2IL4A

Crystal structure of at1g77540-coenzyme a complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
PKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Protein At1g77540
total genus 25
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2il4A00
4KUAA 1I21A 5EC4A 3EO4A 2JEVA 3GYAA 1MJ9A 2OZUA 4FD5A 4H6ZA 5KTDA 4U5YA 4QVTA 1I1DA 4CAXA 2D4PA 4R57A 2Q4VA 3DDDA 1YLEA 4LX9A 4FD7A 2VZZA 2OZHA 1IIDA 4CRYB 2Z11A 2ATRA 5GCNA 4UA3A 2DXQA 4JD6A 5FVJA 2PC1A 5F46A 3TT2A 2G0BA 4NF1A 3PZJA 4CAVA 4NCZA 2FS5A 4XPLA 4AVAA 2FT0A 2ZW7A 3RYOA 4OLLA 1KZFA 2BUEA 3F5BA 2HQYA 5DWMA 2EVNA 2ZW5A 1K4JA 3TFYA 1KUXA 1VHSA 4RI1A 2Q04A 4XPDC 4YGOA 3NE7A 4H89A 4XNHC 2D4OA 4NEXA 1ON0A 4L89A 2OZGA 1S7NA 2HV2A 3JUWA 2EUIA 2P0WA 2Y0MA 1S7FA 3PP9A 1J4JA 4NSQA 3SXNA 4U9YA 1YR0A 4KZTA 3TOBA 4QC6A 2GIVA 4OADA 1IICA 2B4BA 1YVOA 2NMTA 3D2PA 4PK2A 1Y9KA 2BSWA 1CJWA 2VQYA 1Q2CA 3EXNA 1QSTA 1MK4A 3QAHA 2FE7A 4JXQA 3WR7A 4CRZB 2FCKA 5KTCA 4FD6A 1KUYA 3LODA 2Z0ZA 2R7HA 1YGHA 2JDDA 1XF8A 1XE4A 5F48A 4QB9A 3T9YA 2B3VA 3BLNA 1L0CA 2AJ6A 5IB0A 3OWCA 3G8WA 4R3KA 4M3SA 4KOVA 1CM0A 4B5PA 1QSMA 4E0AA 5HH1A 5ISVA 2CNTA 5JPHA 2B5GB 1YREA 2QMLA 2B5GA 3SHPA 4QUSA 4KOWA 4K30A 2KCWA 4HNWB 4HNXB 1M4IA 3D8PA 4PSWA 3R95A 3DR6A 4MY3A 3R1KA 4KOUA 3FB3A 4BMHA 3CXPA 2VXKA 3IWGA 4IUSA 3F8KA 3R9GA 1NMTA 1WWZA 2K5TA 2BEIA 1RO5A 4KLWA 3R96A 2IL4A 3EFAA 4X5KA 2R1IA 2R8VA 2FIWA 2PQ8A 2PSWA 4F6AA 4JLYA 1BOBA 2A4NA 3I3GA 2B3UA 3S6HA 3FNCA 5JQ4A 1VKCA 4GS4A 2B58A 3TTHA 4B5OA 3TO6A 5F47A 3S6FA 4LUAA 3P2FA 2PR1A 4KOSA 5HMNA 5CNPA 3D3SA 4R87A 2I00A 3F0AA 2R98A 3VWDA 4MJ8A 4PSXA 1P4NA 1LRZA 3DSBA 3FXTA 3GKRA 4UWIA 1Z4RA 4EVYA 1BO4A 1Q2YA 1SQHA 4II9A 3TCVA 3ZZIA 1S5KA 3I9SA 1QSNA 3UY5A 2BL1A 2Q7BA 2OB0A 1P0HA 1N71A 1TIQA 2B4DB 4PV6A 2QIRA 2J8RA 3T90A 2Q4YA 4QBJA 1XEBA 1XIXA 2REEA 4MY0A 3KKWA 1S3ZA 3V8IA 4J3GA 2Q0YA 3QB8A 3DNSA 1NSLA 3TOAA 4R9MA 3R9EA 1Q2DA 3EY5A 2GE3A 1S60A 3VWEA 1RXTA 3W6XA 3FBUA 3CXQA 2CNMA 3G3SA 3BJ8A 2RC4A 3SXOA 1UFHA 2PR8A 4HKFA 2QECA 1WK4A 3B8GA 2B4DA 4KOTA 3E0KA 4E8OA 3TE4A 4ONUA 2P6GA 1MJAA 5C82A 2C27A 3FYNA 3BJ7A 2REFA 2CNSA 2O28A 4KOYA 4MI4A 4KVXA 1S7KA 5H86A 2OU2A 1GHEA 2I79A 3H4QA 5I0CA 3C26A 3D2MA 3DR8A 4KORA 2P6EA 4AB7A 4ZBGA 3ZJ0A 5KTAA 3FRMA 2VI7A 4AVCA 4ORFA 4AG7A 4XPDB 1S7LA 3R9FA 3CXSA 2PDOA 2F5IA 4UWJA 1B87A 1M1DA 2J8MA 1IB1E 2HUZA 4NXYA 4MBUA 4F0YA 2FXFA 5EBVA 1IYKA 2JDCA 3GY9A 3PGPA 3S6KA 4M85A 2Q44A 1IYLA 1YK3A 4Y49B 4IF5A 4PK3A 5C88A 4H6UA 2Z10A 4KVOE 1I12A 4HNYB 4JXRA 4R3LA 5IV0A 2X7BA 1YVKA 3MGDA 2PRBA 3TO9A 1MJBA 1M44A 2ARHA 5H84A 3TO7A 2P6FA 1KUVA 4YFJA 1Y9WA 3P2HA 2WPXA 4MHDA 4CS0B 4U9ZA 4JJXA 1OZPA 4KUBA 3LD2A 3JVNA 1Z4EA 4XPKA 5J8FA 2OH1A 2ZW4A 2JLMA 1V0CA 3S6GA 1R57A 2AE6A 3FIXA 3N7ZA 1M4DA 1Y7RA 2WPWA 4RS2A 1FY7A 2ZW6A 1PU9A 2GANA 4UBRA 4KLVA 2FSRA 2CY2A 4L8AA 1Z9UA 1PUAA 1U6MA 4Y49C 4FD4A 5IX3A 2H5MA 4CAWA 1QSRA 2VZYA 2ZXVA 1B6BA 4I49A 2G3TA 2J8NA 5DWNA 1XMTA 4KVME 4E2AA 3IGRA 5F49A 1QSOA 1YX0A 4AG9A 3K9UA 4B5PB 5J8CA 4JWPA 5E96A 1NE9A 3EC4A 4AVBA 3W91A 4XNHB 4OAEA 4YRHA 2ZPAA 2VEZA 1M4GA 4DNCA 2FL4A 2FIAA 4KOXA 2G3AA 3W6SA 2VBQA
chains in the Genus database with same CATH superfamily
5THWA 2YGWA 4Q38A 4PXEA 3N5FA 1IOFA 4KUAA 4WJBA 4LQ6A 1I21A 3KR5A 5EC4A 5F09A 4NFRA 1R3NA 2NYQA 2JEVA 3EO4A 3GYAA 1MJ9A 2OZUA 2C1CA 4CPAA 4MFQA 1FT7A 4FD5A 4H6ZA 5KTDA 4U5YA 5JGFA 4ZY2A 4QVTA 4CGOA 1I1DA 2FVGA 4NGSA 4CAXA 2D4PA 4PXDA 4CGMA 3CDXA 4R57A 2Q4VA 4B10A 3DDDA 1YLEA 4LX9A 4FD7A 4Q7AA 4NJQA 3PB6X 2VZZA 2OZHA 1IIDA 4UIBA 4C7HA 4CRYB 2Z11A 4P4JA 2ATRA 5GCNA 4UA3A 1BLLE 2DXQA 4NGQA 4P4IA 4JD6A 5FVJA 2PC1A 5F46A 2PVVA 3TT2A 2G0BA 4GXHA 4OIWA 4NF1A 3PZJA 1AMPA 3HLPA 4NCZA 2PJAA 4MHNA 1Z5RA 2FS5A 2YNCC 4CAVA 4FBEA 1LFWA 4XPLA 4AVAA 2FT0A 2ZW7A 3QNVA 3RYOA 4OLLA 1KZFA 2BUEA 3F5BA 2HQYA 4MFKA 5DWMA 4KSFA 4A32A 2EVNA 2ZW5A 1K4JA 4MFJA 2XEFA 3L2NA 1KUXA 4W9YA 4ZX8A 3TFYA 1VHSA 4BBHA 3HUVA 3KI9A 4RI1A 2Q04A 4XPDC 4YGOA 1M4LA 3NE7A 4OC2A 4H89A 4FWUA 4XNHC 2D4OA 4NEXA 1ON0A 4L89A 2OZGA 1S7NA 4A30A 1HEEA 2HV2A 3JUWA 2C6CA 2EUIA 1CBXA 2P0WA 1VGYA 2Y0MA 3FJUA 1S7FA 3PP9A 4OC0A 1J4JA 4NSQA 3LMSA 3FX6A 3SXNA 3GLJA 1Z8XA 4O23A 4B12A 4CGLA 5DS0A 4U9YA 3FECA 2AFUA 1YR0A 4KZTA 2Z3PA 3FMCA 3TOBA 4NGRA 4QC6A 5K8OA 2GIVA 1UWYA 4OADA 1IICA 2NMTA 2B4BA 1YVOA 3D2PA 3NH4A 4PK2A 1Y9KA 2BSWA 2GREA 4A31A 2DPTA 1CJWA 2VQYA 1Q2CA 3EXNA 3IU2A 2V77A 3SJEA 1HDUA 1QSTA 1BPMA 2ZOGA 1MK4A 2ZEPA 3QAHA 4R76A 2FE7A 4JXQA 4DJLA 3A9LA 1AYEA 4IHMA 2BCOA 3WR7A 4CRZB 5A28A 2FCKA 2CIJA 5KTCA 5LYLA 1X10A 2YNDA 4FD6A 1KUYA 4OMEA 3LODA 2C6PA 2Z0ZA 2R7HA 3SJGA 1YGHA 4A37A 2JDDA 1XF8A 1XE4A 4ONWA 4QB9A 5F48A 3T9YA 2PIYA 4MHYA 5HXDA 2B3VA 3BLNA 1L0CA 2AJ6A 3BHXA 4ZI6A 3OWCA 5IB0A 3G8WA 4R3KA 2O53A 4M3SA 4KOVA 3DLJA 3PBBA 4Z65A 4TWEA 1CM0A 3NH5A 4B5PA 1QSMA 3CPAA 1LAMA 1PCAA 4P4EA 5LYIA 4E0AA 1RTQA 4ZX9A 5HH1A 5ISVA 2CNTA 3CT9A 5JPHA 2B5GB 1YREA 2ZEHA 3FF3A 8CPAA 4ZY0A 2QMLA 2B5GA 4P4DA 4PPZA 3SHPA 1QQ9A 2CTBA 4QUSA 2PJBA 4KOWA 3RBUA 4OKOA 1ARLA 2PJCA 4K30A 2KCWA 4HNWB 3QAYA 4HNXB 1M4IA 2Q7SA 1Y0RA 3D8PA 4PSWA 3D66A 2PJ1A 3R95A 3DR6A 3B3WA 3H8EA 3I1UA 4MY3A 4OIDA 4IAVA 3R1KA 1A2ZA 1YLOA 3B7IA 3D7GA 4OC5A 1EE3P 4KOUA 3FB3A 4PXBA 4P10A 3CXPA 4BMHA 1YW6A 3SI1A 5K8NA 3KASA 3KQZA 4CAEA 2VXKA 3KL9A 2NSMA 3IWGA 4IUSA 5G1ZA 3F8KA 3V38A 3NFZA 3R9GA 1NMTA 3TX8A 5AG4A 5J1QA 1AUGA 4MXUA 5ELYA 4H2KA 1WWZA 2CF4A 1F57A 3IIBA 2K5TA 4WWVA 5A27A 2BEIA 2RFHA 2XEJA 1DE4C 1RO5A 4CYNA 4F9VA 4KLWA 3R96A 2IL4A 3RNZA 3EFAA 4NGNA 4X5KA 1Q7LA 2AFOA 3WT4A 2Q43A 5K8MA 2R1IA 2R8VA 4F8ZA 2FIWA 3KZWA 2Z3LA 2PQ8A 2PSWA 1XJOA 5I4MA 1ZG9A 4MCRA 3IU1A 4UCMA 4F6AA 4JLYA 1BOBA 2A4NA 3SI0A 2BOAA 3I3GA 2B3UA 4MFZA 4UFWA 3S6HA 3FNCA 5HVHA 4P6YA 5JQ4A 3S9NA 1VKCA 4OC4A 4GS4A 1BPNA 2B58A 2F7VA 4KSAA 4UFXA 2QVPA 4GM5A 3TTHA 4B5OA 4YU9A 3TO6A 5F47A 3S6FA 4LUAA 2PIZA 3P2FA 2PR1A 4KOSA 5HMNA 2HC9A 4X8IA 5CNPA 4BINA 4BD9A 3D3SA 4M6GA 2Z3KA 4R87A 3ISZA 2I00A 3T8WA 3D68A 4UF4A 4R7MA 1F2OA 2EK9A 2QJ8A 1YSJA 4CYOA 3F0AA 2R98A 3VWDA 3IC1A 4MJ8A 2AFXA 1Z8WA 2ZEFA 4PSXA 3PB7X 1P4NA 1LRZA 3DSBA 3FXTA 3GKRA 3RO0A 1XBUA 5CBMA 2Z3NA 2POKA 2GU2A 2WSAA 4UWIA 2PJ7A 1Z4RA 2EK8A 4B11A 3GUXA 4EVYA 1BO4A 1Q2YA 3D7HA 1SQHA 4II9A 3TCVA 5G21A 3ZZIA 1CX8A 1XOVA 2ANPA 1S5KA 5HVGA 4A94A 3I9SA 7CPAA 1QSNA 4P45A 4HPSA 5AG5A 3UY5A 2BL1A 2Q7BA 2OB0A 4C7IA 4DYOA 1P0HA 1HDQA 2ZEEA 1N71A 1TIQA 2RB7A 2JBKA 2B4DB 2PE3A 4PV6A 2QIRA 2J8RA 1NSAA 2PJ4A 3T90A 2Q4YA 3FEDA 4QBJA 1XEBA 1XIXA 2REEA 2BO9A 4MY0A 3KKWA 1S3ZA 4YWYA 4MHZA 3V8IA 4UFVA 4J3GA 3JTKA 3ISXA 4NGPA 2Q0YA 3QB8A 4MFPA 3DNSA 4UCPA 1IU8A 1NSLA 2O4HA 3V7ZA 3TOAA 4R9MA 3MRUA 3R9EA 4B14A 1Q2DA 3EY5A 2GE3A 1S60A 1IGBA 3VATA 3VWEA 1RXTA 3SJFA 3W6XA 3K9TA 3FBUA 4X2TA 4MRIA 1ELLP 4OC3A 4PQAA 3CXQA 2CNMA 3G3SA 6CPAA 3BJ8A 2RC4A 3B2YA 5D8NA 3VH9A 2PJ0A 4ZGYB 4K3NA 3SXOA 3D7FA 3PEIA 3WC5A 1ELMP 1UFHA 2AFWA 4AXVA 2PR8A 4HKFA 2QECA 5HVFA 4RUHA 1WK4A 3B8GA 2B4DA 4P44A 2C6GA 4KOTA 3E0KA 4E8OA 3TE4A 4ONUA 2DPSA 1TKFA 2P6GA 1MJAA 3H5ZA 3VARA 5C82A 2AFSA 2IJZA 2V8DA 3WABA 2C27A 3WC7A 1VHEA 2ZOFA 4G1PA 2PJ5A 3RZAA 3FYNA 3BJ7A 2REFA 4CYPA 2CNSA 2O28A 4KOYA 2PVWA 3H8FA 5LRKA 3B3SA 4EMEA 1FNOA 4MI4A 4C2YA 2Q4ZA 2YNEA 3S9MA 1ZG8A 2J9AA 2OOTA 4LQGA 3KGQA 1IY7A 1H8LA 4KVXA 1S7KA 5H86A 2OU2A 1GHEA 2I79A 3H4QA 4IK2A 4KS9A 3SJXA 2AFZA 2Q51A 3IO1A 3IWEA 4MMOA 1CP6A 3NA6A 5I0CA 2Z3OA 3C26A 2HB6A 2WZNA 2ZEOA 3D2MA 1XRYA 2ZEDA 3DR8A 3KHZA 2P6EA 3PFEA 4KORA 1TF9A 4AB7A 4CAFA 1Z2LA 3LWUA 4ZBGA 3ZJ0A 3NH8A 5KTAA 3FRMA 2VI7A 1JWQA 3B3TA 4AVCA 1ZLHA 2QYVA 4ORFA 4AG7A 2GLJA 5BWAB 4XPDB 5JM6A 2V8HA 1S7LA 2JBJA 3R9FA 1CG2A 1JQGA 2GFQA 4MCPA 2Z3MA 2EWBA 3CXSA 3D4UA 2ZEGA 1LAPA 2PDOA 1XFOA 2F5IA 2ZEMA 4UWJA 1GYTA 5LRGA 1B87A 2PCUA 1M1DA 2J8MA 1IB1E 1R43A 2HUZA 4NXYA 4MBUA 4C2XA 5AG7A 4Q36A 3S9LA 4F0YA 3FH4A 2CXAA 1TKHA 2FXFA 3PBEA 5EBVA 3TC8A 1IYKA 2JDCA 1CPXA 3NE8A 5K8PA 3GY9A 3PGPA 3S6KA 4M85A 2Q44A 1IYLA 4MHPA 1YK3A 2G9DA 4Y49B 1CP7A 4FAIA 4IF5A 4PK3A 4UCNA 5C88A 4H6UA 2Z10A 2PJ8A 4KVOE 1I12A 5EMIA 2OR4A 2V8VA 1F2PA 4MCQA 2WUUA 4HNYB 4C2ZA 4JXRA 4R3LA 4MFLA 5IV0A 2X7BA 1YVKA 3MGDA 4JYWA 4UEFA 2PRBA 1CPSA 3TO9A 1MJBA 3JRUA 2F8HA 1M44A 1Y0YA 2ARHA 1IOIA 3FEEA 4P4FA 4EWTA 5H84A 1ZO0A 3BI0A 3D67A 3K2KA 3TO7A 2P6FA 4B6ZA 1KUVA 5AG6A 4CYQA 3LACA 4MCSA 4A95A 3WC6A 1Z8LA 2GLFA 4YFJA 1ARMA 1Y9WA 4A38A 3P2HA 2WPXA 2EO8A 1TKJA 3KR4A 2PRQA 1LANA 3KHXA 4MHDA 3IJ3A 4CS0B 3MN8A 4F0XA 5LYDA 4U9ZA 4JJXA 2JEWA 1TXRA 5G22A 1OZPA 4KUBA 1YQEA 4ZY1A 3LD2A 2XEIA 2IMOA 3JVNA 4KSIA 1Z4EA 4XPKA 3DGVA 1OBRA 1YW4A 3B3CA 5J8FA 4B13A 1VHOA 2OH1A 2ZELA 4A2ZA 2ZW4A 2JLMA 1V0CA 3B35A 3CZXA 3S6GA 2PJ3A 1R57A 2ZENA 4NGMA 2AE6A 3FIXA 1Z8TA 3PB4X 4M6IA 2VL1A 4TNUA 2DEAA 3N7ZA 1M4DA 3PRTA 4EFDA 1Y7RA 4PXCA 2WPWA 4ZYQA 1ZG7A 2WYRA 4RS2A 4CGPA 1Y7EA 1FY7A 2ZW6A 3IWWA 1PU9A 4DUKA 5IB9A 2GANA 4UBRA 4RN7A 4KLVA 2FSRA 1X12A 2CY2A 2PJ9A 4L8AA 1LCPA 2DF5A 1Z9UA 3B3VA 4C68A 3IEHA 4R6TA 1PUAA 1U6MA 3D7DA 4A39A 4CGNA 4Y49C 3GB0A 1ZLIA 3H8GA 4FD4A 4F9UA 5IX3A 2H5MA 4CAWA 4UEZA 1TF8A 2AFMA 3BXMA 1QSRA 1VIXA 2VZYA 2ZXVA 4UIAA 5D29A 4A33A 2XEGA 1DTDA 1B6BA 4I49A 5AGEA 2ABZA 3PFOA 2G3TA 2J8NA 5G20A 2YNCA 1YMEA 2CTCA 1BAVA 5DWNA 1LOKA 4X3RA 1XMTA 4KVME 4E2AA 3IGRA 4FUUA 2ODFA 5F49A 3GIUA 1QSOA 1YX0A 2EBJA 4UEEA 4AG9A 3K9UA 2PJ6A 1QMUA 4R8FA 3PB9X 2IQ6A 3FVLA 3SI2A 4B5PB 5J8CA 1PYTB 4JWPA 5E96A 5JH9A 1NE9A 3EC4A 3RAMA 4AVBA 4NGTA 3W91A 4M6HA 4XNHB 5CPAA 4OAEA 4P4BA 5LRJA 2I3CA 1KWMA 3BI1A 4OC1A 4YRHA 5LYFA 2ZPAA 2VEZA 4NJRA 1XMBA 1M4GA 4DNCA 3CPXA 2FL4A 2FIAA 4KOXA 2G3AA 2V8GA 3PB8X 4OP4A 4JZ0A 3W6SA 2PJ2A 3IFEA 2VBQA 3KQXA
chains in the Genus database with same CATH topology
2YGWA 4Q38A 4KUAA 1I21A 5EC4A 3EO4A 2JEVA 3GYAA 1MJ9A 2OZUA 4MFQA 4FD5A 4H6ZA 5KTDA 4U5YA 4QVTA 4CGOA 1I1DA 4CAXA 2D4PA 4CGMA 4R57A 2Q4VA 4B10A 3DDDA 1YLEA 4LX9A 4FD7A 2VZZA 2OZHA 1IIDA 4C7HA 4CRYB 2Z11A 2ATRA 5GCNA 4UA3A 2DXQA 4JD6A 5FVJA 2PC1A 5F46A 3TT2A 2G0BA 4NF1A 3PZJA 4CAVA 4NCZA 2YNCC 2FS5A 4XPLA 4AVAA 2FT0A 2ZW7A 3RYOA 4OLLA 1KZFA 2BUEA 3F5BA 2HQYA 4MFKA 5DWMA 4KSFA 4A32A 2EVNA 2ZW5A 1K4JA 4MFJA 3TFYA 1KUXA 1VHSA 4BBHA 4RI1A 2Q04A 4XPDC 4YGOA 3NE7A 4H89A 4XNHC 2D4OA 4NEXA 1ON0A 4L89A 2OZGA 1S7NA 4A30A 2HV2A 3JUWA 2EUIA 2P0WA 2Y0MA 1S7FA 3PP9A 1J4JA 4NSQA 3SXNA 4B12A 4CGLA 4U9YA 1YR0A 4KZTA 2Z3PA 3TOBA 4QC6A 2GIVA 4OADA 1IICA 2B4BA 1YVOA 2NMTA 3D2PA 4PK2A 1Y9KA 2BSWA 4A31A 2DPTA 1CJWA 2VQYA 1Q2CA 3EXNA 3IU2A 1QSTA 1MK4A 3QAHA 2FE7A 4JXQA 5A28A 3A9LA 3WR7A 4CRZB 2FCKA 5KTCA 2YNDA 4FD6A 1KUYA 3LODA 2Z0ZA 2R7HA 1YGHA 2JDDA 1XF8A 1XE4A 5F48A 4QB9A 3T9YA 2B3VA 3BLNA 1L0CA 2AJ6A 5IB0A 3OWCA 3G8WA 4R3KA 4M3SA 4KOVA 1CM0A 4B5PA 1QSMA 4E0AA 5HH1A 5ISVA 2CNTA 5JPHA 2B5GB 1YREA 2QMLA 2B5GA 3SHPA 4QUSA 4KOWA 4K30A 2KCWA 4HNWB 4HNXB 1M4IA 3D8PA 4PSWA 3R95A 3DR6A 4MY3A 4B13A 3R1KA 4KOUA 3FB3A 4BMHA 3CXPA 4CAEA 2VXKA 3IWGA 4IUSA 5G1ZA 3F8KA 3R9GA 1NMTA 5AG4A 1WWZA 5A27A 2K5TA 2BEIA 1RO5A 4CYNA 4KLWA 3R96A 2IL4A 3EFAA 4X5KA 2R1IA 2R8VA 2FIWA 2Z3LA 2PQ8A 2PSWA 4F6AA 3IU1A 4UCMA 4JLYA 1BOBA 2A4NA 3I3GA 4MFZA 2B3UA 4UFWA 3S6HA 3FNCA 5JQ4A 1VKCA 4GS4A 4UFXA 2B58A 4KSAA 3TTHA 4B5OA 3TO6A 5F47A 3S6FA 4LUAA 3P2FA 2PR1A 4KOSA 5HMNA 5CNPA 3D3SA 2Z3KA 4R87A 2I00A 4CYOA 3F0AA 2R98A 3VWDA 4MJ8A 4PSXA 1P4NA 1LRZA 3DSBA 3FXTA 3GKRA 2Z3NA 2WSAA 4UWIA 4B11A 1Z4RA 4EVYA 1BO4A 1Q2YA 1SQHA 4II9A 3TCVA 5G21A 3ZZIA 1S5KA 3I9SA 1QSNA 5AG5A 3UY5A 2BL1A 2Q7BA 2OB0A 4C7IA 1P0HA 1N71A 1TIQA 2B4DB 4PV6A 2QIRA 2J8RA 3T90A 2Q4YA 4QBJA 1XEBA 1XIXA 2REEA 4MY0A 3KKWA 1S3ZA 3V8IA 4UFVA 4J3GA 3JTKA 2Q0YA 3QB8A 4MFPA 3DNSA 4UCPA 1NSLA 3TOAA 4R9MA 3R9EA 4B14A 1Q2DA 3EY5A 2GE3A 1S60A 3VWEA 1RXTA 3W6XA 3FBUA 3CXQA 2CNMA 3G3SA 3BJ8A 2RC4A 4ZGYB 3SXOA 1UFHA 2PR8A 4HKFA 2QECA 1WK4A 3B8GA 2B4DA 4KOTA 3E0KA 4E8OA 3TE4A 4ONUA 2DPSA 2P6GA 3H5ZA 1MJAA 5C82A 2C27A 3FYNA 3BJ7A 2REFA 4CYPA 2CNSA 2O28A 4KOYA 4MI4A 4C2YA 2YNEA 4KVXA 1S7KA 5H86A 2OU2A 1GHEA 2I79A 3H4QA 4KS9A 3IWEA 5I0CA 2Z3OA 3C26A 3D2MA 3DR8A 4KORA 2P6EA 4AB7A 4CAFA 4ZBGA 3ZJ0A 5KTAA 3FRMA 2VI7A 4AVCA 4ORFA 4AG7A 5BWAB 4XPDB 1S7LA 3R9FA 2Z3MA 3CXSA 2PDOA 2F5IA 4UWJA 1B87A 1M1DA 2J8MA 1IB1E 2HUZA 4NXYA 4MBUA 4C2XA 5AG7A 4Q36A 4F0YA 2CXAA 2FXFA 5EBVA 1IYKA 2JDCA 3GY9A 3PGPA 3S6KA 4M85A 2Q44A 1IYLA 1YK3A 4Y49B 4IF5A 4PK3A 4UCNA 5C88A 4H6UA 2Z10A 4KVOE 1I12A 2WUUA 4HNYB 4C2ZA 4JXRA 4R3LA 4MFLA 5IV0A 2X7BA 1YVKA 3MGDA 2PRBA 3TO9A 1MJBA 1M44A 2ARHA 5H84A 1ZO0A 3TO7A 2P6FA 4CYQA 1KUVA 5AG6A 4A95A 4YFJA 1Y9WA 3P2HA 2WPXA 4MHDA 4CS0B 4F0XA 4U9ZA 4JJXA 5G22A 1OZPA 4KUBA 3LD2A 3JVNA 1Z4EA 4XPKA 5J8FA 4A2ZA 2OH1A 2ZW4A 2JLMA 1V0CA 3S6GA 1R57A 2AE6A 3FIXA 3N7ZA 1M4DA 1Y7RA 2WPWA 4RS2A 4CGPA 1FY7A 2ZW6A 1PU9A 2GANA 4UBRA 4KLVA 2FSRA 2CY2A 4L8AA 1Z9UA 4C68A 1PUAA 1U6MA 4CGNA 4Y49C 4FD4A 5IX3A 2H5MA 4CAWA 1QSRA 2VZYA 2ZXVA 4A33A 1B6BA 4I49A 5AGEA 5G20A 2G3TA 2J8NA 2YNCA 5DWNA 1XMTA 4KVME 4E2AA 3IGRA 5F49A 1QSOA 1YX0A 4AG9A 3K9UA 4B5PB 5J8CA 4JWPA 5E96A 1NE9A 3EC4A 4AVBA 3W91A 4XNHB 4OAEA 4YRHA 2ZPAA 2VEZA 1M4GA 4DNCA 2FL4A 2FIAA 4KOXA 2G3AA 3W6SA 2VBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUA A;  1I21 A;  5EC4 A;  3EO4 A;  2JEV A;  3GYA A;  1MJ9 A;  2OZU A;  4FD5 A;  4H6Z A;  5KTD A;  4U5Y A;  4QVT A;  1I1D A;  4CAX A;  2D4P A;  4R57 A;  2Q4V A;  3DDD A;  1YLE A;  4LX9 A;  4FD7 A;  2VZZ A;  2OZH A;  1IID A;  4CRY B;  2Z11 A;  2ATR A;  5GCN A;  4UA3 A;  2DXQ A;  4JD6 A;  5FVJ A;  2PC1 A;  5F46 A;  3TT2 A;  2G0B A;  4NF1 A;  3PZJ A;  4CAV A;  4NCZ A;  2FS5 A;  4XPL A;  4AVA A;  2FT0 A;  2ZW7 A;  3RYO A;  4OLL A;  1KZF A;  2BUE A;  3F5B A;  2HQY A;  5DWM A;  2EVN A;  2ZW5 A;  1K4J A;  3TFY A;  1KUX A;  1VHS A;  4RI1 A;  2Q04 A;  4XPD C;  4YGO A;  3NE7 A;  4H89 A;  4XNH C;  2D4O A;  4NEX A;  1ON0 A;  4L89 A;  2OZG A;  1S7N A;  2HV2 A;  3JUW A;  2EUI A;  2P0W A;  2Y0M A;  1S7F A;  3PP9 A;  1J4J A;  4NSQ A;  3SXN A;  4U9Y A;  1YR0 A;  4KZT A;  3TOB A;  4QC6 A;  2GIV A;  4OAD A;  1IIC A;  2B4B A;  1YVO A;  2NMT A;  3D2P A;  4PK2 A;  1Y9K A;  2BSW A;  1CJW A;  2VQY A;  1Q2C A;  3EXN A;  1QST A;  1MK4 A;  3QAH A;  2FE7 A;  4JXQ A;  3WR7 A;  4CRZ B;  2FCK A;  5KTC A;  4FD6 A;  1KUY A;  3LOD A;  2Z0Z A;  2R7H A;  1YGH A;  2JDD A;  1XF8 A;  1XE4 A;  5F48 A;  4QB9 A;  3T9Y A;  2B3V A;  3BLN A;  1L0C A;  2AJ6 A;  5IB0 A;  3OWC A;  3G8W A;  4R3K A;  4M3S A;  4KOV A;  1CM0 A;  4B5P A;  1QSM A;  4E0A A;  5HH1 A;  5ISV A;  2CNT A;  5JPH A;  2B5G B;  1YRE A;  2QML A;  2B5G A;  3SHP A;  4QUS A;  4KOW A;  4K30 A;  2KCW A;  4HNW B;  4HNX B;  1M4I A;  3D8P A;  4PSW A;  3R95 A;  3DR6 A;  4MY3 A;  3R1K A;  4KOU A;  3FB3 A;  4BMH A;  3CXP A;  2VXK A;  3IWG A;  4IUS A;  3F8K A;  3R9G A;  1NMT A;  1WWZ A;  2K5T A;  2BEI A;  1RO5 A;  4KLW A;  3R96 A;  2IL4 A;  3EFA A;  4X5K A;  2R1I A;  2R8V A;  2FIW A;  2PQ8 A;  2PSW A;  4F6A A;  4JLY A;  1BOB A;  2A4N A;  3I3G A;  2B3U A;  3S6H A;  3FNC A;  5JQ4 A;  1VKC A;  4GS4 A;  2B58 A;  3TTH A;  4B5O A;  3TO6 A;  5F47 A;  3S6F A;  4LUA A;  3P2F A;  2PR1 A;  4KOS A;  5HMN A;  5CNP A;  3D3S A;  4R87 A;  2I00 A;  3F0A A;  2R98 A;  3VWD A;  4MJ8 A;  4PSX A;  1P4N A;  1LRZ A;  3DSB A;  3FXT A;  3GKR A;  4UWI A;  1Z4R A;  4EVY A;  1BO4 A;  1Q2Y A;  1SQH A;  4II9 A;  3TCV A;  3ZZI A;  1S5K A;  3I9S A;  1QSN A;  3UY5 A;  2BL1 A;  2Q7B A;  2OB0 A;  1P0H A;  1N71 A;  1TIQ A;  2B4D B;  4PV6 A;  2QIR A;  2J8R A;  3T90 A;  2Q4Y A;  4QBJ A;  1XEB A;  1XIX A;  2REE A;  4MY0 A;  3KKW A;  1S3Z A;  3V8I A;  4J3G A;  2Q0Y A;  3QB8 A;  3DNS A;  1NSL A;  3TOA A;  4R9M A;  3R9E A;  1Q2D A;  3EY5 A;  2GE3 A;  1S60 A;  3VWE A;  1RXT A;  3W6X A;  3FBU A;  3CXQ A;  2CNM A;  3G3S A;  3BJ8 A;  2RC4 A;  3SXO A;  1UFH A;  2PR8 A;  4HKF A;  2QEC A;  1WK4 A;  3B8G A;  2B4D A;  4KOT A;  3E0K A;  4E8O A;  3TE4 A;  4ONU A;  2P6G A;  1MJA A;  5C82 A;  2C27 A;  3FYN A;  3BJ7 A;  2REF A;  2CNS A;  2O28 A;  4KOY A;  4MI4 A;  4KVX A;  1S7K A;  5H86 A;  2OU2 A;  1GHE A;  2I79 A;  3H4Q A;  5I0C A;  3C26 A;  3D2M A;  3DR8 A;  4KOR A;  2P6E A;  4AB7 A;  4ZBG A;  3ZJ0 A;  5KTA A;  3FRM A;  2VI7 A;  4AVC A;  4ORF A;  4AG7 A;  4XPD B;  1S7L A;  3R9F A;  3CXS A;  2PDO A;  2F5I A;  4UWJ A;  1B87 A;  1M1D A;  2J8M A;  1IB1 E;  2HUZ A;  4NXY A;  4MBU A;  4F0Y A;  2FXF A;  5EBV A;  1IYK A;  2JDC A;  3GY9 A;  3PGP A;  3S6K A;  4M85 A;  2Q44 A;  1IYL A;  1YK3 A;  4Y49 B;  4IF5 A;  4PK3 A;  5C88 A;  4H6U A;  2Z10 A;  4KVO E;  1I12 A;  4HNY B;  4JXR A;  4R3L A;  5IV0 A;  2X7B A;  1YVK A;  3MGD A;  2PRB A;  3TO9 A;  1MJB A;  1M44 A;  2ARH A;  5H84 A;  3TO7 A;  2P6F A;  1KUV A;  4YFJ A;  1Y9W A;  3P2H A;  2WPX A;  4MHD A;  4CS0 B;  4U9Z A;  4JJX A;  1OZP A;  4KUB A;  3LD2 A;  3JVN A;  1Z4E A;  4XPK A;  5J8F A;  2OH1 A;  2ZW4 A;  2JLM A;  1V0C A;  3S6G A;  1R57 A;  2AE6 A;  3FIX A;  3N7Z A;  1M4D A;  1Y7R A;  2WPW A;  4RS2 A;  1FY7 A;  2ZW6 A;  1PU9 A;  2GAN A;  4UBR A;  4KLV A;  2FSR A;  2CY2 A;  4L8A A;  1Z9U A;  1PUA A;  1U6M A;  4Y49 C;  4FD4 A;  5IX3 A;  2H5M A;  4CAW A;  1QSR A;  2VZY A;  2ZXV A;  1B6B A;  4I49 A;  2G3T A;  2J8N A;  5DWN A;  1XMT A;  4KVM E;  4E2A A;  3IGR A;  5F49 A;  1QSO A;  1YX0 A;  4AG9 A;  3K9U A;  4B5P B;  5J8C A;  4JWP A;  5E96 A;  1NE9 A;  3EC4 A;  4AVB A;  3W91 A;  4XNH B;  4OAE A;  4YRH A;  2ZPA A;  2VEZ A;  1M4G A;  4DNC A;  2FL4 A;  2FIA A;  4KOX A;  2G3A A;  3W6S A;  2VBQ A; 
#chains in the Genus database with same CATH topology
 5THW A;  2YGW A;  4Q38 A;  4PXE A;  3N5F A;  1IOF A;  4KUA A;  4WJB A;  4LQ6 A;  1I21 A;  3KR5 A;  5EC4 A;  5F09 A;  4NFR A;  1R3N A;  2NYQ A;  2JEV A;  3EO4 A;  3GYA A;  1MJ9 A;  2OZU A;  2C1C A;  4CPA A;  4MFQ A;  1FT7 A;  4FD5 A;  4H6Z A;  5KTD A;  4U5Y A;  5JGF A;  4ZY2 A;  4QVT A;  4CGO A;  1I1D A;  2FVG A;  4NGS A;  4CAX A;  2D4P A;  4PXD A;  4CGM A;  3CDX A;  4R57 A;  2Q4V A;  4B10 A;  3DDD A;  1YLE A;  4LX9 A;  4FD7 A;  4Q7A A;  4NJQ A;  3PB6 X;  2VZZ A;  2OZH A;  1IID A;  4UIB A;  4C7H A;  4CRY B;  2Z11 A;  4P4J A;  2ATR A;  5GCN A;  4UA3 A;  1BLL E;  2DXQ A;  4NGQ A;  4P4I A;  4JD6 A;  5FVJ A;  2PC1 A;  5F46 A;  2PVV A;  3TT2 A;  2G0B A;  4GXH A;  4OIW A;  4NF1 A;  3PZJ A;  1AMP A;  3HLP A;  4NCZ A;  2PJA A;  4MHN A;  1Z5R A;  2FS5 A;  2YNC C;  4CAV A;  4FBE A;  1LFW A;  4XPL A;  4AVA A;  2FT0 A;  2ZW7 A;  3QNV A;  3RYO A;  4OLL A;  1KZF A;  2BUE A;  3F5B A;  2HQY A;  4MFK A;  5DWM A;  4KSF A;  4A32 A;  2EVN A;  2ZW5 A;  1K4J A;  4MFJ A;  2XEF A;  3L2N A;  1KUX A;  4W9Y A;  4ZX8 A;  3TFY A;  1VHS A;  4BBH A;  3HUV A;  3KI9 A;  4RI1 A;  2Q04 A;  4XPD C;  4YGO A;  1M4L A;  3NE7 A;  4OC2 A;  4H89 A;  4FWU A;  4XNH C;  2D4O A;  4NEX A;  1ON0 A;  4L89 A;  2OZG A;  1S7N A;  4A30 A;  1HEE A;  2HV2 A;  3JUW A;  2C6C A;  2EUI A;  1CBX A;  2P0W A;  1VGY A;  2Y0M A;  3FJU A;  1S7F A;  3PP9 A;  4OC0 A;  1J4J A;  4NSQ A;  3LMS A;  3FX6 A;  3SXN A;  3GLJ A;  1Z8X A;  4O23 A;  4B12 A;  4CGL A;  5DS0 A;  4U9Y A;  3FEC A;  2AFU A;  1YR0 A;  4KZT A;  2Z3P A;  3FMC A;  3TOB A;  4NGR A;  4QC6 A;  5K8O A;  2GIV A;  1UWY A;  4OAD A;  1IIC A;  2NMT A;  2B4B A;  1YVO A;  3D2P A;  3NH4 A;  4PK2 A;  1Y9K A;  2BSW A;  2GRE A;  4A31 A;  2DPT A;  1CJW A;  2VQY A;  1Q2C A;  3EXN A;  3IU2 A;  2V77 A;  3SJE A;  1HDU A;  1QST A;  1BPM A;  2ZOG A;  1MK4 A;  2ZEP A;  3QAH A;  4R76 A;  2FE7 A;  4JXQ A;  4DJL A;  3A9L A;  1AYE A;  4IHM A;  2BCO A;  3WR7 A;  4CRZ B;  5A28 A;  2FCK A;  2CIJ A;  5KTC A;  5LYL A;  1X10 A;  2YND A;  4FD6 A;  1KUY A;  4OME A;  3LOD A;  2C6P A;  2Z0Z A;  2R7H A;  3SJG A;  1YGH A;  4A37 A;  2JDD A;  1XF8 A;  1XE4 A;  4ONW A;  4QB9 A;  5F48 A;  3T9Y A;  2PIY A;  4MHY A;  5HXD A;  2B3V A;  3BLN A;  1L0C A;  2AJ6 A;  3BHX A;  4ZI6 A;  3OWC A;  5IB0 A;  3G8W A;  4R3K A;  2O53 A;  4M3S A;  4KOV A;  3DLJ A;  3PBB A;  4Z65 A;  4TWE A;  1CM0 A;  3NH5 A;  4B5P A;  1QSM A;  3CPA A;  1LAM A;  1PCA A;  4P4E A;  5LYI A;  4E0A A;  1RTQ A;  4ZX9 A;  5HH1 A;  5ISV A;  2CNT A;  3CT9 A;  5JPH A;  2B5G B;  1YRE A;  2ZEH A;  3FF3 A;  8CPA A;  4ZY0 A;  2QML A;  2B5G A;  4P4D A;  4PPZ A;  3SHP A;  1QQ9 A;  2CTB A;  4QUS A;  2PJB A;  4KOW A;  3RBU A;  4OKO A;  1ARL A;  2PJC A;  4K30 A;  2KCW A;  4HNW B;  3QAY A;  4HNX B;  1M4I A;  2Q7S A;  1Y0R A;  3D8P A;  4PSW A;  3D66 A;  2PJ1 A;  3R95 A;  3DR6 A;  3B3W A;  3H8E A;  3I1U A;  4MY3 A;  4OID A;  4IAV A;  3R1K A;  1A2Z A;  1YLO A;  3B7I A;  3D7G A;  4OC5 A;  1EE3 P;  4KOU A;  3FB3 A;  4PXB A;  4P10 A;  3CXP A;  4BMH A;  1YW6 A;  3SI1 A;  5K8N A;  3KAS A;  3KQZ A;  4CAE A;  2VXK A;  3KL9 A;  2NSM A;  3IWG A;  4IUS A;  5G1Z A;  3F8K A;  3V38 A;  3NFZ A;  3R9G A;  1NMT A;  3TX8 A;  5AG4 A;  5J1Q A;  1AUG A;  4MXU A;  5ELY A;  4H2K A;  1WWZ A;  2CF4 A;  1F57 A;  3IIB A;  2K5T A;  4WWV A;  5A27 A;  2BEI A;  2RFH A;  2XEJ A;  1DE4 C;  1RO5 A;  4CYN A;  4F9V A;  4KLW A;  3R96 A;  2IL4 A;  3RNZ A;  3EFA A;  4NGN A;  4X5K A;  1Q7L A;  2AFO A;  3WT4 A;  2Q43 A;  5K8M A;  2R1I A;  2R8V A;  4F8Z A;  2FIW A;  3KZW A;  2Z3L A;  2PQ8 A;  2PSW A;  1XJO A;  5I4M A;  1ZG9 A;  4MCR A;  3IU1 A;  4UCM A;  4F6A A;  4JLY A;  1BOB A;  2A4N A;  3SI0 A;  2BOA A;  3I3G A;  2B3U A;  4MFZ A;  4UFW A;  3S6H A;  3FNC A;  5HVH A;  4P6Y A;  5JQ4 A;  3S9N A;  1VKC A;  4OC4 A;  4GS4 A;  1BPN A;  2B58 A;  2F7V A;  4KSA A;  4UFX A;  2QVP A;  4GM5 A;  3TTH A;  4B5O A;  4YU9 A;  3TO6 A;  5F47 A;  3S6F A;  4LUA A;  2PIZ A;  3P2F A;  2PR1 A;  4KOS A;  5HMN A;  2HC9 A;  4X8I A;  5CNP A;  4BIN A;  4BD9 A;  3D3S A;  4M6G A;  2Z3K A;  4R87 A;  3ISZ A;  2I00 A;  3T8W A;  3D68 A;  4UF4 A;  4R7M A;  1F2O A;  2EK9 A;  2QJ8 A;  1YSJ A;  4CYO A;  3F0A A;  2R98 A;  3VWD A;  3IC1 A;  4MJ8 A;  2AFX A;  1Z8W A;  2ZEF A;  4PSX A;  3PB7 X;  1P4N A;  1LRZ A;  3DSB A;  3FXT A;  3GKR A;  3RO0 A;  1XBU A;  5CBM A;  2Z3N A;  2POK A;  2GU2 A;  2WSA A;  4UWI A;  2PJ7 A;  1Z4R A;  2EK8 A;  4B11 A;  3GUX A;  4EVY A;  1BO4 A;  1Q2Y A;  3D7H A;  1SQH A;  4II9 A;  3TCV A;  5G21 A;  3ZZI A;  1CX8 A;  1XOV A;  2ANP A;  1S5K A;  5HVG A;  4A94 A;  3I9S A;  7CPA A;  1QSN A;  4P45 A;  4HPS A;  5AG5 A;  3UY5 A;  2BL1 A;  2Q7B A;  2OB0 A;  4C7I A;  4DYO A;  1P0H A;  1HDQ A;  2ZEE A;  1N71 A;  1TIQ A;  2RB7 A;  2JBK A;  2B4D B;  2PE3 A;  4PV6 A;  2QIR A;  2J8R A;  1NSA A;  2PJ4 A;  3T90 A;  2Q4Y A;  3FED A;  4QBJ A;  1XEB A;  1XIX A;  2REE A;  2BO9 A;  4MY0 A;  3KKW A;  1S3Z A;  4YWY A;  4MHZ A;  3V8I A;  4UFV A;  4J3G A;  3JTK A;  3ISX A;  4NGP A;  2Q0Y A;  3QB8 A;  4MFP A;  3DNS A;  4UCP A;  1IU8 A;  1NSL A;  2O4H A;  3V7Z A;  3TOA A;  4R9M A;  3MRU A;  3R9E A;  4B14 A;  1Q2D A;  3EY5 A;  2GE3 A;  1S60 A;  1IGB A;  3VAT A;  3VWE A;  1RXT A;  3SJF A;  3W6X A;  3K9T A;  3FBU A;  4X2T A;  4MRI A;  1ELL P;  4OC3 A;  4PQA A;  3CXQ A;  2CNM A;  3G3S A;  6CPA A;  3BJ8 A;  2RC4 A;  3B2Y A;  5D8N A;  3VH9 A;  2PJ0 A;  4ZGY B;  4K3N A;  3SXO A;  3D7F A;  3PEI A;  3WC5 A;  1ELM P;  1UFH A;  2AFW A;  4AXV A;  2PR8 A;  4HKF A;  2QEC A;  5HVF A;  4RUH A;  1WK4 A;  3B8G A;  2B4D A;  4P44 A;  2C6G A;  4KOT A;  3E0K A;  4E8O A;  3TE4 A;  4ONU A;  2DPS A;  1TKF A;  2P6G A;  1MJA A;  3H5Z A;  3VAR A;  5C82 A;  2AFS A;  2IJZ A;  2V8D A;  3WAB A;  2C27 A;  3WC7 A;  1VHE A;  2ZOF A;  4G1P A;  2PJ5 A;  3RZA A;  3FYN A;  3BJ7 A;  2REF A;  4CYP A;  2CNS A;  2O28 A;  4KOY A;  2PVW A;  3H8F A;  5LRK A;  3B3S A;  4EME A;  1FNO A;  4MI4 A;  4C2Y A;  2Q4Z A;  2YNE A;  3S9M A;  1ZG8 A;  2J9A A;  2OOT A;  4LQG A;  3KGQ A;  1IY7 A;  1H8L A;  4KVX A;  1S7K A;  5H86 A;  2OU2 A;  1GHE A;  2I79 A;  3H4Q A;  4IK2 A;  4KS9 A;  3SJX A;  2AFZ A;  2Q51 A;  3IO1 A;  3IWE A;  4MMO A;  1CP6 A;  3NA6 A;  5I0C A;  2Z3O A;  3C26 A;  2HB6 A;  2WZN A;  2ZEO A;  3D2M A;  1XRY A;  2ZED A;  3DR8 A;  3KHZ A;  2P6E A;  3PFE A;  4KOR A;  1TF9 A;  4AB7 A;  4CAF A;  1Z2L A;  3LWU A;  4ZBG A;  3ZJ0 A;  3NH8 A;  5KTA A;  3FRM A;  2VI7 A;  1JWQ A;  3B3T A;  4AVC A;  1ZLH A;  2QYV A;  4ORF A;  4AG7 A;  2GLJ A;  5BWA B;  4XPD B;  5JM6 A;  2V8H A;  1S7L A;  2JBJ A;  3R9F A;  1CG2 A;  1JQG A;  2GFQ A;  4MCP A;  2Z3M A;  2EWB A;  3CXS A;  3D4U A;  2ZEG A;  1LAP A;  2PDO A;  1XFO A;  2F5I A;  2ZEM A;  4UWJ A;  1GYT A;  5LRG A;  1B87 A;  2PCU A;  1M1D A;  2J8M A;  1IB1 E;  1R43 A;  2HUZ A;  4NXY A;  4MBU A;  4C2X A;  5AG7 A;  4Q36 A;  3S9L A;  4F0Y A;  3FH4 A;  2CXA A;  1TKH A;  2FXF A;  3PBE A;  5EBV A;  3TC8 A;  1IYK A;  2JDC A;  1CPX A;  3NE8 A;  5K8P A;  3GY9 A;  3PGP A;  3S6K A;  4M85 A;  2Q44 A;  1IYL A;  4MHP A;  1YK3 A;  2G9D A;  4Y49 B;  1CP7 A;  4FAI A;  4IF5 A;  4PK3 A;  4UCN A;  5C88 A;  4H6U A;  2Z10 A;  2PJ8 A;  4KVO E;  1I12 A;  5EMI A;  2OR4 A;  2V8V A;  1F2P A;  4MCQ A;  2WUU A;  4HNY B;  4C2Z A;  4JXR A;  4R3L A;  4MFL A;  5IV0 A;  2X7B A;  1YVK A;  3MGD A;  4JYW A;  4UEF A;  2PRB A;  1CPS A;  3TO9 A;  1MJB A;  3JRU A;  2F8H A;  1M44 A;  1Y0Y A;  2ARH A;  1IOI A;  3FEE A;  4P4F A;  4EWT A;  5H84 A;  1ZO0 A;  3BI0 A;  3D67 A;  3K2K A;  3TO7 A;  2P6F A;  4B6Z A;  1KUV A;  5AG6 A;  4CYQ A;  3LAC A;  4MCS A;  4A95 A;  3WC6 A;  1Z8L A;  2GLF A;  4YFJ A;  1ARM A;  1Y9W A;  4A38 A;  3P2H A;  2WPX A;  2EO8 A;  1TKJ A;  3KR4 A;  2PRQ A;  1LAN A;  3KHX A;  4MHD A;  3IJ3 A;  4CS0 B;  3MN8 A;  4F0X A;  5LYD A;  4U9Z A;  4JJX A;  2JEW A;  1TXR A;  5G22 A;  1OZP A;  4KUB A;  1YQE A;  4ZY1 A;  3LD2 A;  2XEI A;  2IMO A;  3JVN A;  4KSI A;  1Z4E A;  4XPK A;  3DGV A;  1OBR A;  1YW4 A;  3B3C A;  5J8F A;  4B13 A;  1VHO A;  2OH1 A;  2ZEL A;  4A2Z A;  2ZW4 A;  2JLM A;  1V0C A;  3B35 A;  3CZX A;  3S6G A;  2PJ3 A;  1R57 A;  2ZEN A;  4NGM A;  2AE6 A;  3FIX A;  1Z8T A;  3PB4 X;  4M6I A;  2VL1 A;  4TNU A;  2DEA A;  3N7Z A;  1M4D A;  3PRT A;  4EFD A;  1Y7R A;  4PXC A;  2WPW A;  4ZYQ A;  1ZG7 A;  2WYR A;  4RS2 A;  4CGP A;  1Y7E A;  1FY7 A;  2ZW6 A;  3IWW A;  1PU9 A;  4DUK A;  5IB9 A;  2GAN A;  4UBR A;  4RN7 A;  4KLV A;  2FSR A;  1X12 A;  2CY2 A;  2PJ9 A;  4L8A A;  1LCP A;  2DF5 A;  1Z9U A;  3B3V A;  4C68 A;  3IEH A;  4R6T A;  1PUA A;  1U6M A;  3D7D A;  4A39 A;  4CGN A;  4Y49 C;  3GB0 A;  1ZLI A;  3H8G A;  4FD4 A;  4F9U A;  5IX3 A;  2H5M A;  4CAW A;  4UEZ A;  1TF8 A;  2AFM A;  3BXM A;  1QSR A;  1VIX A;  2VZY A;  2ZXV A;  4UIA A;  5D29 A;  4A33 A;  2XEG A;  1DTD A;  1B6B A;  4I49 A;  5AGE A;  2ABZ A;  3PFO A;  2G3T A;  2J8N A;  5G20 A;  2YNC A;  1YME A;  2CTC A;  1BAV A;  5DWN A;  1LOK A;  4X3R A;  1XMT A;  4KVM E;  4E2A A;  3IGR A;  4FUU A;  2ODF A;  5F49 A;  3GIU A;  1QSO A;  1YX0 A;  2EBJ A;  4UEE A;  4AG9 A;  3K9U A;  2PJ6 A;  1QMU A;  4R8F A;  3PB9 X;  2IQ6 A;  3FVL A;  3SI2 A;  4B5P B;  5J8C A;  1PYT B;  4JWP A;  5E96 A;  5JH9 A;  1NE9 A;  3EC4 A;  3RAM A;  4AVB A;  4NGT A;  3W91 A;  4M6H A;  4XNH B;  5CPA A;  4OAE A;  4P4B A;  5LRJ A;  2I3C A;  1KWM A;  3BI1 A;  4OC1 A;  4YRH A;  5LYF A;  2ZPA A;  2VEZ A;  4NJR A;  1XMB A;  1M4G A;  4DNC A;  3CPX A;  2FL4 A;  2FIA A;  4KOX A;  2G3A A;  2V8G A;  3PB8 X;  4OP4 A;  4JZ0 A;  3W6S A;  2PJ2 A;  3IFE A;  2VBQ A;  3KQX A; 
#chains in the Genus database with same CATH homology
 2YGW A;  4Q38 A;  4KUA A;  1I21 A;  5EC4 A;  3EO4 A;  2JEV A;  3GYA A;  1MJ9 A;  2OZU A;  4MFQ A;  4FD5 A;  4H6Z A;  5KTD A;  4U5Y A;  4QVT A;  4CGO A;  1I1D A;  4CAX A;  2D4P A;  4CGM A;  4R57 A;  2Q4V A;  4B10 A;  3DDD A;  1YLE A;  4LX9 A;  4FD7 A;  2VZZ A;  2OZH A;  1IID A;  4C7H A;  4CRY B;  2Z11 A;  2ATR A;  5GCN A;  4UA3 A;  2DXQ A;  4JD6 A;  5FVJ A;  2PC1 A;  5F46 A;  3TT2 A;  2G0B A;  4NF1 A;  3PZJ A;  4CAV A;  4NCZ A;  2YNC C;  2FS5 A;  4XPL A;  4AVA A;  2FT0 A;  2ZW7 A;  3RYO A;  4OLL A;  1KZF A;  2BUE A;  3F5B A;  2HQY A;  4MFK A;  5DWM A;  4KSF A;  4A32 A;  2EVN A;  2ZW5 A;  1K4J A;  4MFJ A;  3TFY A;  1KUX A;  1VHS A;  4BBH A;  4RI1 A;  2Q04 A;  4XPD C;  4YGO A;  3NE7 A;  4H89 A;  4XNH C;  2D4O A;  4NEX A;  1ON0 A;  4L89 A;  2OZG A;  1S7N A;  4A30 A;  2HV2 A;  3JUW A;  2EUI A;  2P0W A;  2Y0M A;  1S7F A;  3PP9 A;  1J4J A;  4NSQ A;  3SXN A;  4B12 A;  4CGL A;  4U9Y A;  1YR0 A;  4KZT A;  2Z3P A;  3TOB A;  4QC6 A;  2GIV A;  4OAD A;  1IIC A;  2B4B A;  1YVO A;  2NMT A;  3D2P A;  4PK2 A;  1Y9K A;  2BSW A;  4A31 A;  2DPT A;  1CJW A;  2VQY A;  1Q2C A;  3EXN A;  3IU2 A;  1QST A;  1MK4 A;  3QAH A;  2FE7 A;  4JXQ A;  5A28 A;  3A9L A;  3WR7 A;  4CRZ B;  2FCK A;  5KTC A;  2YND A;  4FD6 A;  1KUY A;  3LOD A;  2Z0Z A;  2R7H A;  1YGH A;  2JDD A;  1XF8 A;  1XE4 A;  5F48 A;  4QB9 A;  3T9Y A;  2B3V A;  3BLN A;  1L0C A;  2AJ6 A;  5IB0 A;  3OWC A;  3G8W A;  4R3K A;  4M3S A;  4KOV A;  1CM0 A;  4B5P A;  1QSM A;  4E0A A;  5HH1 A;  5ISV A;  2CNT A;  5JPH A;  2B5G B;  1YRE A;  2QML A;  2B5G A;  3SHP A;  4QUS A;  4KOW A;  4K30 A;  2KCW A;  4HNW B;  4HNX B;  1M4I A;  3D8P A;  4PSW A;  3R95 A;  3DR6 A;  4MY3 A;  4B13 A;  3R1K A;  4KOU A;  3FB3 A;  4BMH A;  3CXP A;  4CAE A;  2VXK A;  3IWG A;  4IUS A;  5G1Z A;  3F8K A;  3R9G A;  1NMT A;  5AG4 A;  1WWZ A;  5A27 A;  2K5T A;  2BEI A;  1RO5 A;  4CYN A;  4KLW A;  3R96 A;  2IL4 A;  3EFA A;  4X5K A;  2R1I A;  2R8V A;  2FIW A;  2Z3L A;  2PQ8 A;  2PSW A;  4F6A A;  3IU1 A;  4UCM A;  4JLY A;  1BOB A;  2A4N A;  3I3G A;  4MFZ A;  2B3U A;  4UFW A;  3S6H A;  3FNC A;  5JQ4 A;  1VKC A;  4GS4 A;  4UFX A;  2B58 A;  4KSA A;  3TTH A;  4B5O A;  3TO6 A;  5F47 A;  3S6F A;  4LUA A;  3P2F A;  2PR1 A;  4KOS A;  5HMN A;  5CNP A;  3D3S A;  2Z3K A;  4R87 A;  2I00 A;  4CYO A;  3F0A A;  2R98 A;  3VWD A;  4MJ8 A;  4PSX A;  1P4N A;  1LRZ A;  3DSB A;  3FXT A;  3GKR A;  2Z3N A;  2WSA A;  4UWI A;  4B11 A;  1Z4R A;  4EVY A;  1BO4 A;  1Q2Y A;  1SQH A;  4II9 A;  3TCV A;  5G21 A;  3ZZI A;  1S5K A;  3I9S A;  1QSN A;  5AG5 A;  3UY5 A;  2BL1 A;  2Q7B A;  2OB0 A;  4C7I A;  1P0H A;  1N71 A;  1TIQ A;  2B4D B;  4PV6 A;  2QIR A;  2J8R A;  3T90 A;  2Q4Y A;  4QBJ A;  1XEB A;  1XIX A;  2REE A;  4MY0 A;  3KKW A;  1S3Z A;  3V8I A;  4UFV A;  4J3G A;  3JTK A;  2Q0Y A;  3QB8 A;  4MFP A;  3DNS A;  4UCP A;  1NSL A;  3TOA A;  4R9M A;  3R9E A;  4B14 A;  1Q2D A;  3EY5 A;  2GE3 A;  1S60 A;  3VWE A;  1RXT A;  3W6X A;  3FBU A;  3CXQ A;  2CNM A;  3G3S A;  3BJ8 A;  2RC4 A;  4ZGY B;  3SXO A;  1UFH A;  2PR8 A;  4HKF A;  2QEC A;  1WK4 A;  3B8G A;  2B4D A;  4KOT A;  3E0K A;  4E8O A;  3TE4 A;  4ONU A;  2DPS A;  2P6G A;  3H5Z A;  1MJA A;  5C82 A;  2C27 A;  3FYN A;  3BJ7 A;  2REF A;  4CYP A;  2CNS A;  2O28 A;  4KOY A;  4MI4 A;  4C2Y A;  2YNE A;  4KVX A;  1S7K A;  5H86 A;  2OU2 A;  1GHE A;  2I79 A;  3H4Q A;  4KS9 A;  3IWE A;  5I0C A;  2Z3O A;  3C26 A;  3D2M A;  3DR8 A;  4KOR A;  2P6E A;  4AB7 A;  4CAF A;  4ZBG A;  3ZJ0 A;  5KTA A;  3FRM A;  2VI7 A;  4AVC A;  4ORF A;  4AG7 A;  5BWA B;  4XPD B;  1S7L A;  3R9F A;  2Z3M A;  3CXS A;  2PDO A;  2F5I A;  4UWJ A;  1B87 A;  1M1D A;  2J8M A;  1IB1 E;  2HUZ A;  4NXY A;  4MBU A;  4C2X A;  5AG7 A;  4Q36 A;  4F0Y A;  2CXA A;  2FXF A;  5EBV A;  1IYK A;  2JDC A;  3GY9 A;  3PGP A;  3S6K A;  4M85 A;  2Q44 A;  1IYL A;  1YK3 A;  4Y49 B;  4IF5 A;  4PK3 A;  4UCN A;  5C88 A;  4H6U A;  2Z10 A;  4KVO E;  1I12 A;  2WUU A;  4HNY B;  4C2Z A;  4JXR A;  4R3L A;  4MFL A;  5IV0 A;  2X7B A;  1YVK A;  3MGD A;  2PRB A;  3TO9 A;  1MJB A;  1M44 A;  2ARH A;  5H84 A;  1ZO0 A;  3TO7 A;  2P6F A;  4CYQ A;  1KUV A;  5AG6 A;  4A95 A;  4YFJ A;  1Y9W A;  3P2H A;  2WPX A;  4MHD A;  4CS0 B;  4F0X A;  4U9Z A;  4JJX A;  5G22 A;  1OZP A;  4KUB A;  3LD2 A;  3JVN A;  1Z4E A;  4XPK A;  5J8F A;  4A2Z A;  2OH1 A;  2ZW4 A;  2JLM A;  1V0C A;  3S6G A;  1R57 A;  2AE6 A;  3FIX A;  3N7Z A;  1M4D A;  1Y7R A;  2WPW A;  4RS2 A;  4CGP A;  1FY7 A;  2ZW6 A;  1PU9 A;  2GAN A;  4UBR A;  4KLV A;  2FSR A;  2CY2 A;  4L8A A;  1Z9U A;  4C68 A;  1PUA A;  1U6M A;  4CGN A;  4Y49 C;  4FD4 A;  5IX3 A;  2H5M A;  4CAW A;  1QSR A;  2VZY A;  2ZXV A;  4A33 A;  1B6B A;  4I49 A;  5AGE A;  5G20 A;  2G3T A;  2J8N A;  2YNC A;  5DWN A;  1XMT A;  4KVM E;  4E2A A;  3IGR A;  5F49 A;  1QSO A;  1YX0 A;  4AG9 A;  3K9U A;  4B5P B;  5J8C A;  4JWP A;  5E96 A;  1NE9 A;  3EC4 A;  4AVB A;  3W91 A;  4XNH B;  4OAE A;  4YRH A;  2ZPA A;  2VEZ A;  1M4G A;  4DNC A;  2FL4 A;  2FIA A;  4KOX A;  2G3A A;  3W6S A;  2VBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...