2IL4A

Crystal structure of at1g77540-coenzyme a complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
PKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein At1g77540
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 25
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2il4A00
1R57A 1M4IA 5DWNA 2R7HA 4QVTA 2WPWA 3VWDA 4NSQA 4NXYA 3R9EA 2VI7A 4JWPA 3R9GA 1PUAA 2ZW5A 3T9YA 2FXFA 4R3KA 4KLWA 2EUIA 2Z11A 3PZJA 4U9YA 2FCKA 3GYAA 1MJBA 2KCWA 4UBRA 1Q2DA 4DNCA 1Z4EA 5C88A 2AE6A 2JLMA 4KLVA 3EY5A 3W91A 3TFYA 3TCVA 2OZGA 3BJ8A 1S7KA 4HNYB 5J8CA 3QB8A 1I1DA 2D4OA 4BMHA 4QB9A 1FY7A 4J3GA 3ZZIA 3EXNA 1YX0A 4CAXA 1Q2CA 5F47A 2FE7A 1YLEA 3TTHA 1I12A 2C27A 1BOBA 3MGDA 4Y49C 2JDDA 3N7ZA 4ONUA 3QAHA 3EFAA 1KUXA 4XPLA 2G0BA 4M85A 4NCZA 1KUYA 4ZBGA 5H86A 4X5KA 2Q04A 2PRBA 2GIVA 4H6UA 3FXTA 4IUSA 4NEXA 3C26A 3F5BA 3SHPA 3JVNA 2ZW4A 1MJ9A 3FNCA 2B5GB 2O28A 3G3SA 4IF5A 1U6MA 4KOUA 1Y7RA 4KVOE 2VZZA 1RO5A 4PSWA 5IX3A 2BSWA 1Q2YA 1TIQA 2HUZA 1B87A 1XF8A 4XNHC 1S7NA 5ISVA 1LRZA 4KZTA 2B4DB 2X7BA 1OZPA 4OAEA 3TE4A 2I79A 4B5PA 1Y9KA 3PGPA 1QSNA 2EVNA 1J4JA 4OLLA 2JDCA 2P6FA 2Z0ZA 4MY0A 1M1DA 3SXNA 2B3VA 2OH1A 1XEBA 2G3TA 4L8AA 2A4NA 4CRYB 2FSRA 1YVKA 4MHDA 3R95A 4L89A 4MI4A 3R96A 3I3GA 3T90A 2AJ6A 3P2HA 3TOBA 2OZUA 1K4JA 3I9SA 2VEZA 2I00A 4CRZB 4AG7A 1S7FA 1M4DA 2BEIA 2VXKA 3DNSA 4HNWB 1QSTA 4E2AA 2Q4VA 5KTAA 3V8IA 2Y0MA 2F5IA 2FIWA 3LD2A 4UA3A 1BO4A 4HKFA 2PC1A 4H89A 4ORFA 1QSRA 4R9MA 4YRHA 2IL4A 2B3UA 1M44A 4LUAA 4QBJA 2BL1A 1CJWA 5HH1A 2FT0A 2J8NA 4U5YA 1IICA 4AG9A 3GKRA 4JD6A 1S7LA 1IYLA 3FRMA 5E96A 3F0AA 3CXPA 3VWEA 1IYKA 4XPDB 3K9UA 1VKCA 2DXQA 3W6SA 2CNSA 3D2MA 1SQHA 2CNMA 5JQ4A 2B5GA 3RYOA 2FS5A 5IV0A 2ZPAA 3IGRA 4R3LA 1S3ZA 1UFHA 2QIRA 5IB0A 1RXTA 4KOTA 4AVAA 3FBUA 4PK2A 3F8KA 3GY9A 4FD7A 2Q7BA 4H6ZA 2ATRA 1I21A 3R1KA 4KOSA 4NF1A 1XMTA 3FIXA 1NE9A 3SXOA 1QSMA 1S5KA 1YGHA 4AVBA 2GE3A 4QUSA 5JPHA 4AB7A 4OADA 3S6FA 3P2FA 2VZYA 2G3AA 4M3SA 3BLNA 3W6XA 4KOWA 4CS0B 2QECA 1ON0A 2NMTA 4R57A 1NSLA 4XNHB 5C82A 1WWZA 2REEA 2REFA 3CXSA 2WPXA 2R98A 2QMLA 3S6KA 5CNPA 4YGOA 3DDDA 4FD5A 1YREA 4CAVA 2R1IA 2B4BA 2J8MA 4LX9A 2P0WA 4PSXA 4KOVA 2VBQA 1NMTA 2JEVA 3D3SA 4PK3A 3H4QA 1MJAA 4U9ZA 4UWIA 3S6GA 1KZFA 1S60A 2P6EA 2PR1A 4B5PB 2PQ8A 4MY3A 4F6AA 5EC4A 3WR7A 3DR8A 3DSBA 3EO4A 1MK4A 3KKWA 2FIAA 1Z9UA 2ZW6A 2OB0A 2PR8A 3CXQA 5F46A 1XIXA 3JUWA 4FD4A 2K5TA 3D2PA 4B5OA 5H84A 4KOYA 2Q0YA 1IB1E 4KVXA 2H5MA 4KUAA 4GS4A 2PDOA 3E0KA 4UWJA 5DWMA 2GANA 3TO7A 2ZW7A 1YK3A 2BUEA 1P4NA 2FL4A 3TO9A 2CY2A 4I49A 3BJ7A 4E0AA 2Z10A 4KVME 4XPDC 4JJXA 3FB3A 4KUBA 4AVCA 5KTDA 2ZXVA 4K30A 1Y9WA 4EVYA 1P0HA 3D8PA 4XPKA 5F49A 4RS2A 4Y49B 2OU2A 2D4PA 4YFJA 1YR0A 2HV2A 1N71A 5I0CA 3LODA 1QSOA 1XE4A 1IIDA 1B6BA 4FD6A 2HQYA 1V0CA 4RI1A 2CNTA 2B4DA 4KORA 3EC4A 3G8WA 4F0YA 3UY5A 4KOXA 3R9FA 2J8RA 4HNXB 1YVOA 3S6HA 1M4GA 2VQYA 1Z4RA 1KUVA 2RC4A 2ARHA 5KTCA 1WK4A 4II9A 4JXRA 4CAWA 4JLYA 2R8VA 5FVJA 3FYNA 4MBUA 1L0CA 4PV6A 2PSWA 4R87A 2P6GA 1CM0A 3DR6A 5HMNA 4JXQA 3NE7A 3TOAA 5J8FA 5F48A 3B8GA 3IWGA 2Q44A 2OZHA 3ZJ0A 3TO6A 2Q4YA 3PP9A 5GCNA 4QC6A 4E8OA 2B58A 3TT2A 5EBVA 4MJ8A 3OWCA 1GHEA 1PU9A 1VHSA
chains in the Genus database with same CATH superfamily
3V38A 3D7DA 1R57A 1M4IA 5DWNA 1ZLIA 4UEFA 2R7HA 4QVTA 2WPWA 3VWDA 4A95A 2ZOGA 4NSQA 1VHEA 2DEAA 4P6YA 4NXYA 3R9EA 2VI7A 5LYLA 1CP6A 4JWPA 3R9GA 4LQ6A 1PUAA 2ZW5A 3T9YA 3VARA 3FJUA 4MRIA 2FXFA 1ZO0A 3CPAA 1Y7EA 3SJFA 3WC5A 4R3KA 4CGNA 4Z65A 1IOIA 3ISZA 4KLWA 2EUIA 3PRTA 4IAVA 2Z11A 1F57A 3PZJA 4U9YA 3NH8A 5LYIA 3GLJA 1CX8A 4BBHA 2FCKA 4NGRA 5D8NA 5K8MA 3GYAA 1MJBA 4PPZA 2KCWA 4UBRA 1Q2DA 3LACA 2OOTA 4DNCA 2V8HA 1XJOA 1Z4EA 5C88A 4CGOA 2AE6A 3NH4A 2JLMA 4KLVA 4UCPA 2CTCA 3SI2A 3SJXA 7CPAA 3EY5A 4KSIA 3RBUA 3W91A 4B10A 3TFYA 4MFZA 4M6HA 3TCVA 2OZGA 3BJ8A 3GUXA 5AG5A 2CTBA 3LMSA 1S7KA 4UFVA 4HNYB 5J8CA 4R8FA 3QB8A 1I1DA 3VH9A 2C6CA 2D4OA 3S9NA 4BMHA 4QB9A 4ZX8A 1FY7A 4J3GA 4X3RA 5LRKA 4UFXA 5JH9A 2PJ2A 3PEIA 4YU9A 3ZZIA 3EXNA 1HDQA 1Z8WA 1YX0A 4CAXA 5J1QA 4B13A 1Q2CA 3GB0A 5F47A 2FE7A 3SI1A 4O23A 1YLEA 4TNUA 3TTHA 1I12A 1LANA 2C27A 1BOBA 3MGDA 2RB7A 4OC4A 1TKJA 2EK8A 4Y49C 2PJ7A 1AUGA 2JDDA 3N7ZA 3PB7X 2V8DA 2Q51A 3KASA 4ONUA 3QAHA 4F8ZA 8CPAA 4K3NA 1LFWA 1KUXA 1OBRA 3EFAA 4NGSA 3KR5A 1LCPA 4XPLA 4G1PA 2G0BA 2XEGA 4M85A 4R7MA 4NCZA 2GREA 5LYDA 3PB6X 1KUYA 3NA6A 4ZBGA 4ZY0A 1ELLP 4DUKA 3PB9X 5H86A 3IIBA 3IU1A 4X5KA 3FF3A 2PJ0A 2Q04A 2PRBA 4OKOA 2GIVA 4MFLA 4H6UA 5HVGA 2NYQA 3FXTA 4MHYA 4B12A 1DE4C 2PJ4A 1R3NA 4IUSA 4NEXA 5THWA 1UWYA 5CBMA 1FNOA 1XOVA 1F2PA 2O4HA 3C26A 3F5BA 3JVNA 3SHPA 4UCNA 2ZW4A 1MJ9A 3FNCA 2B5GB 1A2ZA 2O28A 3G3SA 3IC1A 1M4LA 4IF5A 1H8LA 1U6MA 4KOUA 3NE8A 1Y7RA 4KVOE 3CZXA 4LQGA 4NGMA 3JRUA 1YMEA 2VZZA 1RO5A 3D7HA 4PSWA 5G20A 5IX3A 2BSWA 1Q2YA 2QVPA 1TIQA 5HVHA 2HUZA 4OC2A 2YNEA 1B87A 1XF8A 2PJ5A 3BXMA 3FEEA 1Y0RA 4XNHC 4P4DA 4NGTA 1S7NA 2WZNA 5ISVA 1LRZA 4KZTA 2B4DB 3S9MA 2X7BA 1OZPA 2DPSA 4JZ0A 4OAEA 1PCAA 1Q7LA 5HXDA 3IFEA 3K2KA 2PVVA 3TE4A 4OIDA 2I79A 4B5PA 1Y9KA 3PGPA 2V8VA 4TWEA 5D29A 1QSNA 4ZYQA 2EVNA 3HLPA 1BAVA 1J4JA 4OLLA 2JDCA 2P6FA 1CG2A 2POKA 2Z0ZA 3B3WA 5K8OA 4MY0A 1M1DA 4X8IA 5LYFA 3FH4A 3WT4A 4Q7AA 2ANPA 4OC5A 3SXNA 6CPAA 2OH1A 2AFXA 2B3VA 3KGQA 3A9LA 3RAMA 4A94A 1Z8TA 2Z3KA 1XEBA 2Z3LA 1TKHA 2AFOA 2G3TA 1XRYA 4L8AA 1ZG8A 4MCSA 1ZG9A 4R76A 2A4NA 4CRYB 4R6TA 2FSRA 4FWUA 1YVKA 1ARLA 3MN8A 4MHDA 3R95A 4L89A 4MCPA 4KSAA 4MI4A 3BHXA 2Q43A 3L2NA 3R96A 3I3GA 1CPXA 3T90A 2AJ6A 1LOKA 2C6PA 3P2HA 2PJCA 3TOBA 3MRUA 2OZUA 1K4JA 1LAMA 3I9SA 2VEZA 2GLJA 2I00A 2AFMA 4CRZB 4AG7A 3NH5A 1S7FA 1VIXA 5G1ZA 1M4DA 2BEIA 3D7FA 2VXKA 3DNSA 3JTKA 4HNWB 1QSTA 4MCRA 2PIYA 5LRJA 4E2AA 2Q4VA 5KTAA 3V8IA 2Y0MA 2EK9A 2F5IA 2FIWA 3LD2A 5AGEA 4UA3A 4C68A 4MHNA 4A2ZA 5AG7A 4FUUA 4MHZA 4P4IA 1BO4A 2VL1A 4HKFA 4MFQA 4Q38A 2ZEGA 2YNCC 2PC1A 1Z8LA 3B3TA 4H89A 4ORFA 1QSRA 2JBJA 4R9MA 4YRHA 4OIWA 1EE3P 1X12A 2IL4A 2B3UA 3KQXA 4MHPA 1M44A 4LUAA 2ZEMA 4QBJA 1KWMA 2BL1A 1CJWA 2IQ6A 2ZEOA 1YQEA 3B2YA 5HH1A 1CP7A 2HC9A 4MFPA 4ONWA 2FT0A 2J8NA 1CBXA 4U5YA 1IICA 4AG9A 1Y0YA 1YW4A 3GKRA 2ZOFA 4NGQA 4JD6A 4X2TA 1S7LA 1IYLA 3IWEA 1IGBA 2QYVA 1QQ9A 3FRMA 3K9TA 2PJ9A 3QAYA 5E96A 4UCMA 3F0AA 1NSAA 3CXPA 4UEZA 2PJ6A 1IYKA 4XPDB 3VWEA 3K9UA 1VKCA 2JEWA 3B7IA 4P4BA 2DXQA 3H8FA 2CNSA 4H2KA 3W6SA 5F09A 3D2MA 4GXHA 1SQHA 2CNMA 5LRGA 2B5GA 5JQ4A 4ZX9A 4Q36A 3RYOA 2FS5A 3RZAA 5JM6A 1QMUA 2PVWA 3TC8A 5IV0A 2ZPAA 3IGRA 4M6GA 1PYTB 2XEJA 3KI9A 4R3LA 1S3ZA 1UFHA 2QIRA 4BINA 5IB0A 2PJ3A 1RXTA 1F2OA 4KOTA 4AVAA 3FBUA 4C2YA 2ZEHA 3WC6A 2JBKA 4PXEA 2IJZA 1YW6A 2EWBA 4PK2A 3F8KA 3WABA 3CT9A 3B35A 1XMBA 2EBJA 2XEIA 3D68A 3KR4A 2ZEPA 3GY9A 2Z3NA 4FD7A 2PE3A 3CDXA 2YGWA 4H6ZA 3KHXA 2Q7BA 2ATRA 1I21A 3R1KA 2NSMA 4KOSA 4NF1A 4DYOA 4F9VA 4P4FA 4NGPA 1XMTA 4RUHA 4W9YA 1AMPA 3FIXA 1BPNA 1NE9A 3SXOA 1QSMA 3KHZA 3FMCA 2BOAA 4B14A 1S5KA 1YGHA 4CYNA 4AVBA 5IB9A 2GE3A 1HEEA 4QUSA 4BD9A 5JPHA 4M6IA 4MCQA 4OADA 4AB7A 3S6FA 4NFRA 4CPAA 2PJAA 3P2FA 3B3CA 3PFEA 3H5ZA 2VZYA 4ZY2A 2G3AA 3TX8A 4OMEA 3PB8X 4M3SA 1LAPA 3V7ZA 3BLNA 3W6XA 4KOWA 4C7HA 4CS0B 4CYPA 5ELYA 2DPTA 2QECA 1AYEA 4OC1A 2O53A 3B3VA 3CPXA 1ON0A 2NMTA 4R57A 2PJ8A 1NSLA 4XNHB 3LWUA 2ZELA 1YSJA 5C82A 4CGPA 1WWZA 1YLOA 2REEA 2REFA 3CXSA 2WPXA 2ABZA 2QMLA 2R98A 3S6KA 5CNPA 1ZG7A 4YGOA 5A28A 2PJ1A 1FT7A 3DDDA 4FD5A 4IK2A 5HVFA 1VGYA 1Z2LA 1YREA 2YNDA 2R1IA 4A39A 4CAVA 4EWTA 3PFOA 4F0XA 4NJRA 3D7GA 4CGMA 4JYWA 2B4BA 1TXRA 3BI0A 5DS0A 2J8MA 4LX9A 2P0WA 4PSXA 3FECA 1JWQA 4OC0A 4GM5A 5K8NA 4KOVA 2VBQA 1NMTA 2JEVA 3D3SA 3DGVA 1GYTA 2CXAA 4PK3A 3VATA 4HPSA 2YNCA 1ARMA 3H4QA 3H8GA 3D66A 1MJAA 4U9ZA 4UWIA 3S6GA 1KZFA 3PBEA 4ZY1A 1S60A 2P6EA 2PR1A 2ZENA 2PQ8A 4B5PB 4MY3A 2FVGA 2G9DA 2PCUA 3FX6A 2V77A 4CAFA 5EC4A 4F6AA 3WR7A 3DR8A 4CYQA 3DSBA 3RO0A 3EO4A 1MK4A 3KKWA 3D4UA 2FIAA 1Z9UA 4WJBA 2ZW6A 2OB0A 2PR8A 1Z5RA 2Z3OA 4UEEA 5AG6A 4P45A 3CXQA 1ZLHA 5F46A 1XIXA 3JUWA 2IMOA 4FD4A 2K5TA 3D2PA 4CGLA 4B5OA 5H84A 4KOYA 2Q0YA 1IB1E 3D67A 3IU2A 4KVXA 2H5MA 5G21A 2Z3MA 4KUAA 1BPMA 3N5FA 3KL9A 4GS4A 3WC7A 2WYRA 2PDOA 3E0KA 1TF9A 3PBBA 1XBUA 4UWJA 2GANA 5DWMA 3TO7A 5JGFA 2ZW7A 4CYOA 1YK3A 2C6GA 4EMEA 1IY7A 2F8HA 4A37A 2BUEA 1P4NA 2FL4A 3TO9A 2CY2A 1CPSA 3DLJA 4KS9A 4I49A 2RFHA 4YWYA 1IOFA 5A27A 4MXUA 2Q7SA 3BJ7A 3S9LA 4E0AA 2WSAA 2Z10A 4KVME 2EO8A 4XPDC 3KQZA 2DF5A 4JJXA 3FB3A 2OR4A 4FAIA 2PRQA 4KUBA 4AVCA 5KTDA 2ZXVA 4PXCA 1VHOA 4K30A 1Y9WA 2C1CA 2AFZA 2J9AA 4EVYA 1XFOA 2PIZA 1P0HA 3D8PA 3KZWA 4RN7A 4XPKA 3QNVA 5F49A 3NFZA 5G22A 2WUUA 4RS2A 4Y49B 2OU2A 2D4PA 4MFJA 3H8EA 3B3SA 3GIUA 1YR0A 3SJGA 4YFJA 2HV2A 4UIAA 1N71A 2GU2A 4MMOA 5I0CA 3ISXA 3LODA 4OP4A 4KSFA 1QSOA 1XE4A 2XEFA 2CF4A 1IIDA 4UFWA 4AXVA 5I4MA 1B6BA 4FD6A 2HQYA 1V0CA 5CPAA 4CAEA 2F7VA 4DJLA 4A33A 4B11A 4RI1A 2CNTA 2B4DA 2BCOA 1HDUA 3IWWA 4KORA 1RTQA 3EC4A 4FBEA 3I1UA 2CIJA 3G8WA 3IEHA 4F0YA 3UY5A 2Q4ZA 4PQAA 1BLLE 4KOXA 1TF8A 1ELMP 3T8WA 3R9FA 2J8RA 4HNXB 1YVOA 3S6HA 4NGNA 1Z8XA 3HUVA 4P4EA 1M4GA 2VQYA 1Z4RA 1KUVA 2BO9A 2ARHA 2GFQA 2RC4A 2ZEEA 5KTCA 1WK4A 2HB6A 3RNZA 4A30A 2I3CA 4II9A 4ZGYB 2ODFA 2V8GA 2ZEFA 4A38A 2AFUA 4A32A 4P10A 4IHMA 3FEDA 4JXRA 4CAWA 5AG4A 4WWVA 3SI0A 1TKFA 1X10A 4JLYA 4C2ZA 4EFDA 3PB4X 4C2XA 2ZEDA 4NJQA 2R8VA 3BI1A 5FVJA 3FYNA 4MBUA 1L0CA 4PXDA 4PV6A 2PSWA 4OC3A 3FVLA 2Z3PA 4R87A 2P6GA 1CM0A 2GLFA 3DR6A 4UIBA 1JQGA 4JXQA 5BWAB 5HMNA 3NE7A 4P4JA 3SJEA 3TOAA 4ZI6A 5J8FA 5K8PA 3IO1A 3B8GA 4P44A 5EMIA 5F48A 2AFWA 1IU8A 3IWGA 2QJ8A 1DTDA 2Q44A 2OZHA 4MFKA 3ZJ0A 4B6ZA 4F9UA 2PJBA 4UF4A 3TO6A 2Q4YA 3PP9A 3IJ3A 5GCNA 4A31A 4QC6A 4C7IA 4E8OA 2B58A 2AFSA 3TT2A 5EBVA 1R43A 4MJ8A 4PXBA 3OWCA 1GHEA 1PU9A 1VHSA
chains in the Genus database with same CATH topology
1R57A 1M4IA 5DWNA 2R7HA 4QVTA 2WPWA 3VWDA 4A95A 4NSQA 4NXYA 3R9EA 2VI7A 4JWPA 3R9GA 1PUAA 2ZW5A 3T9YA 2FXFA 1ZO0A 4CGNA 4R3KA 4KLWA 2EUIA 2Z11A 3PZJA 4U9YA 4BBHA 2FCKA 3GYAA 1MJBA 2KCWA 4UBRA 1Q2DA 4DNCA 1Z4EA 5C88A 4CGOA 2AE6A 2JLMA 4KLVA 4UCPA 3EY5A 3W91A 3TFYA 4B10A 4MFZA 3TCVA 2OZGA 3BJ8A 5AG5A 1S7KA 4UFVA 4HNYB 5J8CA 3QB8A 1I1DA 2D4OA 4BMHA 4QB9A 1FY7A 4J3GA 4UFXA 3ZZIA 3EXNA 1YX0A 4CAXA 4B13A 1Q2CA 5F47A 2FE7A 1YLEA 3TTHA 1I12A 2C27A 1BOBA 3MGDA 4Y49C 2JDDA 3N7ZA 4ONUA 3QAHA 3EFAA 1KUXA 4XPLA 2G0BA 4M85A 4NCZA 1KUYA 4ZBGA 5H86A 3IU1A 4X5KA 2Q04A 2PRBA 2GIVA 4MFLA 4H6UA 3FXTA 4B12A 4IUSA 4NEXA 3C26A 3F5BA 3SHPA 3JVNA 4UCNA 2ZW4A 1MJ9A 3FNCA 2B5GB 2O28A 3G3SA 4IF5A 1U6MA 4KOUA 1Y7RA 4KVOE 2VZZA 1RO5A 4PSWA 5G20A 5IX3A 2BSWA 1Q2YA 1TIQA 2HUZA 2YNEA 1B87A 1XF8A 4XNHC 1S7NA 5ISVA 1LRZA 4KZTA 2B4DB 2X7BA 1OZPA 2DPSA 4OAEA 3TE4A 2I79A 4B5PA 1Y9KA 3PGPA 1QSNA 2EVNA 1J4JA 4OLLA 2JDCA 2P6FA 2Z0ZA 4MY0A 1M1DA 3SXNA 2B3VA 2OH1A 3A9LA 2Z3KA 1XEBA 2Z3LA 2G3TA 4L8AA 2A4NA 4CRYB 2FSRA 1YVKA 4MHDA 3R95A 4L89A 4KSAA 4MI4A 3R96A 3I3GA 3T90A 2AJ6A 3P2HA 3TOBA 2OZUA 1K4JA 3I9SA 2VEZA 2I00A 4CRZB 4AG7A 1S7FA 5G1ZA 1M4DA 2BEIA 4HNWB 2VXKA 3DNSA 3JTKA 1QSTA 4E2AA 2Q4VA 5KTAA 3V8IA 2Y0MA 2F5IA 2FIWA 3LD2A 5AGEA 4UA3A 4C68A 4A2ZA 5AG7A 1BO4A 4HKFA 4MFQA 4Q38A 2YNCC 2PC1A 4H89A 4ORFA 1QSRA 4R9MA 4YRHA 2IL4A 2B3UA 1M44A 4LUAA 4QBJA 2BL1A 1CJWA 5HH1A 4MFPA 2FT0A 2J8NA 4U5YA 1IICA 4AG9A 3GKRA 4JD6A 1S7LA 1IYLA 3IWEA 3FRMA 5E96A 4UCMA 3F0AA 3CXPA 3VWEA 1IYKA 4XPDB 3K9UA 1VKCA 2DXQA 3W6SA 2CNSA 3D2MA 1SQHA 2CNMA 5JQ4A 2B5GA 4Q36A 3RYOA 2FS5A 5IV0A 2ZPAA 3IGRA 4R3LA 1S3ZA 1UFHA 2QIRA 5IB0A 1RXTA 4KOTA 4AVAA 3FBUA 4C2YA 4PK2A 3F8KA 3GY9A 4FD7A 2Z3NA 2Q7BA 2YGWA 4H6ZA 2ATRA 1I21A 3R1KA 4KOSA 4NF1A 1XMTA 3FIXA 1NE9A 3SXOA 1QSMA 4B14A 1S5KA 1YGHA 4CYNA 4AVBA 2GE3A 4QUSA 5JPHA 4AB7A 4OADA 3S6FA 3P2FA 3H5ZA 2VZYA 2G3AA 4M3SA 3BLNA 3W6XA 4KOWA 4C7HA 4CS0B 4CYPA 2DPTA 2QECA 1ON0A 2NMTA 4R57A 1NSLA 4XNHB 5C82A 4CGPA 1WWZA 2REEA 2REFA 3CXSA 2WPXA 2R98A 2QMLA 3S6KA 5CNPA 4YGOA 5A28A 3DDDA 4FD5A 2YNDA 1YREA 4CAVA 2R1IA 4F0XA 4CGMA 2B4BA 2J8MA 4LX9A 2P0WA 4PSXA 4KOVA 2VBQA 1NMTA 2JEVA 3D3SA 2CXAA 4PK3A 2YNCA 3H4QA 1MJAA 4U9ZA 4UWIA 3S6GA 1KZFA 1S60A 2P6EA 2PR1A 4B5PB 2PQ8A 4MY3A 4CAFA 4F6AA 5EC4A 3WR7A 3DR8A 4CYQA 3DSBA 3EO4A 1MK4A 3KKWA 2FIAA 1Z9UA 2ZW6A 2OB0A 2PR8A 2Z3OA 5AG6A 3CXQA 5F46A 1XIXA 3JUWA 4FD4A 2K5TA 3D2PA 4CGLA 4B5OA 5H84A 4KOYA 2Q0YA 1IB1E 3IU2A 4KVXA 2H5MA 5G21A 2Z3MA 4KUAA 4GS4A 2PDOA 3E0KA 4UWJA 5DWMA 2GANA 3TO7A 2ZW7A 4CYOA 1YK3A 2BUEA 1P4NA 2FL4A 3TO9A 2CY2A 4KS9A 4I49A 5A27A 3BJ7A 4E0AA 2WSAA 2Z10A 4KVME 4XPDC 4JJXA 3FB3A 4KUBA 4AVCA 5KTDA 2ZXVA 4K30A 1Y9WA 4EVYA 1P0HA 3D8PA 4XPKA 5F49A 5G22A 2WUUA 4RS2A 4Y49B 2OU2A 2D4PA 4MFJA 4YFJA 1YR0A 2HV2A 1N71A 5I0CA 3LODA 4KSFA 1QSOA 1XE4A 4UFWA 1IIDA 1B6BA 4FD6A 2HQYA 1V0CA 4CAEA 4A33A 4B11A 4RI1A 2CNTA 2B4DA 4KORA 3EC4A 3G8WA 4F0YA 3UY5A 4KOXA 3R9FA 2J8RA 4HNXB 1YVOA 3S6HA 1M4GA 2VQYA 1Z4RA 1KUVA 2RC4A 2ARHA 5KTCA 1WK4A 4A30A 4II9A 4ZGYB 4A32A 4JXRA 4CAWA 5AG4A 4JLYA 4C2ZA 4C2XA 2R8VA 5FVJA 3FYNA 4MBUA 1L0CA 4PV6A 2PSWA 4R87A 2Z3PA 2P6GA 1CM0A 3DR6A 5BWAB 5HMNA 4JXQA 3NE7A 3TOAA 5J8FA 5F48A 3B8GA 3IWGA 2Q44A 4MFKA 2OZHA 3ZJ0A 3TO6A 2Q4YA 3PP9A 5GCNA 4A31A 4QC6A 4C7IA 4E8OA 2B58A 3TT2A 5EBVA 4MJ8A 3OWCA 1GHEA 1PU9A 1VHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R57 A;  1M4I A;  5DWN A;  2R7H A;  4QVT A;  2WPW A;  3VWD A;  4NSQ A;  4NXY A;  3R9E A;  2VI7 A;  4JWP A;  3R9G A;  1PUA A;  2ZW5 A;  3T9Y A;  2FXF A;  4R3K A;  4KLW A;  2EUI A;  2Z11 A;  3PZJ A;  4U9Y A;  2FCK A;  3GYA A;  1MJB A;  2KCW A;  4UBR A;  1Q2D A;  4DNC A;  1Z4E A;  5C88 A;  2AE6 A;  2JLM A;  4KLV A;  3EY5 A;  3W91 A;  3TFY A;  3TCV A;  2OZG A;  3BJ8 A;  1S7K A;  4HNY B;  5J8C A;  3QB8 A;  1I1D A;  2D4O A;  4BMH A;  4QB9 A;  1FY7 A;  4J3G A;  3ZZI A;  3EXN A;  1YX0 A;  4CAX A;  1Q2C A;  5F47 A;  2FE7 A;  1YLE A;  3TTH A;  1I12 A;  2C27 A;  1BOB A;  3MGD A;  4Y49 C;  2JDD A;  3N7Z A;  4ONU A;  3QAH A;  3EFA A;  1KUX A;  4XPL A;  2G0B A;  4M85 A;  4NCZ A;  1KUY A;  4ZBG A;  5H86 A;  4X5K A;  2Q04 A;  2PRB A;  2GIV A;  4H6U A;  3FXT A;  4IUS A;  4NEX A;  3C26 A;  3F5B A;  3SHP A;  3JVN A;  2ZW4 A;  1MJ9 A;  3FNC A;  2B5G B;  2O28 A;  3G3S A;  4IF5 A;  1U6M A;  4KOU A;  1Y7R A;  4KVO E;  2VZZ A;  1RO5 A;  4PSW A;  5IX3 A;  2BSW A;  1Q2Y A;  1TIQ A;  2HUZ A;  1B87 A;  1XF8 A;  4XNH C;  1S7N A;  5ISV A;  1LRZ A;  4KZT A;  2B4D B;  2X7B A;  1OZP A;  4OAE A;  3TE4 A;  2I79 A;  4B5P A;  1Y9K A;  3PGP A;  1QSN A;  2EVN A;  1J4J A;  4OLL A;  2JDC A;  2P6F A;  2Z0Z A;  4MY0 A;  1M1D A;  3SXN A;  2B3V A;  2OH1 A;  1XEB A;  2G3T A;  4L8A A;  2A4N A;  4CRY B;  2FSR A;  1YVK A;  4MHD A;  3R95 A;  4L89 A;  4MI4 A;  3R96 A;  3I3G A;  3T90 A;  2AJ6 A;  3P2H A;  3TOB A;  2OZU A;  1K4J A;  3I9S A;  2VEZ A;  2I00 A;  4CRZ B;  4AG7 A;  1S7F A;  1M4D A;  2BEI A;  2VXK A;  3DNS A;  4HNW B;  1QST A;  4E2A A;  2Q4V A;  5KTA A;  3V8I A;  2Y0M A;  2F5I A;  2FIW A;  3LD2 A;  4UA3 A;  1BO4 A;  4HKF A;  2PC1 A;  4H89 A;  4ORF A;  1QSR A;  4R9M A;  4YRH A;  2IL4 A;  2B3U A;  1M44 A;  4LUA A;  4QBJ A;  2BL1 A;  1CJW A;  5HH1 A;  2FT0 A;  2J8N A;  4U5Y A;  1IIC A;  4AG9 A;  3GKR A;  4JD6 A;  1S7L A;  1IYL A;  3FRM A;  5E96 A;  3F0A A;  3CXP A;  3VWE A;  1IYK A;  4XPD B;  3K9U A;  1VKC A;  2DXQ A;  3W6S A;  2CNS A;  3D2M A;  1SQH A;  2CNM A;  5JQ4 A;  2B5G A;  3RYO A;  2FS5 A;  5IV0 A;  2ZPA A;  3IGR A;  4R3L A;  1S3Z A;  1UFH A;  2QIR A;  5IB0 A;  1RXT A;  4KOT A;  4AVA A;  3FBU A;  4PK2 A;  3F8K A;  3GY9 A;  4FD7 A;  2Q7B A;  4H6Z A;  2ATR A;  1I21 A;  3R1K A;  4KOS A;  4NF1 A;  1XMT A;  3FIX A;  1NE9 A;  3SXO A;  1QSM A;  1S5K A;  1YGH A;  4AVB A;  2GE3 A;  4QUS A;  5JPH A;  4AB7 A;  4OAD A;  3S6F A;  3P2F A;  2VZY A;  2G3A A;  4M3S A;  3BLN A;  3W6X A;  4KOW A;  4CS0 B;  2QEC A;  1ON0 A;  2NMT A;  4R57 A;  1NSL A;  4XNH B;  5C82 A;  1WWZ A;  2REE A;  2REF A;  3CXS A;  2WPX A;  2R98 A;  2QML A;  3S6K A;  5CNP A;  4YGO A;  3DDD A;  4FD5 A;  1YRE A;  4CAV A;  2R1I A;  2B4B A;  2J8M A;  4LX9 A;  2P0W A;  4PSX A;  4KOV A;  2VBQ A;  1NMT A;  2JEV A;  3D3S A;  4PK3 A;  3H4Q A;  1MJA A;  4U9Z A;  4UWI A;  3S6G A;  1KZF A;  1S60 A;  2P6E A;  2PR1 A;  4B5P B;  2PQ8 A;  4MY3 A;  4F6A A;  5EC4 A;  3WR7 A;  3DR8 A;  3DSB A;  3EO4 A;  1MK4 A;  3KKW A;  2FIA A;  1Z9U A;  2ZW6 A;  2OB0 A;  2PR8 A;  3CXQ A;  5F46 A;  1XIX A;  3JUW A;  4FD4 A;  2K5T A;  3D2P A;  4B5O A;  5H84 A;  4KOY A;  2Q0Y A;  1IB1 E;  4KVX A;  2H5M A;  4KUA A;  4GS4 A;  2PDO A;  3E0K A;  4UWJ A;  5DWM A;  2GAN A;  3TO7 A;  2ZW7 A;  1YK3 A;  2BUE A;  1P4N A;  2FL4 A;  3TO9 A;  2CY2 A;  4I49 A;  3BJ7 A;  4E0A A;  2Z10 A;  4KVM E;  4XPD C;  4JJX A;  3FB3 A;  4KUB A;  4AVC A;  5KTD A;  2ZXV A;  4K30 A;  1Y9W A;  4EVY A;  1P0H A;  3D8P A;  4XPK A;  5F49 A;  4RS2 A;  4Y49 B;  2OU2 A;  2D4P A;  4YFJ A;  1YR0 A;  2HV2 A;  1N71 A;  5I0C A;  3LOD A;  1QSO A;  1XE4 A;  1IID A;  1B6B A;  4FD6 A;  2HQY A;  1V0C A;  4RI1 A;  2CNT A;  2B4D A;  4KOR A;  3EC4 A;  3G8W A;  4F0Y A;  3UY5 A;  4KOX A;  3R9F A;  2J8R A;  4HNX B;  1YVO A;  3S6H A;  1M4G A;  2VQY A;  1Z4R A;  1KUV A;  2RC4 A;  2ARH A;  5KTC A;  1WK4 A;  4II9 A;  4JXR A;  4CAW A;  4JLY A;  2R8V A;  5FVJ A;  3FYN A;  4MBU A;  1L0C A;  4PV6 A;  2PSW A;  4R87 A;  2P6G A;  1CM0 A;  3DR6 A;  5HMN A;  4JXQ A;  3NE7 A;  3TOA A;  5J8F A;  5F48 A;  3B8G A;  3IWG A;  2Q44 A;  2OZH A;  3ZJ0 A;  3TO6 A;  2Q4Y A;  3PP9 A;  5GCN A;  4QC6 A;  4E8O A;  2B58 A;  3TT2 A;  5EBV A;  4MJ8 A;  3OWC A;  1GHE A;  1PU9 A;  1VHS A; 
#chains in the Genus database with same CATH topology
 3V38 A;  3D7D A;  1R57 A;  1M4I A;  5DWN A;  1ZLI A;  4UEF A;  2R7H A;  4QVT A;  2WPW A;  3VWD A;  4A95 A;  2ZOG A;  4NSQ A;  1VHE A;  2DEA A;  4P6Y A;  4NXY A;  3R9E A;  2VI7 A;  5LYL A;  1CP6 A;  4JWP A;  3R9G A;  4LQ6 A;  1PUA A;  2ZW5 A;  3T9Y A;  3VAR A;  3FJU A;  4MRI A;  2FXF A;  1ZO0 A;  3CPA A;  1Y7E A;  3SJF A;  3WC5 A;  4R3K A;  4CGN A;  4Z65 A;  1IOI A;  3ISZ A;  4KLW A;  2EUI A;  3PRT A;  4IAV A;  2Z11 A;  1F57 A;  3PZJ A;  4U9Y A;  3NH8 A;  5LYI A;  3GLJ A;  1CX8 A;  4BBH A;  2FCK A;  4NGR A;  5D8N A;  5K8M A;  3GYA A;  1MJB A;  4PPZ A;  2KCW A;  4UBR A;  1Q2D A;  3LAC A;  2OOT A;  4DNC A;  2V8H A;  1XJO A;  1Z4E A;  5C88 A;  4CGO A;  2AE6 A;  3NH4 A;  2JLM A;  4KLV A;  4UCP A;  2CTC A;  3SI2 A;  3SJX A;  7CPA A;  3EY5 A;  4KSI A;  3RBU A;  3W91 A;  4B10 A;  3TFY A;  4MFZ A;  4M6H A;  3TCV A;  2OZG A;  3BJ8 A;  3GUX A;  5AG5 A;  2CTB A;  3LMS A;  1S7K A;  4UFV A;  4HNY B;  5J8C A;  4R8F A;  3QB8 A;  1I1D A;  3VH9 A;  2C6C A;  2D4O A;  3S9N A;  4BMH A;  4QB9 A;  4ZX8 A;  1FY7 A;  4J3G A;  4X3R A;  5LRK A;  4UFX A;  5JH9 A;  2PJ2 A;  3PEI A;  4YU9 A;  3ZZI A;  3EXN A;  1HDQ A;  1Z8W A;  1YX0 A;  4CAX A;  5J1Q A;  4B13 A;  1Q2C A;  3GB0 A;  5F47 A;  2FE7 A;  3SI1 A;  4O23 A;  1YLE A;  4TNU A;  3TTH A;  1I12 A;  1LAN A;  2C27 A;  1BOB A;  3MGD A;  2RB7 A;  4OC4 A;  1TKJ A;  2EK8 A;  4Y49 C;  2PJ7 A;  1AUG A;  2JDD A;  3N7Z A;  3PB7 X;  2V8D A;  2Q51 A;  3KAS A;  4ONU A;  3QAH A;  4F8Z A;  8CPA A;  4K3N A;  1LFW A;  1KUX A;  1OBR A;  3EFA A;  4NGS A;  3KR5 A;  1LCP A;  4XPL A;  4G1P A;  2G0B A;  2XEG A;  4M85 A;  4R7M A;  4NCZ A;  2GRE A;  5LYD A;  3PB6 X;  1KUY A;  3NA6 A;  4ZBG A;  4ZY0 A;  1ELL P;  4DUK A;  3PB9 X;  5H86 A;  3IIB A;  3IU1 A;  4X5K A;  3FF3 A;  2PJ0 A;  2Q04 A;  2PRB A;  4OKO A;  2GIV A;  4MFL A;  4H6U A;  5HVG A;  2NYQ A;  3FXT A;  4MHY A;  4B12 A;  1DE4 C;  2PJ4 A;  1R3N A;  4IUS A;  4NEX A;  5THW A;  1UWY A;  5CBM A;  1FNO A;  1XOV A;  1F2P A;  2O4H A;  3C26 A;  3F5B A;  3JVN A;  3SHP A;  4UCN A;  2ZW4 A;  1MJ9 A;  3FNC A;  2B5G B;  1A2Z A;  2O28 A;  3G3S A;  3IC1 A;  1M4L A;  4IF5 A;  1H8L A;  1U6M A;  4KOU A;  3NE8 A;  1Y7R A;  4KVO E;  3CZX A;  4LQG A;  4NGM A;  3JRU A;  1YME A;  2VZZ A;  1RO5 A;  3D7H A;  4PSW A;  5G20 A;  5IX3 A;  2BSW A;  1Q2Y A;  2QVP A;  1TIQ A;  5HVH A;  2HUZ A;  4OC2 A;  2YNE A;  1B87 A;  1XF8 A;  2PJ5 A;  3BXM A;  3FEE A;  1Y0R A;  4XNH C;  4P4D A;  4NGT A;  1S7N A;  2WZN A;  5ISV A;  1LRZ A;  4KZT A;  2B4D B;  3S9M A;  2X7B A;  1OZP A;  2DPS A;  4JZ0 A;  4OAE A;  1PCA A;  1Q7L A;  5HXD A;  3IFE A;  3K2K A;  2PVV A;  3TE4 A;  4OID A;  2I79 A;  4B5P A;  1Y9K A;  3PGP A;  2V8V A;  4TWE A;  5D29 A;  1QSN A;  4ZYQ A;  2EVN A;  3HLP A;  1BAV A;  1J4J A;  4OLL A;  2JDC A;  2P6F A;  1CG2 A;  2POK A;  2Z0Z A;  3B3W A;  5K8O A;  4MY0 A;  1M1D A;  4X8I A;  5LYF A;  3FH4 A;  3WT4 A;  4Q7A A;  2ANP A;  4OC5 A;  3SXN A;  6CPA A;  2OH1 A;  2AFX A;  2B3V A;  3KGQ A;  3A9L A;  3RAM A;  4A94 A;  1Z8T A;  2Z3K A;  1XEB A;  2Z3L A;  1TKH A;  2AFO A;  2G3T A;  1XRY A;  4L8A A;  1ZG8 A;  4MCS A;  1ZG9 A;  4R76 A;  2A4N A;  4CRY B;  4R6T A;  2FSR A;  4FWU A;  1YVK A;  1ARL A;  3MN8 A;  4MHD A;  3R95 A;  4L89 A;  4MCP A;  4KSA A;  4MI4 A;  3BHX A;  2Q43 A;  3L2N A;  3R96 A;  3I3G A;  1CPX A;  3T90 A;  2AJ6 A;  1LOK A;  2C6P A;  3P2H A;  2PJC A;  3TOB A;  3MRU A;  2OZU A;  1K4J A;  1LAM A;  3I9S A;  2VEZ A;  2GLJ A;  2I00 A;  2AFM A;  4CRZ B;  4AG7 A;  3NH5 A;  1S7F A;  1VIX A;  5G1Z A;  1M4D A;  2BEI A;  3D7F A;  2VXK A;  3DNS A;  3JTK A;  4HNW B;  1QST A;  4MCR A;  2PIY A;  5LRJ A;  4E2A A;  2Q4V A;  5KTA A;  3V8I A;  2Y0M A;  2EK9 A;  2F5I A;  2FIW A;  3LD2 A;  5AGE A;  4UA3 A;  4C68 A;  4MHN A;  4A2Z A;  5AG7 A;  4FUU A;  4MHZ A;  4P4I A;  1BO4 A;  2VL1 A;  4HKF A;  4MFQ A;  4Q38 A;  2ZEG A;  2YNC C;  2PC1 A;  1Z8L A;  3B3T A;  4H89 A;  4ORF A;  1QSR A;  2JBJ A;  4R9M A;  4YRH A;  4OIW A;  1EE3 P;  1X12 A;  2IL4 A;  2B3U A;  3KQX A;  4MHP A;  1M44 A;  4LUA A;  2ZEM A;  4QBJ A;  1KWM A;  2BL1 A;  1CJW A;  2IQ6 A;  2ZEO A;  1YQE A;  3B2Y A;  5HH1 A;  1CP7 A;  2HC9 A;  4MFP A;  4ONW A;  2FT0 A;  2J8N A;  1CBX A;  4U5Y A;  1IIC A;  4AG9 A;  1Y0Y A;  1YW4 A;  3GKR A;  2ZOF A;  4NGQ A;  4JD6 A;  4X2T A;  1S7L A;  1IYL A;  3IWE A;  1IGB A;  2QYV A;  1QQ9 A;  3FRM A;  3K9T A;  2PJ9 A;  3QAY A;  5E96 A;  4UCM A;  3F0A A;  1NSA A;  3CXP A;  4UEZ A;  2PJ6 A;  1IYK A;  4XPD B;  3VWE A;  3K9U A;  1VKC A;  2JEW A;  3B7I A;  4P4B A;  2DXQ A;  3H8F A;  2CNS A;  4H2K A;  3W6S A;  5F09 A;  3D2M A;  4GXH A;  1SQH A;  2CNM A;  5LRG A;  2B5G A;  5JQ4 A;  4ZX9 A;  4Q36 A;  3RYO A;  2FS5 A;  3RZA A;  5JM6 A;  1QMU A;  2PVW A;  3TC8 A;  5IV0 A;  2ZPA A;  3IGR A;  4M6G A;  1PYT B;  2XEJ A;  3KI9 A;  4R3L A;  1S3Z A;  1UFH A;  2QIR A;  4BIN A;  5IB0 A;  2PJ3 A;  1RXT A;  1F2O A;  4KOT A;  4AVA A;  3FBU A;  4C2Y A;  2ZEH A;  3WC6 A;  2JBK A;  4PXE A;  2IJZ A;  1YW6 A;  2EWB A;  4PK2 A;  3F8K A;  3WAB A;  3CT9 A;  3B35 A;  1XMB A;  2EBJ A;  2XEI A;  3D68 A;  3KR4 A;  2ZEP A;  3GY9 A;  2Z3N A;  4FD7 A;  2PE3 A;  3CDX A;  2YGW A;  4H6Z A;  3KHX A;  2Q7B A;  2ATR A;  1I21 A;  3R1K A;  2NSM A;  4KOS A;  4NF1 A;  4DYO A;  4F9V A;  4P4F A;  4NGP A;  1XMT A;  4RUH A;  4W9Y A;  1AMP A;  3FIX A;  1BPN A;  1NE9 A;  3SXO A;  1QSM A;  3KHZ A;  3FMC A;  2BOA A;  4B14 A;  1S5K A;  1YGH A;  4CYN A;  4AVB A;  5IB9 A;  2GE3 A;  1HEE A;  4QUS A;  4BD9 A;  5JPH A;  4M6I A;  4MCQ A;  4OAD A;  4AB7 A;  3S6F A;  4NFR A;  4CPA A;  2PJA A;  3P2F A;  3B3C A;  3PFE A;  3H5Z A;  2VZY A;  4ZY2 A;  2G3A A;  3TX8 A;  4OME A;  3PB8 X;  4M3S A;  1LAP A;  3V7Z A;  3BLN A;  3W6X A;  4KOW A;  4C7H A;  4CS0 B;  4CYP A;  5ELY A;  2DPT A;  2QEC A;  1AYE A;  4OC1 A;  2O53 A;  3B3V A;  3CPX A;  1ON0 A;  2NMT A;  4R57 A;  2PJ8 A;  1NSL A;  4XNH B;  3LWU A;  2ZEL A;  1YSJ A;  5C82 A;  4CGP A;  1WWZ A;  1YLO A;  2REE A;  2REF A;  3CXS A;  2WPX A;  2ABZ A;  2QML A;  2R98 A;  3S6K A;  5CNP A;  1ZG7 A;  4YGO A;  5A28 A;  2PJ1 A;  1FT7 A;  3DDD A;  4FD5 A;  4IK2 A;  5HVF A;  1VGY A;  1Z2L A;  1YRE A;  2YND A;  2R1I A;  4A39 A;  4CAV A;  4EWT A;  3PFO A;  4F0X A;  4NJR A;  3D7G A;  4CGM A;  4JYW A;  2B4B A;  1TXR A;  3BI0 A;  5DS0 A;  2J8M A;  4LX9 A;  2P0W A;  4PSX A;  3FEC A;  1JWQ A;  4OC0 A;  4GM5 A;  5K8N A;  4KOV A;  2VBQ A;  1NMT A;  2JEV A;  3D3S A;  3DGV A;  1GYT A;  2CXA A;  4PK3 A;  3VAT A;  4HPS A;  2YNC A;  1ARM A;  3H4Q A;  3H8G A;  3D66 A;  1MJA A;  4U9Z A;  4UWI A;  3S6G A;  1KZF A;  3PBE A;  4ZY1 A;  1S60 A;  2P6E A;  2PR1 A;  2ZEN A;  2PQ8 A;  4B5P B;  4MY3 A;  2FVG A;  2G9D A;  2PCU A;  3FX6 A;  2V77 A;  4CAF A;  5EC4 A;  4F6A A;  3WR7 A;  3DR8 A;  4CYQ A;  3DSB A;  3RO0 A;  3EO4 A;  1MK4 A;  3KKW A;  3D4U A;  2FIA A;  1Z9U A;  4WJB A;  2ZW6 A;  2OB0 A;  2PR8 A;  1Z5R A;  2Z3O A;  4UEE A;  5AG6 A;  4P45 A;  3CXQ A;  1ZLH A;  5F46 A;  1XIX A;  3JUW A;  2IMO A;  4FD4 A;  2K5T A;  3D2P A;  4CGL A;  4B5O A;  5H84 A;  4KOY A;  2Q0Y A;  1IB1 E;  3D67 A;  3IU2 A;  4KVX A;  2H5M A;  5G21 A;  2Z3M A;  4KUA A;  1BPM A;  3N5F A;  3KL9 A;  4GS4 A;  3WC7 A;  2WYR A;  2PDO A;  3E0K A;  1TF9 A;  3PBB A;  1XBU A;  4UWJ A;  2GAN A;  5DWM A;  3TO7 A;  5JGF A;  2ZW7 A;  4CYO A;  1YK3 A;  2C6G A;  4EME A;  1IY7 A;  2F8H A;  4A37 A;  2BUE A;  1P4N A;  2FL4 A;  3TO9 A;  2CY2 A;  1CPS A;  3DLJ A;  4KS9 A;  4I49 A;  2RFH A;  4YWY A;  1IOF A;  5A27 A;  4MXU A;  2Q7S A;  3BJ7 A;  3S9L A;  4E0A A;  2WSA A;  2Z10 A;  4KVM E;  2EO8 A;  4XPD C;  3KQZ A;  2DF5 A;  4JJX A;  3FB3 A;  2OR4 A;  4FAI A;  2PRQ A;  4KUB A;  4AVC A;  5KTD A;  2ZXV A;  4PXC A;  1VHO A;  4K30 A;  1Y9W A;  2C1C A;  2AFZ A;  2J9A A;  4EVY A;  1XFO A;  2PIZ A;  1P0H A;  3D8P A;  3KZW A;  4RN7 A;  4XPK A;  3QNV A;  5F49 A;  3NFZ A;  5G22 A;  2WUU A;  4RS2 A;  4Y49 B;  2OU2 A;  2D4P A;  4MFJ A;  3H8E A;  3B3S A;  3GIU A;  1YR0 A;  3SJG A;  4YFJ A;  2HV2 A;  4UIA A;  1N71 A;  2GU2 A;  4MMO A;  5I0C A;  3ISX A;  3LOD A;  4OP4 A;  4KSF A;  1QSO A;  1XE4 A;  2XEF A;  2CF4 A;  1IID A;  4UFW A;  4AXV A;  5I4M A;  1B6B A;  4FD6 A;  2HQY A;  1V0C A;  5CPA A;  4CAE A;  2F7V A;  4DJL A;  4A33 A;  4B11 A;  4RI1 A;  2CNT A;  2B4D A;  2BCO A;  1HDU A;  3IWW A;  4KOR A;  1RTQ A;  3EC4 A;  4FBE A;  3I1U A;  2CIJ A;  3G8W A;  3IEH A;  4F0Y A;  3UY5 A;  2Q4Z A;  4PQA A;  1BLL E;  4KOX A;  1TF8 A;  1ELM P;  3T8W A;  3R9F A;  2J8R A;  4HNX B;  1YVO A;  3S6H A;  4NGN A;  1Z8X A;  3HUV A;  4P4E A;  1M4G A;  2VQY A;  1Z4R A;  1KUV A;  2BO9 A;  2ARH A;  2GFQ A;  2RC4 A;  2ZEE A;  5KTC A;  1WK4 A;  2HB6 A;  3RNZ A;  4A30 A;  2I3C A;  4II9 A;  4ZGY B;  2ODF A;  2V8G A;  2ZEF A;  4A38 A;  2AFU A;  4A32 A;  4P10 A;  4IHM A;  3FED A;  4JXR A;  4CAW A;  5AG4 A;  4WWV A;  3SI0 A;  1TKF A;  1X10 A;  4JLY A;  4C2Z A;  4EFD A;  3PB4 X;  4C2X A;  2ZED A;  4NJQ A;  2R8V A;  3BI1 A;  5FVJ A;  3FYN A;  4MBU A;  1L0C A;  4PXD A;  4PV6 A;  2PSW A;  4OC3 A;  3FVL A;  2Z3P A;  4R87 A;  2P6G A;  1CM0 A;  2GLF A;  3DR6 A;  4UIB A;  1JQG A;  4JXQ A;  5BWA B;  5HMN A;  3NE7 A;  4P4J A;  3SJE A;  3TOA A;  4ZI6 A;  5J8F A;  5K8P A;  3IO1 A;  3B8G A;  4P44 A;  5EMI A;  5F48 A;  2AFW A;  1IU8 A;  3IWG A;  2QJ8 A;  1DTD A;  2Q44 A;  2OZH A;  4MFK A;  3ZJ0 A;  4B6Z A;  4F9U A;  2PJB A;  4UF4 A;  3TO6 A;  2Q4Y A;  3PP9 A;  3IJ3 A;  5GCN A;  4A31 A;  4QC6 A;  4C7I A;  4E8O A;  2B58 A;  2AFS A;  3TT2 A;  5EBV A;  1R43 A;  4MJ8 A;  4PXB A;  3OWC A;  1GHE A;  1PU9 A;  1VHS A; 
#chains in the Genus database with same CATH homology
 1R57 A;  1M4I A;  5DWN A;  2R7H A;  4QVT A;  2WPW A;  3VWD A;  4A95 A;  4NSQ A;  4NXY A;  3R9E A;  2VI7 A;  4JWP A;  3R9G A;  1PUA A;  2ZW5 A;  3T9Y A;  2FXF A;  1ZO0 A;  4CGN A;  4R3K A;  4KLW A;  2EUI A;  2Z11 A;  3PZJ A;  4U9Y A;  4BBH A;  2FCK A;  3GYA A;  1MJB A;  2KCW A;  4UBR A;  1Q2D A;  4DNC A;  1Z4E A;  5C88 A;  4CGO A;  2AE6 A;  2JLM A;  4KLV A;  4UCP A;  3EY5 A;  3W91 A;  3TFY A;  4B10 A;  4MFZ A;  3TCV A;  2OZG A;  3BJ8 A;  5AG5 A;  1S7K A;  4UFV A;  4HNY B;  5J8C A;  3QB8 A;  1I1D A;  2D4O A;  4BMH A;  4QB9 A;  1FY7 A;  4J3G A;  4UFX A;  3ZZI A;  3EXN A;  1YX0 A;  4CAX A;  4B13 A;  1Q2C A;  5F47 A;  2FE7 A;  1YLE A;  3TTH A;  1I12 A;  2C27 A;  1BOB A;  3MGD A;  4Y49 C;  2JDD A;  3N7Z A;  4ONU A;  3QAH A;  3EFA A;  1KUX A;  4XPL A;  2G0B A;  4M85 A;  4NCZ A;  1KUY A;  4ZBG A;  5H86 A;  3IU1 A;  4X5K A;  2Q04 A;  2PRB A;  2GIV A;  4MFL A;  4H6U A;  3FXT A;  4B12 A;  4IUS A;  4NEX A;  3C26 A;  3F5B A;  3SHP A;  3JVN A;  4UCN A;  2ZW4 A;  1MJ9 A;  3FNC A;  2B5G B;  2O28 A;  3G3S A;  4IF5 A;  1U6M A;  4KOU A;  1Y7R A;  4KVO E;  2VZZ A;  1RO5 A;  4PSW A;  5G20 A;  5IX3 A;  2BSW A;  1Q2Y A;  1TIQ A;  2HUZ A;  2YNE A;  1B87 A;  1XF8 A;  4XNH C;  1S7N A;  5ISV A;  1LRZ A;  4KZT A;  2B4D B;  2X7B A;  1OZP A;  2DPS A;  4OAE A;  3TE4 A;  2I79 A;  4B5P A;  1Y9K A;  3PGP A;  1QSN A;  2EVN A;  1J4J A;  4OLL A;  2JDC A;  2P6F A;  2Z0Z A;  4MY0 A;  1M1D A;  3SXN A;  2B3V A;  2OH1 A;  3A9L A;  2Z3K A;  1XEB A;  2Z3L A;  2G3T A;  4L8A A;  2A4N A;  4CRY B;  2FSR A;  1YVK A;  4MHD A;  3R95 A;  4L89 A;  4KSA A;  4MI4 A;  3R96 A;  3I3G A;  3T90 A;  2AJ6 A;  3P2H A;  3TOB A;  2OZU A;  1K4J A;  3I9S A;  2VEZ A;  2I00 A;  4CRZ B;  4AG7 A;  1S7F A;  5G1Z A;  1M4D A;  2BEI A;  4HNW B;  2VXK A;  3DNS A;  3JTK A;  1QST A;  4E2A A;  2Q4V A;  5KTA A;  3V8I A;  2Y0M A;  2F5I A;  2FIW A;  3LD2 A;  5AGE A;  4UA3 A;  4C68 A;  4A2Z A;  5AG7 A;  1BO4 A;  4HKF A;  4MFQ A;  4Q38 A;  2YNC C;  2PC1 A;  4H89 A;  4ORF A;  1QSR A;  4R9M A;  4YRH A;  2IL4 A;  2B3U A;  1M44 A;  4LUA A;  4QBJ A;  2BL1 A;  1CJW A;  5HH1 A;  4MFP A;  2FT0 A;  2J8N A;  4U5Y A;  1IIC A;  4AG9 A;  3GKR A;  4JD6 A;  1S7L A;  1IYL A;  3IWE A;  3FRM A;  5E96 A;  4UCM A;  3F0A A;  3CXP A;  3VWE A;  1IYK A;  4XPD B;  3K9U A;  1VKC A;  2DXQ A;  3W6S A;  2CNS A;  3D2M A;  1SQH A;  2CNM A;  5JQ4 A;  2B5G A;  4Q36 A;  3RYO A;  2FS5 A;  5IV0 A;  2ZPA A;  3IGR A;  4R3L A;  1S3Z A;  1UFH A;  2QIR A;  5IB0 A;  1RXT A;  4KOT A;  4AVA A;  3FBU A;  4C2Y A;  4PK2 A;  3F8K A;  3GY9 A;  4FD7 A;  2Z3N A;  2Q7B A;  2YGW A;  4H6Z A;  2ATR A;  1I21 A;  3R1K A;  4KOS A;  4NF1 A;  1XMT A;  3FIX A;  1NE9 A;  3SXO A;  1QSM A;  4B14 A;  1S5K A;  1YGH A;  4CYN A;  4AVB A;  2GE3 A;  4QUS A;  5JPH A;  4AB7 A;  4OAD A;  3S6F A;  3P2F A;  3H5Z A;  2VZY A;  2G3A A;  4M3S A;  3BLN A;  3W6X A;  4KOW A;  4C7H A;  4CS0 B;  4CYP A;  2DPT A;  2QEC A;  1ON0 A;  2NMT A;  4R57 A;  1NSL A;  4XNH B;  5C82 A;  4CGP A;  1WWZ A;  2REE A;  2REF A;  3CXS A;  2WPX A;  2R98 A;  2QML A;  3S6K A;  5CNP A;  4YGO A;  5A28 A;  3DDD A;  4FD5 A;  2YND A;  1YRE A;  4CAV A;  2R1I A;  4F0X A;  4CGM A;  2B4B A;  2J8M A;  4LX9 A;  2P0W A;  4PSX A;  4KOV A;  2VBQ A;  1NMT A;  2JEV A;  3D3S A;  2CXA A;  4PK3 A;  2YNC A;  3H4Q A;  1MJA A;  4U9Z A;  4UWI A;  3S6G A;  1KZF A;  1S60 A;  2P6E A;  2PR1 A;  4B5P B;  2PQ8 A;  4MY3 A;  4CAF A;  4F6A A;  5EC4 A;  3WR7 A;  3DR8 A;  4CYQ A;  3DSB A;  3EO4 A;  1MK4 A;  3KKW A;  2FIA A;  1Z9U A;  2ZW6 A;  2OB0 A;  2PR8 A;  2Z3O A;  5AG6 A;  3CXQ A;  5F46 A;  1XIX A;  3JUW A;  4FD4 A;  2K5T A;  3D2P A;  4CGL A;  4B5O A;  5H84 A;  4KOY A;  2Q0Y A;  1IB1 E;  3IU2 A;  4KVX A;  2H5M A;  5G21 A;  2Z3M A;  4KUA A;  4GS4 A;  2PDO A;  3E0K A;  4UWJ A;  5DWM A;  2GAN A;  3TO7 A;  2ZW7 A;  4CYO A;  1YK3 A;  2BUE A;  1P4N A;  2FL4 A;  3TO9 A;  2CY2 A;  4KS9 A;  4I49 A;  5A27 A;  3BJ7 A;  4E0A A;  2WSA A;  2Z10 A;  4KVM E;  4XPD C;  4JJX A;  3FB3 A;  4KUB A;  4AVC A;  5KTD A;  2ZXV A;  4K30 A;  1Y9W A;  4EVY A;  1P0H A;  3D8P A;  4XPK A;  5F49 A;  5G22 A;  2WUU A;  4RS2 A;  4Y49 B;  2OU2 A;  2D4P A;  4MFJ A;  4YFJ A;  1YR0 A;  2HV2 A;  1N71 A;  5I0C A;  3LOD A;  4KSF A;  1QSO A;  1XE4 A;  4UFW A;  1IID A;  1B6B A;  4FD6 A;  2HQY A;  1V0C A;  4CAE A;  4A33 A;  4B11 A;  4RI1 A;  2CNT A;  2B4D A;  4KOR A;  3EC4 A;  3G8W A;  4F0Y A;  3UY5 A;  4KOX A;  3R9F A;  2J8R A;  4HNX B;  1YVO A;  3S6H A;  1M4G A;  2VQY A;  1Z4R A;  1KUV A;  2RC4 A;  2ARH A;  5KTC A;  1WK4 A;  4A30 A;  4II9 A;  4ZGY B;  4A32 A;  4JXR A;  4CAW A;  5AG4 A;  4JLY A;  4C2Z A;  4C2X A;  2R8V A;  5FVJ A;  3FYN A;  4MBU A;  1L0C A;  4PV6 A;  2PSW A;  4R87 A;  2Z3P A;  2P6G A;  1CM0 A;  3DR6 A;  5BWA B;  5HMN A;  4JXQ A;  3NE7 A;  3TOA A;  5J8F A;  5F48 A;  3B8G A;  3IWG A;  2Q44 A;  4MFK A;  2OZH A;  3ZJ0 A;  3TO6 A;  2Q4Y A;  3PP9 A;  5GCN A;  4A31 A;  4QC6 A;  4C7I A;  4E8O A;  2B58 A;  3TT2 A;  5EBV A;  4MJ8 A;  3OWC A;  1GHE A;  1PU9 A;  1VHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...