1IOIA

X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMELEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PYRROLIDONE CARBOXYL PEPTIDASE
publication title X-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, Pyrococcus furiosus, and its cys-free mutant
pubmed rcsb
source organism Pyrococcus furiosus
total genus 68
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1ioiA00
2EO8A 1Z8TA 3LACA 2EBJA 3GIUA 4GXHA 1AUGA 1X12A 1A2ZA 4HPSA 1Z8XA 2DF5A 1IOFA 1Z8WA 1IOIA 3RNZA 3RO0A 1IU8A 1X10A
chains in the Genus database with same CATH superfamily
5KTAA 3K9UA 4DJLA 5F47A 1AMPA 1LANA 1S7LA 2O28A 4XPKA 5A27A 2FSRA 2ZXVA 4GXHA 4BBHA 4X2TA 2C6PA 2VI7A 4OC1A 4Y49B 1WWZA 4AG9A 4NGQA 2PIZA 1KUXA 3WABA 2GE3A 2V8HA 4CAXA 2K5TA 2AFSA 1YVOA 2B4BA 3S9MA 2V8VA 1LRZA 1V0CA 1XBUA 2OZGA 3TT2A 1ARMA 5K8PA 1Z8XA 1TF9A 3W91A 4UEEA 1Y9KA 1PUAA 3H8GA 4OC0A 2BUEA 1Z2LA 2ZEEA 3I1UA 3LD2A 3RAMA 2ZW5A 4NJQA 2GREA 4MCRA 2EK9A 5IX3A 2OU2A 3IFEA 2RC4A 3TFYA 1BO4A 2D4PA 2JBJA 3D2PA 2BL1A 1GYTA 2WSAA 6CPAA 3TO6A 4LQGA 4R3LA 1YMEA 4WJBA 2PIYA 2OOTA 3BLNA 5LYDA 5G1ZA 3NE7A 4M6HA 3TO9A 1YW6A 2Z3OA 4A2ZA 4NF1A 1MJAA 1KWMA 4UBRA 1FNOA 1VHEA 2CNSA 4MMOA 1RXTA 3CXQA 4OC5A 4FBEA 2GLJA 1S60A 1BAVA 4B10A 4UFVA 2NSMA 4P4IA 3FIXA 2GLFA 4BINA 4II9A 3FRMA 5I0CA 1KZFA 1F2PA 5E96A 1M44A 2PE3A 2OZHA 2PJ0A 2I79A 2REFA 3IO1A 3F8KA 2PC1A 1Z9UA 4MBUA 4YWYA 3V38A 5HXDA 2FE7A 4M6IA 3GY9A 3K9TA 4UCPA 4A30A 5IB9A 2DPTA 4MY0A 5J8CA 4KOYA 2EVNA 3IWEA 1QSNA 4B13A 4B12A 5LRKA 4MI4A 2ZW7A 4H89A 3PP9A 4KOXA 2CNMA 2H5MA 4QBJA 4CRZB 2FS5A 4LUAA 3VWEA 1U6MA 2PRBA 4L89A 4A95A 1XJOA 5JM6A 4KOWA 2JDDA 3IU1A 5AG5A 2FT0A 1TF8A 4PPZA 4DNCA 4YFJA 1SQHA 4KOVA 3PB8X 4F9VA 2OB0A 5H84A 3EY5A 2G3TA 3HLPA 4NGNA 3A9LA 4R3KA 5LYIA 2D4OA 3FECA 4R76A 4CYNA 2XEFA 4C2XA 4KVXA 4NXYA 4UFXA 3SHPA 4XPLA 4YRHA 4MCQA 4JJXA 4MCPA 1NSAA 3D68A 3SXNA 4BD9A 2Z11A 3IU2A 3FMCA 4R7MA 2B5GB 4Q38A 1YK3A 2PJAA 3T90A 4Q7AA 2WPXA 5ELYA 1Z4EA 3WT4A 1PYTB 4MHZA 4P4JA 2P6EA 2AFWA 1CG2A 3G3SA 2A4NA 4F8ZA 4AG7A 1YSJA 5I4MA 2QJ8A 3D7FA 5HVFA 4C2YA 3SXOA 1LAPA 3DLJA 3KHZA 3NA6A 4K3NA 4MY3A 4PXEA 1Z8TA 1X10A 2ZENA 3FF3A 4UCNA 3TTHA 4F0XA 4MFLA 1M4DA 4WWVA 4UEFA 4HNYB 1QSMA 1CPSA 1M4LA 2EUIA 2ZOFA 2QVPA 4KSIA 1XFOA 2WUUA 4B5OA 4BMHA 1R57A 2ZELA 4E2AA 3MGDA 3KQZA 3D2MA 2POKA 2QYVA 1M4GA 1Y0YA 2VZZA 3SJGA 5JQ4A 1QQ9A 3H5ZA 4M6GA 4FAIA 1Z4RA 2Q4VA 2ZOGA 4AVAA 4CAWA 3B3VA 8CPAA 1L0CA 5THWA 1QSOA 2Y0MA 3CZXA 3KASA 3TOAA 3GUXA 2DF5A 2EK8A 1Z8WA 2V8GA 4HKFA 3VH9A 4OC4A 2WZNA 2PJ5A 4PK2A 2HV2A 1Y0RA 3GLJA 3TOBA 2C6GA 2ARHA 2OZUA 2CF4A 3D7DA 2ZW6A 4FD7A 2YNCC 4B5PA 3KHXA 4NCZA 4NFRA 2PJ3A 4HNWB 4ZY1A 1ZG7A 2Z3MA 3ISXA 4IAVA 3BJ7A 2QMLA 3KR5A 1XF8A 3ISZA 4PQAA 3BI0A 3PB7X 4P10A 2GFQA 3PBBA 4P4DA 5KTCA 4KVOE 4CGNA 3BI1A 1A2ZA 4HPSA 2G9DA 4E8OA 4HNXB 4C68A 3EXNA 2AFMA 1IGBA 4FD6A 4NGPA 3IJ3A 1TIQA 2Q43A 1MJBA 2Q4YA 2VBQA 4U5YA 4OC3A 3KGQA 1YQEA 3RO0A 3NH5A 1IU8A 4IK2A 1IY7A 1Y7RA 3MN8A 1S3ZA 5C88A 3SI2A 2C27A 4RI1A 2VQYA 2OH1A 3BXMA 2P0WA 4OP4A 1KUYA 1Q2YA 2KCWA 2Z3KA 3GKRA 1N71A 4OKOA 4UIBA 5AG7A 3R96A 5IB0A 4JXQA 3JVNA 4PV6A 4NEXA 3FJUA 5IV0A 2JEVA 4UWIA 3WC5A 2XEIA 4CAFA 3KR4A 1DTDA 3RBUA 5BWAB 3D3SA 4B14A 3VARA 3FBUA 1LOKA 2J8NA 2P6GA 5AGEA 2I3CA 3FVLA 3IC1A 4TNUA 1RO5A 4RN7A 3CXSA 2VXKA 3PB9X 4EVYA 2J8RA 2XEJA 4B6ZA 1XIXA 2ZEOA 4P45A 5K8OA 2PDOA 4PXBA 2PJ7A 3LMSA 4MJ8A 2C1CA 1QMUA 4MHPA 4AB7A 2PQ8A 2VEZA 2JBKA 2PCUA 2G0BA 4XPDC 2Z10A 4KOSA 2R98A 3FXTA 1CP7A 4UIAA 1YR0A 4A39A 4C7HA 5KTDA 3WR7A 1I21A 1JQGA 2PJ8A 2PVWA 1AYEA 2Z3NA 4KLWA 3CDXA 2J8MA 2GU2A 3H4QA 1Z5RA 3BHXA 2Q0YA 3GB0A 4GS4A 4KVME 2B3VA 3L2NA 3S6GA 4AVBA 2NMTA 5G20A 5LRGA 1TXRA 1YW4A 3D7GA 4MFJA 1IOIA 4GM5A 4X5KA 2PJ2A 4B11A 5A28A 3FB3A 4KSAA 4A33A 1HDUA 5JH9A 1XRYA 1I12A 5AG4A 3LACA 4CYPA 1PU9A 1JWQA 3NFZA 1HEEA 2B3UA 5AG6A 1Q7LA 1TKFA 4J3GA 2AE6A 3D4UA 4P4FA 3OWCA 4OAEA 4TWEA 1ZLHA 2IQ6A 3V7ZA 1S5KA 2O53A 1S7FA 4NGTA 2PJ6A 3QAHA 5GCNA 3PFOA 1CM0A 2DPSA 3KL9A 2GANA 1Z8LA 3SI1A 4RS2A 4XNHC 5H86A 1HDQA 4P6YA 1XEBA 4UEZA 1EE3P 2B4DB 4UA3A 3T9YA 3SJXA 4ZGYB 3FX6A 2EWBA 2PSWA 1IOFA 2X7BA 3CT9A 4KS9A 4EWTA 4OADA 1R3NA 4ZBGA 2FIAA 2ANPA 3RZAA 3TO7A 3B3WA 2ODFA 3KI9A 3V8IA 5F46A 4PSWA 2B5GA 1M1DA 1S7KA 1UWYA 2IMOA 2R7HA 4IUSA 4K30A 4OLLA 2B4DA 1XE4A 4H2KA 3F5BA 2XEGA 3CXPA 3LWUA 4YGOA 3ZJ0A 3FYNA 1PCAA 3NE8A 5FVJA 3JRUA 5K8MA 1VHSA 2F5IA 3B3CA 1B6BA 4CYOA 2PJ4A 2WPWA 1YREA 2HUZA 1VGYA 2Z0ZA 4PXCA 2YNDA 2BOAA 3B3TA 3PEIA 4LQ6A 4X8IA 3FNCA 3G8WA 4QVTA 5HH1A 3DDDA 3GYAA 2HC9A 4MFKA 3T8WA 4CAVA 4KUAA 3H8FA 1ELMP 1WK4A 3FEDA 3JTKA 1MK4A 3B35A 3IWWA 4P4BA 1XMTA 2GIVA 4G1PA 4ZY0A 4A31A 3N7ZA 2ZEPA 1F57A 1YX0A 2PR8A 2V8DA 4PXDA 1ELLP 1Q2CA 2CXAA 2EBJA 2FXFA 1ZG9A 2PJBA 4R87A 2CTCA 5G21A 3S6HA 3WC7A 1RTQA 3TX8A 5C82A 5HVHA 5JGFA 1ON0A 5HVGA 3FH4A 4JD6A 5DWNA 1XMBA 3TE4A 2JLMA 1Y9WA 2PR1A 2C6CA 4H6UA 4UWJA 1FT7A 3TC8A 3S9LA 2ZEGA 3CPAA 2ZEHA 2F8HA 3MRUA 2AFXA 3PGPA 4CPAA 5DS0A 1LCPA 1I1DA 3I9SA 1IB1E 1BPMA 2VL1A 2HQYA 2RB7A 4MHYA 2CY2A 3IEHA 3SJEA 1IIDA 4NGMA 2DXQA 2ZEFA 4MFZA 4XPDB 2YGWA 3B8GA 1CBXA 5F48A 2PJCA 5CBMA 4IF5A 2P6FA 3VWDA 3KZWA 4CGOA 3UY5A 2ZEDA 2AFUA 2Q04A 1YVKA 3DR8A 4OMEA 1NE9A 4QC6A 3SI0A 1R43A 2F7VA 3P2HA 4NGRA 3B2YA 4MHDA 4PSXA 3ZZIA 2ZEMA 1LAMA 4F6AA 4ZX8A 2OR4A 4CGLA 1CP6A 3KQXA 2PVVA 3R1KA 4X3RA 4A32A 2Q4ZA 4KORA 4CS0B 2I00A 1MJ9A 3IIBA 1TKHA 4Q36A 4MRIA 4AVCA 5G22A 4C7IA 4MFPA 4Z65A 4ONUA 1VKCA 3SJFA 3N5FA 1DE4C 4NJRA 2REEA 4EMEA 4RUHA 4LX9A 5D29A 4NGSA 5J1QA 4NSQA 4UFWA 2BEIA 4IHMA 4AXVA 4KOUA 1FY7A 5F49A 3R9EA 4L8AA 4XNHB 3RYOA 4ZY2A 2R1IA 4Y49C 2FCKA 3PRTA 2AFOA 2BCOA 2YNEA 2VZYA 3S9NA 2JDCA 2Q7SA 1NSLA 4JXRA 4KOTA 4KZTA 7CPAA 4UCMA 3D67A 5EC4A 3RNZA 2IJZA 2R8VA 4PK3A 2PJ9A 1CPXA 1ARLA 2PJ1A 5ISVA 3R9GA 4QUSA 5JPHA 2EO8A 2AFZA 1VHOA 4CAEA 3S6KA 5F09A 1IYLA 1YLOA 3DNSA 3EC4A 2QECA 4CGMA 3DSBA 4I49A 2B58A 4C2ZA 5LRJA 4FD5A 4ZYQA 1ZO0A 2Q7BA 2BSWA 3GIUA 3LODA 3I3GA 4KLVA 2CTBA 3HUVA 3PB4X 5DWMA 3W6XA 1AUGA 1Y7EA 3PZJA 1GHEA 4OIDA 1IICA 2AJ6A 2ATRA 3H8EA 4UF4A 1CX8A 5LYLA 4EFDA 2RFHA 3D7HA 3QNVA 4MHNA 2HB6A 4U9ZA 4KUBA 4YU9A 3QAYA 1BPNA 5J8FA 3JUWA 4FD4A 1K4JA 1Q2DA 3R9FA 3EO4A 2CIJA 4KSFA 4R57A 4OC2A 2QIRA 3D66A 3PB6X 4JZ0A 2DEAA 1TKJA 4JWPA 4ZX9A 4CYQA 3DGVA 2PRQA 2WYRA 2G3AA 2Z3PA 3FEEA 4R6TA 4CRYB 2FL4A 1UFHA 1M4IA 3NH8A 3S6FA 2FIWA 4U9YA 3W6SA 4M3SA 4E0AA 1OZPA 1KUVA 4R9MA 4F0YA 4ZI6A 1QSRA 3IGRA 2O4HA 1BLLE 3B3SA 1X12A 3K2KA 3P2FA 2YNCA 4O23A 4A37A 1B87A 1XOVA 3B7IA 2FVGA 3DR6A 2ZW4A 3NH4A 1VIXA 4OIWA 2NYQA 1YGHA 4MCSA 4M85A 2Z3LA 4JYWA 3QB8A 4P44A 5HMNA 3PBEA 4DUKA 3F0AA 3D8PA 3IWGA 1NMTA 3R95A 3TCVA 1LFWA 4F9UA 5EBVA 4ONWA 1H8LA 4W9YA 4CGPA 1CJWA 2Q44A 5EMIA 1OBRA 1F2OA 2IL4A 3E0KA 1IYKA 1J4JA 1ZLIA 4P4EA 5CPAA 4H6ZA 1QSTA 4A94A 3KKWA 1BOBA 2ABZA 3PFEA 3WC6A 4FUUA 4B5PB 1P4NA 4QB9A 2Q51A 4JLYA 4DYOA 2CNTA 3BJ8A 4MFQA 3VATA 2ZPAA 4ORFA 4A38A 2JEWA 5K8NA 2BO9A 2J9AA 3CPXA 2V77A 1S7NA 1ZG8A 5CNPA 5D8NA 5LYFA 3EFAA 4MXUA 1P0HA 4FWUA 1YLEA 4R8FA 3C26A
chains in the Genus database with same CATH topology
2EO8A 1Z8TA 3LACA 2EBJA 3GIUA 4GXHA 1AUGA 1X12A 1A2ZA 4HPSA 1Z8XA 2DF5A 1IOFA 1Z8WA 1IOIA 3RNZA 3RO0A 1IU8A 1X10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EO8 A;  1Z8T A;  3LAC A;  2EBJ A;  3GIU A;  4GXH A;  1AUG A;  1X12 A;  1A2Z A;  4HPS A;  1Z8X A;  2DF5 A;  1IOF A;  1Z8W A;  1IOI A;  3RNZ A;  3RO0 A;  1IU8 A;  1X10 A; 
#chains in the Genus database with same CATH topology
 5KTA A;  3K9U A;  4DJL A;  5F47 A;  1AMP A;  1LAN A;  1S7L A;  2O28 A;  4XPK A;  5A27 A;  2FSR A;  2ZXV A;  4GXH A;  4BBH A;  4X2T A;  2C6P A;  2VI7 A;  4OC1 A;  4Y49 B;  1WWZ A;  4AG9 A;  4NGQ A;  2PIZ A;  1KUX A;  3WAB A;  2GE3 A;  2V8H A;  4CAX A;  2K5T A;  2AFS A;  1YVO A;  2B4B A;  3S9M A;  2V8V A;  1LRZ A;  1V0C A;  1XBU A;  2OZG A;  3TT2 A;  1ARM A;  5K8P A;  1Z8X A;  1TF9 A;  3W91 A;  4UEE A;  1Y9K A;  1PUA A;  3H8G A;  4OC0 A;  2BUE A;  1Z2L A;  2ZEE A;  3I1U A;  3LD2 A;  3RAM A;  2ZW5 A;  4NJQ A;  2GRE A;  4MCR A;  2EK9 A;  5IX3 A;  2OU2 A;  3IFE A;  2RC4 A;  3TFY A;  1BO4 A;  2D4P A;  2JBJ A;  3D2P A;  2BL1 A;  1GYT A;  2WSA A;  6CPA A;  3TO6 A;  4LQG A;  4R3L A;  1YME A;  4WJB A;  2PIY A;  2OOT A;  3BLN A;  5LYD A;  5G1Z A;  3NE7 A;  4M6H A;  3TO9 A;  1YW6 A;  2Z3O A;  4A2Z A;  4NF1 A;  1MJA A;  1KWM A;  4UBR A;  1FNO A;  1VHE A;  2CNS A;  4MMO A;  1RXT A;  3CXQ A;  4OC5 A;  4FBE A;  2GLJ A;  1S60 A;  1BAV A;  4B10 A;  4UFV A;  2NSM A;  4P4I A;  3FIX A;  2GLF A;  4BIN A;  4II9 A;  3FRM A;  5I0C A;  1KZF A;  1F2P A;  5E96 A;  1M44 A;  2PE3 A;  2OZH A;  2PJ0 A;  2I79 A;  2REF A;  3IO1 A;  3F8K A;  2PC1 A;  1Z9U A;  4MBU A;  4YWY A;  3V38 A;  5HXD A;  2FE7 A;  4M6I A;  3GY9 A;  3K9T A;  4UCP A;  4A30 A;  5IB9 A;  2DPT A;  4MY0 A;  5J8C A;  4KOY A;  2EVN A;  3IWE A;  1QSN A;  4B13 A;  4B12 A;  5LRK A;  4MI4 A;  2ZW7 A;  4H89 A;  3PP9 A;  4KOX A;  2CNM A;  2H5M A;  4QBJ A;  4CRZ B;  2FS5 A;  4LUA A;  3VWE A;  1U6M A;  2PRB A;  4L89 A;  4A95 A;  1XJO A;  5JM6 A;  4KOW A;  2JDD A;  3IU1 A;  5AG5 A;  2FT0 A;  1TF8 A;  4PPZ A;  4DNC A;  4YFJ A;  1SQH A;  4KOV A;  3PB8 X;  4F9V A;  2OB0 A;  5H84 A;  3EY5 A;  2G3T A;  3HLP A;  4NGN A;  3A9L A;  4R3K A;  5LYI A;  2D4O A;  3FEC A;  4R76 A;  4CYN A;  2XEF A;  4C2X A;  4KVX A;  4NXY A;  4UFX A;  3SHP A;  4XPL A;  4YRH A;  4MCQ A;  4JJX A;  4MCP A;  1NSA A;  3D68 A;  3SXN A;  4BD9 A;  2Z11 A;  3IU2 A;  3FMC A;  4R7M A;  2B5G B;  4Q38 A;  1YK3 A;  2PJA A;  3T90 A;  4Q7A A;  2WPX A;  5ELY A;  1Z4E A;  3WT4 A;  1PYT B;  4MHZ A;  4P4J A;  2P6E A;  2AFW A;  1CG2 A;  3G3S A;  2A4N A;  4F8Z A;  4AG7 A;  1YSJ A;  5I4M A;  2QJ8 A;  3D7F A;  5HVF A;  4C2Y A;  3SXO A;  1LAP A;  3DLJ A;  3KHZ A;  3NA6 A;  4K3N A;  4MY3 A;  4PXE A;  1Z8T A;  1X10 A;  2ZEN A;  3FF3 A;  4UCN A;  3TTH A;  4F0X A;  4MFL A;  1M4D A;  4WWV A;  4UEF A;  4HNY B;  1QSM A;  1CPS A;  1M4L A;  2EUI A;  2ZOF A;  2QVP A;  4KSI A;  1XFO A;  2WUU A;  4B5O A;  4BMH A;  1R57 A;  2ZEL A;  4E2A A;  3MGD A;  3KQZ A;  3D2M A;  2POK A;  2QYV A;  1M4G A;  1Y0Y A;  2VZZ A;  3SJG A;  5JQ4 A;  1QQ9 A;  3H5Z A;  4M6G A;  4FAI A;  1Z4R A;  2Q4V A;  2ZOG A;  4AVA A;  4CAW A;  3B3V A;  8CPA A;  1L0C A;  5THW A;  1QSO A;  2Y0M A;  3CZX A;  3KAS A;  3TOA A;  3GUX A;  2DF5 A;  2EK8 A;  1Z8W A;  2V8G A;  4HKF A;  3VH9 A;  4OC4 A;  2WZN A;  2PJ5 A;  4PK2 A;  2HV2 A;  1Y0R A;  3GLJ A;  3TOB A;  2C6G A;  2ARH A;  2OZU A;  2CF4 A;  3D7D A;  2ZW6 A;  4FD7 A;  2YNC C;  4B5P A;  3KHX A;  4NCZ A;  4NFR A;  2PJ3 A;  4HNW B;  4ZY1 A;  1ZG7 A;  2Z3M A;  3ISX A;  4IAV A;  3BJ7 A;  2QML A;  3KR5 A;  1XF8 A;  3ISZ A;  4PQA A;  3BI0 A;  3PB7 X;  4P10 A;  2GFQ A;  3PBB A;  4P4D A;  5KTC A;  4KVO E;  4CGN A;  3BI1 A;  1A2Z A;  4HPS A;  2G9D A;  4E8O A;  4HNX B;  4C68 A;  3EXN A;  2AFM A;  1IGB A;  4FD6 A;  4NGP A;  3IJ3 A;  1TIQ A;  2Q43 A;  1MJB A;  2Q4Y A;  2VBQ A;  4U5Y A;  4OC3 A;  3KGQ A;  1YQE A;  3RO0 A;  3NH5 A;  1IU8 A;  4IK2 A;  1IY7 A;  1Y7R A;  3MN8 A;  1S3Z A;  5C88 A;  3SI2 A;  2C27 A;  4RI1 A;  2VQY A;  2OH1 A;  3BXM A;  2P0W A;  4OP4 A;  1KUY A;  1Q2Y A;  2KCW A;  2Z3K A;  3GKR A;  1N71 A;  4OKO A;  4UIB A;  5AG7 A;  3R96 A;  5IB0 A;  4JXQ A;  3JVN A;  4PV6 A;  4NEX A;  3FJU A;  5IV0 A;  2JEV A;  4UWI A;  3WC5 A;  2XEI A;  4CAF A;  3KR4 A;  1DTD A;  3RBU A;  5BWA B;  3D3S A;  4B14 A;  3VAR A;  3FBU A;  1LOK A;  2J8N A;  2P6G A;  5AGE A;  2I3C A;  3FVL A;  3IC1 A;  4TNU A;  1RO5 A;  4RN7 A;  3CXS A;  2VXK A;  3PB9 X;  4EVY A;  2J8R A;  2XEJ A;  4B6Z A;  1XIX A;  2ZEO A;  4P45 A;  5K8O A;  2PDO A;  4PXB A;  2PJ7 A;  3LMS A;  4MJ8 A;  2C1C A;  1QMU A;  4MHP A;  4AB7 A;  2PQ8 A;  2VEZ A;  2JBK A;  2PCU A;  2G0B A;  4XPD C;  2Z10 A;  4KOS A;  2R98 A;  3FXT A;  1CP7 A;  4UIA A;  1YR0 A;  4A39 A;  4C7H A;  5KTD A;  3WR7 A;  1I21 A;  1JQG A;  2PJ8 A;  2PVW A;  1AYE A;  2Z3N A;  4KLW A;  3CDX A;  2J8M A;  2GU2 A;  3H4Q A;  1Z5R A;  3BHX A;  2Q0Y A;  3GB0 A;  4GS4 A;  4KVM E;  2B3V A;  3L2N A;  3S6G A;  4AVB A;  2NMT A;  5G20 A;  5LRG A;  1TXR A;  1YW4 A;  3D7G A;  4MFJ A;  1IOI A;  4GM5 A;  4X5K A;  2PJ2 A;  4B11 A;  5A28 A;  3FB3 A;  4KSA A;  4A33 A;  1HDU A;  5JH9 A;  1XRY A;  1I12 A;  5AG4 A;  3LAC A;  4CYP A;  1PU9 A;  1JWQ A;  3NFZ A;  1HEE A;  2B3U A;  5AG6 A;  1Q7L A;  1TKF A;  4J3G A;  2AE6 A;  3D4U A;  4P4F A;  3OWC A;  4OAE A;  4TWE A;  1ZLH A;  2IQ6 A;  3V7Z A;  1S5K A;  2O53 A;  1S7F A;  4NGT A;  2PJ6 A;  3QAH A;  5GCN A;  3PFO A;  1CM0 A;  2DPS A;  3KL9 A;  2GAN A;  1Z8L A;  3SI1 A;  4RS2 A;  4XNH C;  5H86 A;  1HDQ A;  4P6Y A;  1XEB A;  4UEZ A;  1EE3 P;  2B4D B;  4UA3 A;  3T9Y A;  3SJX A;  4ZGY B;  3FX6 A;  2EWB A;  2PSW A;  1IOF A;  2X7B A;  3CT9 A;  4KS9 A;  4EWT A;  4OAD A;  1R3N A;  4ZBG A;  2FIA A;  2ANP A;  3RZA A;  3TO7 A;  3B3W A;  2ODF A;  3KI9 A;  3V8I A;  5F46 A;  4PSW A;  2B5G A;  1M1D A;  1S7K A;  1UWY A;  2IMO A;  2R7H A;  4IUS A;  4K30 A;  4OLL A;  2B4D A;  1XE4 A;  4H2K A;  3F5B A;  2XEG A;  3CXP A;  3LWU A;  4YGO A;  3ZJ0 A;  3FYN A;  1PCA A;  3NE8 A;  5FVJ A;  3JRU A;  5K8M A;  1VHS A;  2F5I A;  3B3C A;  1B6B A;  4CYO A;  2PJ4 A;  2WPW A;  1YRE A;  2HUZ A;  1VGY A;  2Z0Z A;  4PXC A;  2YND A;  2BOA A;  3B3T A;  3PEI A;  4LQ6 A;  4X8I A;  3FNC A;  3G8W A;  4QVT A;  5HH1 A;  3DDD A;  3GYA A;  2HC9 A;  4MFK A;  3T8W A;  4CAV A;  4KUA A;  3H8F A;  1ELM P;  1WK4 A;  3FED A;  3JTK A;  1MK4 A;  3B35 A;  3IWW A;  4P4B A;  1XMT A;  2GIV A;  4G1P A;  4ZY0 A;  4A31 A;  3N7Z A;  2ZEP A;  1F57 A;  1YX0 A;  2PR8 A;  2V8D A;  4PXD A;  1ELL P;  1Q2C A;  2CXA A;  2EBJ A;  2FXF A;  1ZG9 A;  2PJB A;  4R87 A;  2CTC A;  5G21 A;  3S6H A;  3WC7 A;  1RTQ A;  3TX8 A;  5C82 A;  5HVH A;  5JGF A;  1ON0 A;  5HVG A;  3FH4 A;  4JD6 A;  5DWN A;  1XMB A;  3TE4 A;  2JLM A;  1Y9W A;  2PR1 A;  2C6C A;  4H6U A;  4UWJ A;  1FT7 A;  3TC8 A;  3S9L A;  2ZEG A;  3CPA A;  2ZEH A;  2F8H A;  3MRU A;  2AFX A;  3PGP A;  4CPA A;  5DS0 A;  1LCP A;  1I1D A;  3I9S A;  1IB1 E;  1BPM A;  2VL1 A;  2HQY A;  2RB7 A;  4MHY A;  2CY2 A;  3IEH A;  3SJE A;  1IID A;  4NGM A;  2DXQ A;  2ZEF A;  4MFZ A;  4XPD B;  2YGW A;  3B8G A;  1CBX A;  5F48 A;  2PJC A;  5CBM A;  4IF5 A;  2P6F A;  3VWD A;  3KZW A;  4CGO A;  3UY5 A;  2ZED A;  2AFU A;  2Q04 A;  1YVK A;  3DR8 A;  4OME A;  1NE9 A;  4QC6 A;  3SI0 A;  1R43 A;  2F7V A;  3P2H A;  4NGR A;  3B2Y A;  4MHD A;  4PSX A;  3ZZI A;  2ZEM A;  1LAM A;  4F6A A;  4ZX8 A;  2OR4 A;  4CGL A;  1CP6 A;  3KQX A;  2PVV A;  3R1K A;  4X3R A;  4A32 A;  2Q4Z A;  4KOR A;  4CS0 B;  2I00 A;  1MJ9 A;  3IIB A;  1TKH A;  4Q36 A;  4MRI A;  4AVC A;  5G22 A;  4C7I A;  4MFP A;  4Z65 A;  4ONU A;  1VKC A;  3SJF A;  3N5F A;  1DE4 C;  4NJR A;  2REE A;  4EME A;  4RUH A;  4LX9 A;  5D29 A;  4NGS A;  5J1Q A;  4NSQ A;  4UFW A;  2BEI A;  4IHM A;  4AXV A;  4KOU A;  1FY7 A;  5F49 A;  3R9E A;  4L8A A;  4XNH B;  3RYO A;  4ZY2 A;  2R1I A;  4Y49 C;  2FCK A;  3PRT A;  2AFO A;  2BCO A;  2YNE A;  2VZY A;  3S9N A;  2JDC A;  2Q7S A;  1NSL A;  4JXR A;  4KOT A;  4KZT A;  7CPA A;  4UCM A;  3D67 A;  5EC4 A;  3RNZ A;  2IJZ A;  2R8V A;  4PK3 A;  2PJ9 A;  1CPX A;  1ARL A;  2PJ1 A;  5ISV A;  3R9G A;  4QUS A;  5JPH A;  2EO8 A;  2AFZ A;  1VHO A;  4CAE A;  3S6K A;  5F09 A;  1IYL A;  1YLO A;  3DNS A;  3EC4 A;  2QEC A;  4CGM A;  3DSB A;  4I49 A;  2B58 A;  4C2Z A;  5LRJ A;  4FD5 A;  4ZYQ A;  1ZO0 A;  2Q7B A;  2BSW A;  3GIU A;  3LOD A;  3I3G A;  4KLV A;  2CTB A;  3HUV A;  3PB4 X;  5DWM A;  3W6X A;  1AUG A;  1Y7E A;  3PZJ A;  1GHE A;  4OID A;  1IIC A;  2AJ6 A;  2ATR A;  3H8E A;  4UF4 A;  1CX8 A;  5LYL A;  4EFD A;  2RFH A;  3D7H A;  3QNV A;  4MHN A;  2HB6 A;  4U9Z A;  4KUB A;  4YU9 A;  3QAY A;  1BPN A;  5J8F A;  3JUW A;  4FD4 A;  1K4J A;  1Q2D A;  3R9F A;  3EO4 A;  2CIJ A;  4KSF A;  4R57 A;  4OC2 A;  2QIR A;  3D66 A;  3PB6 X;  4JZ0 A;  2DEA A;  1TKJ A;  4JWP A;  4ZX9 A;  4CYQ A;  3DGV A;  2PRQ A;  2WYR A;  2G3A A;  2Z3P A;  3FEE A;  4R6T A;  4CRY B;  2FL4 A;  1UFH A;  1M4I A;  3NH8 A;  3S6F A;  2FIW A;  4U9Y A;  3W6S A;  4M3S A;  4E0A A;  1OZP A;  1KUV A;  4R9M A;  4F0Y A;  4ZI6 A;  1QSR A;  3IGR A;  2O4H A;  1BLL E;  3B3S A;  1X12 A;  3K2K A;  3P2F A;  2YNC A;  4O23 A;  4A37 A;  1B87 A;  1XOV A;  3B7I A;  2FVG A;  3DR6 A;  2ZW4 A;  3NH4 A;  1VIX A;  4OIW A;  2NYQ A;  1YGH A;  4MCS A;  4M85 A;  2Z3L A;  4JYW A;  3QB8 A;  4P44 A;  5HMN A;  3PBE A;  4DUK A;  3F0A A;  3D8P A;  3IWG A;  1NMT A;  3R95 A;  3TCV A;  1LFW A;  4F9U A;  5EBV A;  4ONW A;  1H8L A;  4W9Y A;  4CGP A;  1CJW A;  2Q44 A;  5EMI A;  1OBR A;  1F2O A;  2IL4 A;  3E0K A;  1IYK A;  1J4J A;  1ZLI A;  4P4E A;  5CPA A;  4H6Z A;  1QST A;  4A94 A;  3KKW A;  1BOB A;  2ABZ A;  3PFE A;  3WC6 A;  4FUU A;  4B5P B;  1P4N A;  4QB9 A;  2Q51 A;  4JLY A;  4DYO A;  2CNT A;  3BJ8 A;  4MFQ A;  3VAT A;  2ZPA A;  4ORF A;  4A38 A;  2JEW A;  5K8N A;  2BO9 A;  2J9A A;  3CPX A;  2V77 A;  1S7N A;  1ZG8 A;  5CNP A;  5D8N A;  5LYF A;  3EFA A;  4MXU A;  1P0H A;  4FWU A;  1YLE A;  4R8F A;  3C26 A; 
#chains in the Genus database with same CATH homology
 2EO8 A;  1Z8T A;  3LAC A;  2EBJ A;  3GIU A;  4GXH A;  1AUG A;  1X12 A;  1A2Z A;  4HPS A;  1Z8X A;  2DF5 A;  1IOF A;  1Z8W A;  1IOI A;  3RNZ A;  3RO0 A;  1IU8 A;  1X10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...