4E2AA

Crystal structure of the putative acetyltransferase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
QVEIRKVNQDELSLLQKIAIQTFRETFAFDNTAEQLQNFFDEAYTLSVLKLELDDKESETYFILMSGKAAGFLKVNWGSSQTEQVLEDAFEIQRLYILKAYQGLGLGKQLFEFALERAQISGLSWVWLGVWEKNVKAQLLYAKYGFEQFSKHSFFVGNKVDTDWLLKKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative acetyltransferase
publication title Crystal Structure of the Putative acetyltransferase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
total genus 54
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e2aA00
2ZW7A 2FCKA 4XPKA 1Z4EA 3QAHA 3SXOA 3EC4A 4HNYB 1YVKA 1YVOA 2CNMA 2PSWA 5J8FA 4MBUA 1YK3A 2FIAA 4ORFA 3I3GA 2PC1A 4YGOA 3SHPA 2B4DA 3ZJ0A 3TOBA 4AB7A 5ISVA 2F5IA 4J3GA 1XMTA 1GHEA 2FSRA 3FB3A 1TIQA 1S7KA 1OZPA 4UWIA 4B5PA 1KUXA 2OZGA 2REEA 4KVME 4MHDA 1Q2DA 2P6GA 2Q0YA 1MJBA 4X5KA 3F8KA 1FY7A 1BOBA 2OZUA 2O28A 1CM0A 2VZZA 3NE7A 4JXRA 3BJ7A 4MY0A 3D8PA 1SQHA 1IB1E 3D3SA 3C26A 2EUIA 3FBUA 2R98A 4AVAA 4XPDC 5IB0A 2G0BA 1XF8A 4LUAA 1I12A 5E96A 5C82A 2OU2A 5DWNA 2J8RA 2Q7BA 2PRBA 1QSTA 1MK4A 3ZZIA 1YGHA 2Y0MA 3SXNA 3BLNA 3K9UA 4QVTA 3B8GA 2HV2A 3RYOA 3F0AA 2A4NA 1M4DA 1IYLA 4HNWB 4PSWA 2Q44A 3TTHA 5F47A 1NMTA 5F49A 2Q4VA 2FIWA 4AG7A 2B5GA 3F5BA 1XEBA 1YREA 1VKCA 4YRHA 1S7LA 2ZW5A 3TFYA 5EC4A 3EO4A 4XNHB 3S6HA 4QUSA 2JEVA 2R1IA 1S7NA 3IWGA 4KVXA 3TO6A 3D2PA 4E8OA 1XIXA 2PR8A 1YLEA 1RXTA 3W6SA 3BJ8A 2ZXVA 1Z4RA 2FL4A 4FD5A 4DNCA 5C88A 2CNTA 3R9GA 4M85A 4FD6A 2P0WA 2KCWA 3IGRA 1U6MA 4JWPA 3EFAA 3TCVA 4K30A 1M4GA 3R9EA 4R3KA 3FNCA 4PSXA 3R95A 2VQYA 4ONUA 4JXQA 1UFHA 1ON0A 3T9YA 2VEZA 3FIXA 1M44A 4KOUA 5H86A 4LX9A 3QB8A 2FE7A 5HH1A 4H6UA 2JLMA 4MY3A 5J8CA 3N7ZA 2Q04A 3R9FA 4KORA 4KOVA 2VI7A 2BUEA 4QB9A 4YFJA 3MGDA 4HKFA 1N71A 4ZBGA 3S6KA 4KOYA 3PP9A 4PK3A 1J4JA 1MJAA 2D4PA 1KZFA 3GYAA 4XPLA 5KTAA 1S5KA 3WR7A 2GANA 4E0AA 4JD6A 3TO7A 4RS2A 3DNSA 2JDCA 5EBVA 1Y7RA 3DSBA 2WPWA 4U9ZA 4NEXA 4AVCA 2VZYA 4AG9A 2AE6A 2BL1A 1IICA 4I49A 4GS4A 1PU9A 1PUAA 2BEIA 2NMTA 4KUBA 1WWZA 1NE9A 3VWDA 5KTCA 4QC6A 4PV6A 2PDOA 3G8WA 3PZJA 2IL4A 4B5OA 2QIRA 1S60A 4NXYA 3UY5A 2K5TA 4KOWA 3JVNA 4UBRA 2ARHA 1IIDA 2ZPAA 3GY9A 2BSWA 4Y49C 2FT0A 2ATRA 1K4JA 4R3LA 4PK2A 1L0CA 3S6FA 2R8VA 1YR0A 4CRZB 2GE3A 2HUZA 2ZW4A 4M3SA 1P4NA 1BO4A 4H6ZA 2J8NA 3TO9A 3TT2A 3VWEA 3V8IA 3CXSA 4F0YA 2G3AA 1Q2YA 5KTDA 5FVJA 3PGPA 5HMNA 5DWMA 1CJWA 1YX0A 1KUYA 4XPDB 1WK4A 3W6XA 4MJ8A 2B4BA 3TOAA 4E2AA 4CAXA 2CY2A 4L89A 1RO5A 3KKWA 1QSRA 1I21A 3TE4A 2ZW6A 1QSNA 2Z0ZA 5H84A 3I9SA 3LODA 4UA3A 5F46A 3P2HA 1Y9KA 5CNPA 1QSMA 4OLLA 1V0CA 3EY5A 4JLYA 5JQ4A 2B4DB 3CXPA 1Q2CA 2H5MA 4OAEA 1LRZA 3DR8A 3S6GA 4CRYB 1S3ZA 2GIVA 4BMHA 1B87A 1KUVA 4UWJA 2RC4A 2X7BA 4OADA 4HNXB 4B5PB 4NCZA 3D2MA 3T90A 1M1DA 4KLWA 2P6EA 2DXQA 1Y9WA 1R57A 3H4QA 4CAVA 4U9YA 2Q4YA 3FRMA 3LD2A 2Z10A 5IX3A 1QSOA 2P6FA 4KOXA 2VXKA 4R57A 2FS5A 4CS0B 2I00A 5IV0A 4JJXA 4CAWA 3W91A 2WPXA 2CNSA 2OZHA 3FYNA 3CXQA 4NSQA 4XNHC 2HQYA 1I1DA 4AVBA 5GCNA 5F48A 3R96A 2R7HA 3JUWA 4U5YA 1P0HA 2J8MA 4H89A 4KOSA 4KZTA 3GKRA 2PR1A 2VBQA 4KOTA 2QMLA 4KVOE 2D4OA 4IUSA 4F6AA 4R87A 4KLVA 2B5GB 2AJ6A 2EVNA 5I0CA 4RI1A 4MI4A 2OB0A 3R1KA 1S7FA 2C27A 2FXFA 2G3TA 3P2FA 4L8AA 3DR6A 1Z9UA 1B6BA 1NSLA 4II9A 2QECA 2B58A 3DDDA 1M4IA 4IF5A 3G3SA 2PQ8A 4NF1A 5JPHA 2I79A 2JDDA 3EXNA 4QBJA 3FXTA 3OWCA 4EVYA 4FD4A 1VHSA 2Z11A 2OH1A 1XE4A 2REFA 4KUAA 4Y49B 2B3UA 2B3VA 1MJ9A 3E0KA 4FD7A 4R9MA 1IYKA
chains in the Genus database with same CATH superfamily
2YNCA 2ZW7A 2FCKA 2JBJA 4NGSA 4MFLA 4F9VA 4XPKA 1DE4C 1Z4EA 3QAHA 3SXOA 3EC4A 3GLJA 2QJ8A 1YVKA 3DLJA 4HNYB 2CF4A 1YVOA 2CNMA 2GLFA 3WC6A 2PJ8A 2PSWA 4YU9A 5J8FA 3D7FA 4MBUA 5G21A 1YK3A 4CYPA 2FIAA 4ORFA 3I3GA 2PC1A 4PXCA 5LYLA 4YGOA 3SHPA 3I1UA 1BLLE 2B4DA 1XFOA 4C7IA 4OC2A 2PIZA 3ZJ0A 3TOBA 4AB7A 3PFEA 5ISVA 2F5IA 4J3GA 1XMTA 2DPSA 1GHEA 1HEEA 2FSRA 5IB9A 2XEIA 1GYTA 3FB3A 3WC5A 1TIQA 4C2XA 3B7IA 1S7KA 3LWUA 1OZPA 4UWIA 3FF3A 3BHXA 4B5PA 1KUXA 2OZGA 2PJ6A 2REEA 1Y0YA 2IQ6A 4NFRA 4KVME 4MHDA 4ONWA 3S9NA 1Q2DA 4O23A 2P6GA 2Q0YA 1MJBA 3IEHA 2HB6A 4X5KA 3F8KA 1FY7A 1TKJA 1BOBA 2OZUA 2C1CA 3FEEA 2PJCA 2EBJA 2O28A 1IY7A 1CM0A 2VZZA 4EWTA 2PJ5A 3JTKA 4RUHA 4X2TA 3IWEA 3IJ3A 3NE7A 1A2ZA 3LACA 2EO8A 3BJ7A 4JXRA 4MY0A 2QYVA 1VIXA 1XJOA 1BAVA 3D8PA 3SI2A 4CAEA 4FAIA 1F57A 1LCPA 5HXDA 2WYRA 1SQHA 1IB1E 4ZY0A 5K8PA 3D3SA 3C26A 2EUIA 3D68A 3FBUA 3KGQA 1IOIA 2XEJA 3KR4A 2R98A 1LOKA 4AVAA 4NGRA 4XPDC 5IB0A 2G0BA 1XF8A 4R7MA 3CZXA 5AG4A 3N5FA 1NSAA 1CPSA 1LFWA 4LUAA 1I12A 5E96A 5C82A 4CYQA 3BI0A 2OU2A 5DWNA 2J8RA 2Q7BA 2PRBA 1QSTA 1VHOA 3FECA 1DTDA 1MK4A 3ZZIA 2PVVA 1YGHA 2Y0MA 3D4UA 4NGPA 3SXNA 1IGBA 3NA6A 3BLNA 3K9UA 3KI9A 2YNCC 1CP7A 3FH4A 4QVTA 4FBEA 3B8GA 2HV2A 3RYOA 1VHEA 3F0AA 2A4NA 4WJBA 1M4DA 1IYLA 4HNWB 4HPSA 4R8FA 4WWVA 4PSWA 1ZG7A 2Q44A 4Q38A 1X10A 4OC3A 3SJEA 4PXEA 3TTHA 5F47A 4M6HA 2PE3A 5LRGA 5LYDA 2CXAA 3V38A 1TKFA 1NMTA 1UWYA 5F49A 2Q4VA 2FIWA 4MFPA 2B5GA 3F5BA 4AG7A 5I4MA 2EWBA 1XEBA 2CTCA 1YREA 1CPXA 4FUUA 5LRJA 1VKCA 4YRHA 1S7LA 2ZW5A 3TFYA 2C6GA 3EO4A 4XNHB 5EC4A 3S6HA 3V7ZA 5CBMA 3NH8A 3FJUA 4QUSA 4DUKA 3GB0A 5EMIA 2JEVA 2R1IA 4UEFA 4LQ6A 5G20A 3TC8A 1S7NA 2ZEEA 3IWGA 4KVXA 1FT7A 5JGFA 3S9LA 1XBUA 3TO6A 3D2PA 1TKHA 4E8OA 1XIXA 3D7GA 3D66A 2PR8A 4OIWA 1YLEA 1RXTA 3W6SA 3BJ8A 2ZXVA 1Z4RA 2FL4A 2Q7SA 3LMSA 1IU8A 4FD5A 4MFJA 4MXUA 4DNCA 5C88A 4JZ0A 4A31A 2NYQA 4B10A 2CNTA 3R9GA 2Z3OA 4M85A 2PJ7A 4F0XA 4FD6A 1AUGA 2P0WA 2KCWA 2ZELA 1U6MA 3IGRA 1JWQA 3EFAA 4JWPA 2Q51A 1CP6A 4P4DA 3TCVA 4K30A 5A28A 2HC9A 1M4GA 3R9EA 3RO0A 4R3KA 3H8FA 3FNCA 4PSXA 4MHYA 3KQXA 3R95A 3CPAA 2VQYA 4ONUA 4JXQA 4UFWA 4MHNA 1UFHA 1ON0A 2PJ4A 3T9YA 2VEZA 3D7HA 3FIXA 3RBUA 4B12A 2V77A 4ZI6A 4KSFA 1M44A 4KOUA 5H86A 4LX9A 4NGNA 4ZX8A 4C2YA 3QB8A 2CIJA 2EK9A 4ZYQA 2OR4A 4B14A 2EK8A 2FE7A 5HH1A 3KASA 4H6UA 2JLMA 4MY3A 4OC5A 4UCPA 3N7ZA 3VARA 2Q04A 3R9FA 5J8CA 3KR5A 5JM6A 4G1PA 4KORA 4KOVA 4M6IA 2IMOA 3HLPA 4ZY2A 3WABA 2VI7A 4Q36A 2BUEA 3MN8A 4R6TA 3H5ZA 2JBKA 4QB9A 2Z3MA 2F7VA 4EMEA 4YFJA 3FMCA 4BD9A 2CTBA 3MGDA 4KSIA 2PJ0A 4HKFA 1N71A 4MCSA 2VL1A 4RN7A 2BO9A 4ZBGA 2ZEDA 5AG6A 1XMBA 5LYFA 1F2OA 3PB6X 3S6KA 4KOYA 4X8IA 3PP9A 4PK3A 2O53A 4CAFA 1J4JA 1F2PA 2D4PA 1KZFA 1MJAA 1YLOA 5G22A 4AXVA 3GYAA 4A33A 3FX6A 2GFQA 4M6GA 4IHMA 4OKOA 4XPLA 1HDUA 1Y7EA 4TWEA 4PXBA 2O4HA 4P44A 5KTAA 1S5KA 2V8DA 4OC4A 3WR7A 2ANPA 2GANA 2PJAA 3CPXA 4JD6A 3TO7A 4E0AA 4RS2A 5K8MA 3DNSA 2AFXA 4MFZA 8CPAA 2JDCA 4MRIA 3PFOA 2ZEFA 4KS9A 5EBVA 1Y7RA 4F9UA 2PCUA 3DSBA 2WPWA 4U9ZA 4NEXA 3D67A 3K9TA 2VZYA 4AVCA 4AG9A 3BI1A 2AE6A 1ARLA 2AFMA 1IICA 2BL1A 4I49A 4BBHA 3NE8A 4GS4A 1PU9A 2NMTA 1PUAA 2BEIA 4KUBA 4CPAA 3GUXA 5D8NA 1WWZA 1NE9A 4NJRA 3VWDA 5KTCA 4NGTA 4QC6A 5AG7A 4B11A 4PV6A 5LRKA 1XRYA 4UEEA 2PDOA 3G8WA 4P6YA 3PZJA 2IL4A 4B5OA 1Z5RA 1S60A 2QIRA 3IO1A 3NFZA 4NXYA 2GU2A 3DGVA 3PBBA 3UY5A 3T8WA 4PQAA 3MRUA 2K5TA 3PBEA 4KOWA 4YWYA 3SJXA 3JVNA 2YNDA 2ARHA 4UBRA 5A27A 1IIDA 2ZPAA 2DEAA 4UCNA 1LAPA 3GY9A 2BSWA 1PYTB 2F8HA 3IU2A 4Y49C 2FT0A 2ATRA 1AMPA 3IFEA 4NGMA 1K4JA 4R3LA 4PK2A 1XOVA 1L0CA 3S6FA 4NGQA 2R8VA 1YR0A 2PVWA 1FNOA 4CRZB 2GE3A 4A30A 4UCMA 3IIBA 3FEDA 2HUZA 1ZLIA 4R76A 2ZW4A 4M3SA 1ARMA 1P4NA 3KHXA 4P4FA 3PB9X 3KQZA 4CGOA 1BO4A 3A9LA 4H2KA 4H6ZA 3QNVA 2J8NA 3TO9A 3TT2A 4OMEA 3V8IA 3VWEA 2ODFA 3QAYA 3CXSA 2YNEA 4F0YA 3VATA 2G3AA 4A2ZA 5K8NA 1Q2YA 4B13A 2V8VA 2WSAA 5HVGA 5KTDA 3CT9A 4R9MA 5FVJA 1QQ9A 3B3VA 3SI0A 1LANA 4PXDA 5BWAB 3VH9A 4KSAA 1Z8WA 3SJFA 4B6ZA 3PGPA 3SJGA 5DWMA 5HMNA 4BINA 1CJWA 1YX0A 1KUYA 4XPDB 1WK4A 3TX8A 3W6XA 4MJ8A 4CGMA 2B4BA 2C6CA 3TOAA 1H8LA 1QMUA 3RZAA 4E2AA 4CAXA 2CY2A 4L89A 1RO5A 3KKWA 1QSRA 1I21A 2QVPA 2XEGA 2V8GA 3TE4A 2ZW6A 1QSNA 4C7HA 2Z0ZA 3HUVA 3B35A 3JRUA 4P4JA 5H84A 1YMEA 3I9SA 3B3TA 3LODA 2DPTA 4UA3A 1TXRA 4CYOA 5F46A 5D29A 3B3CA 3KL9A 4PPZA 1TF8A 4MHPA 1M4LA 3P2HA 4A94A 1Z8XA 2GREA 4MFQA 1Y9KA 1IOFA 4P4IA 4LQGA 5CNPA 3PB7X 1PCAA 4IK2A 1QSMA 4OLLA 1V0CA 3EY5A 4JLYA 5JQ4A 4MHZA 2B4DB 3CXPA 1Q2CA 4Z65A 4UIAA 2H5MA 2PJBA 4OAEA 4NJQA 1LRZA 3DR8A 6CPAA 1YSJA 3S6GA 1R3NA 4A32A 4CRYB 1S3ZA 2GIVA 5AG5A 4BMHA 1YQEA 1B87A 2ABZA 1KUVA 4UWJA 3NH4A 2OOTA 3SI1A 2RC4A 2X7BA 4OADA 4HNXB 4UF4A 4B5PB 4NCZA 2IJZA 2ZOGA 3D2MA 1ELLP 1R43A 3T90A 1M1DA 5LYIA 3BXMA 2AFOA 4P4EA 2JEWA 2XEFA 4ZGYB 3K2KA 1ZLHA 4KLWA 2P6EA 2DXQA 1CBXA 1Y9WA 1R57A 3H4QA 4CAVA 4U9YA 2Q4YA 3FRMA 4A39A 3LD2A 3GIUA 4UFVA 2Z10A 5HVHA 1Y0RA 2PRQA 1LAMA 4A37A 1QSOA 2P6FA 5IX3A 4KOXA 1EE3P 2VXKA 3KHZA 4R57A 3PEIA 3B2YA 2FS5A 5J1QA 1ELMP 3ISXA 5G1ZA 4CS0B 2C6PA 2I00A 3B3SA 5IV0A 4JJXA 4CAWA 3W91A 1HDQA 2WPXA 2CNSA 2OZHA 2AFZA 3FYNA 4P10A 4DYOA 3CXQA 4NSQA 4XNHC 4A38A 2AFSA 2HQYA 1I1DA 4FWUA 3IU1A 3S9MA 4AVBA 5F09A 2BCOA 2ZENA 4IAVA 5GCNA 5F48A 4OP4A 2AFWA 3R96A 2R7HA 3JUWA 3IC1A 4Q7AA 4U5YA 4JYWA 2Q4ZA 1ZG8A 1P0HA 1CG2A 2I3CA 2J8MA 4H89A 4KOSA 2PJ2A 3H8EA 2Z3LA 1VGYA 1Z8TA 1BPMA 3PRTA 4KZTA 4DJLA 3GKRA 2BOAA 2PR1A 3WC7A 2VBQA 4KOTA 2QMLA 4KVOE 4K3NA 3NH5A 4X3RA 2D4OA 4OC1A 1Z8LA 4CYNA 2RB7A 1ZO0A 2NSMA 2POKA 3IWWA 4IUSA 3PB4X 4MCPA 3FVLA 2Z3PA 4UIBA 4CGNA 1ZG9A 4MCQA 4F6AA 2V8HA 4R87A 2AFUA 4KLVA 4ZX9A 5ELYA 2PJ3A 2Q43A 2B5GB 2AJ6A 4OC0A 2PJ1A 4C68A 1CX8A 2RFHA 3CDXA 2EVNA 4OIDA 1JQGA 5I0CA 3D7DA 1TF9A 2J9AA 2YGWA 2Z3NA 4MFKA 4MI4A 2GLJA 2OB0A 3R1KA 4RI1A 1S7FA 4TNUA 3L2NA 2C27A 4GM5A 2FXFA 4W9YA 3WT4A 4EFDA 1AYEA 2ZEPA 2ZEOA 2G3TA 1X12A 3P2FA 4L8AA 5AGEA 5JH9A 5DS0A 5HVFA 3DR6A 1Z9UA 1BPNA 1B6BA 1NSLA 4II9A 4P45A 2QECA 2B58A 3ISZA 3DDDA 5THWA 2PIYA 2ZEMA 4CGLA 7CPAA 1M4IA 1YW6A 3H8GA 4MMOA 4IF5A 1Z2LA 2PQ8A 3G3SA 4F8ZA 4GXHA 3B3WA 4MCRA 4NF1A 2G9DA 5CPAA 5JPHA 2I79A 4P4BA 2JDDA 3EXNA 4QBJA 2FVGA 2ZEHA 3FXTA 3OWCA 3RNZA 4A95A 4EVYA 2Z3KA 1YW4A 2ZOFA 2WZNA 4FD4A 3RAMA 1VHSA 2Z11A 5K8OA 3PB8X 2OH1A 4UEZA 1Q7LA 1XE4A 2REFA 4KUAA 2ZEGA 4Y49B 2DF5A 1OBRA 2B3UA 2B3VA 2WUUA 2PJ9A 4UFXA 4C2ZA 4ZY1A 1MJ9A 3E0KA 3KZWA 4FD7A 4CGPA 1KWMA 1RTQA 1IYKA
chains in the Genus database with same CATH topology
2YNCA 2ZW7A 2FCKA 4MFLA 4XPKA 1Z4EA 3QAHA 3SXOA 3EC4A 4HNYB 1YVKA 1YVOA 2CNMA 2PSWA 5J8FA 4MBUA 5G21A 1YK3A 4CYPA 2FIAA 4ORFA 3I3GA 2PC1A 4YGOA 3SHPA 2B4DA 4C7IA 3ZJ0A 3TOBA 4AB7A 5ISVA 2F5IA 4J3GA 1XMTA 2DPSA 1GHEA 2FSRA 3FB3A 1TIQA 4C2XA 1S7KA 1OZPA 4UWIA 4B5PA 1KUXA 2OZGA 2REEA 4KVME 4MHDA 1Q2DA 2P6GA 2Q0YA 1MJBA 4X5KA 3F8KA 1FY7A 1BOBA 2OZUA 2O28A 1CM0A 2VZZA 3JTKA 3IWEA 3NE7A 4JXRA 3BJ7A 4MY0A 3D8PA 4CAEA 1SQHA 1IB1E 3D3SA 3C26A 2EUIA 3FBUA 2R98A 4AVAA 4XPDC 5IB0A 2G0BA 1XF8A 5AG4A 4LUAA 1I12A 5E96A 5C82A 4CYQA 2OU2A 5DWNA 2J8RA 2Q7BA 2PRBA 1QSTA 1MK4A 3ZZIA 1YGHA 2Y0MA 3SXNA 3BLNA 3K9UA 2YNCC 4QVTA 3B8GA 2HV2A 3RYOA 3F0AA 2A4NA 1M4DA 1IYLA 4HNWB 4PSWA 2Q44A 4Q38A 3TTHA 5F47A 2CXAA 1NMTA 5F49A 2Q4VA 2FIWA 4MFPA 2B5GA 3F5BA 4AG7A 1XEBA 1YREA 1VKCA 4YRHA 1S7LA 2ZW5A 3TFYA 5EC4A 3EO4A 4XNHB 3S6HA 4QUSA 5G20A 2JEVA 2R1IA 1S7NA 3IWGA 4KVXA 3TO6A 3D2PA 4E8OA 1XIXA 2PR8A 1YLEA 1RXTA 3W6SA 3BJ8A 2ZXVA 1Z4RA 2FL4A 4FD5A 4DNCA 4MFJA 5C88A 4A31A 4B10A 2CNTA 3R9GA 2Z3OA 4M85A 4F0XA 4FD6A 2P0WA 2KCWA 3IGRA 1U6MA 4JWPA 3EFAA 5A28A 3TCVA 4K30A 1M4GA 3R9EA 4R3KA 3FNCA 4PSXA 3R95A 2VQYA 4ONUA 4JXQA 4UFWA 1UFHA 1ON0A 3T9YA 2VEZA 3FIXA 4B12A 4KSFA 1M44A 4KOUA 5H86A 4LX9A 4C2YA 3QB8A 4B14A 2FE7A 5HH1A 4H6UA 2JLMA 4MY3A 4UCPA 5J8CA 3N7ZA 2Q04A 3R9FA 4KORA 4KOVA 2VI7A 4Q36A 2BUEA 3H5ZA 4QB9A 2Z3MA 4YFJA 3MGDA 4HKFA 1N71A 4ZBGA 5AG6A 3S6KA 4KOYA 3PP9A 4PK3A 4CAFA 1J4JA 1MJAA 2D4PA 1KZFA 5G22A 3GYAA 4A33A 4XPLA 5KTAA 1S5KA 3WR7A 2GANA 4E0AA 4JD6A 3TO7A 4RS2A 3DNSA 4MFZA 2JDCA 4KS9A 5EBVA 1Y7RA 3DSBA 2WPWA 4U9ZA 4NEXA 4AVCA 2VZYA 4AG9A 2AE6A 2BL1A 1IICA 4I49A 4BBHA 4GS4A 1PU9A 1PUAA 2BEIA 2NMTA 4KUBA 1WWZA 1NE9A 3VWDA 5KTCA 4QC6A 5AG7A 4B11A 4PV6A 2PDOA 3G8WA 3PZJA 2IL4A 4B5OA 2QIRA 1S60A 4NXYA 3UY5A 2K5TA 4KOWA 3JVNA 2YNDA 2ARHA 4UBRA 5A27A 1IIDA 2ZPAA 4UCNA 3GY9A 2BSWA 3IU2A 4Y49C 2FT0A 2ATRA 1K4JA 4R3LA 4PK2A 1L0CA 3S6FA 2R8VA 1YR0A 4CRZB 2GE3A 4A30A 4UCMA 2HUZA 2ZW4A 4M3SA 1P4NA 4CGOA 1BO4A 3A9LA 4H6ZA 2J8NA 3TO9A 3TT2A 3VWEA 3V8IA 3CXSA 2YNEA 4F0YA 2G3AA 4A2ZA 1Q2YA 4B13A 2WSAA 5KTDA 5FVJA 5BWAB 4KSAA 3PGPA 5HMNA 5DWMA 1CJWA 1YX0A 1KUYA 4XPDB 1WK4A 3W6XA 4MJ8A 4CGMA 2B4BA 3TOAA 4E2AA 4CAXA 2CY2A 4L89A 1RO5A 3KKWA 1QSRA 1I21A 3TE4A 2ZW6A 1QSNA 4C7HA 2Z0ZA 5H84A 3I9SA 3LODA 2DPTA 4UA3A 4CYOA 5F46A 3P2HA 4MFQA 1Y9KA 5CNPA 1QSMA 4OLLA 1V0CA 3EY5A 4JLYA 5JQ4A 2B4DB 3CXPA 1Q2CA 2H5MA 4OAEA 1LRZA 3DR8A 3S6GA 4A32A 4CRYB 1S3ZA 2GIVA 5AG5A 4BMHA 1B87A 1KUVA 4UWJA 2RC4A 2X7BA 4OADA 4HNXB 4B5PB 4NCZA 3D2MA 3T90A 1M1DA 4ZGYB 4KLWA 2P6EA 2DXQA 1Y9WA 1R57A 3H4QA 4CAVA 4U9YA 2Q4YA 3FRMA 3LD2A 4UFVA 2Z10A 5IX3A 1QSOA 2P6FA 4KOXA 2VXKA 4R57A 2FS5A 5G1ZA 4CS0B 2I00A 5IV0A 4JJXA 4CAWA 3W91A 2WPXA 2CNSA 2OZHA 3FYNA 3CXQA 4NSQA 4XNHC 2HQYA 1I1DA 3IU1A 4AVBA 5GCNA 5F48A 3R96A 2R7HA 3JUWA 4U5YA 1P0HA 2J8MA 4H89A 4KOSA 2Z3LA 4KZTA 3GKRA 2PR1A 2VBQA 4KOTA 2QMLA 4KVOE 2D4OA 4CYNA 1ZO0A 4IUSA 2Z3PA 4CGNA 4F6AA 4R87A 4KLVA 2B5GB 2AJ6A 4C68A 2EVNA 5I0CA 4MFKA 2YGWA 2Z3NA 4RI1A 4MI4A 2OB0A 3R1KA 1S7FA 2C27A 2FXFA 2G3TA 3P2FA 4L8AA 5AGEA 3DR6A 1Z9UA 1B6BA 1NSLA 4II9A 2QECA 2B58A 3DDDA 4CGLA 1M4IA 4IF5A 3G3SA 2PQ8A 4NF1A 5JPHA 2I79A 2JDDA 3EXNA 4QBJA 3FXTA 3OWCA 4A95A 4EVYA 2Z3KA 4FD4A 1VHSA 2Z11A 2OH1A 1XE4A 2REFA 4KUAA 4Y49B 2B3UA 2B3VA 2WUUA 4UFXA 4C2ZA 1MJ9A 3E0KA 4FD7A 4CGPA 4R9MA 1IYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW7 A;  2FCK A;  4XPK A;  1Z4E A;  3QAH A;  3SXO A;  3EC4 A;  4HNY B;  1YVK A;  1YVO A;  2CNM A;  2PSW A;  5J8F A;  4MBU A;  1YK3 A;  2FIA A;  4ORF A;  3I3G A;  2PC1 A;  4YGO A;  3SHP A;  2B4D A;  3ZJ0 A;  3TOB A;  4AB7 A;  5ISV A;  2F5I A;  4J3G A;  1XMT A;  1GHE A;  2FSR A;  3FB3 A;  1TIQ A;  1S7K A;  1OZP A;  4UWI A;  4B5P A;  1KUX A;  2OZG A;  2REE A;  4KVM E;  4MHD A;  1Q2D A;  2P6G A;  2Q0Y A;  1MJB A;  4X5K A;  3F8K A;  1FY7 A;  1BOB A;  2OZU A;  2O28 A;  1CM0 A;  2VZZ A;  3NE7 A;  4JXR A;  3BJ7 A;  4MY0 A;  3D8P A;  1SQH A;  1IB1 E;  3D3S A;  3C26 A;  2EUI A;  3FBU A;  2R98 A;  4AVA A;  4XPD C;  5IB0 A;  2G0B A;  1XF8 A;  4LUA A;  1I12 A;  5E96 A;  5C82 A;  2OU2 A;  5DWN A;  2J8R A;  2Q7B A;  2PRB A;  1QST A;  1MK4 A;  3ZZI A;  1YGH A;  2Y0M A;  3SXN A;  3BLN A;  3K9U A;  4QVT A;  3B8G A;  2HV2 A;  3RYO A;  3F0A A;  2A4N A;  1M4D A;  1IYL A;  4HNW B;  4PSW A;  2Q44 A;  3TTH A;  5F47 A;  1NMT A;  5F49 A;  2Q4V A;  2FIW A;  4AG7 A;  2B5G A;  3F5B A;  1XEB A;  1YRE A;  1VKC A;  4YRH A;  1S7L A;  2ZW5 A;  3TFY A;  5EC4 A;  3EO4 A;  4XNH B;  3S6H A;  4QUS A;  2JEV A;  2R1I A;  1S7N A;  3IWG A;  4KVX A;  3TO6 A;  3D2P A;  4E8O A;  1XIX A;  2PR8 A;  1YLE A;  1RXT A;  3W6S A;  3BJ8 A;  2ZXV A;  1Z4R A;  2FL4 A;  4FD5 A;  4DNC A;  5C88 A;  2CNT A;  3R9G A;  4M85 A;  4FD6 A;  2P0W A;  2KCW A;  3IGR A;  1U6M A;  4JWP A;  3EFA A;  3TCV A;  4K30 A;  1M4G A;  3R9E A;  4R3K A;  3FNC A;  4PSX A;  3R95 A;  2VQY A;  4ONU A;  4JXQ A;  1UFH A;  1ON0 A;  3T9Y A;  2VEZ A;  3FIX A;  1M44 A;  4KOU A;  5H86 A;  4LX9 A;  3QB8 A;  2FE7 A;  5HH1 A;  4H6U A;  2JLM A;  4MY3 A;  5J8C A;  3N7Z A;  2Q04 A;  3R9F A;  4KOR A;  4KOV A;  2VI7 A;  2BUE A;  4QB9 A;  4YFJ A;  3MGD A;  4HKF A;  1N71 A;  4ZBG A;  3S6K A;  4KOY A;  3PP9 A;  4PK3 A;  1J4J A;  1MJA A;  2D4P A;  1KZF A;  3GYA A;  4XPL A;  5KTA A;  1S5K A;  3WR7 A;  2GAN A;  4E0A A;  4JD6 A;  3TO7 A;  4RS2 A;  3DNS A;  2JDC A;  5EBV A;  1Y7R A;  3DSB A;  2WPW A;  4U9Z A;  4NEX A;  4AVC A;  2VZY A;  4AG9 A;  2AE6 A;  2BL1 A;  1IIC A;  4I49 A;  4GS4 A;  1PU9 A;  1PUA A;  2BEI A;  2NMT A;  4KUB A;  1WWZ A;  1NE9 A;  3VWD A;  5KTC A;  4QC6 A;  4PV6 A;  2PDO A;  3G8W A;  3PZJ A;  2IL4 A;  4B5O A;  2QIR A;  1S60 A;  4NXY A;  3UY5 A;  2K5T A;  4KOW A;  3JVN A;  4UBR A;  2ARH A;  1IID A;  2ZPA A;  3GY9 A;  2BSW A;  4Y49 C;  2FT0 A;  2ATR A;  1K4J A;  4R3L A;  4PK2 A;  1L0C A;  3S6F A;  2R8V A;  1YR0 A;  4CRZ B;  2GE3 A;  2HUZ A;  2ZW4 A;  4M3S A;  1P4N A;  1BO4 A;  4H6Z A;  2J8N A;  3TO9 A;  3TT2 A;  3VWE A;  3V8I A;  3CXS A;  4F0Y A;  2G3A A;  1Q2Y A;  5KTD A;  5FVJ A;  3PGP A;  5HMN A;  5DWM A;  1CJW A;  1YX0 A;  1KUY A;  4XPD B;  1WK4 A;  3W6X A;  4MJ8 A;  2B4B A;  3TOA A;  4E2A A;  4CAX A;  2CY2 A;  4L89 A;  1RO5 A;  3KKW A;  1QSR A;  1I21 A;  3TE4 A;  2ZW6 A;  1QSN A;  2Z0Z A;  5H84 A;  3I9S A;  3LOD A;  4UA3 A;  5F46 A;  3P2H A;  1Y9K A;  5CNP A;  1QSM A;  4OLL A;  1V0C A;  3EY5 A;  4JLY A;  5JQ4 A;  2B4D B;  3CXP A;  1Q2C A;  2H5M A;  4OAE A;  1LRZ A;  3DR8 A;  3S6G A;  4CRY B;  1S3Z A;  2GIV A;  4BMH A;  1B87 A;  1KUV A;  4UWJ A;  2RC4 A;  2X7B A;  4OAD A;  4HNX B;  4B5P B;  4NCZ A;  3D2M A;  3T90 A;  1M1D A;  4KLW A;  2P6E A;  2DXQ A;  1Y9W A;  1R57 A;  3H4Q A;  4CAV A;  4U9Y A;  2Q4Y A;  3FRM A;  3LD2 A;  2Z10 A;  5IX3 A;  1QSO A;  2P6F A;  4KOX A;  2VXK A;  4R57 A;  2FS5 A;  4CS0 B;  2I00 A;  5IV0 A;  4JJX A;  4CAW A;  3W91 A;  2WPX A;  2CNS A;  2OZH A;  3FYN A;  3CXQ A;  4NSQ A;  4XNH C;  2HQY A;  1I1D A;  4AVB A;  5GCN A;  5F48 A;  3R96 A;  2R7H A;  3JUW A;  4U5Y A;  1P0H A;  2J8M A;  4H89 A;  4KOS A;  4KZT A;  3GKR A;  2PR1 A;  2VBQ A;  4KOT A;  2QML A;  4KVO E;  2D4O A;  4IUS A;  4F6A A;  4R87 A;  4KLV A;  2B5G B;  2AJ6 A;  2EVN A;  5I0C A;  4RI1 A;  4MI4 A;  2OB0 A;  3R1K A;  1S7F A;  2C27 A;  2FXF A;  2G3T A;  3P2F A;  4L8A A;  3DR6 A;  1Z9U A;  1B6B A;  1NSL A;  4II9 A;  2QEC A;  2B58 A;  3DDD A;  1M4I A;  4IF5 A;  3G3S A;  2PQ8 A;  4NF1 A;  5JPH A;  2I79 A;  2JDD A;  3EXN A;  4QBJ A;  3FXT A;  3OWC A;  4EVY A;  4FD4 A;  1VHS A;  2Z11 A;  2OH1 A;  1XE4 A;  2REF A;  4KUA A;  4Y49 B;  2B3U A;  2B3V A;  1MJ9 A;  3E0K A;  4FD7 A;  4R9M A;  1IYK A; 
#chains in the Genus database with same CATH topology
 2YNC A;  2ZW7 A;  2FCK A;  2JBJ A;  4NGS A;  4MFL A;  4F9V A;  4XPK A;  1DE4 C;  1Z4E A;  3QAH A;  3SXO A;  3EC4 A;  3GLJ A;  2QJ8 A;  1YVK A;  3DLJ A;  4HNY B;  2CF4 A;  1YVO A;  2CNM A;  2GLF A;  3WC6 A;  2PJ8 A;  2PSW A;  4YU9 A;  5J8F A;  3D7F A;  4MBU A;  5G21 A;  1YK3 A;  4CYP A;  2FIA A;  4ORF A;  3I3G A;  2PC1 A;  4PXC A;  5LYL A;  4YGO A;  3SHP A;  3I1U A;  1BLL E;  2B4D A;  1XFO A;  4C7I A;  4OC2 A;  2PIZ A;  3ZJ0 A;  3TOB A;  4AB7 A;  3PFE A;  5ISV A;  2F5I A;  4J3G A;  1XMT A;  2DPS A;  1GHE A;  1HEE A;  2FSR A;  5IB9 A;  2XEI A;  1GYT A;  3FB3 A;  3WC5 A;  1TIQ A;  4C2X A;  3B7I A;  1S7K A;  3LWU A;  1OZP A;  4UWI A;  3FF3 A;  3BHX A;  4B5P A;  1KUX A;  2OZG A;  2PJ6 A;  2REE A;  1Y0Y A;  2IQ6 A;  4NFR A;  4KVM E;  4MHD A;  4ONW A;  3S9N A;  1Q2D A;  4O23 A;  2P6G A;  2Q0Y A;  1MJB A;  3IEH A;  2HB6 A;  4X5K A;  3F8K A;  1FY7 A;  1TKJ A;  1BOB A;  2OZU A;  2C1C A;  3FEE A;  2PJC A;  2EBJ A;  2O28 A;  1IY7 A;  1CM0 A;  2VZZ A;  4EWT A;  2PJ5 A;  3JTK A;  4RUH A;  4X2T A;  3IWE A;  3IJ3 A;  3NE7 A;  1A2Z A;  3LAC A;  2EO8 A;  3BJ7 A;  4JXR A;  4MY0 A;  2QYV A;  1VIX A;  1XJO A;  1BAV A;  3D8P A;  3SI2 A;  4CAE A;  4FAI A;  1F57 A;  1LCP A;  5HXD A;  2WYR A;  1SQH A;  1IB1 E;  4ZY0 A;  5K8P A;  3D3S A;  3C26 A;  2EUI A;  3D68 A;  3FBU A;  3KGQ A;  1IOI A;  2XEJ A;  3KR4 A;  2R98 A;  1LOK A;  4AVA A;  4NGR A;  4XPD C;  5IB0 A;  2G0B A;  1XF8 A;  4R7M A;  3CZX A;  5AG4 A;  3N5F A;  1NSA A;  1CPS A;  1LFW A;  4LUA A;  1I12 A;  5E96 A;  5C82 A;  4CYQ A;  3BI0 A;  2OU2 A;  5DWN A;  2J8R A;  2Q7B A;  2PRB A;  1QST A;  1VHO A;  3FEC A;  1DTD A;  1MK4 A;  3ZZI A;  2PVV A;  1YGH A;  2Y0M A;  3D4U A;  4NGP A;  3SXN A;  1IGB A;  3NA6 A;  3BLN A;  3K9U A;  3KI9 A;  2YNC C;  1CP7 A;  3FH4 A;  4QVT A;  4FBE A;  3B8G A;  2HV2 A;  3RYO A;  1VHE A;  3F0A A;  2A4N A;  4WJB A;  1M4D A;  1IYL A;  4HNW B;  4HPS A;  4R8F A;  4WWV A;  4PSW A;  1ZG7 A;  2Q44 A;  4Q38 A;  1X10 A;  4OC3 A;  3SJE A;  4PXE A;  3TTH A;  5F47 A;  4M6H A;  2PE3 A;  5LRG A;  5LYD A;  2CXA A;  3V38 A;  1TKF A;  1NMT A;  1UWY A;  5F49 A;  2Q4V A;  2FIW A;  4MFP A;  2B5G A;  3F5B A;  4AG7 A;  5I4M A;  2EWB A;  1XEB A;  2CTC A;  1YRE A;  1CPX A;  4FUU A;  5LRJ A;  1VKC A;  4YRH A;  1S7L A;  2ZW5 A;  3TFY A;  2C6G A;  3EO4 A;  4XNH B;  5EC4 A;  3S6H A;  3V7Z A;  5CBM A;  3NH8 A;  3FJU A;  4QUS A;  4DUK A;  3GB0 A;  5EMI A;  2JEV A;  2R1I A;  4UEF A;  4LQ6 A;  5G20 A;  3TC8 A;  1S7N A;  2ZEE A;  3IWG A;  4KVX A;  1FT7 A;  5JGF A;  3S9L A;  1XBU A;  3TO6 A;  3D2P A;  1TKH A;  4E8O A;  1XIX A;  3D7G A;  3D66 A;  2PR8 A;  4OIW A;  1YLE A;  1RXT A;  3W6S A;  3BJ8 A;  2ZXV A;  1Z4R A;  2FL4 A;  2Q7S A;  3LMS A;  1IU8 A;  4FD5 A;  4MFJ A;  4MXU A;  4DNC A;  5C88 A;  4JZ0 A;  4A31 A;  2NYQ A;  4B10 A;  2CNT A;  3R9G A;  2Z3O A;  4M85 A;  2PJ7 A;  4F0X A;  4FD6 A;  1AUG A;  2P0W A;  2KCW A;  2ZEL A;  1U6M A;  3IGR A;  1JWQ A;  3EFA A;  4JWP A;  2Q51 A;  1CP6 A;  4P4D A;  3TCV A;  4K30 A;  5A28 A;  2HC9 A;  1M4G A;  3R9E A;  3RO0 A;  4R3K A;  3H8F A;  3FNC A;  4PSX A;  4MHY A;  3KQX A;  3R95 A;  3CPA A;  2VQY A;  4ONU A;  4JXQ A;  4UFW A;  4MHN A;  1UFH A;  1ON0 A;  2PJ4 A;  3T9Y A;  2VEZ A;  3D7H A;  3FIX A;  3RBU A;  4B12 A;  2V77 A;  4ZI6 A;  4KSF A;  1M44 A;  4KOU A;  5H86 A;  4LX9 A;  4NGN A;  4ZX8 A;  4C2Y A;  3QB8 A;  2CIJ A;  2EK9 A;  4ZYQ A;  2OR4 A;  4B14 A;  2EK8 A;  2FE7 A;  5HH1 A;  3KAS A;  4H6U A;  2JLM A;  4MY3 A;  4OC5 A;  4UCP A;  3N7Z A;  3VAR A;  2Q04 A;  3R9F A;  5J8C A;  3KR5 A;  5JM6 A;  4G1P A;  4KOR A;  4KOV A;  4M6I A;  2IMO A;  3HLP A;  4ZY2 A;  3WAB A;  2VI7 A;  4Q36 A;  2BUE A;  3MN8 A;  4R6T A;  3H5Z A;  2JBK A;  4QB9 A;  2Z3M A;  2F7V A;  4EME A;  4YFJ A;  3FMC A;  4BD9 A;  2CTB A;  3MGD A;  4KSI A;  2PJ0 A;  4HKF A;  1N71 A;  4MCS A;  2VL1 A;  4RN7 A;  2BO9 A;  4ZBG A;  2ZED A;  5AG6 A;  1XMB A;  5LYF A;  1F2O A;  3PB6 X;  3S6K A;  4KOY A;  4X8I A;  3PP9 A;  4PK3 A;  2O53 A;  4CAF A;  1J4J A;  1F2P A;  2D4P A;  1KZF A;  1MJA A;  1YLO A;  5G22 A;  4AXV A;  3GYA A;  4A33 A;  3FX6 A;  2GFQ A;  4M6G A;  4IHM A;  4OKO A;  4XPL A;  1HDU A;  1Y7E A;  4TWE A;  4PXB A;  2O4H A;  4P44 A;  5KTA A;  1S5K A;  2V8D A;  4OC4 A;  3WR7 A;  2ANP A;  2GAN A;  2PJA A;  3CPX A;  4JD6 A;  3TO7 A;  4E0A A;  4RS2 A;  5K8M A;  3DNS A;  2AFX A;  4MFZ A;  8CPA A;  2JDC A;  4MRI A;  3PFO A;  2ZEF A;  4KS9 A;  5EBV A;  1Y7R A;  4F9U A;  2PCU A;  3DSB A;  2WPW A;  4U9Z A;  4NEX A;  3D67 A;  3K9T A;  2VZY A;  4AVC A;  4AG9 A;  3BI1 A;  2AE6 A;  1ARL A;  2AFM A;  1IIC A;  2BL1 A;  4I49 A;  4BBH A;  3NE8 A;  4GS4 A;  1PU9 A;  2NMT A;  1PUA A;  2BEI A;  4KUB A;  4CPA A;  3GUX A;  5D8N A;  1WWZ A;  1NE9 A;  4NJR A;  3VWD A;  5KTC A;  4NGT A;  4QC6 A;  5AG7 A;  4B11 A;  4PV6 A;  5LRK A;  1XRY A;  4UEE A;  2PDO A;  3G8W A;  4P6Y A;  3PZJ A;  2IL4 A;  4B5O A;  1Z5R A;  1S60 A;  2QIR A;  3IO1 A;  3NFZ A;  4NXY A;  2GU2 A;  3DGV A;  3PBB A;  3UY5 A;  3T8W A;  4PQA A;  3MRU A;  2K5T A;  3PBE A;  4KOW A;  4YWY A;  3SJX A;  3JVN A;  2YND A;  2ARH A;  4UBR A;  5A27 A;  1IID A;  2ZPA A;  2DEA A;  4UCN A;  1LAP A;  3GY9 A;  2BSW A;  1PYT B;  2F8H A;  3IU2 A;  4Y49 C;  2FT0 A;  2ATR A;  1AMP A;  3IFE A;  4NGM A;  1K4J A;  4R3L A;  4PK2 A;  1XOV A;  1L0C A;  3S6F A;  4NGQ A;  2R8V A;  1YR0 A;  2PVW A;  1FNO A;  4CRZ B;  2GE3 A;  4A30 A;  4UCM A;  3IIB A;  3FED A;  2HUZ A;  1ZLI A;  4R76 A;  2ZW4 A;  4M3S A;  1ARM A;  1P4N A;  3KHX A;  4P4F A;  3PB9 X;  3KQZ A;  4CGO A;  1BO4 A;  3A9L A;  4H2K A;  4H6Z A;  3QNV A;  2J8N A;  3TO9 A;  3TT2 A;  4OME A;  3V8I A;  3VWE A;  2ODF A;  3QAY A;  3CXS A;  2YNE A;  4F0Y A;  3VAT A;  2G3A A;  4A2Z A;  5K8N A;  1Q2Y A;  4B13 A;  2V8V A;  2WSA A;  5HVG A;  5KTD A;  3CT9 A;  4R9M A;  5FVJ A;  1QQ9 A;  3B3V A;  3SI0 A;  1LAN A;  4PXD A;  5BWA B;  3VH9 A;  4KSA A;  1Z8W A;  3SJF A;  4B6Z A;  3PGP A;  3SJG A;  5DWM A;  5HMN A;  4BIN A;  1CJW A;  1YX0 A;  1KUY A;  4XPD B;  1WK4 A;  3TX8 A;  3W6X A;  4MJ8 A;  4CGM A;  2B4B A;  2C6C A;  3TOA A;  1H8L A;  1QMU A;  3RZA A;  4E2A A;  4CAX A;  2CY2 A;  4L89 A;  1RO5 A;  3KKW A;  1QSR A;  1I21 A;  2QVP A;  2XEG A;  2V8G A;  3TE4 A;  2ZW6 A;  1QSN A;  4C7H A;  2Z0Z A;  3HUV A;  3B35 A;  3JRU A;  4P4J A;  5H84 A;  1YME A;  3I9S A;  3B3T A;  3LOD A;  2DPT A;  4UA3 A;  1TXR A;  4CYO A;  5F46 A;  5D29 A;  3B3C A;  3KL9 A;  4PPZ A;  1TF8 A;  4MHP A;  1M4L A;  3P2H A;  4A94 A;  1Z8X A;  2GRE A;  4MFQ A;  1Y9K A;  1IOF A;  4P4I A;  4LQG A;  5CNP A;  3PB7 X;  1PCA A;  4IK2 A;  1QSM A;  4OLL A;  1V0C A;  3EY5 A;  4JLY A;  5JQ4 A;  4MHZ A;  2B4D B;  3CXP A;  1Q2C A;  4Z65 A;  4UIA A;  2H5M A;  2PJB A;  4OAE A;  4NJQ A;  1LRZ A;  3DR8 A;  6CPA A;  1YSJ A;  3S6G A;  1R3N A;  4A32 A;  4CRY B;  1S3Z A;  2GIV A;  5AG5 A;  4BMH A;  1YQE A;  1B87 A;  2ABZ A;  1KUV A;  4UWJ A;  3NH4 A;  2OOT A;  3SI1 A;  2RC4 A;  2X7B A;  4OAD A;  4HNX B;  4UF4 A;  4B5P B;  4NCZ A;  2IJZ A;  2ZOG A;  3D2M A;  1ELL P;  1R43 A;  3T90 A;  1M1D A;  5LYI A;  3BXM A;  2AFO A;  4P4E A;  2JEW A;  2XEF A;  4ZGY B;  3K2K A;  1ZLH A;  4KLW A;  2P6E A;  2DXQ A;  1CBX A;  1Y9W A;  1R57 A;  3H4Q A;  4CAV A;  4U9Y A;  2Q4Y A;  3FRM A;  4A39 A;  3LD2 A;  3GIU A;  4UFV A;  2Z10 A;  5HVH A;  1Y0R A;  2PRQ A;  1LAM A;  4A37 A;  1QSO A;  2P6F A;  5IX3 A;  4KOX A;  1EE3 P;  2VXK A;  3KHZ A;  4R57 A;  3PEI A;  3B2Y A;  2FS5 A;  5J1Q A;  1ELM P;  3ISX A;  5G1Z A;  4CS0 B;  2C6P A;  2I00 A;  3B3S A;  5IV0 A;  4JJX A;  4CAW A;  3W91 A;  1HDQ A;  2WPX A;  2CNS A;  2OZH A;  2AFZ A;  3FYN A;  4P10 A;  4DYO A;  3CXQ A;  4NSQ A;  4XNH C;  4A38 A;  2AFS A;  2HQY A;  1I1D A;  4FWU A;  3IU1 A;  3S9M A;  4AVB A;  5F09 A;  2BCO A;  2ZEN A;  4IAV A;  5GCN A;  5F48 A;  4OP4 A;  2AFW A;  3R96 A;  2R7H A;  3JUW A;  3IC1 A;  4Q7A A;  4U5Y A;  4JYW A;  2Q4Z A;  1ZG8 A;  1P0H A;  1CG2 A;  2I3C A;  2J8M A;  4H89 A;  4KOS A;  2PJ2 A;  3H8E A;  2Z3L A;  1VGY A;  1Z8T A;  1BPM A;  3PRT A;  4KZT A;  4DJL A;  3GKR A;  2BOA A;  2PR1 A;  3WC7 A;  2VBQ A;  4KOT A;  2QML A;  4KVO E;  4K3N A;  3NH5 A;  4X3R A;  2D4O A;  4OC1 A;  1Z8L A;  4CYN A;  2RB7 A;  1ZO0 A;  2NSM A;  2POK A;  3IWW A;  4IUS A;  3PB4 X;  4MCP A;  3FVL A;  2Z3P A;  4UIB A;  4CGN A;  1ZG9 A;  4MCQ A;  4F6A A;  2V8H A;  4R87 A;  2AFU A;  4KLV A;  4ZX9 A;  5ELY A;  2PJ3 A;  2Q43 A;  2B5G B;  2AJ6 A;  4OC0 A;  2PJ1 A;  4C68 A;  1CX8 A;  2RFH A;  3CDX A;  2EVN A;  4OID A;  1JQG A;  5I0C A;  3D7D A;  1TF9 A;  2J9A A;  2YGW A;  2Z3N A;  4MFK A;  4MI4 A;  2GLJ A;  2OB0 A;  3R1K A;  4RI1 A;  1S7F A;  4TNU A;  3L2N A;  2C27 A;  4GM5 A;  2FXF A;  4W9Y A;  3WT4 A;  4EFD A;  1AYE A;  2ZEP A;  2ZEO A;  2G3T A;  1X12 A;  3P2F A;  4L8A A;  5AGE A;  5JH9 A;  5DS0 A;  5HVF A;  3DR6 A;  1Z9U A;  1BPN A;  1B6B A;  1NSL A;  4II9 A;  4P45 A;  2QEC A;  2B58 A;  3ISZ A;  3DDD A;  5THW A;  2PIY A;  2ZEM A;  4CGL A;  7CPA A;  1M4I A;  1YW6 A;  3H8G A;  4MMO A;  4IF5 A;  1Z2L A;  2PQ8 A;  3G3S A;  4F8Z A;  4GXH A;  3B3W A;  4MCR A;  4NF1 A;  2G9D A;  5CPA A;  5JPH A;  2I79 A;  4P4B A;  2JDD A;  3EXN A;  4QBJ A;  2FVG A;  2ZEH A;  3FXT A;  3OWC A;  3RNZ A;  4A95 A;  4EVY A;  2Z3K A;  1YW4 A;  2ZOF A;  2WZN A;  4FD4 A;  3RAM A;  1VHS A;  2Z11 A;  5K8O A;  3PB8 X;  2OH1 A;  4UEZ A;  1Q7L A;  1XE4 A;  2REF A;  4KUA A;  2ZEG A;  4Y49 B;  2DF5 A;  1OBR A;  2B3U A;  2B3V A;  2WUU A;  2PJ9 A;  4UFX A;  4C2Z A;  4ZY1 A;  1MJ9 A;  3E0K A;  3KZW A;  4FD7 A;  4CGP A;  1KWM A;  1RTQ A;  1IYK A; 
#chains in the Genus database with same CATH homology
 2YNC A;  2ZW7 A;  2FCK A;  4MFL A;  4XPK A;  1Z4E A;  3QAH A;  3SXO A;  3EC4 A;  4HNY B;  1YVK A;  1YVO A;  2CNM A;  2PSW A;  5J8F A;  4MBU A;  5G21 A;  1YK3 A;  4CYP A;  2FIA A;  4ORF A;  3I3G A;  2PC1 A;  4YGO A;  3SHP A;  2B4D A;  4C7I A;  3ZJ0 A;  3TOB A;  4AB7 A;  5ISV A;  2F5I A;  4J3G A;  1XMT A;  2DPS A;  1GHE A;  2FSR A;  3FB3 A;  1TIQ A;  4C2X A;  1S7K A;  1OZP A;  4UWI A;  4B5P A;  1KUX A;  2OZG A;  2REE A;  4KVM E;  4MHD A;  1Q2D A;  2P6G A;  2Q0Y A;  1MJB A;  4X5K A;  3F8K A;  1FY7 A;  1BOB A;  2OZU A;  2O28 A;  1CM0 A;  2VZZ A;  3JTK A;  3IWE A;  3NE7 A;  4JXR A;  3BJ7 A;  4MY0 A;  3D8P A;  4CAE A;  1SQH A;  1IB1 E;  3D3S A;  3C26 A;  2EUI A;  3FBU A;  2R98 A;  4AVA A;  4XPD C;  5IB0 A;  2G0B A;  1XF8 A;  5AG4 A;  4LUA A;  1I12 A;  5E96 A;  5C82 A;  4CYQ A;  2OU2 A;  5DWN A;  2J8R A;  2Q7B A;  2PRB A;  1QST A;  1MK4 A;  3ZZI A;  1YGH A;  2Y0M A;  3SXN A;  3BLN A;  3K9U A;  2YNC C;  4QVT A;  3B8G A;  2HV2 A;  3RYO A;  3F0A A;  2A4N A;  1M4D A;  1IYL A;  4HNW B;  4PSW A;  2Q44 A;  4Q38 A;  3TTH A;  5F47 A;  2CXA A;  1NMT A;  5F49 A;  2Q4V A;  2FIW A;  4MFP A;  2B5G A;  3F5B A;  4AG7 A;  1XEB A;  1YRE A;  1VKC A;  4YRH A;  1S7L A;  2ZW5 A;  3TFY A;  5EC4 A;  3EO4 A;  4XNH B;  3S6H A;  4QUS A;  5G20 A;  2JEV A;  2R1I A;  1S7N A;  3IWG A;  4KVX A;  3TO6 A;  3D2P A;  4E8O A;  1XIX A;  2PR8 A;  1YLE A;  1RXT A;  3W6S A;  3BJ8 A;  2ZXV A;  1Z4R A;  2FL4 A;  4FD5 A;  4DNC A;  4MFJ A;  5C88 A;  4A31 A;  4B10 A;  2CNT A;  3R9G A;  2Z3O A;  4M85 A;  4F0X A;  4FD6 A;  2P0W A;  2KCW A;  3IGR A;  1U6M A;  4JWP A;  3EFA A;  5A28 A;  3TCV A;  4K30 A;  1M4G A;  3R9E A;  4R3K A;  3FNC A;  4PSX A;  3R95 A;  2VQY A;  4ONU A;  4JXQ A;  4UFW A;  1UFH A;  1ON0 A;  3T9Y A;  2VEZ A;  3FIX A;  4B12 A;  4KSF A;  1M44 A;  4KOU A;  5H86 A;  4LX9 A;  4C2Y A;  3QB8 A;  4B14 A;  2FE7 A;  5HH1 A;  4H6U A;  2JLM A;  4MY3 A;  4UCP A;  5J8C A;  3N7Z A;  2Q04 A;  3R9F A;  4KOR A;  4KOV A;  2VI7 A;  4Q36 A;  2BUE A;  3H5Z A;  4QB9 A;  2Z3M A;  4YFJ A;  3MGD A;  4HKF A;  1N71 A;  4ZBG A;  5AG6 A;  3S6K A;  4KOY A;  3PP9 A;  4PK3 A;  4CAF A;  1J4J A;  1MJA A;  2D4P A;  1KZF A;  5G22 A;  3GYA A;  4A33 A;  4XPL A;  5KTA A;  1S5K A;  3WR7 A;  2GAN A;  4E0A A;  4JD6 A;  3TO7 A;  4RS2 A;  3DNS A;  4MFZ A;  2JDC A;  4KS9 A;  5EBV A;  1Y7R A;  3DSB A;  2WPW A;  4U9Z A;  4NEX A;  4AVC A;  2VZY A;  4AG9 A;  2AE6 A;  2BL1 A;  1IIC A;  4I49 A;  4BBH A;  4GS4 A;  1PU9 A;  1PUA A;  2BEI A;  2NMT A;  4KUB A;  1WWZ A;  1NE9 A;  3VWD A;  5KTC A;  4QC6 A;  5AG7 A;  4B11 A;  4PV6 A;  2PDO A;  3G8W A;  3PZJ A;  2IL4 A;  4B5O A;  2QIR A;  1S60 A;  4NXY A;  3UY5 A;  2K5T A;  4KOW A;  3JVN A;  2YND A;  2ARH A;  4UBR A;  5A27 A;  1IID A;  2ZPA A;  4UCN A;  3GY9 A;  2BSW A;  3IU2 A;  4Y49 C;  2FT0 A;  2ATR A;  1K4J A;  4R3L A;  4PK2 A;  1L0C A;  3S6F A;  2R8V A;  1YR0 A;  4CRZ B;  2GE3 A;  4A30 A;  4UCM A;  2HUZ A;  2ZW4 A;  4M3S A;  1P4N A;  4CGO A;  1BO4 A;  3A9L A;  4H6Z A;  2J8N A;  3TO9 A;  3TT2 A;  3VWE A;  3V8I A;  3CXS A;  2YNE A;  4F0Y A;  2G3A A;  4A2Z A;  1Q2Y A;  4B13 A;  2WSA A;  5KTD A;  5FVJ A;  5BWA B;  4KSA A;  3PGP A;  5HMN A;  5DWM A;  1CJW A;  1YX0 A;  1KUY A;  4XPD B;  1WK4 A;  3W6X A;  4MJ8 A;  4CGM A;  2B4B A;  3TOA A;  4E2A A;  4CAX A;  2CY2 A;  4L89 A;  1RO5 A;  3KKW A;  1QSR A;  1I21 A;  3TE4 A;  2ZW6 A;  1QSN A;  4C7H A;  2Z0Z A;  5H84 A;  3I9S A;  3LOD A;  2DPT A;  4UA3 A;  4CYO A;  5F46 A;  3P2H A;  4MFQ A;  1Y9K A;  5CNP A;  1QSM A;  4OLL A;  1V0C A;  3EY5 A;  4JLY A;  5JQ4 A;  2B4D B;  3CXP A;  1Q2C A;  2H5M A;  4OAE A;  1LRZ A;  3DR8 A;  3S6G A;  4A32 A;  4CRY B;  1S3Z A;  2GIV A;  5AG5 A;  4BMH A;  1B87 A;  1KUV A;  4UWJ A;  2RC4 A;  2X7B A;  4OAD A;  4HNX B;  4B5P B;  4NCZ A;  3D2M A;  3T90 A;  1M1D A;  4ZGY B;  4KLW A;  2P6E A;  2DXQ A;  1Y9W A;  1R57 A;  3H4Q A;  4CAV A;  4U9Y A;  2Q4Y A;  3FRM A;  3LD2 A;  4UFV A;  2Z10 A;  5IX3 A;  1QSO A;  2P6F A;  4KOX A;  2VXK A;  4R57 A;  2FS5 A;  5G1Z A;  4CS0 B;  2I00 A;  5IV0 A;  4JJX A;  4CAW A;  3W91 A;  2WPX A;  2CNS A;  2OZH A;  3FYN A;  3CXQ A;  4NSQ A;  4XNH C;  2HQY A;  1I1D A;  3IU1 A;  4AVB A;  5GCN A;  5F48 A;  3R96 A;  2R7H A;  3JUW A;  4U5Y A;  1P0H A;  2J8M A;  4H89 A;  4KOS A;  2Z3L A;  4KZT A;  3GKR A;  2PR1 A;  2VBQ A;  4KOT A;  2QML A;  4KVO E;  2D4O A;  4CYN A;  1ZO0 A;  4IUS A;  2Z3P A;  4CGN A;  4F6A A;  4R87 A;  4KLV A;  2B5G B;  2AJ6 A;  4C68 A;  2EVN A;  5I0C A;  4MFK A;  2YGW A;  2Z3N A;  4RI1 A;  4MI4 A;  2OB0 A;  3R1K A;  1S7F A;  2C27 A;  2FXF A;  2G3T A;  3P2F A;  4L8A A;  5AGE A;  3DR6 A;  1Z9U A;  1B6B A;  1NSL A;  4II9 A;  2QEC A;  2B58 A;  3DDD A;  4CGL A;  1M4I A;  4IF5 A;  3G3S A;  2PQ8 A;  4NF1 A;  5JPH A;  2I79 A;  2JDD A;  3EXN A;  4QBJ A;  3FXT A;  3OWC A;  4A95 A;  4EVY A;  2Z3K A;  4FD4 A;  1VHS A;  2Z11 A;  2OH1 A;  1XE4 A;  2REF A;  4KUA A;  4Y49 B;  2B3U A;  2B3V A;  2WUU A;  4UFX A;  4C2Z A;  1MJ9 A;  3E0K A;  4FD7 A;  4CGP A;  4R9M A;  1IYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...