4E2AA

Crystal structure of the putative acetyltransferase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
QVEIRKVNQDELSLLQKIAIQTFRETFAFDNTAEQLQNFFDEAYTLSVLKLELDDKESETYFILMSGKAAGFLKVNWGSSQTEQVLEDAFEIQRLYILKAYQGLGLGKQLFEFALERAQISGLSWVWLGVWEKNVKAQLLYAKYGFEQFSKHSFFVGNKVDTDWLLKKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title Crystal Structure of the Putative acetyltransferase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 54
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e2aA00
2H5MA 1B87A 2C27A 4CAWA 4XNHB 2EVNA 4KZTA 1Z9UA 5EC4A 4KUAA 1B6BA 2P0WA 4CRYB 2Q04A 1SQHA 2GE3A 2P6GA 4MBUA 3FBUA 2FT0A 2R1IA 4H89A 4LX9A 2VXKA 1XIXA 3CXPA 2VZZA 4FD6A 4KOUA 2FE7A 3FB3A 5F46A 2WPWA 3I9SA 2P6FA 4OADA 3P2HA 1PUAA 2ZW6A 3JUWA 2OB0A 1NSLA 3DNSA 4EVYA 2Z10A 4R3KA 1P0HA 1Q2YA 2PR1A 3OWCA 2VI7A 1ON0A 2G3AA 5FVJA 2FSRA 2NMTA 4LUAA 4PSWA 4UA3A 4U5YA 4RS2A 4MHDA 4ZBGA 1KZFA 2X7BA 2FS5A 4L8AA 2REEA 3TFYA 2R7HA 2PC1A 4B5PA 1S60A 3F0AA 3BLNA 3B8GA 3S6HA 2Q44A 1BO4A 3P2FA 2HUZA 1MJ9A 4JLYA 1TIQA 2B3VA 4NSQA 3I3GA 4JJXA 4RI1A 3EY5A 4U9YA 4QUSA 1WWZA 3EFAA 2B3UA 2B4DB 4R57A 2Q7BA 2VBQA 1I12A 2R98A 3JVNA 4YFJA 3WR7A 1Q2DA 1J4JA 2CNMA 3GY9A 4R9MA 3MGDA 2PRBA 1V0CA 1VKCA 3FYNA 3TOAA 4NF1A 4PK3A 4X5KA 2ATRA 1M4GA 4CAXA 1M4IA 3W91A 4KVOE 4J3GA 1GHEA 2VZYA 2PSWA 3R9EA 2FL4A 4UBRA 3ZJ0A 3DR8A 4GS4A 4B5OA 2I79A 1M44A 4XPDB 3R9FA 4MY3A 1S7NA 1I21A 1U6MA 2OU2A 2FCKA 3DSBA 5J8FA 3R9GA 2Q0YA 3CXQA 4FD7A 2ZXVA 2AE6A 3UY5A 1WK4A 1M4DA 1KUYA 3PP9A 5KTDA 4ONUA 3VWEA 4E2AA 5JQ4A 1MK4A 1OZPA 1RO5A 5C82A 3ZZIA 4BMHA 4E0AA 1Y9WA 4AVAA 5IX3A 5H84A 4JD6A 1VHSA 3TO9A 4ORFA 4I49A 3RYOA 1I1DA 5IV0A 1YGHA 4KOVA 5JPHA 4R3LA 2BSWA 4HNWB 5DWNA 3GKRA 3TTHA 2B5GB 5F49A 4JWPA 4Y49C 3BJ8A 3R95A 4F6AA 2ZW7A 1S5KA 4E8OA 4MJ8A 3PGPA 3V8IA 3KKWA 3S6GA 3TO6A 2WPXA 5GCNA 3EXNA 3TOBA 5E96A 3LD2A 4XPLA 5I0CA 2OZGA 4AVCA 2VQYA 1QSNA 4KOYA 3D2PA 1MJBA 3GYAA 4KVXA 1IB1E 4M85A 3G3SA 4UWJA 2F5IA 2G0BA 4QB9A 4CAVA 3TO7A 3SXOA 4KLVA 2K5TA 1QSTA 5KTCA 1IICA 5ISVA 4CRZB 4HNYB 3D2MA 4CS0B 5J8CA 3FNCA 1Z4RA 3W6SA 4H6ZA 4KOWA 3IGRA 2O28A 5EBVA 1S7LA 1BOBA 2OH1A 3BJ7A 1Q2CA 4PV6A 1NE9A 4M3SA 4MY0A 2Y0MA 4DNCA 3G8WA 1XF8A 2JEVA 3FRMA 5HH1A 1PU9A 3F8KA 4OLLA 3TE4A 2KCWA 5HMNA 4PSXA 3EC4A 1L0CA 3TCVA 4KORA 1CJWA 2B4DA 2OZUA 4KOXA 2B4BA 1M1DA 2JDDA 1QSOA 4KOSA 3SHPA 4KVME 3K9UA 4UWIA 4F0YA 2FXFA 3QB8A 5CNPA 4NCZA 1IYLA 2G3TA 4AG9A 3CXSA 1R57A 2OZHA 2CNSA 4H6UA 3T9YA 1UFHA 1Y7RA 2PQ8A 1QSMA 1YVKA 2Z11A 1CM0A 2QECA 2QMLA 1S7FA 5IB0A 1S7KA 3E0KA 3DR6A 2P6EA 3NE7A 2D4OA 3F5BA 2HQYA 1KUVA 2JDCA 2JLMA 4HNXB 4B5PB 2FIWA 2HV2A 4KOTA 3TT2A 4MI4A 3N7ZA 4YGOA 4R87A 1YX0A 2ZPAA 1KUXA 2J8RA 3R1KA 4OAEA 2DXQA 3T90A 2D4PA 1N71A 5DWMA 1XE4A 2VEZA 3C26A 4NXYA 2BEIA 2ZW4A 2ARHA 5KTAA 1YVOA 5F48A 3FIXA 4XPDC 1Y9KA 4KUBA 4XNHC 2QIRA 3D8PA 2J8MA 3VWDA 4JXQA 4L89A 1NMTA 2CNTA 4PK2A 3LODA 2J8NA 4HKFA 3W6XA 1LRZA 3S6KA 4YRHA 1Z4EA 2PR8A 1YREA 3QAHA 2RC4A 4IF5A 1IYKA 3D3SA 4AB7A 2FIAA 1XMTA 3IWGA 2EUIA 2B5GA 2R8VA 3SXNA 1YLEA 2GIVA 4AG7A 2AJ6A 2BL1A 4IUSA 4XPKA 4KLWA 2GANA 4K30A 1IIDA 1YR0A 2A4NA 2Z0ZA 4QBJA 3H4QA 2IL4A 1XEBA 5C88A 3PZJA 3EO4A 4II9A 3R96A 2REFA 1RXTA 2PDOA 1K4JA 2CY2A 4AVBA 4FD4A 1P4NA 1QSRA 2B58A 4QVTA 4NEXA 2BUEA 1YK3A 4FD5A 3FXTA 4U9ZA 1FY7A 1MJAA 2I00A 4JXRA 4Y49B 2ZW5A 2Q4VA 3DDDA 5H86A 4QC6A 3S6FA 5F47A 1S3ZA 2Q4YA
chains in the Genus database with same CATH superfamily
2H5MA 2HB6A 4PXDA 1B87A 2C27A 1HDUA 3S9MA 4CAWA 5A28A 4XNHB 2EVNA 5CBMA 4KZTA 1Z9UA 4UEEA 5EC4A 2JBJA 4BD9A 2J9AA 4KUAA 2HC9A 1B6BA 2P0WA 3GIUA 4CRYB 2Q04A 4UIBA 1SQHA 2GE3A 2P6GA 4MBUA 3FBUA 4FBEA 2FT0A 1F2PA 2R1IA 4H89A 4P4EA 2PJ9A 3WABA 2Z3KA 4R76A 4B6ZA 2PJ1A 4A37A 2C6CA 3CXPA 2VXKA 1XIXA 3A9LA 2VZZA 4FD6A 4KOUA 4LX9A 2YNEA 4NGPA 3RZAA 4UCMA 2FE7A 3H8EA 2PJ5A 3SI1A 3FB3A 4PXBA 5F46A 4CYPA 1XOVA 3SI2A 2WPWA 1XBUA 3I9SA 2ZEFA 3B3WA 5JM6A 2P6FA 4OADA 3P2HA 1PUAA 5K8NA 2ZW6A 3JUWA 1S3ZA 1ZLIA 2OB0A 1NSLA 3GB0A 3DNSA 5AG6A 4EVYA 2PJ0A 1ZG8A 3B3TA 2Z10A 4R3KA 1P0HA 2OR4A 1Q2YA 2PR1A 4C2ZA 4YWYA 3TC8A 3OWCA 2FVGA 2VI7A 1BLLE 4MCSA 4OC3A 4KSAA 1ON0A 3NFZA 2G3AA 1R43A 3FVLA 2GLFA 3IU2A 2EWBA 5FVJA 1QMUA 4NGTA 3FH4A 2FSRA 2NMTA 3NA6A 4LUAA 4PSWA 3SI0A 3PEIA 4UA3A 4OP4A 4ZY0A 2NSMA 2CXAA 4U5YA 4OC4A 4RS2A 3CZXA 4MHDA 2ABZA 2VL1A 4ZBGA 1KZFA 2X7BA 4C7HA 2WSAA 4A33A 2FS5A 4IK2A 4OMEA 3PBBA 3IJ3A 4A30A 1XFOA 4L8AA 4P4BA 1VHOA 2REEA 4MHPA 2F8HA 3TFYA 2XEJA 2EBJA 1YW6A 1YLOA 2R7HA 3D7GA 1M4LA 2PC1A 4CYNA 4B5PA 1S60A 3F0AA 1CX8A 3BLNA 3B8GA 3S6HA 2CIJA 1BO4A 2Q44A 3P2FA 2HUZA 5LRGA 1MJ9A 4JLYA 2Z3NA 1TIQA 2B3VA 4NSQA 2EK9A 3D7HA 3I3GA 3H5ZA 3K9TA 4JJXA 4LQGA 3KR5A 4OC2A 4RI1A 3EY5A 2RFHA 3KHXA 1XRYA 4QUSA 4U9YA 4TWEA 1WWZA 3EFAA 2ZOGA 2B3UA 2B4DB 2XEFA 1F57A 4GXHA 2O4HA 4MFJA 2ZENA 4BBHA 5THWA 3B7IA 4R57A 2Q7BA 2VBQA 3NH8A 4NJQA 1I12A 3GLJA 4C2XA 4NGNA 5LRKA 2GLJA 2R98A 4WWVA 3JVNA 4Z65A 4A2ZA 5J1QA 4YFJA 3D4UA 3WR7A 5AG4A 2O53A 1Q2DA 1IU8A 4UEFA 2WYRA 1J4JA 2CNMA 3GY9A 3MN8A 4P44A 4R9MA 3MGDA 4MRIA 2PRBA 2BO9A 3I1UA 3KHZA 5G20A 4H2KA 4MCPA 1V0CA 1IOFA 1VKCA 3FJUA 2PIYA 3FYNA 4OC1A 3TOAA 4MHYA 4DYOA 4NF1A 1UWYA 4P10A 4OIDA 4PK3A 4AXVA 4MHZA 5G21A 5EMIA 1ELLP 4X5KA 2ATRA 4DUKA 1M4GA 3IWEA 4KSFA 4X2TA 2JBKA 4CAXA 1M4IA 2Z3OA 3WC5A 3W91A 4KVOE 4J3GA 1GHEA 2V8DA 3IU1A 4RN7A 1CP7A 2VZYA 1Z8TA 2PSWA 3R9EA 3WT4A 1RTQA 3LMSA 2FL4A 4UBRA 3H8GA 1DTDA 3DR8A 4GS4A 3ZJ0A 5IB9A 5F09A 1YW4A 1X10A 1LFWA 5LYDA 4UCPA 2AFOA 4B5OA 4CAEA 1Z8WA 2I79A 5G22A 1M44A 1ZLHA 4XPDB 3R9FA 4MY3A 1S7NA 1I21A 2PJAA 1U6MA 2OU2A 2AFXA 2FCKA 3DSBA 5J8FA 3KGQA 2PJ7A 3R9GA 2Q0YA 4CAFA 3CXQA 4FD7A 3PB8X 2ZXVA 4B11A 4RUHA 3D7FA 2YNCA 2PJCA 4Q7AA 2AE6A 3UY5A 4W9YA 4X3RA 1WK4A 4F8ZA 1FT7A 4CGPA 3B3CA 4R6TA 1M4DA 1KUYA 4BINA 2IQ6A 3PP9A 3V7ZA 3KQZA 5KTDA 4CGNA 4ONUA 3RNZA 1CPXA 3L2NA 3VWEA 4E2AA 4CYOA 2ZEPA 5JQ4A 1MK4A 2PVWA 3K2KA 1LAMA 1ELMP 1OZPA 1RO5A 3KQXA 4MHNA 3T8WA 3ZZIA 5C82A 4BMHA 4E0AA 1Y9WA 4AVAA 1KWMA 4PPZA 4OC0A 5IX3A 5H84A 2Z3LA 1CG2A 4JD6A 4O23A 4F9VA 2YNCC 2I3CA 1YQEA 1VHSA 3TO9A 4ORFA 4I49A 3RYOA 4OIWA 3SJFA 5HVHA 5LYIA 3N5FA 2CTCA 4KS9A 2IMOA 1I1DA 4A95A 3BXMA 3FEEA 5IV0A 1YGHA 3S9LA 4P45A 3NH4A 3HUVA 3RBUA 4R8FA 2PJ4A 4KOVA 5JPHA 1OBRA 3PBEA 4R3LA 4FUUA 4DJLA 4UFXA 3IWWA 4UFWA 1BPMA 2BSWA 1NSAA 4HNWB 3SJGA 1BPNA 5DWNA 3GKRA 3TTHA 2B5GB 5F49A 2PJ6A 4JWPA 1TF8A 3BI0A 4Y49C 3BJ8A 3R95A 4F6AA 2ZW7A 3KL9A 2Q4ZA 3PB9X 4JYWA 4NGRA 4P4DA 4OC5A 1S5KA 4R7MA 4E8OA 4MJ8A 3PGPA 4PXCA 3V8IA 4LQ6A 3KKWA 2ZELA 3S6GA 4CGLA 5HVGA 3TO6A 4MFLA 2DEAA 2WPXA 3WC6A 5GCNA 3EXNA 2Q7SA 1ARMA 2PJ8A 3IIBA 5E96A 3TOBA 4M6GA 3LD2A 4XPLA 5I0CA 2OZGA 4AVCA 2VQYA 8CPAA 2C1CA 1QSNA 3ISZA 3D2PA 1MJBA 3FMCA 3GYAA 4KOYA 4KVXA 2Q43A 1ZO0A 1VIXA 1IB1E 3FF3A 2PJ2A 3G3SA 4M85A 4MXUA 1JQGA 4ONWA 2DF5A 3MRUA 5AG7A 4MCRA 2F5IA 2WZNA 2G0BA 3PB4X 4QB9A 1YSJA 4UWJA 1YMEA 3V38A 4EFDA 1X12A 2AFMA 3D66A 3KASA 4C7IA 4CAVA 1CPSA 4UF4A 3TO7A 3FX6A 3SXOA 4KLVA 2ZOFA 5ELYA 2K5TA 1QSTA 2PRQA 1IOIA 2ANPA 4GM5A 5KTCA 1IY7A 1TKHA 1IICA 5ISVA 4A39A 4CRZB 4HNYB 3D2MA 4CS0B 5J8CA 3FNCA 1Z4RA 5JH9A 1Y7EA 4PXEA 3W6SA 4H6ZA 4KOWA 3IGRA 2O28A 2ZEHA 5EBVA 1S7LA 2C6PA 1BOBA 2OH1A 3BJ7A 4TNUA 5A27A 1H8LA 3IC1A 1EE3P 3DLJA 1PYTB 5CPAA 1Q2CA 4PV6A 1F2OA 1NE9A 4M3SA 2ZEGA 4MY0A 2OOTA 1XJOA 6CPAA 2Y0MA 4DNCA 5K8PA 1ARLA 3NE8A 3G8WA 1XF8A 2JEVA 3B35A 3FRMA 1PU9A 3PRTA 5HH1A 3F8KA 4OLLA 4OKOA 5LYLA 3TE4A 4P4JA 2KCWA 5HMNA 4PSXA 2Q51A 4UEZA 3EC4A 1L0CA 2PJ3A 3TCVA 3D68A 4MFPA 4NGSA 4KORA 1CJWA 2V8GA 3DGVA 2B4DA 2G9DA 2OZUA 3KI9A 5JGFA 3PB6X 4NJRA 4KOXA 4JZ0A 2B4BA 4UFVA 7CPAA 5K8OA 3CT9A 3TX8A 1CP6A 1LCPA 1M1DA 4IHMA 2JDDA 4CPAA 1QSOA 2RB7A 4KOSA 3K9UA 4KVME 4UWIA 3SHPA 2FXFA 4F0YA 3QB8A 5CNPA 4M6IA 1IYLA 2AFUA 2PJBA 4NCZA 2G3TA 4AG9A 3B3VA 1GYTA 3CXSA 1R57A 2OZHA 2CNSA 4H6UA 4KSIA 3T9YA 4A32A 1UFHA 1Y0YA 3IEHA 4ZX8A 3VATA 4ZY2A 1Y7RA 4PQAA 2PQ8A 4B12A 1QSMA 1YVKA 3LACA 2EO8A 2V8VA 1QQ9A 1CM0A 2Z11A 4P4IA 4M6HA 1PCAA 4EMEA 2AFSA 2PVVA 2QECA 2QMLA 2Z3MA 1S7FA 4HPSA 4UCNA 3WC7A 5IB0A 3H8FA 1S7KA 4A31A 1Y0RA 4ZGYB 2AFZA 2GFQA 1JWQA 4CGMA 3E0KA 3DR6A 2WUUA 2P6EA 3NE7A 1A2ZA 1DE4C 4P4FA 4F9UA 2D4OA 3F5BA 2HQYA 3S9NA 1IGBA 1KUVA 2JDCA 2JLMA 4HNXB 2EK8A 5D29A 1HEEA 3SJXA 2FIWA 4B5PB 2HV2A 5AG5A 4MFKA 2AFWA 5I4MA 3CDXA 2QJ8A 4KOTA 3CPXA 3TT2A 4MI4A 3N7ZA 4YGOA 4R87A 2GU2A 1YX0A 2ZPAA 1TXRA 1KUXA 2J8RA 3KR4A 3R1KA 4OAEA 4B13A 2ODFA 1HDQA 2DXQA 2ZEMA 3BHXA 3PFEA 3T90A 2D4PA 2PIZA 4F0XA 3SJEA 1N71A 5DWMA 2PE3A 1VHEA 4CGOA 1XE4A 2VEZA 3C26A 3D67A 3CPAA 2BEIA 2ZW4A 4NXYA 2ARHA 2YNDA 1R3NA 4ZX9A 1YVOA 3FEDA 4C68A 5KTAA 5F48A 3FIXA 4XPDC 4FWUA 1TKJA 5D8NA 1Y9KA 3JRUA 2V8HA 5LYFA 4KUBA 2ZEDA 4XNHC 2POKA 2F7VA 2QIRA 1LANA 1LAPA 2CTBA 2J8MA 3BI1A 3D8PA 4IAVA 1Z2LA 4Q38A 3VWDA 4JXQA 2QYVA 4L89A 4MMOA 4NGQA 4CYQA 3VH9A 1NMTA 2CNTA 3RO0A 4PK2A 1TF9A 1ZG9A 3LODA 2J8NA 4Q36A 4HKFA 3W6XA 1LRZA 3NH5A 3S6KA 4FAIA 4NGMA 4G1PA 4YRHA 1Z4EA 2PR8A 1YREA 3QAHA 2RC4A 4IF5A 1IYKA 3D3SA 5AGEA 2NYQA 1Z5RA 2QVPA 2XEGA 4P6YA 4AB7A 2FIAA 4ZI6A 1XMTA 5G1ZA 3IWGA 4B14A 2EUIA 2PCUA 4A38A 2C6GA 3B3SA 4ZYQA 2B5GA 2IJZA 2R8VA 1Z8LA 3SXNA 1YLEA 4A94A 1Q7LA 2GIVA 4MCQA 2CF4A 4AG7A 2AJ6A 2BL1A 3PFOA 4IUSA 3LWUA 4X8IA 4KLWA 4XPKA 5BWAB 1AUGA 5K8MA 3IO1A 3JTKA 4MFZA 2GANA 4K30A 2JEWA 1IIDA 1XMBA 1YR0A 2A4NA 2XEIA 2Z0ZA 3PB7X 3H4QA 2IL4A 1XEBA 4QBJA 5C88A 3ISXA 3PZJA 3HLPA 4MFQA 3EO4A 4II9A 5DS0A 4C2YA 5HVFA 3R96A 1TKFA 1FNOA 2REFA 1RXTA 2PDOA 3B2YA 4K3NA 2BOAA 4NFRA 1K4JA 2CY2A 4AVBA 1BAVA 1AMPA 2V77A 4FD4A 2YGWA 1LOKA 1Z8XA 1P4NA 3D7DA 1QSRA 1CBXA 4B10A 3IFEA 2B58A 4QVTA 4NEXA 2BUEA 3GUXA 5LRJA 4ZY1A 2ZEEA 1AYEA 1YK3A 3FXTA 4FD5A 4UIAA 2BCOA 3QAYA 4U9ZA 2ZEOA 3KZWA 1FY7A 2GREA 1MJAA 3QNVA 2I00A 2DPTA 4JXRA 4WJBA 3FECA 4Y49B 2ZW5A 2Q4VA 4EWTA 2DPSA 3VARA 5HXDA 3DDDA 5H86A 1ZG7A 4QC6A 2Z3PA 3S6FA 5F47A 3RAMA 4YU9A 1VGYA 2Q4YA
chains in the Genus database with same CATH topology
2H5MA 1B87A 2C27A 4CAWA 5A28A 4XNHB 2EVNA 4KZTA 1Z9UA 5EC4A 4KUAA 1B6BA 2P0WA 4CRYB 2Q04A 1SQHA 2GE3A 2P6GA 4MBUA 3FBUA 2FT0A 2R1IA 4H89A 2Z3KA 4MFZA 3CXPA 2VXKA 1XIXA 3A9LA 2VZZA 4FD6A 4KOUA 4LX9A 2YNEA 4UCMA 2FE7A 3FB3A 5F46A 4CYPA 2WPWA 3I9SA 2P6FA 4OADA 3P2HA 1PUAA 2ZW6A 3JUWA 2OB0A 1NSLA 3DNSA 5AG6A 4EVYA 2Z10A 4R3KA 1P0HA 1Q2YA 2PR1A 4C2ZA 3OWCA 2VI7A 4KSAA 1ON0A 2G3AA 3IU2A 5FVJA 2FSRA 2NMTA 4LUAA 4PSWA 4UA3A 2CXAA 4U5YA 4RS2A 4MHDA 4ZBGA 1KZFA 2X7BA 4C7HA 2WSAA 4A33A 2FS5A 4A30A 4L8AA 2REEA 3TFYA 2R7HA 2PC1A 4CYNA 4B5PA 1S60A 3F0AA 3BLNA 3B8GA 3S6HA 2Q44A 1BO4A 3P2FA 2HUZA 1MJ9A 4JLYA 2Z3NA 1TIQA 2B3VA 4NSQA 3I3GA 3H5ZA 4JJXA 4RI1A 3EY5A 4U9YA 4QUSA 3EFAA 1WWZA 2B3UA 2B4DB 4MFJA 4BBHA 4R57A 2Q7BA 2VBQA 4C2XA 1I12A 2R98A 3JVNA 4A2ZA 4YFJA 3WR7A 5AG4A 1Q2DA 1J4JA 2CNMA 3GY9A 4R9MA 3MGDA 2PRBA 5G20A 1V0CA 1VKCA 3FYNA 3TOAA 4NF1A 4PK3A 5G21A 4X5KA 2ATRA 1M4GA 3IWEA 4KSFA 4CAXA 1M4IA 2Z3OA 3W91A 4KVOE 4J3GA 1GHEA 3IU1A 2VZYA 2PSWA 3R9EA 2FL4A 4UBRA 3ZJ0A 3DR8A 4GS4A 4UCPA 4B5OA 4CAEA 2I79A 5G22A 1M44A 4XPDB 3R9FA 4MY3A 1S7NA 1I21A 1U6MA 2OU2A 2FCKA 3DSBA 5J8FA 3R9GA 2Q0YA 4CAFA 3CXQA 4FD7A 2ZXVA 4B11A 2YNCA 2AE6A 3UY5A 1WK4A 4CGPA 1M4DA 1KUYA 3PP9A 5KTDA 4CGNA 4ONUA 3VWEA 4E2AA 4CYOA 5JQ4A 1MK4A 1OZPA 1RO5A 5C82A 3ZZIA 4BMHA 4E0AA 1Y9WA 4AVAA 5IX3A 5H84A 2Z3LA 4JD6A 2YNCC 1VHSA 3TO9A 4ORFA 4I49A 3RYOA 4KS9A 1I1DA 4A95A 5IV0A 1YGHA 4KOVA 5JPHA 4R3LA 4UFXA 4UFWA 2BSWA 4HNWB 5DWNA 3GKRA 3TTHA 2B5GB 5F49A 4JWPA 4Y49C 3BJ8A 3R95A 4F6AA 2ZW7A 1S5KA 4E8OA 4MJ8A 3PGPA 3V8IA 4CGLA 3KKWA 3S6GA 3TO6A 4MFLA 2WPXA 5GCNA 3EXNA 3TOBA 5E96A 3LD2A 4XPLA 5I0CA 2OZGA 4AVCA 2VQYA 1QSNA 4KOYA 3D2PA 1MJBA 3GYAA 4KVXA 1ZO0A 1IB1E 4M85A 3G3SA 5AG7A 4UWJA 2F5IA 2G0BA 4QB9A 4C7IA 4CAVA 3TO7A 3SXOA 4KLVA 2K5TA 1QSTA 5KTCA 1IICA 5ISVA 4CRZB 4HNYB 3D2MA 4CS0B 5J8CA 3FNCA 1Z4RA 3W6SA 4H6ZA 4KOWA 3IGRA 2O28A 5EBVA 1S7LA 5A27A 1BOBA 2OH1A 3BJ7A 1Q2CA 4PV6A 1NE9A 4M3SA 4MY0A 2Y0MA 4DNCA 3G8WA 1XF8A 2JEVA 3FRMA 5HH1A 1PU9A 3F8KA 4OLLA 3TE4A 2KCWA 5HMNA 4PSXA 3EC4A 1L0CA 3TCVA 4MFPA 4KORA 1CJWA 2B4DA 2OZUA 4KOXA 4UFVA 2B4BA 1M1DA 2JDDA 1QSOA 4KOSA 3SHPA 3K9UA 4KVME 4UWIA 4F0YA 2FXFA 3QB8A 5CNPA 4NCZA 1IYLA 2G3TA 4AG9A 3CXSA 1R57A 2OZHA 2CNSA 4H6UA 3T9YA 4A32A 1UFHA 1Y7RA 2PQ8A 4B12A 1QSMA 1YVKA 2Z11A 1CM0A 2QECA 2QMLA 2Z3MA 1S7FA 4UCNA 5IB0A 1S7KA 4A31A 4ZGYB 4CGMA 3E0KA 3DR6A 2WUUA 2P6EA 3NE7A 2D4OA 3F5BA 2HQYA 1KUVA 2JDCA 2JLMA 4HNXB 4B5PB 2FIWA 2HV2A 5AG5A 4MFKA 4KOTA 3TT2A 4MI4A 3N7ZA 4YGOA 4R87A 1YX0A 2ZPAA 1KUXA 2J8RA 3R1KA 4OAEA 4B13A 4F0XA 2DXQA 3T90A 2D4PA 1N71A 5DWMA 4CGOA 1XE4A 2VEZA 3C26A 4NXYA 2BEIA 2ZW4A 2ARHA 2YNDA 5KTAA 1YVOA 4C68A 5F48A 3FIXA 4XPDC 1Y9KA 4KUBA 4XNHC 2QIRA 3D8PA 2J8MA 4Q38A 3VWDA 4JXQA 4L89A 4CYQA 1NMTA 2CNTA 4PK2A 3LODA 2J8NA 4Q36A 4HKFA 3W6XA 1LRZA 3S6KA 4YRHA 1Z4EA 2PR8A 1YREA 3QAHA 2RC4A 4IF5A 1IYKA 3D3SA 5AGEA 4AB7A 2FIAA 1XMTA 5G1ZA 3IWGA 4B14A 2EUIA 2B5GA 2R8VA 3SXNA 1YLEA 2GIVA 4AG7A 2AJ6A 2BL1A 4IUSA 4XPKA 4KLWA 5BWAB 3JTKA 2GANA 4K30A 1IIDA 1YR0A 2A4NA 2Z0ZA 4QBJA 3H4QA 2IL4A 1XEBA 5C88A 3PZJA 4MFQA 3EO4A 4II9A 4C2YA 3R96A 2REFA 1RXTA 2PDOA 1K4JA 2CY2A 4AVBA 4FD4A 2YGWA 1P4NA 1QSRA 4B10A 2B58A 4QVTA 4NEXA 2BUEA 1YK3A 4FD5A 3FXTA 4U9ZA 1FY7A 1MJAA 2I00A 2DPTA 4JXRA 4Y49B 2ZW5A 2Q4VA 2DPSA 3DDDA 5H86A 4QC6A 2Z3PA 3S6FA 5F47A 1S3ZA 2Q4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5M A;  1B87 A;  2C27 A;  4CAW A;  4XNH B;  2EVN A;  4KZT A;  1Z9U A;  5EC4 A;  4KUA A;  1B6B A;  2P0W A;  4CRY B;  2Q04 A;  1SQH A;  2GE3 A;  2P6G A;  4MBU A;  3FBU A;  2FT0 A;  2R1I A;  4H89 A;  4LX9 A;  2VXK A;  1XIX A;  3CXP A;  2VZZ A;  4FD6 A;  4KOU A;  2FE7 A;  3FB3 A;  5F46 A;  2WPW A;  3I9S A;  2P6F A;  4OAD A;  3P2H A;  1PUA A;  2ZW6 A;  3JUW A;  2OB0 A;  1NSL A;  3DNS A;  4EVY A;  2Z10 A;  4R3K A;  1P0H A;  1Q2Y A;  2PR1 A;  3OWC A;  2VI7 A;  1ON0 A;  2G3A A;  5FVJ A;  2FSR A;  2NMT A;  4LUA A;  4PSW A;  4UA3 A;  4U5Y A;  4RS2 A;  4MHD A;  4ZBG A;  1KZF A;  2X7B A;  2FS5 A;  4L8A A;  2REE A;  3TFY A;  2R7H A;  2PC1 A;  4B5P A;  1S60 A;  3F0A A;  3BLN A;  3B8G A;  3S6H A;  2Q44 A;  1BO4 A;  3P2F A;  2HUZ A;  1MJ9 A;  4JLY A;  1TIQ A;  2B3V A;  4NSQ A;  3I3G A;  4JJX A;  4RI1 A;  3EY5 A;  4U9Y A;  4QUS A;  1WWZ A;  3EFA A;  2B3U A;  2B4D B;  4R57 A;  2Q7B A;  2VBQ A;  1I12 A;  2R98 A;  3JVN A;  4YFJ A;  3WR7 A;  1Q2D A;  1J4J A;  2CNM A;  3GY9 A;  4R9M A;  3MGD A;  2PRB A;  1V0C A;  1VKC A;  3FYN A;  3TOA A;  4NF1 A;  4PK3 A;  4X5K A;  2ATR A;  1M4G A;  4CAX A;  1M4I A;  3W91 A;  4KVO E;  4J3G A;  1GHE A;  2VZY A;  2PSW A;  3R9E A;  2FL4 A;  4UBR A;  3ZJ0 A;  3DR8 A;  4GS4 A;  4B5O A;  2I79 A;  1M44 A;  4XPD B;  3R9F A;  4MY3 A;  1S7N A;  1I21 A;  1U6M A;  2OU2 A;  2FCK A;  3DSB A;  5J8F A;  3R9G A;  2Q0Y A;  3CXQ A;  4FD7 A;  2ZXV A;  2AE6 A;  3UY5 A;  1WK4 A;  1M4D A;  1KUY A;  3PP9 A;  5KTD A;  4ONU A;  3VWE A;  4E2A A;  5JQ4 A;  1MK4 A;  1OZP A;  1RO5 A;  5C82 A;  3ZZI A;  4BMH A;  4E0A A;  1Y9W A;  4AVA A;  5IX3 A;  5H84 A;  4JD6 A;  1VHS A;  3TO9 A;  4ORF A;  4I49 A;  3RYO A;  1I1D A;  5IV0 A;  1YGH A;  4KOV A;  5JPH A;  4R3L A;  2BSW A;  4HNW B;  5DWN A;  3GKR A;  3TTH A;  2B5G B;  5F49 A;  4JWP A;  4Y49 C;  3BJ8 A;  3R95 A;  4F6A A;  2ZW7 A;  1S5K A;  4E8O A;  4MJ8 A;  3PGP A;  3V8I A;  3KKW A;  3S6G A;  3TO6 A;  2WPX A;  5GCN A;  3EXN A;  3TOB A;  5E96 A;  3LD2 A;  4XPL A;  5I0C A;  2OZG A;  4AVC A;  2VQY A;  1QSN A;  4KOY A;  3D2P A;  1MJB A;  3GYA A;  4KVX A;  1IB1 E;  4M85 A;  3G3S A;  4UWJ A;  2F5I A;  2G0B A;  4QB9 A;  4CAV A;  3TO7 A;  3SXO A;  4KLV A;  2K5T A;  1QST A;  5KTC A;  1IIC A;  5ISV A;  4CRZ B;  4HNY B;  3D2M A;  4CS0 B;  5J8C A;  3FNC A;  1Z4R A;  3W6S A;  4H6Z A;  4KOW A;  3IGR A;  2O28 A;  5EBV A;  1S7L A;  1BOB A;  2OH1 A;  3BJ7 A;  1Q2C A;  4PV6 A;  1NE9 A;  4M3S A;  4MY0 A;  2Y0M A;  4DNC A;  3G8W A;  1XF8 A;  2JEV A;  3FRM A;  5HH1 A;  1PU9 A;  3F8K A;  4OLL A;  3TE4 A;  2KCW A;  5HMN A;  4PSX A;  3EC4 A;  1L0C A;  3TCV A;  4KOR A;  1CJW A;  2B4D A;  2OZU A;  4KOX A;  2B4B A;  1M1D A;  2JDD A;  1QSO A;  4KOS A;  3SHP A;  4KVM E;  3K9U A;  4UWI A;  4F0Y A;  2FXF A;  3QB8 A;  5CNP A;  4NCZ A;  1IYL A;  2G3T A;  4AG9 A;  3CXS A;  1R57 A;  2OZH A;  2CNS A;  4H6U A;  3T9Y A;  1UFH A;  1Y7R A;  2PQ8 A;  1QSM A;  1YVK A;  2Z11 A;  1CM0 A;  2QEC A;  2QML A;  1S7F A;  5IB0 A;  1S7K A;  3E0K A;  3DR6 A;  2P6E A;  3NE7 A;  2D4O A;  3F5B A;  2HQY A;  1KUV A;  2JDC A;  2JLM A;  4HNX B;  4B5P B;  2FIW A;  2HV2 A;  4KOT A;  3TT2 A;  4MI4 A;  3N7Z A;  4YGO A;  4R87 A;  1YX0 A;  2ZPA A;  1KUX A;  2J8R A;  3R1K A;  4OAE A;  2DXQ A;  3T90 A;  2D4P A;  1N71 A;  5DWM A;  1XE4 A;  2VEZ A;  3C26 A;  4NXY A;  2BEI A;  2ZW4 A;  2ARH A;  5KTA A;  1YVO A;  5F48 A;  3FIX A;  4XPD C;  1Y9K A;  4KUB A;  4XNH C;  2QIR A;  3D8P A;  2J8M A;  3VWD A;  4JXQ A;  4L89 A;  1NMT A;  2CNT A;  4PK2 A;  3LOD A;  2J8N A;  4HKF A;  3W6X A;  1LRZ A;  3S6K A;  4YRH A;  1Z4E A;  2PR8 A;  1YRE A;  3QAH A;  2RC4 A;  4IF5 A;  1IYK A;  3D3S A;  4AB7 A;  2FIA A;  1XMT A;  3IWG A;  2EUI A;  2B5G A;  2R8V A;  3SXN A;  1YLE A;  2GIV A;  4AG7 A;  2AJ6 A;  2BL1 A;  4IUS A;  4XPK A;  4KLW A;  2GAN A;  4K30 A;  1IID A;  1YR0 A;  2A4N A;  2Z0Z A;  4QBJ A;  3H4Q A;  2IL4 A;  1XEB A;  5C88 A;  3PZJ A;  3EO4 A;  4II9 A;  3R96 A;  2REF A;  1RXT A;  2PDO A;  1K4J A;  2CY2 A;  4AVB A;  4FD4 A;  1P4N A;  1QSR A;  2B58 A;  4QVT A;  4NEX A;  2BUE A;  1YK3 A;  4FD5 A;  3FXT A;  4U9Z A;  1FY7 A;  1MJA A;  2I00 A;  4JXR A;  4Y49 B;  2ZW5 A;  2Q4V A;  3DDD A;  5H86 A;  4QC6 A;  3S6F A;  5F47 A;  1S3Z A;  2Q4Y A; 
#chains in the Genus database with same CATH topology
 2H5M A;  2HB6 A;  4PXD A;  1B87 A;  2C27 A;  1HDU A;  3S9M A;  4CAW A;  5A28 A;  4XNH B;  2EVN A;  5CBM A;  4KZT A;  1Z9U A;  4UEE A;  5EC4 A;  2JBJ A;  4BD9 A;  2J9A A;  4KUA A;  2HC9 A;  1B6B A;  2P0W A;  3GIU A;  4CRY B;  2Q04 A;  4UIB A;  1SQH A;  2GE3 A;  2P6G A;  4MBU A;  3FBU A;  4FBE A;  2FT0 A;  1F2P A;  2R1I A;  4H89 A;  4P4E A;  2PJ9 A;  3WAB A;  2Z3K A;  4R76 A;  4B6Z A;  2PJ1 A;  4A37 A;  2C6C A;  3CXP A;  2VXK A;  1XIX A;  3A9L A;  2VZZ A;  4FD6 A;  4KOU A;  4LX9 A;  2YNE A;  4NGP A;  3RZA A;  4UCM A;  2FE7 A;  3H8E A;  2PJ5 A;  3SI1 A;  3FB3 A;  4PXB A;  5F46 A;  4CYP A;  1XOV A;  3SI2 A;  2WPW A;  1XBU A;  3I9S A;  2ZEF A;  3B3W A;  5JM6 A;  2P6F A;  4OAD A;  3P2H A;  1PUA A;  5K8N A;  2ZW6 A;  3JUW A;  1S3Z A;  1ZLI A;  2OB0 A;  1NSL A;  3GB0 A;  3DNS A;  5AG6 A;  4EVY A;  2PJ0 A;  1ZG8 A;  3B3T A;  2Z10 A;  4R3K A;  1P0H A;  2OR4 A;  1Q2Y A;  2PR1 A;  4C2Z A;  4YWY A;  3TC8 A;  3OWC A;  2FVG A;  2VI7 A;  1BLL E;  4MCS A;  4OC3 A;  4KSA A;  1ON0 A;  3NFZ A;  2G3A A;  1R43 A;  3FVL A;  2GLF A;  3IU2 A;  2EWB A;  5FVJ A;  1QMU A;  4NGT A;  3FH4 A;  2FSR A;  2NMT A;  3NA6 A;  4LUA A;  4PSW A;  3SI0 A;  3PEI A;  4UA3 A;  4OP4 A;  4ZY0 A;  2NSM A;  2CXA A;  4U5Y A;  4OC4 A;  4RS2 A;  3CZX A;  4MHD A;  2ABZ A;  2VL1 A;  4ZBG A;  1KZF A;  2X7B A;  4C7H A;  2WSA A;  4A33 A;  2FS5 A;  4IK2 A;  4OME A;  3PBB A;  3IJ3 A;  4A30 A;  1XFO A;  4L8A A;  4P4B A;  1VHO A;  2REE A;  4MHP A;  2F8H A;  3TFY A;  2XEJ A;  2EBJ A;  1YW6 A;  1YLO A;  2R7H A;  3D7G A;  1M4L A;  2PC1 A;  4CYN A;  4B5P A;  1S60 A;  3F0A A;  1CX8 A;  3BLN A;  3B8G A;  3S6H A;  2CIJ A;  1BO4 A;  2Q44 A;  3P2F A;  2HUZ A;  5LRG A;  1MJ9 A;  4JLY A;  2Z3N A;  1TIQ A;  2B3V A;  4NSQ A;  2EK9 A;  3D7H A;  3I3G A;  3H5Z A;  3K9T A;  4JJX A;  4LQG A;  3KR5 A;  4OC2 A;  4RI1 A;  3EY5 A;  2RFH A;  3KHX A;  1XRY A;  4QUS A;  4U9Y A;  4TWE A;  1WWZ A;  3EFA A;  2ZOG A;  2B3U A;  2B4D B;  2XEF A;  1F57 A;  4GXH A;  2O4H A;  4MFJ A;  2ZEN A;  4BBH A;  5THW A;  3B7I A;  4R57 A;  2Q7B A;  2VBQ A;  3NH8 A;  4NJQ A;  1I12 A;  3GLJ A;  4C2X A;  4NGN A;  5LRK A;  2GLJ A;  2R98 A;  4WWV A;  3JVN A;  4Z65 A;  4A2Z A;  5J1Q A;  4YFJ A;  3D4U A;  3WR7 A;  5AG4 A;  2O53 A;  1Q2D A;  1IU8 A;  4UEF A;  2WYR A;  1J4J A;  2CNM A;  3GY9 A;  3MN8 A;  4P44 A;  4R9M A;  3MGD A;  4MRI A;  2PRB A;  2BO9 A;  3I1U A;  3KHZ A;  5G20 A;  4H2K A;  4MCP A;  1V0C A;  1IOF A;  1VKC A;  3FJU A;  2PIY A;  3FYN A;  4OC1 A;  3TOA A;  4MHY A;  4DYO A;  4NF1 A;  1UWY A;  4P10 A;  4OID A;  4PK3 A;  4AXV A;  4MHZ A;  5G21 A;  5EMI A;  1ELL P;  4X5K A;  2ATR A;  4DUK A;  1M4G A;  3IWE A;  4KSF A;  4X2T A;  2JBK A;  4CAX A;  1M4I A;  2Z3O A;  3WC5 A;  3W91 A;  4KVO E;  4J3G A;  1GHE A;  2V8D A;  3IU1 A;  4RN7 A;  1CP7 A;  2VZY A;  1Z8T A;  2PSW A;  3R9E A;  3WT4 A;  1RTQ A;  3LMS A;  2FL4 A;  4UBR A;  3H8G A;  1DTD A;  3DR8 A;  4GS4 A;  3ZJ0 A;  5IB9 A;  5F09 A;  1YW4 A;  1X10 A;  1LFW A;  5LYD A;  4UCP A;  2AFO A;  4B5O A;  4CAE A;  1Z8W A;  2I79 A;  5G22 A;  1M44 A;  1ZLH A;  4XPD B;  3R9F A;  4MY3 A;  1S7N A;  1I21 A;  2PJA A;  1U6M A;  2OU2 A;  2AFX A;  2FCK A;  3DSB A;  5J8F A;  3KGQ A;  2PJ7 A;  3R9G A;  2Q0Y A;  4CAF A;  3CXQ A;  4FD7 A;  3PB8 X;  2ZXV A;  4B11 A;  4RUH A;  3D7F A;  2YNC A;  2PJC A;  4Q7A A;  2AE6 A;  3UY5 A;  4W9Y A;  4X3R A;  1WK4 A;  4F8Z A;  1FT7 A;  4CGP A;  3B3C A;  4R6T A;  1M4D A;  1KUY A;  4BIN A;  2IQ6 A;  3PP9 A;  3V7Z A;  3KQZ A;  5KTD A;  4CGN A;  4ONU A;  3RNZ A;  1CPX A;  3L2N A;  3VWE A;  4E2A A;  4CYO A;  2ZEP A;  5JQ4 A;  1MK4 A;  2PVW A;  3K2K A;  1LAM A;  1ELM P;  1OZP A;  1RO5 A;  3KQX A;  4MHN A;  3T8W A;  3ZZI A;  5C82 A;  4BMH A;  4E0A A;  1Y9W A;  4AVA A;  1KWM A;  4PPZ A;  4OC0 A;  5IX3 A;  5H84 A;  2Z3L A;  1CG2 A;  4JD6 A;  4O23 A;  4F9V A;  2YNC C;  2I3C A;  1YQE A;  1VHS A;  3TO9 A;  4ORF A;  4I49 A;  3RYO A;  4OIW A;  3SJF A;  5HVH A;  5LYI A;  3N5F A;  2CTC A;  4KS9 A;  2IMO A;  1I1D A;  4A95 A;  3BXM A;  3FEE A;  5IV0 A;  1YGH A;  3S9L A;  4P45 A;  3NH4 A;  3HUV A;  3RBU A;  4R8F A;  2PJ4 A;  4KOV A;  5JPH A;  1OBR A;  3PBE A;  4R3L A;  4FUU A;  4DJL A;  4UFX A;  3IWW A;  4UFW A;  1BPM A;  2BSW A;  1NSA A;  4HNW B;  3SJG A;  1BPN A;  5DWN A;  3GKR A;  3TTH A;  2B5G B;  5F49 A;  2PJ6 A;  4JWP A;  1TF8 A;  3BI0 A;  4Y49 C;  3BJ8 A;  3R95 A;  4F6A A;  2ZW7 A;  3KL9 A;  2Q4Z A;  3PB9 X;  4JYW A;  4NGR A;  4P4D A;  4OC5 A;  1S5K A;  4R7M A;  4E8O A;  4MJ8 A;  3PGP A;  4PXC A;  3V8I A;  4LQ6 A;  3KKW A;  2ZEL A;  3S6G A;  4CGL A;  5HVG A;  3TO6 A;  4MFL A;  2DEA A;  2WPX A;  3WC6 A;  5GCN A;  3EXN A;  2Q7S A;  1ARM A;  2PJ8 A;  3IIB A;  5E96 A;  3TOB A;  4M6G A;  3LD2 A;  4XPL A;  5I0C A;  2OZG A;  4AVC A;  2VQY A;  8CPA A;  2C1C A;  1QSN A;  3ISZ A;  3D2P A;  1MJB A;  3FMC A;  3GYA A;  4KOY A;  4KVX A;  2Q43 A;  1ZO0 A;  1VIX A;  1IB1 E;  3FF3 A;  2PJ2 A;  3G3S A;  4M85 A;  4MXU A;  1JQG A;  4ONW A;  2DF5 A;  3MRU A;  5AG7 A;  4MCR A;  2F5I A;  2WZN A;  2G0B A;  3PB4 X;  4QB9 A;  1YSJ A;  4UWJ A;  1YME A;  3V38 A;  4EFD A;  1X12 A;  2AFM A;  3D66 A;  3KAS A;  4C7I A;  4CAV A;  1CPS A;  4UF4 A;  3TO7 A;  3FX6 A;  3SXO A;  4KLV A;  2ZOF A;  5ELY A;  2K5T A;  1QST A;  2PRQ A;  1IOI A;  2ANP A;  4GM5 A;  5KTC A;  1IY7 A;  1TKH A;  1IIC A;  5ISV A;  4A39 A;  4CRZ B;  4HNY B;  3D2M A;  4CS0 B;  5J8C A;  3FNC A;  1Z4R A;  5JH9 A;  1Y7E A;  4PXE A;  3W6S A;  4H6Z A;  4KOW A;  3IGR A;  2O28 A;  2ZEH A;  5EBV A;  1S7L A;  2C6P A;  1BOB A;  2OH1 A;  3BJ7 A;  4TNU A;  5A27 A;  1H8L A;  3IC1 A;  1EE3 P;  3DLJ A;  1PYT B;  5CPA A;  1Q2C A;  4PV6 A;  1F2O A;  1NE9 A;  4M3S A;  2ZEG A;  4MY0 A;  2OOT A;  1XJO A;  6CPA A;  2Y0M A;  4DNC A;  5K8P A;  1ARL A;  3NE8 A;  3G8W A;  1XF8 A;  2JEV A;  3B35 A;  3FRM A;  1PU9 A;  3PRT A;  5HH1 A;  3F8K A;  4OLL A;  4OKO A;  5LYL A;  3TE4 A;  4P4J A;  2KCW A;  5HMN A;  4PSX A;  2Q51 A;  4UEZ A;  3EC4 A;  1L0C A;  2PJ3 A;  3TCV A;  3D68 A;  4MFP A;  4NGS A;  4KOR A;  1CJW A;  2V8G A;  3DGV A;  2B4D A;  2G9D A;  2OZU A;  3KI9 A;  5JGF A;  3PB6 X;  4NJR A;  4KOX A;  4JZ0 A;  2B4B A;  4UFV A;  7CPA A;  5K8O A;  3CT9 A;  3TX8 A;  1CP6 A;  1LCP A;  1M1D A;  4IHM A;  2JDD A;  4CPA A;  1QSO A;  2RB7 A;  4KOS A;  3K9U A;  4KVM E;  4UWI A;  3SHP A;  2FXF A;  4F0Y A;  3QB8 A;  5CNP A;  4M6I A;  1IYL A;  2AFU A;  2PJB A;  4NCZ A;  2G3T A;  4AG9 A;  3B3V A;  1GYT A;  3CXS A;  1R57 A;  2OZH A;  2CNS A;  4H6U A;  4KSI A;  3T9Y A;  4A32 A;  1UFH A;  1Y0Y A;  3IEH A;  4ZX8 A;  3VAT A;  4ZY2 A;  1Y7R A;  4PQA A;  2PQ8 A;  4B12 A;  1QSM A;  1YVK A;  3LAC A;  2EO8 A;  2V8V A;  1QQ9 A;  1CM0 A;  2Z11 A;  4P4I A;  4M6H A;  1PCA A;  4EME A;  2AFS A;  2PVV A;  2QEC A;  2QML A;  2Z3M A;  1S7F A;  4HPS A;  4UCN A;  3WC7 A;  5IB0 A;  3H8F A;  1S7K A;  4A31 A;  1Y0R A;  4ZGY B;  2AFZ A;  2GFQ A;  1JWQ A;  4CGM A;  3E0K A;  3DR6 A;  2WUU A;  2P6E A;  3NE7 A;  1A2Z A;  1DE4 C;  4P4F A;  4F9U A;  2D4O A;  3F5B A;  2HQY A;  3S9N A;  1IGB A;  1KUV A;  2JDC A;  2JLM A;  4HNX B;  2EK8 A;  5D29 A;  1HEE A;  3SJX A;  2FIW A;  4B5P B;  2HV2 A;  5AG5 A;  4MFK A;  2AFW A;  5I4M A;  3CDX A;  2QJ8 A;  4KOT A;  3CPX A;  3TT2 A;  4MI4 A;  3N7Z A;  4YGO A;  4R87 A;  2GU2 A;  1YX0 A;  2ZPA A;  1TXR A;  1KUX A;  2J8R A;  3KR4 A;  3R1K A;  4OAE A;  4B13 A;  2ODF A;  1HDQ A;  2DXQ A;  2ZEM A;  3BHX A;  3PFE A;  3T90 A;  2D4P A;  2PIZ A;  4F0X A;  3SJE A;  1N71 A;  5DWM A;  2PE3 A;  1VHE A;  4CGO A;  1XE4 A;  2VEZ A;  3C26 A;  3D67 A;  3CPA A;  2BEI A;  2ZW4 A;  4NXY A;  2ARH A;  2YND A;  1R3N A;  4ZX9 A;  1YVO A;  3FED A;  4C68 A;  5KTA A;  5F48 A;  3FIX A;  4XPD C;  4FWU A;  1TKJ A;  5D8N A;  1Y9K A;  3JRU A;  2V8H A;  5LYF A;  4KUB A;  2ZED A;  4XNH C;  2POK A;  2F7V A;  2QIR A;  1LAN A;  1LAP A;  2CTB A;  2J8M A;  3BI1 A;  3D8P A;  4IAV A;  1Z2L A;  4Q38 A;  3VWD A;  4JXQ A;  2QYV A;  4L89 A;  4MMO A;  4NGQ A;  4CYQ A;  3VH9 A;  1NMT A;  2CNT A;  3RO0 A;  4PK2 A;  1TF9 A;  1ZG9 A;  3LOD A;  2J8N A;  4Q36 A;  4HKF A;  3W6X A;  1LRZ A;  3NH5 A;  3S6K A;  4FAI A;  4NGM A;  4G1P A;  4YRH A;  1Z4E A;  2PR8 A;  1YRE A;  3QAH A;  2RC4 A;  4IF5 A;  1IYK A;  3D3S A;  5AGE A;  2NYQ A;  1Z5R A;  2QVP A;  2XEG A;  4P6Y A;  4AB7 A;  2FIA A;  4ZI6 A;  1XMT A;  5G1Z A;  3IWG A;  4B14 A;  2EUI A;  2PCU A;  4A38 A;  2C6G A;  3B3S A;  4ZYQ A;  2B5G A;  2IJZ A;  2R8V A;  1Z8L A;  3SXN A;  1YLE A;  4A94 A;  1Q7L A;  2GIV A;  4MCQ A;  2CF4 A;  4AG7 A;  2AJ6 A;  2BL1 A;  3PFO A;  4IUS A;  3LWU A;  4X8I A;  4KLW A;  4XPK A;  5BWA B;  1AUG A;  5K8M A;  3IO1 A;  3JTK A;  4MFZ A;  2GAN A;  4K30 A;  2JEW A;  1IID A;  1XMB A;  1YR0 A;  2A4N A;  2XEI A;  2Z0Z A;  3PB7 X;  3H4Q A;  2IL4 A;  1XEB A;  4QBJ A;  5C88 A;  3ISX A;  3PZJ A;  3HLP A;  4MFQ A;  3EO4 A;  4II9 A;  5DS0 A;  4C2Y A;  5HVF A;  3R96 A;  1TKF A;  1FNO A;  2REF A;  1RXT A;  2PDO A;  3B2Y A;  4K3N A;  2BOA A;  4NFR A;  1K4J A;  2CY2 A;  4AVB A;  1BAV A;  1AMP A;  2V77 A;  4FD4 A;  2YGW A;  1LOK A;  1Z8X A;  1P4N A;  3D7D A;  1QSR A;  1CBX A;  4B10 A;  3IFE A;  2B58 A;  4QVT A;  4NEX A;  2BUE A;  3GUX A;  5LRJ A;  4ZY1 A;  2ZEE A;  1AYE A;  1YK3 A;  3FXT A;  4FD5 A;  4UIA A;  2BCO A;  3QAY A;  4U9Z A;  2ZEO A;  3KZW A;  1FY7 A;  2GRE A;  1MJA A;  3QNV A;  2I00 A;  2DPT A;  4JXR A;  4WJB A;  3FEC A;  4Y49 B;  2ZW5 A;  2Q4V A;  4EWT A;  2DPS A;  3VAR A;  5HXD A;  3DDD A;  5H86 A;  1ZG7 A;  4QC6 A;  2Z3P A;  3S6F A;  5F47 A;  3RAM A;  4YU9 A;  1VGY A;  2Q4Y A; 
#chains in the Genus database with same CATH homology
 2H5M A;  1B87 A;  2C27 A;  4CAW A;  5A28 A;  4XNH B;  2EVN A;  4KZT A;  1Z9U A;  5EC4 A;  4KUA A;  1B6B A;  2P0W A;  4CRY B;  2Q04 A;  1SQH A;  2GE3 A;  2P6G A;  4MBU A;  3FBU A;  2FT0 A;  2R1I A;  4H89 A;  2Z3K A;  4MFZ A;  3CXP A;  2VXK A;  1XIX A;  3A9L A;  2VZZ A;  4FD6 A;  4KOU A;  4LX9 A;  2YNE A;  4UCM A;  2FE7 A;  3FB3 A;  5F46 A;  4CYP A;  2WPW A;  3I9S A;  2P6F A;  4OAD A;  3P2H A;  1PUA A;  2ZW6 A;  3JUW A;  2OB0 A;  1NSL A;  3DNS A;  5AG6 A;  4EVY A;  2Z10 A;  4R3K A;  1P0H A;  1Q2Y A;  2PR1 A;  4C2Z A;  3OWC A;  2VI7 A;  4KSA A;  1ON0 A;  2G3A A;  3IU2 A;  5FVJ A;  2FSR A;  2NMT A;  4LUA A;  4PSW A;  4UA3 A;  2CXA A;  4U5Y A;  4RS2 A;  4MHD A;  4ZBG A;  1KZF A;  2X7B A;  4C7H A;  2WSA A;  4A33 A;  2FS5 A;  4A30 A;  4L8A A;  2REE A;  3TFY A;  2R7H A;  2PC1 A;  4CYN A;  4B5P A;  1S60 A;  3F0A A;  3BLN A;  3B8G A;  3S6H A;  2Q44 A;  1BO4 A;  3P2F A;  2HUZ A;  1MJ9 A;  4JLY A;  2Z3N A;  1TIQ A;  2B3V A;  4NSQ A;  3I3G A;  3H5Z A;  4JJX A;  4RI1 A;  3EY5 A;  4U9Y A;  4QUS A;  3EFA A;  1WWZ A;  2B3U A;  2B4D B;  4MFJ A;  4BBH A;  4R57 A;  2Q7B A;  2VBQ A;  4C2X A;  1I12 A;  2R98 A;  3JVN A;  4A2Z A;  4YFJ A;  3WR7 A;  5AG4 A;  1Q2D A;  1J4J A;  2CNM A;  3GY9 A;  4R9M A;  3MGD A;  2PRB A;  5G20 A;  1V0C A;  1VKC A;  3FYN A;  3TOA A;  4NF1 A;  4PK3 A;  5G21 A;  4X5K A;  2ATR A;  1M4G A;  3IWE A;  4KSF A;  4CAX A;  1M4I A;  2Z3O A;  3W91 A;  4KVO E;  4J3G A;  1GHE A;  3IU1 A;  2VZY A;  2PSW A;  3R9E A;  2FL4 A;  4UBR A;  3ZJ0 A;  3DR8 A;  4GS4 A;  4UCP A;  4B5O A;  4CAE A;  2I79 A;  5G22 A;  1M44 A;  4XPD B;  3R9F A;  4MY3 A;  1S7N A;  1I21 A;  1U6M A;  2OU2 A;  2FCK A;  3DSB A;  5J8F A;  3R9G A;  2Q0Y A;  4CAF A;  3CXQ A;  4FD7 A;  2ZXV A;  4B11 A;  2YNC A;  2AE6 A;  3UY5 A;  1WK4 A;  4CGP A;  1M4D A;  1KUY A;  3PP9 A;  5KTD A;  4CGN A;  4ONU A;  3VWE A;  4E2A A;  4CYO A;  5JQ4 A;  1MK4 A;  1OZP A;  1RO5 A;  5C82 A;  3ZZI A;  4BMH A;  4E0A A;  1Y9W A;  4AVA A;  5IX3 A;  5H84 A;  2Z3L A;  4JD6 A;  2YNC C;  1VHS A;  3TO9 A;  4ORF A;  4I49 A;  3RYO A;  4KS9 A;  1I1D A;  4A95 A;  5IV0 A;  1YGH A;  4KOV A;  5JPH A;  4R3L A;  4UFX A;  4UFW A;  2BSW A;  4HNW B;  5DWN A;  3GKR A;  3TTH A;  2B5G B;  5F49 A;  4JWP A;  4Y49 C;  3BJ8 A;  3R95 A;  4F6A A;  2ZW7 A;  1S5K A;  4E8O A;  4MJ8 A;  3PGP A;  3V8I A;  4CGL A;  3KKW A;  3S6G A;  3TO6 A;  4MFL A;  2WPX A;  5GCN A;  3EXN A;  3TOB A;  5E96 A;  3LD2 A;  4XPL A;  5I0C A;  2OZG A;  4AVC A;  2VQY A;  1QSN A;  4KOY A;  3D2P A;  1MJB A;  3GYA A;  4KVX A;  1ZO0 A;  1IB1 E;  4M85 A;  3G3S A;  5AG7 A;  4UWJ A;  2F5I A;  2G0B A;  4QB9 A;  4C7I A;  4CAV A;  3TO7 A;  3SXO A;  4KLV A;  2K5T A;  1QST A;  5KTC A;  1IIC A;  5ISV A;  4CRZ B;  4HNY B;  3D2M A;  4CS0 B;  5J8C A;  3FNC A;  1Z4R A;  3W6S A;  4H6Z A;  4KOW A;  3IGR A;  2O28 A;  5EBV A;  1S7L A;  5A27 A;  1BOB A;  2OH1 A;  3BJ7 A;  1Q2C A;  4PV6 A;  1NE9 A;  4M3S A;  4MY0 A;  2Y0M A;  4DNC A;  3G8W A;  1XF8 A;  2JEV A;  3FRM A;  5HH1 A;  1PU9 A;  3F8K A;  4OLL A;  3TE4 A;  2KCW A;  5HMN A;  4PSX A;  3EC4 A;  1L0C A;  3TCV A;  4MFP A;  4KOR A;  1CJW A;  2B4D A;  2OZU A;  4KOX A;  4UFV A;  2B4B A;  1M1D A;  2JDD A;  1QSO A;  4KOS A;  3SHP A;  3K9U A;  4KVM E;  4UWI A;  4F0Y A;  2FXF A;  3QB8 A;  5CNP A;  4NCZ A;  1IYL A;  2G3T A;  4AG9 A;  3CXS A;  1R57 A;  2OZH A;  2CNS A;  4H6U A;  3T9Y A;  4A32 A;  1UFH A;  1Y7R A;  2PQ8 A;  4B12 A;  1QSM A;  1YVK A;  2Z11 A;  1CM0 A;  2QEC A;  2QML A;  2Z3M A;  1S7F A;  4UCN A;  5IB0 A;  1S7K A;  4A31 A;  4ZGY B;  4CGM A;  3E0K A;  3DR6 A;  2WUU A;  2P6E A;  3NE7 A;  2D4O A;  3F5B A;  2HQY A;  1KUV A;  2JDC A;  2JLM A;  4HNX B;  4B5P B;  2FIW A;  2HV2 A;  5AG5 A;  4MFK A;  4KOT A;  3TT2 A;  4MI4 A;  3N7Z A;  4YGO A;  4R87 A;  1YX0 A;  2ZPA A;  1KUX A;  2J8R A;  3R1K A;  4OAE A;  4B13 A;  4F0X A;  2DXQ A;  3T90 A;  2D4P A;  1N71 A;  5DWM A;  4CGO A;  1XE4 A;  2VEZ A;  3C26 A;  4NXY A;  2BEI A;  2ZW4 A;  2ARH A;  2YND A;  5KTA A;  1YVO A;  4C68 A;  5F48 A;  3FIX A;  4XPD C;  1Y9K A;  4KUB A;  4XNH C;  2QIR A;  3D8P A;  2J8M A;  4Q38 A;  3VWD A;  4JXQ A;  4L89 A;  4CYQ A;  1NMT A;  2CNT A;  4PK2 A;  3LOD A;  2J8N A;  4Q36 A;  4HKF A;  3W6X A;  1LRZ A;  3S6K A;  4YRH A;  1Z4E A;  2PR8 A;  1YRE A;  3QAH A;  2RC4 A;  4IF5 A;  1IYK A;  3D3S A;  5AGE A;  4AB7 A;  2FIA A;  1XMT A;  5G1Z A;  3IWG A;  4B14 A;  2EUI A;  2B5G A;  2R8V A;  3SXN A;  1YLE A;  2GIV A;  4AG7 A;  2AJ6 A;  2BL1 A;  4IUS A;  4XPK A;  4KLW A;  5BWA B;  3JTK A;  2GAN A;  4K30 A;  1IID A;  1YR0 A;  2A4N A;  2Z0Z A;  4QBJ A;  3H4Q A;  2IL4 A;  1XEB A;  5C88 A;  3PZJ A;  4MFQ A;  3EO4 A;  4II9 A;  4C2Y A;  3R96 A;  2REF A;  1RXT A;  2PDO A;  1K4J A;  2CY2 A;  4AVB A;  4FD4 A;  2YGW A;  1P4N A;  1QSR A;  4B10 A;  2B58 A;  4QVT A;  4NEX A;  2BUE A;  1YK3 A;  4FD5 A;  3FXT A;  4U9Z A;  1FY7 A;  1MJA A;  2I00 A;  2DPT A;  4JXR A;  4Y49 B;  2ZW5 A;  2Q4V A;  2DPS A;  3DDD A;  5H86 A;  4QC6 A;  2Z3P A;  3S6F A;  5F47 A;  1S3Z A;  2Q4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...