2FXFA

Human spermidine/spermine n1-acetyltransferase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
164
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title The Crystal Structure of Human spermidine/spermine N1-acetyltransferase
rcsb
source organism Homo sapiens
total genus 44
structure length 164
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2006-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2fxfA00
2CNMA 1KUYA 1WWZA 3GKRA 2FSRA 4PK2A 1OZPA 3G8WA 1M4GA 2HQYA 2JLMA 4KORA 1NMTA 1Q2CA 3FYNA 1IYKA 2DXQA 2FCKA 1NSLA 4KOTA 3S6KA 4R57A 1I21A 1YVKA 2G0BA 2NMTA 3FB3A 3DNSA 2O28A 3ZZIA 2ZPAA 3LD2A 4MY0A 3TCVA 1S7FA 5F48A 2Z0ZA 3R95A 4R87A 4AVCA 2VBQA 3EO4A 1M1DA 2B4DA 1Q2YA 4HNXB 2VXKA 1LRZA 4MI4A 5HMNA 1Y9WA 2B4BA 4UWJA 4I49A 2OZHA 2CNSA 1XE4A 2OU2A 4X5KA 2GIVA 3BJ8A 5C82A 2BL1A 3TO7A 1KUVA 4OLLA 3H4QA 4B5OA 3F0AA 4E0AA 4K30A 2OZUA 1MJAA 4CRYB 1M4DA 2F5IA 2Z10A 5CNPA 4E2AA 2ZW6A 3TO6A 3IWGA 1BO4A 4U9YA 3K9UA 1PUAA 1NE9A 1Y7RA 1Z4EA 4QC6A 4XPDB 1XEBA 4PV6A 2IL4A 4BMHA 4KUAA 2X7BA 1KZFA 4F6AA 3I3GA 3LODA 5IB0A 2PR1A 3N7ZA 4XPDC 4ZBGA 4MBUA 3R96A 4JLYA 1XF8A 2B4DB 2BSWA 2PSWA 1UFHA 2EUIA 5KTAA 4YRHA 3PZJA 4KVOE 4KZTA 2R7HA 3EC4A 3G3SA 1S7LA 1RXTA 1I1DA 2JDCA 2BEIA 1YK3A 1N71A 5E96A 2VQYA 4CAVA 2P6FA 3W91A 1PU9A 5DWMA 5EBVA 2HV2A 5I0CA 2A4NA 2REFA 4KOUA 3I9SA 3S6GA 3TT2A 4FD5A 4H6UA 1IICA 1YR0A 3R9FA 4R3LA 4JJXA 3EY5A 2QECA 2R98A 4DNCA 3JUWA 4EVYA 4AB7A 4QVTA 4OADA 4CS0B 3CXQA 2J8NA 4PSWA 2R1IA 3GY9A 3EXNA 4B5PB 4CAWA 4HKFA 2CNTA 4L89A 1S7NA 5DWNA 4ONUA 4NF1A 4II9A 3BJ7A 2ZXVA 4M3SA 2J8RA 3RYOA 2GANA 1S7KA 4CAXA 2B58A 1IYLA 5IV0A 4YFJA 3B8GA 2J8MA 1Y9KA 4JXQA 3IGRA 1XIXA 3QAHA 4U9ZA 4ORFA 5C88A 5IX3A 2EVNA 2CY2A 4KLWA 1CJWA 4KOWA 2Y0MA 1YLEA 1MJBA 4M85A 2OH1A 4KUBA 3BLNA 5KTCA 3E0KA 4KVME 3OWCA 3FBUA 1J4JA 3TOAA 3WR7A 1YREA 2FE7A 2FS5A 1B87A 1BOBA 1Z4RA 1CM0A 4XNHB 4PSXA 1ON0A 2BUEA 2D4PA 4JWPA 2FL4A 5HH1A 2JDDA 1S60A 2HUZA 2Z11A 4KVXA 1U6MA 2Q04A 4RS2A 4XNHC 1RO5A 1QSRA 1GHEA 1YX0A 2B5GA 3CXPA 5ISVA 3D8PA 3FNCA 3W6XA 2Q4VA 2ATRA 3W6SA 2G3AA 4RI1A 5F49A 4F0YA 3D2PA 1Z9UA 3T90A 2Q0YA 3SXNA 1VHSA 4NSQA 1MJ9A 2PQ8A 4NEXA 4AVAA 2ARHA 3EFAA 3TFYA 4NXYA 1QSNA 3R9GA 3DR8A 4PK3A 3T9YA 1QSTA 1IIDA 1QSMA 3TOBA 3ZJ0A 2VEZA 3D3SA 2H5MA 4QBJA 3PGPA 1M44A 3DR6A 2QIRA 1KUXA 2WPXA 5F47A 4AVBA 4LUAA 5FVJA 2PDOA 3PP9A 2ZW7A 2RC4A 2I79A 3R9EA 1XMTA 4KOVA 4UA3A 2B3VA 4YGOA 1M4IA 3JVNA 2B5GB 2P6GA 2QMLA 4J3GA 4KOSA 1SQHA 4KLVA 2FXFA 4U5YA 2AJ6A 4HNWB 2Q7BA 3P2FA 5F46A 2R8VA 2K5TA 2WPWA 1QSOA 1YGHA 2PR8A 2ZW4A 4MJ8A 2C27A 3F5BA 4R3KA 2P6EA 3FXTA 4H6ZA 1P0HA 4HNYB 2VZZA 1YVOA 2AE6A 2B3UA 3UY5A 3C26A 2Q44A 5J8CA 5JQ4A 2REEA 3KKWA 4CRZB 5GCNA 3S6HA 4NCZA 1S3ZA 4IF5A 3TE4A 2P0WA 4AG9A 3DDDA 3CXSA 1WK4A 4IUSA 5EC4A 3FRMA 3MGDA 4QUSA 1Q2DA 1K4JA 2G3TA 4KOYA 2VZYA 2PRBA 3FIXA 1I12A 1IB1E 1VKCA 4FD4A 4H89A 3S6FA 4XPKA 1V0CA 3QB8A 4UWIA 2VI7A 4E8OA 1TIQA 1FY7A 2I00A 3D2MA 4R9MA 2FT0A 4FD6A 2PC1A 4Y49B 1B6BA 4MY3A 5JPHA 3VWDA 1L0CA 2OB0A 2FIWA 4XPLA 2Q4YA 2KCWA 5H86A 2ZW5A 3SHPA 3V8IA 3R1KA 4GS4A 4Y49C 4AG7A 4MHDA 2D4OA 4JD6A 1P4NA 3VWEA 4OAEA 4UBRA 4LX9A 4KOXA 3GYAA 4B5PA 1S5KA 5H84A 3P2HA 4JXRA 3TTHA 2JEVA 5J8FA 3DSBA 4L8AA 3NE7A 2GE3A 3TO9A 3SXOA 3F8KA 2OZGA 2FIAA 1MK4A 4QB9A 1R57A 5KTDA 4FD7A
chains in the Genus database with same CATH superfamily
4MXUA 2CNMA 1KUYA 1WWZA 3GKRA 4FUUA 2YNDA 2FSRA 4PK2A 1OZPA 3G8WA 1VHOA 1M4GA 2HQYA 2JLMA 5G1ZA 1TF8A 2DF5A 4KORA 4R7MA 3V38A 1NMTA 2C6PA 3B7IA 1Q2CA 3D7FA 2O53A 4UEFA 3FYNA 4A32A 2EWBA 1IYKA 2DXQA 2AFXA 2FCKA 1NSLA 4OC0A 4KOTA 3S6KA 1IOFA 4R57A 1XBUA 1I21A 4EMEA 5K8PA 3FF3A 5AG5A 4MCRA 4JYWA 1YVKA 2G0BA 3KHZA 2CIJA 4MCQA 2NMTA 1IGBA 3FB3A 2PJ0A 3DNSA 4P4IA 4NGPA 2O28A 1X12A 1CP6A 1TF9A 3IEHA 3ZZIA 2ZPAA 4FAIA 3LD2A 4MY0A 3D7GA 1ELLP 4WJBA 2AFWA 4MCSA 4NJRA 4OMEA 4CGPA 3TCVA 1S7FA 4UCMA 5F48A 4UF4A 2Z0ZA 2Z3MA 3R95A 4R87A 1IOIA 3SI1A 4AVCA 2VBQA 4FWUA 1M1DA 2B4DA 2HB6A 1Q2YA 3EO4A 2WYRA 1YW6A 3GLJA 2VXKA 1LRZA 4HNXB 5AG6A 4MI4A 5HMNA 5JH9A 1Y9WA 4PXEA 2B4BA 3D4UA 1ZLIA 4UWJA 3IC1A 2Z3PA 4I49A 1YW4A 1LANA 2OZHA 3S9LA 2CNSA 1XE4A 2OU2A 4X5KA 2GIVA 2GREA 4UIAA 3BJ8A 5C82A 2BL1A 4Z65A 3TO7A 1KUVA 4OLLA 4Q38A 4K3NA 4BBHA 3NH8A 5K8OA 3H4QA 4B5OA 3PB9X 3RBUA 3F0AA 4E0AA 3I1UA 4K30A 2OZUA 1MJAA 2RFHA 1LOKA 4CRYB 1M4DA 2F5IA 2Z10A 5CNPA 1A2ZA 4E2AA 2ZW6A 3RAMA 3IWGA 4GXHA 3TO6A 1BO4A 4ZYQA 4U9YA 2OR4A 1BPMA 3ISXA 3K9UA 4P44A 1PUAA 1NE9A 1Y7RA 1Z4EA 2VL1A 3H8EA 4QC6A 2PJ3A 4CGNA 4XPDB 4EWTA 3PB4X 1XEBA 3H8GA 4PV6A 2IL4A 2C6GA 4KSAA 4B10A 4BMHA 4KUAA 3D7DA 2X7BA 1KZFA 4NFRA 3KL9A 2Z3NA 2WUUA 3WT4A 4B6ZA 4F6AA 5HXDA 3I3GA 4ZY0A 1YLOA 2BOAA 3LODA 5IB0A 3PEIA 3SJXA 2PR1A 3N7ZA 4XPDC 3VARA 4P45A 4ZBGA 4MBUA 3R96A 4UFVA 2PJ6A 2RB7A 4JLYA 1XF8A 2PJAA 4X3RA 2B4DB 4Q7AA 3KZWA 3TC8A 5A27A 2BSWA 1Z8LA 2JEWA 2PSWA 4BD9A 2PJ8A 3KI9A 1UFHA 4A2ZA 3PFOA 2EUIA 4KS9A 1NSAA 4MHNA 4ZX9A 2BCOA 1ARLA 5KTAA 1M4LA 4YRHA 3PZJA 4MFJA 2Q7SA 4KVOE 4KZTA 2R7HA 4PQAA 3RNZA 3T8WA 1IU8A 3EC4A 2CXAA 3DLJA 1DE4C 1XFOA 3G3SA 1X10A 2PRQA 3SI2A 2ZOGA 4HPSA 1S7LA 1RXTA 3D7HA 1I1DA 2JDCA 1FT7A 4TWEA 2BEIA 2F8HA 4MFKA 1YK3A 6CPAA 4MHYA 1N71A 2AFZA 5E96A 3SI0A 2PIZA 4O23A 2VQYA 4F0XA 4CAVA 5AG7A 2P6FA 3W91A 1PU9A 5DWMA 5EBVA 2YGWA 1XJOA 1BPNA 2HV2A 2GLFA 5I0CA 1PYTB 2A4NA 2REFA 4KOUA 3I9SA 3IU1A 1Z8XA 5BWAB 1LFWA 2AFSA 3S6GA 3TT2A 3CDXA 1R43A 4ZX8A 4FD5A 5AG4A 4H6UA 4Q36A 1IICA 3B3WA 3CT9A 1YR0A 3R9FA 4M6GA 4A38A 3FEDA 3IU2A 4R3LA 4JJXA 4F9UA 5A28A 4CGOA 4M6HA 1QMUA 5J1QA 3EY5A 2QECA 2BO9A 2R98A 1F2PA 4NGMA 2V8HA 3QAYA 4LQ6A 1R3NA 4MRIA 2EBJA 3JUWA 4DNCA 3A9LA 4EVYA 4AB7A 4QVTA 1ZG9A 4OADA 5LYLA 3D66A 4KSFA 4CS0B 4UCPA 3B3SA 3B3VA 3CXQA 1TKJA 2J8NA 4PSWA 2G9DA 4IAVA 1ARMA 4B13A 2R1IA 3GY9A 4UEZA 3NH4A 4AXVA 3HUVA 3EXNA 3KQXA 4FBEA 4B5PB 4CAWA 4HKFA 1F57A 2CNTA 4L89A 4OC2A 2EK9A 4DUKA 3PB8X 5JM6A 1CG2A 1RTQA 1BAVA 3KQZA 4WWVA 4H2KA 4TNUA 2CF4A 2EO8A 4ZY1A 1S7NA 5DWNA 4ONUA 4NF1A 4II9A 3BJ7A 2ZXVA 4A31A 4M3SA 1LAMA 2J8RA 3JRUA 3RYOA 2GANA 1S7KA 3K2KA 3L2NA 2B58A 4CAXA 3CPAA 1IYLA 5IV0A 2Z3LA 4YFJA 3RZAA 1YMEA 3B2YA 3B8GA 2J8MA 4NGTA 7CPAA 1Y0YA 1Y9KA 2GU2A 4JXQA 3IGRA 1XIXA 3QAHA 4BINA 1ZO0A 2XEGA 2YNCC 4C7HA 3IIBA 8CPAA 4U9ZA 2PJ7A 1XMBA 1Z8TA 2JBJA 2Q43A 4ORFA 4OC1A 5C88A 5IX3A 2EVNA 2CY2A 4KLWA 1CJWA 2IQ6A 2Y0MA 1YSJA 1YLEA 1MJBA 3QNVA 4KOWA 2V77A 4R8FA 3S9MA 4A37A 4M85A 2PJCA 4P6YA 5LYDA 2ZEGA 4UCNA 2OH1A 4MHPA 4KUBA 3BLNA 5KTCA 3E0KA 5G20A 4KVME 3MN8A 2V8DA 4ZY2A 4B12A 4CAEA 1Z5RA 3OWCA 2ZEDA 1J4JA 1GYTA 2GFQA 3FBUA 3GIUA 2CTBA 3DGVA 3IWEA 4P4JA 3TOAA 3WC6A 1YREA 3WR7A 2FE7A 2FS5A 3FH4A 3PBBA 2XEFA 2AFMA 1B87A 1BOBA 1Z4RA 3KHXA 4OKOA 5CBMA 3FMCA 5K8MA 1CM0A 4X2TA 3B3CA 4XNHB 1CBXA 3N5FA 4G1PA 4PSXA 4C2XA 3GB0A 1ZLHA 4UFXA 1ON0A 1Z2LA 2BUEA 1JWQA 3CPXA 4C7IA 1AMPA 2D4PA 1TKFA 4JWPA 2FL4A 2PIYA 1XRYA 5G22A 5HH1A 1ZG8A 1AUGA 1S60A 2HUZA 2JDDA 3TX8A 2Z11A 2ZENA 4PXDA 2WSAA 4KVXA 4UIBA 1U6MA 5HVGA 2Q04A 1QQ9A 4RS2A 3LMSA 4XNHC 1RO5A 4YU9A 4OC3A 1QSRA 5LRKA 4CGMA 1GHEA 1YX0A 2PJBA 2B5GA 4RUHA 3CXPA 5ISVA 2ZEPA 3BI1A 3D8PA 3FNCA 4B14A 3W6XA 2Q4VA 2ATRA 3MRUA 3W6SA 2G3AA 4RI1A 5F49A 2PVWA 4F0YA 3D2PA 1Z9UA 5D29A 4W9YA 3T90A 1F2OA 2Q0YA 4MFZA 3SXNA 4MFQA 1VHSA 2POKA 3PRTA 1IY7A 4NSQA 4CPAA 4MHZA 1MJ9A 2JBKA 2PJ9A 2PQ8A 3IFEA 4NEXA 4AVAA 2ARHA 3EFAA 5LRJA 4C68A 3SJGA 3TFYA 2ABZA 2O4HA 1DTDA 4MCPA 3WC7A 2PJ1A 4NXYA 3NH5A 1QSNA 3R9GA 3FEEA 3DR8A 2OOTA 2ZEEA 4C2ZA 1OBRA 4PK3A 3T9YA 1QSTA 2ZELA 4PPZA 1HDUA 1IIDA 1CPXA 4ONWA 4IHMA 1QSMA 1Q7LA 4NGQA 4DYOA 1VGYA 3TOBA 4NGSA 3PBEA 3ZJ0A 4IK2A 2VEZA 3D3SA 2H5MA 4QBJA 3PGPA 4P10A 1M44A 3DR6A 2QIRA 4F8ZA 1KUXA 2FVGA 2WPXA 3LWUA 4LUAA 4RN7A 5F47A 4AVBA 4CYOA 4EFDA 2DEAA 2J9AA 5FVJA 2PDOA 3IWWA 3PP9A 2ZW7A 4NGNA 5LYIA 2RC4A 2ZEMA 4CYPA 4ZGYB 2I79A 3NFZA 2WZNA 3HLPA 3R9EA 5EMIA 1XMTA 4KOVA 5F09A 1LAPA 2ANPA 2Z3OA 4UA3A 2B3VA 4YGOA 2IMOA 1CX8A 1M4IA 4UEEA 1UWYA 3JVNA 1BLLE 2B5GB 2P6GA 2QMLA 2QYVA 5K8NA 3S9NA 3VH9A 4J3GA 4OIDA 4R76A 1VHEA 4KOSA 1CPSA 1SQHA 4LQGA 4X8IA 4A30A 4KLVA 4DJLA 1TXRA 2Z3KA 2FXFA 3NE8A 4U5YA 2AJ6A 3H8FA 3FECA 4HNWB 2Q7BA 3P2FA 2V8GA 5AGEA 5F46A 5I4MA 3V7ZA 2R8VA 2K5TA 2WPWA 4NJQA 4B11A 1QSOA 1YGHA 2PR8A 3D68A 2PJ5A 2ZW4A 5G21A 4MFLA 2QVPA 5ELYA 4MJ8A 3H5ZA 2C27A 3F5BA 4R3KA 4P4EA 2NSMA 4C2YA 2P6EA 5CPAA 2Q51A 3FXTA 4H6ZA 1P0HA 4ZI6A 2NYQA 5JGFA 3BI0A 3GUXA 4HNYB 2VZZA 1YVOA 2AE6A 2B3UA 2AFUA 1AYEA 3UY5A 3WABA 3C26A 2Q44A 3IO1A 5J8CA 1H8LA 4P4FA 2IJZA 5JQ4A 4A95A 2REEA 3KKWA 4CRZB 4OC4A 4P4DA 4NCZA 4R6TA 3D67A 5GCNA 3S6HA 1ELMP 4CYNA 5LYFA 1TKHA 3ISZA 1S3ZA 5HVFA 3RO0A 4IF5A 3TE4A 3JTKA 1VIXA 2P0WA 3NA6A 4AG9A 3CZXA 3CXSA 3DDDA 4MMOA 1WK4A 4A94A 5LRGA 4IUSA 1XOVA 1Y7EA 3FJUA 2C6CA 5EC4A 3KGQA 2PVVA 3FRMA 1LCPA 3MGDA 4OIWA 3FX6A 3K9TA 4A39A 4QUSA 1Q2DA 3PB7X 4JZ0A 1K4JA 1FNOA 2G3TA 2ZOFA 4KOYA 3FVLA 2VZYA 2PRBA 3LACA 3FIXA 1I12A 1IB1E 1VKCA 2I3CA 4FD4A 2C1CA 4H89A 5D8NA 3S6FA 4XPKA 5HVHA 4P4BA 1V0CA 3BHXA 3QB8A 3KASA 4UWIA 2VI7A 4E8OA 1TIQA 4NGRA 2PJ2A 2QJ8A 2HC9A 4PXBA 1FY7A 1JQGA 2I00A 3D2MA 4OC5A 2EK8A 4R9MA 2FT0A 4FD6A 2PC1A 4Y49B 1B6BA 2ZEFA 4MY3A 1HDQA 5JPHA 3VWDA 1L0CA 2F7VA 2OB0A 3WC5A 4PXCA 2FIWA 2DPTA 2XEJA 4XPLA 2Q4YA 2KCWA 5H86A 1KWMA 2ZW5A 3SHPA 1CP7A 4CYQA 5IB9A 2GLJA 3V8IA 3R1KA 2ZEOA 4GS4A 1ZG7A 3B35A 4Y49C 1PCAA 4AG7A 4MHDA 4OP4A 2D4OA 3SJEA 4JD6A 4YWYA 3PFEA 3IJ3A 1P4NA 3VWEA 1EE3P 4OAEA 3SJFA 4UBRA 3KR5A 3B3TA 2PCUA 1Z8WA 4LX9A 1Y0RA 2Q4ZA 1HEEA 2YNEA 3KR4A 4KOXA 3GYAA 4QB9A 3BXMA 4B5PA 4F9VA 4M6IA 1S5KA 5H84A 3P2HA 2DPSA 2XEIA 3VATA 4UFWA 4JXRA 5THWA 1YQEA 3TTHA 4CAFA 2JEVA 2CTCA 5J8FA 4CGLA 4A33A 3DSBA 4L8AA 2YNCA 3NE7A 2GE3A 4GM5A 3PB6X 3TO9A 4MFPA 5DS0A 3SXOA 2AFOA 2PE3A 4KSIA 3F8KA 2OZGA 2FIAA 2PJ4A 1MK4A 2ODFA 2V8VA 1R57A 2ZEHA 5KTDA 4FD7A
chains in the Genus database with same CATH topology
2CNMA 1KUYA 1WWZA 3GKRA 2YNDA 2FSRA 4PK2A 1OZPA 3G8WA 1M4GA 2HQYA 2JLMA 5G1ZA 4KORA 1NMTA 1Q2CA 3FYNA 4A32A 1IYKA 2DXQA 2FCKA 1NSLA 4KOTA 3S6KA 4R57A 1I21A 5AG5A 1YVKA 2G0BA 2NMTA 3FB3A 3DNSA 2O28A 3ZZIA 2ZPAA 3LD2A 4MY0A 4CGPA 3TCVA 1S7FA 4UCMA 5F48A 2Z0ZA 2Z3MA 3R95A 4R87A 4AVCA 2VBQA 3EO4A 1M1DA 2B4DA 1Q2YA 4HNXB 5AG6A 2VXKA 1LRZA 4MI4A 5HMNA 1Y9WA 2B4BA 4UWJA 4I49A 2Z3PA 2OZHA 2CNSA 1XE4A 2OU2A 4X5KA 2GIVA 3BJ8A 5C82A 2BL1A 3TO7A 1KUVA 4OLLA 4Q38A 4BBHA 3H4QA 4B5OA 3F0AA 4E0AA 4K30A 2OZUA 1MJAA 4CRYB 1M4DA 2F5IA 2Z10A 5CNPA 4E2AA 2ZW6A 3TO6A 3IWGA 1BO4A 4U9YA 3K9UA 1PUAA 1NE9A 1Y7RA 1Z4EA 4CGNA 4QC6A 4XPDB 1XEBA 4PV6A 2IL4A 4B10A 4KSAA 4BMHA 4KUAA 2X7BA 1KZFA 4F6AA 2Z3NA 2WUUA 3I3GA 3LODA 5IB0A 2PR1A 3N7ZA 4XPDC 4ZBGA 4MBUA 3R96A 4UFVA 4JLYA 1XF8A 2B4DB 5A27A 2BSWA 2PSWA 1UFHA 4A2ZA 2EUIA 4KS9A 5KTAA 4YRHA 3PZJA 4MFJA 4KVOE 4KZTA 2R7HA 3EC4A 2CXAA 3G3SA 1S7LA 1RXTA 1I1DA 2JDCA 2BEIA 4MFKA 1YK3A 1N71A 5E96A 2VQYA 4F0XA 4CAVA 5AG7A 2P6FA 3W91A 1PU9A 5DWMA 5EBVA 2YGWA 2HV2A 5I0CA 2A4NA 2REFA 4KOUA 3I9SA 3IU1A 5BWAB 3S6GA 3TT2A 4FD5A 5AG4A 4H6UA 4Q36A 1IICA 1YR0A 3R9FA 3IU2A 4R3LA 4JJXA 5A28A 4CGOA 3EY5A 2QECA 2R98A 4DNCA 3JUWA 3A9LA 4EVYA 4AB7A 4QVTA 4OADA 4KSFA 4CS0B 4UCPA 3CXQA 2J8NA 4PSWA 4B13A 2R1IA 3GY9A 3EXNA 4B5PB 4CAWA 4HKFA 2CNTA 4L89A 1S7NA 5DWNA 4ONUA 4NF1A 4II9A 3BJ7A 2ZXVA 4A31A 4M3SA 2J8RA 3RYOA 2GANA 1S7KA 4CAXA 2B58A 1IYLA 5IV0A 2Z3LA 4YFJA 3B8GA 2J8MA 1Y9KA 4JXQA 3IGRA 1XIXA 3QAHA 1ZO0A 2YNCC 4C7HA 4U9ZA 4ORFA 5C88A 5IX3A 2EVNA 2CY2A 4KLWA 1CJWA 4KOWA 2Y0MA 1YLEA 1MJBA 4M85A 4UCNA 2OH1A 4KUBA 3BLNA 5KTCA 3E0KA 5G20A 4KVME 4B12A 4CAEA 3OWCA 3FBUA 1J4JA 3IWEA 3TOAA 3WR7A 1YREA 2FE7A 2FS5A 1B87A 1BOBA 1Z4RA 1CM0A 4XNHB 4PSXA 4C2XA 4UFXA 1ON0A 2BUEA 4C7IA 2D4PA 4JWPA 2FL4A 5G22A 5HH1A 2JDDA 1S60A 2HUZA 2Z11A 2WSAA 4KVXA 1U6MA 2Q04A 4RS2A 4XNHC 1RO5A 1QSRA 4CGMA 1GHEA 1YX0A 2B5GA 3CXPA 5ISVA 3D8PA 3FNCA 4B14A 3W6XA 2Q4VA 2ATRA 3W6SA 2G3AA 4RI1A 5F49A 4F0YA 3D2PA 1Z9UA 3T90A 2Q0YA 4MFZA 3SXNA 4MFQA 1VHSA 4NSQA 1MJ9A 2PQ8A 4NEXA 4AVAA 2ARHA 3EFAA 4C68A 3TFYA 4NXYA 1QSNA 3R9GA 3DR8A 4C2ZA 4PK3A 3T9YA 1QSTA 1IIDA 1QSMA 3TOBA 3ZJ0A 2VEZA 3D3SA 2H5MA 4QBJA 3PGPA 1M44A 3DR6A 2QIRA 1KUXA 2WPXA 5F47A 4AVBA 4LUAA 4CYOA 5FVJA 2PDOA 3PP9A 2ZW7A 4CYPA 2RC4A 4ZGYB 2I79A 3R9EA 1XMTA 4KOVA 2Z3OA 4UA3A 2B3VA 4YGOA 1M4IA 3JVNA 2B5GB 2P6GA 2QMLA 4J3GA 4KOSA 1SQHA 4A30A 4KLVA 2Z3KA 2FXFA 4U5YA 2AJ6A 4HNWB 2Q7BA 3P2FA 5AGEA 5F46A 2R8VA 2K5TA 2WPWA 4B11A 1QSOA 1YGHA 2PR8A 2ZW4A 5G21A 4MFLA 4MJ8A 3H5ZA 2C27A 3F5BA 4R3KA 4C2YA 2P6EA 3FXTA 4H6ZA 1P0HA 4HNYB 2VZZA 1YVOA 2AE6A 2B3UA 3UY5A 3C26A 2Q44A 5J8CA 5JQ4A 4A95A 2REEA 3KKWA 4CRZB 5GCNA 3S6HA 4NCZA 4CYNA 1S3ZA 4IF5A 3TE4A 3JTKA 2P0WA 4AG9A 3DDDA 3CXSA 1WK4A 4IUSA 5EC4A 3FRMA 3MGDA 4QUSA 1Q2DA 1K4JA 2G3TA 4KOYA 2VZYA 2PRBA 3FIXA 1I12A 1IB1E 1VKCA 4FD4A 4H89A 3S6FA 4XPKA 1V0CA 3QB8A 4UWIA 2VI7A 4E8OA 1TIQA 1FY7A 2I00A 3D2MA 4R9MA 2FT0A 4FD6A 2PC1A 4Y49B 1B6BA 4MY3A 5JPHA 3VWDA 1L0CA 2OB0A 2FIWA 2DPTA 4XPLA 2Q4YA 2KCWA 5H86A 2ZW5A 3SHPA 4CYQA 3V8IA 3R1KA 4GS4A 4Y49C 4AG7A 4MHDA 2D4OA 4JD6A 1P4NA 3VWEA 4OAEA 4UBRA 4LX9A 2YNEA 4KOXA 3GYAA 4B5PA 1S5KA 5H84A 3P2HA 2DPSA 4UFWA 4JXRA 3TTHA 4CAFA 2JEVA 5J8FA 4CGLA 4A33A 3DSBA 4L8AA 2YNCA 3NE7A 2GE3A 3TO9A 4MFPA 3SXOA 3F8KA 2OZGA 2FIAA 1MK4A 4QB9A 1R57A 5KTDA 4FD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNM A;  1KUY A;  1WWZ A;  3GKR A;  2FSR A;  4PK2 A;  1OZP A;  3G8W A;  1M4G A;  2HQY A;  2JLM A;  4KOR A;  1NMT A;  1Q2C A;  3FYN A;  1IYK A;  2DXQ A;  2FCK A;  1NSL A;  4KOT A;  3S6K A;  4R57 A;  1I21 A;  1YVK A;  2G0B A;  2NMT A;  3FB3 A;  3DNS A;  2O28 A;  3ZZI A;  2ZPA A;  3LD2 A;  4MY0 A;  3TCV A;  1S7F A;  5F48 A;  2Z0Z A;  3R95 A;  4R87 A;  4AVC A;  2VBQ A;  3EO4 A;  1M1D A;  2B4D A;  1Q2Y A;  4HNX B;  2VXK A;  1LRZ A;  4MI4 A;  5HMN A;  1Y9W A;  2B4B A;  4UWJ A;  4I49 A;  2OZH A;  2CNS A;  1XE4 A;  2OU2 A;  4X5K A;  2GIV A;  3BJ8 A;  5C82 A;  2BL1 A;  3TO7 A;  1KUV A;  4OLL A;  3H4Q A;  4B5O A;  3F0A A;  4E0A A;  4K30 A;  2OZU A;  1MJA A;  4CRY B;  1M4D A;  2F5I A;  2Z10 A;  5CNP A;  4E2A A;  2ZW6 A;  3TO6 A;  3IWG A;  1BO4 A;  4U9Y A;  3K9U A;  1PUA A;  1NE9 A;  1Y7R A;  1Z4E A;  4QC6 A;  4XPD B;  1XEB A;  4PV6 A;  2IL4 A;  4BMH A;  4KUA A;  2X7B A;  1KZF A;  4F6A A;  3I3G A;  3LOD A;  5IB0 A;  2PR1 A;  3N7Z A;  4XPD C;  4ZBG A;  4MBU A;  3R96 A;  4JLY A;  1XF8 A;  2B4D B;  2BSW A;  2PSW A;  1UFH A;  2EUI A;  5KTA A;  4YRH A;  3PZJ A;  4KVO E;  4KZT A;  2R7H A;  3EC4 A;  3G3S A;  1S7L A;  1RXT A;  1I1D A;  2JDC A;  2BEI A;  1YK3 A;  1N71 A;  5E96 A;  2VQY A;  4CAV A;  2P6F A;  3W91 A;  1PU9 A;  5DWM A;  5EBV A;  2HV2 A;  5I0C A;  2A4N A;  2REF A;  4KOU A;  3I9S A;  3S6G A;  3TT2 A;  4FD5 A;  4H6U A;  1IIC A;  1YR0 A;  3R9F A;  4R3L A;  4JJX A;  3EY5 A;  2QEC A;  2R98 A;  4DNC A;  3JUW A;  4EVY A;  4AB7 A;  4QVT A;  4OAD A;  4CS0 B;  3CXQ A;  2J8N A;  4PSW A;  2R1I A;  3GY9 A;  3EXN A;  4B5P B;  4CAW A;  4HKF A;  2CNT A;  4L89 A;  1S7N A;  5DWN A;  4ONU A;  4NF1 A;  4II9 A;  3BJ7 A;  2ZXV A;  4M3S A;  2J8R A;  3RYO A;  2GAN A;  1S7K A;  4CAX A;  2B58 A;  1IYL A;  5IV0 A;  4YFJ A;  3B8G A;  2J8M A;  1Y9K A;  4JXQ A;  3IGR A;  1XIX A;  3QAH A;  4U9Z A;  4ORF A;  5C88 A;  5IX3 A;  2EVN A;  2CY2 A;  4KLW A;  1CJW A;  4KOW A;  2Y0M A;  1YLE A;  1MJB A;  4M85 A;  2OH1 A;  4KUB A;  3BLN A;  5KTC A;  3E0K A;  4KVM E;  3OWC A;  3FBU A;  1J4J A;  3TOA A;  3WR7 A;  1YRE A;  2FE7 A;  2FS5 A;  1B87 A;  1BOB A;  1Z4R A;  1CM0 A;  4XNH B;  4PSX A;  1ON0 A;  2BUE A;  2D4P A;  4JWP A;  2FL4 A;  5HH1 A;  2JDD A;  1S60 A;  2HUZ A;  2Z11 A;  4KVX A;  1U6M A;  2Q04 A;  4RS2 A;  4XNH C;  1RO5 A;  1QSR A;  1GHE A;  1YX0 A;  2B5G A;  3CXP A;  5ISV A;  3D8P A;  3FNC A;  3W6X A;  2Q4V A;  2ATR A;  3W6S A;  2G3A A;  4RI1 A;  5F49 A;  4F0Y A;  3D2P A;  1Z9U A;  3T90 A;  2Q0Y A;  3SXN A;  1VHS A;  4NSQ A;  1MJ9 A;  2PQ8 A;  4NEX A;  4AVA A;  2ARH A;  3EFA A;  3TFY A;  4NXY A;  1QSN A;  3R9G A;  3DR8 A;  4PK3 A;  3T9Y A;  1QST A;  1IID A;  1QSM A;  3TOB A;  3ZJ0 A;  2VEZ A;  3D3S A;  2H5M A;  4QBJ A;  3PGP A;  1M44 A;  3DR6 A;  2QIR A;  1KUX A;  2WPX A;  5F47 A;  4AVB A;  4LUA A;  5FVJ A;  2PDO A;  3PP9 A;  2ZW7 A;  2RC4 A;  2I79 A;  3R9E A;  1XMT A;  4KOV A;  4UA3 A;  2B3V A;  4YGO A;  1M4I A;  3JVN A;  2B5G B;  2P6G A;  2QML A;  4J3G A;  4KOS A;  1SQH A;  4KLV A;  2FXF A;  4U5Y A;  2AJ6 A;  4HNW B;  2Q7B A;  3P2F A;  5F46 A;  2R8V A;  2K5T A;  2WPW A;  1QSO A;  1YGH A;  2PR8 A;  2ZW4 A;  4MJ8 A;  2C27 A;  3F5B A;  4R3K A;  2P6E A;  3FXT A;  4H6Z A;  1P0H A;  4HNY B;  2VZZ A;  1YVO A;  2AE6 A;  2B3U A;  3UY5 A;  3C26 A;  2Q44 A;  5J8C A;  5JQ4 A;  2REE A;  3KKW A;  4CRZ B;  5GCN A;  3S6H A;  4NCZ A;  1S3Z A;  4IF5 A;  3TE4 A;  2P0W A;  4AG9 A;  3DDD A;  3CXS A;  1WK4 A;  4IUS A;  5EC4 A;  3FRM A;  3MGD A;  4QUS A;  1Q2D A;  1K4J A;  2G3T A;  4KOY A;  2VZY A;  2PRB A;  3FIX A;  1I12 A;  1IB1 E;  1VKC A;  4FD4 A;  4H89 A;  3S6F A;  4XPK A;  1V0C A;  3QB8 A;  4UWI A;  2VI7 A;  4E8O A;  1TIQ A;  1FY7 A;  2I00 A;  3D2M A;  4R9M A;  2FT0 A;  4FD6 A;  2PC1 A;  4Y49 B;  1B6B A;  4MY3 A;  5JPH A;  3VWD A;  1L0C A;  2OB0 A;  2FIW A;  4XPL A;  2Q4Y A;  2KCW A;  5H86 A;  2ZW5 A;  3SHP A;  3V8I A;  3R1K A;  4GS4 A;  4Y49 C;  4AG7 A;  4MHD A;  2D4O A;  4JD6 A;  1P4N A;  3VWE A;  4OAE A;  4UBR A;  4LX9 A;  4KOX A;  3GYA A;  4B5P A;  1S5K A;  5H84 A;  3P2H A;  4JXR A;  3TTH A;  2JEV A;  5J8F A;  3DSB A;  4L8A A;  3NE7 A;  2GE3 A;  3TO9 A;  3SXO A;  3F8K A;  2OZG A;  2FIA A;  1MK4 A;  4QB9 A;  1R57 A;  5KTD A;  4FD7 A; 
#chains in the Genus database with same CATH topology
 4MXU A;  2CNM A;  1KUY A;  1WWZ A;  3GKR A;  4FUU A;  2YND A;  2FSR A;  4PK2 A;  1OZP A;  3G8W A;  1VHO A;  1M4G A;  2HQY A;  2JLM A;  5G1Z A;  1TF8 A;  2DF5 A;  4KOR A;  4R7M A;  3V38 A;  1NMT A;  2C6P A;  3B7I A;  1Q2C A;  3D7F A;  2O53 A;  4UEF A;  3FYN A;  4A32 A;  2EWB A;  1IYK A;  2DXQ A;  2AFX A;  2FCK A;  1NSL A;  4OC0 A;  4KOT A;  3S6K A;  1IOF A;  4R57 A;  1XBU A;  1I21 A;  4EME A;  5K8P A;  3FF3 A;  5AG5 A;  4MCR A;  4JYW A;  1YVK A;  2G0B A;  3KHZ A;  2CIJ A;  4MCQ A;  2NMT A;  1IGB A;  3FB3 A;  2PJ0 A;  3DNS A;  4P4I A;  4NGP A;  2O28 A;  1X12 A;  1CP6 A;  1TF9 A;  3IEH A;  3ZZI A;  2ZPA A;  4FAI A;  3LD2 A;  4MY0 A;  3D7G A;  1ELL P;  4WJB A;  2AFW A;  4MCS A;  4NJR A;  4OME A;  4CGP A;  3TCV A;  1S7F A;  4UCM A;  5F48 A;  4UF4 A;  2Z0Z A;  2Z3M A;  3R95 A;  4R87 A;  1IOI A;  3SI1 A;  4AVC A;  2VBQ A;  4FWU A;  1M1D A;  2B4D A;  2HB6 A;  1Q2Y A;  3EO4 A;  2WYR A;  1YW6 A;  3GLJ A;  2VXK A;  1LRZ A;  4HNX B;  5AG6 A;  4MI4 A;  5HMN A;  5JH9 A;  1Y9W A;  4PXE A;  2B4B A;  3D4U A;  1ZLI A;  4UWJ A;  3IC1 A;  2Z3P A;  4I49 A;  1YW4 A;  1LAN A;  2OZH A;  3S9L A;  2CNS A;  1XE4 A;  2OU2 A;  4X5K A;  2GIV A;  2GRE A;  4UIA A;  3BJ8 A;  5C82 A;  2BL1 A;  4Z65 A;  3TO7 A;  1KUV A;  4OLL A;  4Q38 A;  4K3N A;  4BBH A;  3NH8 A;  5K8O A;  3H4Q A;  4B5O A;  3PB9 X;  3RBU A;  3F0A A;  4E0A A;  3I1U A;  4K30 A;  2OZU A;  1MJA A;  2RFH A;  1LOK A;  4CRY B;  1M4D A;  2F5I A;  2Z10 A;  5CNP A;  1A2Z A;  4E2A A;  2ZW6 A;  3RAM A;  3IWG A;  4GXH A;  3TO6 A;  1BO4 A;  4ZYQ A;  4U9Y A;  2OR4 A;  1BPM A;  3ISX A;  3K9U A;  4P44 A;  1PUA A;  1NE9 A;  1Y7R A;  1Z4E A;  2VL1 A;  3H8E A;  4QC6 A;  2PJ3 A;  4CGN A;  4XPD B;  4EWT A;  3PB4 X;  1XEB A;  3H8G A;  4PV6 A;  2IL4 A;  2C6G A;  4KSA A;  4B10 A;  4BMH A;  4KUA A;  3D7D A;  2X7B A;  1KZF A;  4NFR A;  3KL9 A;  2Z3N A;  2WUU A;  3WT4 A;  4B6Z A;  4F6A A;  5HXD A;  3I3G A;  4ZY0 A;  1YLO A;  2BOA A;  3LOD A;  5IB0 A;  3PEI A;  3SJX A;  2PR1 A;  3N7Z A;  4XPD C;  3VAR A;  4P45 A;  4ZBG A;  4MBU A;  3R96 A;  4UFV A;  2PJ6 A;  2RB7 A;  4JLY A;  1XF8 A;  2PJA A;  4X3R A;  2B4D B;  4Q7A A;  3KZW A;  3TC8 A;  5A27 A;  2BSW A;  1Z8L A;  2JEW A;  2PSW A;  4BD9 A;  2PJ8 A;  3KI9 A;  1UFH A;  4A2Z A;  3PFO A;  2EUI A;  4KS9 A;  1NSA A;  4MHN A;  4ZX9 A;  2BCO A;  1ARL A;  5KTA A;  1M4L A;  4YRH A;  3PZJ A;  4MFJ A;  2Q7S A;  4KVO E;  4KZT A;  2R7H A;  4PQA A;  3RNZ A;  3T8W A;  1IU8 A;  3EC4 A;  2CXA A;  3DLJ A;  1DE4 C;  1XFO A;  3G3S A;  1X10 A;  2PRQ A;  3SI2 A;  2ZOG A;  4HPS A;  1S7L A;  1RXT A;  3D7H A;  1I1D A;  2JDC A;  1FT7 A;  4TWE A;  2BEI A;  2F8H A;  4MFK A;  1YK3 A;  6CPA A;  4MHY A;  1N71 A;  2AFZ A;  5E96 A;  3SI0 A;  2PIZ A;  4O23 A;  2VQY A;  4F0X A;  4CAV A;  5AG7 A;  2P6F A;  3W91 A;  1PU9 A;  5DWM A;  5EBV A;  2YGW A;  1XJO A;  1BPN A;  2HV2 A;  2GLF A;  5I0C A;  1PYT B;  2A4N A;  2REF A;  4KOU A;  3I9S A;  3IU1 A;  1Z8X A;  5BWA B;  1LFW A;  2AFS A;  3S6G A;  3TT2 A;  3CDX A;  1R43 A;  4ZX8 A;  4FD5 A;  5AG4 A;  4H6U A;  4Q36 A;  1IIC A;  3B3W A;  3CT9 A;  1YR0 A;  3R9F A;  4M6G A;  4A38 A;  3FED A;  3IU2 A;  4R3L A;  4JJX A;  4F9U A;  5A28 A;  4CGO A;  4M6H A;  1QMU A;  5J1Q A;  3EY5 A;  2QEC A;  2BO9 A;  2R98 A;  1F2P A;  4NGM A;  2V8H A;  3QAY A;  4LQ6 A;  1R3N A;  4MRI A;  2EBJ A;  3JUW A;  4DNC A;  3A9L A;  4EVY A;  4AB7 A;  4QVT A;  1ZG9 A;  4OAD A;  5LYL A;  3D66 A;  4KSF A;  4CS0 B;  4UCP A;  3B3S A;  3B3V A;  3CXQ A;  1TKJ A;  2J8N A;  4PSW A;  2G9D A;  4IAV A;  1ARM A;  4B13 A;  2R1I A;  3GY9 A;  4UEZ A;  3NH4 A;  4AXV A;  3HUV A;  3EXN A;  3KQX A;  4FBE A;  4B5P B;  4CAW A;  4HKF A;  1F57 A;  2CNT A;  4L89 A;  4OC2 A;  2EK9 A;  4DUK A;  3PB8 X;  5JM6 A;  1CG2 A;  1RTQ A;  1BAV A;  3KQZ A;  4WWV A;  4H2K A;  4TNU A;  2CF4 A;  2EO8 A;  4ZY1 A;  1S7N A;  5DWN A;  4ONU A;  4NF1 A;  4II9 A;  3BJ7 A;  2ZXV A;  4A31 A;  4M3S A;  1LAM A;  2J8R A;  3JRU A;  3RYO A;  2GAN A;  1S7K A;  3K2K A;  3L2N A;  2B58 A;  4CAX A;  3CPA A;  1IYL A;  5IV0 A;  2Z3L A;  4YFJ A;  3RZA A;  1YME A;  3B2Y A;  3B8G A;  2J8M A;  4NGT A;  7CPA A;  1Y0Y A;  1Y9K A;  2GU2 A;  4JXQ A;  3IGR A;  1XIX A;  3QAH A;  4BIN A;  1ZO0 A;  2XEG A;  2YNC C;  4C7H A;  3IIB A;  8CPA A;  4U9Z A;  2PJ7 A;  1XMB A;  1Z8T A;  2JBJ A;  2Q43 A;  4ORF A;  4OC1 A;  5C88 A;  5IX3 A;  2EVN A;  2CY2 A;  4KLW A;  1CJW A;  2IQ6 A;  2Y0M A;  1YSJ A;  1YLE A;  1MJB A;  3QNV A;  4KOW A;  2V77 A;  4R8F A;  3S9M A;  4A37 A;  4M85 A;  2PJC A;  4P6Y A;  5LYD A;  2ZEG A;  4UCN A;  2OH1 A;  4MHP A;  4KUB A;  3BLN A;  5KTC A;  3E0K A;  5G20 A;  4KVM E;  3MN8 A;  2V8D A;  4ZY2 A;  4B12 A;  4CAE A;  1Z5R A;  3OWC A;  2ZED A;  1J4J A;  1GYT A;  2GFQ A;  3FBU A;  3GIU A;  2CTB A;  3DGV A;  3IWE A;  4P4J A;  3TOA A;  3WC6 A;  1YRE A;  3WR7 A;  2FE7 A;  2FS5 A;  3FH4 A;  3PBB A;  2XEF A;  2AFM A;  1B87 A;  1BOB A;  1Z4R A;  3KHX A;  4OKO A;  5CBM A;  3FMC A;  5K8M A;  1CM0 A;  4X2T A;  3B3C A;  4XNH B;  1CBX A;  3N5F A;  4G1P A;  4PSX A;  4C2X A;  3GB0 A;  1ZLH A;  4UFX A;  1ON0 A;  1Z2L A;  2BUE A;  1JWQ A;  3CPX A;  4C7I A;  1AMP A;  2D4P A;  1TKF A;  4JWP A;  2FL4 A;  2PIY A;  1XRY A;  5G22 A;  5HH1 A;  1ZG8 A;  1AUG A;  1S60 A;  2HUZ A;  2JDD A;  3TX8 A;  2Z11 A;  2ZEN A;  4PXD A;  2WSA A;  4KVX A;  4UIB A;  1U6M A;  5HVG A;  2Q04 A;  1QQ9 A;  4RS2 A;  3LMS A;  4XNH C;  1RO5 A;  4YU9 A;  4OC3 A;  1QSR A;  5LRK A;  4CGM A;  1GHE A;  1YX0 A;  2PJB A;  2B5G A;  4RUH A;  3CXP A;  5ISV A;  2ZEP A;  3BI1 A;  3D8P A;  3FNC A;  4B14 A;  3W6X A;  2Q4V A;  2ATR A;  3MRU A;  3W6S A;  2G3A A;  4RI1 A;  5F49 A;  2PVW A;  4F0Y A;  3D2P A;  1Z9U A;  5D29 A;  4W9Y A;  3T90 A;  1F2O A;  2Q0Y A;  4MFZ A;  3SXN A;  4MFQ A;  1VHS A;  2POK A;  3PRT A;  1IY7 A;  4NSQ A;  4CPA A;  4MHZ A;  1MJ9 A;  2JBK A;  2PJ9 A;  2PQ8 A;  3IFE A;  4NEX A;  4AVA A;  2ARH A;  3EFA A;  5LRJ A;  4C68 A;  3SJG A;  3TFY A;  2ABZ A;  2O4H A;  1DTD A;  4MCP A;  3WC7 A;  2PJ1 A;  4NXY A;  3NH5 A;  1QSN A;  3R9G A;  3FEE A;  3DR8 A;  2OOT A;  2ZEE A;  4C2Z A;  1OBR A;  4PK3 A;  3T9Y A;  1QST A;  2ZEL A;  4PPZ A;  1HDU A;  1IID A;  1CPX A;  4ONW A;  4IHM A;  1QSM A;  1Q7L A;  4NGQ A;  4DYO A;  1VGY A;  3TOB A;  4NGS A;  3PBE A;  3ZJ0 A;  4IK2 A;  2VEZ A;  3D3S A;  2H5M A;  4QBJ A;  3PGP A;  4P10 A;  1M44 A;  3DR6 A;  2QIR A;  4F8Z A;  1KUX A;  2FVG A;  2WPX A;  3LWU A;  4LUA A;  4RN7 A;  5F47 A;  4AVB A;  4CYO A;  4EFD A;  2DEA A;  2J9A A;  5FVJ A;  2PDO A;  3IWW A;  3PP9 A;  2ZW7 A;  4NGN A;  5LYI A;  2RC4 A;  2ZEM A;  4CYP A;  4ZGY B;  2I79 A;  3NFZ A;  2WZN A;  3HLP A;  3R9E A;  5EMI A;  1XMT A;  4KOV A;  5F09 A;  1LAP A;  2ANP A;  2Z3O A;  4UA3 A;  2B3V A;  4YGO A;  2IMO A;  1CX8 A;  1M4I A;  4UEE A;  1UWY A;  3JVN A;  1BLL E;  2B5G B;  2P6G A;  2QML A;  2QYV A;  5K8N A;  3S9N A;  3VH9 A;  4J3G A;  4OID A;  4R76 A;  1VHE A;  4KOS A;  1CPS A;  1SQH A;  4LQG A;  4X8I A;  4A30 A;  4KLV A;  4DJL A;  1TXR A;  2Z3K A;  2FXF A;  3NE8 A;  4U5Y A;  2AJ6 A;  3H8F A;  3FEC A;  4HNW B;  2Q7B A;  3P2F A;  2V8G A;  5AGE A;  5F46 A;  5I4M A;  3V7Z A;  2R8V A;  2K5T A;  2WPW A;  4NJQ A;  4B11 A;  1QSO A;  1YGH A;  2PR8 A;  3D68 A;  2PJ5 A;  2ZW4 A;  5G21 A;  4MFL A;  2QVP A;  5ELY A;  4MJ8 A;  3H5Z A;  2C27 A;  3F5B A;  4R3K A;  4P4E A;  2NSM A;  4C2Y A;  2P6E A;  5CPA A;  2Q51 A;  3FXT A;  4H6Z A;  1P0H A;  4ZI6 A;  2NYQ A;  5JGF A;  3BI0 A;  3GUX A;  4HNY B;  2VZZ A;  1YVO A;  2AE6 A;  2B3U A;  2AFU A;  1AYE A;  3UY5 A;  3WAB A;  3C26 A;  2Q44 A;  3IO1 A;  5J8C A;  1H8L A;  4P4F A;  2IJZ A;  5JQ4 A;  4A95 A;  2REE A;  3KKW A;  4CRZ B;  4OC4 A;  4P4D A;  4NCZ A;  4R6T A;  3D67 A;  5GCN A;  3S6H A;  1ELM P;  4CYN A;  5LYF A;  1TKH A;  3ISZ A;  1S3Z A;  5HVF A;  3RO0 A;  4IF5 A;  3TE4 A;  3JTK A;  1VIX A;  2P0W A;  3NA6 A;  4AG9 A;  3CZX A;  3CXS A;  3DDD A;  4MMO A;  1WK4 A;  4A94 A;  5LRG A;  4IUS A;  1XOV A;  1Y7E A;  3FJU A;  2C6C A;  5EC4 A;  3KGQ A;  2PVV A;  3FRM A;  1LCP A;  3MGD A;  4OIW A;  3FX6 A;  3K9T A;  4A39 A;  4QUS A;  1Q2D A;  3PB7 X;  4JZ0 A;  1K4J A;  1FNO A;  2G3T A;  2ZOF A;  4KOY A;  3FVL A;  2VZY A;  2PRB A;  3LAC A;  3FIX A;  1I12 A;  1IB1 E;  1VKC A;  2I3C A;  4FD4 A;  2C1C A;  4H89 A;  5D8N A;  3S6F A;  4XPK A;  5HVH A;  4P4B A;  1V0C A;  3BHX A;  3QB8 A;  3KAS A;  4UWI A;  2VI7 A;  4E8O A;  1TIQ A;  4NGR A;  2PJ2 A;  2QJ8 A;  2HC9 A;  4PXB A;  1FY7 A;  1JQG A;  2I00 A;  3D2M A;  4OC5 A;  2EK8 A;  4R9M A;  2FT0 A;  4FD6 A;  2PC1 A;  4Y49 B;  1B6B A;  2ZEF A;  4MY3 A;  1HDQ A;  5JPH A;  3VWD A;  1L0C A;  2F7V A;  2OB0 A;  3WC5 A;  4PXC A;  2FIW A;  2DPT A;  2XEJ A;  4XPL A;  2Q4Y A;  2KCW A;  5H86 A;  1KWM A;  2ZW5 A;  3SHP A;  1CP7 A;  4CYQ A;  5IB9 A;  2GLJ A;  3V8I A;  3R1K A;  2ZEO A;  4GS4 A;  1ZG7 A;  3B35 A;  4Y49 C;  1PCA A;  4AG7 A;  4MHD A;  4OP4 A;  2D4O A;  3SJE A;  4JD6 A;  4YWY A;  3PFE A;  3IJ3 A;  1P4N A;  3VWE A;  1EE3 P;  4OAE A;  3SJF A;  4UBR A;  3KR5 A;  3B3T A;  2PCU A;  1Z8W A;  4LX9 A;  1Y0R A;  2Q4Z A;  1HEE A;  2YNE A;  3KR4 A;  4KOX A;  3GYA A;  4QB9 A;  3BXM A;  4B5P A;  4F9V A;  4M6I A;  1S5K A;  5H84 A;  3P2H A;  2DPS A;  2XEI A;  3VAT A;  4UFW A;  4JXR A;  5THW A;  1YQE A;  3TTH A;  4CAF A;  2JEV A;  2CTC A;  5J8F A;  4CGL A;  4A33 A;  3DSB A;  4L8A A;  2YNC A;  3NE7 A;  2GE3 A;  4GM5 A;  3PB6 X;  3TO9 A;  4MFP A;  5DS0 A;  3SXO A;  2AFO A;  2PE3 A;  4KSI A;  3F8K A;  2OZG A;  2FIA A;  2PJ4 A;  1MK4 A;  2ODF A;  2V8V A;  1R57 A;  2ZEH A;  5KTD A;  4FD7 A; 
#chains in the Genus database with same CATH homology
 2CNM A;  1KUY A;  1WWZ A;  3GKR A;  2YND A;  2FSR A;  4PK2 A;  1OZP A;  3G8W A;  1M4G A;  2HQY A;  2JLM A;  5G1Z A;  4KOR A;  1NMT A;  1Q2C A;  3FYN A;  4A32 A;  1IYK A;  2DXQ A;  2FCK A;  1NSL A;  4KOT A;  3S6K A;  4R57 A;  1I21 A;  5AG5 A;  1YVK A;  2G0B A;  2NMT A;  3FB3 A;  3DNS A;  2O28 A;  3ZZI A;  2ZPA A;  3LD2 A;  4MY0 A;  4CGP A;  3TCV A;  1S7F A;  4UCM A;  5F48 A;  2Z0Z A;  2Z3M A;  3R95 A;  4R87 A;  4AVC A;  2VBQ A;  3EO4 A;  1M1D A;  2B4D A;  1Q2Y A;  4HNX B;  5AG6 A;  2VXK A;  1LRZ A;  4MI4 A;  5HMN A;  1Y9W A;  2B4B A;  4UWJ A;  4I49 A;  2Z3P A;  2OZH A;  2CNS A;  1XE4 A;  2OU2 A;  4X5K A;  2GIV A;  3BJ8 A;  5C82 A;  2BL1 A;  3TO7 A;  1KUV A;  4OLL A;  4Q38 A;  4BBH A;  3H4Q A;  4B5O A;  3F0A A;  4E0A A;  4K30 A;  2OZU A;  1MJA A;  4CRY B;  1M4D A;  2F5I A;  2Z10 A;  5CNP A;  4E2A A;  2ZW6 A;  3TO6 A;  3IWG A;  1BO4 A;  4U9Y A;  3K9U A;  1PUA A;  1NE9 A;  1Y7R A;  1Z4E A;  4CGN A;  4QC6 A;  4XPD B;  1XEB A;  4PV6 A;  2IL4 A;  4B10 A;  4KSA A;  4BMH A;  4KUA A;  2X7B A;  1KZF A;  4F6A A;  2Z3N A;  2WUU A;  3I3G A;  3LOD A;  5IB0 A;  2PR1 A;  3N7Z A;  4XPD C;  4ZBG A;  4MBU A;  3R96 A;  4UFV A;  4JLY A;  1XF8 A;  2B4D B;  5A27 A;  2BSW A;  2PSW A;  1UFH A;  4A2Z A;  2EUI A;  4KS9 A;  5KTA A;  4YRH A;  3PZJ A;  4MFJ A;  4KVO E;  4KZT A;  2R7H A;  3EC4 A;  2CXA A;  3G3S A;  1S7L A;  1RXT A;  1I1D A;  2JDC A;  2BEI A;  4MFK A;  1YK3 A;  1N71 A;  5E96 A;  2VQY A;  4F0X A;  4CAV A;  5AG7 A;  2P6F A;  3W91 A;  1PU9 A;  5DWM A;  5EBV A;  2YGW A;  2HV2 A;  5I0C A;  2A4N A;  2REF A;  4KOU A;  3I9S A;  3IU1 A;  5BWA B;  3S6G A;  3TT2 A;  4FD5 A;  5AG4 A;  4H6U A;  4Q36 A;  1IIC A;  1YR0 A;  3R9F A;  3IU2 A;  4R3L A;  4JJX A;  5A28 A;  4CGO A;  3EY5 A;  2QEC A;  2R98 A;  4DNC A;  3JUW A;  3A9L A;  4EVY A;  4AB7 A;  4QVT A;  4OAD A;  4KSF A;  4CS0 B;  4UCP A;  3CXQ A;  2J8N A;  4PSW A;  4B13 A;  2R1I A;  3GY9 A;  3EXN A;  4B5P B;  4CAW A;  4HKF A;  2CNT A;  4L89 A;  1S7N A;  5DWN A;  4ONU A;  4NF1 A;  4II9 A;  3BJ7 A;  2ZXV A;  4A31 A;  4M3S A;  2J8R A;  3RYO A;  2GAN A;  1S7K A;  4CAX A;  2B58 A;  1IYL A;  5IV0 A;  2Z3L A;  4YFJ A;  3B8G A;  2J8M A;  1Y9K A;  4JXQ A;  3IGR A;  1XIX A;  3QAH A;  1ZO0 A;  2YNC C;  4C7H A;  4U9Z A;  4ORF A;  5C88 A;  5IX3 A;  2EVN A;  2CY2 A;  4KLW A;  1CJW A;  4KOW A;  2Y0M A;  1YLE A;  1MJB A;  4M85 A;  4UCN A;  2OH1 A;  4KUB A;  3BLN A;  5KTC A;  3E0K A;  5G20 A;  4KVM E;  4B12 A;  4CAE A;  3OWC A;  3FBU A;  1J4J A;  3IWE A;  3TOA A;  3WR7 A;  1YRE A;  2FE7 A;  2FS5 A;  1B87 A;  1BOB A;  1Z4R A;  1CM0 A;  4XNH B;  4PSX A;  4C2X A;  4UFX A;  1ON0 A;  2BUE A;  4C7I A;  2D4P A;  4JWP A;  2FL4 A;  5G22 A;  5HH1 A;  2JDD A;  1S60 A;  2HUZ A;  2Z11 A;  2WSA A;  4KVX A;  1U6M A;  2Q04 A;  4RS2 A;  4XNH C;  1RO5 A;  1QSR A;  4CGM A;  1GHE A;  1YX0 A;  2B5G A;  3CXP A;  5ISV A;  3D8P A;  3FNC A;  4B14 A;  3W6X A;  2Q4V A;  2ATR A;  3W6S A;  2G3A A;  4RI1 A;  5F49 A;  4F0Y A;  3D2P A;  1Z9U A;  3T90 A;  2Q0Y A;  4MFZ A;  3SXN A;  4MFQ A;  1VHS A;  4NSQ A;  1MJ9 A;  2PQ8 A;  4NEX A;  4AVA A;  2ARH A;  3EFA A;  4C68 A;  3TFY A;  4NXY A;  1QSN A;  3R9G A;  3DR8 A;  4C2Z A;  4PK3 A;  3T9Y A;  1QST A;  1IID A;  1QSM A;  3TOB A;  3ZJ0 A;  2VEZ A;  3D3S A;  2H5M A;  4QBJ A;  3PGP A;  1M44 A;  3DR6 A;  2QIR A;  1KUX A;  2WPX A;  5F47 A;  4AVB A;  4LUA A;  4CYO A;  5FVJ A;  2PDO A;  3PP9 A;  2ZW7 A;  4CYP A;  2RC4 A;  4ZGY B;  2I79 A;  3R9E A;  1XMT A;  4KOV A;  2Z3O A;  4UA3 A;  2B3V A;  4YGO A;  1M4I A;  3JVN A;  2B5G B;  2P6G A;  2QML A;  4J3G A;  4KOS A;  1SQH A;  4A30 A;  4KLV A;  2Z3K A;  2FXF A;  4U5Y A;  2AJ6 A;  4HNW B;  2Q7B A;  3P2F A;  5AGE A;  5F46 A;  2R8V A;  2K5T A;  2WPW A;  4B11 A;  1QSO A;  1YGH A;  2PR8 A;  2ZW4 A;  5G21 A;  4MFL A;  4MJ8 A;  3H5Z A;  2C27 A;  3F5B A;  4R3K A;  4C2Y A;  2P6E A;  3FXT A;  4H6Z A;  1P0H A;  4HNY B;  2VZZ A;  1YVO A;  2AE6 A;  2B3U A;  3UY5 A;  3C26 A;  2Q44 A;  5J8C A;  5JQ4 A;  4A95 A;  2REE A;  3KKW A;  4CRZ B;  5GCN A;  3S6H A;  4NCZ A;  4CYN A;  1S3Z A;  4IF5 A;  3TE4 A;  3JTK A;  2P0W A;  4AG9 A;  3DDD A;  3CXS A;  1WK4 A;  4IUS A;  5EC4 A;  3FRM A;  3MGD A;  4QUS A;  1Q2D A;  1K4J A;  2G3T A;  4KOY A;  2VZY A;  2PRB A;  3FIX A;  1I12 A;  1IB1 E;  1VKC A;  4FD4 A;  4H89 A;  3S6F A;  4XPK A;  1V0C A;  3QB8 A;  4UWI A;  2VI7 A;  4E8O A;  1TIQ A;  1FY7 A;  2I00 A;  3D2M A;  4R9M A;  2FT0 A;  4FD6 A;  2PC1 A;  4Y49 B;  1B6B A;  4MY3 A;  5JPH A;  3VWD A;  1L0C A;  2OB0 A;  2FIW A;  2DPT A;  4XPL A;  2Q4Y A;  2KCW A;  5H86 A;  2ZW5 A;  3SHP A;  4CYQ A;  3V8I A;  3R1K A;  4GS4 A;  4Y49 C;  4AG7 A;  4MHD A;  2D4O A;  4JD6 A;  1P4N A;  3VWE A;  4OAE A;  4UBR A;  4LX9 A;  2YNE A;  4KOX A;  3GYA A;  4B5P A;  1S5K A;  5H84 A;  3P2H A;  2DPS A;  4UFW A;  4JXR A;  3TTH A;  4CAF A;  2JEV A;  5J8F A;  4CGL A;  4A33 A;  3DSB A;  4L8A A;  2YNC A;  3NE7 A;  2GE3 A;  3TO9 A;  4MFP A;  3SXO A;  3F8K A;  2OZG A;  2FIA A;  1MK4 A;  4QB9 A;  1R57 A;  5KTD A;  4FD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...