 2EWBA 3NA6A 2JBKA 1M1DA 1RO5A 1XE4A 1PYTB 3LWUA 4NGPA 5LYDA 3WT4A 4CAEA 2OU2A 2EUIA 1MK4A 7CPAA 1WWZA 3ISZA 1M4DA 2PJ8A 4KUAA 3B8GA 3K9UA 1Y9WA 1NSAA 3V7ZA 3IU1A 4LQ6A 4UEZA 5LYIA 2QYVA 1AUGA 3KZWA 1CPXA 3EO4A 4UA3A 4G1PA 4MFLA 3S9MA 4KOVA 2HQYA 5EMIA 3KL9A 1ZG9A 4B14A 3W6SA 4CAFA 4K30A 1QQ9A 1WK4A 4B11A 1L0CA 4CYNA 5HH1A 2I00A 1Y7RA 3S6KA 1ARLA 4A39A 4AVBA 3FX6A 4CYOA 2C27A 4CGMA 2Q51A 5KTCA 3EY5A 5K8NA 2PC1A 2PIYA 4K3NA 3VATA 4UFWA 3GY9A 4PXDA 5F48A 1P0HA 2WZNA 3NH8A 1R57A 2CNTA 4MCQA 5HVGA 2OZHA 4UFXA 3RAMA 2BL1A 2RB7A 4H6ZA 3FF3A 5G1ZA 4C68A 3R9FA 4QC6A 2PJ1A 4RI1A 3V8IA 3P2HA 3JVNA 4Z65A 5CNPA 3DR6A 3HLPA 1Z8TA 3W91A 4CYPA 4OC0A 3H8GA 2ARHA 5JQ4A 4GM5A 2PQ8A 3SJGA 4A37A 3TTHA 1SQHA 4LQGA 2Q4VA 2Z3MA 2PR1A 2POKA 3B35A 4EVYA 3B3CA 3GIUA 4M85A 3TO9A 3VWDA 4MFJA 4OIDA 2AFUA 4KUBA 1Z4EA 4F0XA 3FXTA 5BWAB 4NGSA 1BOBA 3F5BA 1R43A 4KLWA 2WUUA 4ONWA 2JEWA 3RZAA 3D4UA 3GLJA 3I9SA 3TC8A 4MJ8A 2XEGA 4A2ZA 1KUVA 2IQ6A 2ZW7A 2DPSA 4JLYA 5H86A 4ONUA 4F8ZA 5EC4A 1IU8A 3D2MA 1YW6A 1RXTA 3D7GA 5JH9A 1FY7A 1DTDA 4OIWA 4P6YA 2ZENA 2WYRA 4KOWA 4P44A 2J8NA 1Q7LA 2ZPAA 3H4QA 2HC9A 4MCPA 3TOAA 3RYOA 2ANPA 4PPZA 4E0AA 4RN7A 2PVWA 2WSAA 3RBUA 2G0BA 4R7MA 3VH9A 3PFEA 4II9A 3S6FA 3LD2A 5I0CA 3MGDA 3JTKA 4A33A 4C7IA 5F46A 2PJBA 1IY7A 2ZW6A 4KSFA 4MY0A 2V8VA 4RUHA 3BI1A 4NGTA 1X10A 4NJQA 1J4JA 4CPAA 4OC3A 2FXFA 2BEIA 2ZEHA 4B5PA 4X2TA 4YRHA 2Y0MA 2B5GA 2I3CA 2V8HA 1YX0A 4R6TA 3IWGA 1NE9A 3PP9A 3CDXA 4MRIA 3IIBA 5E96A 3R95A 2BOAA 1YW4A 4KOTA 2AJ6A 1XIXA 1N71A 3TE4A 4RS2A 4PSXA 4CAWA 1M44A 1YLEA 1I21A 4BINA 3JRUA 3R1KA 2P0WA 2YNEA 4DUKA 1VHEA 4CRZB 4P10A 4IF5A 3D7DA 1YREA 4UWIA 2C6CA 2XEIA 1ZG8A 1Z8LA 3D68A 3FIXA 1XJOA 2ZEGA 1FT7A 3EC4A 3RNZA 3V38A 1QSRA 1M4GA 1HEEA 2IJZA 3D3SA 3D8PA 5DWNA 4AVAA 4KOSA 1XFOA 4NGNA 4MFQA 5GCNA 1TKFA 2R1IA 1CPSA 4KVOE 1QSNA 2PSWA 1XOVA 4IAVA 4C2ZA 3FMCA 2Z11A 5LRGA 3BI0A 2BSWA 3RO0A 2REEA 2ZEEA 4Y49C 2Z3PA 3D66A 1CBXA 1Y9KA 3FH4A 3KASA 2Z10A 5LRKA 1ZLHA 1UWYA 2ZXVA 3S9NA 1YVKA 2PJ7A 3I1UA 2AFOA 4I49A 4BMHA 3CXPA 2O4HA 1LAPA 1LAMA 1I1DA 2HB6A 2ZEMA 3FRMA 4GXHA 1CX8A 3I3GA 5F49A 5IB0A 5HMNA 2VI7A 5THWA 2ZOGA 4ZYQA 3ZJ0A 1BPNA 1ZO0A 4MFKA 4CGNA 3PFOA 4E2AA 2JEVA
chains in the Genus database with same CATH topology
4R87A 1KUYA 1LRZA 4QVTA 1S3ZA 4H6UA 1BO4A 2P6GA 3SXNA 3CXQA 2GIVA 1IYKA 4HNXB 3BJ8A 4CS0B 1TIQA 3H5ZA 2J8MA 1GHEA 2Z0ZA 2WPWA 4KZTA 3LODA 1S7NA 4B5PB 2B5GB 2B3UA 2G3TA 2CY2A 4KVME 2CXAA 3GKRA 4M3SA 4UFVA 3OWCA 2NMTA 2QECA 4KOYA 5IX3A 4JXRA 3FYNA 4YGOA 4KVXA 4NCZA 5JPHA 3IWEA 3TO6A 2OB0A 3S6HA 4UCNA 3IU2A 3G3SA 4AB7A 4KOXA 3TO7A 1IIDA 4AG9A 3TFYA 1IICA 5F47A 1I12A 1NMTA 2FIWA 4OADA 3R96A 3F0AA 2JLMA 3SXOA 4FD4A 4FD7A 2YGWA 2DXQA 5AGEA 1PU9A 4QUSA 3TCVA 4MY3A 4H89A 2VXKA 4KORA 4CGLA 4KS9A 1B87A 4ZBGA 2R98A 3FNCA 2OZGA 1CM0A 5AG5A 5EBVA 2D4OA 4GS4A 3R9GA 3EXNA 2OH1A 4U5YA 2Z3NA 1QSTA 2FL4A 3WR7A 2YNCA 3F8KA 5KTDA 3C26A 3DNSA 3FBUA 2FCKA 2JDCA 2O28A 4L8AA 4F0YA 2CNSA 4CAVA 3SHPA 4JXQA 1Q2YA 1MJ9A 4LX9A 3S6GA 3PGPA 2Z3LA 4XNHB 4IUSA 1XEBA 2B4DA 4MI4A 2VEZA 1P4NA 4R3KA 4Q36A 4UWJA 5IV0A 2F5IA 4A31A 1YK3A 5G22A 4MHDA 2EVNA 4LUAA 2HV2A 4XPLA 4C2XA 4MBUA 4QB9A 1V0CA 2REFA 1XF8A 4JWPA 2RC4A 3FB3A 1S7FA 5KTAA 4F6AA 1Q2DA 4MFPA 4HNYB 1QSMA 5ISVA 5DWMA 4R9MA 5G20A 1VKCA 2WPXA 4YFJA 2Q7BA 4FD6A 1QSOA 2KCWA 2H5MA 4R3LA 2X7BA 4PSWA 2FT0A 1PUAA 1KZFA 4CYQA 2Q44A 2ATRA 2PRBA 4PK2A 4PK3A 2VZZA 2GE3A 4ZGYB 1IB1E 3GYAA 4CGOA 4X5KA 1YVOA 2VQYA 4B13A 5AG6A 1B6BA 4XPKA 3UY5A 2Z3OA 1MJBA 1MJAA 4B10A 3DR8A 2YNDA 4AG7A 4DNCA 2DPTA 4Q38A 2BUEA 1Z4RA 4FD5A 4BBHA 5AG7A 2B4BA 4JD6A 3BJ7A 4E8OA 2VBQA 1VHSA 1S60A 3JUWA 5AG4A 2B3VA 2P6FA 3N7ZA 2R8VA 3T9YA 2J8RA 4C7HA 1YGHA 2Q0YA 4XPDB 4CAXA 3QAHA 3CXSA 4R57A 2Q04A 2B4DB 2D4PA 2YNCC 5FVJA 2VZYA 3IGRA 3EFAA 2B58A 4HKFA 4NF1A 1Z9UA 5C82A 1K4JA 2AE6A 4XPDC 2IL4A 1NSLA 2I79A 4NEXA 3W6XA 4A30A 2FS5A 2CNMA 2K5TA 2JDDA 2QIRA 3D2PA 1Q2CA 4L89A 3TT2A 3DDDA 4C2YA 2G3AA 2ZW5A 3ZZIA 2R7HA 2P6EA 1ON0A 4B12A 4CGPA 4KLVA 4NSQA 5J8CA 4AVCA 4U9YA 1OZPA 3P2FA 5A27A 2ZW4A 4JJXA 2OZUA 3QB8A 1S5KA 2FIAA 1M4IA 1CJWA 4HNWB 2GANA 3G8WA 2PR8A 4UCMA 3DSBA 5H84A 1IYLA 5A28A 1XMTA 4KOUA 4OAEA 5J8FA 3NE7A 4B5OA 4UBRA 5C88A 4QBJA 2FSRA 3A9LA 3KKWA 4U9ZA 2FE7A 4KSAA 4Y49B 2Z3KA 4OLLA 5G21A 4XNHC 2A4NA 3BLNA 1U6MA 2HUZA 1KUXA 2QMLA 3PZJA 3T90A 3TOBA 4J3GA 3E0KA 4PV6A 4A95A 4UCPA 2PDOA 2Q4YA 3VWEA 4ORFA 4MFZA 1S7KA 1UFHA 3R9EA 4CRYB 4NXYA 4A32A 1YR0A 1S7LA 1M1DA 1RO5A 1XE4A 4CAEA 2OU2A 2EUIA 1MK4A 1WWZA 1M4DA 4KUAA 3B8GA 3K9UA 1Y9WA 3IU1A 3EO4A 4UA3A 4MFLA 4KOVA 2HQYA 4B14A 3W6SA 4CAFA 4K30A 1WK4A 4B11A 1L0CA 4CYNA 5HH1A 2I00A 1Y7RA 3S6KA 4AVBA 4CYOA 2C27A 4CGMA 5KTCA 3EY5A 2PC1A 4UFWA 3GY9A 5F48A 1P0HA 1R57A 2CNTA 2OZHA 4UFXA 2BL1A 4H6ZA 5G1ZA 4C68A 3R9FA 4QC6A 4RI1A 3V8IA 3P2HA 3JVNA 5CNPA 3DR6A 5JQ4A 3W91A 4CYPA 2ARHA 2PQ8A 3TTHA 1SQHA 2Q4VA 2Z3MA 2PR1A 4EVYA 4M85A 3TO9A 3VWDA 4MFJA 4KUBA 1Z4EA 4F0XA 3FXTA 5BWAB 1BOBA 3F5BA 4KLWA 2WUUA 3I9SA 4MJ8A 4A2ZA 1KUVA 2ZW7A 2DPSA 4JLYA 5H86A 4ONUA 5EC4A 3D2MA 1RXTA 1FY7A 4KOWA 2J8NA 2ZPAA 3H4QA 3TOAA 3RYOA 4E0AA 2WSAA 2G0BA 4II9A 3S6FA 3LD2A 5I0CA 3MGDA 3JTKA 4A33A 4C7IA 5F46A 4KSFA 2ZW6A 4MY0A 1J4JA 2FXFA 2BEIA 4B5PA 4YRHA 2Y0MA 2B5GA 1YX0A 3IWGA 1NE9A 3PP9A 5E96A 3R95A 4KOTA 2AJ6A 1XIXA 1N71A 3TE4A 4RS2A 4PSXA 4CAWA 1M44A 1YLEA 1I21A 3R1KA 2P0WA 2YNEA 4CRZB 4IF5A 1YREA 4UWIA 3FIXA 3EC4A 1QSRA 1M4GA 3D3SA 3D8PA 5DWNA 4AVAA 4KOSA 5GCNA 4MFQA 2R1IA 4KVOE 1QSNA 2PSWA 4C2ZA 2Z11A 2BSWA 2REEA 4Y49C 2Z3PA 1Y9KA 2Z10A 2ZXVA 1YVKA 4I49A 4BMHA 3CXPA 1I1DA 3FRMA 3I3GA 5F49A 5IB0A 5HMNA 2VI7A 3ZJ0A 1ZO0A 4MFKA 4CGNA 4E2AA 2JEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R87 A;  1KUY A;  1LRZ A;  4QVT A;  1S3Z A;  4H6U A;  1BO4 A;  2P6G A;  3SXN A;  3CXQ A;  2GIV A;  1IYK A;  4HNX B;  3BJ8 A;  4CS0 B;  1TIQ A;  2J8M A;  1GHE A;  2Z0Z A;  2WPW A;  4KZT A;  3LOD A;  1S7N A;  4B5P B;  2B5G B;  2B3U A;  2G3T A;  2CY2 A;  4KVM E;  4M3S A;  3GKR A;  3OWC A;  2NMT A;  2QEC A;  4KOY A;  5IX3 A;  4JXR A;  3FYN A;  4YGO A;  4KVX A;  4NCZ A;  5JPH A;  3TO6 A;  2OB0 A;  3S6H A;  3G3S A;  4AB7 A;  4KOX A;  3TO7 A;  1IID A;  4AG9 A;  3TFY A;  1IIC A;  5F47 A;  1I12 A;  1NMT A;  2FIW A;  4OAD A;  3R96 A;  3F0A A;  2JLM A;  3SXO A;  4FD4 A;  4FD7 A;  2DXQ A;  1PU9 A;  4QUS A;  3TCV A;  4MY3 A;  4H89 A;  2VXK A;  4KOR A;  1B87 A;  4ZBG A;  2R98 A;  3FNC A;  2OZG A;  1CM0 A;  5EBV A;  2D4O A;  4GS4 A;  3R9G A;  3EXN A;  2OH1 A;  4U5Y A;  1QST A;  2FL4 A;  3WR7 A;  3F8K A;  5KTD A;  3C26 A;  3DNS A;  3FBU A;  2FCK A;  2JDC A;  2O28 A;  4L8A A;  4F0Y A;  2CNS A;  4CAV A;  3SHP A;  4JXQ A;  1Q2Y A;  1MJ9 A;  4LX9 A;  3S6G A;  3PGP A;  4XNH B;  4IUS A;  1XEB A;  2B4D A;  4MI4 A;  2VEZ A;  1P4N A;  4R3K A;  4UWJ A;  5IV0 A;  2F5I A;  1YK3 A;  4MHD A;  2EVN A;  4LUA A;  2HV2 A;  4XPL A;  4MBU A;  4QB9 A;  1V0C A;  2REF A;  1XF8 A;  4JWP A;  2RC4 A;  3FB3 A;  1S7F A;  5KTA A;  4F6A A;  1Q2D A;  4HNY B;  1QSM A;  5ISV A;  5DWM A;  4R9M A;  1VKC A;  2WPX A;  4YFJ A;  2Q7B A;  4FD6 A;  1QSO A;  2KCW A;  2H5M A;  4R3L A;  2X7B A;  4PSW A;  2FT0 A;  1PUA A;  1KZF A;  2Q44 A;  2ATR A;  2PRB A;  4PK2 A;  4PK3 A;  2VZZ A;  2GE3 A;  1IB1 E;  3GYA A;  4X5K A;  1YVO A;  2VQY A;  1B6B A;  4XPK A;  3UY5 A;  1MJB A;  1MJA A;  3DR8 A;  4AG7 A;  4DNC A;  2BUE A;  1Z4R A;  4FD5 A;  2B4B A;  4JD6 A;  3BJ7 A;  4E8O A;  2VBQ A;  1VHS A;  1S60 A;  3JUW A;  2B3V A;  2P6F A;  3N7Z A;  2R8V A;  3T9Y A;  2J8R A;  1YGH A;  2Q0Y A;  4XPD B;  4CAX A;  3QAH A;  3CXS A;  4R57 A;  2Q04 A;  2B4D B;  2D4P A;  5FVJ A;  2VZY A;  3IGR A;  3EFA A;  2B58 A;  4HKF A;  4NF1 A;  1Z9U A;  5C82 A;  1K4J A;  2AE6 A;  4XPD C;  2IL4 A;  1NSL A;  2I79 A;  4NEX A;  3W6X A;  2FS5 A;  2CNM A;  2K5T A;  2JDD A;  2QIR A;  3D2P A;  1Q2C A;  4L89 A;  3TT2 A;  3DDD A;  2G3A A;  2ZW5 A;  3ZZI A;  2R7H A;  2P6E A;  1ON0 A;  4KLV A;  4NSQ A;  5J8C A;  4AVC A;  4U9Y A;  1OZP A;  3P2F A;  2ZW4 A;  2OZU A;  3QB8 A;  4JJX A;  1S5K A;  2FIA A;  1M4I A;  1CJW A;  4HNW B;  2GAN A;  3G8W A;  2PR8 A;  3DSB A;  5H84 A;  1IYL A;  1XMT A;  4KOU A;  4OAE A;  5J8F A;  3NE7 A;  4B5O A;  4UBR A;  5C88 A;  4QBJ A;  2FSR A;  3KKW A;  4U9Z A;  2FE7 A;  4Y49 B;  4OLL A;  4XNH C;  2A4N A;  3BLN A;  1U6M A;  2HUZ A;  1KUX A;  2QML A;  3PZJ A;  3T90 A;  3TOB A;  3E0K A;  4J3G A;  4PV6 A;  2PDO A;  2Q4Y A;  3VWE A;  4ORF A;  1S7K A;  1UFH A;  3R9E A;  4CRY B;  4NXY A;  1YR0 A;  1S7L A;  1M1D A;  1RO5 A;  1XE4 A;  2OU2 A;  2EUI A;  1MK4 A;  1WWZ A;  1M4D A;  4KUA A;  3B8G A;  3K9U A;  1Y9W A;  3EO4 A;  4UA3 A;  4KOV A;  2HQY A;  3W6S A;  4K30 A;  1WK4 A;  1L0C A;  5HH1 A;  2I00 A;  1Y7R A;  3S6K A;  4AVB A;  2C27 A;  5KTC A;  3EY5 A;  2PC1 A;  3GY9 A;  5F48 A;  1P0H A;  1R57 A;  2CNT A;  2OZH A;  2BL1 A;  4H6Z A;  3R9F A;  4QC6 A;  4RI1 A;  3V8I A;  3P2H A;  3JVN A;  5CNP A;  3DR6 A;  5JQ4 A;  3W91 A;  2ARH A;  2PQ8 A;  3TTH A;  1SQH A;  2Q4V A;  2PR1 A;  4EVY A;  4M85 A;  3TO9 A;  3VWD A;  4KUB A;  1Z4E A;  3FXT A;  1BOB A;  3F5B A;  4KLW A;  3I9S A;  4MJ8 A;  1KUV A;  2ZW7 A;  4JLY A;  5H86 A;  4ONU A;  5EC4 A;  3D2M A;  1RXT A;  1FY7 A;  4KOW A;  2J8N A;  2ZPA A;  3H4Q A;  3TOA A;  3RYO A;  4E0A A;  2G0B A;  4II9 A;  3S6F A;  3LD2 A;  5I0C A;  3MGD A;  5F46 A;  2ZW6 A;  4MY0 A;  1J4J A;  2FXF A;  2BEI A;  4B5P A;  4YRH A;  2Y0M A;  2B5G A;  1YX0 A;  3IWG A;  1NE9 A;  3PP9 A;  5E96 A;  3R95 A;  4KOT A;  2AJ6 A;  1XIX A;  1N71 A;  3TE4 A;  4RS2 A;  4PSX A;  4CAW A;  1M44 A;  1YLE A;  1I21 A;  3R1K A;  2P0W A;  4CRZ B;  4IF5 A;  1YRE A;  4UWI A;  3FIX A;  3EC4 A;  1QSR A;  1M4G A;  3D3S A;  3D8P A;  5DWN A;  4AVA A;  4KOS A;  5GCN A;  2R1I A;  4KVO E;  1QSN A;  2PSW A;  2Z11 A;  2BSW A;  2REE A;  4Y49 C;  1Y9K A;  2Z10 A;  2ZXV A;  1YVK A;  4I49 A;  4BMH A;  3CXP A;  1I1D A;  3FRM A;  3I3G A;  5F49 A;  5IB0 A;  5HMN A;  2VI7 A;  3ZJ0 A;  4E2A A;  2JEV A; 
#chains in the Genus database with same CATH topology
 4R87 A;  3IWW A;  1KUY A;  3NE8 A;  4O23 A;  1LRZ A;  2BCO A;  4QVT A;  1S3Z A;  2AFW A;  1BO4 A;  4H6U A;  3PEI A;  4DYO A;  2P6G A;  3SXN A;  3CXQ A;  2GRE A;  2GIV A;  4UIB A;  3LAC A;  1IYK A;  4HNX B;  3S9L A;  2AFX A;  3BJ8 A;  4P4J A;  3DGV A;  3BXM A;  1TIQ A;  4CS0 B;  3H5Z A;  2ZED A;  2J8M A;  1GHE A;  2PJ3 A;  2Z0Z A;  3B3T A;  3SJE A;  2WPW A;  4KZT A;  3LOD A;  1S7N A;  4B5P B;  1LOK A;  2B5G B;  4ZY2 A;  4A94 A;  3KGQ A;  3SJX A;  2B3U A;  3KQZ A;  2G3T A;  2CY2 A;  2O53 A;  2CXA A;  3GKR A;  4KVM E;  4M3S A;  4P4B A;  2PIZ A;  4UFV A;  3OWC A;  5JM6 A;  2NMT A;  2QEC A;  4KOY A;  5IX3 A;  2DEA A;  3IC1 A;  3IJ3 A;  4JXR A;  1JWQ A;  3FYN A;  1LAN A;  3NH4 A;  4FUU A;  2ZEL A;  4M6H A;  4P45 A;  4YGO A;  4KVX A;  4NCZ A;  5JPH A;  3B3S A;  3IWE A;  4PXC A;  3TO6 A;  5LYL A;  2OB0 A;  4M6I A;  1Y0Y A;  3IFE A;  3SJF A;  1TF8 A;  3S6H A;  4UCN A;  3IU2 A;  3GUX A;  3G3S A;  4AB7 A;  2EK8 A;  4KOX A;  3TO7 A;  4X3R A;  5HVF A;  1IID A;  4AG9 A;  3TFY A;  1IIC A;  2EK9 A;  2QJ8 A;  2CF4 A;  5CPA A;  5F47 A;  1I12 A;  1NMT A;  2FIW A;  4PQA A;  2C1C A;  4OAD A;  4P4E A;  2EBJ A;  3R96 A;  3F0A A;  2JLM A;  3SXO A;  4FD4 A;  1F2P A;  1QMU A;  4FD7 A;  2XEJ A;  3TX8 A;  2YGW A;  1AMP A;  3WC7 A;  2DXQ A;  3NFZ A;  5AGE A;  1KWM A;  1FNO A;  1PU9 A;  4QUS A;  1VGY A;  3L2N A;  3TCV A;  3WAB A;  4MY3 A;  1ARM A;  4MHN A;  4IK2 A;  4P4I A;  4EME A;  2F8H A;  4H89 A;  2VXK A;  3WC6 A;  1ZLI A;  5IB9 A;  3N5F A;  4KOR A;  4CGL A;  5K8O A;  4KS9 A;  1B87 A;  4ZBG A;  2R98 A;  5CBM A;  5F09 A;  2FVG A;  3FNC A;  2OZG A;  1IOF A;  4MXU A;  1CM0 A;  5AG5 A;  5D29 A;  4ZY0 A;  5EBV A;  2D4O A;  4GS4 A;  3R9G A;  2AFZ A;  2OH1 A;  3EXN A;  4U5Y A;  4MMO A;  5K8P A;  2Z3N A;  3B3V A;  3H8E A;  4P4F A;  2J9A A;  1QST A;  2FL4 A;  4DJL A;  2V8D A;  3WR7 A;  2YNC A;  3F8K A;  5KTD A;  3C26 A;  3DNS A;  4F9V A;  3FBU A;  4UF4 A;  2FCK A;  2JDC A;  2O28 A;  4L8A A;  4A38 A;  4F0Y A;  2Q43 A;  2CNS A;  3LMS A;  3SHP A;  4CAV A;  4JXQ A;  1M4L A;  1Q2Y A;  4R8F A;  1MJ9 A;  2ZEO A;  5LYF A;  3KHZ A;  4NFR A;  4LX9 A;  5K8M A;  4EWT A;  1YSJ A;  3VAR A;  3S6G A;  4AXV A;  2OR4 A;  2BO9 A;  3PGP A;  2Z3L A;  1X12 A;  4XNH B;  4IUS A;  1XEB A;  2B4D A;  4MI4 A;  2PJ0 A;  1P4N A;  2VEZ A;  4R3K A;  4Q36 A;  3PB4 X;  4UWJ A;  1IOI A;  2VL1 A;  5IV0 A;  2F5I A;  3D67 A;  4HPS A;  1ZG7 A;  4A31 A;  2EO8 A;  1YK3 A;  5G22 A;  4MHD A;  2EVN A;  2PJC A;  2V8G A;  3FED A;  3FJU A;  4LUA A;  1VIX A;  2HV2 A;  1TF9 A;  4XPL A;  1Z5R A;  4OKO A;  3PB7 X;  4ZX8 A;  4KSI A;  4C2X A;  4MBU A;  4QB9 A;  2Q7S A;  1V0C A;  2REF A;  4MHP A;  1XF8 A;  4JWP A;  2RC4 A;  3SI1 A;  3FB3 A;  1JQG A;  1S7F A;  2PJA A;  3IO1 A;  5KTA A;  1XBU A;  4F6A A;  4MHY A;  1Q2D A;  4MFP A;  4HNY B;  2GFQ A;  1QSM A;  3NH5 A;  5ISV A;  5DWM A;  4R9M A;  5G20 A;  1VKC A;  2WPX A;  3D7F A;  4YFJ A;  2Q7B A;  3FEC A;  4FD6 A;  1Y0R A;  4H2K A;  1QSO A;  2KCW A;  2H5M A;  2ODF A;  1GYT A;  3QNV A;  4R3L A;  3KR5 A;  4JZ0 A;  2X7B A;  4PSW A;  2FT0 A;  1PUA A;  1KZF A;  4CYQ A;  2Q44 A;  2PJ6 A;  1PCA A;  2ATR A;  2PRB A;  2Q4Z A;  4PK2 A;  4PK3 A;  2VZZ A;  4NGQ A;  2GE3 A;  2QVP A;  4P4D A;  1CG2 A;  4ZGY B;  1H8L A;  1Z8W A;  1LFW A;  2PJ5 A;  1IB1 E;  3GYA A;  4CGO A;  4X5K A;  1YVO A;  2VQY A;  4B13 A;  5AG6 A;  2PVV A;  1B6B A;  1Z8X A;  4XPK A;  3UY5 A;  4FWU A;  5HXD A;  4OC4 A;  1BLL E;  1BPM A;  1MJA A;  1MJB A;  2Z3O A;  1HDQ A;  4B10 A;  3DR8 A;  2YND A;  3T8W A;  4UEE A;  1R3N A;  4M6G A;  4AG7 A;  2PE3 A;  4NGM A;  4DNC A;  4MHZ A;  1OBR A;  1IGB A;  2DPT A;  1ELL P;  4Q38 A;  2BUE A;  2PJ9 A;  1Z4R A;  4FD5 A;  1RTQ A;  5JGF A;  4BBH A;  5AG7 A;  5J1Q A;  3PB9 X;  4TNU A;  2B4B A;  4BD9 A;  4JD6 A;  3BJ7 A;  4E8O A;  2VBQ A;  1XRY A;  1VHS A;  4EFD A;  1S60 A;  3JUW A;  5AG4 A;  1F57 A;  2B3V A;  2C6P A;  2P6F A;  2R8V A;  3N7Z A;  4FAI A;  3ISX A;  3T9Y A;  2J8R A;  4C7H A;  4W9Y A;  8CPA A;  4MCR A;  2CTC A;  4JYW A;  1YGH A;  1DE4 C;  2Q0Y A;  3K9T A;  2PJ2 A;  4XPD B;  4CAX A;  4IHM A;  2PCU A;  3QAH A;  5DS0 A;  3CZX A;  3CXS A;  3B7I A;  1ELM P;  4R57 A;  2Q04 A;  3MN8 A;  2ABZ A;  2B4D B;  2ZEP A;  2D4P A;  2YNC C;  5FVJ A;  1A2Z A;  2VZY A;  4F9U A;  3IGR A;  3IEH A;  3EFA A;  2B58 A;  4ZI6 A;  2PJ4 A;  3FVL A;  4HKF A;  5D8N A;  3PB8 X;  4NF1 A;  1AYE A;  1Z9U A;  5C82 A;  1K4J A;  2AE6 A;  4WJB A;  2IL4 A;  4XPD C;  2GLF A;  2I79 A;  2V77 A;  4NEX A;  1NSL A;  3W6X A;  2FS5 A;  4A30 A;  4Q7A A;  2CNM A;  2K5T A;  2JDD A;  2QIR A;  3D2P A;  1BAV A;  1LCP A;  2F7V A;  2C6G A;  3SI0 A;  1Q2C A;  2OOT A;  3KHX A;  4L89 A;  4MCS A;  3DDD A;  3TT2 A;  4C2Y A;  1VHO A;  2G3A A;  2ZW5 A;  3ZZI A;  2R7H A;  1HDU A;  2P6E A;  2IMO A;  2AFM A;  3FEE A;  3K2K A;  3PB6 X;  2NSM A;  5C88 A;  1ON0 A;  4B12 A;  2ZOF A;  4CGP A;  4KLV A;  2PRQ A;  1TKH A;  3HUV A;  3BHX A;  4R76 A;  4ZX9 A;  4NSQ A;  4PXB A;  5J8C A;  4AVC A;  4U9Y A;  1OZP A;  1F2O A;  1Z2L A;  3P2F A;  5A27 A;  2ZW4 A;  1YME A;  1CP6 A;  4OP4 A;  2OZU A;  3QB8 A;  4JJX A;  1S5K A;  2CTB A;  2FIA A;  4OC1 A;  1TXR A;  3GB0 A;  5HVH A;  2NYQ A;  2ZEF A;  5LRJ A;  5I4M A;  4PXE A;  3PBE A;  3CPA A;  3DLJ A;  1M4I A;  6CPA A;  1CJW A;  2XEF A;  1YLO A;  3KQX A;  4FBE A;  4HNW B;  2GAN A;  3G8W A;  3MRU A;  4B6Z A;  2PR8 A;  4UCM A;  3DSB A;  4OME A;  4X8I A;  5H84 A;  3KI9 A;  2GU2 A;  1IYL A;  5A28 A;  3QAY A;  1XMT A;  4KOU A;  4UEF A;  4OAE A;  5J8F A;  3NE7 A;  4NGR A;  4UBR A;  4UIA A;  4B5O A;  2FSR A;  1TKJ A;  3A9L A;  3KKW A;  3PBB A;  2AFS A;  4QBJ A;  3B3W A;  3PRT A;  4U9Z A;  2FE7 A;  4KSA A;  4Y49 B;  5ELY A;  2Z3K A;  4OLL A;  5G21 A;  2DF5 A;  3H8F A;  4XNH C;  2A4N A;  1EE3 P;  3BLN A;  1U6M A;  2HUZ A;  1KUX A;  4YU9 A;  2QML A;  3PZJ A;  2CIJ A;  3KR4 A;  3T90 A;  3TOB A;  3E0K A;  4J3G A;  4PV6 A;  3WC5 A;  4NJR A;  4A95 A;  2G9D A;  3CPX A;  2PDO A;  4UCP A;  2Q4Y A;  3VWE A;  1XMB A;  4ORF A;  4YWY A;  4MFZ A;  2JBJ A;  1S7K A;  1UFH A;  1CP7 A;  1Y7E A;  2RFH A;  4TWE A;  3R9E A;  4CRY B;  4NXY A;  4WWV A;  4A32 A;  4ZY1 A;  4OC2 A;  3B2Y A;  1YR0 A;  2GLJ A;  1S7L A;  3D7H A;  4OC5 A;  1YQE A;  3CT9 A;  3SI2 A;  2EWB A;  3NA6 A;  2JBK A;  1M1D A;  1RO5 A;  1XE4 A;  1PYT B;  3LWU A;  4NGP A;  5LYD A;  3WT4 A;  4CAE A;  2OU2 A;  2EUI A;  1MK4 A;  7CPA A;  1WWZ A;  3ISZ A;  1M4D A;  2PJ8 A;  4KUA A;  3B8G A;  3K9U A;  1Y9W A;  1NSA A;  3V7Z A;  3IU1 A;  4LQ6 A;  4UEZ A;  5LYI A;  2QYV A;  1AUG A;  3KZW A;  1CPX A;  3EO4 A;  4UA3 A;  4G1P A;  4MFL A;  3S9M A;  4KOV A;  2HQY A;  5EMI A;  3KL9 A;  1ZG9 A;  4B14 A;  3W6S A;  4CAF A;  4K30 A;  1QQ9 A;  1WK4 A;  4B11 A;  1L0C A;  4CYN A;  5HH1 A;  2I00 A;  1Y7R A;  3S6K A;  1ARL A;  4A39 A;  4AVB A;  3FX6 A;  4CYO A;  2C27 A;  4CGM A;  2Q51 A;  5KTC A;  3EY5 A;  5K8N A;  2PC1 A;  2PIY A;  4K3N A;  3VAT A;  4UFW A;  3GY9 A;  4PXD A;  5F48 A;  1P0H A;  2WZN A;  3NH8 A;  1R57 A;  2CNT A;  4MCQ A;  5HVG A;  2OZH A;  4UFX A;  3RAM A;  2BL1 A;  2RB7 A;  4H6Z A;  3FF3 A;  5G1Z A;  4C68 A;  3R9F A;  4QC6 A;  2PJ1 A;  4RI1 A;  3V8I A;  3P2H A;  3JVN A;  4Z65 A;  5CNP A;  3DR6 A;  3HLP A;  1Z8T A;  3W91 A;  4CYP A;  4OC0 A;  3H8G A;  2ARH A;  5JQ4 A;  4GM5 A;  2PQ8 A;  3SJG A;  4A37 A;  3TTH A;  1SQH A;  4LQG A;  2Q4V A;  2Z3M A;  2PR1 A;  2POK A;  3B35 A;  4EVY A;  3B3C A;  3GIU A;  4M85 A;  3TO9 A;  3VWD A;  4MFJ A;  4OID A;  2AFU A;  4KUB A;  1Z4E A;  4F0X A;  3FXT A;  5BWA B;  4NGS A;  1BOB A;  3F5B A;  1R43 A;  4KLW A;  2WUU A;  4ONW A;  2JEW A;  3RZA A;  3D4U A;  3GLJ A;  3I9S A;  3TC8 A;  4MJ8 A;  2XEG A;  4A2Z A;  1KUV A;  2IQ6 A;  2ZW7 A;  2DPS A;  4JLY A;  5H86 A;  4ONU A;  4F8Z A;  5EC4 A;  1IU8 A;  3D2M A;  1YW6 A;  1RXT A;  3D7G A;  5JH9 A;  1FY7 A;  1DTD A;  4OIW A;  4P6Y A;  2ZEN A;  2WYR A;  4KOW A;  4P44 A;  2J8N A;  1Q7L A;  2ZPA A;  3H4Q A;  2HC9 A;  4MCP A;  3TOA A;  3RYO A;  2ANP A;  4PPZ A;  4E0A A;  4RN7 A;  2PVW A;  2WSA A;  3RBU A;  2G0B A;  4R7M A;  3VH9 A;  3PFE A;  4II9 A;  3S6F A;  3LD2 A;  5I0C A;  3MGD A;  3JTK A;  4A33 A;  4C7I A;  5F46 A;  2PJB A;  1IY7 A;  2ZW6 A;  4KSF A;  4MY0 A;  2V8V A;  4RUH A;  3BI1 A;  4NGT A;  1X10 A;  4NJQ A;  1J4J A;  4CPA A;  4OC3 A;  2FXF A;  2BEI A;  2ZEH A;  4B5P A;  4X2T A;  4YRH A;  2Y0M A;  2B5G A;  2I3C A;  2V8H A;  1YX0 A;  4R6T A;  3IWG A;  1NE9 A;  3PP9 A;  3CDX A;  4MRI A;  3IIB A;  5E96 A;  3R95 A;  2BOA A;  1YW4 A;  4KOT A;  2AJ6 A;  1XIX A;  1N71 A;  3TE4 A;  4RS2 A;  4PSX A;  4CAW A;  1M44 A;  1YLE A;  1I21 A;  4BIN A;  3JRU A;  3R1K A;  2P0W A;  2YNE A;  4DUK A;  1VHE A;  4CRZ B;  4P10 A;  4IF5 A;  3D7D A;  1YRE A;  4UWI A;  2C6C A;  2XEI A;  1ZG8 A;  1Z8L A;  3D68 A;  3FIX A;  1XJO A;  2ZEG A;  1FT7 A;  3EC4 A;  3RNZ A;  3V38 A;  1QSR A;  1M4G A;  1HEE A;  2IJZ A;  3D3S A;  3D8P A;  5DWN A;  4AVA A;  4KOS A;  1XFO A;  4NGN A;  4MFQ A;  5GCN A;  1TKF A;  2R1I A;  1CPS A;  4KVO E;  1QSN A;  2PSW A;  1XOV A;  4IAV A;  4C2Z A;  3FMC A;  2Z11 A;  5LRG A;  3BI0 A;  2BSW A;  3RO0 A;  2REE A;  2ZEE A;  4Y49 C;  2Z3P A;  3D66 A;  1CBX A;  1Y9K A;  3FH4 A;  3KAS A;  2Z10 A;  5LRK A;  1ZLH A;  1UWY A;  2ZXV A;  3S9N A;  1YVK A;  2PJ7 A;  3I1U A;  2AFO A;  4I49 A;  4BMH A;  3CXP A;  2O4H A;  1LAP A;  1LAM A;  1I1D A;  2HB6 A;  2ZEM A;  3FRM A;  4GXH A;  1CX8 A;  3I3G A;  5F49 A;  5IB0 A;  5HMN A;  2VI7 A;  5THW A;  2ZOG A;  4ZYQ A;  3ZJ0 A;  1BPN A;  1ZO0 A;  4MFK A;  4CGN A;  3PFO A;  4E2A A;  2JEV A; 
#chains in the Genus database with same CATH homology
 4R87 A;  1KUY A;  1LRZ A;  4QVT A;  1S3Z A;  4H6U A;  1BO4 A;  2P6G A;  3SXN A;  3CXQ A;  2GIV A;  1IYK A;  4HNX B;  3BJ8 A;  4CS0 B;  1TIQ A;  3H5Z A;  2J8M A;  1GHE A;  2Z0Z A;  2WPW A;  4KZT A;  3LOD A;  1S7N A;  4B5P B;  2B5G B;  2B3U A;  2G3T A;  2CY2 A;  4KVM E;  2CXA A;  3GKR A;  4M3S A;  4UFV A;  3OWC A;  2NMT A;  2QEC A;  4KOY A;  5IX3 A;  4JXR A;  3FYN A;  4YGO A;  4KVX A;  4NCZ A;  5JPH A;  3IWE A;  3TO6 A;  2OB0 A;  3S6H A;  4UCN A;  3IU2 A;  3G3S A;  4AB7 A;  4KOX A;  3TO7 A;  1IID A;  4AG9 A;  3TFY A;  1IIC A;  5F47 A;  1I12 A;  1NMT A;  2FIW A;  4OAD A;  3R96 A;  3F0A A;  2JLM A;  3SXO A;  4FD4 A;  4FD7 A;  2YGW A;  2DXQ A;  5AGE A;  1PU9 A;  4QUS A;  3TCV A;  4MY3 A;  4H89 A;  2VXK A;  4KOR A;  4CGL A;  4KS9 A;  1B87 A;  4ZBG A;  2R98 A;  3FNC A;  2OZG A;  1CM0 A;  5AG5 A;  5EBV A;  2D4O A;  4GS4 A;  3R9G A;  3EXN A;  2OH1 A;  4U5Y A;  2Z3N A;  1QST A;  2FL4 A;  3WR7 A;  2YNC A;  3F8K A;  5KTD A;  3C26 A;  3DNS A;  3FBU A;  2FCK A;  2JDC A;  2O28 A;  4L8A A;  4F0Y A;  2CNS A;  4CAV A;  3SHP A;  4JXQ A;  1Q2Y A;  1MJ9 A;  4LX9 A;  3S6G A;  3PGP A;  2Z3L A;  4XNH B;  4IUS A;  1XEB A;  2B4D A;  4MI4 A;  2VEZ A;  1P4N A;  4R3K A;  4Q36 A;  4UWJ A;  5IV0 A;  2F5I A;  4A31 A;  1YK3 A;  5G22 A;  4MHD A;  2EVN A;  4LUA A;  2HV2 A;  4XPL A;  4C2X A;  4MBU A;  4QB9 A;  1V0C A;  2REF A;  1XF8 A;  4JWP A;  2RC4 A;  3FB3 A;  1S7F A;  5KTA A;  4F6A A;  1Q2D A;  4MFP A;  4HNY B;  1QSM A;  5ISV A;  5DWM A;  4R9M A;  5G20 A;  1VKC A;  2WPX A;  4YFJ A;  2Q7B A;  4FD6 A;  1QSO A;  2KCW A;  2H5M A;  4R3L A;  2X7B A;  4PSW A;  2FT0 A;  1PUA A;  1KZF A;  4CYQ A;  2Q44 A;  2ATR A;  2PRB A;  4PK2 A;  4PK3 A;  2VZZ A;  2GE3 A;  4ZGY B;  1IB1 E;  3GYA A;  4CGO A;  4X5K A;  1YVO A;  2VQY A;  4B13 A;  5AG6 A;  1B6B A;  4XPK A;  3UY5 A;  2Z3O A;  1MJB A;  1MJA A;  4B10 A;  3DR8 A;  2YND A;  4AG7 A;  4DNC A;  2DPT A;  4Q38 A;  2BUE A;  1Z4R A;  4FD5 A;  4BBH A;  5AG7 A;  2B4B A;  4JD6 A;  3BJ7 A;  4E8O A;  2VBQ A;  1VHS A;  1S60 A;  3JUW A;  5AG4 A;  2B3V A;  2P6F A;  3N7Z A;  2R8V A;  3T9Y A;  2J8R A;  4C7H A;  1YGH A;  2Q0Y A;  4XPD B;  4CAX A;  3QAH A;  3CXS A;  4R57 A;  2Q04 A;  2B4D B;  2D4P A;  2YNC C;  5FVJ A;  2VZY A;  3IGR A;  3EFA A;  2B58 A;  4HKF A;  4NF1 A;  1Z9U A;  5C82 A;  1K4J A;  2AE6 A;  4XPD C;  2IL4 A;  1NSL A;  2I79 A;  4NEX A;  3W6X A;  4A30 A;  2FS5 A;  2CNM A;  2K5T A;  2JDD A;  2QIR A;  3D2P A;  1Q2C A;  4L89 A;  3TT2 A;  3DDD A;  4C2Y A;  2G3A A;  2ZW5 A;  3ZZI A;  2R7H A;  2P6E A;  1ON0 A;  4B12 A;  4CGP A;  4KLV A;  4NSQ A;  5J8C A;  4AVC A;  4U9Y A;  1OZP A;  3P2F A;  5A27 A;  2ZW4 A;  4JJX A;  2OZU A;  3QB8 A;  1S5K A;  2FIA A;  1M4I A;  1CJW A;  4HNW B;  2GAN A;  3G8W A;  2PR8 A;  4UCM A;  3DSB A;  5H84 A;  1IYL A;  5A28 A;  1XMT A;  4KOU A;  4OAE A;  5J8F A;  3NE7 A;  4B5O A;  4UBR A;  5C88 A;  4QBJ A;  2FSR A;  3A9L A;  3KKW A;  4U9Z A;  2FE7 A;  4KSA A;  4Y49 B;  2Z3K A;  4OLL A;  5G21 A;  4XNH C;  2A4N A;  3BLN A;  1U6M A;  2HUZ A;  1KUX A;  2QML A;  3PZJ A;  3T90 A;  3TOB A;  4J3G A;  3E0K A;  4PV6 A;  4A95 A;  4UCP A;  2PDO A;  2Q4Y A;  3VWE A;  4ORF A;  4MFZ A;  1S7K A;  1UFH A;  3R9E A;  4CRY B;  4NXY A;  4A32 A;  1YR0 A;  1S7L A;  1M1D A;  1RO5 A;  1XE4 A;  4CAE A;  2OU2 A;  2EUI A;  1MK4 A;  1WWZ A;  1M4D A;  4KUA A;  3B8G A;  3K9U A;  1Y9W A;  3IU1 A;  3EO4 A;  4UA3 A;  4MFL A;  4KOV A;  2HQY A;  4B14 A;  3W6S A;  4CAF A;  4K30 A;  1WK4 A;  4B11 A;  1L0C A;  4CYN A;  5HH1 A;  2I00 A;  1Y7R A;  3S6K A;  4AVB A;  4CYO A;  2C27 A;  4CGM A;  5KTC A;  3EY5 A;  2PC1 A;  4UFW A;  3GY9 A;  5F48 A;  1P0H A;  1R57 A;  2CNT A;  2OZH A;  4UFX A;  2BL1 A;  4H6Z A;  5G1Z A;  4C68 A;  3R9F A;  4QC6 A;  4RI1 A;  3V8I A;  3P2H A;  3JVN A;  5CNP A;  3DR6 A;  5JQ4 A;  3W91 A;  4CYP A;  2ARH A;  2PQ8 A;  3TTH A;  1SQH A;  2Q4V A;  2Z3M A;  2PR1 A;  4EVY A;  4M85 A;  3TO9 A;  3VWD A;  4MFJ A;  4KUB A;  1Z4E A;  4F0X A;  3FXT A;  5BWA B;  1BOB A;  3F5B A;  4KLW A;  2WUU A;  3I9S A;  4MJ8 A;  4A2Z A;  1KUV A;  2ZW7 A;  2DPS A;  4JLY A;  5H86 A;  4ONU A;  5EC4 A;  3D2M A;  1RXT A;  1FY7 A;  4KOW A;  2J8N A;  2ZPA A;  3H4Q A;  3TOA A;  3RYO A;  4E0A A;  2WSA A;  2G0B A;  4II9 A;  3S6F A;  3LD2 A;  5I0C A;  3MGD A;  3JTK A;  4A33 A;  4C7I A;  5F46 A;  4KSF A;  2ZW6 A;  4MY0 A;  1J4J A;  2FXF A;  2BEI A;  4B5P A;  4YRH A;  2Y0M A;  2B5G A;  1YX0 A;  3IWG A;  1NE9 A;  3PP9 A;  5E96 A;  3R95 A;  4KOT A;  2AJ6 A;  1XIX A;  1N71 A;  3TE4 A;  4RS2 A;  4PSX A;  4CAW A;  1M44 A;  1YLE A;  1I21 A;  3R1K A;  2P0W A;  2YNE A;  4CRZ B;  4IF5 A;  1YRE A;  4UWI A;  3FIX A;  3EC4 A;  1QSR A;  1M4G A;  3D3S A;  3D8P A;  5DWN A;  4AVA A;  4KOS A;  5GCN A;  4MFQ A;  2R1I A;  4KVO E;  1QSN A;  2PSW A;  4C2Z A;  2Z11 A;  2BSW A;  2REE A;  4Y49 C;  2Z3P A;  1Y9K A;  2Z10 A;  2ZXV A;  1YVK A;  4I49 A;  4BMH A;  3CXP A;  1I1D A;  3FRM A;  3I3G A;  5F49 A;  5IB0 A;  5HMN A;  2VI7 A;  3ZJ0 A;  1ZO0 A;  4MFK A;  4CGN A;  4E2A A;  2JEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...