2IL4A

Crystal structure of at1g77540-coenzyme a complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
PKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein At1g77540
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 25
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2il4A00
1RXTA 2KCWA 1QSMA 2EUIA 2FXFA 4AG7A 2J8MA 3FXTA 2P6FA 4GS4A 2GE3A 2FL4A 2B3VA 1YK3A 2G3AA 4HKFA 1XIXA 4LX9A 2NMTA 3OWCA 5C82A 2ATRA 4H89A 1SQHA 3F0AA 3IGRA 4CS0B 4IUSA 4KVME 3VWDA 1KUYA 1QSRA 2R98A 4JWPA 3DR6A 3TOAA 2G3TA 2REFA 3EXNA 3GY9A 4R87A 1K4JA 2WPXA 3D8PA 1Y9WA 4NCZA 1I21A 1I1DA 4MBUA 3DSBA 4MI4A 1B87A 2BL1A 3R95A 4AVAA 2JDDA 4CAVA 2D4PA 1MK4A 3TFYA 2FIAA 1XMTA 2GANA 4RS2A 1Q2YA 2Q4YA 2B4DB 2FCKA 3FYNA 5F47A 1M4GA 2J8NA 2QIRA 1S7LA 3RYOA 2OH1A 5J8CA 2DXQA 3S6KA 1BO4A 2BSWA 2Z11A 4H6ZA 2FSRA 3TT2A 4EVYA 1IIDA 3G8WA 4AVCA 2ZXVA 4OLLA 3PGPA 4ONUA 2VZYA 3SXOA 3C26A 2Q0YA 3QB8A 3H4QA 3SXNA 3D2PA 3FRMA 2B58A 2VXKA 3R9FA 2G0BA 2P6EA 1U6MA 1KZFA 2PQ8A 2ZW6A 3BJ8A 1YLEA 3IWGA 4B5OA 4HNWB 4NF1A 4CAXA 4MY0A 4QBJA 3LODA 1P4NA 4KZTA 4QB9A 5J8FA 2VI7A 3UY5A 4QVTA 3TO9A 1S7FA 2EVNA 3DR8A 4L89A 3B8GA 1Z4EA 3KKWA 4MHDA 1YVKA 4J3GA 4KUBA 3S6FA 2ARHA 2RC4A 5C88A 4RI1A 4K30A 1TIQA 4R3LA 5JPHA 2O28A 1MJBA 4PSXA 5JQ4A 3TO6A 4UWIA 4AG9A 2Q44A 2B4DA 4UWJA 5DWMA 2JDCA 1Q2DA 5FVJA 3W91A 4U9YA 5H84A 4FD7A 4QC6A 4YRHA 3WR7A 1XEBA 4OADA 4XPKA 4KOTA 4CRYB 2FT0A 1S7NA 5F48A 5KTCA 4QUSA 3VWEA 3FBUA 3P2FA 2HUZA 2ZW4A 1FY7A 5F49A 2I00A 4NEXA 3BLNA 4M3SA 1S60A 2FS5A 2Q7BA 1WK4A 2REEA 1BOBA 1CM0A 4KVOE 1IICA 2CNSA 4H6UA 4AB7A 4U9ZA 4XPLA 4AVBA 2ZPAA 1ON0A 1YREA 2GIVA 4JJXA 2B4BA 2FE7A 1KUVA 3D3SA 4UBRA 4UA3A 2BEIA 4MY3A 2VBQA 4E0AA 1CJWA 3QAHA 2ZW7A 2K5TA 5KTAA 1LRZA 3TO7A 1S5KA 3PZJA 2A4NA 3LD2A 4FD6A 1M1DA 2J8RA 5KTDA 1M44A 3TCVA 1M4IA 4B5PB 3JVNA 4KOSA 4KUAA 5E96A 2B5GB 2VZZA 4JLYA 3EY5A 2OZHA 1YVOA 4YGOA 1L0CA 1NSLA 2I79A 3I3GA 4KOVA 1QSTA 2Z0ZA 4KVXA 2PRBA 4II9A 1YGHA 1M4DA 4XPDB 3R1KA 4CRZB 3D2MA 1MJAA 2IL4A 3FIXA 2OZGA 3EFAA 5HH1A 4R57A 5DWNA 3CXQA 2JEVA 1GHEA 2H5MA 4IF5A 5IB0A 1RO5A 4M85A 4PSWA 1MJ9A 4MJ8A 2D4OA 1IYKA 3F5BA 1PUAA 2CNTA 3W6XA 2R8VA 3R9EA 3TE4A 1Z4RA 5EC4A 4ORFA 2JLMA 4HNXB 2VQYA 4PK2A 2VEZA 3G3SA 1S7KA 1OZPA 2HQYA 3W6SA 1PU9A 3CXPA 4X5KA 2P6GA 3DDDA 1QSOA 1IB1E 2PR1A 3GKRA 4PV6A 2OB0A 3S6GA 4KOWA 5ISVA 4B5PA 1NMTA 1V0CA 2PR8A 2B5GA 1B6BA 2P0WA 3S6HA 1KUXA 2AE6A 4R3KA 2HV2A 2Q04A 4ZBGA 4JD6A 4U5YA 2AJ6A 4KOXA 2ZW5A 4KOUA 1UFHA 1XF8A 4L8AA 5EBVA 3E0KA 4XPDC 1VHSA 3FB3A 4E2AA 5H86A 1VKCA 3K9UA 2PDOA 3T9YA 3V8IA 2Z10A 3T90A 1IYLA 4YFJA 2CNMA 1Z9UA 3MGDA 1S3ZA 2FIWA 5CNPA 2B3UA 3TOBA 3ZJ0A 1N71A 4XNHC 3ZZIA 5F46A 5HMNA 4Y49C 3NE7A 4KLWA 3FNCA 4NSQA 2OU2A 3SHPA 2PC1A 3BJ7A 4PK3A 3CXSA 5IV0A 4NXYA 4JXRA 1R57A 2R7HA 2CY2A 4CAWA 4I49A 1NE9A 3F8KA 2X7BA 1P0HA 1Y7RA 2F5IA 2Y0MA 3JUWA 4FD4A 4KOYA 2C27A 2OZUA 1WWZA 2Q4VA 3R96A 1I12A 1Y9KA 3GYAA 4E8OA 4BMHA 2PSWA 3I9SA 5IX3A 4FD5A 3EC4A 4KORA 4R9MA 1QSNA 3N7ZA 2QMLA 3R9GA 3DNSA 3P2HA 4XNHB 4DNCA 5I0CA 2R1IA 1Q2CA 4Y49B 4KLVA 3TTHA 4JXQA 2WPWA 3PP9A 1XE4A 4OAEA 2BUEA 5GCNA 1J4JA 3EO4A 2QECA 4LUAA 1YR0A 4F0YA 4F6AA 1YX0A 4HNYB
chains in the Genus database with same CATH superfamily
3WT4A 1RXTA 2KCWA 4YWYA 1QSMA 2EUIA 2FXFA 2GLJA 2IMOA 4AG7A 4C68A 1LFWA 1ZG9A 2J8MA 3FXTA 2HC9A 2WSAA 3SJFA 1YW6A 2P6FA 2V8DA 3PB4X 3KQXA 1HDUA 1RTQA 4EFDA 1BAVA 3K2KA 2GE3A 4GS4A 4UF4A 2WZNA 4X8IA 4MRIA 5K8OA 2GLFA 4OC2A 2RB7A 5D8NA 5DS0A 3D7DA 2FL4A 4JYWA 3HLPA 2B3VA 2C6PA 2Q4ZA 4UEEA 3FEDA 2RFHA 1YK3A 4P4BA 2ZOGA 2G3AA 4HKFA 1XIXA 4LX9A 4OC3A 2NMTA 2V8HA 1LAMA 3OWCA 4UEZA 1ELMP 4M6HA 4F0XA 5C82A 2ATRA 4H89A 3WC6A 1SQHA 2V77A 3F0AA 3IGRA 4CS0B 2PIZA 4IUSA 4KVME 3VWDA 1KUYA 2O4HA 1HDQA 1QSRA 2R98A 3IEHA 4JWPA 1CG2A 3DR6A 3D68A 3TOAA 1ARLA 5A27A 4K3NA 2G3TA 3VH9A 2F8HA 2REFA 3EXNA 2PJ6A 3GY9A 4PXEA 3FJUA 4R87A 3H8EA 1CPSA 1K4JA 2Z3MA 2PJ0A 2WPXA 3D8PA 1Y9WA 4NCZA 1I21A 4CYPA 2IQ6A 2XEJA 2OOTA 1XBUA 5ELYA 1I1DA 4CYNA 4MBUA 3DSBA 3VATA 4DYOA 4MI4A 1B87A 2BL1A 2PJ4A 2J9AA 4NFRA 5AG6A 4G1PA 3RO0A 3R95A 4GM5A 1EE3P 3WABA 2JDDA 4AVAA 4CAVA 2D4PA 1QQ9A 1MK4A 3SI0A 3TFYA 3CZXA 2FIAA 2DPTA 1XMTA 2GANA 2YGWA 3FH4A 4RS2A 5LYLA 1Q2YA 2Q4YA 3B7IA 2B4DB 3KL9A 4C7IA 3B3SA 2FCKA 3FYNA 5F47A 1M4GA 5LYDA 2J8NA 2QIRA 1S7LA 3T8WA 3RYOA 4IK2A 1VGYA 5J1QA 1IU8A 2OH1A 3IU2A 4MFJA 5AG4A 2DXQA 2V8GA 3S6KA 5J8CA 1BO4A 2BSWA 2Z11A 2Z3KA 4H6ZA 4B11A 4CYQA 4ZY1A 4NGQA 2ZEMA 2FSRA 4NGTA 3TT2A 1ELLP 3BXMA 1IIDA 3G8WA 4AVCA 4EVYA 2ZXVA 5CBMA 4M6IA 3D7HA 2YNDA 3KASA 4OLLA 2PIYA 3PGPA 4ONUA 2VZYA 5G20A 3H8FA 3SXOA 3NH8A 3C26A 2Q0YA 5CPAA 3BHXA 3QB8A 2C1CA 4OP4A 4MMOA 5JH9A 3PFEA 4BBHA 2ZENA 3H4QA 4B13A 3SXNA 3D7FA 5EMIA 3D2PA 3FRMA 4A39A 2B58A 4HPSA 2VXKA 4P45A 1TKHA 3QNVA 5G1ZA 3R9FA 2G0BA 1JWQA 2P6EA 4LQGA 4W9YA 3B35A 3RAMA 1U6MA 1KZFA 3IC1A 2PQ8A 2ZW6A 3BJ8A 4OC5A 2ZEPA 1YLEA 3D67A 4A30A 3IWGA 2Z3OA 4B5OA 3FEEA 4HNWB 4NF1A 3QAYA 3KZWA 4B12A 4CAXA 2CIJA 4MY0A 4QBJA 3LODA 1Z8XA 3TC8A 2PE3A 5K8NA 4CYOA 1P4NA 4KZTA 4QB9A 5D29A 5J8FA 2VI7A 2YNEA 5AG5A 3UY5A 1AMPA 1IOFA 1LANA 1S7FA 4QVTA 3TO9A 2EVNA 2F7VA 3DR8A 4L89A 4Q36A 3JRUA 4NGSA 2O53A 3B8GA 3NA6A 1Z8TA 2GREA 3PBBA 1Z4EA 3KKWA 3KGQA 4MFQA 4MHDA 3VARA 1NSAA 1YVKA 4BINA 3NE8A 3IWEA 3LMSA 2PVWA 4J3GA 4KUBA 3S6FA 1ZO0A 2ARHA 2RC4A 4P4JA 4C2ZA 5G21A 5C88A 4RI1A 4K30A 1VIXA 4A38A 2ZEOA 1TIQA 4R3LA 3FF3A 3LWUA 5JPHA 2AFWA 3FVLA 2O28A 1MJBA 2OR4A 2Q51A 4PSXA 4X2TA 4OC1A 8CPAA 5JQ4A 3TO6A 4UWIA 4AG9A 2AFXA 2B4DA 2Q44A 1ZG8A 2PCUA 4UWJA 5DWMA 2JDCA 3KHZA 1Q2DA 5FVJA 3KI9A 4U9YA 4P4IA 1FNOA 4MHZA 3W91A 3BI0A 5H84A 5G22A 3GLJA 4FD7A 4QC6A 4YRHA 1HEEA 3GIUA 3WR7A 1XEBA 4OADA 4XPKA 3RNZA 2AFZA 4KOTA 4CRYB 2FT0A 3FX6A 5KTDA 1S7NA 5F48A 5KTCA 2PJ9A 4QUSA 3PRTA 4MCQA 3VWEA 4CGNA 4F8ZA 2G9DA 4A37A 3SJGA 3S9LA 3FBUA 3WC7A 3P2FA 4KSIA 2HUZA 2WYRA 2ZW4A 1FY7A 5F49A 2I00A 4NEXA 4MFKA 2PJBA 3BLNA 2VL1A 4M3SA 4OIDA 2AFOA 3FECA 4UCNA 3SI2A 3D7GA 1S60A 4PXDA 2FS5A 1M4LA 2Q7BA 4ONWA 1WK4A 2REEA 1BOBA 1CM0A 4PPZA 4KVOE 4RN7A 1IICA 2CNSA 4H6UA 4AB7A 5LRKA 4U9ZA 1FT7A 4XPLA 1QMUA 4AVBA 2PJ1A 1AUGA 2ZPAA 3IIBA 1ON0A 4TNUA 1LCPA 5AG7A 1YREA 2GIVA 4A33A 3DGVA 4IAVA 1GYTA 4C7HA 4JZ0A 1XOVA 2ZEGA 1IY7A 3SJEA 4JJXA 4KS9A 4R76A 5THWA 2B4BA 2FE7A 1KUVA 3D3SA 4UBRA 1DTDA 2CTBA 3HUVA 4UA3A 2BEIA 4MY3A 2VBQA 4E0AA 1CJWA 3QAHA 1DE4C 2ZW7A 4EWTA 4UIBA 4ZY0A 2K5TA 3LACA 5KTAA 3H5ZA 3B3TA 3PFOA 1LRZA 1Z8LA 3TO7A 3B2YA 5HVFA 1S5KA 3PZJA 2A4NA 3LD2A 4FD6A 4ZY2A 4ZI6A 3GB0A 4GXHA 4MCPA 1M1DA 2Z3NA 4WJBA 5IB9A 4B10A 2J8RA 3BI1A 1M44A 3TCVA 1M4IA 2AFUA 4B5PB 3JVNA 4KOSA 4KUAA 5E96A 4F9UA 4FBEA 2PJ7A 3PB6X 4MXUA 2B5GB 2VZZA 4JLYA 3EY5A 2OZHA 2EK8A 4H2KA 4MHNA 3V7ZA 1XFOA 2BO9A 1YVOA 4YGOA 1LAPA 1L0CA 5K8MA 1NSLA 3NH5A 3PEIA 2I79A 3GUXA 1Z5RA 3I3GA 4KOVA 4NGNA 1X10A 1QSTA 2QJ8A 1TXRA 2Z0ZA 4KVXA 3S9NA 2PRBA 4II9A 2YNCC 3FMCA 4M6GA 1YGHA 1M4DA 4XPDB 3R1KA 4CRZB 3D2MA 3DLJA 1MJAA 4OC0A 1IGBA 2IL4A 3FIXA 4Q38A 4F9VA 4FAIA 1TKFA 2OZGA 2I3CA 3EFAA 4PXBA 4R57A 5HH1A 1VHEA 5LRGA 4CAEA 2NSMA 5DWNA 4MCSA 1YMEA 3CXQA 2JEVA 2JBJA 1GHEA 1XRYA 4B6ZA 4R7MA 4ZX8A 4IHMA 2H5MA 5LRJA 4IF5A 5F09A 5IB0A 2EWBA 1RO5A 4M85A 2GU2A 3PB9X 4PSWA 1MJ9A 4MJ8A 2PJ3A 4OIWA 2D4OA 4X3RA 3PBEA 2PJAA 4C2YA 1Z8WA 1IYKA 1VHOA 1OBRA 3F5BA 5LYIA 2Q7SA 5JM6A 3RBUA 1PUAA 4ZX9A 2CNTA 3W6XA 4A2ZA 2R8VA 1F2OA 5I4MA 3R9EA 3TE4A 1Z4RA 4O23A 5EC4A 2Z3PA 3H8GA 1JQGA 4FWUA 2JLMA 4HNXB 2VQYA 4MCRA 4ORFA 1ZG7A 2GFQA 4P4FA 1F2PA 3A9LA 4PK2A 2AFSA 2BCOA 2VEZA 2XEFA 2ZELA 5HXDA 3G3SA 1S7KA 4TWEA 3CPAA 1OZPA 2ZOFA 2HQYA 3IU1A 4ZGYB 3W6SA 4A95A 1PU9A 1CP6A 2V8VA 3CXPA 3NH4A 4CAFA 5JGFA 4X5KA 2P6GA 4P44A 3DDDA 4NGPA 4R8FA 1PYTB 1QSOA 1YSJA 2BOAA 1IB1E 2PR1A 3GKRA 3PB8X 4PV6A 4CGLA 2PVVA 4UIAA 4PQAA 4DJLA 1YQEA 2C6GA 2DEAA 4UFXA 3CDXA 4R6TA 2ANPA 3N5FA 4PXCA 2OB0A 4Q7AA 4OMEA 4UCPA 3S6GA 4CGPA 4KOWA 5ISVA 2JBKA 4B5PA 1NMTA 2ZEFA 1R3NA 1V0CA 4MFZA 4LQ6A 2PR8A 1ZLHA 3IJ3A 2B5GA 1B6BA 2P0WA 3S6HA 1KUXA 2AE6A 3ISXA 3JTKA 2HV2A 4R3KA 1BLLE 3SJXA 1ARMA 3IO1A 2XEIA 3PB7X 2Q04A 4ZBGA 3B3CA 3I1UA 1BPNA 1YW4A 2AJ6A 4JD6A 4KOXA 4P4DA 2ZW5A 4U5YA 4MFLA 4KOUA 1UFHA 1CX8A 1XF8A 3K9TA 3SI1A 4L8AA 5EBVA 3E0KA 4XPDC 1VHSA 3FB3A 4E2AA 5H86A 4P10A 1VKCA 3S9MA 3K9UA 2PDOA 3B3VA 3T9YA 5HVHA 4KSFA 5A28A 2POKA 3IFEA 3B3WA 2AFMA 3V8IA 2Z10A 4OKOA 3T90A 1IYLA 4YFJA 5K8PA 2CNMA 4P4EA 1Z9UA 3KR5A 4MHYA 1XJOA 3ISZA 3MGDA 3MN8A 2JEWA 1Y0YA 1S3ZA 4UEFA 2FIWA 5CNPA 2B3UA 3TOBA 1XMBA 3ZJ0A 2XEGA 4RUHA 1N71A 4XNHC 2DF5A 6CPAA 3KHXA 5LYFA 2NYQA 3ZZIA 2EBJA 5F46A 5HMNA 1CBXA 2CTCA 4Y49C 3NE7A 4KLWA 3FNCA 4NSQA 2OU2A 4UCMA 3SHPA 2PC1A 3L2NA 5BWAB 2EO8A 3BJ7A 4PK3A 4P6YA 2FVGA 4YU9A 4DUKA 2WUUA 5HVGA 2PJ2A 3CXSA 4A32A 4Z65A 4EMEA 1BPMA 4UFWA 5IV0A 4NGRA 4NXYA 4JXRA 1R57A 4OC4A 4CPAA 1Y7EA 2R7HA 2CY2A 4CAWA 4I49A 2EK9A 1NE9A 3F8KA 4B14A 2IJZA 2ZEDA 4UFVA 2X7BA 1AYEA 1P0HA 1Y7RA 2F5IA 2Y0MA 3JUWA 4WWVA 2Z3LA 4FD4A 4KOYA 2C27A 2OZUA 3RZAA 1WWZA 4MFPA 2Q4VA 3R96A 1I12A 1TF8A 1ZLIA 2YNCA 4MHPA 3TX8A 2DPSA 1Y9KA 3CPXA 1LOKA 4CGMA 1A2ZA 3GYAA 2PJCA 4E8OA 1CPXA 4BMHA 2PRQA 2PSWA 3I9SA 4FUUA 2QVPA 2ZEHA 4NJRA 1IOIA 4FD5A 4A31A 2QYVA 3EC4A 5IX3A 4KORA 4R9MA 1QSNA 2Q43A 3D4UA 3D66A 3KQZA 3N7ZA 1CP7A 2QMLA 1F57A 2CF4A 2PJ5A 3R9GA 3DNSA 3P2HA 4AXVA 4XNHB 4C2XA 4DNCA 5I0CA 1PCAA 3KR4A 2ZEEA 4ZYQA 7CPAA 2R1IA 3MRUA 1Q2CA 4NGMA 4KLVA 4Y49B 1TKJA 3TTHA 4KSAA 4CGOA 2PJ8A 4JXQA 2WPWA 3PP9A 1XE4A 4OAEA 4BD9A 3CT9A 1H8LA 1TF9A 1YLOA 1UWYA 2BUEA 4A94A 5GCNA 1Z2LA 2ABZA 5AGEA 1J4JA 4NJQA 3EO4A 2QECA 4LUAA 1YR0A 1R43A 4F0YA 3NFZA 4F6AA 2HB6A 1Q7LA 1X12A 1KWMA 3IWWA 3WC5A 2C6CA 1YX0A 2CXAA 2ODFA 4HNYB 3V38A 1Y0RA
chains in the Genus database with same CATH topology
1RXTA 2KCWA 1QSMA 2EUIA 2FXFA 4AG7A 4C68A 2J8MA 3FXTA 2WSAA 2P6FA 4GS4A 2GE3A 2FL4A 2B3VA 1YK3A 2G3AA 4HKFA 1XIXA 4LX9A 2NMTA 3OWCA 4F0XA 5C82A 2ATRA 4H89A 1SQHA 3F0AA 3IGRA 4CS0B 4IUSA 4KVME 3VWDA 1KUYA 1QSRA 2R98A 4JWPA 3DR6A 3TOAA 5A27A 2G3TA 2REFA 3EXNA 3GY9A 4R87A 2Z3MA 1K4JA 2WPXA 3D8PA 1Y9WA 4NCZA 1I21A 4CYPA 4CYNA 1I1DA 4MBUA 3DSBA 4MI4A 1B87A 2BL1A 5AG6A 3R95A 4AVAA 2JDDA 4CAVA 2D4PA 1MK4A 3TFYA 2FIAA 2DPTA 1XMTA 2GANA 2YGWA 4RS2A 1Q2YA 2Q4YA 2B4DB 4C7IA 2FCKA 3FYNA 5F47A 1M4GA 2J8NA 2QIRA 1S7LA 3RYOA 2OH1A 3IU2A 4MFJA 5AG4A 2DXQA 3S6KA 5J8CA 1BO4A 2BSWA 2Z11A 2Z3KA 4H6ZA 4B11A 2FSRA 3TT2A 4EVYA 1IIDA 3G8WA 4AVCA 2ZXVA 2YNDA 4OLLA 3PGPA 4ONUA 2VZYA 5G20A 3SXOA 3C26A 2Q0YA 3QB8A 4BBHA 3H4QA 4B13A 3SXNA 3D2PA 3FRMA 2B58A 2VXKA 3R9FA 5G1ZA 2G0BA 2P6EA 1U6MA 1KZFA 2PQ8A 2ZW6A 3BJ8A 1YLEA 4A30A 3IWGA 2Z3OA 4B5OA 4HNWB 4NF1A 4B12A 4CAXA 4MY0A 4QBJA 3LODA 4CYOA 1P4NA 4KZTA 4QB9A 5J8FA 2VI7A 2YNEA 5AG5A 3UY5A 4QVTA 3TO9A 1S7FA 2EVNA 3DR8A 4L89A 4Q36A 3B8GA 1Z4EA 3KKWA 4MFQA 4MHDA 1YVKA 3IWEA 4J3GA 4KUBA 3S6FA 1ZO0A 2ARHA 2RC4A 4C2ZA 5G21A 5C88A 4RI1A 4K30A 1TIQA 4R3LA 5JPHA 2O28A 1MJBA 4PSXA 5JQ4A 3TO6A 4UWIA 4AG9A 2Q44A 2B4DA 4UWJA 5DWMA 2JDCA 1Q2DA 5FVJA 3W91A 4U9YA 5H84A 5G22A 4FD7A 4QC6A 4YRHA 3WR7A 1XEBA 4OADA 4XPKA 4KOTA 4CRYB 2FT0A 1S7NA 5F48A 5KTCA 4QUSA 3VWEA 4CGNA 3FBUA 3P2FA 2HUZA 2ZW4A 1FY7A 5F49A 2I00A 4NEXA 4MFKA 3BLNA 4M3SA 4UCNA 1S60A 2FS5A 2Q7BA 1WK4A 2REEA 1BOBA 1CM0A 4KVOE 1IICA 2CNSA 4H6UA 4AB7A 4U9ZA 4XPLA 4AVBA 2ZPAA 1ON0A 5AG7A 1YREA 2GIVA 4A33A 4C7HA 4JJXA 4KS9A 2B4BA 2FE7A 1KUVA 3D3SA 4UBRA 4UA3A 2BEIA 4MY3A 2VBQA 4E0AA 1CJWA 3QAHA 2ZW7A 2K5TA 5KTAA 3H5ZA 1LRZA 3TO7A 1S5KA 3PZJA 2A4NA 3LD2A 4FD6A 1M1DA 2Z3NA 4B10A 2J8RA 5KTDA 1M44A 3TCVA 1M4IA 4B5PB 3JVNA 4KOSA 4KUAA 5E96A 2B5GB 2VZZA 4JLYA 3EY5A 2OZHA 1YVOA 4YGOA 1L0CA 1NSLA 2I79A 3I3GA 4KOVA 1QSTA 2Z0ZA 4KVXA 2PRBA 4II9A 2YNCC 1YGHA 1M4DA 4XPDB 3R1KA 4CRZB 3D2MA 1MJAA 2IL4A 3FIXA 4Q38A 2OZGA 3EFAA 5HH1A 4CYQA 4R57A 4CAEA 5DWNA 3CXQA 2JEVA 1GHEA 2H5MA 4IF5A 5IB0A 1RO5A 4M85A 4PSWA 1MJ9A 4MJ8A 2D4OA 4C2YA 1IYKA 3F5BA 1PUAA 2CNTA 3W6XA 4A2ZA 2R8VA 3R9EA 3TE4A 1Z4RA 5EC4A 2Z3PA 4ORFA 2JLMA 4HNXB 2VQYA 3A9LA 4PK2A 2VEZA 3G3SA 1S7KA 3IU1A 1OZPA 4ZGYB 2HQYA 3W6SA 4A95A 1PU9A 3CXPA 4CAFA 4X5KA 2P6GA 3DDDA 1QSOA 1IB1E 2PR1A 3GKRA 4PV6A 4CGLA 4UFXA 4UCPA 2OB0A 4CGPA 3S6GA 4KOWA 5ISVA 4B5PA 1NMTA 1V0CA 4MFZA 2PR8A 2B5GA 1B6BA 2P0WA 3S6HA 1KUXA 2AE6A 3JTKA 2HV2A 4R3KA 2Q04A 4ZBGA 4JD6A 4U5YA 2AJ6A 4KOXA 2ZW5A 4MFLA 4KOUA 1UFHA 1XF8A 4L8AA 5EBVA 3E0KA 4XPDC 1VHSA 3FB3A 4E2AA 5H86A 1VKCA 3K9UA 2PDOA 3T9YA 4KSFA 5A28A 3V8IA 2Z10A 3T90A 1IYLA 4YFJA 2CNMA 1Z9UA 3MGDA 1S3ZA 2FIWA 5CNPA 2B3UA 3TOBA 3ZJ0A 1N71A 4XNHC 3ZZIA 5F46A 5HMNA 4Y49C 3NE7A 4KLWA 3FNCA 4NSQA 2OU2A 4UCMA 3SHPA 2PC1A 5BWAB 3BJ7A 4PK3A 2WUUA 4A32A 3CXSA 5IV0A 4UFWA 4NXYA 4JXRA 1R57A 2R7HA 2CY2A 4CAWA 4I49A 1NE9A 3F8KA 4B14A 4UFVA 2X7BA 1P0HA 1Y7RA 2F5IA 2Y0MA 3JUWA 2Z3LA 4FD4A 4KOYA 2C27A 2OZUA 1WWZA 4MFPA 2Q4VA 3R96A 1I12A 2YNCA 2DPSA 1Y9KA 4CGMA 3GYAA 4E8OA 4BMHA 2PSWA 3I9SA 5IX3A 4A31A 4FD5A 3EC4A 4KORA 4R9MA 1QSNA 3N7ZA 2QMLA 3R9GA 3DNSA 3P2HA 4C2XA 4XNHB 4DNCA 5I0CA 2R1IA 1Q2CA 4Y49B 4KLVA 3TTHA 4KSAA 4CGOA 4JXQA 2WPWA 3PP9A 1XE4A 4OAEA 2BUEA 5GCNA 5AGEA 1J4JA 3EO4A 2QECA 4LUAA 1YR0A 4F0YA 4F6AA 2CXAA 1YX0A 4HNYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXT A;  2KCW A;  1QSM A;  2EUI A;  2FXF A;  4AG7 A;  2J8M A;  3FXT A;  2P6F A;  4GS4 A;  2GE3 A;  2FL4 A;  2B3V A;  1YK3 A;  2G3A A;  4HKF A;  1XIX A;  4LX9 A;  2NMT A;  3OWC A;  5C82 A;  2ATR A;  4H89 A;  1SQH A;  3F0A A;  3IGR A;  4CS0 B;  4IUS A;  4KVM E;  3VWD A;  1KUY A;  1QSR A;  2R98 A;  4JWP A;  3DR6 A;  3TOA A;  2G3T A;  2REF A;  3EXN A;  3GY9 A;  4R87 A;  1K4J A;  2WPX A;  3D8P A;  1Y9W A;  4NCZ A;  1I21 A;  1I1D A;  4MBU A;  3DSB A;  4MI4 A;  1B87 A;  2BL1 A;  3R95 A;  4AVA A;  2JDD A;  4CAV A;  2D4P A;  1MK4 A;  3TFY A;  2FIA A;  1XMT A;  2GAN A;  4RS2 A;  1Q2Y A;  2Q4Y A;  2B4D B;  2FCK A;  3FYN A;  5F47 A;  1M4G A;  2J8N A;  2QIR A;  1S7L A;  3RYO A;  2OH1 A;  5J8C A;  2DXQ A;  3S6K A;  1BO4 A;  2BSW A;  2Z11 A;  4H6Z A;  2FSR A;  3TT2 A;  4EVY A;  1IID A;  3G8W A;  4AVC A;  2ZXV A;  4OLL A;  3PGP A;  4ONU A;  2VZY A;  3SXO A;  3C26 A;  2Q0Y A;  3QB8 A;  3H4Q A;  3SXN A;  3D2P A;  3FRM A;  2B58 A;  2VXK A;  3R9F A;  2G0B A;  2P6E A;  1U6M A;  1KZF A;  2PQ8 A;  2ZW6 A;  3BJ8 A;  1YLE A;  3IWG A;  4B5O A;  4HNW B;  4NF1 A;  4CAX A;  4MY0 A;  4QBJ A;  3LOD A;  1P4N A;  4KZT A;  4QB9 A;  5J8F A;  2VI7 A;  3UY5 A;  4QVT A;  3TO9 A;  1S7F A;  2EVN A;  3DR8 A;  4L89 A;  3B8G A;  1Z4E A;  3KKW A;  4MHD A;  1YVK A;  4J3G A;  4KUB A;  3S6F A;  2ARH A;  2RC4 A;  5C88 A;  4RI1 A;  4K30 A;  1TIQ A;  4R3L A;  5JPH A;  2O28 A;  1MJB A;  4PSX A;  5JQ4 A;  3TO6 A;  4UWI A;  4AG9 A;  2Q44 A;  2B4D A;  4UWJ A;  5DWM A;  2JDC A;  1Q2D A;  5FVJ A;  3W91 A;  4U9Y A;  5H84 A;  4FD7 A;  4QC6 A;  4YRH A;  3WR7 A;  1XEB A;  4OAD A;  4XPK A;  4KOT A;  4CRY B;  2FT0 A;  1S7N A;  5F48 A;  5KTC A;  4QUS A;  3VWE A;  3FBU A;  3P2F A;  2HUZ A;  2ZW4 A;  1FY7 A;  5F49 A;  2I00 A;  4NEX A;  3BLN A;  4M3S A;  1S60 A;  2FS5 A;  2Q7B A;  1WK4 A;  2REE A;  1BOB A;  1CM0 A;  4KVO E;  1IIC A;  2CNS A;  4H6U A;  4AB7 A;  4U9Z A;  4XPL A;  4AVB A;  2ZPA A;  1ON0 A;  1YRE A;  2GIV A;  4JJX A;  2B4B A;  2FE7 A;  1KUV A;  3D3S A;  4UBR A;  4UA3 A;  2BEI A;  4MY3 A;  2VBQ A;  4E0A A;  1CJW A;  3QAH A;  2ZW7 A;  2K5T A;  5KTA A;  1LRZ A;  3TO7 A;  1S5K A;  3PZJ A;  2A4N A;  3LD2 A;  4FD6 A;  1M1D A;  2J8R A;  5KTD A;  1M44 A;  3TCV A;  1M4I A;  4B5P B;  3JVN A;  4KOS A;  4KUA A;  5E96 A;  2B5G B;  2VZZ A;  4JLY A;  3EY5 A;  2OZH A;  1YVO A;  4YGO A;  1L0C A;  1NSL A;  2I79 A;  3I3G A;  4KOV A;  1QST A;  2Z0Z A;  4KVX A;  2PRB A;  4II9 A;  1YGH A;  1M4D A;  4XPD B;  3R1K A;  4CRZ B;  3D2M A;  1MJA A;  2IL4 A;  3FIX A;  2OZG A;  3EFA A;  5HH1 A;  4R57 A;  5DWN A;  3CXQ A;  2JEV A;  1GHE A;  2H5M A;  4IF5 A;  5IB0 A;  1RO5 A;  4M85 A;  4PSW A;  1MJ9 A;  4MJ8 A;  2D4O A;  1IYK A;  3F5B A;  1PUA A;  2CNT A;  3W6X A;  2R8V A;  3R9E A;  3TE4 A;  1Z4R A;  5EC4 A;  4ORF A;  2JLM A;  4HNX B;  2VQY A;  4PK2 A;  2VEZ A;  3G3S A;  1S7K A;  1OZP A;  2HQY A;  3W6S A;  1PU9 A;  3CXP A;  4X5K A;  2P6G A;  3DDD A;  1QSO A;  1IB1 E;  2PR1 A;  3GKR A;  4PV6 A;  2OB0 A;  3S6G A;  4KOW A;  5ISV A;  4B5P A;  1NMT A;  1V0C A;  2PR8 A;  2B5G A;  1B6B A;  2P0W A;  3S6H A;  1KUX A;  2AE6 A;  4R3K A;  2HV2 A;  2Q04 A;  4ZBG A;  4JD6 A;  4U5Y A;  2AJ6 A;  4KOX A;  2ZW5 A;  4KOU A;  1UFH A;  1XF8 A;  4L8A A;  5EBV A;  3E0K A;  4XPD C;  1VHS A;  3FB3 A;  4E2A A;  5H86 A;  1VKC A;  3K9U A;  2PDO A;  3T9Y A;  3V8I A;  2Z10 A;  3T90 A;  1IYL A;  4YFJ A;  2CNM A;  1Z9U A;  3MGD A;  1S3Z A;  2FIW A;  5CNP A;  2B3U A;  3TOB A;  3ZJ0 A;  1N71 A;  4XNH C;  3ZZI A;  5F46 A;  5HMN A;  4Y49 C;  3NE7 A;  4KLW A;  3FNC A;  4NSQ A;  2OU2 A;  3SHP A;  2PC1 A;  3BJ7 A;  4PK3 A;  3CXS A;  5IV0 A;  4NXY A;  4JXR A;  1R57 A;  2R7H A;  2CY2 A;  4CAW A;  4I49 A;  1NE9 A;  3F8K A;  2X7B A;  1P0H A;  1Y7R A;  2F5I A;  2Y0M A;  3JUW A;  4FD4 A;  4KOY A;  2C27 A;  2OZU A;  1WWZ A;  2Q4V A;  3R96 A;  1I12 A;  1Y9K A;  3GYA A;  4E8O A;  4BMH A;  2PSW A;  3I9S A;  5IX3 A;  4FD5 A;  3EC4 A;  4KOR A;  4R9M A;  1QSN A;  3N7Z A;  2QML A;  3R9G A;  3DNS A;  3P2H A;  4XNH B;  4DNC A;  5I0C A;  2R1I A;  1Q2C A;  4Y49 B;  4KLV A;  3TTH A;  4JXQ A;  2WPW A;  3PP9 A;  1XE4 A;  4OAE A;  2BUE A;  5GCN A;  1J4J A;  3EO4 A;  2QEC A;  4LUA A;  1YR0 A;  4F0Y A;  4F6A A;  1YX0 A;  4HNY B; 
#chains in the Genus database with same CATH topology
 3WT4 A;  1RXT A;  2KCW A;  4YWY A;  1QSM A;  2EUI A;  2FXF A;  2GLJ A;  2IMO A;  4AG7 A;  4C68 A;  1LFW A;  1ZG9 A;  2J8M A;  3FXT A;  2HC9 A;  2WSA A;  3SJF A;  1YW6 A;  2P6F A;  2V8D A;  3PB4 X;  3KQX A;  1HDU A;  1RTQ A;  4EFD A;  1BAV A;  3K2K A;  2GE3 A;  4GS4 A;  4UF4 A;  2WZN A;  4X8I A;  4MRI A;  5K8O A;  2GLF A;  4OC2 A;  2RB7 A;  5D8N A;  5DS0 A;  3D7D A;  2FL4 A;  4JYW A;  3HLP A;  2B3V A;  2C6P A;  2Q4Z A;  4UEE A;  3FED A;  2RFH A;  1YK3 A;  4P4B A;  2ZOG A;  2G3A A;  4HKF A;  1XIX A;  4LX9 A;  4OC3 A;  2NMT A;  2V8H A;  1LAM A;  3OWC A;  4UEZ A;  1ELM P;  4M6H A;  4F0X A;  5C82 A;  2ATR A;  4H89 A;  3WC6 A;  1SQH A;  2V77 A;  3F0A A;  3IGR A;  4CS0 B;  2PIZ A;  4IUS A;  4KVM E;  3VWD A;  1KUY A;  2O4H A;  1HDQ A;  1QSR A;  2R98 A;  3IEH A;  4JWP A;  1CG2 A;  3DR6 A;  3D68 A;  3TOA A;  1ARL A;  5A27 A;  4K3N A;  2G3T A;  3VH9 A;  2F8H A;  2REF A;  3EXN A;  2PJ6 A;  3GY9 A;  4PXE A;  3FJU A;  4R87 A;  3H8E A;  1CPS A;  1K4J A;  2Z3M A;  2PJ0 A;  2WPX A;  3D8P A;  1Y9W A;  4NCZ A;  1I21 A;  4CYP A;  2IQ6 A;  2XEJ A;  2OOT A;  1XBU A;  5ELY A;  1I1D A;  4CYN A;  4MBU A;  3DSB A;  3VAT A;  4DYO A;  4MI4 A;  1B87 A;  2BL1 A;  2PJ4 A;  2J9A A;  4NFR A;  5AG6 A;  4G1P A;  3RO0 A;  3R95 A;  4GM5 A;  1EE3 P;  3WAB A;  2JDD A;  4AVA A;  4CAV A;  2D4P A;  1QQ9 A;  1MK4 A;  3SI0 A;  3TFY A;  3CZX A;  2FIA A;  2DPT A;  1XMT A;  2GAN A;  2YGW A;  3FH4 A;  4RS2 A;  5LYL A;  1Q2Y A;  2Q4Y A;  3B7I A;  2B4D B;  3KL9 A;  4C7I A;  3B3S A;  2FCK A;  3FYN A;  5F47 A;  1M4G A;  5LYD A;  2J8N A;  2QIR A;  1S7L A;  3T8W A;  3RYO A;  4IK2 A;  1VGY A;  5J1Q A;  1IU8 A;  2OH1 A;  3IU2 A;  4MFJ A;  5AG4 A;  2DXQ A;  2V8G A;  3S6K A;  5J8C A;  1BO4 A;  2BSW A;  2Z11 A;  2Z3K A;  4H6Z A;  4B11 A;  4CYQ A;  4ZY1 A;  4NGQ A;  2ZEM A;  2FSR A;  4NGT A;  3TT2 A;  1ELL P;  3BXM A;  1IID A;  3G8W A;  4AVC A;  4EVY A;  2ZXV A;  5CBM A;  4M6I A;  3D7H A;  2YND A;  3KAS A;  4OLL A;  2PIY A;  3PGP A;  4ONU A;  2VZY A;  5G20 A;  3H8F A;  3SXO A;  3NH8 A;  3C26 A;  2Q0Y A;  5CPA A;  3BHX A;  3QB8 A;  2C1C A;  4OP4 A;  4MMO A;  5JH9 A;  3PFE A;  4BBH A;  2ZEN A;  3H4Q A;  4B13 A;  3SXN A;  3D7F A;  5EMI A;  3D2P A;  3FRM A;  4A39 A;  2B58 A;  4HPS A;  2VXK A;  4P45 A;  1TKH A;  3QNV A;  5G1Z A;  3R9F A;  2G0B A;  1JWQ A;  2P6E A;  4LQG A;  4W9Y A;  3B35 A;  3RAM A;  1U6M A;  1KZF A;  3IC1 A;  2PQ8 A;  2ZW6 A;  3BJ8 A;  4OC5 A;  2ZEP A;  1YLE A;  3D67 A;  4A30 A;  3IWG A;  2Z3O A;  4B5O A;  3FEE A;  4HNW B;  4NF1 A;  3QAY A;  3KZW A;  4B12 A;  4CAX A;  2CIJ A;  4MY0 A;  4QBJ A;  3LOD A;  1Z8X A;  3TC8 A;  2PE3 A;  5K8N A;  4CYO A;  1P4N A;  4KZT A;  4QB9 A;  5D29 A;  5J8F A;  2VI7 A;  2YNE A;  5AG5 A;  3UY5 A;  1AMP A;  1IOF A;  1LAN A;  1S7F A;  4QVT A;  3TO9 A;  2EVN A;  2F7V A;  3DR8 A;  4L89 A;  4Q36 A;  3JRU A;  4NGS A;  2O53 A;  3B8G A;  3NA6 A;  1Z8T A;  2GRE A;  3PBB A;  1Z4E A;  3KKW A;  3KGQ A;  4MFQ A;  4MHD A;  3VAR A;  1NSA A;  1YVK A;  4BIN A;  3NE8 A;  3IWE A;  3LMS A;  2PVW A;  4J3G A;  4KUB A;  3S6F A;  1ZO0 A;  2ARH A;  2RC4 A;  4P4J A;  4C2Z A;  5G21 A;  5C88 A;  4RI1 A;  4K30 A;  1VIX A;  4A38 A;  2ZEO A;  1TIQ A;  4R3L A;  3FF3 A;  3LWU A;  5JPH A;  2AFW A;  3FVL A;  2O28 A;  1MJB A;  2OR4 A;  2Q51 A;  4PSX A;  4X2T A;  4OC1 A;  8CPA A;  5JQ4 A;  3TO6 A;  4UWI A;  4AG9 A;  2AFX A;  2B4D A;  2Q44 A;  1ZG8 A;  2PCU A;  4UWJ A;  5DWM A;  2JDC A;  3KHZ A;  1Q2D A;  5FVJ A;  3KI9 A;  4U9Y A;  4P4I A;  1FNO A;  4MHZ A;  3W91 A;  3BI0 A;  5H84 A;  5G22 A;  3GLJ A;  4FD7 A;  4QC6 A;  4YRH A;  1HEE A;  3GIU A;  3WR7 A;  1XEB A;  4OAD A;  4XPK A;  3RNZ A;  2AFZ A;  4KOT A;  4CRY B;  2FT0 A;  3FX6 A;  5KTD A;  1S7N A;  5F48 A;  5KTC A;  2PJ9 A;  4QUS A;  3PRT A;  4MCQ A;  3VWE A;  4CGN A;  4F8Z A;  2G9D A;  4A37 A;  3SJG A;  3S9L A;  3FBU A;  3WC7 A;  3P2F A;  4KSI A;  2HUZ A;  2WYR A;  2ZW4 A;  1FY7 A;  5F49 A;  2I00 A;  4NEX A;  4MFK A;  2PJB A;  3BLN A;  2VL1 A;  4M3S A;  4OID A;  2AFO A;  3FEC A;  4UCN A;  3SI2 A;  3D7G A;  1S60 A;  4PXD A;  2FS5 A;  1M4L A;  2Q7B A;  4ONW A;  1WK4 A;  2REE A;  1BOB A;  1CM0 A;  4PPZ A;  4KVO E;  4RN7 A;  1IIC A;  2CNS A;  4H6U A;  4AB7 A;  5LRK A;  4U9Z A;  1FT7 A;  4XPL A;  1QMU A;  4AVB A;  2PJ1 A;  1AUG A;  2ZPA A;  3IIB A;  1ON0 A;  4TNU A;  1LCP A;  5AG7 A;  1YRE A;  2GIV A;  4A33 A;  3DGV A;  4IAV A;  1GYT A;  4C7H A;  4JZ0 A;  1XOV A;  2ZEG A;  1IY7 A;  3SJE A;  4JJX A;  4KS9 A;  4R76 A;  5THW A;  2B4B A;  2FE7 A;  1KUV A;  3D3S A;  4UBR A;  1DTD A;  2CTB A;  3HUV A;  4UA3 A;  2BEI A;  4MY3 A;  2VBQ A;  4E0A A;  1CJW A;  3QAH A;  1DE4 C;  2ZW7 A;  4EWT A;  4UIB A;  4ZY0 A;  2K5T A;  3LAC A;  5KTA A;  3H5Z A;  3B3T A;  3PFO A;  1LRZ A;  1Z8L A;  3TO7 A;  3B2Y A;  5HVF A;  1S5K A;  3PZJ A;  2A4N A;  3LD2 A;  4FD6 A;  4ZY2 A;  4ZI6 A;  3GB0 A;  4GXH A;  4MCP A;  1M1D A;  2Z3N A;  4WJB A;  5IB9 A;  4B10 A;  2J8R A;  3BI1 A;  1M44 A;  3TCV A;  1M4I A;  2AFU A;  4B5P B;  3JVN A;  4KOS A;  4KUA A;  5E96 A;  4F9U A;  4FBE A;  2PJ7 A;  3PB6 X;  4MXU A;  2B5G B;  2VZZ A;  4JLY A;  3EY5 A;  2OZH A;  2EK8 A;  4H2K A;  4MHN A;  3V7Z A;  1XFO A;  2BO9 A;  1YVO A;  4YGO A;  1LAP A;  1L0C A;  5K8M A;  1NSL A;  3NH5 A;  3PEI A;  2I79 A;  3GUX A;  1Z5R A;  3I3G A;  4KOV A;  4NGN A;  1X10 A;  1QST A;  2QJ8 A;  1TXR A;  2Z0Z A;  4KVX A;  3S9N A;  2PRB A;  4II9 A;  2YNC C;  3FMC A;  4M6G A;  1YGH A;  1M4D A;  4XPD B;  3R1K A;  4CRZ B;  3D2M A;  3DLJ A;  1MJA A;  4OC0 A;  1IGB A;  2IL4 A;  3FIX A;  4Q38 A;  4F9V A;  4FAI A;  1TKF A;  2OZG A;  2I3C A;  3EFA A;  4PXB A;  4R57 A;  5HH1 A;  1VHE A;  5LRG A;  4CAE A;  2NSM A;  5DWN A;  4MCS A;  1YME A;  3CXQ A;  2JEV A;  2JBJ A;  1GHE A;  1XRY A;  4B6Z A;  4R7M A;  4ZX8 A;  4IHM A;  2H5M A;  5LRJ A;  4IF5 A;  5F09 A;  5IB0 A;  2EWB A;  1RO5 A;  4M85 A;  2GU2 A;  3PB9 X;  4PSW A;  1MJ9 A;  4MJ8 A;  2PJ3 A;  4OIW A;  2D4O A;  4X3R A;  3PBE A;  2PJA A;  4C2Y A;  1Z8W A;  1IYK A;  1VHO A;  1OBR A;  3F5B A;  5LYI A;  2Q7S A;  5JM6 A;  3RBU A;  1PUA A;  4ZX9 A;  2CNT A;  3W6X A;  4A2Z A;  2R8V A;  1F2O A;  5I4M A;  3R9E A;  3TE4 A;  1Z4R A;  4O23 A;  5EC4 A;  2Z3P A;  3H8G A;  1JQG A;  4FWU A;  2JLM A;  4HNX B;  2VQY A;  4MCR A;  4ORF A;  1ZG7 A;  2GFQ A;  4P4F A;  1F2P A;  3A9L A;  4PK2 A;  2AFS A;  2BCO A;  2VEZ A;  2XEF A;  2ZEL A;  5HXD A;  3G3S A;  1S7K A;  4TWE A;  3CPA A;  1OZP A;  2ZOF A;  2HQY A;  3IU1 A;  4ZGY B;  3W6S A;  4A95 A;  1PU9 A;  1CP6 A;  2V8V A;  3CXP A;  3NH4 A;  4CAF A;  5JGF A;  4X5K A;  2P6G A;  4P44 A;  3DDD A;  4NGP A;  4R8F A;  1PYT B;  1QSO A;  1YSJ A;  2BOA A;  1IB1 E;  2PR1 A;  3GKR A;  3PB8 X;  4PV6 A;  4CGL A;  2PVV A;  4UIA A;  4PQA A;  4DJL A;  1YQE A;  2C6G A;  2DEA A;  4UFX A;  3CDX A;  4R6T A;  2ANP A;  3N5F A;  4PXC A;  2OB0 A;  4Q7A A;  4OME A;  4UCP A;  3S6G A;  4CGP A;  4KOW A;  5ISV A;  2JBK A;  4B5P A;  1NMT A;  2ZEF A;  1R3N A;  1V0C A;  4MFZ A;  4LQ6 A;  2PR8 A;  1ZLH A;  3IJ3 A;  2B5G A;  1B6B A;  2P0W A;  3S6H A;  1KUX A;  2AE6 A;  3ISX A;  3JTK A;  2HV2 A;  4R3K A;  1BLL E;  3SJX A;  1ARM A;  3IO1 A;  2XEI A;  3PB7 X;  2Q04 A;  4ZBG A;  3B3C A;  3I1U A;  1BPN A;  1YW4 A;  2AJ6 A;  4JD6 A;  4KOX A;  4P4D A;  2ZW5 A;  4U5Y A;  4MFL A;  4KOU A;  1UFH A;  1CX8 A;  1XF8 A;  3K9T A;  3SI1 A;  4L8A A;  5EBV A;  3E0K A;  4XPD C;  1VHS A;  3FB3 A;  4E2A A;  5H86 A;  4P10 A;  1VKC A;  3S9M A;  3K9U A;  2PDO A;  3B3V A;  3T9Y A;  5HVH A;  4KSF A;  5A28 A;  2POK A;  3IFE A;  3B3W A;  2AFM A;  3V8I A;  2Z10 A;  4OKO A;  3T90 A;  1IYL A;  4YFJ A;  5K8P A;  2CNM A;  4P4E A;  1Z9U A;  3KR5 A;  4MHY A;  1XJO A;  3ISZ A;  3MGD A;  3MN8 A;  2JEW A;  1Y0Y A;  1S3Z A;  4UEF A;  2FIW A;  5CNP A;  2B3U A;  3TOB A;  1XMB A;  3ZJ0 A;  2XEG A;  4RUH A;  1N71 A;  4XNH C;  2DF5 A;  6CPA A;  3KHX A;  5LYF A;  2NYQ A;  3ZZI A;  2EBJ A;  5F46 A;  5HMN A;  1CBX A;  2CTC A;  4Y49 C;  3NE7 A;  4KLW A;  3FNC A;  4NSQ A;  2OU2 A;  4UCM A;  3SHP A;  2PC1 A;  3L2N A;  5BWA B;  2EO8 A;  3BJ7 A;  4PK3 A;  4P6Y A;  2FVG A;  4YU9 A;  4DUK A;  2WUU A;  5HVG A;  2PJ2 A;  3CXS A;  4A32 A;  4Z65 A;  4EME A;  1BPM A;  4UFW A;  5IV0 A;  4NGR A;  4NXY A;  4JXR A;  1R57 A;  4OC4 A;  4CPA A;  1Y7E A;  2R7H A;  2CY2 A;  4CAW A;  4I49 A;  2EK9 A;  1NE9 A;  3F8K A;  4B14 A;  2IJZ A;  2ZED A;  4UFV A;  2X7B A;  1AYE A;  1P0H A;  1Y7R A;  2F5I A;  2Y0M A;  3JUW A;  4WWV A;  2Z3L A;  4FD4 A;  4KOY A;  2C27 A;  2OZU A;  3RZA A;  1WWZ A;  4MFP A;  2Q4V A;  3R96 A;  1I12 A;  1TF8 A;  1ZLI A;  2YNC A;  4MHP A;  3TX8 A;  2DPS A;  1Y9K A;  3CPX A;  1LOK A;  4CGM A;  1A2Z A;  3GYA A;  2PJC A;  4E8O A;  1CPX A;  4BMH A;  2PRQ A;  2PSW A;  3I9S A;  4FUU A;  2QVP A;  2ZEH A;  4NJR A;  1IOI A;  4FD5 A;  4A31 A;  2QYV A;  3EC4 A;  5IX3 A;  4KOR A;  4R9M A;  1QSN A;  2Q43 A;  3D4U A;  3D66 A;  3KQZ A;  3N7Z A;  1CP7 A;  2QML A;  1F57 A;  2CF4 A;  2PJ5 A;  3R9G A;  3DNS A;  3P2H A;  4AXV A;  4XNH B;  4C2X A;  4DNC A;  5I0C A;  1PCA A;  3KR4 A;  2ZEE A;  4ZYQ A;  7CPA A;  2R1I A;  3MRU A;  1Q2C A;  4NGM A;  4KLV A;  4Y49 B;  1TKJ A;  3TTH A;  4KSA A;  4CGO A;  2PJ8 A;  4JXQ A;  2WPW A;  3PP9 A;  1XE4 A;  4OAE A;  4BD9 A;  3CT9 A;  1H8L A;  1TF9 A;  1YLO A;  1UWY A;  2BUE A;  4A94 A;  5GCN A;  1Z2L A;  2ABZ A;  5AGE A;  1J4J A;  4NJQ A;  3EO4 A;  2QEC A;  4LUA A;  1YR0 A;  1R43 A;  4F0Y A;  3NFZ A;  4F6A A;  2HB6 A;  1Q7L A;  1X12 A;  1KWM A;  3IWW A;  3WC5 A;  2C6C A;  1YX0 A;  2CXA A;  2ODF A;  4HNY B;  3V38 A;  1Y0R A; 
#chains in the Genus database with same CATH homology
 1RXT A;  2KCW A;  1QSM A;  2EUI A;  2FXF A;  4AG7 A;  4C68 A;  2J8M A;  3FXT A;  2WSA A;  2P6F A;  4GS4 A;  2GE3 A;  2FL4 A;  2B3V A;  1YK3 A;  2G3A A;  4HKF A;  1XIX A;  4LX9 A;  2NMT A;  3OWC A;  4F0X A;  5C82 A;  2ATR A;  4H89 A;  1SQH A;  3F0A A;  3IGR A;  4CS0 B;  4IUS A;  4KVM E;  3VWD A;  1KUY A;  1QSR A;  2R98 A;  4JWP A;  3DR6 A;  3TOA A;  5A27 A;  2G3T A;  2REF A;  3EXN A;  3GY9 A;  4R87 A;  2Z3M A;  1K4J A;  2WPX A;  3D8P A;  1Y9W A;  4NCZ A;  1I21 A;  4CYP A;  4CYN A;  1I1D A;  4MBU A;  3DSB A;  4MI4 A;  1B87 A;  2BL1 A;  5AG6 A;  3R95 A;  4AVA A;  2JDD A;  4CAV A;  2D4P A;  1MK4 A;  3TFY A;  2FIA A;  2DPT A;  1XMT A;  2GAN A;  2YGW A;  4RS2 A;  1Q2Y A;  2Q4Y A;  2B4D B;  4C7I A;  2FCK A;  3FYN A;  5F47 A;  1M4G A;  2J8N A;  2QIR A;  1S7L A;  3RYO A;  2OH1 A;  3IU2 A;  4MFJ A;  5AG4 A;  2DXQ A;  3S6K A;  5J8C A;  1BO4 A;  2BSW A;  2Z11 A;  2Z3K A;  4H6Z A;  4B11 A;  2FSR A;  3TT2 A;  4EVY A;  1IID A;  3G8W A;  4AVC A;  2ZXV A;  2YND A;  4OLL A;  3PGP A;  4ONU A;  2VZY A;  5G20 A;  3SXO A;  3C26 A;  2Q0Y A;  3QB8 A;  4BBH A;  3H4Q A;  4B13 A;  3SXN A;  3D2P A;  3FRM A;  2B58 A;  2VXK A;  3R9F A;  5G1Z A;  2G0B A;  2P6E A;  1U6M A;  1KZF A;  2PQ8 A;  2ZW6 A;  3BJ8 A;  1YLE A;  4A30 A;  3IWG A;  2Z3O A;  4B5O A;  4HNW B;  4NF1 A;  4B12 A;  4CAX A;  4MY0 A;  4QBJ A;  3LOD A;  4CYO A;  1P4N A;  4KZT A;  4QB9 A;  5J8F A;  2VI7 A;  2YNE A;  5AG5 A;  3UY5 A;  4QVT A;  3TO9 A;  1S7F A;  2EVN A;  3DR8 A;  4L89 A;  4Q36 A;  3B8G A;  1Z4E A;  3KKW A;  4MFQ A;  4MHD A;  1YVK A;  3IWE A;  4J3G A;  4KUB A;  3S6F A;  1ZO0 A;  2ARH A;  2RC4 A;  4C2Z A;  5G21 A;  5C88 A;  4RI1 A;  4K30 A;  1TIQ A;  4R3L A;  5JPH A;  2O28 A;  1MJB A;  4PSX A;  5JQ4 A;  3TO6 A;  4UWI A;  4AG9 A;  2Q44 A;  2B4D A;  4UWJ A;  5DWM A;  2JDC A;  1Q2D A;  5FVJ A;  3W91 A;  4U9Y A;  5H84 A;  5G22 A;  4FD7 A;  4QC6 A;  4YRH A;  3WR7 A;  1XEB A;  4OAD A;  4XPK A;  4KOT A;  4CRY B;  2FT0 A;  1S7N A;  5F48 A;  5KTC A;  4QUS A;  3VWE A;  4CGN A;  3FBU A;  3P2F A;  2HUZ A;  2ZW4 A;  1FY7 A;  5F49 A;  2I00 A;  4NEX A;  4MFK A;  3BLN A;  4M3S A;  4UCN A;  1S60 A;  2FS5 A;  2Q7B A;  1WK4 A;  2REE A;  1BOB A;  1CM0 A;  4KVO E;  1IIC A;  2CNS A;  4H6U A;  4AB7 A;  4U9Z A;  4XPL A;  4AVB A;  2ZPA A;  1ON0 A;  5AG7 A;  1YRE A;  2GIV A;  4A33 A;  4C7H A;  4JJX A;  4KS9 A;  2B4B A;  2FE7 A;  1KUV A;  3D3S A;  4UBR A;  4UA3 A;  2BEI A;  4MY3 A;  2VBQ A;  4E0A A;  1CJW A;  3QAH A;  2ZW7 A;  2K5T A;  5KTA A;  3H5Z A;  1LRZ A;  3TO7 A;  1S5K A;  3PZJ A;  2A4N A;  3LD2 A;  4FD6 A;  1M1D A;  2Z3N A;  4B10 A;  2J8R A;  5KTD A;  1M44 A;  3TCV A;  1M4I A;  4B5P B;  3JVN A;  4KOS A;  4KUA A;  5E96 A;  2B5G B;  2VZZ A;  4JLY A;  3EY5 A;  2OZH A;  1YVO A;  4YGO A;  1L0C A;  1NSL A;  2I79 A;  3I3G A;  4KOV A;  1QST A;  2Z0Z A;  4KVX A;  2PRB A;  4II9 A;  2YNC C;  1YGH A;  1M4D A;  4XPD B;  3R1K A;  4CRZ B;  3D2M A;  1MJA A;  2IL4 A;  3FIX A;  4Q38 A;  2OZG A;  3EFA A;  5HH1 A;  4CYQ A;  4R57 A;  4CAE A;  5DWN A;  3CXQ A;  2JEV A;  1GHE A;  2H5M A;  4IF5 A;  5IB0 A;  1RO5 A;  4M85 A;  4PSW A;  1MJ9 A;  4MJ8 A;  2D4O A;  4C2Y A;  1IYK A;  3F5B A;  1PUA A;  2CNT A;  3W6X A;  4A2Z A;  2R8V A;  3R9E A;  3TE4 A;  1Z4R A;  5EC4 A;  2Z3P A;  4ORF A;  2JLM A;  4HNX B;  2VQY A;  3A9L A;  4PK2 A;  2VEZ A;  3G3S A;  1S7K A;  3IU1 A;  1OZP A;  4ZGY B;  2HQY A;  3W6S A;  4A95 A;  1PU9 A;  3CXP A;  4CAF A;  4X5K A;  2P6G A;  3DDD A;  1QSO A;  1IB1 E;  2PR1 A;  3GKR A;  4PV6 A;  4CGL A;  4UFX A;  4UCP A;  2OB0 A;  4CGP A;  3S6G A;  4KOW A;  5ISV A;  4B5P A;  1NMT A;  1V0C A;  4MFZ A;  2PR8 A;  2B5G A;  1B6B A;  2P0W A;  3S6H A;  1KUX A;  2AE6 A;  3JTK A;  2HV2 A;  4R3K A;  2Q04 A;  4ZBG A;  4JD6 A;  4U5Y A;  2AJ6 A;  4KOX A;  2ZW5 A;  4MFL A;  4KOU A;  1UFH A;  1XF8 A;  4L8A A;  5EBV A;  3E0K A;  4XPD C;  1VHS A;  3FB3 A;  4E2A A;  5H86 A;  1VKC A;  3K9U A;  2PDO A;  3T9Y A;  4KSF A;  5A28 A;  3V8I A;  2Z10 A;  3T90 A;  1IYL A;  4YFJ A;  2CNM A;  1Z9U A;  3MGD A;  1S3Z A;  2FIW A;  5CNP A;  2B3U A;  3TOB A;  3ZJ0 A;  1N71 A;  4XNH C;  3ZZI A;  5F46 A;  5HMN A;  4Y49 C;  3NE7 A;  4KLW A;  3FNC A;  4NSQ A;  2OU2 A;  4UCM A;  3SHP A;  2PC1 A;  5BWA B;  3BJ7 A;  4PK3 A;  2WUU A;  4A32 A;  3CXS A;  5IV0 A;  4UFW A;  4NXY A;  4JXR A;  1R57 A;  2R7H A;  2CY2 A;  4CAW A;  4I49 A;  1NE9 A;  3F8K A;  4B14 A;  4UFV A;  2X7B A;  1P0H A;  1Y7R A;  2F5I A;  2Y0M A;  3JUW A;  2Z3L A;  4FD4 A;  4KOY A;  2C27 A;  2OZU A;  1WWZ A;  4MFP A;  2Q4V A;  3R96 A;  1I12 A;  2YNC A;  2DPS A;  1Y9K A;  4CGM A;  3GYA A;  4E8O A;  4BMH A;  2PSW A;  3I9S A;  5IX3 A;  4A31 A;  4FD5 A;  3EC4 A;  4KOR A;  4R9M A;  1QSN A;  3N7Z A;  2QML A;  3R9G A;  3DNS A;  3P2H A;  4C2X A;  4XNH B;  4DNC A;  5I0C A;  2R1I A;  1Q2C A;  4Y49 B;  4KLV A;  3TTH A;  4KSA A;  4CGO A;  4JXQ A;  2WPW A;  3PP9 A;  1XE4 A;  4OAE A;  2BUE A;  5GCN A;  5AGE A;  1J4J A;  3EO4 A;  2QEC A;  4LUA A;  1YR0 A;  4F0Y A;  4F6A A;  2CXA A;  1YX0 A;  4HNY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...