1IOIA

X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMELEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRROLIDONE CARBOXYL PEPTIDASE
publication title X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, Pyrococcus furiosus, and its cys-free mutant
pubmed rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1ioiA00
3RO0A 4GXHA 1X12A 1IOIA 3RNZA 2EBJA 3GIUA 1IU8A 1Z8TA 1A2ZA 2DF5A 3LACA 1Z8XA 2EO8A 4HPSA 1X10A 1Z8WA 1IOFA 1AUGA
chains in the Genus database with same CATH superfamily
2PQ8A 4FBEA 4JZ0A 1I12A 1Z2LA 4CAWA 2GU2A 3IIBA 5F49A 4EFDA 1TKJA 4YGOA 5G1ZA 3S9LA 1YR0A 4KOSA 4MHPA 5J8CA 1P0HA 2NMTA 1PUAA 2PCUA 3OWCA 3FECA 3I3GA 3CT9A 3DGVA 2Q4VA 3B2YA 1IIDA 5H86A 2PJ1A 2POKA 2BO9A 3DR6A 4NGTA 1Q2CA 3CPXA 3K9UA 2VEZA 3FMCA 4HNXB 4C2XA 3RAMA 1YREA 4B10A 4MXUA 4IUSA 8CPAA 4LX9A 2PSWA 4HPSA 3LODA 4C68A 1B6BA 4ZY0A 1XIXA 4IK2A 1S7NA 3GY9A 4W9YA 3W6XA 3EY5A 2XEGA 4MFLA 3SJFA 3FB3A 2B4DB 4TNUA 2B58A 4X2TA 3SXNA 3FNCA 1VHOA 1ARLA 3PFEA 4UFVA 2GREA 4KOUA 1YSJA 4OC1A 1X12A 2D4OA 4UCMA 2GFQA 1RTQA 4NGRA 4F6AA 4B6ZA 2P6FA 1ARMA 4X5KA 1UFHA 4MHDA 2OU2A 4EMEA 6CPAA 2Y0MA 1M4LA 3TO7A 2QVPA 2J9AA 2VZYA 5HMNA 1M4DA 2GLJA 2BOAA 2AFSA 1KUYA 1QSRA 2FE7A 3D7DA 4GS4A 4M6IA 5K8OA 4HKFA 4RS2A 2O53A 4MFJA 1NSAA 2J8NA 2VI7A 2RFHA 4XPDC 4MY0A 1LOKA 4KZTA 4EVYA 1IGBA 2G3TA 2ZW6A 4RI1A 3GUXA 4UFWA 5JPHA 1CM0A 1BPMA 4NGPA 2YNDA 4MI4A 2ZEGA 4A2ZA 2K5TA 5THWA 4PXCA 3FYNA 1YW4A 4CAEA 3P2FA 4P4EA 1NSLA 3JUWA 1XMTA 3PBBA 4MMOA 2CIJA 3D67A 4KOWA 2I3CA 2YNEA 3H8EA 4DYOA 2F8HA 4B14A 3MRUA 4JXQA 4NEXA 4BINA 3H8GA 1J4JA 4CRYB 5AG4A 2PVVA 4MCSA 2AFZA 4Q38A 5KTCA 2RB7A 1IICA 2OR4A 1NE9A 4KS9A 5LRJA 1LANA 2FS5A 1QSNA 3B3VA 4FUUA 2Q4ZA 4QVTA 3T8WA 2B4DA 2EK9A 2VL1A 2WUUA 1VIXA 3CDXA 2PJ8A 1IYLA 4Q36A 4KUBA 3VWDA 3FJUA 1WK4A 3KHXA 1VGYA 1AYEA 4OADA 3D2PA 2CTCA 5J8FA 1I1DA 2JEVA 3R9EA 2BEIA 4KOTA 2PRBA 1Y9KA 4EWTA 2DPSA 2IQ6A 4MRIA 1QSMA 4AVAA 2AFXA 4UEEA 2GE3A 3CPAA 1BPNA 3TT2A 4CGOA 4A31A 1PCAA 1QSTA 2XEJA 2Z3MA 3N7ZA 4JD6A 1JWQA 4AVBA 2IL4A 4MHNA 1XJOA 2Q0YA 4U9YA 4IHMA 3D3SA 4WWVA 4A38A 4O23A 1M4GA 1ZLHA 2H5MA 2Z3LA 1S7KA 5H84A 4OC3A 1SQHA 4FD7A 2NSMA 4I49A 4MCPA 4X8IA 5CPAA 3H8FA 1VHSA 5FVJA 1RO5A 3N5FA 1TF8A 3BI0A 4R8FA 2Z3KA 3IWWA 4XPKA 2ZEPA 5J1QA 3NA6A 2CNSA 2OOTA 1YVKA 2GLFA 2ZW7A 1HEEA 3B7IA 4YU9A 2AFWA 4R3LA 5EC4A 4H2KA 2JEWA 1S5KA 2DF5A 2VZZA 1F2OA 1AMPA 2ZEEA 4QB9A 4DJLA 3F5BA 3NH4A 4MCQA 4F8ZA 3R1KA 1ZG7A 4E8OA 2CY2A 2PJCA 3F0AA 4Z65A 2V8DA 2PVWA 4UIBA 3IO1A 4Y49B 2ATRA 4R6TA 4C7HA 3R9FA 3LMSA 1BAVA 2PJ2A 5AG5A 2IMOA 3PB9X 3SJGA 4ONWA 4CGLA 3KKWA 3FEDA 2YNCC 3FIXA 5JM6A 4BMHA 1CJWA 1MK4A 1TKHA 3B3TA 3QNVA 4ONUA 4NGQA 4GXHA 2PE3A 3JTKA 2AFUA 2V8HA 4AXVA 3D7FA 2PJ0A 4YRHA 2I79A 4C2ZA 4CYQA 2CXAA 3TE4A 2AFOA 2WPWA 4OC5A 1OZPA 2C1CA 1K4JA 4OKOA 2ZEDA 4XNHC 4CYPA 5A27A 2PR8A 3D7HA 3TTHA 4JLYA 4UCPA 2C6PA 1H8LA 4OP4A 2Z0ZA 4UFXA 3PP9A 3E0KA 5HVHA 2Q7SA 1BO4A 4P4DA 2B3VA 2FIWA 4KOXA 4R9MA 2P6GA 1YGHA 4Q7AA 3H4QA 4QBJA 2A4NA 1X10A 5CBMA 4PXEA 4OC4A 4OAEA 4P4JA 2CF4A 4M6HA 2HC9A 1VKCA 2FT0A 4KVME 4R76A 1VHEA 2JBJA 4MY3A 3WR7A 4MHYA 1S60A 5F47A 5LYIA 4A32A 3R9GA 2Q04A 3WC5A 4FAIA 3NH8A 2PIYA 1XFOA 1YX0A 3EC4A 3PB4X 4F9UA 2V8GA 3I9SA 4E2AA 4ZX9A 2PJ9A 3L2NA 4KUAA 4QC6A 3PB6X 3V38A 1IB1E 4P44A 2EO8A 3D68A 5CNPA 4NFRA 3IWGA 1JQGA 3KR4A 4MBUA 2F7VA 3HLPA 4OIDA 3NH5A 2EK8A 5AGEA 3NFZA 3GKRA 1IYKA 2Q44A 2ZEOA 4PK2A 3TX8A 5LYDA 4UCNA 1Z8WA 4ZI6A 4HNYB 1AUGA 3RYOA 3SI1A 3D8PA 1CBXA 2DPTA 4KLVA 3DR8A 3C26A 5IB9A 1NMTA 1YK3A 3SHPA 4R87A 1P4NA 2PJ6A 3TFYA 3FVLA 2VBQA 3H5ZA 1TIQA 3RZAA 3JRUA 4NGNA 4XPLA 1XOVA 3SXOA 2FVGA 2JBKA 3NE7A 1WWZA 1PYTB 2HV2A 2ZEMA 3KGQA 2PJBA 2Q51A 2PJ3A 4WJBA 2WZNA 1FY7A 1Z9UA 5C88A 3PGPA 4AVCA 5F09A 4KOVA 1M1DA 3BHXA 5A28A 2R1IA 5HXDA 5K8NA 4PQAA 1KZFA 2WYRA 2PIZA 3D66A 4B13A 3WABA 1L0CA 5K8PA 1RXTA 2QJ8A 4M6GA 4MHZA 5BWAB 1F2PA 2PJ4A 4M3SA 2R8VA 4NXYA 3P2HA 3SJXA 5HVFA 1CPSA 1YLOA 1YQEA 3FX6A 3IGRA 4NCZA 4X3RA 4ZY2A 3S6HA 5ELYA 3S9MA 3EXNA 2HQYA 2QYVA 3PFOA 4AB7A 3LD2A 2PRQA 3IC1A 4QUSA 2PDOA 5LYLA 4K3NA 3GIUA 4UWJA 2R98A 1LAPA 4OC0A 3TOBA 3VARA 3EO4A 1GHEA 4MFPA 2FXFA 1Q2YA 2ABZA 2Z10A 2PJAA 2REFA 3DDDA 3D2MA 4P4FA 1QQ9A 1YVOA 2ARHA 3DSBA 4PSWA 1Y7EA 2BUEA 2DEAA 2O28A 3TO6A 5JH9A 4G1PA 4P6YA 3V7ZA 2Z3OA 1Q2DA 4KLWA 4AG9A 2G0BA 3QB8A 4JJXA 3BJ7A 4UWIA 5G20A 1PU9A 3EFAA 5E96A 4OLLA 3IFEA 3CZXA 1ELLP 1Z8LA 4C7IA 1KWMA 1IU8A 1ZG9A 2FIAA 3B35A 3FF3A 4R3KA 4UF4A 5EMIA 4KSIA 4FD6A 2JDDA 2EWBA 2WSAA 4C2YA 2ODFA 2BL1A 3IU1A 4K30A 4OC2A 4CPAA 5I0CA 3FEEA 3I1UA 4KOYA 1BLLE 5C82A 2DXQA 4H89A 4PV6A 3FBUA 1UWYA 4P4IA 3KASA 1DTDA 2OZUA 3CXSA 2ZOFA 4H6ZA 4JWPA 2IJZA 2G9DA 4UEFA 2ZELA 3BXMA 2V77A 3KR5A 4M85A 2ZXVA 2OB0A 1OBRA 4NSQA 4CAVA 4IAVA 3QAYA 3WC7A 1IOIA 4YWYA 1KUVA 2C27A 4KORA 4CGPA 4II9A 4P10A 4UA3A 4NJQA 1M4IA 4TWEA 3MN8A 1YMEA 2P0WA 4GM5A 2VXKA 1QMUA 3K9TA 3KZWA 4R7MA 2GANA 5EBVA 3S6FA 1FNOA 2B4BA 3SI2A 2EVNA 2FL4A 4XPDB 1BOBA 2J8RA 2F5IA 2J8MA 3KQZA 1Z5RA 4A94A 5IX3A 3B3CA 1Y0RA 2XEFA 4MJ8A 4PPZA 5IV0A 3VH9A 1XE4A 1TF9A 4FD5A 3PRTA 4KSFA 2OZGA 5JQ4A 5DWMA 3S6KA 2ZW4A 5G21A 3UY5A 4UEZA 2BCOA 1TXRA 4R57A 1GYTA 2XEIA 4CAXA 1XMBA 2PJ5A 3B8GA 5D8NA 1DE4C 1YW6A 5JGFA 4A30A 5K8MA 1S7FA 3W6SA 3MGDA 4A37A 1ZLIA 2C6CA 2Q4YA 4H6UA 5DWNA 3CXQA 1LCPA 2ZENA 1Z8XA 3KQXA 1Z4RA 3PB8X 4F0XA 1LAMA 4ZGYB 1R3NA 3FXTA 5DS0A 3G8WA 4CAFA 3NE8A 2GIVA 4NF1A 2D4PA 3K2KA 3ZJ0A 3PZJA 3DNSA 4Y49C 1EE3P 4B5PA 4UIAA 4OMEA 1R57A 2PJ7A 2Q7BA 3RO0A 3ISXA 3S6GA 3WT4A 3PEIA 1CP7A 3A9LA 2B3UA 2V8VA 1HDUA 4CYOA 1YLEA 4DUKA 3S9NA 2Z3PA 2ZEHA 1I21A 5IB0A 2O4HA 1LFWA 4U9ZA 4P4BA 2OZHA 2FSRA 1A2ZA 5GCNA 1M44A 3QAHA 3LACA 4A95A 2Q43A 3KHZA 2QIRA 4MFZA 4NGMA 4MFKA 4PK3A 1MJAA 2Z11A 4CGMA 5I4MA 3R95A 5D29A 1S3ZA 1U6MA 2QECA 4L8AA 4CGNA 3GLJA 4ORFA 1HDQA 2PR1A 1F57A 4L89A 3PBEA 4LQGA 1IOFA 4KVOE 3SJEA 1XBUA 1FT7A 3V8IA 4AG7A 4F0YA 3FH4A 1N71A 3F8KA 2CNTA 4CRZB 4FD4A 2AE6A 4FWUA 2WPXA 3G3SA 5AG7A 4P45A 1XF8A 2PC1A 3TOAA 2R7HA 2G3AA 2REEA 3BJ8A 1CX8A 2ANPA 4KVXA 1MJBA 2QMLA 3FRMA 1XEBA 1QSOA 4PXDA 2B5GB 2Z3NA 3WC6A 5LRGA 3BLNA 3D4UA 2JLMA 1B87A 1TKFA 4B12A 2ZPAA 5HH1A 5HVGA 4PSXA 7CPAA 2AJ6A 2HUZA 3W91A 5LYFA 3T90A 3ISZA 1KUXA 3TO9A 4IF5A 1CP6A 1XRYA 1Q7LA 4MFQA 4LQ6A 1IY7A 1ZO0A 1ON0A 3VATA 1Z4EA 2I00A 4JXRA 2YGWA 1Y0YA 3RBUA 2RC4A 4XNHB 3IU2A 4ZX8A 3RNZA 5LRKA 2EBJA 2X7BA 1Y9WA 3HUVA 3LWUA 2AFMA 5KTAA 3JVNA 3T9YA 1CG2A 1ZG8A 1S7LA 4NJRA 4CS0B 2FCKA 2JDCA 5F48A 5ISVA 4F9VA 3KL9A 1CPXA 4B5OA 2KCWA 4ZY1A 4BD9A 4MCRA 5AG6A 2EUIA 4OIWA 1ELMP 4ZBGA 2OH1A 1MJ9A 4LUAA 2ZW5A 4B5PB 4YFJA 4J3GA 2NYQA 3TCVA 3VWEA 4BBHA 4UBRA 4A33A 3ZZIA 4NGSA 4E0AA 2VQYA 3R96A 4RN7A 2ZEFA 3PB7X 4CYNA 3IEHA 4U5YA 1V0CA 4PXBA 5G22A 2CNMA 3IJ3A 1Z8TA 3BI1A 2B5GA 1LRZA 3TC8A 3B3SA 2ZOGA 2CTBA 4ZYQA 4A39A 2HB6A 2C6GA 4HNWB 4JYWA 3IWEA 3DLJA 3B3WA 3CXPA 3D7GA 3GYAA 1R43A 3GB0A 2BSWA 2YNCA 5F46A 4KSAA 3SI0A 1Y7RA 4RUHA 5KTDA 4DNCA 2P6EA 3KI9A 4B11A
chains in the Genus database with same CATH topology
3RO0A 4GXHA 1X12A 1IOIA 3RNZA 2EBJA 3GIUA 1IU8A 1Z8TA 1A2ZA 2DF5A 3LACA 1Z8XA 2EO8A 4HPSA 1X10A 1Z8WA 1IOFA 1AUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RO0 A;  4GXH A;  1X12 A;  1IOI A;  3RNZ A;  2EBJ A;  3GIU A;  1IU8 A;  1Z8T A;  1A2Z A;  2DF5 A;  3LAC A;  1Z8X A;  2EO8 A;  4HPS A;  1X10 A;  1Z8W A;  1IOF A;  1AUG A; 
#chains in the Genus database with same CATH topology
 2PQ8 A;  4FBE A;  4JZ0 A;  1I12 A;  1Z2L A;  4CAW A;  2GU2 A;  3IIB A;  5F49 A;  4EFD A;  1TKJ A;  4YGO A;  5G1Z A;  3S9L A;  1YR0 A;  4KOS A;  4MHP A;  5J8C A;  1P0H A;  2NMT A;  1PUA A;  2PCU A;  3OWC A;  3FEC A;  3I3G A;  3CT9 A;  3DGV A;  2Q4V A;  3B2Y A;  1IID A;  5H86 A;  2PJ1 A;  2POK A;  2BO9 A;  3DR6 A;  4NGT A;  1Q2C A;  3CPX A;  3K9U A;  2VEZ A;  3FMC A;  4HNX B;  4C2X A;  3RAM A;  1YRE A;  4B10 A;  4MXU A;  4IUS A;  8CPA A;  4LX9 A;  2PSW A;  4HPS A;  3LOD A;  4C68 A;  1B6B A;  4ZY0 A;  1XIX A;  4IK2 A;  1S7N A;  3GY9 A;  4W9Y A;  3W6X A;  3EY5 A;  2XEG A;  4MFL A;  3SJF A;  3FB3 A;  2B4D B;  4TNU A;  2B58 A;  4X2T A;  3SXN A;  3FNC A;  1VHO A;  1ARL A;  3PFE A;  4UFV A;  2GRE A;  4KOU A;  1YSJ A;  4OC1 A;  1X12 A;  2D4O A;  4UCM A;  2GFQ A;  1RTQ A;  4NGR A;  4F6A A;  4B6Z A;  2P6F A;  1ARM A;  4X5K A;  1UFH A;  4MHD A;  2OU2 A;  4EME A;  6CPA A;  2Y0M A;  1M4L A;  3TO7 A;  2QVP A;  2J9A A;  2VZY A;  5HMN A;  1M4D A;  2GLJ A;  2BOA A;  2AFS A;  1KUY A;  1QSR A;  2FE7 A;  3D7D A;  4GS4 A;  4M6I A;  5K8O A;  4HKF A;  4RS2 A;  2O53 A;  4MFJ A;  1NSA A;  2J8N A;  2VI7 A;  2RFH A;  4XPD C;  4MY0 A;  1LOK A;  4KZT A;  4EVY A;  1IGB A;  2G3T A;  2ZW6 A;  4RI1 A;  3GUX A;  4UFW A;  5JPH A;  1CM0 A;  1BPM A;  4NGP A;  2YND A;  4MI4 A;  2ZEG A;  4A2Z A;  2K5T A;  5THW A;  4PXC A;  3FYN A;  1YW4 A;  4CAE A;  3P2F A;  4P4E A;  1NSL A;  3JUW A;  1XMT A;  3PBB A;  4MMO A;  2CIJ A;  3D67 A;  4KOW A;  2I3C A;  2YNE A;  3H8E A;  4DYO A;  2F8H A;  4B14 A;  3MRU A;  4JXQ A;  4NEX A;  4BIN A;  3H8G A;  1J4J A;  4CRY B;  5AG4 A;  2PVV A;  4MCS A;  2AFZ A;  4Q38 A;  5KTC A;  2RB7 A;  1IIC A;  2OR4 A;  1NE9 A;  4KS9 A;  5LRJ A;  1LAN A;  2FS5 A;  1QSN A;  3B3V A;  4FUU A;  2Q4Z A;  4QVT A;  3T8W A;  2B4D A;  2EK9 A;  2VL1 A;  2WUU A;  1VIX A;  3CDX A;  2PJ8 A;  1IYL A;  4Q36 A;  4KUB A;  3VWD A;  3FJU A;  1WK4 A;  3KHX A;  1VGY A;  1AYE A;  4OAD A;  3D2P A;  2CTC A;  5J8F A;  1I1D A;  2JEV A;  3R9E A;  2BEI A;  4KOT A;  2PRB A;  1Y9K A;  4EWT A;  2DPS A;  2IQ6 A;  4MRI A;  1QSM A;  4AVA A;  2AFX A;  4UEE A;  2GE3 A;  3CPA A;  1BPN A;  3TT2 A;  4CGO A;  4A31 A;  1PCA A;  1QST A;  2XEJ A;  2Z3M A;  3N7Z A;  4JD6 A;  1JWQ A;  4AVB A;  2IL4 A;  4MHN A;  1XJO A;  2Q0Y A;  4U9Y A;  4IHM A;  3D3S A;  4WWV A;  4A38 A;  4O23 A;  1M4G A;  1ZLH A;  2H5M A;  2Z3L A;  1S7K A;  5H84 A;  4OC3 A;  1SQH A;  4FD7 A;  2NSM A;  4I49 A;  4MCP A;  4X8I A;  5CPA A;  3H8F A;  1VHS A;  5FVJ A;  1RO5 A;  3N5F A;  1TF8 A;  3BI0 A;  4R8F A;  2Z3K A;  3IWW A;  4XPK A;  2ZEP A;  5J1Q A;  3NA6 A;  2CNS A;  2OOT A;  1YVK A;  2GLF A;  2ZW7 A;  1HEE A;  3B7I A;  4YU9 A;  2AFW A;  4R3L A;  5EC4 A;  4H2K A;  2JEW A;  1S5K A;  2DF5 A;  2VZZ A;  1F2O A;  1AMP A;  2ZEE A;  4QB9 A;  4DJL A;  3F5B A;  3NH4 A;  4MCQ A;  4F8Z A;  3R1K A;  1ZG7 A;  4E8O A;  2CY2 A;  2PJC A;  3F0A A;  4Z65 A;  2V8D A;  2PVW A;  4UIB A;  3IO1 A;  4Y49 B;  2ATR A;  4R6T A;  4C7H A;  3R9F A;  3LMS A;  1BAV A;  2PJ2 A;  5AG5 A;  2IMO A;  3PB9 X;  3SJG A;  4ONW A;  4CGL A;  3KKW A;  3FED A;  2YNC C;  3FIX A;  5JM6 A;  4BMH A;  1CJW A;  1MK4 A;  1TKH A;  3B3T A;  3QNV A;  4ONU A;  4NGQ A;  4GXH A;  2PE3 A;  3JTK A;  2AFU A;  2V8H A;  4AXV A;  3D7F A;  2PJ0 A;  4YRH A;  2I79 A;  4C2Z A;  4CYQ A;  2CXA A;  3TE4 A;  2AFO A;  2WPW A;  4OC5 A;  1OZP A;  2C1C A;  1K4J A;  4OKO A;  2ZED A;  4XNH C;  4CYP A;  5A27 A;  2PR8 A;  3D7H A;  3TTH A;  4JLY A;  4UCP A;  2C6P A;  1H8L A;  4OP4 A;  2Z0Z A;  4UFX A;  3PP9 A;  3E0K A;  5HVH A;  2Q7S A;  1BO4 A;  4P4D A;  2B3V A;  2FIW A;  4KOX A;  4R9M A;  2P6G A;  1YGH A;  4Q7A A;  3H4Q A;  4QBJ A;  2A4N A;  1X10 A;  5CBM A;  4PXE A;  4OC4 A;  4OAE A;  4P4J A;  2CF4 A;  4M6H A;  2HC9 A;  1VKC A;  2FT0 A;  4KVM E;  4R76 A;  1VHE A;  2JBJ A;  4MY3 A;  3WR7 A;  4MHY A;  1S60 A;  5F47 A;  5LYI A;  4A32 A;  3R9G A;  2Q04 A;  3WC5 A;  4FAI A;  3NH8 A;  2PIY A;  1XFO A;  1YX0 A;  3EC4 A;  3PB4 X;  4F9U A;  2V8G A;  3I9S A;  4E2A A;  4ZX9 A;  2PJ9 A;  3L2N A;  4KUA A;  4QC6 A;  3PB6 X;  3V38 A;  1IB1 E;  4P44 A;  2EO8 A;  3D68 A;  5CNP A;  4NFR A;  3IWG A;  1JQG A;  3KR4 A;  4MBU A;  2F7V A;  3HLP A;  4OID A;  3NH5 A;  2EK8 A;  5AGE A;  3NFZ A;  3GKR A;  1IYK A;  2Q44 A;  2ZEO A;  4PK2 A;  3TX8 A;  5LYD A;  4UCN A;  1Z8W A;  4ZI6 A;  4HNY B;  1AUG A;  3RYO A;  3SI1 A;  3D8P A;  1CBX A;  2DPT A;  4KLV A;  3DR8 A;  3C26 A;  5IB9 A;  1NMT A;  1YK3 A;  3SHP A;  4R87 A;  1P4N A;  2PJ6 A;  3TFY A;  3FVL A;  2VBQ A;  3H5Z A;  1TIQ A;  3RZA A;  3JRU A;  4NGN A;  4XPL A;  1XOV A;  3SXO A;  2FVG A;  2JBK A;  3NE7 A;  1WWZ A;  1PYT B;  2HV2 A;  2ZEM A;  3KGQ A;  2PJB A;  2Q51 A;  2PJ3 A;  4WJB A;  2WZN A;  1FY7 A;  1Z9U A;  5C88 A;  3PGP A;  4AVC A;  5F09 A;  4KOV A;  1M1D A;  3BHX A;  5A28 A;  2R1I A;  5HXD A;  5K8N A;  4PQA A;  1KZF A;  2WYR A;  2PIZ A;  3D66 A;  4B13 A;  3WAB A;  1L0C A;  5K8P A;  1RXT A;  2QJ8 A;  4M6G A;  4MHZ A;  5BWA B;  1F2P A;  2PJ4 A;  4M3S A;  2R8V A;  4NXY A;  3P2H A;  3SJX A;  5HVF A;  1CPS A;  1YLO A;  1YQE A;  3FX6 A;  3IGR A;  4NCZ A;  4X3R A;  4ZY2 A;  3S6H A;  5ELY A;  3S9M A;  3EXN A;  2HQY A;  2QYV A;  3PFO A;  4AB7 A;  3LD2 A;  2PRQ A;  3IC1 A;  4QUS A;  2PDO A;  5LYL A;  4K3N A;  3GIU A;  4UWJ A;  2R98 A;  1LAP A;  4OC0 A;  3TOB A;  3VAR A;  3EO4 A;  1GHE A;  4MFP A;  2FXF A;  1Q2Y A;  2ABZ A;  2Z10 A;  2PJA A;  2REF A;  3DDD A;  3D2M A;  4P4F A;  1QQ9 A;  1YVO A;  2ARH A;  3DSB A;  4PSW A;  1Y7E A;  2BUE A;  2DEA A;  2O28 A;  3TO6 A;  5JH9 A;  4G1P A;  4P6Y A;  3V7Z A;  2Z3O A;  1Q2D A;  4KLW A;  4AG9 A;  2G0B A;  3QB8 A;  4JJX A;  3BJ7 A;  4UWI A;  5G20 A;  1PU9 A;  3EFA A;  5E96 A;  4OLL A;  3IFE A;  3CZX A;  1ELL P;  1Z8L A;  4C7I A;  1KWM A;  1IU8 A;  1ZG9 A;  2FIA A;  3B35 A;  3FF3 A;  4R3K A;  4UF4 A;  5EMI A;  4KSI A;  4FD6 A;  2JDD A;  2EWB A;  2WSA A;  4C2Y A;  2ODF A;  2BL1 A;  3IU1 A;  4K30 A;  4OC2 A;  4CPA A;  5I0C A;  3FEE A;  3I1U A;  4KOY A;  1BLL E;  5C82 A;  2DXQ A;  4H89 A;  4PV6 A;  3FBU A;  1UWY A;  4P4I A;  3KAS A;  1DTD A;  2OZU A;  3CXS A;  2ZOF A;  4H6Z A;  4JWP A;  2IJZ A;  2G9D A;  4UEF A;  2ZEL A;  3BXM A;  2V77 A;  3KR5 A;  4M85 A;  2ZXV A;  2OB0 A;  1OBR A;  4NSQ A;  4CAV A;  4IAV A;  3QAY A;  3WC7 A;  1IOI A;  4YWY A;  1KUV A;  2C27 A;  4KOR A;  4CGP A;  4II9 A;  4P10 A;  4UA3 A;  4NJQ A;  1M4I A;  4TWE A;  3MN8 A;  1YME A;  2P0W A;  4GM5 A;  2VXK A;  1QMU A;  3K9T A;  3KZW A;  4R7M A;  2GAN A;  5EBV A;  3S6F A;  1FNO A;  2B4B A;  3SI2 A;  2EVN A;  2FL4 A;  4XPD B;  1BOB A;  2J8R A;  2F5I A;  2J8M A;  3KQZ A;  1Z5R A;  4A94 A;  5IX3 A;  3B3C A;  1Y0R A;  2XEF A;  4MJ8 A;  4PPZ A;  5IV0 A;  3VH9 A;  1XE4 A;  1TF9 A;  4FD5 A;  3PRT A;  4KSF A;  2OZG A;  5JQ4 A;  5DWM A;  3S6K A;  2ZW4 A;  5G21 A;  3UY5 A;  4UEZ A;  2BCO A;  1TXR A;  4R57 A;  1GYT A;  2XEI A;  4CAX A;  1XMB A;  2PJ5 A;  3B8G A;  5D8N A;  1DE4 C;  1YW6 A;  5JGF A;  4A30 A;  5K8M A;  1S7F A;  3W6S A;  3MGD A;  4A37 A;  1ZLI A;  2C6C A;  2Q4Y A;  4H6U A;  5DWN A;  3CXQ A;  1LCP A;  2ZEN A;  1Z8X A;  3KQX A;  1Z4R A;  3PB8 X;  4F0X A;  1LAM A;  4ZGY B;  1R3N A;  3FXT A;  5DS0 A;  3G8W A;  4CAF A;  3NE8 A;  2GIV A;  4NF1 A;  2D4P A;  3K2K A;  3ZJ0 A;  3PZJ A;  3DNS A;  4Y49 C;  1EE3 P;  4B5P A;  4UIA A;  4OME A;  1R57 A;  2PJ7 A;  2Q7B A;  3RO0 A;  3ISX A;  3S6G A;  3WT4 A;  3PEI A;  1CP7 A;  3A9L A;  2B3U A;  2V8V A;  1HDU A;  4CYO A;  1YLE A;  4DUK A;  3S9N A;  2Z3P A;  2ZEH A;  1I21 A;  5IB0 A;  2O4H A;  1LFW A;  4U9Z A;  4P4B A;  2OZH A;  2FSR A;  1A2Z A;  5GCN A;  1M44 A;  3QAH A;  3LAC A;  4A95 A;  2Q43 A;  3KHZ A;  2QIR A;  4MFZ A;  4NGM A;  4MFK A;  4PK3 A;  1MJA A;  2Z11 A;  4CGM A;  5I4M A;  3R95 A;  5D29 A;  1S3Z A;  1U6M A;  2QEC A;  4L8A A;  4CGN A;  3GLJ A;  4ORF A;  1HDQ A;  2PR1 A;  1F57 A;  4L89 A;  3PBE A;  4LQG A;  1IOF A;  4KVO E;  3SJE A;  1XBU A;  1FT7 A;  3V8I A;  4AG7 A;  4F0Y A;  3FH4 A;  1N71 A;  3F8K A;  2CNT A;  4CRZ B;  4FD4 A;  2AE6 A;  4FWU A;  2WPX A;  3G3S A;  5AG7 A;  4P45 A;  1XF8 A;  2PC1 A;  3TOA A;  2R7H A;  2G3A A;  2REE A;  3BJ8 A;  1CX8 A;  2ANP A;  4KVX A;  1MJB A;  2QML A;  3FRM A;  1XEB A;  1QSO A;  4PXD A;  2B5G B;  2Z3N A;  3WC6 A;  5LRG A;  3BLN A;  3D4U A;  2JLM A;  1B87 A;  1TKF A;  4B12 A;  2ZPA A;  5HH1 A;  5HVG A;  4PSX A;  7CPA A;  2AJ6 A;  2HUZ A;  3W91 A;  5LYF A;  3T90 A;  3ISZ A;  1KUX A;  3TO9 A;  4IF5 A;  1CP6 A;  1XRY A;  1Q7L A;  4MFQ A;  4LQ6 A;  1IY7 A;  1ZO0 A;  1ON0 A;  3VAT A;  1Z4E A;  2I00 A;  4JXR A;  2YGW A;  1Y0Y A;  3RBU A;  2RC4 A;  4XNH B;  3IU2 A;  4ZX8 A;  3RNZ A;  5LRK A;  2EBJ A;  2X7B A;  1Y9W A;  3HUV A;  3LWU A;  2AFM A;  5KTA A;  3JVN A;  3T9Y A;  1CG2 A;  1ZG8 A;  1S7L A;  4NJR A;  4CS0 B;  2FCK A;  2JDC A;  5F48 A;  5ISV A;  4F9V A;  3KL9 A;  1CPX A;  4B5O A;  2KCW A;  4ZY1 A;  4BD9 A;  4MCR A;  5AG6 A;  2EUI A;  4OIW A;  1ELM P;  4ZBG A;  2OH1 A;  1MJ9 A;  4LUA A;  2ZW5 A;  4B5P B;  4YFJ A;  4J3G A;  2NYQ A;  3TCV A;  3VWE A;  4BBH A;  4UBR A;  4A33 A;  3ZZI A;  4NGS A;  4E0A A;  2VQY A;  3R96 A;  4RN7 A;  2ZEF A;  3PB7 X;  4CYN A;  3IEH A;  4U5Y A;  1V0C A;  4PXB A;  5G22 A;  2CNM A;  3IJ3 A;  1Z8T A;  3BI1 A;  2B5G A;  1LRZ A;  3TC8 A;  3B3S A;  2ZOG A;  2CTB A;  4ZYQ A;  4A39 A;  2HB6 A;  2C6G A;  4HNW B;  4JYW A;  3IWE A;  3DLJ A;  3B3W A;  3CXP A;  3D7G A;  3GYA A;  1R43 A;  3GB0 A;  2BSW A;  2YNC A;  5F46 A;  4KSA A;  3SI0 A;  1Y7R A;  4RUH A;  5KTD A;  4DNC A;  2P6E A;  3KI9 A;  4B11 A; 
#chains in the Genus database with same CATH homology
 3RO0 A;  4GXH A;  1X12 A;  1IOI A;  3RNZ A;  2EBJ A;  3GIU A;  1IU8 A;  1Z8T A;  1A2Z A;  2DF5 A;  3LAC A;  1Z8X A;  2EO8 A;  4HPS A;  1X10 A;  1Z8W A;  1IOF A;  1AUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...