4E2AA

Crystal structure of the putative acetyltransferase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
QVEIRKVNQDELSLLQKIAIQTFRETFAFDNTAEQLQNFFDEAYTLSVLKLELDDKESETYFILMSGKAAGFLKVNWGSSQTEQVLEDAFEIQRLYILKAYQGLGLGKQLFEFALERAQISGLSWVWLGVWEKNVKAQLLYAKYGFEQFSKHSFFVGNKVDTDWLLKKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title Crystal Structure of the Putative acetyltransferase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 54
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e2aA00
1IB1E 2FSRA 1FY7A 3W6SA 1XE4A 4K30A 2VBQA 4FD6A 5HMNA 1QSMA 4ORFA 4PSXA 5IV0A 3TCVA 2FE7A 4KVXA 2BL1A 3TOAA 4B5PA 2QIRA 4R57A 2I79A 4NF1A 1VKCA 3GKRA 4J3GA 2B4DB 3JUWA 3TO7A 1M44A 4UWJA 4JWPA 3EFAA 3RYOA 3EXNA 4QB9A 4U5YA 2FIWA 3CXQA 1BOBA 2R98A 4BMHA 3DNSA 2PDOA 2PR8A 2Q04A 4YRHA 2G3AA 1J4JA 4IF5A 3H4QA 1Y9KA 1I12A 1IIDA 1K4JA 4CAXA 5C82A 2IL4A 2Z0ZA 3MGDA 5F49A 4KVOE 2ZPAA 4RI1A 4F6AA 3P2HA 2OH1A 1MK4A 3PGPA 4XPDC 4ZBGA 2JDDA 4II9A 1WWZA 4KOVA 3WR7A 1B87A 3TTHA 1KUXA 2BSWA 2O28A 1XMTA 5KTDA 1CJWA 2PR1A 5ISVA 4QUSA 4E8OA 3EC4A 4MI4A 1S7FA 4E2AA 4KOXA 3C26A 5IB0A 1M4DA 4OADA 1YGHA 1R57A 2Q0YA 1IICA 2OZGA 2ZW7A 2B5GB 4HNXB 3CXSA 2G3TA 2GIVA 2VXKA 1UFHA 2FS5A 2PRBA 5J8FA 1XIXA 1VHSA 4OLLA 1IYLA 5DWNA 3SXNA 3GYAA 2P0WA 3TT2A 3S6GA 2ZW6A 2REEA 1MJBA 1Y9WA 2VZYA 2CY2A 1GHEA 4KLVA 4FD5A 3NE7A 4H6ZA 4XPKA 4CAVA 2WPXA 2Y0MA 1Y7RA 4JXQA 2Q44A 2R1IA 3FBUA 4KLWA 3DDDA 4B5OA 2EVNA 1M4IA 3R9GA 3G8WA 5EC4A 1CM0A 2X7BA 4FD7A 1NE9A 2VEZA 2P6EA 2G0BA 2BEIA 1XEBA 1Q2YA 2ZW5A 5H86A 2P6FA 3I3GA 1MJAA 3R96A 1Z4EA 2QMLA 4I49A 1LRZA 2FXFA 5DWMA 4MY0A 5H84A 4KOTA 1QSRA 4MHDA 3G3SA 4KOYA 3GY9A 2RC4A 5F48A 2Q4YA 1M4GA 3ZJ0A 4QVTA 2OZHA 2CNTA 4R87A 4HKFA 4X5KA 3D2MA 3T9YA 3UY5A 1S7LA 4B5PB 3D8PA 3V8IA 2D4OA 3VWDA 1S60A 2AJ6A 3PZJA 4IUSA 4KORA 5F47A 4M85A 4R3KA 3ZZIA 4E0AA 2J8MA 4DNCA 4R9MA 5KTAA 2GANA 3S6FA 4R3LA 2FIAA 2CNMA 3B8GA 4HNWB 3DR8A 5J8CA 4PV6A 3R95A 4CRZB 4UA3A 3BLNA 1NMTA 3JVNA 3TO6A 3OWCA 1MJ9A 3FYNA 4KVME 1YX0A 4H6UA 4AG7A 5JQ4A 1Q2DA 3F5BA 2PC1A 4QC6A 1QSOA 1L0CA 3FNCA 3FRMA 4AB7A 5I0CA 2ZW4A 3FB3A 5JPHA 2JEVA 2H5MA 4XPLA 3P2FA 3D3SA 3SXOA 2Z11A 4NCZA 3S6HA 3IWGA 3EO4A 2ZXVA 4LUAA 4KUBA 1S7NA 4AG9A 2EUIA 2R8VA 4UWIA 2CNSA 2B4BA 2REFA 5EBVA 5E96A 4CS0B 1PUAA 4NXYA 1P0HA 5KTCA 1QSNA 1P4NA 2PSWA 2B4DA 4KZTA 4XPDB 1RXTA 4MBUA 4CAWA 1RO5A 2NMTA 2OZUA 4OAEA 4H89A 3TFYA 1Q2CA 2AE6A 2Q4VA 3LD2A 2K5TA 3W91A 2QECA 5F46A 1OZPA 3KKWA 2ATRA 3SHPA 2HV2A 2JDCA 2R7HA 4L89A 5GCNA 2OU2A 3DR6A 2Z10A 1Z4RA 4MJ8A 3E0KA 3S6KA 1U6MA 1WK4A 1YK3A 4XNHC 4AVBA 1XF8A 5CNPA 2HQYA 1Z9UA 3EY5A 3TO9A 3I9SA 5IX3A 3W6XA 1TIQA 4L8AA 4NEXA 3DSBA 4Y49C 4PK2A 2B3UA 2A4NA 2J8RA 1N71A 4NSQA 5C88A 4RS2A 4KOWA 3BJ8A 3LODA 4ONUA 3N7ZA 2VZZA 2J8NA 3PP9A 1V0CA 4U9ZA 1BO4A 1B6BA 1YR0A 2B3VA 3T90A 3CXPA 2GE3A 4U9YA 2VQYA 1I1DA 2ARHA 3K9UA 2F5IA 4QBJA 4KUAA 2KCWA 1SQHA 2C27A 4UBRA 3D2PA 1S5KA 4M3SA 1PU9A 2WPWA 2B5GA 1M1DA 2BUEA 2VI7A 1KUYA 5FVJA 3VWEA 2HUZA 2PQ8A 4LX9A 4HNYB 2Q7BA 4YFJA 4YGOA 3F0AA 4KOSA 1YLEA 4MY3A 3TOBA 4XNHB 1YVOA 4AVAA 3BJ7A 1S3ZA 1NSLA 3TE4A 3R9EA 4JD6A 1I21A 4JXRA 3IGRA 1S7KA 1KUVA 2I00A 3FXTA 2D4PA 4PK3A 1IYKA 1YVKA 4Y49B 2FT0A 3R9FA 3QB8A 1KZFA 4AVCA 4FD4A 4KOUA 4JJXA 3R1KA 4F0YA 1ON0A 2FCKA 5HH1A 3F8KA 4JLYA 4CRYB 2JLMA 3QAHA 4EVYA 4GS4A 2FL4A 2OB0A 4PSWA 1QSTA 1YREA 2P6GA 2DXQA 2B58A 3FIXA
chains in the Genus database with same CATH superfamily
1IB1E 2FSRA 4UCPA 3V7ZA 1FY7A 3W6SA 2O4HA 1PCAA 1XE4A 4NGMA 4K30A 2VBQA 4FD6A 4X8IA 5HVHA 5IB9A 3PFOA 5JM6A 5HMNA 2EK9A 3NH8A 1QSMA 3IFEA 4ORFA 4PSXA 2PJ0A 4OC5A 4IHMA 5IV0A 3TCVA 3KHZA 2FE7A 4KVXA 4G1PA 4CPAA 4FAIA 1KWMA 2BL1A 2QVPA 2XEFA 4KS9A 4NJQA 2V8HA 2EK8A 3TOAA 4B5PA 2QIRA 4R57A 4ZX8A 4P44A 2I79A 4PXDA 2WSAA 4NF1A 2AFZA 1VKCA 3IEHA 3GKRA 4F9VA 3ISZA 4J3GA 2PIZA 2B4DB 3JUWA 4UF4A 3TO7A 1M44A 4H2KA 4UWJA 4JWPA 3EFAA 4OC2A 1Z2LA 3RYOA 3EXNA 4NFRA 4QB9A 4U5YA 5HXDA 1TKFA 1EE3P 2FIWA 1X10A 3D67A 2XEIA 3CXQA 1BOBA 2R98A 4BMHA 3DNSA 2Z3MA 3K2KA 1XJOA 2XEJA 1RTQA 2PDOA 2PR8A 2AFMA 2POKA 2Q04A 4LQGA 4YRHA 2G3AA 1FNOA 1J4JA 1H8LA 1QMUA 3FF3A 3JRUA 5G20A 2JEWA 3TX8A 4IF5A 3H4QA 3FECA 3D68A 1Y9KA 3HUVA 1I12A 3IO1A 1Z8WA 2JBKA 4NGTA 5G21A 4MCRA 7CPAA 2CF4A 1IIDA 1K4JA 2F7VA 4CAXA 3IJ3A 5C82A 4C68A 2IL4A 2HB6A 3KR4A 3BXMA 2C6GA 2Z0ZA 3KR5A 3MGDA 5F49A 4KVOE 3FVLA 2ZPAA 4RI1A 2WZNA 4OC1A 4F6AA 3D7FA 2YNDA 2ZEMA 2OH1A 1MK4A 2PVVA 2ZEEA 3P2HA 4M6GA 2DPSA 4YWYA 1JWQA 3PGPA 4XPDC 2HC9A 2BOAA 3GIUA 4ZBGA 4RUHA 4EWTA 2YGWA 2JDDA 2ZOFA 4II9A 2YNEA 4B10A 2DF5A 1VGYA 2FVGA 1CP6A 1WWZA 3MN8A 4KOVA 4ZI6A 2Z3LA 4M6IA 3DGVA 3D66A 1BPMA 4PXCA 4GXHA 3WR7A 4CYOA 1B87A 3TTHA 4P4FA 4DYOA 1KUXA 2BSWA 2O28A 1YW4A 4MMOA 1XMTA 3WC5A 5KTDA 4ZY0A 1M4LA 2NSMA 1CJWA 3CDXA 3PBBA 1TXRA 3S9NA 1QQ9A 2PJ8A 2PR1A 4RN7A 4C2ZA 4A2ZA 1AUGA 5ISVA 1F57A 4LQ6A 4OC4A 4QUSA 4E8OA 4AXVA 3EC4A 4MI4A 1S7FA 4E2AA 4KOXA 3C26A 4K3NA 4C7IA 5IB0A 5K8MA 2AFWA 1M4DA 4FWUA 4KSFA 2XEGA 4OADA 1YGHA 1R57A 2GFQA 2Q0YA 1IICA 1ZG8A 2OZGA 2ZW7A 3B2YA 3IWWA 2B5GB 3SI2A 4HNXB 3CXSA 2G3TA 1CP7A 2GIVA 2ZEDA 1ELMP 2VXKA 3FX6A 1OBRA 4OC3A 3WABA 4A32A 4F0XA 1UFHA 2FS5A 3PBEA 5LRGA 2C6PA 2PRBA 5J8FA 1XIXA 1VHSA 4KSIA 1IYLA 4OLLA 5DWNA 3SXNA 3GYAA 2P0WA 1VIXA 4ZYQA 3TT2A 3S6GA 1IOFA 4A33A 2ZW6A 1R3NA 2REEA 1IOIA 1MJBA 1Y9WA 1ZLIA 2VZYA 5CPAA 4B12A 2CY2A 1GHEA 4KLVA 4FD5A 4UFVA 1F2OA 1XFOA 3FMCA 2PJAA 3NE7A 2AFXA 5AG7A 4H6ZA 4XPKA 4CAVA 3SI1A 1UWYA 1JQGA 2WPXA 3GUXA 4A37A 3KQZA 2DPTA 2Y0MA 1Y7RA 4IAVA 5THWA 2Q44A 4JXQA 3CZXA 2R1IA 2Z3NA 3FBUA 3KQXA 4M6HA 3D7HA 4MHPA 4KLWA 2QYVA 3DDDA 4DJLA 2EO8A 3PB9X 4B5OA 2EVNA 1M4IA 3R9GA 3G8WA 4ONWA 5EC4A 1CM0A 2X7BA 3DLJA 4UCNA 4UIAA 4FD7A 1NE9A 3H8GA 2VEZA 2P6EA 4MHYA 4BINA 4FBEA 4A30A 4R76A 2G0BA 4A38A 1R43A 2BEIA 3H5ZA 1XEBA 1Q2YA 2ZW5A 5H86A 2P6FA 3I3GA 1MJAA 4MFJA 5A27A 3B3SA 2CTCA 3R96A 1ELLP 1Z4EA 2QMLA 2ZEPA 3RNZA 4Q7AA 4I49A 4CYQA 3IU2A 4C7HA 1LRZA 2FXFA 5DWMA 2IJZA 4MY0A 4A39A 4PQAA 4OC0A 5H84A 4KOTA 4O23A 1QSRA 4MHDA 3G3SA 4KOYA 1CBXA 3GY9A 4YU9A 2RC4A 4X2TA 2Q4YA 4Q38A 5F48A 4F9UA 1DE4C 1F2PA 1M4GA 3BI0A 3RZAA 4NGNA 3ZJ0A 4A94A 4QVTA 2OZHA 2CNTA 1XBUA 4R87A 4HKFA 3V38A 3B3WA 3LMSA 4BBHA 4CYNA 4X5KA 4UEFA 3D2MA 5LYDA 3T9YA 2GLFA 1S7LA 3HLPA 3UY5A 2PJBA 4B5PB 4CAEA 3D8PA 3V8IA 2CTBA 2D4OA 3VWDA 3PRTA 1S60A 2AJ6A 3PZJA 4IUSA 4KORA 1Q7LA 5F47A 4M85A 3RBUA 5AGEA 1Z5RA 4P6YA 4DUKA 3B3CA 2EBJA 2Q51A 4R3KA 3ZZIA 4E0AA 2J8MA 4UCMA 3TC8A 4DNCA 2Q43A 3IC1A 1TF8A 2AFOA 4R9MA 5KTAA 2GANA 3S6FA 4R3LA 2FIAA 2F8HA 2CNMA 1Y0RA 4MFPA 4MRIA 4B13A 3KHXA 3KGQA 3H8FA 2C1CA 2G9DA 3B8GA 5AG6A 3B7IA 4HNWB 4CGPA 5I4MA 5F09A 3FH4A 3DR8A 5J8CA 1LFWA 2ANPA 4PPZA 1DTDA 2PJ4A 3CPXA 4A31A 4PV6A 2PIYA 3R95A 4CRZB 4UA3A 1HEEA 4C2XA 1AYEA 4MHZA 3BLNA 1NMTA 3JVNA 2CXAA 1LCPA 3KI9A 3TO6A 4F8ZA 3OWCA 2DEAA 1MJ9A 1LAPA 3FYNA 1CG2A 2CIJA 4KVME 4JYWA 6CPAA 2VL1A 1YX0A 4H6UA 4AG7A 5JQ4A 1Q2DA 3L2NA 3F5BA 2PC1A 2GREA 2RB7A 3D7GA 1QSOA 4OKOA 1NSAA 1L0CA 2V77A 4QC6A 1ZLHA 3FNCA 3FRMA 2JBJA 2Z3KA 4P4EA 4AB7A 3VARA 2BCOA 3K9TA 2GLJA 3FEEA 3A9LA 2ZW4A 5I0CA 1CPSA 3FB3A 2GU2A 2OOTA 2AFUA 1IGBA 2PJ6A 4IK2A 5JPHA 2JEVA 2H5MA 4P45A 2BO9A 4XPLA 5LYLA 3IIBA 3P2FA 3D3SA 3SXOA 3PEIA 2Z11A 1YW6A 5G22A 3KASA 4NCZA 3D4UA 3D7DA 4CAFA 4GM5A 3S6HA 3IWGA 3EO4A 4P4JA 2ZXVA 1FT7A 3NFZA 4KUBA 4LUAA 1S7NA 2Q4ZA 4AG9A 1LOKA 2EUIA 2R8VA 3SJGA 4UWIA 5LYFA 2CNSA 4X3RA 1Y0YA 2B4BA 3LWUA 2REFA 5EBVA 2PCUA 5E96A 4CS0B 1PUAA 4NXYA 1Z8LA 1P0HA 5K8PA 5D29A 1IY7A 2PJ9A 1BAVA 3B35A 5KTCA 3PB7X 1QSNA 3IU1A 1P4NA 2PSWA 2B4DA 4KZTA 4NGSA 4MCPA 4XPDB 4BD9A 1RXTA 4MBUA 4MCQA 4R6TA 4OIDA 1RO5A 4CAWA 1LAMA 5BWAB 2NMTA 2PJ3A 2OZUA 3T8WA 5CBMA 2PJ1A 5J1QA 4B14A 4OAEA 1PYTB 2Z3OA 2PJ5A 4H89A 3TFYA 1Q2CA 1VHOA 1VHEA 4MFZA 2AE6A 2V8GA 2Q4VA 3FJUA 3LD2A 4MXUA 4WJBA 2I3CA 2K5TA 3W91A 2QECA 2ZEFA 4CGNA 1CX8A 4R8FA 5F46A 1OZPA 3KKWA 2ZEGA 1Y7EA 8CPAA 5D8NA 2ATRA 3NE8A 1CPXA 1BLLE 1TKJA 3SHPA 2HV2A 3ISXA 4ZGYB 4CGOA 3PB6X 4Q36A 2IQ6A 2JDCA 2R7HA 4L89A 1IU8A 5GCNA 2OU2A 4KSAA 2V8VA 3DR6A 1Z8TA 2Z10A 4WWVA 1Z4RA 4MJ8A 3E0KA 3BI1A 3GB0A 1U6MA 1WK4A 1YK3A 4XNHC 3S6KA 4AVBA 1XF8A 4A95A 1Z8XA 5K8OA 3WT4A 5CNPA 2C6CA 2HQYA 1Z9UA 3EY5A 3TO9A 5JH9A 5EMIA 2PJCA 3I9SA 3PB8X 3SJFA 3VH9A 2NYQA 4UFXA 3W6XA 5IX3A 5HVFA 3S9LA 1TIQA 4L8AA 4NEXA 2WYRA 3DSBA 2PJ2A 4Y49C 1ZO0A 3BHXA 5HVGA 4PK2A 5A28A 2B3UA 1TKHA 2RFHA 2Z3PA 2A4NA 3RAMA 2J8RA 3QNVA 3SJXA 4R7MA 1N71A 2QJ8A 4EFDA 4NSQA 5C88A 1XRYA 4MCSA 2OR4A 5LRKA 3FEDA 4RS2A 4KOWA 3BJ8A 3LODA 1YQEA 4ONUA 3N7ZA 2VZZA 2J8NA 3PP9A 1V0CA 4NGPA 4U9ZA 1BO4A 5JGFA 1B6BA 4HPSA 5ELYA 4ZY2A 2YNCC 4EMEA 1BPNA 1LANA 4P10A 1YR0A 1HDQA 2B3VA 3T90A 3CXPA 2GE3A 4P4DA 4U9YA 2VQYA 1I1DA 1A2ZA 4ZY1A 5K8NA 1YSJA 2PE3A 1XOVA 2ARHA 3SI0A 3K9UA 2ZEHA 2F5IA 4QBJA 1ZG9A 4KUAA 3CPAA 3LACA 2KCWA 4B6ZA 1SQHA 2C27A 1ARLA 3NH4A 4UBRA 3D2PA 3PB4X 1S5KA 4OP4A 2PVWA 3RO0A 4M3SA 1GYTA 1PU9A 2WPWA 4UIBA 2PJ7A 1ZG7A 2B5GA 1M1DA 4P4BA 4MFQA 4UEZA 2BUEA 3NH5A 4MHNA 1TF9A 4OMEA 4MFLA 2VI7A 1HDUA 4CYPA 1KUYA 2ABZA 5FVJA 2EWBA 3CT9A 3VWEA 4OIWA 2HUZA 2PQ8A 3MRUA 4LX9A 2PRQA 4PXBA 4HNYB 2Q7BA 3NA6A 4YFJA 4YGOA 4NGQA 4C2YA 4CGLA 2YNCA 3F0AA 2AFSA 4KOSA 4PXEA 2ZELA 1YLEA 4MY3A 3TOBA 4NJRA 4XNHB 1YVOA 4AVAA 4ZX9A 2ZEOA 3BJ7A 4Z65A 1X12A 1ARMA 1S3ZA 1NSLA 1YMEA 3TE4A 4MFKA 5G1ZA 3R9EA 3B3TA 3S9MA 4JD6A 1I21A 3WC7A 4JXRA 3IGRA 1S7KA 4W9YA 1KUVA 2J9AA 2ZENA 2I00A 3KZWA 4P4IA 1YLOA 3FXTA 5DS0A 5LYIA 2D4PA 3KL9A 3WC6A 3PFEA 4PK3A 2ODFA 5AG5A 4B11A 1IYKA 1YVKA 4Y49B 2FT0A 3I1UA 3R9FA 3QB8A 4TWEA 3GLJA 3SJEA 4NGRA 1KZFA 4AVCA 2ZOGA 4FD4A 3N5FA 2V8DA 4KOUA 3JTKA 4JJXA 3B3VA 3R1KA 4TNUA 4F0YA 1ON0A 2O53A 4UEEA 2FCKA 5HH1A 3IWEA 4JZ0A 3QAYA 3F8KA 4JLYA 4CRYB 1AMPA 3H8EA 4FUUA 2JLMA 3QAHA 3VATA 4EVYA 5AG4A 4GS4A 2WUUA 2FL4A 2OB0A 2Q7SA 4PSWA 4UFWA 1QSTA 1XMBA 5LRJA 1YREA 4CGMA 2IMOA 2P6GA 2DXQA 2B58A 3FIXA
chains in the Genus database with same CATH topology
1IB1E 2FSRA 4UCPA 1FY7A 3W6SA 1XE4A 4K30A 2VBQA 4FD6A 5HMNA 1QSMA 4ORFA 4PSXA 5IV0A 3TCVA 2FE7A 4KVXA 2BL1A 4KS9A 3TOAA 4B5PA 2QIRA 4R57A 2I79A 2WSAA 4NF1A 1VKCA 3GKRA 4J3GA 2B4DB 3JUWA 3TO7A 1M44A 4UWJA 4JWPA 3EFAA 3RYOA 3EXNA 4QB9A 4U5YA 2FIWA 3CXQA 1BOBA 2R98A 4BMHA 3DNSA 2Z3MA 2PDOA 2PR8A 2Q04A 4YRHA 5G1ZA 2G3AA 1J4JA 5G20A 4IF5A 3H4QA 1Y9KA 1I12A 5G21A 1IIDA 1K4JA 4CAXA 5C82A 4C68A 2IL4A 2Z0ZA 3MGDA 5F49A 4KVOE 2ZPAA 4RI1A 2YNDA 3P2HA 2OH1A 1MK4A 4F6AA 2DPSA 3PGPA 4XPDC 4ZBGA 2YGWA 2JDDA 4II9A 2YNEA 4B10A 1WWZA 4KOVA 2Z3LA 3WR7A 4CYOA 1B87A 3TTHA 1KUXA 2BSWA 2O28A 1XMTA 5KTDA 1CJWA 2PR1A 4C2ZA 4A2ZA 5ISVA 4QUSA 4E8OA 3EC4A 4MI4A 1S7FA 4E2AA 4KOXA 3C26A 4C7IA 5IB0A 1M4DA 4KSFA 4OADA 1YGHA 1R57A 2Q0YA 1IICA 2OZGA 2ZW7A 2B5GB 4HNXB 3CXSA 2G3TA 2GIVA 2VXKA 4A32A 4F0XA 1UFHA 2FS5A 2PRBA 5J8FA 1XIXA 1VHSA 4OLLA 1IYLA 5DWNA 3SXNA 3GYAA 2P0WA 3TT2A 3S6GA 4A33A 2ZW6A 2REEA 1MJBA 1Y9WA 2VZYA 4B12A 2CY2A 1GHEA 4KLVA 4FD5A 4UFVA 3NE7A 5AG7A 4H6ZA 4XPKA 4CAVA 2WPXA 2DPTA 2Y0MA 1Y7RA 4JXQA 2Q44A 2R1IA 2Z3NA 3FBUA 4KLWA 3DDDA 4B5OA 2EVNA 1M4IA 3R9GA 3G8WA 5EC4A 1CM0A 2X7BA 4UCNA 4FD7A 1NE9A 2VEZA 2P6EA 4A30A 2G0BA 3H5ZA 2BEIA 1XEBA 1Q2YA 2ZW5A 5H86A 2P6FA 3I3GA 1MJAA 4MFJA 5A27A 3R96A 1Z4EA 2QMLA 4I49A 4CYQA 3IU2A 4C7HA 1LRZA 2FXFA 5DWMA 4MY0A 5H84A 4KOTA 1QSRA 4MHDA 3G3SA 4KOYA 3GY9A 2RC4A 5F48A 2Q4YA 4Q38A 1M4GA 3ZJ0A 4QVTA 2OZHA 2CNTA 4R87A 4HKFA 4BBHA 4CYNA 4X5KA 3D2MA 3T9YA 3UY5A 1S7LA 4B5PB 4CAEA 3D8PA 3V8IA 2D4OA 3VWDA 1S60A 2AJ6A 3PZJA 4IUSA 4KORA 5F47A 4M85A 5AGEA 4R3KA 3ZZIA 4E0AA 2J8MA 4UCMA 4DNCA 4R9MA 5KTAA 2GANA 3S6FA 4R3LA 2FIAA 2CNMA 4MFPA 4B13A 3B8GA 5AG6A 4CGPA 4HNWB 3DR8A 5J8CA 4A31A 4PV6A 3R95A 4CRZB 4UA3A 4C2XA 3BLNA 1NMTA 3JVNA 2CXAA 3TO6A 3OWCA 1MJ9A 3FYNA 4KVME 1YX0A 4H6UA 4AG7A 5JQ4A 1Q2DA 3F5BA 2PC1A 4QC6A 1QSOA 1L0CA 3FNCA 3FRMA 2Z3KA 4AB7A 5I0CA 3A9LA 2ZW4A 3FB3A 5JPHA 2JEVA 2H5MA 4XPLA 3P2FA 3D3SA 3SXOA 2Z11A 5G22A 4CAFA 4NCZA 3S6HA 3IWGA 3EO4A 2ZXVA 4LUAA 4KUBA 1S7NA 4AG9A 2EUIA 2R8VA 4UWIA 2CNSA 2B4BA 2REFA 5EBVA 5E96A 4CS0B 1PUAA 4NXYA 1P0HA 5KTCA 1QSNA 3IU1A 1P4NA 2PSWA 2B4DA 4KZTA 4XPDB 1RXTA 4MBUA 4CAWA 1RO5A 5BWAB 2NMTA 2OZUA 4B14A 4OAEA 2Z3OA 4H89A 3TFYA 1Q2CA 4MFZA 2AE6A 2Q4VA 3LD2A 2K5TA 3W91A 2QECA 4CGNA 5F46A 1OZPA 3KKWA 2ATRA 3SHPA 2HV2A 4ZGYB 4CGOA 4Q36A 2JDCA 2R7HA 4L89A 5GCNA 2OU2A 4KSAA 3DR6A 2Z10A 1Z4RA 4MJ8A 3E0KA 3S6KA 1U6MA 1WK4A 1YK3A 4XNHC 4AVBA 1XF8A 4A95A 5CNPA 2HQYA 1Z9UA 3EY5A 3TO9A 3I9SA 4UFXA 3W6XA 5IX3A 1TIQA 4L8AA 4NEXA 3DSBA 4Y49C 1ZO0A 4PK2A 5A28A 2B3UA 2Z3PA 2A4NA 2J8RA 1N71A 4NSQA 5C88A 4RS2A 4KOWA 3BJ8A 3LODA 4ONUA 3N7ZA 2VZZA 2J8NA 3PP9A 1V0CA 4U9ZA 1BO4A 1B6BA 2YNCC 1YR0A 2B3VA 3T90A 3CXPA 2GE3A 4U9YA 2VQYA 1I1DA 2ARHA 3K9UA 2F5IA 4QBJA 4KUAA 2KCWA 1SQHA 2C27A 4UBRA 3D2PA 1S5KA 4M3SA 1PU9A 2WPWA 2B5GA 1M1DA 4MFQA 2BUEA 4MFLA 2VI7A 4CYPA 1KUYA 5FVJA 3VWEA 2HUZA 2PQ8A 4LX9A 4HNYB 2Q7BA 4YFJA 4YGOA 4C2YA 4CGLA 2YNCA 3F0AA 4KOSA 1YLEA 4MY3A 3TOBA 4XNHB 1YVOA 4AVAA 3BJ7A 1S3ZA 1NSLA 3TE4A 4MFKA 3R9EA 4JD6A 1I21A 4JXRA 3IGRA 1S7KA 1KUVA 2I00A 3FXTA 2D4PA 4PK3A 5AG5A 4B11A 1IYKA 1YVKA 4Y49B 2FT0A 3R9FA 3QB8A 1KZFA 4AVCA 4FD4A 4KOUA 3JTKA 4JJXA 3R1KA 4F0YA 1ON0A 2FCKA 5HH1A 3IWEA 3F8KA 4JLYA 4CRYB 2JLMA 3QAHA 4EVYA 5AG4A 4GS4A 2WUUA 2FL4A 2OB0A 4PSWA 4UFWA 1QSTA 4CGMA 1YREA 2P6GA 2DXQA 2B58A 3FIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IB1 E;  2FSR A;  1FY7 A;  3W6S A;  1XE4 A;  4K30 A;  2VBQ A;  4FD6 A;  5HMN A;  1QSM A;  4ORF A;  4PSX A;  5IV0 A;  3TCV A;  2FE7 A;  4KVX A;  2BL1 A;  3TOA A;  4B5P A;  2QIR A;  4R57 A;  2I79 A;  4NF1 A;  1VKC A;  3GKR A;  4J3G A;  2B4D B;  3JUW A;  3TO7 A;  1M44 A;  4UWJ A;  4JWP A;  3EFA A;  3RYO A;  3EXN A;  4QB9 A;  4U5Y A;  2FIW A;  3CXQ A;  1BOB A;  2R98 A;  4BMH A;  3DNS A;  2PDO A;  2PR8 A;  2Q04 A;  4YRH A;  2G3A A;  1J4J A;  4IF5 A;  3H4Q A;  1Y9K A;  1I12 A;  1IID A;  1K4J A;  4CAX A;  5C82 A;  2IL4 A;  2Z0Z A;  3MGD A;  5F49 A;  4KVO E;  2ZPA A;  4RI1 A;  4F6A A;  3P2H A;  2OH1 A;  1MK4 A;  3PGP A;  4XPD C;  4ZBG A;  2JDD A;  4II9 A;  1WWZ A;  4KOV A;  3WR7 A;  1B87 A;  3TTH A;  1KUX A;  2BSW A;  2O28 A;  1XMT A;  5KTD A;  1CJW A;  2PR1 A;  5ISV A;  4QUS A;  4E8O A;  3EC4 A;  4MI4 A;  1S7F A;  4E2A A;  4KOX A;  3C26 A;  5IB0 A;  1M4D A;  4OAD A;  1YGH A;  1R57 A;  2Q0Y A;  1IIC A;  2OZG A;  2ZW7 A;  2B5G B;  4HNX B;  3CXS A;  2G3T A;  2GIV A;  2VXK A;  1UFH A;  2FS5 A;  2PRB A;  5J8F A;  1XIX A;  1VHS A;  4OLL A;  1IYL A;  5DWN A;  3SXN A;  3GYA A;  2P0W A;  3TT2 A;  3S6G A;  2ZW6 A;  2REE A;  1MJB A;  1Y9W A;  2VZY A;  2CY2 A;  1GHE A;  4KLV A;  4FD5 A;  3NE7 A;  4H6Z A;  4XPK A;  4CAV A;  2WPX A;  2Y0M A;  1Y7R A;  4JXQ A;  2Q44 A;  2R1I A;  3FBU A;  4KLW A;  3DDD A;  4B5O A;  2EVN A;  1M4I A;  3R9G A;  3G8W A;  5EC4 A;  1CM0 A;  2X7B A;  4FD7 A;  1NE9 A;  2VEZ A;  2P6E A;  2G0B A;  2BEI A;  1XEB A;  1Q2Y A;  2ZW5 A;  5H86 A;  2P6F A;  3I3G A;  1MJA A;  3R96 A;  1Z4E A;  2QML A;  4I49 A;  1LRZ A;  2FXF A;  5DWM A;  4MY0 A;  5H84 A;  4KOT A;  1QSR A;  4MHD A;  3G3S A;  4KOY A;  3GY9 A;  2RC4 A;  5F48 A;  2Q4Y A;  1M4G A;  3ZJ0 A;  4QVT A;  2OZH A;  2CNT A;  4R87 A;  4HKF A;  4X5K A;  3D2M A;  3T9Y A;  3UY5 A;  1S7L A;  4B5P B;  3D8P A;  3V8I A;  2D4O A;  3VWD A;  1S60 A;  2AJ6 A;  3PZJ A;  4IUS A;  4KOR A;  5F47 A;  4M85 A;  4R3K A;  3ZZI A;  4E0A A;  2J8M A;  4DNC A;  4R9M A;  5KTA A;  2GAN A;  3S6F A;  4R3L A;  2FIA A;  2CNM A;  3B8G A;  4HNW B;  3DR8 A;  5J8C A;  4PV6 A;  3R95 A;  4CRZ B;  4UA3 A;  3BLN A;  1NMT A;  3JVN A;  3TO6 A;  3OWC A;  1MJ9 A;  3FYN A;  4KVM E;  1YX0 A;  4H6U A;  4AG7 A;  5JQ4 A;  1Q2D A;  3F5B A;  2PC1 A;  4QC6 A;  1QSO A;  1L0C A;  3FNC A;  3FRM A;  4AB7 A;  5I0C A;  2ZW4 A;  3FB3 A;  5JPH A;  2JEV A;  2H5M A;  4XPL A;  3P2F A;  3D3S A;  3SXO A;  2Z11 A;  4NCZ A;  3S6H A;  3IWG A;  3EO4 A;  2ZXV A;  4LUA A;  4KUB A;  1S7N A;  4AG9 A;  2EUI A;  2R8V A;  4UWI A;  2CNS A;  2B4B A;  2REF A;  5EBV A;  5E96 A;  4CS0 B;  1PUA A;  4NXY A;  1P0H A;  5KTC A;  1QSN A;  1P4N A;  2PSW A;  2B4D A;  4KZT A;  4XPD B;  1RXT A;  4MBU A;  4CAW A;  1RO5 A;  2NMT A;  2OZU A;  4OAE A;  4H89 A;  3TFY A;  1Q2C A;  2AE6 A;  2Q4V A;  3LD2 A;  2K5T A;  3W91 A;  2QEC A;  5F46 A;  1OZP A;  3KKW A;  2ATR A;  3SHP A;  2HV2 A;  2JDC A;  2R7H A;  4L89 A;  5GCN A;  2OU2 A;  3DR6 A;  2Z10 A;  1Z4R A;  4MJ8 A;  3E0K A;  3S6K A;  1U6M A;  1WK4 A;  1YK3 A;  4XNH C;  4AVB A;  1XF8 A;  5CNP A;  2HQY A;  1Z9U A;  3EY5 A;  3TO9 A;  3I9S A;  5IX3 A;  3W6X A;  1TIQ A;  4L8A A;  4NEX A;  3DSB A;  4Y49 C;  4PK2 A;  2B3U A;  2A4N A;  2J8R A;  1N71 A;  4NSQ A;  5C88 A;  4RS2 A;  4KOW A;  3BJ8 A;  3LOD A;  4ONU A;  3N7Z A;  2VZZ A;  2J8N A;  3PP9 A;  1V0C A;  4U9Z A;  1BO4 A;  1B6B A;  1YR0 A;  2B3V A;  3T90 A;  3CXP A;  2GE3 A;  4U9Y A;  2VQY A;  1I1D A;  2ARH A;  3K9U A;  2F5I A;  4QBJ A;  4KUA A;  2KCW A;  1SQH A;  2C27 A;  4UBR A;  3D2P A;  1S5K A;  4M3S A;  1PU9 A;  2WPW A;  2B5G A;  1M1D A;  2BUE A;  2VI7 A;  1KUY A;  5FVJ A;  3VWE A;  2HUZ A;  2PQ8 A;  4LX9 A;  4HNY B;  2Q7B A;  4YFJ A;  4YGO A;  3F0A A;  4KOS A;  1YLE A;  4MY3 A;  3TOB A;  4XNH B;  1YVO A;  4AVA A;  3BJ7 A;  1S3Z A;  1NSL A;  3TE4 A;  3R9E A;  4JD6 A;  1I21 A;  4JXR A;  3IGR A;  1S7K A;  1KUV A;  2I00 A;  3FXT A;  2D4P A;  4PK3 A;  1IYK A;  1YVK A;  4Y49 B;  2FT0 A;  3R9F A;  3QB8 A;  1KZF A;  4AVC A;  4FD4 A;  4KOU A;  4JJX A;  3R1K A;  4F0Y A;  1ON0 A;  2FCK A;  5HH1 A;  3F8K A;  4JLY A;  4CRY B;  2JLM A;  3QAH A;  4EVY A;  4GS4 A;  2FL4 A;  2OB0 A;  4PSW A;  1QST A;  1YRE A;  2P6G A;  2DXQ A;  2B58 A;  3FIX A; 
#chains in the Genus database with same CATH topology
 1IB1 E;  2FSR A;  4UCP A;  3V7Z A;  1FY7 A;  3W6S A;  2O4H A;  1PCA A;  1XE4 A;  4NGM A;  4K30 A;  2VBQ A;  4FD6 A;  4X8I A;  5HVH A;  5IB9 A;  3PFO A;  5JM6 A;  5HMN A;  2EK9 A;  3NH8 A;  1QSM A;  3IFE A;  4ORF A;  4PSX A;  2PJ0 A;  4OC5 A;  4IHM A;  5IV0 A;  3TCV A;  3KHZ A;  2FE7 A;  4KVX A;  4G1P A;  4CPA A;  4FAI A;  1KWM A;  2BL1 A;  2QVP A;  2XEF A;  4KS9 A;  4NJQ A;  2V8H A;  2EK8 A;  3TOA A;  4B5P A;  2QIR A;  4R57 A;  4ZX8 A;  4P44 A;  2I79 A;  4PXD A;  2WSA A;  4NF1 A;  2AFZ A;  1VKC A;  3IEH A;  3GKR A;  4F9V A;  3ISZ A;  4J3G A;  2PIZ A;  2B4D B;  3JUW A;  4UF4 A;  3TO7 A;  1M44 A;  4H2K A;  4UWJ A;  4JWP A;  3EFA A;  4OC2 A;  1Z2L A;  3RYO A;  3EXN A;  4NFR A;  4QB9 A;  4U5Y A;  5HXD A;  1TKF A;  1EE3 P;  2FIW A;  1X10 A;  3D67 A;  2XEI A;  3CXQ A;  1BOB A;  2R98 A;  4BMH A;  3DNS A;  2Z3M A;  3K2K A;  1XJO A;  2XEJ A;  1RTQ A;  2PDO A;  2PR8 A;  2AFM A;  2POK A;  2Q04 A;  4LQG A;  4YRH A;  2G3A A;  1FNO A;  1J4J A;  1H8L A;  1QMU A;  3FF3 A;  3JRU A;  5G20 A;  2JEW A;  3TX8 A;  4IF5 A;  3H4Q A;  3FEC A;  3D68 A;  1Y9K A;  3HUV A;  1I12 A;  3IO1 A;  1Z8W A;  2JBK A;  4NGT A;  5G21 A;  4MCR A;  7CPA A;  2CF4 A;  1IID A;  1K4J A;  2F7V A;  4CAX A;  3IJ3 A;  5C82 A;  4C68 A;  2IL4 A;  2HB6 A;  3KR4 A;  3BXM A;  2C6G A;  2Z0Z A;  3KR5 A;  3MGD A;  5F49 A;  4KVO E;  3FVL A;  2ZPA A;  4RI1 A;  2WZN A;  4OC1 A;  4F6A A;  3D7F A;  2YND A;  2ZEM A;  2OH1 A;  1MK4 A;  2PVV A;  2ZEE A;  3P2H A;  4M6G A;  2DPS A;  4YWY A;  1JWQ A;  3PGP A;  4XPD C;  2HC9 A;  2BOA A;  3GIU A;  4ZBG A;  4RUH A;  4EWT A;  2YGW A;  2JDD A;  2ZOF A;  4II9 A;  2YNE A;  4B10 A;  2DF5 A;  1VGY A;  2FVG A;  1CP6 A;  1WWZ A;  3MN8 A;  4KOV A;  4ZI6 A;  2Z3L A;  4M6I A;  3DGV A;  3D66 A;  1BPM A;  4PXC A;  4GXH A;  3WR7 A;  4CYO A;  1B87 A;  3TTH A;  4P4F A;  4DYO A;  1KUX A;  2BSW A;  2O28 A;  1YW4 A;  4MMO A;  1XMT A;  3WC5 A;  5KTD A;  4ZY0 A;  1M4L A;  2NSM A;  1CJW A;  3CDX A;  3PBB A;  1TXR A;  3S9N A;  1QQ9 A;  2PJ8 A;  2PR1 A;  4RN7 A;  4C2Z A;  4A2Z A;  1AUG A;  5ISV A;  1F57 A;  4LQ6 A;  4OC4 A;  4QUS A;  4E8O A;  4AXV A;  3EC4 A;  4MI4 A;  1S7F A;  4E2A A;  4KOX A;  3C26 A;  4K3N A;  4C7I A;  5IB0 A;  5K8M A;  2AFW A;  1M4D A;  4FWU A;  4KSF A;  2XEG A;  4OAD A;  1YGH A;  1R57 A;  2GFQ A;  2Q0Y A;  1IIC A;  1ZG8 A;  2OZG A;  2ZW7 A;  3B2Y A;  3IWW A;  2B5G B;  3SI2 A;  4HNX B;  3CXS A;  2G3T A;  1CP7 A;  2GIV A;  2ZED A;  1ELM P;  2VXK A;  3FX6 A;  1OBR A;  4OC3 A;  3WAB A;  4A32 A;  4F0X A;  1UFH A;  2FS5 A;  3PBE A;  5LRG A;  2C6P A;  2PRB A;  5J8F A;  1XIX A;  1VHS A;  4KSI A;  1IYL A;  4OLL A;  5DWN A;  3SXN A;  3GYA A;  2P0W A;  1VIX A;  4ZYQ A;  3TT2 A;  3S6G A;  1IOF A;  4A33 A;  2ZW6 A;  1R3N A;  2REE A;  1IOI A;  1MJB A;  1Y9W A;  1ZLI A;  2VZY A;  5CPA A;  4B12 A;  2CY2 A;  1GHE A;  4KLV A;  4FD5 A;  4UFV A;  1F2O A;  1XFO A;  3FMC A;  2PJA A;  3NE7 A;  2AFX A;  5AG7 A;  4H6Z A;  4XPK A;  4CAV A;  3SI1 A;  1UWY A;  1JQG A;  2WPX A;  3GUX A;  4A37 A;  3KQZ A;  2DPT A;  2Y0M A;  1Y7R A;  4IAV A;  5THW A;  2Q44 A;  4JXQ A;  3CZX A;  2R1I A;  2Z3N A;  3FBU A;  3KQX A;  4M6H A;  3D7H A;  4MHP A;  4KLW A;  2QYV A;  3DDD A;  4DJL A;  2EO8 A;  3PB9 X;  4B5O A;  2EVN A;  1M4I A;  3R9G A;  3G8W A;  4ONW A;  5EC4 A;  1CM0 A;  2X7B A;  3DLJ A;  4UCN A;  4UIA A;  4FD7 A;  1NE9 A;  3H8G A;  2VEZ A;  2P6E A;  4MHY A;  4BIN A;  4FBE A;  4A30 A;  4R76 A;  2G0B A;  4A38 A;  1R43 A;  2BEI A;  3H5Z A;  1XEB A;  1Q2Y A;  2ZW5 A;  5H86 A;  2P6F A;  3I3G A;  1MJA A;  4MFJ A;  5A27 A;  3B3S A;  2CTC A;  3R96 A;  1ELL P;  1Z4E A;  2QML A;  2ZEP A;  3RNZ A;  4Q7A A;  4I49 A;  4CYQ A;  3IU2 A;  4C7H A;  1LRZ A;  2FXF A;  5DWM A;  2IJZ A;  4MY0 A;  4A39 A;  4PQA A;  4OC0 A;  5H84 A;  4KOT A;  4O23 A;  1QSR A;  4MHD A;  3G3S A;  4KOY A;  1CBX A;  3GY9 A;  4YU9 A;  2RC4 A;  4X2T A;  2Q4Y A;  4Q38 A;  5F48 A;  4F9U A;  1DE4 C;  1F2P A;  1M4G A;  3BI0 A;  3RZA A;  4NGN A;  3ZJ0 A;  4A94 A;  4QVT A;  2OZH A;  2CNT A;  1XBU A;  4R87 A;  4HKF A;  3V38 A;  3B3W A;  3LMS A;  4BBH A;  4CYN A;  4X5K A;  4UEF A;  3D2M A;  5LYD A;  3T9Y A;  2GLF A;  1S7L A;  3HLP A;  3UY5 A;  2PJB A;  4B5P B;  4CAE A;  3D8P A;  3V8I A;  2CTB A;  2D4O A;  3VWD A;  3PRT A;  1S60 A;  2AJ6 A;  3PZJ A;  4IUS A;  4KOR A;  1Q7L A;  5F47 A;  4M85 A;  3RBU A;  5AGE A;  1Z5R A;  4P6Y A;  4DUK A;  3B3C A;  2EBJ A;  2Q51 A;  4R3K A;  3ZZI A;  4E0A A;  2J8M A;  4UCM A;  3TC8 A;  4DNC A;  2Q43 A;  3IC1 A;  1TF8 A;  2AFO A;  4R9M A;  5KTA A;  2GAN A;  3S6F A;  4R3L A;  2FIA A;  2F8H A;  2CNM A;  1Y0R A;  4MFP A;  4MRI A;  4B13 A;  3KHX A;  3KGQ A;  3H8F A;  2C1C A;  2G9D A;  3B8G A;  5AG6 A;  3B7I A;  4HNW B;  4CGP A;  5I4M A;  5F09 A;  3FH4 A;  3DR8 A;  5J8C A;  1LFW A;  2ANP A;  4PPZ A;  1DTD A;  2PJ4 A;  3CPX A;  4A31 A;  4PV6 A;  2PIY A;  3R95 A;  4CRZ B;  4UA3 A;  1HEE A;  4C2X A;  1AYE A;  4MHZ A;  3BLN A;  1NMT A;  3JVN A;  2CXA A;  1LCP A;  3KI9 A;  3TO6 A;  4F8Z A;  3OWC A;  2DEA A;  1MJ9 A;  1LAP A;  3FYN A;  1CG2 A;  2CIJ A;  4KVM E;  4JYW A;  6CPA A;  2VL1 A;  1YX0 A;  4H6U A;  4AG7 A;  5JQ4 A;  1Q2D A;  3L2N A;  3F5B A;  2PC1 A;  2GRE A;  2RB7 A;  3D7G A;  1QSO A;  4OKO A;  1NSA A;  1L0C A;  2V77 A;  4QC6 A;  1ZLH A;  3FNC A;  3FRM A;  2JBJ A;  2Z3K A;  4P4E A;  4AB7 A;  3VAR A;  2BCO A;  3K9T A;  2GLJ A;  3FEE A;  3A9L A;  2ZW4 A;  5I0C A;  1CPS A;  3FB3 A;  2GU2 A;  2OOT A;  2AFU A;  1IGB A;  2PJ6 A;  4IK2 A;  5JPH A;  2JEV A;  2H5M A;  4P45 A;  2BO9 A;  4XPL A;  5LYL A;  3IIB A;  3P2F A;  3D3S A;  3SXO A;  3PEI A;  2Z11 A;  1YW6 A;  5G22 A;  3KAS A;  4NCZ A;  3D4U A;  3D7D A;  4CAF A;  4GM5 A;  3S6H A;  3IWG A;  3EO4 A;  4P4J A;  2ZXV A;  1FT7 A;  3NFZ A;  4KUB A;  4LUA A;  1S7N A;  2Q4Z A;  4AG9 A;  1LOK A;  2EUI A;  2R8V A;  3SJG A;  4UWI A;  5LYF A;  2CNS A;  4X3R A;  1Y0Y A;  2B4B A;  3LWU A;  2REF A;  5EBV A;  2PCU A;  5E96 A;  4CS0 B;  1PUA A;  4NXY A;  1Z8L A;  1P0H A;  5K8P A;  5D29 A;  1IY7 A;  2PJ9 A;  1BAV A;  3B35 A;  5KTC A;  3PB7 X;  1QSN A;  3IU1 A;  1P4N A;  2PSW A;  2B4D A;  4KZT A;  4NGS A;  4MCP A;  4XPD B;  4BD9 A;  1RXT A;  4MBU A;  4MCQ A;  4R6T A;  4OID A;  1RO5 A;  4CAW A;  1LAM A;  5BWA B;  2NMT A;  2PJ3 A;  2OZU A;  3T8W A;  5CBM A;  2PJ1 A;  5J1Q A;  4B14 A;  4OAE A;  1PYT B;  2Z3O A;  2PJ5 A;  4H89 A;  3TFY A;  1Q2C A;  1VHO A;  1VHE A;  4MFZ A;  2AE6 A;  2V8G A;  2Q4V A;  3FJU A;  3LD2 A;  4MXU A;  4WJB A;  2I3C A;  2K5T A;  3W91 A;  2QEC A;  2ZEF A;  4CGN A;  1CX8 A;  4R8F A;  5F46 A;  1OZP A;  3KKW A;  2ZEG A;  1Y7E A;  8CPA A;  5D8N A;  2ATR A;  3NE8 A;  1CPX A;  1BLL E;  1TKJ A;  3SHP A;  2HV2 A;  3ISX A;  4ZGY B;  4CGO A;  3PB6 X;  4Q36 A;  2IQ6 A;  2JDC A;  2R7H A;  4L89 A;  1IU8 A;  5GCN A;  2OU2 A;  4KSA A;  2V8V A;  3DR6 A;  1Z8T A;  2Z10 A;  4WWV A;  1Z4R A;  4MJ8 A;  3E0K A;  3BI1 A;  3GB0 A;  1U6M A;  1WK4 A;  1YK3 A;  4XNH C;  3S6K A;  4AVB A;  1XF8 A;  4A95 A;  1Z8X A;  5K8O A;  3WT4 A;  5CNP A;  2C6C A;  2HQY A;  1Z9U A;  3EY5 A;  3TO9 A;  5JH9 A;  5EMI A;  2PJC A;  3I9S A;  3PB8 X;  3SJF A;  3VH9 A;  2NYQ A;  4UFX A;  3W6X A;  5IX3 A;  5HVF A;  3S9L A;  1TIQ A;  4L8A A;  4NEX A;  2WYR A;  3DSB A;  2PJ2 A;  4Y49 C;  1ZO0 A;  3BHX A;  5HVG A;  4PK2 A;  5A28 A;  2B3U A;  1TKH A;  2RFH A;  2Z3P A;  2A4N A;  3RAM A;  2J8R A;  3QNV A;  3SJX A;  4R7M A;  1N71 A;  2QJ8 A;  4EFD A;  4NSQ A;  5C88 A;  1XRY A;  4MCS A;  2OR4 A;  5LRK A;  3FED A;  4RS2 A;  4KOW A;  3BJ8 A;  3LOD A;  1YQE A;  4ONU A;  3N7Z A;  2VZZ A;  2J8N A;  3PP9 A;  1V0C A;  4NGP A;  4U9Z A;  1BO4 A;  5JGF A;  1B6B A;  4HPS A;  5ELY A;  4ZY2 A;  2YNC C;  4EME A;  1BPN A;  1LAN A;  4P10 A;  1YR0 A;  1HDQ A;  2B3V A;  3T90 A;  3CXP A;  2GE3 A;  4P4D A;  4U9Y A;  2VQY A;  1I1D A;  1A2Z A;  4ZY1 A;  5K8N A;  1YSJ A;  2PE3 A;  1XOV A;  2ARH A;  3SI0 A;  3K9U A;  2ZEH A;  2F5I A;  4QBJ A;  1ZG9 A;  4KUA A;  3CPA A;  3LAC A;  2KCW A;  4B6Z A;  1SQH A;  2C27 A;  1ARL A;  3NH4 A;  4UBR A;  3D2P A;  3PB4 X;  1S5K A;  4OP4 A;  2PVW A;  3RO0 A;  4M3S A;  1GYT A;  1PU9 A;  2WPW A;  4UIB A;  2PJ7 A;  1ZG7 A;  2B5G A;  1M1D A;  4P4B A;  4MFQ A;  4UEZ A;  2BUE A;  3NH5 A;  4MHN A;  1TF9 A;  4OME A;  4MFL A;  2VI7 A;  1HDU A;  4CYP A;  1KUY A;  2ABZ A;  5FVJ A;  2EWB A;  3CT9 A;  3VWE A;  4OIW A;  2HUZ A;  2PQ8 A;  3MRU A;  4LX9 A;  2PRQ A;  4PXB A;  4HNY B;  2Q7B A;  3NA6 A;  4YFJ A;  4YGO A;  4NGQ A;  4C2Y A;  4CGL A;  2YNC A;  3F0A A;  2AFS A;  4KOS A;  4PXE A;  2ZEL A;  1YLE A;  4MY3 A;  3TOB A;  4NJR A;  4XNH B;  1YVO A;  4AVA A;  4ZX9 A;  2ZEO A;  3BJ7 A;  4Z65 A;  1X12 A;  1ARM A;  1S3Z A;  1NSL A;  1YME A;  3TE4 A;  4MFK A;  5G1Z A;  3R9E A;  3B3T A;  3S9M A;  4JD6 A;  1I21 A;  3WC7 A;  4JXR A;  3IGR A;  1S7K A;  4W9Y A;  1KUV A;  2J9A A;  2ZEN A;  2I00 A;  3KZW A;  4P4I A;  1YLO A;  3FXT A;  5DS0 A;  5LYI A;  2D4P A;  3KL9 A;  3WC6 A;  3PFE A;  4PK3 A;  2ODF A;  5AG5 A;  4B11 A;  1IYK A;  1YVK A;  4Y49 B;  2FT0 A;  3I1U A;  3R9F A;  3QB8 A;  4TWE A;  3GLJ A;  3SJE A;  4NGR A;  1KZF A;  4AVC A;  2ZOG A;  4FD4 A;  3N5F A;  2V8D A;  4KOU A;  3JTK A;  4JJX A;  3B3V A;  3R1K A;  4TNU A;  4F0Y A;  1ON0 A;  2O53 A;  4UEE A;  2FCK A;  5HH1 A;  3IWE A;  4JZ0 A;  3QAY A;  3F8K A;  4JLY A;  4CRY B;  1AMP A;  3H8E A;  4FUU A;  2JLM A;  3QAH A;  3VAT A;  4EVY A;  5AG4 A;  4GS4 A;  2WUU A;  2FL4 A;  2OB0 A;  2Q7S A;  4PSW A;  4UFW A;  1QST A;  1XMB A;  5LRJ A;  1YRE A;  4CGM A;  2IMO A;  2P6G A;  2DXQ A;  2B58 A;  3FIX A; 
#chains in the Genus database with same CATH homology
 1IB1 E;  2FSR A;  4UCP A;  1FY7 A;  3W6S A;  1XE4 A;  4K30 A;  2VBQ A;  4FD6 A;  5HMN A;  1QSM A;  4ORF A;  4PSX A;  5IV0 A;  3TCV A;  2FE7 A;  4KVX A;  2BL1 A;  4KS9 A;  3TOA A;  4B5P A;  2QIR A;  4R57 A;  2I79 A;  2WSA A;  4NF1 A;  1VKC A;  3GKR A;  4J3G A;  2B4D B;  3JUW A;  3TO7 A;  1M44 A;  4UWJ A;  4JWP A;  3EFA A;  3RYO A;  3EXN A;  4QB9 A;  4U5Y A;  2FIW A;  3CXQ A;  1BOB A;  2R98 A;  4BMH A;  3DNS A;  2Z3M A;  2PDO A;  2PR8 A;  2Q04 A;  4YRH A;  5G1Z A;  2G3A A;  1J4J A;  5G20 A;  4IF5 A;  3H4Q A;  1Y9K A;  1I12 A;  5G21 A;  1IID A;  1K4J A;  4CAX A;  5C82 A;  4C68 A;  2IL4 A;  2Z0Z A;  3MGD A;  5F49 A;  4KVO E;  2ZPA A;  4RI1 A;  2YND A;  3P2H A;  2OH1 A;  1MK4 A;  4F6A A;  2DPS A;  3PGP A;  4XPD C;  4ZBG A;  2YGW A;  2JDD A;  4II9 A;  2YNE A;  4B10 A;  1WWZ A;  4KOV A;  2Z3L A;  3WR7 A;  4CYO A;  1B87 A;  3TTH A;  1KUX A;  2BSW A;  2O28 A;  1XMT A;  5KTD A;  1CJW A;  2PR1 A;  4C2Z A;  4A2Z A;  5ISV A;  4QUS A;  4E8O A;  3EC4 A;  4MI4 A;  1S7F A;  4E2A A;  4KOX A;  3C26 A;  4C7I A;  5IB0 A;  1M4D A;  4KSF A;  4OAD A;  1YGH A;  1R57 A;  2Q0Y A;  1IIC A;  2OZG A;  2ZW7 A;  2B5G B;  4HNX B;  3CXS A;  2G3T A;  2GIV A;  2VXK A;  4A32 A;  4F0X A;  1UFH A;  2FS5 A;  2PRB A;  5J8F A;  1XIX A;  1VHS A;  4OLL A;  1IYL A;  5DWN A;  3SXN A;  3GYA A;  2P0W A;  3TT2 A;  3S6G A;  4A33 A;  2ZW6 A;  2REE A;  1MJB A;  1Y9W A;  2VZY A;  4B12 A;  2CY2 A;  1GHE A;  4KLV A;  4FD5 A;  4UFV A;  3NE7 A;  5AG7 A;  4H6Z A;  4XPK A;  4CAV A;  2WPX A;  2DPT A;  2Y0M A;  1Y7R A;  4JXQ A;  2Q44 A;  2R1I A;  2Z3N A;  3FBU A;  4KLW A;  3DDD A;  4B5O A;  2EVN A;  1M4I A;  3R9G A;  3G8W A;  5EC4 A;  1CM0 A;  2X7B A;  4UCN A;  4FD7 A;  1NE9 A;  2VEZ A;  2P6E A;  4A30 A;  2G0B A;  3H5Z A;  2BEI A;  1XEB A;  1Q2Y A;  2ZW5 A;  5H86 A;  2P6F A;  3I3G A;  1MJA A;  4MFJ A;  5A27 A;  3R96 A;  1Z4E A;  2QML A;  4I49 A;  4CYQ A;  3IU2 A;  4C7H A;  1LRZ A;  2FXF A;  5DWM A;  4MY0 A;  5H84 A;  4KOT A;  1QSR A;  4MHD A;  3G3S A;  4KOY A;  3GY9 A;  2RC4 A;  5F48 A;  2Q4Y A;  4Q38 A;  1M4G A;  3ZJ0 A;  4QVT A;  2OZH A;  2CNT A;  4R87 A;  4HKF A;  4BBH A;  4CYN A;  4X5K A;  3D2M A;  3T9Y A;  3UY5 A;  1S7L A;  4B5P B;  4CAE A;  3D8P A;  3V8I A;  2D4O A;  3VWD A;  1S60 A;  2AJ6 A;  3PZJ A;  4IUS A;  4KOR A;  5F47 A;  4M85 A;  5AGE A;  4R3K A;  3ZZI A;  4E0A A;  2J8M A;  4UCM A;  4DNC A;  4R9M A;  5KTA A;  2GAN A;  3S6F A;  4R3L A;  2FIA A;  2CNM A;  4MFP A;  4B13 A;  3B8G A;  5AG6 A;  4CGP A;  4HNW B;  3DR8 A;  5J8C A;  4A31 A;  4PV6 A;  3R95 A;  4CRZ B;  4UA3 A;  4C2X A;  3BLN A;  1NMT A;  3JVN A;  2CXA A;  3TO6 A;  3OWC A;  1MJ9 A;  3FYN A;  4KVM E;  1YX0 A;  4H6U A;  4AG7 A;  5JQ4 A;  1Q2D A;  3F5B A;  2PC1 A;  4QC6 A;  1QSO A;  1L0C A;  3FNC A;  3FRM A;  2Z3K A;  4AB7 A;  5I0C A;  3A9L A;  2ZW4 A;  3FB3 A;  5JPH A;  2JEV A;  2H5M A;  4XPL A;  3P2F A;  3D3S A;  3SXO A;  2Z11 A;  5G22 A;  4CAF A;  4NCZ A;  3S6H A;  3IWG A;  3EO4 A;  2ZXV A;  4LUA A;  4KUB A;  1S7N A;  4AG9 A;  2EUI A;  2R8V A;  4UWI A;  2CNS A;  2B4B A;  2REF A;  5EBV A;  5E96 A;  4CS0 B;  1PUA A;  4NXY A;  1P0H A;  5KTC A;  1QSN A;  3IU1 A;  1P4N A;  2PSW A;  2B4D A;  4KZT A;  4XPD B;  1RXT A;  4MBU A;  4CAW A;  1RO5 A;  5BWA B;  2NMT A;  2OZU A;  4B14 A;  4OAE A;  2Z3O A;  4H89 A;  3TFY A;  1Q2C A;  4MFZ A;  2AE6 A;  2Q4V A;  3LD2 A;  2K5T A;  3W91 A;  2QEC A;  4CGN A;  5F46 A;  1OZP A;  3KKW A;  2ATR A;  3SHP A;  2HV2 A;  4ZGY B;  4CGO A;  4Q36 A;  2JDC A;  2R7H A;  4L89 A;  5GCN A;  2OU2 A;  4KSA A;  3DR6 A;  2Z10 A;  1Z4R A;  4MJ8 A;  3E0K A;  3S6K A;  1U6M A;  1WK4 A;  1YK3 A;  4XNH C;  4AVB A;  1XF8 A;  4A95 A;  5CNP A;  2HQY A;  1Z9U A;  3EY5 A;  3TO9 A;  3I9S A;  4UFX A;  3W6X A;  5IX3 A;  1TIQ A;  4L8A A;  4NEX A;  3DSB A;  4Y49 C;  1ZO0 A;  4PK2 A;  5A28 A;  2B3U A;  2Z3P A;  2A4N A;  2J8R A;  1N71 A;  4NSQ A;  5C88 A;  4RS2 A;  4KOW A;  3BJ8 A;  3LOD A;  4ONU A;  3N7Z A;  2VZZ A;  2J8N A;  3PP9 A;  1V0C A;  4U9Z A;  1BO4 A;  1B6B A;  2YNC C;  1YR0 A;  2B3V A;  3T90 A;  3CXP A;  2GE3 A;  4U9Y A;  2VQY A;  1I1D A;  2ARH A;  3K9U A;  2F5I A;  4QBJ A;  4KUA A;  2KCW A;  1SQH A;  2C27 A;  4UBR A;  3D2P A;  1S5K A;  4M3S A;  1PU9 A;  2WPW A;  2B5G A;  1M1D A;  4MFQ A;  2BUE A;  4MFL A;  2VI7 A;  4CYP A;  1KUY A;  5FVJ A;  3VWE A;  2HUZ A;  2PQ8 A;  4LX9 A;  4HNY B;  2Q7B A;  4YFJ A;  4YGO A;  4C2Y A;  4CGL A;  2YNC A;  3F0A A;  4KOS A;  1YLE A;  4MY3 A;  3TOB A;  4XNH B;  1YVO A;  4AVA A;  3BJ7 A;  1S3Z A;  1NSL A;  3TE4 A;  4MFK A;  3R9E A;  4JD6 A;  1I21 A;  4JXR A;  3IGR A;  1S7K A;  1KUV A;  2I00 A;  3FXT A;  2D4P A;  4PK3 A;  5AG5 A;  4B11 A;  1IYK A;  1YVK A;  4Y49 B;  2FT0 A;  3R9F A;  3QB8 A;  1KZF A;  4AVC A;  4FD4 A;  4KOU A;  3JTK A;  4JJX A;  3R1K A;  4F0Y A;  1ON0 A;  2FCK A;  5HH1 A;  3IWE A;  3F8K A;  4JLY A;  4CRY B;  2JLM A;  3QAH A;  4EVY A;  5AG4 A;  4GS4 A;  2WUU A;  2FL4 A;  2OB0 A;  4PSW A;  4UFW A;  1QST A;  4CGM A;  1YRE A;  2P6G A;  2DXQ A;  2B58 A;  3FIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...