3IWGA

Acetyltransferase from gnat family from colwellia psychrerythraea.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
268
Chain Sequence
b'FKIKTIESLSDLTQLKKAYFDSSIVPLDGMWHFGFAPMAKHFGFYVNKNLVGFCCVNDDGYLLQYYLQPEFQLCSQELFTLISQQNSSVIGEVKGAFVSTAELNYQALCLDNSATFKVNSLMYQHNTKLANLEMIDMQIAGTEQLTAFVTFAAANIGAPEQWLTQYYGNLIERKELFGYWHKGKLLAAGECRLFDQYQTEYADLGMIVAQSNRGQGIAKKVLTFLTKHAATQGLTSICSTESNNVAAQKAIAHAGFTSAHRIVQFEFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title X-ray crystal structure of Acetyltransferase from GNAT family from Colwellia psychrerythraea.
rcsb
source organism Colwellia psychrerythraea
molecule tags Transferase
total genus 78
structure length 268
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF18015 Acetyltransf_19 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA02
3.40.630.80 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3iwgA01
2CNMA 2VEZA 3CXSA 3TE4A 3B8GA 3W6SA 2BEIA 2BUEA 2QECA 3K9UA 4OLLA 4HKFA 4CAVA 3FXTA 4H6UA 1I1DA 1U6MA 2PQ8A 2Q44A 3IWGA 3NE7A 4FD5A 4QC6A 3ZZIA 2PSWA 1BOBA 4L8AA 4E2AA 4E8OA 3R9FA 4AG7A 1V0CA 3FBUA 3BLNA 1QSOA 1S7FA 1QSTA 4FD7A 5H84A 1R57A 5EC4A 2Z11A 4ONUA 1YVOA 4R57A 2J8RA 4FD4A 2HUZA 4H6ZA 4KOTA 4F6AA 2R7HA 4MI4A 4M3SA 2Q0YA 2GIVA 5H86A 3V8IA 1CM0A 5J8CA 3F8KA 2P6FA 3D3SA 2EVNA 3N7ZA 2FL4A 3QB8A 4FD6A 4JXRA 1I21A 1MK4A 5EBVA 3G8WA 3S6FA 2FCKA 2BL1A 4QVTA 1IYLA 2D4PA 3R9EA 4U9ZA 2WPXA 5DWMA 2FS5A 5I0CA 5JPHA 4JJXA 1CJWA 2ZXVA 4MBUA 4Y49B 2JDCA 4I49A 4KLVA 1BO4A 2VI7A 1WWZA 2FIAA 3E0KA 5F49A 5JQ4A 3D8PA 2H5MA 3FYNA 1QSRA 2VQYA 3DR8A 2FIWA 4XPDB 1K4JA 2Q4VA 4LUAA 3H4QA 1YLEA 1YREA 5GCNA 1XIXA 2R98A 2Q04A 2OB0A 1TIQA 4B5PA 2RC4A 2B4DA 1IICA 2PR1A 4EVYA 3CXPA 2B3UA 3EXNA 5IV0A 2KCWA 5KTDA 1GHEA 3TOBA 1VHSA 1IYKA 3JUWA 4XPKA 3D2MA 4R3LA 2ARHA 4KVME 1S7KA 4AVAA 3FRMA 4R87A 2OZHA 1LRZA 2G0BA 3MGDA 1FY7A 1KZFA 2J8NA 3BJ7A 1KUVA 4K30A 3R96A 3UY5A 4UWIA 1PU9A 1Y7RA 4YGOA 2P6GA 2P6EA 1P0HA 2Q7BA 3W91A 4U9YA 1S7LA 1YK3A 3D2PA 1NMTA 3R95A 4KOYA 2GE3A 2OZUA 4QUSA 3W6XA 2OZGA 5IX3A 4MJ8A 2F5IA 5ISVA 2G3AA 4IUSA 4R3KA 4RS2A 1RXTA 2CNSA 1SQHA 1PUAA 3EO4A 1UFHA 1YX0A 5IB0A 2DXQA 4B5OA 3CXQA 4R9MA 2VZZA 4UWJA 3TCVA 3DNSA 3S6KA 5J8FA 3GYAA 1Y9WA 2ZW5A 2JLMA 2PC1A 1XE4A 4JXQA 4UA3A 3PZJA 1XMTA 4Y49C 1KUYA 4U5YA 3IGRA 3SXOA 3TO9A 5C88A 4KZTA 3C26A 3F5BA 3VWEA 3PP9A 2D4OA 4KVXA 2WPWA 5CNPA 2FT0A 3DR6A 1L0CA 2JEVA 3EC4A 4OAEA 4XPDC 2B3VA 3G3SA 5F46A 3GKRA 4MHDA 4KOWA 3FIXA 3R1KA 4H89A 4PK3A 3TTHA 1I12A 2C27A 3TO7A 4NSQA 2REEA 5DWNA 4J3GA 2J8MA 3OWCA 4PV6A 3LD2A 2B5GA 2CY2A 1M4DA 1M1DA 4NF1A 2ZW6A 1B87A 3TOAA 3TO6A 4YFJA 5KTCA 1P4NA 3VWDA 1J4JA 1Q2CA 2CNTA 3F0AA 3I9SA 3RYOA 3PGPA 4HNXB 3I3GA 3S6HA 1XF8A 4BMHA 2Z10A 2ATRA 4CAWA 4B5PB 4ZBGA 2B4DB 4KVOE 4E0AA 2FSRA 4XNHB 4RI1A 4XPLA 4AVCA 3GY9A 5KTAA 3DDDA 2PDOA 1S60A 3TFYA 1XEBA 3T90A 5C82A 4PSWA 2B4BA 4DNCA 2K5TA 2O28A 2VBQA 4HNYB 1RO5A 3QAHA 4PK2A 2P0WA 4ORFA 4KUBA 4MY3A 2QIRA 4KOUA 4X5KA 3BJ8A 2FE7A 4YRHA 1YVKA 1IIDA 2NMTA 2Z0ZA 4AVBA 4NEXA 3SHPA 4KOVA 5HH1A 1B6BA 4M85A 2R1IA 2ZPAA 4JWPA 5HMNA 1KUXA 4NXYA 3TT2A 1M4GA 1QSMA 1Q2YA 2AE6A 2JDDA 3P2HA 2EUIA 3S6GA 3WR7A 1Y9KA 2R8VA 2ZW7A 4LX9A 4UBRA 1MJAA 1YR0A 1Z4EA 1YGHA 2REFA 1ON0A 5F48A 1MJBA 3P2FA 5F47A 3FB3A 2Y0MA 4PSXA 4CRYB 1Z9UA 4CRZB 4AB7A 3EY5A 3DSBA 4KOSA 4KOXA 4OADA 2AJ6A 4CAXA 1S5KA 1S3ZA 1Z4RA 1MJ9A 2I00A 1IB1E 3SXNA 3ZJ0A 3KKWA 2Q4YA 2OH1A 1VKCA 2X7BA 4QBJA 5FVJA 2GANA 1NE9A 4MY0A 1NSLA 2VZYA 1N71A 1S7NA 4CS0B 1QSNA 1WK4A 1M4IA 1Q2DA 2FXFA 4L89A 2OU2A 3LODA 4QB9A 4F0YA 2G3TA 2HQYA 2PR8A 2IL4A 2PRBA 2ZW4A 3EFAA 2B58A 3T9YA 4JD6A 4II9A 4KORA 4JLYA 2A4NA 4GS4A 4NCZA 4KLWA 2BSWA 2VXKA 5E96A 4KUAA 3R9GA 4XNHC 2HV2A 3FNCA 4AG9A 1M44A 4HNWB 2B5GB 3JVNA 1OZPA 2I79A 2QMLA 4IF5A
chains in the Genus database with same CATH superfamily
2CNMA 3D66A 3ISXA 2VEZA 4WJBA 4C68A 3CXSA 3KHXA 4EWTA 7CPAA 3TE4A 3B8GA 3W6SA 5LRKA 3KZWA 2BEIA 2BUEA 4CGOA 2QECA 2GREA 3K9UA 2PJBA 4OLLA 2PJ0A 4HKFA 4CAVA 2YNCA 4F8ZA 4KSIA 2EK9A 4IAVA 3FXTA 3K9TA 4UEZA 1X10A 4H6UA 4UFXA 2G9DA 1BAVA 1I1DA 1F2PA 1U6MA 2PJ4A 2ZEDA 2PQ8A 2Z3NA 4A32A 5D29A 2Q44A 3IWGA 3VH9A 3NE7A 1DTDA 1IY7A 2YGWA 4MHNA 4FD5A 4QC6A 4MCPA 2XEFA 3ZZIA 2PIYA 4C7HA 2AFXA 2PSWA 4JYWA 4PQAA 3PB8X 1BOBA 2V8DA 3CZXA 4L8AA 4LQGA 5IB9A 1XJOA 4A33A 4E2AA 4E8OA 1X12A 1XBUA 1V0CA 2AFZA 3FBUA 1PYTB 1QSOA 1S7FA 3BLNA 3KR4A 4X2TA 5A28A 1QSTA 4UF4A 3B3CA 1YW4A 4FD7A 3D7FA 5ELYA 5H84A 4CGLA 1R57A 1Y0RA 5EC4A 4AXVA 2Z11A 4M6GA 1FT7A 4ZY2A 2HC9A 2WYRA 4ONUA 1CBXA 1YVOA 4B12A 4R57A 2J8RA 4FD4A 2HUZA 4H6ZA 3MRUA 4KOTA 4F6AA 5G20A 2R7HA 5K8OA 4MI4A 4M3SA 2Q0YA 3FEEA 4B6ZA 2GIVA 5H86A 1H8LA 1XFOA 3V8IA 1CM0A 5J8CA 3F8KA 2P6FA 3RO0A 3VATA 2GU2A 4CAEA 3D3SA 1TKHA 4KSFA 2EVNA 3KI9A 3N7ZA 4MFJA 2J9AA 5I4MA 1ZG8A 4KSAA 2FL4A 2Z3KA 3CDXA 3QB8A 4Q36A 1CPXA 4ZX8A 4FD6A 2PVWA 3PFEA 1I21A 1CP6A 2EWBA 1MK4A 1ARMA 3G8WA 1QQ9A 4JXRA 5EBVA 3S6FA 4A37A 4MFPA 2FCKA 4C2ZA 3HLPA 2BL1A 4YWYA 4QVTA 1IYLA 2D4PA 3R9EA 2Q43A 3BXMA 3PRTA 1ZLHA 2PJAA 4U9ZA 2WPXA 5DWMA 4OC2A 2FS5A 3KQXA 5I0CA 5JPHA 5AG6A 2DF5A 4JJXA 1CJWA 1YMEA 3A9LA 3NA6A 2ZXVA 2Z3PA 4MBUA 4Y49B 6CPAA 3LMSA 4GM5A 4H2KA 2JDCA 4UIAA 4I49A 4KLVA 1BO4A 1Z8LA 2AFOA 1JWQA 2VI7A 1F57A 1WWZA 3SJGA 2FIAA 3E0KA 5F49A 3V7ZA 2ZENA 2AFMA 2DEAA 1ARLA 4WWVA 3S9NA 5JQ4A 3D8PA 4MCQA 2H5MA 2Q51A 3FYNA 4A95A 4P4BA 1GYTA 1QSRA 2VQYA 3DR8A 2FIWA 4XPDB 1K4JA 1YQEA 5K8NA 1HEEA 1VIXA 4A39A 2Q4VA 4PXDA 4FUUA 4OC1A 4LUAA 3H4QA 1YLEA 1EE3P 1YREA 5GCNA 4Q38A 1XIXA 2R98A 5LYFA 2Q04A 2OB0A 2I3CA 1TIQA 4B5PA 2RC4A 4DJLA 2B4DA 1IICA 2VL1A 1M4LA 2PR1A 4UCMA 4EVYA 3CXPA 2B3UA 3BI1A 3PB4X 2DPTA 3FMCA 3KGQA 3L2NA 3KL9A 2Z3LA 5JH9A 3EXNA 3FEDA 5IV0A 2KCWA 5KTDA 1GHEA 3TOBA 2GFQA 4ZI6A 1VHSA 4CYNA 1IYKA 4NJRA 3JUWA 3D7GA 4PXBA 4IK2A 4XPKA 5J1QA 3D2MA 4P6YA 4R3LA 2V77A 1XMBA 3B3WA 2ARHA 4P45A 4KVME 2ZEEA 3B7IA 4R76A 1DE4C 1S7KA 4MRIA 3SJXA 4UCNA 4AVAA 3FRMA 4R87A 2OZHA 1LRZA 2G0BA 2YNDA 3MGDA 3S9LA 1Y7EA 1FY7A 2ZELA 4BBHA 2PJ1A 3GUXA 3B3VA 4PXEA 4P10A 1YW6A 1KZFA 1XOVA 2C6GA 2J8NA 3BJ7A 2NSMA 4PXCA 4UFVA 4EFDA 1KUVA 3MN8A 4K30A 4CGPA 3R96A 3KHZA 3DGVA 3IWWA 4G1PA 3B3SA 4UWIA 2PJCA 4OC4A 3UY5A 4C7IA 1PU9A 1CX8A 1Y7RA 3IFEA 2P6GA 4YGOA 5LRGA 2P6EA 4CGMA 1P0HA 2Q7BA 5JGFA 3IO1A 3RZAA 3W91A 4AG7A 1TXRA 4FWUA 4MHZA 4CGNA 4F0XA 1BLLE 4U9YA 2FVGA 4IF5A 4A30A 1S7LA 1YK3A 3H5ZA 3B35A 3D2PA 5LYLA 1NMTA 1TKFA 1JQGA 3R95A 2CTBA 4KOYA 1IOFA 4UCPA 2GE3A 2OZUA 4RN7A 4QUSA 4MFKA 4IHMA 3W6XA 4UEEA 3QAYA 5G21A 2OZGA 4KS9A 4MJ8A 5IX3A 2F5IA 5ISVA 2G3AA 3FVLA 2WUUA 3K2KA 8CPAA 2WSAA 4IUSA 4R3KA 4RS2A 3TX8A 1RXTA 2CNSA 1SQHA 2IMOA 4P44A 3VARA 1PUAA 4LQ6A 3EO4A 1UFHA 2PJ5A 3SJEA 1YX0A 2F8HA 5IB0A 2DXQA 4F9VA 2BO9A 3JRUA 4B5OA 3CPXA 3CXQA 4R9MA 2EBJA 2VZZA 4UWJA 2AFWA 3TCVA 3DNSA 3GB0A 2ZOFA 2O53A 4UFWA 1F2OA 3S6KA 5J8FA 3GYAA 1Y9WA 3WABA 2PVVA 2ZW5A 2JLMA 2PC1A 3IU2A 1XE4A 4JXQA 4DUKA 4UA3A 5HVFA 3PZJA 1XMTA 1BPNA 4P4JA 4Y49C 1UWYA 1KUYA 2RB7A 3IGRA 4U5YA 3SXOA 3TO9A 4CYOA 5C88A 5G1ZA 1ZLIA 4KZTA 3C26A 5CBMA 3F5BA 5LRJA 1BPMA 2XEIA 4BD9A 2ZOGA 3SI0A 4ONWA 3VWEA 3PP9A 5AG7A 4B10A 4CPAA 3PB9X 4R6TA 2D4OA 4KVXA 2WPWA 5CNPA 3D67A 3PBEA 4MCSA 1LOKA 2PCUA 2JBJA 2FT0A 4P4EA 3FX6A 3DR6A 5THWA 1L0CA 2ANPA 2JEVA 3EC4A 4NGTA 4OAEA 5HXDA 2XEJA 1IGBA 4XPDC 2C6CA 4X3RA 4OMEA 2B3VA 3G3SA 5F46A 3GKRA 3IU1A 2BCOA 5HVHA 4MHDA 4KOWA 1R43A 1ZG7A 3FIXA 3R1KA 3IJ3A 4H89A 3GLJA 3FH4A 4R7MA 1A2ZA 4F9UA 4PK3A 4P4DA 4ZY0A 3TTHA 1I12A 2C27A 2PE3A 1Z5RA 4X8IA 3QNVA 3B3TA 3TO7A 4NSQA 2REEA 5DWNA 4J3GA 4Z65A 2J8MA 3OWCA 4PV6A 3JTKA 3LD2A 2WZNA 4OIDA 2PJ9A 2B5GA 2CY2A 4OC0A 1M4DA 1M1DA 2EK8A 4NF1A 2ZW6A 1B87A 3V38A 4MXUA 3TOAA 3TO6A 2ZEHA 5LYDA 5K8PA 4YFJA 4NGSA 3NH4A 4NGMA 4NGPA 4P4FA 3BHXA 1ZG9A 4ZGYB 5KTCA 1P4NA 3VWDA 2QVPA 1J4JA 1Q2CA 2CNTA 2ZEOA 3F0AA 3I9SA 3RYOA 4CYPA 3WC6A 3PGPA 4M6IA 4HNXB 3I3GA 1OBRA 2DPSA 1Z8WA 3S6HA 2ABZA 4MCRA 1XF8A 4B13A 2Z10A 4BMHA 2ATRA 4CAWA 3PEIA 4B5PB 1KWMA 4ZBGA 2ZEPA 2V8HA 3PBBA 3SJFA 2B4DB 4KVOE 1VGYA 4E0AA 2FSRA 2PJ3A 2RFHA 4XNHB 3KR5A 3IEHA 3NH5A 1CP7A 1YSJA 4RI1A 4XPLA 4ZX9A 4AVCA 1YLOA 3GY9A 5AG4A 1NSAA 5A27A 4HPSA 5EMIA 3D68A 2Q7SA 1LAMA 4OP4A 5HVGA 4UEFA 3DDDA 2PDOA 1S60A 2PJ2A 5KTAA 5F09A 3FECA 3TFYA 1XEBA 3T90A 2Z3MA 3LACA 4PSWA 5C82A 2B4BA 1XRYA 2CF4A 2IQ6A 1PCAA 4CYQA 4A94A 3KQZA 4DNCA 2K5TA 2O28A 2VBQA 3RNZA 2PJ7A 2ODFA 1RO5A 3DLJA 3QAHA 4HNYB 4MFLA 4PK2A 2P0WA 2V8VA 4MMOA 4ORFA 4FBEA 2Z3OA 2C6PA 4KUBA 2PIZA 1TF8A 5BWAB 4MY3A 2QIRA 2YNCC 4Q7AA 4KOUA 4X5KA 2QYVA 3BJ8A 2FE7A 3N5FA 3NH8A 3KASA 4YRHA 1LANA 2JEWA 4TWEA 1QMUA 1YVKA 3IC1A 1IIDA 4B14A 3H8GA 2NMTA 1LCPA 3PFOA 4ZYQA 2Z0ZA 4OKOA 4K3NA 4NGNA 4A2ZA 4AVBA 1AUGA 4NEXA 3H8FA 5AG5A 1LAPA 5CPAA 5JM6A 3SHPA 4KOVA 5HH1A 2GLJA 2OR4A 1B6BA 2PRQA 1AYEA 3NFZA 1ELMP 3CPAA 4O23A 3TC8A 4M85A 4ZY1A 2R1IA 3WC5A 3BI0A 2AFSA 2V8GA 2ZPAA 4JWPA 2O4HA 2CIJA 1TF9A 4EMEA 3PB7X 2NYQA 5HMNA 1KUXA 4GXHA 4NXYA 3TT2A 3HUVA 2C1CA 1Z8XA 2ZEMA 3LWUA 5G22A 1M4GA 3SI1A 1QSMA 3FF3A 4MFQA 1Q2YA 4NFRA 2AE6A 2JDDA 1CG2A 2JBKA 3P2HA 4DYOA 2EUIA 1Z2LA 1ELLP 3S6GA 3WR7A 1Y9KA 2R8VA 2ZW7A 3D7HA 4LX9A 4UBRA 1MJAA 1YR0A 1Z4EA 1YGHA 2PJ8A 4TNUA 3PB6X 2ZEFA 2REFA 5DS0A 5D8NA 2QJ8A 1ON0A 5F48A 1MJBA 3I1UA 4JZ0A 4P4IA 3D7DA 4W9YA 3R9FA 3P2FA 4B11A 5F47A 1ZO0A 3FB3A 2OOTA 1CPSA 3WT4A 2Y0MA 4M6HA 4OIWA 4NJQA 4RUHA 5K8MA 4PSXA 4CRYB 2HB6A 1Z9UA 4MHYA 2XEGA 4NGRA 5AGEA 3RAMA 3EY5A 2GLFA 2Q4ZA 3DSBA 4R8FA 4AB7A 2AFUA 4KOSA 1Z8TA 3FJUA 3NE8A 4KOXA 1VHEA 4OADA 2AJ6A 4C2YA 4CAXA 1S5KA 1S3ZA 1Z4RA 1MJ9A 2I00A 1IB1E 2IJZA 3SXNA 1Q7LA 3ZJ0A 4C2XA 3KKWA 2Q4YA 1Y0YA 3S9MA 2OH1A 1VKCA 2ZEGA 4CAFA 2POKA 1HDQA 2X7BA 3RBUA 2BOAA 4QBJA 5FVJA 2GANA 1NE9A 1TKJA 1HDUA 1IU8A 2F7VA 4MY0A 1NSLA 2VZYA 1N71A 1S7NA 4CS0B 1QSNA 1WK4A 1M4IA 2FXFA 2CXAA 3IIBA 3T8WA 1R3NA 1RTQA 4L89A 1FNOA 2OU2A 3LODA 4QB9A 2G3TA 2HQYA 2PR8A 2IL4A 4BINA 4F0YA 1VHOA 2PRBA 2CTCA 2ZW4A 3EFAA 4NGQA 4A31A 3GIUA 2B58A 3B2YA 3T9YA 4JD6A 4II9A 4FAIA 4KORA 4YU9A 2EO8A 2PJ6A 2A4NA 4JLYA 4OC3A 4GS4A 4NCZA 4KLWA 2BSWA 2VXKA 3H8EA 3CT9A 4MFZA 4MHPA 5E96A 4KUAA 1IOIA 3R9GA 4XNHC 2HV2A 1AMPA 3FNCA 4A38A 3ISZA 4UIBA 4CRZB 3D4UA 4OC5A 4AG9A 5LYIA 3IWEA 1M44A 4HNWB 2YNEA 2B5GB 3JVNA 4PPZA 3SI2A 3WC7A 1LFWA 1OZPA 2I79A 2QMLA 1Q2DA
chains in the Genus database with same CATH topology
2CNMA 2VEZA 4C68A 3CXSA 3TE4A 3B8GA 3W6SA 2BEIA 2BUEA 4CGOA 2QECA 3K9UA 4OLLA 4HKFA 4CAVA 2YNCA 3FXTA 4H6UA 4UFXA 1I1DA 1U6MA 2PQ8A 2Z3NA 4A32A 2Q44A 3IWGA 3NE7A 2YGWA 4FD5A 4QC6A 3ZZIA 4C7HA 2PSWA 1BOBA 4L8AA 4A33A 4E2AA 4E8OA 3R9FA 4AG7A 1V0CA 3FBUA 3BLNA 1QSOA 1S7FA 5A28A 1QSTA 4CGLA 4FD7A 5H84A 1R57A 5EC4A 2Z11A 4ONUA 1YVOA 4B12A 4R57A 2J8RA 4FD4A 2HUZA 4H6ZA 4KOTA 4F6AA 5G20A 2R7HA 4MI4A 4M3SA 2Q0YA 2GIVA 5H86A 3V8IA 1CM0A 5J8CA 3F8KA 2P6FA 4CAEA 3D3SA 4KSFA 2EVNA 3N7ZA 4MFJA 4KSAA 2FL4A 2Z3KA 4Q36A 3QB8A 4FD6A 4JXRA 1I21A 1MK4A 5EBVA 3G8WA 3S6FA 4MFPA 2FCKA 4C2ZA 2BL1A 4QVTA 1IYLA 2D4PA 3R9EA 4U9ZA 2WPXA 5DWMA 2FS5A 5I0CA 5JPHA 5AG6A 4JJXA 1CJWA 3A9LA 2ZXVA 2Z3PA 4MBUA 4Y49B 2JDCA 4I49A 4KLVA 1BO4A 2VI7A 1WWZA 2FIAA 3E0KA 5F49A 5JQ4A 3D8PA 2H5MA 3FYNA 4A95A 1QSRA 2VQYA 3DR8A 2FIWA 4XPDB 1K4JA 2Q4VA 4LUAA 3H4QA 1YLEA 1YREA 5GCNA 4Q38A 1XIXA 2R98A 2Q04A 2OB0A 1TIQA 4B5PA 2RC4A 2B4DA 1IICA 2PR1A 4UCMA 4EVYA 3CXPA 2B3UA 2DPTA 2Z3LA 3EXNA 5IV0A 2KCWA 5KTDA 1GHEA 3TOBA 1VHSA 4CYNA 1IYKA 3JUWA 4XPKA 3D2MA 4R3LA 2ARHA 4KVME 1S7KA 4UCNA 4AVAA 3FRMA 4R87A 2OZHA 1LRZA 2G0BA 2YNDA 3MGDA 1FY7A 4BBHA 1KZFA 2J8NA 3BJ7A 4UFVA 1KUVA 4K30A 4CGPA 3R96A 3UY5A 4C7IA 4UWIA 1PU9A 1Y7RA 4YGOA 2P6GA 2P6EA 4CGMA 1P0HA 2Q7BA 3W91A 4CGNA 4U9YA 4A30A 1S7LA 1YK3A 3H5ZA 3D2PA 1NMTA 3R95A 4KOYA 4UCPA 2GE3A 2OZUA 4QUSA 4MFKA 3W6XA 5G21A 2OZGA 4KS9A 4MJ8A 5IX3A 2F5IA 5ISVA 2G3AA 2WUUA 2WSAA 4IUSA 4R3KA 4RS2A 1RXTA 2CNSA 1SQHA 1PUAA 3EO4A 1UFHA 1YX0A 5IB0A 2DXQA 4B5OA 3CXQA 4R9MA 2VZZA 4UWJA 3TCVA 3DNSA 4UFWA 3S6KA 5J8FA 3GYAA 1Y9WA 2ZW5A 2JLMA 2PC1A 3IU2A 1XE4A 4JXQA 4UA3A 3PZJA 1XMTA 4Y49C 1KUYA 4U5YA 3IGRA 3SXOA 3TO9A 4CYOA 5C88A 5G1ZA 4KZTA 3C26A 3F5BA 3VWEA 3PP9A 5AG7A 4B10A 2D4OA 4KVXA 2WPWA 5CNPA 2FT0A 3DR6A 1L0CA 2JEVA 3EC4A 4OAEA 4XPDC 2B3VA 3G3SA 5F46A 3GKRA 3IU1A 4MHDA 4KOWA 3FIXA 3R1KA 4H89A 4PK3A 3TTHA 1I12A 2C27A 3TO7A 4NSQA 2REEA 5DWNA 4J3GA 2J8MA 3OWCA 4PV6A 3JTKA 3LD2A 2B5GA 2CY2A 1M4DA 1M1DA 4NF1A 2ZW6A 1B87A 3TOAA 3TO6A 4YFJA 4ZGYB 5KTCA 1P4NA 3VWDA 1J4JA 1Q2CA 2CNTA 3F0AA 3I9SA 3RYOA 4CYPA 3PGPA 4HNXB 3I3GA 2DPSA 3S6HA 1XF8A 4B13A 2Z10A 4BMHA 2ATRA 4CAWA 4B5PB 4ZBGA 2B4DB 4KVOE 4E0AA 2FSRA 4XNHB 4RI1A 4XPLA 4AVCA 3GY9A 5AG4A 5A27A 5KTAA 3DDDA 2PDOA 1S60A 3TFYA 1XEBA 3T90A 2Z3MA 4PSWA 5C82A 2B4BA 4CYQA 4DNCA 2K5TA 2O28A 2VBQA 4F0XA 4HNYB 4MFLA 1RO5A 3QAHA 4PK2A 2P0WA 4ORFA 2Z3OA 4KUBA 5BWAB 4MY3A 2QIRA 2YNCC 4KOUA 4X5KA 3BJ8A 2FE7A 4YRHA 1YVKA 1IIDA 4B14A 2NMTA 2Z0ZA 4AVBA 4A2ZA 4NEXA 5AG5A 3SHPA 4KOVA 5HH1A 1B6BA 4M85A 2R1IA 2ZPAA 4JWPA 5HMNA 1KUXA 4NXYA 3TT2A 5G22A 1M4GA 1QSMA 4MFQA 1Q2YA 2AE6A 2JDDA 3P2HA 2EUIA 3S6GA 3WR7A 1Y9KA 2R8VA 2ZW7A 4LX9A 4UBRA 1MJAA 1YR0A 1Z4EA 1YGHA 2REFA 1ON0A 5F48A 1MJBA 3P2FA 4B11A 5F47A 1ZO0A 3FB3A 2Y0MA 4PSXA 4CRYB 1Z9UA 5AGEA 4CRZB 4AB7A 3EY5A 3DSBA 4KOSA 4KOXA 4OADA 2AJ6A 4C2YA 4CAXA 1S5KA 1S3ZA 1Z4RA 1MJ9A 2I00A 1IB1E 3SXNA 3ZJ0A 4C2XA 3KKWA 2Q4YA 2OH1A 1VKCA 4CAFA 2X7BA 4QBJA 5FVJA 2GANA 1NE9A 4MY0A 1NSLA 2VZYA 1N71A 1S7NA 4CS0B 1QSNA 1WK4A 1M4IA 1Q2DA 2FXFA 2CXAA 4L89A 2OU2A 3LODA 4QB9A 4F0YA 2G3TA 2HQYA 2PR8A 2IL4A 2PRBA 2ZW4A 3EFAA 4A31A 2B58A 3T9YA 4JD6A 4II9A 4KORA 4JLYA 2A4NA 4GS4A 4NCZA 4KLWA 2BSWA 2VXKA 4MFZA 5E96A 4KUAA 3R9GA 4XNHC 2HV2A 3FNCA 4AG9A 3IWEA 1M44A 4HNWB 2YNEA 2B5GB 3JVNA 1OZPA 2I79A 2QMLA 4IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNM A;  2VEZ A;  3CXS A;  3TE4 A;  3B8G A;  3W6S A;  2BEI A;  2BUE A;  2QEC A;  3K9U A;  4OLL A;  4HKF A;  4CAV A;  3FXT A;  4H6U A;  1I1D A;  1U6M A;  2PQ8 A;  2Q44 A;  3IWG A;  3NE7 A;  4FD5 A;  4QC6 A;  3ZZI A;  2PSW A;  1BOB A;  4L8A A;  4E2A A;  4E8O A;  3R9F A;  4AG7 A;  1V0C A;  3FBU A;  3BLN A;  1QSO A;  1S7F A;  1QST A;  4FD7 A;  5H84 A;  1R57 A;  5EC4 A;  2Z11 A;  4ONU A;  1YVO A;  4R57 A;  2J8R A;  4FD4 A;  2HUZ A;  4H6Z A;  4KOT A;  4F6A A;  2R7H A;  4MI4 A;  4M3S A;  2Q0Y A;  2GIV A;  5H86 A;  3V8I A;  1CM0 A;  5J8C A;  3F8K A;  2P6F A;  3D3S A;  2EVN A;  3N7Z A;  2FL4 A;  3QB8 A;  4FD6 A;  4JXR A;  1I21 A;  1MK4 A;  5EBV A;  3G8W A;  3S6F A;  2FCK A;  2BL1 A;  4QVT A;  1IYL A;  2D4P A;  3R9E A;  4U9Z A;  2WPX A;  5DWM A;  2FS5 A;  5I0C A;  5JPH A;  4JJX A;  1CJW A;  2ZXV A;  4MBU A;  4Y49 B;  2JDC A;  4I49 A;  4KLV A;  1BO4 A;  2VI7 A;  1WWZ A;  2FIA A;  3E0K A;  5F49 A;  5JQ4 A;  3D8P A;  2H5M A;  3FYN A;  1QSR A;  2VQY A;  3DR8 A;  2FIW A;  4XPD B;  1K4J A;  2Q4V A;  4LUA A;  3H4Q A;  1YLE A;  1YRE A;  5GCN A;  1XIX A;  2R98 A;  2Q04 A;  2OB0 A;  1TIQ A;  4B5P A;  2RC4 A;  2B4D A;  1IIC A;  2PR1 A;  4EVY A;  3CXP A;  2B3U A;  3EXN A;  5IV0 A;  2KCW A;  5KTD A;  1GHE A;  3TOB A;  1VHS A;  1IYK A;  3JUW A;  4XPK A;  3D2M A;  4R3L A;  2ARH A;  4KVM E;  1S7K A;  4AVA A;  3FRM A;  4R87 A;  2OZH A;  1LRZ A;  2G0B A;  3MGD A;  1FY7 A;  1KZF A;  2J8N A;  3BJ7 A;  1KUV A;  4K30 A;  3R96 A;  3UY5 A;  4UWI A;  1PU9 A;  1Y7R A;  4YGO A;  2P6G A;  2P6E A;  1P0H A;  2Q7B A;  3W91 A;  4U9Y A;  1S7L A;  1YK3 A;  3D2P A;  1NMT A;  3R95 A;  4KOY A;  2GE3 A;  2OZU A;  4QUS A;  3W6X A;  2OZG A;  5IX3 A;  4MJ8 A;  2F5I A;  5ISV A;  2G3A A;  4IUS A;  4R3K A;  4RS2 A;  1RXT A;  2CNS A;  1SQH A;  1PUA A;  3EO4 A;  1UFH A;  1YX0 A;  5IB0 A;  2DXQ A;  4B5O A;  3CXQ A;  4R9M A;  2VZZ A;  4UWJ A;  3TCV A;  3DNS A;  3S6K A;  5J8F A;  3GYA A;  1Y9W A;  2ZW5 A;  2JLM A;  2PC1 A;  1XE4 A;  4JXQ A;  4UA3 A;  3PZJ A;  1XMT A;  4Y49 C;  1KUY A;  4U5Y A;  3IGR A;  3SXO A;  3TO9 A;  5C88 A;  4KZT A;  3C26 A;  3F5B A;  3VWE A;  3PP9 A;  2D4O A;  4KVX A;  2WPW A;  5CNP A;  2FT0 A;  3DR6 A;  1L0C A;  2JEV A;  3EC4 A;  4OAE A;  4XPD C;  2B3V A;  3G3S A;  5F46 A;  3GKR A;  4MHD A;  4KOW A;  3FIX A;  3R1K A;  4H89 A;  4PK3 A;  3TTH A;  1I12 A;  2C27 A;  3TO7 A;  4NSQ A;  2REE A;  5DWN A;  4J3G A;  2J8M A;  3OWC A;  4PV6 A;  3LD2 A;  2B5G A;  2CY2 A;  1M4D A;  1M1D A;  4NF1 A;  2ZW6 A;  1B87 A;  3TOA A;  3TO6 A;  4YFJ A;  5KTC A;  1P4N A;  3VWD A;  1J4J A;  1Q2C A;  2CNT A;  3F0A A;  3I9S A;  3RYO A;  3PGP A;  4HNX B;  3I3G A;  3S6H A;  1XF8 A;  4BMH A;  2Z10 A;  2ATR A;  4CAW A;  4B5P B;  4ZBG A;  2B4D B;  4KVO E;  4E0A A;  2FSR A;  4XNH B;  4RI1 A;  4XPL A;  4AVC A;  3GY9 A;  5KTA A;  3DDD A;  2PDO A;  1S60 A;  3TFY A;  1XEB A;  3T90 A;  5C82 A;  4PSW A;  2B4B A;  4DNC A;  2K5T A;  2O28 A;  2VBQ A;  4HNY B;  1RO5 A;  3QAH A;  4PK2 A;  2P0W A;  4ORF A;  4KUB A;  4MY3 A;  2QIR A;  4KOU A;  4X5K A;  3BJ8 A;  2FE7 A;  4YRH A;  1YVK A;  1IID A;  2NMT A;  2Z0Z A;  4AVB A;  4NEX A;  3SHP A;  4KOV A;  5HH1 A;  1B6B A;  4M85 A;  2R1I A;  2ZPA A;  4JWP A;  5HMN A;  1KUX A;  4NXY A;  3TT2 A;  1M4G A;  1QSM A;  1Q2Y A;  2AE6 A;  2JDD A;  3P2H A;  2EUI A;  3S6G A;  3WR7 A;  1Y9K A;  2R8V A;  2ZW7 A;  4LX9 A;  4UBR A;  1MJA A;  1YR0 A;  1Z4E A;  1YGH A;  2REF A;  1ON0 A;  5F48 A;  1MJB A;  3P2F A;  5F47 A;  3FB3 A;  2Y0M A;  4PSX A;  4CRY B;  1Z9U A;  4CRZ B;  4AB7 A;  3EY5 A;  3DSB A;  4KOS A;  4KOX A;  4OAD A;  2AJ6 A;  4CAX A;  1S5K A;  1S3Z A;  1Z4R A;  1MJ9 A;  2I00 A;  1IB1 E;  3SXN A;  3ZJ0 A;  3KKW A;  2Q4Y A;  2OH1 A;  1VKC A;  2X7B A;  4QBJ A;  5FVJ A;  2GAN A;  1NE9 A;  4MY0 A;  1NSL A;  2VZY A;  1N71 A;  1S7N A;  4CS0 B;  1QSN A;  1WK4 A;  1M4I A;  1Q2D A;  2FXF A;  4L89 A;  2OU2 A;  3LOD A;  4QB9 A;  4F0Y A;  2G3T A;  2HQY A;  2PR8 A;  2IL4 A;  2PRB A;  2ZW4 A;  3EFA A;  2B58 A;  3T9Y A;  4JD6 A;  4II9 A;  4KOR A;  4JLY A;  2A4N A;  4GS4 A;  4NCZ A;  4KLW A;  2BSW A;  2VXK A;  5E96 A;  4KUA A;  3R9G A;  4XNH C;  2HV2 A;  3FNC A;  4AG9 A;  1M44 A;  4HNW B;  2B5G B;  3JVN A;  1OZP A;  2I79 A;  2QML A;  4IF5 A; 
#chains in the Genus database with same CATH topology
 2CNM A;  3D66 A;  3ISX A;  2VEZ A;  4WJB A;  4C68 A;  3CXS A;  3KHX A;  4EWT A;  7CPA A;  3TE4 A;  3B8G A;  3W6S A;  5LRK A;  3KZW A;  2BEI A;  2BUE A;  4CGO A;  2QEC A;  2GRE A;  3K9U A;  2PJB A;  4OLL A;  2PJ0 A;  4HKF A;  4CAV A;  2YNC A;  4F8Z A;  4KSI A;  2EK9 A;  4IAV A;  3FXT A;  3K9T A;  4UEZ A;  1X10 A;  4H6U A;  4UFX A;  2G9D A;  1BAV A;  1I1D A;  1F2P A;  1U6M A;  2PJ4 A;  2ZED A;  2PQ8 A;  2Z3N A;  4A32 A;  5D29 A;  2Q44 A;  3IWG A;  3VH9 A;  3NE7 A;  1DTD A;  1IY7 A;  2YGW A;  4MHN A;  4FD5 A;  4QC6 A;  4MCP A;  2XEF A;  3ZZI A;  2PIY A;  4C7H A;  2AFX A;  2PSW A;  4JYW A;  4PQA A;  3PB8 X;  1BOB A;  2V8D A;  3CZX A;  4L8A A;  4LQG A;  5IB9 A;  1XJO A;  4A33 A;  4E2A A;  4E8O A;  1X12 A;  1XBU A;  1V0C A;  2AFZ A;  3FBU A;  1PYT B;  1QSO A;  1S7F A;  3BLN A;  3KR4 A;  4X2T A;  5A28 A;  1QST A;  4UF4 A;  3B3C A;  1YW4 A;  4FD7 A;  3D7F A;  5ELY A;  5H84 A;  4CGL A;  1R57 A;  1Y0R A;  5EC4 A;  4AXV A;  2Z11 A;  4M6G A;  1FT7 A;  4ZY2 A;  2HC9 A;  2WYR A;  4ONU A;  1CBX A;  1YVO A;  4B12 A;  4R57 A;  2J8R A;  4FD4 A;  2HUZ A;  4H6Z A;  3MRU A;  4KOT A;  4F6A A;  5G20 A;  2R7H A;  5K8O A;  4MI4 A;  4M3S A;  2Q0Y A;  3FEE A;  4B6Z A;  2GIV A;  5H86 A;  1H8L A;  1XFO A;  3V8I A;  1CM0 A;  5J8C A;  3F8K A;  2P6F A;  3RO0 A;  3VAT A;  2GU2 A;  4CAE A;  3D3S A;  1TKH A;  4KSF A;  2EVN A;  3KI9 A;  3N7Z A;  4MFJ A;  2J9A A;  5I4M A;  1ZG8 A;  4KSA A;  2FL4 A;  2Z3K A;  3CDX A;  3QB8 A;  4Q36 A;  1CPX A;  4ZX8 A;  4FD6 A;  2PVW A;  3PFE A;  1I21 A;  1CP6 A;  2EWB A;  1MK4 A;  1ARM A;  3G8W A;  1QQ9 A;  4JXR A;  5EBV A;  3S6F A;  4A37 A;  4MFP A;  2FCK A;  4C2Z A;  3HLP A;  2BL1 A;  4YWY A;  4QVT A;  1IYL A;  2D4P A;  3R9E A;  2Q43 A;  3BXM A;  3PRT A;  1ZLH A;  2PJA A;  4U9Z A;  2WPX A;  5DWM A;  4OC2 A;  2FS5 A;  3KQX A;  5I0C A;  5JPH A;  5AG6 A;  2DF5 A;  4JJX A;  1CJW A;  1YME A;  3A9L A;  3NA6 A;  2ZXV A;  2Z3P A;  4MBU A;  4Y49 B;  6CPA A;  3LMS A;  4GM5 A;  4H2K A;  2JDC A;  4UIA A;  4I49 A;  4KLV A;  1BO4 A;  1Z8L A;  2AFO A;  1JWQ A;  2VI7 A;  1F57 A;  1WWZ A;  3SJG A;  2FIA A;  3E0K A;  5F49 A;  3V7Z A;  2ZEN A;  2AFM A;  2DEA A;  1ARL A;  4WWV A;  3S9N A;  5JQ4 A;  3D8P A;  4MCQ A;  2H5M A;  2Q51 A;  3FYN A;  4A95 A;  4P4B A;  1GYT A;  1QSR A;  2VQY A;  3DR8 A;  2FIW A;  4XPD B;  1K4J A;  1YQE A;  5K8N A;  1HEE A;  1VIX A;  4A39 A;  2Q4V A;  4PXD A;  4FUU A;  4OC1 A;  4LUA A;  3H4Q A;  1YLE A;  1EE3 P;  1YRE A;  5GCN A;  4Q38 A;  1XIX A;  2R98 A;  5LYF A;  2Q04 A;  2OB0 A;  2I3C A;  1TIQ A;  4B5P A;  2RC4 A;  4DJL A;  2B4D A;  1IIC A;  2VL1 A;  1M4L A;  2PR1 A;  4UCM A;  4EVY A;  3CXP A;  2B3U A;  3BI1 A;  3PB4 X;  2DPT A;  3FMC A;  3KGQ A;  3L2N A;  3KL9 A;  2Z3L A;  5JH9 A;  3EXN A;  3FED A;  5IV0 A;  2KCW A;  5KTD A;  1GHE A;  3TOB A;  2GFQ A;  4ZI6 A;  1VHS A;  4CYN A;  1IYK A;  4NJR A;  3JUW A;  3D7G A;  4PXB A;  4IK2 A;  4XPK A;  5J1Q A;  3D2M A;  4P6Y A;  4R3L A;  2V77 A;  1XMB A;  3B3W A;  2ARH A;  4P45 A;  4KVM E;  2ZEE A;  3B7I A;  4R76 A;  1DE4 C;  1S7K A;  4MRI A;  3SJX A;  4UCN A;  4AVA A;  3FRM A;  4R87 A;  2OZH A;  1LRZ A;  2G0B A;  2YND A;  3MGD A;  3S9L A;  1Y7E A;  1FY7 A;  2ZEL A;  4BBH A;  2PJ1 A;  3GUX A;  3B3V A;  4PXE A;  4P10 A;  1YW6 A;  1KZF A;  1XOV A;  2C6G A;  2J8N A;  3BJ7 A;  2NSM A;  4PXC A;  4UFV A;  4EFD A;  1KUV A;  3MN8 A;  4K30 A;  4CGP A;  3R96 A;  3KHZ A;  3DGV A;  3IWW A;  4G1P A;  3B3S A;  4UWI A;  2PJC A;  4OC4 A;  3UY5 A;  4C7I A;  1PU9 A;  1CX8 A;  1Y7R A;  3IFE A;  2P6G A;  4YGO A;  5LRG A;  2P6E A;  4CGM A;  1P0H A;  2Q7B A;  5JGF A;  3IO1 A;  3RZA A;  3W91 A;  4AG7 A;  1TXR A;  4FWU A;  4MHZ A;  4CGN A;  4F0X A;  1BLL E;  4U9Y A;  2FVG A;  4IF5 A;  4A30 A;  1S7L A;  1YK3 A;  3H5Z A;  3B35 A;  3D2P A;  5LYL A;  1NMT A;  1TKF A;  1JQG A;  3R95 A;  2CTB A;  4KOY A;  1IOF A;  4UCP A;  2GE3 A;  2OZU A;  4RN7 A;  4QUS A;  4MFK A;  4IHM A;  3W6X A;  4UEE A;  3QAY A;  5G21 A;  2OZG A;  4KS9 A;  4MJ8 A;  5IX3 A;  2F5I A;  5ISV A;  2G3A A;  3FVL A;  2WUU A;  3K2K A;  8CPA A;  2WSA A;  4IUS A;  4R3K A;  4RS2 A;  3TX8 A;  1RXT A;  2CNS A;  1SQH A;  2IMO A;  4P44 A;  3VAR A;  1PUA A;  4LQ6 A;  3EO4 A;  1UFH A;  2PJ5 A;  3SJE A;  1YX0 A;  2F8H A;  5IB0 A;  2DXQ A;  4F9V A;  2BO9 A;  3JRU A;  4B5O A;  3CPX A;  3CXQ A;  4R9M A;  2EBJ A;  2VZZ A;  4UWJ A;  2AFW A;  3TCV A;  3DNS A;  3GB0 A;  2ZOF A;  2O53 A;  4UFW A;  1F2O A;  3S6K A;  5J8F A;  3GYA A;  1Y9W A;  3WAB A;  2PVV A;  2ZW5 A;  2JLM A;  2PC1 A;  3IU2 A;  1XE4 A;  4JXQ A;  4DUK A;  4UA3 A;  5HVF A;  3PZJ A;  1XMT A;  1BPN A;  4P4J A;  4Y49 C;  1UWY A;  1KUY A;  2RB7 A;  3IGR A;  4U5Y A;  3SXO A;  3TO9 A;  4CYO A;  5C88 A;  5G1Z A;  1ZLI A;  4KZT A;  3C26 A;  5CBM A;  3F5B A;  5LRJ A;  1BPM A;  2XEI A;  4BD9 A;  2ZOG A;  3SI0 A;  4ONW A;  3VWE A;  3PP9 A;  5AG7 A;  4B10 A;  4CPA A;  3PB9 X;  4R6T A;  2D4O A;  4KVX A;  2WPW A;  5CNP A;  3D67 A;  3PBE A;  4MCS A;  1LOK A;  2PCU A;  2JBJ A;  2FT0 A;  4P4E A;  3FX6 A;  3DR6 A;  5THW A;  1L0C A;  2ANP A;  2JEV A;  3EC4 A;  4NGT A;  4OAE A;  5HXD A;  2XEJ A;  1IGB A;  4XPD C;  2C6C A;  4X3R A;  4OME A;  2B3V A;  3G3S A;  5F46 A;  3GKR A;  3IU1 A;  2BCO A;  5HVH A;  4MHD A;  4KOW A;  1R43 A;  1ZG7 A;  3FIX A;  3R1K A;  3IJ3 A;  4H89 A;  3GLJ A;  3FH4 A;  4R7M A;  1A2Z A;  4F9U A;  4PK3 A;  4P4D A;  4ZY0 A;  3TTH A;  1I12 A;  2C27 A;  2PE3 A;  1Z5R A;  4X8I A;  3QNV A;  3B3T A;  3TO7 A;  4NSQ A;  2REE A;  5DWN A;  4J3G A;  4Z65 A;  2J8M A;  3OWC A;  4PV6 A;  3JTK A;  3LD2 A;  2WZN A;  4OID A;  2PJ9 A;  2B5G A;  2CY2 A;  4OC0 A;  1M4D A;  1M1D A;  2EK8 A;  4NF1 A;  2ZW6 A;  1B87 A;  3V38 A;  4MXU A;  3TOA A;  3TO6 A;  2ZEH A;  5LYD A;  5K8P A;  4YFJ A;  4NGS A;  3NH4 A;  4NGM A;  4NGP A;  4P4F A;  3BHX A;  1ZG9 A;  4ZGY B;  5KTC A;  1P4N A;  3VWD A;  2QVP A;  1J4J A;  1Q2C A;  2CNT A;  2ZEO A;  3F0A A;  3I9S A;  3RYO A;  4CYP A;  3WC6 A;  3PGP A;  4M6I A;  4HNX B;  3I3G A;  1OBR A;  2DPS A;  1Z8W A;  3S6H A;  2ABZ A;  4MCR A;  1XF8 A;  4B13 A;  2Z10 A;  4BMH A;  2ATR A;  4CAW A;  3PEI A;  4B5P B;  1KWM A;  4ZBG A;  2ZEP A;  2V8H A;  3PBB A;  3SJF A;  2B4D B;  4KVO E;  1VGY A;  4E0A A;  2FSR A;  2PJ3 A;  2RFH A;  4XNH B;  3KR5 A;  3IEH A;  3NH5 A;  1CP7 A;  1YSJ A;  4RI1 A;  4XPL A;  4ZX9 A;  4AVC A;  1YLO A;  3GY9 A;  5AG4 A;  1NSA A;  5A27 A;  4HPS A;  5EMI A;  3D68 A;  2Q7S A;  1LAM A;  4OP4 A;  5HVG A;  4UEF A;  3DDD A;  2PDO A;  1S60 A;  2PJ2 A;  5KTA A;  5F09 A;  3FEC A;  3TFY A;  1XEB A;  3T90 A;  2Z3M A;  3LAC A;  4PSW A;  5C82 A;  2B4B A;  1XRY A;  2CF4 A;  2IQ6 A;  1PCA A;  4CYQ A;  4A94 A;  3KQZ A;  4DNC A;  2K5T A;  2O28 A;  2VBQ A;  3RNZ A;  2PJ7 A;  2ODF A;  1RO5 A;  3DLJ A;  3QAH A;  4HNY B;  4MFL A;  4PK2 A;  2P0W A;  2V8V A;  4MMO A;  4ORF A;  4FBE A;  2Z3O A;  2C6P A;  4KUB A;  2PIZ A;  1TF8 A;  5BWA B;  4MY3 A;  2QIR A;  2YNC C;  4Q7A A;  4KOU A;  4X5K A;  2QYV A;  3BJ8 A;  2FE7 A;  3N5F A;  3NH8 A;  3KAS A;  4YRH A;  1LAN A;  2JEW A;  4TWE A;  1QMU A;  1YVK A;  3IC1 A;  1IID A;  4B14 A;  3H8G A;  2NMT A;  1LCP A;  3PFO A;  4ZYQ A;  2Z0Z A;  4OKO A;  4K3N A;  4NGN A;  4A2Z A;  4AVB A;  1AUG A;  4NEX A;  3H8F A;  5AG5 A;  1LAP A;  5CPA A;  5JM6 A;  3SHP A;  4KOV A;  5HH1 A;  2GLJ A;  2OR4 A;  1B6B A;  2PRQ A;  1AYE A;  3NFZ A;  1ELM P;  3CPA A;  4O23 A;  3TC8 A;  4M85 A;  4ZY1 A;  2R1I A;  3WC5 A;  3BI0 A;  2AFS A;  2V8G A;  2ZPA A;  4JWP A;  2O4H A;  2CIJ A;  1TF9 A;  4EME A;  3PB7 X;  2NYQ A;  5HMN A;  1KUX A;  4GXH A;  4NXY A;  3TT2 A;  3HUV A;  2C1C A;  1Z8X A;  2ZEM A;  3LWU A;  5G22 A;  1M4G A;  3SI1 A;  1QSM A;  3FF3 A;  4MFQ A;  1Q2Y A;  4NFR A;  2AE6 A;  2JDD A;  1CG2 A;  2JBK A;  3P2H A;  4DYO A;  2EUI A;  1Z2L A;  1ELL P;  3S6G A;  3WR7 A;  1Y9K A;  2R8V A;  2ZW7 A;  3D7H A;  4LX9 A;  4UBR A;  1MJA A;  1YR0 A;  1Z4E A;  1YGH A;  2PJ8 A;  4TNU A;  3PB6 X;  2ZEF A;  2REF A;  5DS0 A;  5D8N A;  2QJ8 A;  1ON0 A;  5F48 A;  1MJB A;  3I1U A;  4JZ0 A;  4P4I A;  3D7D A;  4W9Y A;  3R9F A;  3P2F A;  4B11 A;  5F47 A;  1ZO0 A;  3FB3 A;  2OOT A;  1CPS A;  3WT4 A;  2Y0M A;  4M6H A;  4OIW A;  4NJQ A;  4RUH A;  5K8M A;  4PSX A;  4CRY B;  2HB6 A;  1Z9U A;  4MHY A;  2XEG A;  4NGR A;  5AGE A;  3RAM A;  3EY5 A;  2GLF A;  2Q4Z A;  3DSB A;  4R8F A;  4AB7 A;  2AFU A;  4KOS A;  1Z8T A;  3FJU A;  3NE8 A;  4KOX A;  1VHE A;  4OAD A;  2AJ6 A;  4C2Y A;  4CAX A;  1S5K A;  1S3Z A;  1Z4R A;  1MJ9 A;  2I00 A;  1IB1 E;  2IJZ A;  3SXN A;  1Q7L A;  3ZJ0 A;  4C2X A;  3KKW A;  2Q4Y A;  1Y0Y A;  3S9M A;  2OH1 A;  1VKC A;  2ZEG A;  4CAF A;  2POK A;  1HDQ A;  2X7B A;  3RBU A;  2BOA A;  4QBJ A;  5FVJ A;  2GAN A;  1NE9 A;  1TKJ A;  1HDU A;  1IU8 A;  2F7V A;  4MY0 A;  1NSL A;  2VZY A;  1N71 A;  1S7N A;  4CS0 B;  1QSN A;  1WK4 A;  1M4I A;  2FXF A;  2CXA A;  3IIB A;  3T8W A;  1R3N A;  1RTQ A;  4L89 A;  1FNO A;  2OU2 A;  3LOD A;  4QB9 A;  2G3T A;  2HQY A;  2PR8 A;  2IL4 A;  4BIN A;  4F0Y A;  1VHO A;  2PRB A;  2CTC A;  2ZW4 A;  3EFA A;  4NGQ A;  4A31 A;  3GIU A;  2B58 A;  3B2Y A;  3T9Y A;  4JD6 A;  4II9 A;  4FAI A;  4KOR A;  4YU9 A;  2EO8 A;  2PJ6 A;  2A4N A;  4JLY A;  4OC3 A;  4GS4 A;  4NCZ A;  4KLW A;  2BSW A;  2VXK A;  3H8E A;  3CT9 A;  4MFZ A;  4MHP A;  5E96 A;  4KUA A;  1IOI A;  3R9G A;  4XNH C;  2HV2 A;  1AMP A;  3FNC A;  4A38 A;  3ISZ A;  4UIB A;  4CRZ B;  3D4U A;  4OC5 A;  4AG9 A;  5LYI A;  3IWE A;  1M44 A;  4HNW B;  2YNE A;  2B5G B;  3JVN A;  4PPZ A;  3SI2 A;  3WC7 A;  1LFW A;  1OZP A;  2I79 A;  2QML A;  1Q2D A; 
#chains in the Genus database with same CATH homology
 2CNM A;  2VEZ A;  4C68 A;  3CXS A;  3TE4 A;  3B8G A;  3W6S A;  2BEI A;  2BUE A;  4CGO A;  2QEC A;  3K9U A;  4OLL A;  4HKF A;  4CAV A;  2YNC A;  3FXT A;  4H6U A;  4UFX A;  1I1D A;  1U6M A;  2PQ8 A;  2Z3N A;  4A32 A;  2Q44 A;  3IWG A;  3NE7 A;  2YGW A;  4FD5 A;  4QC6 A;  3ZZI A;  4C7H A;  2PSW A;  1BOB A;  4L8A A;  4A33 A;  4E2A A;  4E8O A;  3R9F A;  4AG7 A;  1V0C A;  3FBU A;  3BLN A;  1QSO A;  1S7F A;  5A28 A;  1QST A;  4CGL A;  4FD7 A;  5H84 A;  1R57 A;  5EC4 A;  2Z11 A;  4ONU A;  1YVO A;  4B12 A;  4R57 A;  2J8R A;  4FD4 A;  2HUZ A;  4H6Z A;  4KOT A;  4F6A A;  5G20 A;  2R7H A;  4MI4 A;  4M3S A;  2Q0Y A;  2GIV A;  5H86 A;  3V8I A;  1CM0 A;  5J8C A;  3F8K A;  2P6F A;  4CAE A;  3D3S A;  4KSF A;  2EVN A;  3N7Z A;  4MFJ A;  4KSA A;  2FL4 A;  2Z3K A;  4Q36 A;  3QB8 A;  4FD6 A;  4JXR A;  1I21 A;  1MK4 A;  5EBV A;  3G8W A;  3S6F A;  4MFP A;  2FCK A;  4C2Z A;  2BL1 A;  4QVT A;  1IYL A;  2D4P A;  3R9E A;  4U9Z A;  2WPX A;  5DWM A;  2FS5 A;  5I0C A;  5JPH A;  5AG6 A;  4JJX A;  1CJW A;  3A9L A;  2ZXV A;  2Z3P A;  4MBU A;  4Y49 B;  2JDC A;  4I49 A;  4KLV A;  1BO4 A;  2VI7 A;  1WWZ A;  2FIA A;  3E0K A;  5F49 A;  5JQ4 A;  3D8P A;  2H5M A;  3FYN A;  4A95 A;  1QSR A;  2VQY A;  3DR8 A;  2FIW A;  4XPD B;  1K4J A;  2Q4V A;  4LUA A;  3H4Q A;  1YLE A;  1YRE A;  5GCN A;  4Q38 A;  1XIX A;  2R98 A;  2Q04 A;  2OB0 A;  1TIQ A;  4B5P A;  2RC4 A;  2B4D A;  1IIC A;  2PR1 A;  4UCM A;  4EVY A;  3CXP A;  2B3U A;  2DPT A;  2Z3L A;  3EXN A;  5IV0 A;  2KCW A;  5KTD A;  1GHE A;  3TOB A;  1VHS A;  4CYN A;  1IYK A;  3JUW A;  4XPK A;  3D2M A;  4R3L A;  2ARH A;  4KVM E;  1S7K A;  4UCN A;  4AVA A;  3FRM A;  4R87 A;  2OZH A;  1LRZ A;  2G0B A;  2YND A;  3MGD A;  1FY7 A;  4BBH A;  1KZF A;  2J8N A;  3BJ7 A;  4UFV A;  1KUV A;  4K30 A;  4CGP A;  3R96 A;  3UY5 A;  4C7I A;  4UWI A;  1PU9 A;  1Y7R A;  4YGO A;  2P6G A;  2P6E A;  4CGM A;  1P0H A;  2Q7B A;  3W91 A;  4CGN A;  4U9Y A;  4A30 A;  1S7L A;  1YK3 A;  3H5Z A;  3D2P A;  1NMT A;  3R95 A;  4KOY A;  4UCP A;  2GE3 A;  2OZU A;  4QUS A;  4MFK A;  3W6X A;  5G21 A;  2OZG A;  4KS9 A;  4MJ8 A;  5IX3 A;  2F5I A;  5ISV A;  2G3A A;  2WUU A;  2WSA A;  4IUS A;  4R3K A;  4RS2 A;  1RXT A;  2CNS A;  1SQH A;  1PUA A;  3EO4 A;  1UFH A;  1YX0 A;  5IB0 A;  2DXQ A;  4B5O A;  3CXQ A;  4R9M A;  2VZZ A;  4UWJ A;  3TCV A;  3DNS A;  4UFW A;  3S6K A;  5J8F A;  3GYA A;  1Y9W A;  2ZW5 A;  2JLM A;  2PC1 A;  3IU2 A;  1XE4 A;  4JXQ A;  4UA3 A;  3PZJ A;  1XMT A;  4Y49 C;  1KUY A;  4U5Y A;  3IGR A;  3SXO A;  3TO9 A;  4CYO A;  5C88 A;  5G1Z A;  4KZT A;  3C26 A;  3F5B A;  3VWE A;  3PP9 A;  5AG7 A;  4B10 A;  2D4O A;  4KVX A;  2WPW A;  5CNP A;  2FT0 A;  3DR6 A;  1L0C A;  2JEV A;  3EC4 A;  4OAE A;  4XPD C;  2B3V A;  3G3S A;  5F46 A;  3GKR A;  3IU1 A;  4MHD A;  4KOW A;  3FIX A;  3R1K A;  4H89 A;  4PK3 A;  3TTH A;  1I12 A;  2C27 A;  3TO7 A;  4NSQ A;  2REE A;  5DWN A;  4J3G A;  2J8M A;  3OWC A;  4PV6 A;  3JTK A;  3LD2 A;  2B5G A;  2CY2 A;  1M4D A;  1M1D A;  4NF1 A;  2ZW6 A;  1B87 A;  3TOA A;  3TO6 A;  4YFJ A;  4ZGY B;  5KTC A;  1P4N A;  3VWD A;  1J4J A;  1Q2C A;  2CNT A;  3F0A A;  3I9S A;  3RYO A;  4CYP A;  3PGP A;  4HNX B;  3I3G A;  2DPS A;  3S6H A;  1XF8 A;  4B13 A;  2Z10 A;  4BMH A;  2ATR A;  4CAW A;  4B5P B;  4ZBG A;  2B4D B;  4KVO E;  4E0A A;  2FSR A;  4XNH B;  4RI1 A;  4XPL A;  4AVC A;  3GY9 A;  5AG4 A;  5A27 A;  5KTA A;  3DDD A;  2PDO A;  1S60 A;  3TFY A;  1XEB A;  3T90 A;  2Z3M A;  4PSW A;  5C82 A;  2B4B A;  4CYQ A;  4DNC A;  2K5T A;  2O28 A;  2VBQ A;  4F0X A;  4HNY B;  4MFL A;  1RO5 A;  3QAH A;  4PK2 A;  2P0W A;  4ORF A;  2Z3O A;  4KUB A;  5BWA B;  4MY3 A;  2QIR A;  2YNC C;  4KOU A;  4X5K A;  3BJ8 A;  2FE7 A;  4YRH A;  1YVK A;  1IID A;  4B14 A;  2NMT A;  2Z0Z A;  4AVB A;  4A2Z A;  4NEX A;  5AG5 A;  3SHP A;  4KOV A;  5HH1 A;  1B6B A;  4M85 A;  2R1I A;  2ZPA A;  4JWP A;  5HMN A;  1KUX A;  4NXY A;  3TT2 A;  5G22 A;  1M4G A;  1QSM A;  4MFQ A;  1Q2Y A;  2AE6 A;  2JDD A;  3P2H A;  2EUI A;  3S6G A;  3WR7 A;  1Y9K A;  2R8V A;  2ZW7 A;  4LX9 A;  4UBR A;  1MJA A;  1YR0 A;  1Z4E A;  1YGH A;  2REF A;  1ON0 A;  5F48 A;  1MJB A;  3P2F A;  4B11 A;  5F47 A;  1ZO0 A;  3FB3 A;  2Y0M A;  4PSX A;  4CRY B;  1Z9U A;  5AGE A;  4CRZ B;  4AB7 A;  3EY5 A;  3DSB A;  4KOS A;  4KOX A;  4OAD A;  2AJ6 A;  4C2Y A;  4CAX A;  1S5K A;  1S3Z A;  1Z4R A;  1MJ9 A;  2I00 A;  1IB1 E;  3SXN A;  3ZJ0 A;  4C2X A;  3KKW A;  2Q4Y A;  2OH1 A;  1VKC A;  4CAF A;  2X7B A;  4QBJ A;  5FVJ A;  2GAN A;  1NE9 A;  4MY0 A;  1NSL A;  2VZY A;  1N71 A;  1S7N A;  4CS0 B;  1QSN A;  1WK4 A;  1M4I A;  1Q2D A;  2FXF A;  2CXA A;  4L89 A;  2OU2 A;  3LOD A;  4QB9 A;  4F0Y A;  2G3T A;  2HQY A;  2PR8 A;  2IL4 A;  2PRB A;  2ZW4 A;  3EFA A;  4A31 A;  2B58 A;  3T9Y A;  4JD6 A;  4II9 A;  4KOR A;  4JLY A;  2A4N A;  4GS4 A;  4NCZ A;  4KLW A;  2BSW A;  2VXK A;  4MFZ A;  5E96 A;  4KUA A;  3R9G A;  4XNH C;  2HV2 A;  3FNC A;  4AG9 A;  3IWE A;  1M44 A;  4HNW B;  2YNE A;  2B5G B;  3JVN A;  1OZP A;  2I79 A;  2QML A;  4IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...