4E2AA

Crystal structure of the putative acetyltransferase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
b'QVEIRKVNQDELSLLQKIAIQTFRETFAFDNTAEQLQNFFDEAYTLSVLKLELDDKESETYFILMSGKAAGFLKVNWGSSQTEQVLEDAFEIQRLYILKAYQGLGLGKQLFEFALERAQISGLSWVWLGVWEKNVKAQLLYAKYGFEQFSKHSFFVGNKVDTDWLLKKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title Crystal Structure of the Putative acetyltransferase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 54
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e2aA00
4R9MA 4JD6A 3DSBA 3GYAA 3CXSA 1YVOA 4GS4A 2REFA 1Y9KA 1ON0A 4PSWA 2EUIA 3FXTA 4FD6A 4R3KA 5E96A 5IV0A 1L0CA 4AB7A 4XNHC 3NE7A 5HH1A 1NE9A 4NEXA 1S7FA 4CAVA 4E2AA 4HNWB 4CRYB 4JXQA 1WK4A 1YK3A 2F5IA 2REEA 4QUSA 3JVNA 2AJ6A 1KUYA 1VHSA 5JQ4A 4AVBA 1LRZA 4YRHA 5F49A 4BMHA 3PP9A 3G8WA 3ZJ0A 4UBRA 2B4BA 2VBQA 5F47A 4B5PB 4FD4A 2OZUA 4Y49C 4IUSA 2OZGA 1YVKA 4J3GA 1VKCA 3DR6A 4NF1A 2B4DA 4U9ZA 2C27A 1QSMA 5H86A 1M4GA 3ZZIA 4Y49B 3D3SA 4E0AA 4XPDB 5I0CA 1S7NA 5FVJA 3TOBA 2Q04A 5EC4A 1M1DA 2X7BA 1BOBA 1IIDA 2CNMA 3IWGA 2Q44A 1FY7A 3CXQA 3LD2A 2B3UA 4EVYA 1UFHA 4QVTA 1P0HA 4B5OA 5DWMA 1OZPA 3T90A 2FIWA 1IICA 4KOXA 2ZXVA 2FL4A 4KZTA 3VWDA 2D4PA 2P6GA 4UA3A 3KKWA 2Q4YA 3GY9A 2BUEA 3R95A 3BLNA 2WPXA 2JDDA 4YGOA 3SXNA 3V8IA 1K4JA 2ZW5A 3TTHA 4U9YA 3I9SA 4CAXA 3WR7A 3S6FA 1M4DA 4M3SA 2QMLA 4KORA 4F6AA 2CNSA 3TFYA 5C82A 4CAWA 3FNCA 3K9UA 4MJ8A 2B5GB 4H89A 2R98A 2K5TA 1XIXA 4JLYA 4UWIA 1RXTA 3DR8A 1CM0A 2FCKA 2ZW6A 1MJAA 1GHEA 1IYKA 1R57A 1I1DA 3S6HA 2BEIA 2I00A 2QECA 4JXRA 4HNXB 4HKFA 3QB8A 4YFJA 3D2PA 5ISVA 4II9A 1Z9UA 5HMNA 2P6FA 1V0CA 3DDDA 2B5GA 2ZPAA 4ONUA 3W6SA 1Z4EA 5C88A 2B4DB 4AG9A 2JEVA 2PRBA 3BJ7A 2H5MA 4MBUA 4FD7A 5GCNA 2R8VA 4KVOE 2BSWA 4QBJA 4NSQA 1QSTA 1S7KA 3H4QA 5F48A 4H6ZA 5KTDA 3TOAA 5J8CA 3S6GA 1B6BA 2OH1A 3P2FA 1P4NA 4JWPA 2FXFA 3PGPA 3SHPA 1S7LA 4QC6A 3CXPA 1NMTA 1QSRA 4XPDC 3TT2A 2Z11A 3S6KA 2PSWA 1YLEA 2IL4A 4NCZA 3BJ8A 4KUBA 2J8MA 1XMTA 2ZW7A 2JDCA 3F5BA 1YGHA 1I12A 2VZYA 4KUAA 3W91A 4I49A 1IB1E 2VQYA 2QIRA 3C26A 4AVCA 3RYOA 2HV2A 3PZJA 1B87A 5H84A 2VEZA 3EO4A 4H6UA 1N71A 4E8OA 1Q2YA 1Q2CA 1YREA 3FBUA 4CRZB 4X5KA 4FD5A 2RC4A 2R7HA 2GANA 3R9FA 1M44A 4MY3A 1BO4A 4CS0B 4AG7A 4MHDA 5EBVA 3G3SA 4PV6A 3TO7A 3F8KA 3MGDA 2VZZA 2DXQA 4DNCA 5J8FA 1U6MA 4HNYB 1I21A 4IF5A 2J8NA 2CY2A 1QSNA 2J8RA 2P0WA 2ARHA 2OZHA 1KUVA 2FIAA 3I3GA 3DNSA 4XPKA 3TE4A 1Z4RA 4L8AA 2HQYA 2B58A 1MK4A 2Y0MA 3R9EA 4ORFA 4NXYA 2VXKA 1YX0A 4KLVA 2Z10A 3T9YA 2PR1A 2Q4VA 3IGRA 1PU9A 3P2HA 5F46A 1Y7RA 2O28A 4KOSA 3TO6A 1NSLA 1WWZA 4L89A 2BL1A 3D8PA 2NMTA 2R1IA 4KOUA 4JJXA 4ZBGA 2KCWA 2G0BA 3EC4A 2P6EA 4KOTA 3EXNA 4R57A 2JLMA 1KZFA 3SXOA 3TCVA 3D2MA 1Q2DA 1YR0A 4OAEA 2Q0YA 4F0YA 2I79A 4XNHB 4RI1A 1KUXA 2Q7BA 3GKRA 1XE4A 4KLWA 2HUZA 3UY5A 1S60A 3E0KA 1MJBA 2WPWA 5JPHA 3FYNA 1RO5A 1QSOA 1Y9WA 3QAHA 2VI7A 3B8GA 4QB9A 3W6XA 1M4IA 2PC1A 4PSXA 4OLLA 1PUAA 3VWEA 2A4NA 2FE7A 5CNPA 5DWNA 2GE3A 4KOWA 5KTCA 3F0AA 2OU2A 2FSRA 4MY0A 4B5PA 2AE6A 4AVAA 4UWJA 4PK3A 2FS5A 3R1KA 2CNTA 4K30A 3JUWA 3FB3A 3TO9A 4OADA 3R9GA 3N7ZA 3FRMA 3LODA 1XEBA 5KTAA 1TIQA 2EVNA 4XPLA 1IYLA 4LX9A 2G3AA 3OWCA 1S3ZA 1XF8A 4R87A 4MI4A 3EFAA 2OB0A 5IB0A 4M85A 1SQHA 1S5KA 2PR8A 4KOVA 2GIVA 1CJWA 4KOYA 4LUAA 2Z0ZA 2ZW4A 1J4JA 4PK2A 4R3LA 2ATRA 2G3TA 3EY5A 3FIXA 4RS2A 1MJ9A 4KVXA 4U5YA 2PQ8A 2B3VA 5IX3A 2PDOA 2D4OA 3R96A 2FT0A 4KVME
chains in the Genus database with same CATH superfamily
2G9DA 4R9MA 4JD6A 4PXDA 4AXVA 3DSBA 1LOKA 3GYAA 3CXSA 4X2TA 1YVOA 4YU9A 5CBMA 1IOIA 2REFA 4GS4A 4NGNA 1Y9KA 3S9NA 4C2ZA 1ON0A 1OBRA 1CP6A 4PSWA 7CPAA 4MRIA 2EUIA 3FXTA 4MMOA 4FD6A 2YNCA 4R3KA 4OIDA 5E96A 5IV0A 1L0CA 4AB7A 2GLFA 3RAMA 1R3NA 2PVWA 4XNHC 3NE7A 2ZEOA 5HH1A 1NE9A 4NEXA 3TX8A 1S7FA 2PJ5A 4CAVA 4E2AA 3GLJA 2V8GA 4WJBA 1CG2A 3KHXA 4HNWB 4CRYB 2AFUA 2YGWA 4CPAA 4JXQA 1WK4A 4CYQA 1FNOA 1YK3A 4R7MA 3WABA 4EFDA 1Y0RA 2F5IA 2REEA 4QUSA 3JVNA 4UCPA 2AJ6A 1KUYA 3FEEA 1VHSA 5JQ4A 4AVBA 2C6PA 1LRZA 2V8DA 4P4JA 1TKJA 5G21A 4MHZA 3HLPA 1Z5RA 4YRHA 5F49A 2QVPA 2WSAA 4BMHA 5DS0A 3VH9A 3PP9A 1KWMA 3G8WA 3ZJ0A 1H8LA 4UBRA 1YLOA 2B4BA 4CGLA 3LWUA 2BOAA 3DGVA 4MFKA 4A37A 2XEFA 4NGQA 2VBQA 5F47A 3NFZA 4B5PB 3B2YA 1YQEA 2XEJA 3FECA 4FD4A 2OZUA 4M6HA 4Y49C 5CPAA 2PJBA 4IUSA 2OZGA 3KL9A 1YVKA 3LMSA 1PYTB 2PE3A 2CF4A 4J3GA 1Z8WA 1VKCA 4LQ6A 3DR6A 4NF1A 4FWUA 2B4DA 4U9ZA 5AGEA 4MHYA 4DYOA 2C27A 1QSMA 5H86A 1M4GA 3ZZIA 4Y49B 4CAEA 4EWTA 3D3SA 4E0AA 4XPDB 2ABZA 1S7NA 2JEWA 3IU1A 5I0CA 3D7HA 1ARMA 5FVJA 3TOBA 1F57A 4TWEA 2Q04A 3WC7A 4B6ZA 5EC4A 3T8WA 5LYLA 3PB4X 3D7GA 1M1DA 2PJAA 2X7BA 4A95A 1BOBA 1IIDA 2CNMA 3IWGA 4UEEA 3SJFA 3B3VA 5A28A 4A2ZA 3FVLA 1Z2LA 1FY7A 2Q44A 3CXQA 2ZELA 2O53A 3LD2A 1AMPA 2B3UA 2F8HA 2PJ2A 1UFHA 4EVYA 3H8FA 4MHPA 4QVTA 3D4UA 4ONWA 1FT7A 1P0HA 4B5OA 5DWMA 1OZPA 3T90A 2FIWA 1IICA 2PIZA 4KOXA 2ZXVA 4NGSA 3GUXA 2FL4A 3NE8A 4KZTA 3VWDA 2Z3NA 4B10A 3A9LA 1BPMA 2D4PA 4OC3A 3VATA 3MRUA 2P6GA 4FBEA 4UA3A 3KKWA 2ZENA 4EMEA 4R8FA 1IY7A 2YNCC 3CT9A 3I1UA 2Q4YA 4Q7AA 3GY9A 4ZYQA 2BUEA 3R95A 3BLNA 2WPXA 4K3NA 1JQGA 2JDDA 4YGOA 3SXNA 2PJ9A 3V8IA 1K4JA 2QJ8A 3D7FA 2ZW5A 3TTHA 1Z8XA 4U9YA 3I9SA 4CAXA 3WR7A 3S6FA 5K8PA 2JBKA 1M4DA 4IHMA 4M3SA 2QMLA 4KORA 4ZX8A 2CNSA 2PJCA 4P4IA 4CAWA 4GM5A 4KSFA 2AFMA 5C82A 1XJOA 3FNCA 4UFVA 3IO1A 3K9UA 3NH5A 4CYNA 4MJ8A 4ZY1A 3S9MA 2B5GB 4H89A 4P6YA 2R98A 1XBUA 2K5TA 3PFOA 3VARA 3WC6A 1XIXA 4JLYA 4UWIA 1RXTA 5HVFA 3DR8A 3S9LA 4HPSA 1ZG8A 1CM0A 2FCKA 4A32A 6CPAA 2ZW6A 4RN7A 1MJAA 1GHEA 1IYKA 1R57A 1I1DA 3ISZA 3S6HA 4FUUA 2BEIA 2I00A 2AFSA 3CPAA 5LYFA 2Z3LA 3QAYA 2QECA 2ZEPA 3KASA 1F2PA 4JXRA 4KSAA 4HNXB 4HKFA 1BAVA 3QB8A 4X3RA 4YFJA 1CPSA 3D2PA 2C6CA 3IEHA 5ISVA 3FF3A 4II9A 3PFEA 4A30A 3IJ3A 3D66A 1LAPA 4MFLA 4CGMA 1Z9UA 1QMUA 3KGQA 4P44A 5HMNA 3BHXA 2P6FA 4C2XA 1V0CA 3JTKA 3WT4A 4M6GA 4A33A 4P45A 3DDDA 2B5GA 3B3TA 2ZPAA 3FMCA 3N5FA 3B35A 4ONUA 3W6SA 1Z4EA 5C88A 2B4DB 4AG9A 2JEVA 2PRBA 3BJ7A 5D8NA 4CGNA 1AYEA 2H5MA 4UEZA 4F9VA 2ZEDA 3L2NA 1VGYA 4MBUA 4P10A 2RB7A 4FD7A 5GCNA 1HDUA 4B12A 2R8VA 3CPXA 4OP4A 4NGRA 4F9UA 2IQ6A 4KVOE 2BSWA 4QBJA 3B7IA 1QSTA 4KS9A 2IJZA 1S7KA 2Q4ZA 3H4QA 2C6GA 3B3WA 4NSQA 2IMOA 3H8EA 3KHZA 4P4DA 5F48A 4H6ZA 4CGPA 4UCMA 3TOAA 4OC5A 1XFOA 5J8CA 5KTDA 3S6GA 2OOTA 1B6BA 2OH1A 1YW6A 1P4NA 3P2FA 4JWPA 1TF8A 2FXFA 2GFQA 2YNEA 3PGPA 4Q38A 3SHPA 2F7VA 1S7LA 4RUHA 3HUVA 2V8VA 2PRQA 3CXPA 4QC6A 1NMTA 1QSRA 4XPDC 3JRUA 3TT2A 2PJ7A 2Z11A 3S6KA 2Z3OA 3GB0A 4Q36A 3FH4A 2PSWA 4UF4A 1YLEA 2IL4A 3SI0A 4C2YA 4NCZA 2EK8A 3BJ8A 2J8MA 4KUBA 1XMTA 2ZW7A 4OC4A 2JDCA 2JBJA 3F5BA 1YGHA 4NGMA 1I12A 2VZYA 4KUAA 3W91A 4I49A 4P4FA 3PRTA 1IB1E 2VQYA 2Z3KA 2ZEGA 1LFWA 4IAVA 2NSMA 4UIBA 1X12A 3TC8A 2QIRA 3C26A 2CXAA 4TNUA 4AVCA 3RYOA 3PB6X 4ZY2A 4MCPA 2HV2A 1A2ZA 3PZJA 1IGBA 1B87A 5H84A 2CTBA 2VEZA 3EO4A 3TFYA 5K8MA 1DTDA 2DEAA 2Q51A 1TKHA 3RNZA 1X10A 4H6UA 4IK2A 4P4EA 1N71A 2EWBA 5HVGA 4F6AA 4E8OA 1Q2YA 4NJRA 1Q2CA 1YREA 4OC2A 4PPZA 4B11A 4CYOA 3IWWA 3FBUA 4M6IA 4CRZB 4X5KA 4FAIA 3BI1A 4NGPA 3KZWA 4FD5A 2RC4A 2CIJA 1ELLP 2R7HA 3IU2A 3FX6A 5G1ZA 4C7IA 2GANA 3R9FA 1M44A 8CPAA 1Y0YA 2Q43A 4MY3A 5JM6A 1BO4A 4CS0B 4AG7A 2WUUA 2YNDA 4MHDA 5EBVA 4C7HA 3G3SA 2GREA 4PV6A 3TO7A 3F8KA 3MGDA 2PVVA 4F8ZA 2VZZA 4BINA 5K8OA 3D67A 2DXQA 3BXMA 2EK9A 4DNCA 1HDQA 1R43A 2PJ3A 5J8FA 4MHNA 5A27A 1LAMA 1U6MA 1CX8A 2V77A 4HNYB 2AFZA 1I21A 4IF5A 5JH9A 2J8NA 2CY2A 4UFXA 4CAFA 1QSNA 2J8RA 3QNVA 2P0WA 2Z3PA 1VHOA 2ARHA 2OZHA 1KUVA 2FIAA 2ZOGA 3ISXA 4MXUA 4A39A 3I3GA 4NFRA 5AG4A 2BCOA 3DNSA 4XPKA 2HB6A 4G1PA 3TE4A 2EO8A 1Z4RA 5HXDA 4L8AA 1TKFA 1DE4C 2C1CA 2B58A 2HQYA 1MK4A 2Y0MA 3R9EA 4ORFA 2XEGA 4MFQA 4NXYA 2VXKA 3IIBA 3KR5A 2PJ8A 2ANPA 5LYIA 1YX0A 3NA6A 5LRGA 4KLVA 4UFWA 5AG6A 2Z10A 5F09A 3T9YA 2PR1A 3SI2A 1YSJA 2Q4VA 3IGRA 4MCSA 1PU9A 3P2HA 2OR4A 1XMBA 4PXBA 4R6TA 1CPXA 3FEDA 2QYVA 5F46A 1Y7RA 3RBUA 2O28A 1EE3P 4KOSA 2Q7SA 3V7ZA 3H5ZA 1HEEA 3TO6A 2PIYA 1WWZA 4YWYA 1NSLA 4BBHA 4DUKA 4OMEA 3WC5A 4L89A 2POKA 1LANA 3IC1A 1LCPA 2EBJA 2BL1A 3D8PA 2DF5A 3SJGA 2NMTA 2R1IA 4KOUA 4JJXA 3KQZA 4ZBGA 2PJ0A 2KCWA 2G0BA 4ZI6A 3EC4A 2P6EA 4KOTA 3EXNA 4R57A 5AG7A 2JLMA 1KZFA 3SXOA 3TCVA 3D2MA 2Z3MA 5BWAB 1Q2DA 5ELYA 1ELMP 1YR0A 5I4MA 1Q7LA 3DLJA 4F0XA 3KQXA 3K2KA 5LYDA 2ZEFA 4OAEA 2Q0YA 1M4LA 1PCAA 4UIAA 2ZEEA 3PB7X 4DJLA 4F0YA 3CZXA 4ZGYB 3PB8X 4MCQA 1GYTA 4A38A 2I79A 3BI0A 4MFPA 2V8HA 5IB9A 4XNHB 4RI1A 5D29A 3SJEA 5K8NA 1KUXA 3H8GA 4X8IA 2AFXA 3B3CA 3IWEA 2PJ6A 3PEIA 2Q7BA 3GKRA 1CP7A 1XE4A 4KLWA 4UEFA 2HUZA 4CGOA 2DPTA 4KSIA 3UY5A 1S60A 3E0KA 1MJBA 1VIXA 2WPWA 1RTQA 1XOVA 4PXEA 5JPHA 1JWQA 3FYNA 1RO5A 3D68A 2RFHA 1QSOA 2WYRA 4WWVA 3GIUA 4ZX9A 1Y9WA 2AFWA 2J9AA 3QAHA 1QQ9A 2VI7A 3B8GA 4MFJA 3SI1A 2PJ4A 1CBXA 2BO9A 1ARLA 2ZEMA 4QB9A 3W6XA 4Z65A 1M4IA 4JYWA 2PC1A 4BD9A 4NJQA 4PSXA 1ZG9A 2I3CA 5J1QA 4OLLA 1PUAA 4P4BA 1ZO0A 2A4NA 3V38A 3VWEA 4NGTA 2FE7A 4OIWA 4A31A 2FVGA 4CYPA 3PBBA 1AUGA 5CNPA 1VHEA 2GE3A 5DWNA 4C68A 5JGFA 1XRYA 4KOWA 1BLLE 5KTCA 5HVHA 1ZLIA 3PB9X 3F0AA 3NH4A 2PCUA 2OU2A 4OC1A 1Y7EA 4MFZA 2VL1A 3CDXA 4PQAA 1ZLHA 1Z8TA 2FSRA 4MY0A 3RZAA 4B5PA 2AE6A 4AVAA 3MN8A 4UWJA 4PK3A 2FS5A 1IOFA 3FJUA 1Z8LA 2CNTA 3R1KA 1YW4A 4GXHA 4K30A 4MCRA 3JUWA 3FB3A 3KR4A 3TO9A 2DPSA 3LACA 4B14A 2AFOA 2ZOFA 1NSAA 4OADA 3R9GA 3N7ZA 3FRMA 3LODA 1XEBA 4R76A 5KTAA 2ODFA 5THWA 1TIQA 2EVNA 4XPLA 3KI9A 2XEIA 2NYQA 4ZY0A 1IYLA 4LX9A 2G3AA 3OWCA 1S3ZA 1XF8A 4R87A 4MI4A 3EFAA 2OB0A 5EMIA 1TXRA 5IB0A 2HC9A 4M85A 5G22A 2WZNA 3IFEA 4LQGA 1SQHA 1S5KA 4H2KA 2PR8A 2CTCA 2GU2A 3SJXA 2PJ1A 1TF9A 2GLJA 4KOVA 2GIVA 1CJWA 4KOYA 4LUAA 1BPNA 2Z0ZA 1J4JA 2ZW4A 3K9TA 2ATRA 1ZG7A 4OC0A 4PK2A 4R3LA 5AG5A 5G20A 2G3TA 3D7DA 4PXCA 3EY5A 3PBEA 3FIXA 1IU8A 2ZEHA 4RS2A 4O23A 5LRJA 1F2OA 1MJ9A 4JZ0A 4UCNA 4W9YA 4KVXA 3NH8A 4U5YA 3B3SA 5LRKA 2PQ8A 2O4HA 4A94A 4B13A 3RO0A 2B3VA 5IX3A 2PDOA 2D4OA 4OKOA 1YMEA 3R96A 2FT0A 1UWYA 4KVME
chains in the Genus database with same CATH topology
4R9MA 4JD6A 3DSBA 3GYAA 3CXSA 1YVOA 4GS4A 2REFA 1Y9KA 4C2ZA 1ON0A 4PSWA 2EUIA 3FXTA 4FD6A 2YNCA 4R3KA 5E96A 5IV0A 1L0CA 4AB7A 4XNHC 3NE7A 5HH1A 1NE9A 4NEXA 1S7FA 4CAVA 4E2AA 4HNWB 4CRYB 2YGWA 4JXQA 1WK4A 4CYQA 1YK3A 2F5IA 2REEA 4QUSA 3JVNA 4UCPA 2AJ6A 1KUYA 1VHSA 5JQ4A 4AVBA 1LRZA 5G21A 4YRHA 5F49A 4BMHA 2WSAA 3PP9A 3G8WA 3ZJ0A 4UBRA 2B4BA 4CGLA 4MFKA 2VBQA 5F47A 4B5PB 4FD4A 2OZUA 4Y49C 4IUSA 2OZGA 1YVKA 4J3GA 1VKCA 3DR6A 4NF1A 2B4DA 4U9ZA 5AGEA 2C27A 1QSMA 5H86A 1M4GA 3ZZIA 4Y49B 4CAEA 3D3SA 4E0AA 4XPDB 3IU1A 1S7NA 5I0CA 5FVJA 3TOBA 2Q04A 5EC4A 1M1DA 2X7BA 4A95A 1BOBA 1IIDA 2CNMA 3IWGA 5A28A 4A2ZA 2Q44A 1FY7A 3CXQA 3LD2A 2B3UA 4EVYA 1UFHA 4QVTA 1P0HA 4B5OA 5DWMA 1OZPA 3T90A 2FIWA 1IICA 4KOXA 2ZXVA 2FL4A 4KZTA 3VWDA 2Z3NA 4B10A 3A9LA 2D4PA 2P6GA 4UA3A 3KKWA 2YNCC 2Q4YA 3GY9A 2BUEA 3R95A 3BLNA 2WPXA 2JDDA 4YGOA 3SXNA 3V8IA 1K4JA 2ZW5A 3TTHA 4U9YA 3I9SA 4CAXA 3WR7A 3S6FA 1M4DA 4M3SA 2QMLA 4KORA 4F6AA 2CNSA 3TFYA 5C82A 4CAWA 4KSFA 3FNCA 4UFVA 3K9UA 4CYNA 4MJ8A 2B5GB 4H89A 2R98A 2K5TA 1XIXA 4JLYA 4UWIA 1RXTA 3DR8A 1CM0A 2FCKA 4A32A 2ZW6A 1MJAA 1GHEA 1IYKA 1R57A 1I1DA 3S6HA 2BEIA 2I00A 2Z3LA 2QECA 4JXRA 4KSAA 4HNXB 4HKFA 3QB8A 4YFJA 3D2PA 5ISVA 4II9A 4A30A 4CGMA 4MFLA 1Z9UA 5HMNA 2P6FA 4C2XA 1V0CA 3JTKA 4A33A 3DDDA 2B5GA 2ZPAA 4ONUA 3W6SA 1Z4EA 5C88A 2B4DB 4AG9A 2JEVA 2PRBA 3BJ7A 4CGNA 2H5MA 4MBUA 4FD7A 5GCNA 4B12A 2R8VA 4KVOE 2BSWA 4QBJA 4NSQA 1QSTA 4KS9A 1S7KA 3H4QA 5F48A 4H6ZA 4CGPA 4UCMA 3TOAA 5J8CA 5KTDA 3S6GA 1B6BA 2OH1A 3P2FA 1P4NA 4JWPA 2FXFA 2YNEA 3PGPA 4Q38A 3SHPA 1S7LA 4QC6A 3CXPA 1NMTA 1QSRA 4XPDC 3TT2A 2Z11A 3S6KA 2Z3OA 4Q36A 2PSWA 1YLEA 2IL4A 4C2YA 4NCZA 3BJ8A 2J8MA 4KUBA 1XMTA 2ZW7A 2JDCA 3F5BA 1YGHA 1I12A 2VZYA 4KUAA 3W91A 4I49A 1IB1E 2VQYA 2Z3KA 2QIRA 3C26A 2CXAA 4AVCA 3RYOA 2HV2A 3PZJA 1B87A 5H84A 2VEZA 3EO4A 4H6UA 1N71A 4E8OA 1Q2YA 1Q2CA 1YREA 4B11A 4CYOA 3FBUA 4CRZB 4X5KA 4FD5A 2RC4A 2R7HA 3IU2A 5G1ZA 4C7IA 2GANA 3R9FA 1M44A 4MY3A 1BO4A 4CS0B 4AG7A 2WUUA 2YNDA 4MHDA 5EBVA 4C7HA 3G3SA 4PV6A 3TO7A 3F8KA 3MGDA 2VZZA 2DXQA 4DNCA 5J8FA 5A27A 1U6MA 4HNYB 1I21A 4IF5A 2J8NA 2CY2A 4UFXA 4CAFA 1QSNA 2J8RA 2P0WA 2Z3PA 2ARHA 2OZHA 1KUVA 2FIAA 5AG4A 3I3GA 3DNSA 4XPKA 3TE4A 1Z4RA 4L8AA 2HQYA 2B58A 1MK4A 2Y0MA 3R9EA 4ORFA 4MFQA 4NXYA 2VXKA 1YX0A 4KLVA 4UFWA 5AG6A 2Z10A 3T9YA 2PR1A 2Q4VA 3IGRA 1PU9A 3P2HA 5F46A 1Y7RA 2O28A 4KOSA 3H5ZA 3TO6A 1NSLA 1WWZA 4BBHA 4L89A 2BL1A 3D8PA 2NMTA 2R1IA 4KOUA 4JJXA 4ZBGA 2KCWA 2G0BA 3EC4A 2P6EA 4KOTA 3EXNA 4R57A 5AG7A 2JLMA 1KZFA 3SXOA 3TCVA 3D2MA 2Z3MA 5BWAB 1Q2DA 1YR0A 4F0XA 4OAEA 2Q0YA 4F0YA 4ZGYB 2I79A 4MFPA 4XNHB 4RI1A 1KUXA 3IWEA 2Q7BA 3GKRA 1XE4A 4KLWA 2HUZA 4CGOA 2DPTA 3UY5A 1S60A 3E0KA 1MJBA 2WPWA 5JPHA 3FYNA 1RO5A 1QSOA 1Y9WA 3QAHA 2VI7A 3B8GA 4MFJA 4QB9A 3W6XA 1M4IA 2PC1A 4PSXA 4OLLA 1PUAA 3VWEA 1ZO0A 2A4NA 2FE7A 4A31A 4CYPA 5CNPA 5DWNA 2GE3A 4C68A 4KOWA 5KTCA 3F0AA 2OU2A 4MFZA 2FSRA 4MY0A 4B5PA 2AE6A 4AVAA 4UWJA 4PK3A 2FS5A 3R1KA 2CNTA 4K30A 3JUWA 3FB3A 4B14A 3TO9A 2DPSA 4OADA 3R9GA 3N7ZA 3FRMA 3LODA 1XEBA 5KTAA 1TIQA 2EVNA 4XPLA 1IYLA 4LX9A 2G3AA 3OWCA 1S3ZA 1XF8A 4R87A 4MI4A 3EFAA 2OB0A 5IB0A 4M85A 5G22A 1SQHA 1S5KA 2PR8A 4KOVA 2GIVA 1CJWA 4KOYA 4LUAA 2Z0ZA 2ZW4A 1J4JA 4PK2A 4R3LA 2ATRA 5AG5A 5G20A 2G3TA 3EY5A 3FIXA 4RS2A 1MJ9A 4UCNA 4KVXA 4U5YA 2PQ8A 4B13A 2B3VA 5IX3A 2PDOA 2D4OA 3R96A 2FT0A 4KVME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9M A;  4JD6 A;  3DSB A;  3GYA A;  3CXS A;  1YVO A;  4GS4 A;  2REF A;  1Y9K A;  1ON0 A;  4PSW A;  2EUI A;  3FXT A;  4FD6 A;  4R3K A;  5E96 A;  5IV0 A;  1L0C A;  4AB7 A;  4XNH C;  3NE7 A;  5HH1 A;  1NE9 A;  4NEX A;  1S7F A;  4CAV A;  4E2A A;  4HNW B;  4CRY B;  4JXQ A;  1WK4 A;  1YK3 A;  2F5I A;  2REE A;  4QUS A;  3JVN A;  2AJ6 A;  1KUY A;  1VHS A;  5JQ4 A;  4AVB A;  1LRZ A;  4YRH A;  5F49 A;  4BMH A;  3PP9 A;  3G8W A;  3ZJ0 A;  4UBR A;  2B4B A;  2VBQ A;  5F47 A;  4B5P B;  4FD4 A;  2OZU A;  4Y49 C;  4IUS A;  2OZG A;  1YVK A;  4J3G A;  1VKC A;  3DR6 A;  4NF1 A;  2B4D A;  4U9Z A;  2C27 A;  1QSM A;  5H86 A;  1M4G A;  3ZZI A;  4Y49 B;  3D3S A;  4E0A A;  4XPD B;  5I0C A;  1S7N A;  5FVJ A;  3TOB A;  2Q04 A;  5EC4 A;  1M1D A;  2X7B A;  1BOB A;  1IID A;  2CNM A;  3IWG A;  2Q44 A;  1FY7 A;  3CXQ A;  3LD2 A;  2B3U A;  4EVY A;  1UFH A;  4QVT A;  1P0H A;  4B5O A;  5DWM A;  1OZP A;  3T90 A;  2FIW A;  1IIC A;  4KOX A;  2ZXV A;  2FL4 A;  4KZT A;  3VWD A;  2D4P A;  2P6G A;  4UA3 A;  3KKW A;  2Q4Y A;  3GY9 A;  2BUE A;  3R95 A;  3BLN A;  2WPX A;  2JDD A;  4YGO A;  3SXN A;  3V8I A;  1K4J A;  2ZW5 A;  3TTH A;  4U9Y A;  3I9S A;  4CAX A;  3WR7 A;  3S6F A;  1M4D A;  4M3S A;  2QML A;  4KOR A;  4F6A A;  2CNS A;  3TFY A;  5C82 A;  4CAW A;  3FNC A;  3K9U A;  4MJ8 A;  2B5G B;  4H89 A;  2R98 A;  2K5T A;  1XIX A;  4JLY A;  4UWI A;  1RXT A;  3DR8 A;  1CM0 A;  2FCK A;  2ZW6 A;  1MJA A;  1GHE A;  1IYK A;  1R57 A;  1I1D A;  3S6H A;  2BEI A;  2I00 A;  2QEC A;  4JXR A;  4HNX B;  4HKF A;  3QB8 A;  4YFJ A;  3D2P A;  5ISV A;  4II9 A;  1Z9U A;  5HMN A;  2P6F A;  1V0C A;  3DDD A;  2B5G A;  2ZPA A;  4ONU A;  3W6S A;  1Z4E A;  5C88 A;  2B4D B;  4AG9 A;  2JEV A;  2PRB A;  3BJ7 A;  2H5M A;  4MBU A;  4FD7 A;  5GCN A;  2R8V A;  4KVO E;  2BSW A;  4QBJ A;  4NSQ A;  1QST A;  1S7K A;  3H4Q A;  5F48 A;  4H6Z A;  5KTD A;  3TOA A;  5J8C A;  3S6G A;  1B6B A;  2OH1 A;  3P2F A;  1P4N A;  4JWP A;  2FXF A;  3PGP A;  3SHP A;  1S7L A;  4QC6 A;  3CXP A;  1NMT A;  1QSR A;  4XPD C;  3TT2 A;  2Z11 A;  3S6K A;  2PSW A;  1YLE A;  2IL4 A;  4NCZ A;  3BJ8 A;  4KUB A;  2J8M A;  1XMT A;  2ZW7 A;  2JDC A;  3F5B A;  1YGH A;  1I12 A;  2VZY A;  4KUA A;  3W91 A;  4I49 A;  1IB1 E;  2VQY A;  2QIR A;  3C26 A;  4AVC A;  3RYO A;  2HV2 A;  3PZJ A;  1B87 A;  5H84 A;  2VEZ A;  3EO4 A;  4H6U A;  1N71 A;  4E8O A;  1Q2Y A;  1Q2C A;  1YRE A;  3FBU A;  4CRZ B;  4X5K A;  4FD5 A;  2RC4 A;  2R7H A;  2GAN A;  3R9F A;  1M44 A;  4MY3 A;  1BO4 A;  4CS0 B;  4AG7 A;  4MHD A;  5EBV A;  3G3S A;  4PV6 A;  3TO7 A;  3F8K A;  3MGD A;  2VZZ A;  2DXQ A;  4DNC A;  5J8F A;  1U6M A;  4HNY B;  1I21 A;  4IF5 A;  2J8N A;  2CY2 A;  1QSN A;  2J8R A;  2P0W A;  2ARH A;  2OZH A;  1KUV A;  2FIA A;  3I3G A;  3DNS A;  4XPK A;  3TE4 A;  1Z4R A;  4L8A A;  2HQY A;  2B58 A;  1MK4 A;  2Y0M A;  3R9E A;  4ORF A;  4NXY A;  2VXK A;  1YX0 A;  4KLV A;  2Z10 A;  3T9Y A;  2PR1 A;  2Q4V A;  3IGR A;  1PU9 A;  3P2H A;  5F46 A;  1Y7R A;  2O28 A;  4KOS A;  3TO6 A;  1NSL A;  1WWZ A;  4L89 A;  2BL1 A;  3D8P A;  2NMT A;  2R1I A;  4KOU A;  4JJX A;  4ZBG A;  2KCW A;  2G0B A;  3EC4 A;  2P6E A;  4KOT A;  3EXN A;  4R57 A;  2JLM A;  1KZF A;  3SXO A;  3TCV A;  3D2M A;  1Q2D A;  1YR0 A;  4OAE A;  2Q0Y A;  4F0Y A;  2I79 A;  4XNH B;  4RI1 A;  1KUX A;  2Q7B A;  3GKR A;  1XE4 A;  4KLW A;  2HUZ A;  3UY5 A;  1S60 A;  3E0K A;  1MJB A;  2WPW A;  5JPH A;  3FYN A;  1RO5 A;  1QSO A;  1Y9W A;  3QAH A;  2VI7 A;  3B8G A;  4QB9 A;  3W6X A;  1M4I A;  2PC1 A;  4PSX A;  4OLL A;  1PUA A;  3VWE A;  2A4N A;  2FE7 A;  5CNP A;  5DWN A;  2GE3 A;  4KOW A;  5KTC A;  3F0A A;  2OU2 A;  2FSR A;  4MY0 A;  4B5P A;  2AE6 A;  4AVA A;  4UWJ A;  4PK3 A;  2FS5 A;  3R1K A;  2CNT A;  4K30 A;  3JUW A;  3FB3 A;  3TO9 A;  4OAD A;  3R9G A;  3N7Z A;  3FRM A;  3LOD A;  1XEB A;  5KTA A;  1TIQ A;  2EVN A;  4XPL A;  1IYL A;  4LX9 A;  2G3A A;  3OWC A;  1S3Z A;  1XF8 A;  4R87 A;  4MI4 A;  3EFA A;  2OB0 A;  5IB0 A;  4M85 A;  1SQH A;  1S5K A;  2PR8 A;  4KOV A;  2GIV A;  1CJW A;  4KOY A;  4LUA A;  2Z0Z A;  2ZW4 A;  1J4J A;  4PK2 A;  4R3L A;  2ATR A;  2G3T A;  3EY5 A;  3FIX A;  4RS2 A;  1MJ9 A;  4KVX A;  4U5Y A;  2PQ8 A;  2B3V A;  5IX3 A;  2PDO A;  2D4O A;  3R96 A;  2FT0 A;  4KVM E; 
#chains in the Genus database with same CATH topology
 2G9D A;  4R9M A;  4JD6 A;  4PXD A;  4AXV A;  3DSB A;  1LOK A;  3GYA A;  3CXS A;  4X2T A;  1YVO A;  4YU9 A;  5CBM A;  1IOI A;  2REF A;  4GS4 A;  4NGN A;  1Y9K A;  3S9N A;  4C2Z A;  1ON0 A;  1OBR A;  1CP6 A;  4PSW A;  7CPA A;  4MRI A;  2EUI A;  3FXT A;  4MMO A;  4FD6 A;  2YNC A;  4R3K A;  4OID A;  5E96 A;  5IV0 A;  1L0C A;  4AB7 A;  2GLF A;  3RAM A;  1R3N A;  2PVW A;  4XNH C;  3NE7 A;  2ZEO A;  5HH1 A;  1NE9 A;  4NEX A;  3TX8 A;  1S7F A;  2PJ5 A;  4CAV A;  4E2A A;  3GLJ A;  2V8G A;  4WJB A;  1CG2 A;  3KHX A;  4HNW B;  4CRY B;  2AFU A;  2YGW A;  4CPA A;  4JXQ A;  1WK4 A;  4CYQ A;  1FNO A;  1YK3 A;  4R7M A;  3WAB A;  4EFD A;  1Y0R A;  2F5I A;  2REE A;  4QUS A;  3JVN A;  4UCP A;  2AJ6 A;  1KUY A;  3FEE A;  1VHS A;  5JQ4 A;  4AVB A;  2C6P A;  1LRZ A;  2V8D A;  4P4J A;  1TKJ A;  5G21 A;  4MHZ A;  3HLP A;  1Z5R A;  4YRH A;  5F49 A;  2QVP A;  2WSA A;  4BMH A;  5DS0 A;  3VH9 A;  3PP9 A;  1KWM A;  3G8W A;  3ZJ0 A;  1H8L A;  4UBR A;  1YLO A;  2B4B A;  4CGL A;  3LWU A;  2BOA A;  3DGV A;  4MFK A;  4A37 A;  2XEF A;  4NGQ A;  2VBQ A;  5F47 A;  3NFZ A;  4B5P B;  3B2Y A;  1YQE A;  2XEJ A;  3FEC A;  4FD4 A;  2OZU A;  4M6H A;  4Y49 C;  5CPA A;  2PJB A;  4IUS A;  2OZG A;  3KL9 A;  1YVK A;  3LMS A;  1PYT B;  2PE3 A;  2CF4 A;  4J3G A;  1Z8W A;  1VKC A;  4LQ6 A;  3DR6 A;  4NF1 A;  4FWU A;  2B4D A;  4U9Z A;  5AGE A;  4MHY A;  4DYO A;  2C27 A;  1QSM A;  5H86 A;  1M4G A;  3ZZI A;  4Y49 B;  4CAE A;  4EWT A;  3D3S A;  4E0A A;  4XPD B;  2ABZ A;  1S7N A;  2JEW A;  3IU1 A;  5I0C A;  3D7H A;  1ARM A;  5FVJ A;  3TOB A;  1F57 A;  4TWE A;  2Q04 A;  3WC7 A;  4B6Z A;  5EC4 A;  3T8W A;  5LYL A;  3PB4 X;  3D7G A;  1M1D A;  2PJA A;  2X7B A;  4A95 A;  1BOB A;  1IID A;  2CNM A;  3IWG A;  4UEE A;  3SJF A;  3B3V A;  5A28 A;  4A2Z A;  3FVL A;  1Z2L A;  1FY7 A;  2Q44 A;  3CXQ A;  2ZEL A;  2O53 A;  3LD2 A;  1AMP A;  2B3U A;  2F8H A;  2PJ2 A;  1UFH A;  4EVY A;  3H8F A;  4MHP A;  4QVT A;  3D4U A;  4ONW A;  1FT7 A;  1P0H A;  4B5O A;  5DWM A;  1OZP A;  3T90 A;  2FIW A;  1IIC A;  2PIZ A;  4KOX A;  2ZXV A;  4NGS A;  3GUX A;  2FL4 A;  3NE8 A;  4KZT A;  3VWD A;  2Z3N A;  4B10 A;  3A9L A;  1BPM A;  2D4P A;  4OC3 A;  3VAT A;  3MRU A;  2P6G A;  4FBE A;  4UA3 A;  3KKW A;  2ZEN A;  4EME A;  4R8F A;  1IY7 A;  2YNC C;  3CT9 A;  3I1U A;  2Q4Y A;  4Q7A A;  3GY9 A;  4ZYQ A;  2BUE A;  3R95 A;  3BLN A;  2WPX A;  4K3N A;  1JQG A;  2JDD A;  4YGO A;  3SXN A;  2PJ9 A;  3V8I A;  1K4J A;  2QJ8 A;  3D7F A;  2ZW5 A;  3TTH A;  1Z8X A;  4U9Y A;  3I9S A;  4CAX A;  3WR7 A;  3S6F A;  5K8P A;  2JBK A;  1M4D A;  4IHM A;  4M3S A;  2QML A;  4KOR A;  4ZX8 A;  2CNS A;  2PJC A;  4P4I A;  4CAW A;  4GM5 A;  4KSF A;  2AFM A;  5C82 A;  1XJO A;  3FNC A;  4UFV A;  3IO1 A;  3K9U A;  3NH5 A;  4CYN A;  4MJ8 A;  4ZY1 A;  3S9M A;  2B5G B;  4H89 A;  4P6Y A;  2R98 A;  1XBU A;  2K5T A;  3PFO A;  3VAR A;  3WC6 A;  1XIX A;  4JLY A;  4UWI A;  1RXT A;  5HVF A;  3DR8 A;  3S9L A;  4HPS A;  1ZG8 A;  1CM0 A;  2FCK A;  4A32 A;  6CPA A;  2ZW6 A;  4RN7 A;  1MJA A;  1GHE A;  1IYK A;  1R57 A;  1I1D A;  3ISZ A;  3S6H A;  4FUU A;  2BEI A;  2I00 A;  2AFS A;  3CPA A;  5LYF A;  2Z3L A;  3QAY A;  2QEC A;  2ZEP A;  3KAS A;  1F2P A;  4JXR A;  4KSA A;  4HNX B;  4HKF A;  1BAV A;  3QB8 A;  4X3R A;  4YFJ A;  1CPS A;  3D2P A;  2C6C A;  3IEH A;  5ISV A;  3FF3 A;  4II9 A;  3PFE A;  4A30 A;  3IJ3 A;  3D66 A;  1LAP A;  4MFL A;  4CGM A;  1Z9U A;  1QMU A;  3KGQ A;  4P44 A;  5HMN A;  3BHX A;  2P6F A;  4C2X A;  1V0C A;  3JTK A;  3WT4 A;  4M6G A;  4A33 A;  4P45 A;  3DDD A;  2B5G A;  3B3T A;  2ZPA A;  3FMC A;  3N5F A;  3B35 A;  4ONU A;  3W6S A;  1Z4E A;  5C88 A;  2B4D B;  4AG9 A;  2JEV A;  2PRB A;  3BJ7 A;  5D8N A;  4CGN A;  1AYE A;  2H5M A;  4UEZ A;  4F9V A;  2ZED A;  3L2N A;  1VGY A;  4MBU A;  4P10 A;  2RB7 A;  4FD7 A;  5GCN A;  1HDU A;  4B12 A;  2R8V A;  3CPX A;  4OP4 A;  4NGR A;  4F9U A;  2IQ6 A;  4KVO E;  2BSW A;  4QBJ A;  3B7I A;  1QST A;  4KS9 A;  2IJZ A;  1S7K A;  2Q4Z A;  3H4Q A;  2C6G A;  3B3W A;  4NSQ A;  2IMO A;  3H8E A;  3KHZ A;  4P4D A;  5F48 A;  4H6Z A;  4CGP A;  4UCM A;  3TOA A;  4OC5 A;  1XFO A;  5J8C A;  5KTD A;  3S6G A;  2OOT A;  1B6B A;  2OH1 A;  1YW6 A;  1P4N A;  3P2F A;  4JWP A;  1TF8 A;  2FXF A;  2GFQ A;  2YNE A;  3PGP A;  4Q38 A;  3SHP A;  2F7V A;  1S7L A;  4RUH A;  3HUV A;  2V8V A;  2PRQ A;  3CXP A;  4QC6 A;  1NMT A;  1QSR A;  4XPD C;  3JRU A;  3TT2 A;  2PJ7 A;  2Z11 A;  3S6K A;  2Z3O A;  3GB0 A;  4Q36 A;  3FH4 A;  2PSW A;  4UF4 A;  1YLE A;  2IL4 A;  3SI0 A;  4C2Y A;  4NCZ A;  2EK8 A;  3BJ8 A;  2J8M A;  4KUB A;  1XMT A;  2ZW7 A;  4OC4 A;  2JDC A;  2JBJ A;  3F5B A;  1YGH A;  4NGM A;  1I12 A;  2VZY A;  4KUA A;  3W91 A;  4I49 A;  4P4F A;  3PRT A;  1IB1 E;  2VQY A;  2Z3K A;  2ZEG A;  1LFW A;  4IAV A;  2NSM A;  4UIB A;  1X12 A;  3TC8 A;  2QIR A;  3C26 A;  2CXA A;  4TNU A;  4AVC A;  3RYO A;  3PB6 X;  4ZY2 A;  4MCP A;  2HV2 A;  1A2Z A;  3PZJ A;  1IGB A;  1B87 A;  5H84 A;  2CTB A;  2VEZ A;  3EO4 A;  3TFY A;  5K8M A;  1DTD A;  2DEA A;  2Q51 A;  1TKH A;  3RNZ A;  1X10 A;  4H6U A;  4IK2 A;  4P4E A;  1N71 A;  2EWB A;  5HVG A;  4F6A A;  4E8O A;  1Q2Y A;  4NJR A;  1Q2C A;  1YRE A;  4OC2 A;  4PPZ A;  4B11 A;  4CYO A;  3IWW A;  3FBU A;  4M6I A;  4CRZ B;  4X5K A;  4FAI A;  3BI1 A;  4NGP A;  3KZW A;  4FD5 A;  2RC4 A;  2CIJ A;  1ELL P;  2R7H A;  3IU2 A;  3FX6 A;  5G1Z A;  4C7I A;  2GAN A;  3R9F A;  1M44 A;  8CPA A;  1Y0Y A;  2Q43 A;  4MY3 A;  5JM6 A;  1BO4 A;  4CS0 B;  4AG7 A;  2WUU A;  2YND A;  4MHD A;  5EBV A;  4C7H A;  3G3S A;  2GRE A;  4PV6 A;  3TO7 A;  3F8K A;  3MGD A;  2PVV A;  4F8Z A;  2VZZ A;  4BIN A;  5K8O A;  3D67 A;  2DXQ A;  3BXM A;  2EK9 A;  4DNC A;  1HDQ A;  1R43 A;  2PJ3 A;  5J8F A;  4MHN A;  5A27 A;  1LAM A;  1U6M A;  1CX8 A;  2V77 A;  4HNY B;  2AFZ A;  1I21 A;  4IF5 A;  5JH9 A;  2J8N A;  2CY2 A;  4UFX A;  4CAF A;  1QSN A;  2J8R A;  3QNV A;  2P0W A;  2Z3P A;  1VHO A;  2ARH A;  2OZH A;  1KUV A;  2FIA A;  2ZOG A;  3ISX A;  4MXU A;  4A39 A;  3I3G A;  4NFR A;  5AG4 A;  2BCO A;  3DNS A;  4XPK A;  2HB6 A;  4G1P A;  3TE4 A;  2EO8 A;  1Z4R A;  5HXD A;  4L8A A;  1TKF A;  1DE4 C;  2C1C A;  2B58 A;  2HQY A;  1MK4 A;  2Y0M A;  3R9E A;  4ORF A;  2XEG A;  4MFQ A;  4NXY A;  2VXK A;  3IIB A;  3KR5 A;  2PJ8 A;  2ANP A;  5LYI A;  1YX0 A;  3NA6 A;  5LRG A;  4KLV A;  4UFW A;  5AG6 A;  2Z10 A;  5F09 A;  3T9Y A;  2PR1 A;  3SI2 A;  1YSJ A;  2Q4V A;  3IGR A;  4MCS A;  1PU9 A;  3P2H A;  2OR4 A;  1XMB A;  4PXB A;  4R6T A;  1CPX A;  3FED A;  2QYV A;  5F46 A;  1Y7R A;  3RBU A;  2O28 A;  1EE3 P;  4KOS A;  2Q7S A;  3V7Z A;  3H5Z A;  1HEE A;  3TO6 A;  2PIY A;  1WWZ A;  4YWY A;  1NSL A;  4BBH A;  4DUK A;  4OME A;  3WC5 A;  4L89 A;  2POK A;  1LAN A;  3IC1 A;  1LCP A;  2EBJ A;  2BL1 A;  3D8P A;  2DF5 A;  3SJG A;  2NMT A;  2R1I A;  4KOU A;  4JJX A;  3KQZ A;  4ZBG A;  2PJ0 A;  2KCW A;  2G0B A;  4ZI6 A;  3EC4 A;  2P6E A;  4KOT A;  3EXN A;  4R57 A;  5AG7 A;  2JLM A;  1KZF A;  3SXO A;  3TCV A;  3D2M A;  2Z3M A;  5BWA B;  1Q2D A;  5ELY A;  1ELM P;  1YR0 A;  5I4M A;  1Q7L A;  3DLJ A;  4F0X A;  3KQX A;  3K2K A;  5LYD A;  2ZEF A;  4OAE A;  2Q0Y A;  1M4L A;  1PCA A;  4UIA A;  2ZEE A;  3PB7 X;  4DJL A;  4F0Y A;  3CZX A;  4ZGY B;  3PB8 X;  4MCQ A;  1GYT A;  4A38 A;  2I79 A;  3BI0 A;  4MFP A;  2V8H A;  5IB9 A;  4XNH B;  4RI1 A;  5D29 A;  3SJE A;  5K8N A;  1KUX A;  3H8G A;  4X8I A;  2AFX A;  3B3C A;  3IWE A;  2PJ6 A;  3PEI A;  2Q7B A;  3GKR A;  1CP7 A;  1XE4 A;  4KLW A;  4UEF A;  2HUZ A;  4CGO A;  2DPT A;  4KSI A;  3UY5 A;  1S60 A;  3E0K A;  1MJB A;  1VIX A;  2WPW A;  1RTQ A;  1XOV A;  4PXE A;  5JPH A;  1JWQ A;  3FYN A;  1RO5 A;  3D68 A;  2RFH A;  1QSO A;  2WYR A;  4WWV A;  3GIU A;  4ZX9 A;  1Y9W A;  2AFW A;  2J9A A;  3QAH A;  1QQ9 A;  2VI7 A;  3B8G A;  4MFJ A;  3SI1 A;  2PJ4 A;  1CBX A;  2BO9 A;  1ARL A;  2ZEM A;  4QB9 A;  3W6X A;  4Z65 A;  1M4I A;  4JYW A;  2PC1 A;  4BD9 A;  4NJQ A;  4PSX A;  1ZG9 A;  2I3C A;  5J1Q A;  4OLL A;  1PUA A;  4P4B A;  1ZO0 A;  2A4N A;  3V38 A;  3VWE A;  4NGT A;  2FE7 A;  4OIW A;  4A31 A;  2FVG A;  4CYP A;  3PBB A;  1AUG A;  5CNP A;  1VHE A;  2GE3 A;  5DWN A;  4C68 A;  5JGF A;  1XRY A;  4KOW A;  1BLL E;  5KTC A;  5HVH A;  1ZLI A;  3PB9 X;  3F0A A;  3NH4 A;  2PCU A;  2OU2 A;  4OC1 A;  1Y7E A;  4MFZ A;  2VL1 A;  3CDX A;  4PQA A;  1ZLH A;  1Z8T A;  2FSR A;  4MY0 A;  3RZA A;  4B5P A;  2AE6 A;  4AVA A;  3MN8 A;  4UWJ A;  4PK3 A;  2FS5 A;  1IOF A;  3FJU A;  1Z8L A;  2CNT A;  3R1K A;  1YW4 A;  4GXH A;  4K30 A;  4MCR A;  3JUW A;  3FB3 A;  3KR4 A;  3TO9 A;  2DPS A;  3LAC A;  4B14 A;  2AFO A;  2ZOF A;  1NSA A;  4OAD A;  3R9G A;  3N7Z A;  3FRM A;  3LOD A;  1XEB A;  4R76 A;  5KTA A;  2ODF A;  5THW A;  1TIQ A;  2EVN A;  4XPL A;  3KI9 A;  2XEI A;  2NYQ A;  4ZY0 A;  1IYL A;  4LX9 A;  2G3A A;  3OWC A;  1S3Z A;  1XF8 A;  4R87 A;  4MI4 A;  3EFA A;  2OB0 A;  5EMI A;  1TXR A;  5IB0 A;  2HC9 A;  4M85 A;  5G22 A;  2WZN A;  3IFE A;  4LQG A;  1SQH A;  1S5K A;  4H2K A;  2PR8 A;  2CTC A;  2GU2 A;  3SJX A;  2PJ1 A;  1TF9 A;  2GLJ A;  4KOV A;  2GIV A;  1CJW A;  4KOY A;  4LUA A;  1BPN A;  2Z0Z A;  1J4J A;  2ZW4 A;  3K9T A;  2ATR A;  1ZG7 A;  4OC0 A;  4PK2 A;  4R3L A;  5AG5 A;  5G20 A;  2G3T A;  3D7D A;  4PXC A;  3EY5 A;  3PBE A;  3FIX A;  1IU8 A;  2ZEH A;  4RS2 A;  4O23 A;  5LRJ A;  1F2O A;  1MJ9 A;  4JZ0 A;  4UCN A;  4W9Y A;  4KVX A;  3NH8 A;  4U5Y A;  3B3S A;  5LRK A;  2PQ8 A;  2O4H A;  4A94 A;  4B13 A;  3RO0 A;  2B3V A;  5IX3 A;  2PDO A;  2D4O A;  4OKO A;  1YME A;  3R96 A;  2FT0 A;  1UWY A;  4KVM E; 
#chains in the Genus database with same CATH homology
 4R9M A;  4JD6 A;  3DSB A;  3GYA A;  3CXS A;  1YVO A;  4GS4 A;  2REF A;  1Y9K A;  4C2Z A;  1ON0 A;  4PSW A;  2EUI A;  3FXT A;  4FD6 A;  2YNC A;  4R3K A;  5E96 A;  5IV0 A;  1L0C A;  4AB7 A;  4XNH C;  3NE7 A;  5HH1 A;  1NE9 A;  4NEX A;  1S7F A;  4CAV A;  4E2A A;  4HNW B;  4CRY B;  2YGW A;  4JXQ A;  1WK4 A;  4CYQ A;  1YK3 A;  2F5I A;  2REE A;  4QUS A;  3JVN A;  4UCP A;  2AJ6 A;  1KUY A;  1VHS A;  5JQ4 A;  4AVB A;  1LRZ A;  5G21 A;  4YRH A;  5F49 A;  4BMH A;  2WSA A;  3PP9 A;  3G8W A;  3ZJ0 A;  4UBR A;  2B4B A;  4CGL A;  4MFK A;  2VBQ A;  5F47 A;  4B5P B;  4FD4 A;  2OZU A;  4Y49 C;  4IUS A;  2OZG A;  1YVK A;  4J3G A;  1VKC A;  3DR6 A;  4NF1 A;  2B4D A;  4U9Z A;  5AGE A;  2C27 A;  1QSM A;  5H86 A;  1M4G A;  3ZZI A;  4Y49 B;  4CAE A;  3D3S A;  4E0A A;  4XPD B;  3IU1 A;  1S7N A;  5I0C A;  5FVJ A;  3TOB A;  2Q04 A;  5EC4 A;  1M1D A;  2X7B A;  4A95 A;  1BOB A;  1IID A;  2CNM A;  3IWG A;  5A28 A;  4A2Z A;  2Q44 A;  1FY7 A;  3CXQ A;  3LD2 A;  2B3U A;  4EVY A;  1UFH A;  4QVT A;  1P0H A;  4B5O A;  5DWM A;  1OZP A;  3T90 A;  2FIW A;  1IIC A;  4KOX A;  2ZXV A;  2FL4 A;  4KZT A;  3VWD A;  2Z3N A;  4B10 A;  3A9L A;  2D4P A;  2P6G A;  4UA3 A;  3KKW A;  2YNC C;  2Q4Y A;  3GY9 A;  2BUE A;  3R95 A;  3BLN A;  2WPX A;  2JDD A;  4YGO A;  3SXN A;  3V8I A;  1K4J A;  2ZW5 A;  3TTH A;  4U9Y A;  3I9S A;  4CAX A;  3WR7 A;  3S6F A;  1M4D A;  4M3S A;  2QML A;  4KOR A;  4F6A A;  2CNS A;  3TFY A;  5C82 A;  4CAW A;  4KSF A;  3FNC A;  4UFV A;  3K9U A;  4CYN A;  4MJ8 A;  2B5G B;  4H89 A;  2R98 A;  2K5T A;  1XIX A;  4JLY A;  4UWI A;  1RXT A;  3DR8 A;  1CM0 A;  2FCK A;  4A32 A;  2ZW6 A;  1MJA A;  1GHE A;  1IYK A;  1R57 A;  1I1D A;  3S6H A;  2BEI A;  2I00 A;  2Z3L A;  2QEC A;  4JXR A;  4KSA A;  4HNX B;  4HKF A;  3QB8 A;  4YFJ A;  3D2P A;  5ISV A;  4II9 A;  4A30 A;  4CGM A;  4MFL A;  1Z9U A;  5HMN A;  2P6F A;  4C2X A;  1V0C A;  3JTK A;  4A33 A;  3DDD A;  2B5G A;  2ZPA A;  4ONU A;  3W6S A;  1Z4E A;  5C88 A;  2B4D B;  4AG9 A;  2JEV A;  2PRB A;  3BJ7 A;  4CGN A;  2H5M A;  4MBU A;  4FD7 A;  5GCN A;  4B12 A;  2R8V A;  4KVO E;  2BSW A;  4QBJ A;  4NSQ A;  1QST A;  4KS9 A;  1S7K A;  3H4Q A;  5F48 A;  4H6Z A;  4CGP A;  4UCM A;  3TOA A;  5J8C A;  5KTD A;  3S6G A;  1B6B A;  2OH1 A;  3P2F A;  1P4N A;  4JWP A;  2FXF A;  2YNE A;  3PGP A;  4Q38 A;  3SHP A;  1S7L A;  4QC6 A;  3CXP A;  1NMT A;  1QSR A;  4XPD C;  3TT2 A;  2Z11 A;  3S6K A;  2Z3O A;  4Q36 A;  2PSW A;  1YLE A;  2IL4 A;  4C2Y A;  4NCZ A;  3BJ8 A;  2J8M A;  4KUB A;  1XMT A;  2ZW7 A;  2JDC A;  3F5B A;  1YGH A;  1I12 A;  2VZY A;  4KUA A;  3W91 A;  4I49 A;  1IB1 E;  2VQY A;  2Z3K A;  2QIR A;  3C26 A;  2CXA A;  4AVC A;  3RYO A;  2HV2 A;  3PZJ A;  1B87 A;  5H84 A;  2VEZ A;  3EO4 A;  4H6U A;  1N71 A;  4E8O A;  1Q2Y A;  1Q2C A;  1YRE A;  4B11 A;  4CYO A;  3FBU A;  4CRZ B;  4X5K A;  4FD5 A;  2RC4 A;  2R7H A;  3IU2 A;  5G1Z A;  4C7I A;  2GAN A;  3R9F A;  1M44 A;  4MY3 A;  1BO4 A;  4CS0 B;  4AG7 A;  2WUU A;  2YND A;  4MHD A;  5EBV A;  4C7H A;  3G3S A;  4PV6 A;  3TO7 A;  3F8K A;  3MGD A;  2VZZ A;  2DXQ A;  4DNC A;  5J8F A;  5A27 A;  1U6M A;  4HNY B;  1I21 A;  4IF5 A;  2J8N A;  2CY2 A;  4UFX A;  4CAF A;  1QSN A;  2J8R A;  2P0W A;  2Z3P A;  2ARH A;  2OZH A;  1KUV A;  2FIA A;  5AG4 A;  3I3G A;  3DNS A;  4XPK A;  3TE4 A;  1Z4R A;  4L8A A;  2HQY A;  2B58 A;  1MK4 A;  2Y0M A;  3R9E A;  4ORF A;  4MFQ A;  4NXY A;  2VXK A;  1YX0 A;  4KLV A;  4UFW A;  5AG6 A;  2Z10 A;  3T9Y A;  2PR1 A;  2Q4V A;  3IGR A;  1PU9 A;  3P2H A;  5F46 A;  1Y7R A;  2O28 A;  4KOS A;  3H5Z A;  3TO6 A;  1NSL A;  1WWZ A;  4BBH A;  4L89 A;  2BL1 A;  3D8P A;  2NMT A;  2R1I A;  4KOU A;  4JJX A;  4ZBG A;  2KCW A;  2G0B A;  3EC4 A;  2P6E A;  4KOT A;  3EXN A;  4R57 A;  5AG7 A;  2JLM A;  1KZF A;  3SXO A;  3TCV A;  3D2M A;  2Z3M A;  5BWA B;  1Q2D A;  1YR0 A;  4F0X A;  4OAE A;  2Q0Y A;  4F0Y A;  4ZGY B;  2I79 A;  4MFP A;  4XNH B;  4RI1 A;  1KUX A;  3IWE A;  2Q7B A;  3GKR A;  1XE4 A;  4KLW A;  2HUZ A;  4CGO A;  2DPT A;  3UY5 A;  1S60 A;  3E0K A;  1MJB A;  2WPW A;  5JPH A;  3FYN A;  1RO5 A;  1QSO A;  1Y9W A;  3QAH A;  2VI7 A;  3B8G A;  4MFJ A;  4QB9 A;  3W6X A;  1M4I A;  2PC1 A;  4PSX A;  4OLL A;  1PUA A;  3VWE A;  1ZO0 A;  2A4N A;  2FE7 A;  4A31 A;  4CYP A;  5CNP A;  5DWN A;  2GE3 A;  4C68 A;  4KOW A;  5KTC A;  3F0A A;  2OU2 A;  4MFZ A;  2FSR A;  4MY0 A;  4B5P A;  2AE6 A;  4AVA A;  4UWJ A;  4PK3 A;  2FS5 A;  3R1K A;  2CNT A;  4K30 A;  3JUW A;  3FB3 A;  4B14 A;  3TO9 A;  2DPS A;  4OAD A;  3R9G A;  3N7Z A;  3FRM A;  3LOD A;  1XEB A;  5KTA A;  1TIQ A;  2EVN A;  4XPL A;  1IYL A;  4LX9 A;  2G3A A;  3OWC A;  1S3Z A;  1XF8 A;  4R87 A;  4MI4 A;  3EFA A;  2OB0 A;  5IB0 A;  4M85 A;  5G22 A;  1SQH A;  1S5K A;  2PR8 A;  4KOV A;  2GIV A;  1CJW A;  4KOY A;  4LUA A;  2Z0Z A;  2ZW4 A;  1J4J A;  4PK2 A;  4R3L A;  2ATR A;  5AG5 A;  5G20 A;  2G3T A;  3EY5 A;  3FIX A;  4RS2 A;  1MJ9 A;  4UCN A;  4KVX A;  4U5Y A;  2PQ8 A;  4B13 A;  2B3V A;  5IX3 A;  2PDO A;  2D4O A;  3R96 A;  2FT0 A;  4KVM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...