2IL4A

Crystal structure of at1g77540-coenzyme a complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
b'PKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein At1g77540
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 25
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2il4A00
1M1DA 1KUVA 4KUAA 5F47A 2HQYA 3FRMA 4B5PB 2O28A 5H84A 3LD2A 2WPWA 3VWEA 4MI4A 1YR0A 2B4DB 2JEVA 2JDCA 2PRBA 1Q2DA 2VZZA 2HV2A 3EFAA 4XPKA 3KKWA 2GE3A 1IYKA 1KUXA 4ORFA 2B5GA 5DWMA 1WWZA 3IWGA 2EVNA 2I79A 4OAEA 2REFA 2VZYA 3V8IA 1Q2CA 1P4NA 1QSNA 1S7KA 1SQHA 2JDDA 1IICA 1S3ZA 4I49A 5DWNA 3R96A 3R95A 4GS4A 4Y49B 3EC4A 3T9YA 2BUEA 3DR6A 3E0KA 4UBRA 1XIXA 4Y49C 1Q2YA 4B5PA 4J3GA 2FT0A 2B4DA 2OZUA 3TCVA 5F48A 1CJWA 5E96A 4PSWA 3DSBA 1PUAA 1GHEA 5I0CA 2OB0A 4CS0B 4ONUA 1K4JA 1PU9A 3N7ZA 1NE9A 4FD7A 1ON0A 2QECA 3MGDA 2B58A 1UFHA 4XPDB 3W6XA 2QMLA 1BOBA 2K5TA 4KZTA 4KOWA 1P0HA 4XPDC 1B6BA 2Q4YA 2GIVA 2IL4A 5JQ4A 4JD6A 3TO7A 3ZZIA 4QBJA 1VKCA 1S7NA 3T90A 4YRHA 1YGHA 2VQYA 3NE7A 4JWPA 2B4BA 4BMHA 4EVYA 3R1KA 2PSWA 4JJXA 2G3TA 2RC4A 1IIDA 5KTDA 4U9ZA 2QIRA 4QUSA 1XEBA 1NSLA 1S60A 4KVOE 2Z0ZA 3R9EA 5ISVA 1M4GA 3FIXA 4H89A 1YX0A 3FBUA 3TT2A 2C27A 1I21A 4AG7A 2Z10A 5JPHA 4HKFA 4L89A 3TOAA 4IF5A 1XE4A 2R8VA 4H6ZA 2ZW7A 2DXQA 1IB1E 2ZPAA 2BL1A 2PR8A 4PK3A 2J8NA 2Q0YA 4R3KA 3R9FA 3BJ8A 3BLNA 3D2MA 2P0WA 1N71A 3TO6A 2EUIA 4R57A 2JLMA 4AVCA 2CNSA 2R98A 1M4IA 3P2HA 4PV6A 2OH1A 4HNYB 1TIQA 3RYOA 4LUAA 3GKRA 2VXKA 3B8GA 1MJ9A 1QSRA 1S7FA 2HUZA 4M85A 1NMTA 5J8CA 4KORA 2CNTA 3S6KA 4HNWB 3H4QA 3ZJ0A 4CAXA 3QB8A 5KTAA 3TOBA 3PP9A 4E2AA 2BEIA 2Q44A 1BO4A 4UWJA 3D3SA 2A4NA 4RS2A 4MY3A 5IV0A 1Z4EA 2R7HA 4QC6A 2FCKA 3F8KA 2PQ8A 4JLYA 3EY5A 3I3GA 4MY0A 3SXNA 3FB3A 3F0AA 5H86A 1YK3A 2R1IA 4KLWA 4CAVA 2ATRA 4U9YA 1KZFA 2ARHA 2FE7A 1Z9UA 2OZHA 4KOUA 2VI7A 2PC1A 2I00A 1YLEA 2ZW6A 3FXTA 3PGPA 4II9A 3C26A 4MHDA 3SHPA 1IYLA 4AVAA 2CNMA 4KOVA 2ZW4A 3TFYA 3P2FA 3CXQA 3TTHA 2F5IA 3VWDA 2P6GA 3D8PA 5F49A 1R57A 2KCWA 1RXTA 2VEZA 1QSOA 4KUBA 4MJ8A 2PR1A 4YFJA 5GCNA 5HMNA 2REEA 3GYAA 4HNXB 1J4JA 2G0BA 2Q04A 3TE4A 1QSMA 2VBQA 1YREA 5EBVA 1XF8A 3R9GA 1I1DA 2OZGA 3DDDA 5C88A 4QVTA 1M44A 1S7LA 3CXSA 4NEXA 1YVOA 4NCZA 4PSXA 4XNHB 2FSRA 4RI1A 5J8FA 4U5YA 1V0CA 3WR7A 4CAWA 3D2PA 4UWIA 4XNHC 3TO9A 3G3SA 4KOSA 5CNPA 1MJAA 1CM0A 3F5BA 4JXQA 4MBUA 1Z4RA 5EC4A 2P6EA 1LRZA 2WPXA 1RO5A 2FIAA 2BSWA 2G3AA 1S5KA 4R87A 4H6UA 4KOTA 4KOXA 4R3LA 4R9MA 4F6AA 3QAHA 3IGRA 2D4PA 4YGOA 4B5OA 2CY2A 4PK2A 2Q7BA 3EXNA 4FD6A 3FNCA 3W91A 2AJ6A 4KVME 3S6FA 4OADA 2J8MA 1OZPA 2FIWA 4KVXA 4L8AA 4OLLA 5IB0A 4CRZB 5KTCA 4IUSA 4AVBA 4M3SA 2FS5A 3LODA 4XPLA 1YVKA 3S6GA 4JXRA 1FY7A 5HH1A 3BJ7A 2B3VA 5C82A 4FD5A 5FVJA 3S6HA 2OU2A 2FL4A 4AG9A 3UY5A 1Y9WA 2Z11A 1I12A 4FD4A 2Y0MA 4F0YA 3DNSA 2B3UA 4ZBGA 5F46A 3JUWA 4NSQA 5IX3A 4K30A 4CRYB 4E0AA 2X7BA 3DR8A 1M4DA 1U6MA 2D4OA 1Y7RA 3JVNA 2NMTA 1KUYA 2P6FA 2J8RA 1MJBA 4X5KA 2PDOA 2ZXVA 2AE6A 2B5GB 2Q4VA 4KOYA 4E8OA 3K9UA 3FYNA 1XMTA 1Y9KA 2ZW5A 2GANA 4KLVA 3GY9A 4LX9A 4QB9A 1B87A 1VHSA 3OWCA 3CXPA 4UA3A 1QSTA 3EO4A 2FXFA 4NXYA 1L0CA 2H5MA 3G8WA 3I9SA 1WK4A 3W6SA 4DNCA 3PZJA 1MK4A 3SXOA 4AB7A 4NF1A
chains in the Genus database with same CATH superfamily
3DLJA 1M1DA 1CPSA 4HPSA 4OC3A 4EWTA 1KUVA 5I4MA 2ABZA 4CYPA 1ZG7A 4KUAA 5JH9A 1JQGA 5F47A 3IIBA 2HQYA 3FRMA 4B5PB 2O28A 3KQZA 3LD2A 2WPWA 5H84A 4MI4A 1TKFA 1YR0A 2B4DB 3VWEA 2JEVA 4NGQA 2JDCA 1Z8XA 2PRBA 1Q2DA 2VZZA 4GM5A 1X10A 2HV2A 3EFAA 2Z3PA 4XPKA 3KKWA 2GE3A 1ZLIA 2XEGA 1IYKA 1KUXA 3GUXA 4ORFA 2B5GA 3ISZA 3D7GA 4NJQA 4X8IA 5DWMA 1WWZA 3IWGA 4C7IA 2EVNA 2I79A 2POKA 2EWBA 3D66A 3SI0A 2BOAA 4OAEA 2REFA 3KZWA 4OIWA 2XEJA 4LQGA 4OC5A 4ZY0A 2DEAA 3SJXA 4Q36A 4CYNA 2VZYA 3V8IA 1Q2CA 1P4NA 1QSNA 1S7KA 1SQHA 2JDDA 2ZEMA 5AG7A 1IICA 2QJ8A 1S3ZA 3HUVA 4I49A 3B3TA 5DWNA 3R96A 4WJBA 2EK9A 3R95A 2O4HA 4IK2A 4MHPA 2OR4A 4GS4A 4Y49B 3EC4A 4MXUA 3T9YA 1QQ9A 3WC7A 4A39A 2BUEA 3DR6A 2ZEDA 3E0KA 4UBRA 1XIXA 4Y49C 1Q2YA 4OKOA 3BI1A 4FUUA 4P4JA 2CF4A 4B5PA 2ZOGA 4J3GA 2FT0A 2B4DA 5ELYA 4OMEA 3KL9A 3QNVA 5DS0A 2OZUA 3FEDA 2EK8A 3TCVA 3FX6A 4TNUA 4ZY1A 3NH5A 5F48A 4ZI6A 1CJWA 2I3CA 3CDXA 4M6GA 3TX8A 4P4DA 1YW4A 3MRUA 5E96A 4PSWA 7CPAA 4B10A 3DSBA 1PUAA 4A30A 3B3VA 5K8MA 1GHEA 5I0CA 2OB0A 2AFOA 3IO1A 1ELMP 4CS0B 4ONUA 3JRUA 3B3WA 1K4JA 1PU9A 2ZEGA 3MN8A 1NE9A 1Z8WA 3N7ZA 4FD7A 1ON0A 4TWEA 2QECA 3MGDA 2B58A 4B14A 1LCPA 3IEHA 4NGSA 1UFHA 3I1UA 4XPDB 3W6XA 2QMLA 4OC4A 1YLOA 3WC6A 5HVHA 4F9UA 1BOBA 2C6PA 2WZNA 3IWEA 1R3NA 2K5TA 4KZTA 4OP4A 4JZ0A 4KOWA 1P0HA 1VIXA 4XPDC 2PJ5A 4GXHA 4NGRA 1B6BA 2Q4YA 2GIVA 5AG5A 4CGMA 4M6HA 2IL4A 2WYRA 2ZELA 4JD6A 3TO7A 5JQ4A 3ZZIA 5JGFA 4QBJA 1VKCA 1S7NA 3T90A 4YRHA 1YGHA 2VQYA 3NE7A 4CAEA 1CX8A 3B3SA 4B12A 1M4LA 4JWPA 2V8GA 5AG6A 4FAIA 5KTAA 2B4BA 4PXBA 3SI1A 5CPAA 4BMHA 4EVYA 2RB7A 3R1KA 1BAVA 5LYDA 2PSWA 2G9DA 2ZEOA 4JJXA 2G3TA 2RC4A 5K8PA 5J1QA 4UCNA 1F57A 1IIDA 5KTDA 4U9ZA 1ZO0A 2QIRA 4UEEA 4QUSA 1XEBA 1NSLA 1S60A 4KVOE 1VHEA 5LRGA 4M6IA 2JEWA 2Z0ZA 1QMUA 4YU9A 2AFMA 3R9EA 4ZX8A 1M4GA 4KSIA 5ISVA 3FIXA 1AMPA 2AFZA 4C2ZA 2ZEFA 3B35A 4H89A 1YX0A 3FBUA 3V7ZA 2V8DA 3TT2A 4A31A 2C27A 1I21A 4AG7A 2HC9A 2Z10A 5JPHA 1XOVA 4HKFA 4L89A 3TOAA 4CAFA 3SJEA 1XMBA 4IF5A 2BCOA 4P4IA 1OBRA 1XE4A 1Y7EA 2R8VA 3CZXA 4H6ZA 2ZW7A 2DXQA 4C68A 1IB1E 2ZPAA 2BL1A 2PJBA 2PR8A 4MCQA 4PK3A 2PJ9A 2J8NA 4PXDA 3WABA 4KSFA 2Q0YA 2YNEA 3FJUA 3PB9X 1TF9A 4R3KA 3A9LA 2QVPA 3R9FA 3BJ8A 4NGTA 3BLNA 3D2MA 2P0WA 3VATA 1N71A 1PCAA 1VGYA 1IOIA 2EUIA 1GYTA 4JYWA 4R57A 2Q7SA 3TO6A 2PJ1A 2JLMA 3RBUA 3H8GA 2GFQA 1UWYA 2CNSA 4AVCA 4UIBA 2GLFA 3GIUA 5G22A 2R98A 2QYVA 1M4IA 3CPXA 2Z3OA 3L2NA 3P2HA 2ZEPA 4MFZA 4PV6A 2OH1A 4HNYB 1TIQA 2FVGA 3IU1A 3RYOA 3D67A 4LUAA 2C1CA 1RTQA 3GKRA 2VXKA 3B8GA 1MJ9A 2PJ8A 1QSRA 4ZYQA 4MCPA 2PJAA 3LWUA 4X2TA 1S7FA 3D7FA 2HUZA 1BLLE 2WSAA 4M85A 1NMTA 3FEEA 2YGWA 5J8CA 4KORA 2CNTA 4CGPA 3S6KA 4KS9A 4EFDA 4HNWB 3H4QA 3ZJ0A 4NGMA 3QB8A 4CAXA 5JM6A 1CP7A 2DPSA 3KI9A 3PP9A 3TOBA 1XRYA 2BEIA 3PRTA 3WT4A 4E2AA 2Q44A 3JTKA 5A27A 1BO4A 1YMEA 4UWJA 3D3SA 4MRIA 5G20A 2A4NA 3S9NA 2IQ6A 1TKJA 4RS2A 4MY3A 2V8HA 5IV0A 5G21A 1Z4EA 3PFEA 1FT7A 4UCMA 2R7HA 4QC6A 3GB0A 5IB9A 2FCKA 3F8KA 2PQ8A 4JLYA 2GLJA 1AUGA 3EY5A 4UEFA 1TF8A 4A37A 1CBXA 3I3GA 3FECA 4MY0A 3SXNA 5D29A 3FB3A 2Z3LA 3F0AA 1IU8A 2V77A 4A2ZA 5H86A 4A94A 4DYOA 1YK3A 2R1IA 4KLWA 1EE3P 5D8NA 4P6YA 4OC0A 4CAVA 2PJ2A 2ATRA 2OOTA 3H5ZA 4U9YA 4X3RA 1LOKA 1HEEA 4IHMA 3D4UA 4A33A 1KZFA 2ARHA 2FE7A 4Q38A 1Z9UA 2CTCA 2YNDA 1A2ZA 2OZHA 2IJZA 5F09A 3BXMA 4KOUA 2VI7A 4AXVA 1CG2A 2PC1A 1TXRA 2I00A 3RAMA 1YLEA 3GLJA 1H8LA 2ZW6A 3FXTA 3PGPA 4II9A 4ZX9A 4BBHA 5A28A 3B3CA 4F8ZA 1F2OA 2VL1A 3C26A 4MHDA 3SHPA 1IYLA 1HDUA 4P4BA 4PXEA 4AVAA 2CNMA 4PXCA 4ZGYB 2JBKA 2PRQA 4KOVA 2ZW4A 3LACA 3P2FA 3CXQA 3TFYA 3TTHA 1LFWA 1XJOA 3KR4A 2F5IA 3QAYA 2AFXA 4BINA 3VWDA 3KQXA 2P6GA 5EMIA 3D8PA 5AG4A 4B6ZA 5F49A 1R57A 4UIAA 2KCWA 1RXTA 5HVFA 4CGLA 2PJ7A 1Y0YA 1QSOA 2VEZA 2NYQA 4A38A 4KUBA 2GREA 3FMCA 3PB6X 4UEZA 3RZAA 1AYEA 2Z3MA 5HXDA 4MJ8A 4ZY2A 3IWWA 2PR1A 4EMEA 4YFJA 5GCNA 5HMNA 2REEA 3GYAA 4HNXB 4CGOA 1J4JA 4IAVA 4FBEA 4MFKA 2G0BA 2Q04A 3TE4A 1ARMA 3KHXA 4NFRA 1QSMA 2VBQA 4K3NA 4AB7A 1YREA 5EBVA 1XF8A 4MHZA 1I1DA 2C6CA 2F8HA 2OZGA 3R9GA 3DDDA 3PB8X 6CPAA 2CXAA 1ZG8A 5C88A 4QVTA 1M44A 1BPMA 4A95A 1S7LA 2CIJA 3CXSA 4CGNA 4NEXA 1YVOA 4NCZA 4PSXA 4XNHB 1BPNA 2FSRA 4RI1A 4UFXA 3D7HA 1LAMA 3FVLA 3H8FA 5LYFA 1XBUA 3IC1A 4P4FA 2ZENA 5J8FA 1CPXA 1V0CA 4U5YA 3WR7A 1Z8TA 3KASA 4CAWA 3D2PA 3PB7X 4UWIA 4WWVA 4XNHC 3SJFA 3TO9A 1YSJA 2NSMA 3G3SA 2V8VA 4KOSA 4B11A 1IGBA 2XEFA 3IJ3A 5CNPA 2CTBA 3BI0A 1MJAA 1CM0A 3F5BA 4JXQA 2EO8A 3PEIA 4MBUA 1LAPA 1Z4RA 3KHZA 5EC4A 2P6EA 1LRZA 2PJ0A 2AFWA 2WPXA 3CPAA 5K8NA 1RO5A 3CT9A 1YQEA 2FIAA 2WUUA 2BSWA 1NSAA 4F0XA 4PPZA 2EBJA 2G3AA 4RUHA 3KGQA 4W9YA 3VH9A 3WC5A 1S5KA 4R87A 4DJLA 1F2PA 2PJ6A 4H6UA 4OIDA 2DPTA 1CP6A 2J9AA 1ELLP 4KOTA 3T8WA 3RO0A 3S9LA 3NH8A 2PVVA 4KOXA 4R3LA 4R9MA 3S9MA 4F6AA 1PYTB 5G1ZA 1YW6A 2DF5A 3QAHA 3KR5A 4LQ6A 3IGRA 3PB4X 2D4PA 4PQAA 4P4EA 4YGOA 4B5OA 5LRKA 3TC8A 2ANPA 2CY2A 3K2KA 4PK2A 2Q7BA 5LYIA 3LMSA 4CYOA 3EXNA 4FD6A 3FNCA 3W91A 4H2KA 3IFEA 2AJ6A 5LRJA 4FWUA 2Q4ZA 3HLPA 4KVME 3S6FA 4OADA 2J8MA 1OZPA 3D7DA 2IMOA 2FIWA 2PVWA 2O53A 4KVXA 4L8AA 1Z8LA 4OLLA 2PIZA 5IB0A 4CRZB 2RFHA 5KTCA 2ODFA 3D68A 4IUSA 4AVBA 1LANA 3FF3A 3NA6A 4M3SA 4MCRA 2Q43A 2FS5A 3LODA 4C2XA 5K8OA 2BO9A 2AFSA 1YVKA 3NH4A 4XPLA 3PBEA 4JXRA 3S6GA 1FY7A 1ZLHA 4CYQA 5HH1A 3VARA 3BJ7A 2B3VA 5C82A 4FD5A 5FVJA 3B7IA 4Z65A 3V38A 1Q7LA 3S6HA 2OU2A 2FL4A 3BHXA 4AG9A 4NGPA 2PJCA 4R76A 1Y9WA 3UY5A 2Z11A 4OC2A 1JWQA 4R8FA 2C6GA 1I12A 4FD4A 2Y0MA 3NE8A 4UFVA 1TKHA 2PJ3A 4F0YA 4ONWA 4BD9A 3IU2A 1VHOA 4F9VA 3DNSA 2B3UA 4MFJA 4MFQA 4ZBGA 5F46A 1DE4C 5HVGA 2ZOFA 4YWYA 3K9TA 4CPAA 3JUWA 4NSQA 1X12A 8CPAA 1Z2LA 4P44A 4UFWA 3SI2A 5IX3A 2ZEEA 5CBMA 4C7HA 4K30A 2YNCC 4CRYB 1KWMA 4E0AA 4MHNA 2PJ4A 2PCUA 2X7BA 3DR8A 4MMOA 3B2YA 1M4DA 1ARLA 1U6MA 4UF4A 2ZEHA 2D4OA 2F7VA 1Y7RA 1IOFA 3JVNA 2NMTA 4P10A 4NJRA 1Y0RA 2JBJA 3NFZA 1KUYA 1Z5RA 2XEIA 2P6FA 5AGEA 4A32A 4UCPA 2J8RA 2GU2A 2Q51A 1MJBA 3H8EA 4X5KA 5THWA 3PBBA 2PDOA 4O23A 2ZXVA 2AE6A 2B5GB 4R7MA 3RNZA 4B13A 5BWAB 5LYLA 2Q4VA 4KSAA 4KOYA 4E8OA 3K9UA 2Z3NA 4R6TA 2HB6A 3FYNA 4MHYA 1XMTA 1Y9KA 2ZW5A 4G1PA 2GANA 4MCSA 4KLVA 3GY9A 4LX9A 4C2YA 4QB9A 1B87A 1VHSA 3OWCA 3DGVA 2PE3A 1R43A 1HDQA 3FH4A 3CXPA 4UA3A 1QSTA 3EO4A 1DTDA 2AFUA 4MFLA 2FXFA 4RN7A 4Q7AA 2PIYA 3SJGA 4NXYA 1L0CA 3PFOA 2H5MA 1FNOA 4MFPA 1XFOA 4P45A 3G8WA 4DUKA 3I9SA 4NGNA 1ZG9A 1WK4A 2YNCA 1IY7A 3N5FA 3W6SA 4DNCA 2Z3KA 3PZJA 1MK4A 3SXOA 4OC1A 3ISXA 4NF1A
chains in the Genus database with same CATH topology
1M1DA 1KUVA 4CYPA 4KUAA 5F47A 2HQYA 3FRMA 4B5PB 2O28A 5H84A 3LD2A 2WPWA 3VWEA 4MI4A 1YR0A 2B4DB 2JEVA 2JDCA 2PRBA 1Q2DA 2VZZA 2HV2A 3EFAA 2Z3PA 4XPKA 3KKWA 2GE3A 1IYKA 1KUXA 4ORFA 2B5GA 5DWMA 1WWZA 3IWGA 4C7IA 2EVNA 2I79A 4OAEA 2REFA 4Q36A 4CYNA 2VZYA 3V8IA 1Q2CA 1P4NA 1QSNA 1S7KA 1SQHA 2JDDA 5AG7A 1IICA 1S3ZA 4I49A 5DWNA 3R96A 3R95A 4GS4A 4Y49B 3EC4A 3T9YA 2BUEA 3DR6A 3E0KA 4UBRA 1XIXA 4Y49C 1Q2YA 4B5PA 4J3GA 2FT0A 2B4DA 2OZUA 3TCVA 5F48A 1CJWA 5E96A 4PSWA 4B10A 3DSBA 1PUAA 4A30A 1GHEA 5I0CA 2OB0A 4CS0B 4ONUA 1K4JA 1PU9A 3N7ZA 1NE9A 4FD7A 1ON0A 2QECA 3MGDA 2B58A 4B14A 1UFHA 4XPDB 3W6XA 2QMLA 1BOBA 3IWEA 2K5TA 4KZTA 4KOWA 1P0HA 4XPDC 1B6BA 2Q4YA 2GIVA 5AG5A 4CGMA 2IL4A 5JQ4A 4JD6A 3TO7A 3ZZIA 4QBJA 1VKCA 1S7NA 3T90A 4YRHA 1YGHA 2VQYA 3NE7A 4CAEA 4B12A 4JWPA 5AG6A 2B4BA 4BMHA 4EVYA 3R1KA 2PSWA 4JJXA 2G3TA 2RC4A 4UCNA 1IIDA 5KTDA 4U9ZA 1ZO0A 2QIRA 4QUSA 1XEBA 1NSLA 1S60A 4KVOE 2Z0ZA 3R9EA 5ISVA 1M4GA 3FIXA 4C2ZA 4H89A 1YX0A 3FBUA 3TT2A 4A31A 2C27A 1I21A 4AG7A 2Z10A 5JPHA 4HKFA 4L89A 3TOAA 4CAFA 4IF5A 1XE4A 2R8VA 4H6ZA 2ZW7A 2DXQA 4C68A 1IB1E 2ZPAA 2BL1A 2PR8A 4PK3A 2J8NA 4KSFA 2Q0YA 2YNEA 4R3KA 3A9LA 3R9FA 3BJ8A 3BLNA 3D2MA 2P0WA 1N71A 3TO6A 2EUIA 4R57A 2JLMA 4AVCA 2CNSA 5G22A 2R98A 1M4IA 2Z3OA 3P2HA 4MFZA 4PV6A 2OH1A 4HNYB 1TIQA 3IU1A 3RYOA 4LUAA 3GKRA 2VXKA 3B8GA 1MJ9A 1QSRA 1S7FA 2HUZA 2WSAA 4M85A 1NMTA 2YGWA 5J8CA 4KORA 2CNTA 4CGPA 3S6KA 4KS9A 4HNWB 3H4QA 3ZJ0A 4CAXA 3QB8A 5KTAA 2DPSA 3PP9A 3TOBA 4E2AA 2BEIA 5A27A 2Q44A 3JTKA 1BO4A 4UWJA 3D3SA 5G20A 2A4NA 4RS2A 4MY3A 5IV0A 5G21A 1Z4EA 4UCMA 2R7HA 4QC6A 2FCKA 3F8KA 2PQ8A 4JLYA 3EY5A 3I3GA 4MY0A 3SXNA 3FB3A 2Z3LA 3F0AA 4A2ZA 5H86A 1YK3A 2R1IA 4KLWA 4CAVA 2ATRA 3H5ZA 4U9YA 4A33A 1KZFA 2ARHA 2FE7A 4Q38A 1Z9UA 2YNDA 2OZHA 4KOUA 2VI7A 2PC1A 2I00A 1YLEA 2ZW6A 3FXTA 3PGPA 4II9A 4BBHA 5A28A 3C26A 4MHDA 3SHPA 1IYLA 4ZGYB 4AVAA 2CNMA 4KOVA 2ZW4A 3TFYA 3P2FA 3CXQA 3TTHA 2F5IA 3VWDA 2P6GA 3D8PA 5AG4A 5F49A 1R57A 2KCWA 1RXTA 4CGLA 2VEZA 1QSOA 4KUBA 2Z3MA 4MJ8A 2PR1A 4YFJA 5GCNA 5HMNA 2REEA 3GYAA 4HNXB 4CGOA 1J4JA 4MFKA 2G0BA 2Q04A 3TE4A 1QSMA 2VBQA 1YREA 5EBVA 1XF8A 3R9GA 1I1DA 2OZGA 3DDDA 2CXAA 5C88A 4QVTA 1M44A 4A95A 1S7LA 3CXSA 4CGNA 4NEXA 1YVOA 4NCZA 4PSXA 4XNHB 2FSRA 4RI1A 4UFXA 5J8FA 4U5YA 1V0CA 3WR7A 4CAWA 3D2PA 4UWIA 4XNHC 3TO9A 3G3SA 4KOSA 4B11A 5CNPA 1MJAA 1CM0A 3F5BA 4JXQA 4MBUA 1Z4RA 5EC4A 2P6EA 1LRZA 2WPXA 1RO5A 2FIAA 2WUUA 2BSWA 4F0XA 2G3AA 1S5KA 4R87A 4H6UA 2DPTA 4KOTA 4KOXA 4R3LA 4R9MA 4F6AA 5G1ZA 3QAHA 3IGRA 2D4PA 4YGOA 4B5OA 2CY2A 4PK2A 2Q7BA 4CYOA 3EXNA 4FD6A 3FNCA 3W91A 2AJ6A 4KVME 3S6FA 4OADA 2J8MA 1OZPA 2FIWA 4KVXA 4L8AA 4OLLA 5IB0A 4CRZB 5KTCA 4IUSA 4AVBA 4M3SA 2FS5A 3LODA 4C2XA 4XPLA 1YVKA 3S6GA 4JXRA 1FY7A 4CYQA 5HH1A 3BJ7A 2B3VA 5C82A 4FD5A 5FVJA 3S6HA 2OU2A 2FL4A 4AG9A 3UY5A 1Y9WA 2Z11A 1I12A 4FD4A 2Y0MA 4UFVA 4F0YA 3IU2A 3DNSA 2B3UA 4MFJA 4MFQA 4ZBGA 5F46A 3JUWA 4NSQA 4UFWA 5IX3A 4C7HA 4K30A 2YNCC 4CRYB 4E0AA 2X7BA 3DR8A 1M4DA 1U6MA 2D4OA 1Y7RA 3JVNA 2NMTA 1KUYA 4A32A 2P6FA 5AGEA 4UCPA 2J8RA 1MJBA 4X5KA 2PDOA 2ZXVA 2AE6A 2B5GB 5BWAB 4B13A 2Q4VA 4KSAA 4KOYA 4E8OA 3K9UA 2Z3NA 3FYNA 1XMTA 1Y9KA 2ZW5A 2GANA 4C2YA 4KLVA 3GY9A 4LX9A 4QB9A 1B87A 1VHSA 3OWCA 3CXPA 4UA3A 1QSTA 3EO4A 4MFLA 2FXFA 4NXYA 1L0CA 2H5MA 4MFPA 3G8WA 3I9SA 1WK4A 2YNCA 3W6SA 4DNCA 2Z3KA 3PZJA 1MK4A 3SXOA 4AB7A 4NF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1D A;  1KUV A;  4KUA A;  5F47 A;  2HQY A;  3FRM A;  4B5P B;  2O28 A;  5H84 A;  3LD2 A;  2WPW A;  3VWE A;  4MI4 A;  1YR0 A;  2B4D B;  2JEV A;  2JDC A;  2PRB A;  1Q2D A;  2VZZ A;  2HV2 A;  3EFA A;  4XPK A;  3KKW A;  2GE3 A;  1IYK A;  1KUX A;  4ORF A;  2B5G A;  5DWM A;  1WWZ A;  3IWG A;  2EVN A;  2I79 A;  4OAE A;  2REF A;  2VZY A;  3V8I A;  1Q2C A;  1P4N A;  1QSN A;  1S7K A;  1SQH A;  2JDD A;  1IIC A;  1S3Z A;  4I49 A;  5DWN A;  3R96 A;  3R95 A;  4GS4 A;  4Y49 B;  3EC4 A;  3T9Y A;  2BUE A;  3DR6 A;  3E0K A;  4UBR A;  1XIX A;  4Y49 C;  1Q2Y A;  4B5P A;  4J3G A;  2FT0 A;  2B4D A;  2OZU A;  3TCV A;  5F48 A;  1CJW A;  5E96 A;  4PSW A;  3DSB A;  1PUA A;  1GHE A;  5I0C A;  2OB0 A;  4CS0 B;  4ONU A;  1K4J A;  1PU9 A;  3N7Z A;  1NE9 A;  4FD7 A;  1ON0 A;  2QEC A;  3MGD A;  2B58 A;  1UFH A;  4XPD B;  3W6X A;  2QML A;  1BOB A;  2K5T A;  4KZT A;  4KOW A;  1P0H A;  4XPD C;  1B6B A;  2Q4Y A;  2GIV A;  2IL4 A;  5JQ4 A;  4JD6 A;  3TO7 A;  3ZZI A;  4QBJ A;  1VKC A;  1S7N A;  3T90 A;  4YRH A;  1YGH A;  2VQY A;  3NE7 A;  4JWP A;  2B4B A;  4BMH A;  4EVY A;  3R1K A;  2PSW A;  4JJX A;  2G3T A;  2RC4 A;  1IID A;  5KTD A;  4U9Z A;  2QIR A;  4QUS A;  1XEB A;  1NSL A;  1S60 A;  4KVO E;  2Z0Z A;  3R9E A;  5ISV A;  1M4G A;  3FIX A;  4H89 A;  1YX0 A;  3FBU A;  3TT2 A;  2C27 A;  1I21 A;  4AG7 A;  2Z10 A;  5JPH A;  4HKF A;  4L89 A;  3TOA A;  4IF5 A;  1XE4 A;  2R8V A;  4H6Z A;  2ZW7 A;  2DXQ A;  1IB1 E;  2ZPA A;  2BL1 A;  2PR8 A;  4PK3 A;  2J8N A;  2Q0Y A;  4R3K A;  3R9F A;  3BJ8 A;  3BLN A;  3D2M A;  2P0W A;  1N71 A;  3TO6 A;  2EUI A;  4R57 A;  2JLM A;  4AVC A;  2CNS A;  2R98 A;  1M4I A;  3P2H A;  4PV6 A;  2OH1 A;  4HNY B;  1TIQ A;  3RYO A;  4LUA A;  3GKR A;  2VXK A;  3B8G A;  1MJ9 A;  1QSR A;  1S7F A;  2HUZ A;  4M85 A;  1NMT A;  5J8C A;  4KOR A;  2CNT A;  3S6K A;  4HNW B;  3H4Q A;  3ZJ0 A;  4CAX A;  3QB8 A;  5KTA A;  3TOB A;  3PP9 A;  4E2A A;  2BEI A;  2Q44 A;  1BO4 A;  4UWJ A;  3D3S A;  2A4N A;  4RS2 A;  4MY3 A;  5IV0 A;  1Z4E A;  2R7H A;  4QC6 A;  2FCK A;  3F8K A;  2PQ8 A;  4JLY A;  3EY5 A;  3I3G A;  4MY0 A;  3SXN A;  3FB3 A;  3F0A A;  5H86 A;  1YK3 A;  2R1I A;  4KLW A;  4CAV A;  2ATR A;  4U9Y A;  1KZF A;  2ARH A;  2FE7 A;  1Z9U A;  2OZH A;  4KOU A;  2VI7 A;  2PC1 A;  2I00 A;  1YLE A;  2ZW6 A;  3FXT A;  3PGP A;  4II9 A;  3C26 A;  4MHD A;  3SHP A;  1IYL A;  4AVA A;  2CNM A;  4KOV A;  2ZW4 A;  3TFY A;  3P2F A;  3CXQ A;  3TTH A;  2F5I A;  3VWD A;  2P6G A;  3D8P A;  5F49 A;  1R57 A;  2KCW A;  1RXT A;  2VEZ A;  1QSO A;  4KUB A;  4MJ8 A;  2PR1 A;  4YFJ A;  5GCN A;  5HMN A;  2REE A;  3GYA A;  4HNX B;  1J4J A;  2G0B A;  2Q04 A;  3TE4 A;  1QSM A;  2VBQ A;  1YRE A;  5EBV A;  1XF8 A;  3R9G A;  1I1D A;  2OZG A;  3DDD A;  5C88 A;  4QVT A;  1M44 A;  1S7L A;  3CXS A;  4NEX A;  1YVO A;  4NCZ A;  4PSX A;  4XNH B;  2FSR A;  4RI1 A;  5J8F A;  4U5Y A;  1V0C A;  3WR7 A;  4CAW A;  3D2P A;  4UWI A;  4XNH C;  3TO9 A;  3G3S A;  4KOS A;  5CNP A;  1MJA A;  1CM0 A;  3F5B A;  4JXQ A;  4MBU A;  1Z4R A;  5EC4 A;  2P6E A;  1LRZ A;  2WPX A;  1RO5 A;  2FIA A;  2BSW A;  2G3A A;  1S5K A;  4R87 A;  4H6U A;  4KOT A;  4KOX A;  4R3L A;  4R9M A;  4F6A A;  3QAH A;  3IGR A;  2D4P A;  4YGO A;  4B5O A;  2CY2 A;  4PK2 A;  2Q7B A;  3EXN A;  4FD6 A;  3FNC A;  3W91 A;  2AJ6 A;  4KVM E;  3S6F A;  4OAD A;  2J8M A;  1OZP A;  2FIW A;  4KVX A;  4L8A A;  4OLL A;  5IB0 A;  4CRZ B;  5KTC A;  4IUS A;  4AVB A;  4M3S A;  2FS5 A;  3LOD A;  4XPL A;  1YVK A;  3S6G A;  4JXR A;  1FY7 A;  5HH1 A;  3BJ7 A;  2B3V A;  5C82 A;  4FD5 A;  5FVJ A;  3S6H A;  2OU2 A;  2FL4 A;  4AG9 A;  3UY5 A;  1Y9W A;  2Z11 A;  1I12 A;  4FD4 A;  2Y0M A;  4F0Y A;  3DNS A;  2B3U A;  4ZBG A;  5F46 A;  3JUW A;  4NSQ A;  5IX3 A;  4K30 A;  4CRY B;  4E0A A;  2X7B A;  3DR8 A;  1M4D A;  1U6M A;  2D4O A;  1Y7R A;  3JVN A;  2NMT A;  1KUY A;  2P6F A;  2J8R A;  1MJB A;  4X5K A;  2PDO A;  2ZXV A;  2AE6 A;  2B5G B;  2Q4V A;  4KOY A;  4E8O A;  3K9U A;  3FYN A;  1XMT A;  1Y9K A;  2ZW5 A;  2GAN A;  4KLV A;  3GY9 A;  4LX9 A;  4QB9 A;  1B87 A;  1VHS A;  3OWC A;  3CXP A;  4UA3 A;  1QST A;  3EO4 A;  2FXF A;  4NXY A;  1L0C A;  2H5M A;  3G8W A;  3I9S A;  1WK4 A;  3W6S A;  4DNC A;  3PZJ A;  1MK4 A;  3SXO A;  4AB7 A;  4NF1 A; 
#chains in the Genus database with same CATH topology
 3DLJ A;  1M1D A;  1CPS A;  4HPS A;  4OC3 A;  4EWT A;  1KUV A;  5I4M A;  2ABZ A;  4CYP A;  1ZG7 A;  4KUA A;  5JH9 A;  1JQG A;  5F47 A;  3IIB A;  2HQY A;  3FRM A;  4B5P B;  2O28 A;  3KQZ A;  3LD2 A;  2WPW A;  5H84 A;  4MI4 A;  1TKF A;  1YR0 A;  2B4D B;  3VWE A;  2JEV A;  4NGQ A;  2JDC A;  1Z8X A;  2PRB A;  1Q2D A;  2VZZ A;  4GM5 A;  1X10 A;  2HV2 A;  3EFA A;  2Z3P A;  4XPK A;  3KKW A;  2GE3 A;  1ZLI A;  2XEG A;  1IYK A;  1KUX A;  3GUX A;  4ORF A;  2B5G A;  3ISZ A;  3D7G A;  4NJQ A;  4X8I A;  5DWM A;  1WWZ A;  3IWG A;  4C7I A;  2EVN A;  2I79 A;  2POK A;  2EWB A;  3D66 A;  3SI0 A;  2BOA A;  4OAE A;  2REF A;  3KZW A;  4OIW A;  2XEJ A;  4LQG A;  4OC5 A;  4ZY0 A;  2DEA A;  3SJX A;  4Q36 A;  4CYN A;  2VZY A;  3V8I A;  1Q2C A;  1P4N A;  1QSN A;  1S7K A;  1SQH A;  2JDD A;  2ZEM A;  5AG7 A;  1IIC A;  2QJ8 A;  1S3Z A;  3HUV A;  4I49 A;  3B3T A;  5DWN A;  3R96 A;  4WJB A;  2EK9 A;  3R95 A;  2O4H A;  4IK2 A;  4MHP A;  2OR4 A;  4GS4 A;  4Y49 B;  3EC4 A;  4MXU A;  3T9Y A;  1QQ9 A;  3WC7 A;  4A39 A;  2BUE A;  3DR6 A;  2ZED A;  3E0K A;  4UBR A;  1XIX A;  4Y49 C;  1Q2Y A;  4OKO A;  3BI1 A;  4FUU A;  4P4J A;  2CF4 A;  4B5P A;  2ZOG A;  4J3G A;  2FT0 A;  2B4D A;  5ELY A;  4OME A;  3KL9 A;  3QNV A;  5DS0 A;  2OZU A;  3FED A;  2EK8 A;  3TCV A;  3FX6 A;  4TNU A;  4ZY1 A;  3NH5 A;  5F48 A;  4ZI6 A;  1CJW A;  2I3C A;  3CDX A;  4M6G A;  3TX8 A;  4P4D A;  1YW4 A;  3MRU A;  5E96 A;  4PSW A;  7CPA A;  4B10 A;  3DSB A;  1PUA A;  4A30 A;  3B3V A;  5K8M A;  1GHE A;  5I0C A;  2OB0 A;  2AFO A;  3IO1 A;  1ELM P;  4CS0 B;  4ONU A;  3JRU A;  3B3W A;  1K4J A;  1PU9 A;  2ZEG A;  3MN8 A;  1NE9 A;  1Z8W A;  3N7Z A;  4FD7 A;  1ON0 A;  4TWE A;  2QEC A;  3MGD A;  2B58 A;  4B14 A;  1LCP A;  3IEH A;  4NGS A;  1UFH A;  3I1U A;  4XPD B;  3W6X A;  2QML A;  4OC4 A;  1YLO A;  3WC6 A;  5HVH A;  4F9U A;  1BOB A;  2C6P A;  2WZN A;  3IWE A;  1R3N A;  2K5T A;  4KZT A;  4OP4 A;  4JZ0 A;  4KOW A;  1P0H A;  1VIX A;  4XPD C;  2PJ5 A;  4GXH A;  4NGR A;  1B6B A;  2Q4Y A;  2GIV A;  5AG5 A;  4CGM A;  4M6H A;  2IL4 A;  2WYR A;  2ZEL A;  4JD6 A;  3TO7 A;  5JQ4 A;  3ZZI A;  5JGF A;  4QBJ A;  1VKC A;  1S7N A;  3T90 A;  4YRH A;  1YGH A;  2VQY A;  3NE7 A;  4CAE A;  1CX8 A;  3B3S A;  4B12 A;  1M4L A;  4JWP A;  2V8G A;  5AG6 A;  4FAI A;  5KTA A;  2B4B A;  4PXB A;  3SI1 A;  5CPA A;  4BMH A;  4EVY A;  2RB7 A;  3R1K A;  1BAV A;  5LYD A;  2PSW A;  2G9D A;  2ZEO A;  4JJX A;  2G3T A;  2RC4 A;  5K8P A;  5J1Q A;  4UCN A;  1F57 A;  1IID A;  5KTD A;  4U9Z A;  1ZO0 A;  2QIR A;  4UEE A;  4QUS A;  1XEB A;  1NSL A;  1S60 A;  4KVO E;  1VHE A;  5LRG A;  4M6I A;  2JEW A;  2Z0Z A;  1QMU A;  4YU9 A;  2AFM A;  3R9E A;  4ZX8 A;  1M4G A;  4KSI A;  5ISV A;  3FIX A;  1AMP A;  2AFZ A;  4C2Z A;  2ZEF A;  3B35 A;  4H89 A;  1YX0 A;  3FBU A;  3V7Z A;  2V8D A;  3TT2 A;  4A31 A;  2C27 A;  1I21 A;  4AG7 A;  2HC9 A;  2Z10 A;  5JPH A;  1XOV A;  4HKF A;  4L89 A;  3TOA A;  4CAF A;  3SJE A;  1XMB A;  4IF5 A;  2BCO A;  4P4I A;  1OBR A;  1XE4 A;  1Y7E A;  2R8V A;  3CZX A;  4H6Z A;  2ZW7 A;  2DXQ A;  4C68 A;  1IB1 E;  2ZPA A;  2BL1 A;  2PJB A;  2PR8 A;  4MCQ A;  4PK3 A;  2PJ9 A;  2J8N A;  4PXD A;  3WAB A;  4KSF A;  2Q0Y A;  2YNE A;  3FJU A;  3PB9 X;  1TF9 A;  4R3K A;  3A9L A;  2QVP A;  3R9F A;  3BJ8 A;  4NGT A;  3BLN A;  3D2M A;  2P0W A;  3VAT A;  1N71 A;  1PCA A;  1VGY A;  1IOI A;  2EUI A;  1GYT A;  4JYW A;  4R57 A;  2Q7S A;  3TO6 A;  2PJ1 A;  2JLM A;  3RBU A;  3H8G A;  2GFQ A;  1UWY A;  2CNS A;  4AVC A;  4UIB A;  2GLF A;  3GIU A;  5G22 A;  2R98 A;  2QYV A;  1M4I A;  3CPX A;  2Z3O A;  3L2N A;  3P2H A;  2ZEP A;  4MFZ A;  4PV6 A;  2OH1 A;  4HNY B;  1TIQ A;  2FVG A;  3IU1 A;  3RYO A;  3D67 A;  4LUA A;  2C1C A;  1RTQ A;  3GKR A;  2VXK A;  3B8G A;  1MJ9 A;  2PJ8 A;  1QSR A;  4ZYQ A;  4MCP A;  2PJA A;  3LWU A;  4X2T A;  1S7F A;  3D7F A;  2HUZ A;  1BLL E;  2WSA A;  4M85 A;  1NMT A;  3FEE A;  2YGW A;  5J8C A;  4KOR A;  2CNT A;  4CGP A;  3S6K A;  4KS9 A;  4EFD A;  4HNW B;  3H4Q A;  3ZJ0 A;  4NGM A;  3QB8 A;  4CAX A;  5JM6 A;  1CP7 A;  2DPS A;  3KI9 A;  3PP9 A;  3TOB A;  1XRY A;  2BEI A;  3PRT A;  3WT4 A;  4E2A A;  2Q44 A;  3JTK A;  5A27 A;  1BO4 A;  1YME A;  4UWJ A;  3D3S A;  4MRI A;  5G20 A;  2A4N A;  3S9N A;  2IQ6 A;  1TKJ A;  4RS2 A;  4MY3 A;  2V8H A;  5IV0 A;  5G21 A;  1Z4E A;  3PFE A;  1FT7 A;  4UCM A;  2R7H A;  4QC6 A;  3GB0 A;  5IB9 A;  2FCK A;  3F8K A;  2PQ8 A;  4JLY A;  2GLJ A;  1AUG A;  3EY5 A;  4UEF A;  1TF8 A;  4A37 A;  1CBX A;  3I3G A;  3FEC A;  4MY0 A;  3SXN A;  5D29 A;  3FB3 A;  2Z3L A;  3F0A A;  1IU8 A;  2V77 A;  4A2Z A;  5H86 A;  4A94 A;  4DYO A;  1YK3 A;  2R1I A;  4KLW A;  1EE3 P;  5D8N A;  4P6Y A;  4OC0 A;  4CAV A;  2PJ2 A;  2ATR A;  2OOT A;  3H5Z A;  4U9Y A;  4X3R A;  1LOK A;  1HEE A;  4IHM A;  3D4U A;  4A33 A;  1KZF A;  2ARH A;  2FE7 A;  4Q38 A;  1Z9U A;  2CTC A;  2YND A;  1A2Z A;  2OZH A;  2IJZ A;  5F09 A;  3BXM A;  4KOU A;  2VI7 A;  4AXV A;  1CG2 A;  2PC1 A;  1TXR A;  2I00 A;  3RAM A;  1YLE A;  3GLJ A;  1H8L A;  2ZW6 A;  3FXT A;  3PGP A;  4II9 A;  4ZX9 A;  4BBH A;  5A28 A;  3B3C A;  4F8Z A;  1F2O A;  2VL1 A;  3C26 A;  4MHD A;  3SHP A;  1IYL A;  1HDU A;  4P4B A;  4PXE A;  4AVA A;  2CNM A;  4PXC A;  4ZGY B;  2JBK A;  2PRQ A;  4KOV A;  2ZW4 A;  3LAC A;  3P2F A;  3CXQ A;  3TFY A;  3TTH A;  1LFW A;  1XJO A;  3KR4 A;  2F5I A;  3QAY A;  2AFX A;  4BIN A;  3VWD A;  3KQX A;  2P6G A;  5EMI A;  3D8P A;  5AG4 A;  4B6Z A;  5F49 A;  1R57 A;  4UIA A;  2KCW A;  1RXT A;  5HVF A;  4CGL A;  2PJ7 A;  1Y0Y A;  1QSO A;  2VEZ A;  2NYQ A;  4A38 A;  4KUB A;  2GRE A;  3FMC A;  3PB6 X;  4UEZ A;  3RZA A;  1AYE A;  2Z3M A;  5HXD A;  4MJ8 A;  4ZY2 A;  3IWW A;  2PR1 A;  4EME A;  4YFJ A;  5GCN A;  5HMN A;  2REE A;  3GYA A;  4HNX B;  4CGO A;  1J4J A;  4IAV A;  4FBE A;  4MFK A;  2G0B A;  2Q04 A;  3TE4 A;  1ARM A;  3KHX A;  4NFR A;  1QSM A;  2VBQ A;  4K3N A;  4AB7 A;  1YRE A;  5EBV A;  1XF8 A;  4MHZ A;  1I1D A;  2C6C A;  2F8H A;  2OZG A;  3R9G A;  3DDD A;  3PB8 X;  6CPA A;  2CXA A;  1ZG8 A;  5C88 A;  4QVT A;  1M44 A;  1BPM A;  4A95 A;  1S7L A;  2CIJ A;  3CXS A;  4CGN A;  4NEX A;  1YVO A;  4NCZ A;  4PSX A;  4XNH B;  1BPN A;  2FSR A;  4RI1 A;  4UFX A;  3D7H A;  1LAM A;  3FVL A;  3H8F A;  5LYF A;  1XBU A;  3IC1 A;  4P4F A;  2ZEN A;  5J8F A;  1CPX A;  1V0C A;  4U5Y A;  3WR7 A;  1Z8T A;  3KAS A;  4CAW A;  3D2P A;  3PB7 X;  4UWI A;  4WWV A;  4XNH C;  3SJF A;  3TO9 A;  1YSJ A;  2NSM A;  3G3S A;  2V8V A;  4KOS A;  4B11 A;  1IGB A;  2XEF A;  3IJ3 A;  5CNP A;  2CTB A;  3BI0 A;  1MJA A;  1CM0 A;  3F5B A;  4JXQ A;  2EO8 A;  3PEI A;  4MBU A;  1LAP A;  1Z4R A;  3KHZ A;  5EC4 A;  2P6E A;  1LRZ A;  2PJ0 A;  2AFW A;  2WPX A;  3CPA A;  5K8N A;  1RO5 A;  3CT9 A;  1YQE A;  2FIA A;  2WUU A;  2BSW A;  1NSA A;  4F0X A;  4PPZ A;  2EBJ A;  2G3A A;  4RUH A;  3KGQ A;  4W9Y A;  3VH9 A;  3WC5 A;  1S5K A;  4R87 A;  4DJL A;  1F2P A;  2PJ6 A;  4H6U A;  4OID A;  2DPT A;  1CP6 A;  2J9A A;  1ELL P;  4KOT A;  3T8W A;  3RO0 A;  3S9L A;  3NH8 A;  2PVV A;  4KOX A;  4R3L A;  4R9M A;  3S9M A;  4F6A A;  1PYT B;  5G1Z A;  1YW6 A;  2DF5 A;  3QAH A;  3KR5 A;  4LQ6 A;  3IGR A;  3PB4 X;  2D4P A;  4PQA A;  4P4E A;  4YGO A;  4B5O A;  5LRK A;  3TC8 A;  2ANP A;  2CY2 A;  3K2K A;  4PK2 A;  2Q7B A;  5LYI A;  3LMS A;  4CYO A;  3EXN A;  4FD6 A;  3FNC A;  3W91 A;  4H2K A;  3IFE A;  2AJ6 A;  5LRJ A;  4FWU A;  2Q4Z A;  3HLP A;  4KVM E;  3S6F A;  4OAD A;  2J8M A;  1OZP A;  3D7D A;  2IMO A;  2FIW A;  2PVW A;  2O53 A;  4KVX A;  4L8A A;  1Z8L A;  4OLL A;  2PIZ A;  5IB0 A;  4CRZ B;  2RFH A;  5KTC A;  2ODF A;  3D68 A;  4IUS A;  4AVB A;  1LAN A;  3FF3 A;  3NA6 A;  4M3S A;  4MCR A;  2Q43 A;  2FS5 A;  3LOD A;  4C2X A;  5K8O A;  2BO9 A;  2AFS A;  1YVK A;  3NH4 A;  4XPL A;  3PBE A;  4JXR A;  3S6G A;  1FY7 A;  1ZLH A;  4CYQ A;  5HH1 A;  3VAR A;  3BJ7 A;  2B3V A;  5C82 A;  4FD5 A;  5FVJ A;  3B7I A;  4Z65 A;  3V38 A;  1Q7L A;  3S6H A;  2OU2 A;  2FL4 A;  3BHX A;  4AG9 A;  4NGP A;  2PJC A;  4R76 A;  1Y9W A;  3UY5 A;  2Z11 A;  4OC2 A;  1JWQ A;  4R8F A;  2C6G A;  1I12 A;  4FD4 A;  2Y0M A;  3NE8 A;  4UFV A;  1TKH A;  2PJ3 A;  4F0Y A;  4ONW A;  4BD9 A;  3IU2 A;  1VHO A;  4F9V A;  3DNS A;  2B3U A;  4MFJ A;  4MFQ A;  4ZBG A;  5F46 A;  1DE4 C;  5HVG A;  2ZOF A;  4YWY A;  3K9T A;  4CPA A;  3JUW A;  4NSQ A;  1X12 A;  8CPA A;  1Z2L A;  4P44 A;  4UFW A;  3SI2 A;  5IX3 A;  2ZEE A;  5CBM A;  4C7H A;  4K30 A;  2YNC C;  4CRY B;  1KWM A;  4E0A A;  4MHN A;  2PJ4 A;  2PCU A;  2X7B A;  3DR8 A;  4MMO A;  3B2Y A;  1M4D A;  1ARL A;  1U6M A;  4UF4 A;  2ZEH A;  2D4O A;  2F7V A;  1Y7R A;  1IOF A;  3JVN A;  2NMT A;  4P10 A;  4NJR A;  1Y0R A;  2JBJ A;  3NFZ A;  1KUY A;  1Z5R A;  2XEI A;  2P6F A;  5AGE A;  4A32 A;  4UCP A;  2J8R A;  2GU2 A;  2Q51 A;  1MJB A;  3H8E A;  4X5K A;  5THW A;  3PBB A;  2PDO A;  4O23 A;  2ZXV A;  2AE6 A;  2B5G B;  4R7M A;  3RNZ A;  4B13 A;  5BWA B;  5LYL A;  2Q4V A;  4KSA A;  4KOY A;  4E8O A;  3K9U A;  2Z3N A;  4R6T A;  2HB6 A;  3FYN A;  4MHY A;  1XMT A;  1Y9K A;  2ZW5 A;  4G1P A;  2GAN A;  4MCS A;  4KLV A;  3GY9 A;  4LX9 A;  4C2Y A;  4QB9 A;  1B87 A;  1VHS A;  3OWC A;  3DGV A;  2PE3 A;  1R43 A;  1HDQ A;  3FH4 A;  3CXP A;  4UA3 A;  1QST A;  3EO4 A;  1DTD A;  2AFU A;  4MFL A;  2FXF A;  4RN7 A;  4Q7A A;  2PIY A;  3SJG A;  4NXY A;  1L0C A;  3PFO A;  2H5M A;  1FNO A;  4MFP A;  1XFO A;  4P45 A;  3G8W A;  4DUK A;  3I9S A;  4NGN A;  1ZG9 A;  1WK4 A;  2YNC A;  1IY7 A;  3N5F A;  3W6S A;  4DNC A;  2Z3K A;  3PZJ A;  1MK4 A;  3SXO A;  4OC1 A;  3ISX A;  4NF1 A; 
#chains in the Genus database with same CATH homology
 1M1D A;  1KUV A;  4CYP A;  4KUA A;  5F47 A;  2HQY A;  3FRM A;  4B5P B;  2O28 A;  5H84 A;  3LD2 A;  2WPW A;  3VWE A;  4MI4 A;  1YR0 A;  2B4D B;  2JEV A;  2JDC A;  2PRB A;  1Q2D A;  2VZZ A;  2HV2 A;  3EFA A;  2Z3P A;  4XPK A;  3KKW A;  2GE3 A;  1IYK A;  1KUX A;  4ORF A;  2B5G A;  5DWM A;  1WWZ A;  3IWG A;  4C7I A;  2EVN A;  2I79 A;  4OAE A;  2REF A;  4Q36 A;  4CYN A;  2VZY A;  3V8I A;  1Q2C A;  1P4N A;  1QSN A;  1S7K A;  1SQH A;  2JDD A;  5AG7 A;  1IIC A;  1S3Z A;  4I49 A;  5DWN A;  3R96 A;  3R95 A;  4GS4 A;  4Y49 B;  3EC4 A;  3T9Y A;  2BUE A;  3DR6 A;  3E0K A;  4UBR A;  1XIX A;  4Y49 C;  1Q2Y A;  4B5P A;  4J3G A;  2FT0 A;  2B4D A;  2OZU A;  3TCV A;  5F48 A;  1CJW A;  5E96 A;  4PSW A;  4B10 A;  3DSB A;  1PUA A;  4A30 A;  1GHE A;  5I0C A;  2OB0 A;  4CS0 B;  4ONU A;  1K4J A;  1PU9 A;  3N7Z A;  1NE9 A;  4FD7 A;  1ON0 A;  2QEC A;  3MGD A;  2B58 A;  4B14 A;  1UFH A;  4XPD B;  3W6X A;  2QML A;  1BOB A;  3IWE A;  2K5T A;  4KZT A;  4KOW A;  1P0H A;  4XPD C;  1B6B A;  2Q4Y A;  2GIV A;  5AG5 A;  4CGM A;  2IL4 A;  5JQ4 A;  4JD6 A;  3TO7 A;  3ZZI A;  4QBJ A;  1VKC A;  1S7N A;  3T90 A;  4YRH A;  1YGH A;  2VQY A;  3NE7 A;  4CAE A;  4B12 A;  4JWP A;  5AG6 A;  2B4B A;  4BMH A;  4EVY A;  3R1K A;  2PSW A;  4JJX A;  2G3T A;  2RC4 A;  4UCN A;  1IID A;  5KTD A;  4U9Z A;  1ZO0 A;  2QIR A;  4QUS A;  1XEB A;  1NSL A;  1S60 A;  4KVO E;  2Z0Z A;  3R9E A;  5ISV A;  1M4G A;  3FIX A;  4C2Z A;  4H89 A;  1YX0 A;  3FBU A;  3TT2 A;  4A31 A;  2C27 A;  1I21 A;  4AG7 A;  2Z10 A;  5JPH A;  4HKF A;  4L89 A;  3TOA A;  4CAF A;  4IF5 A;  1XE4 A;  2R8V A;  4H6Z A;  2ZW7 A;  2DXQ A;  4C68 A;  1IB1 E;  2ZPA A;  2BL1 A;  2PR8 A;  4PK3 A;  2J8N A;  4KSF A;  2Q0Y A;  2YNE A;  4R3K A;  3A9L A;  3R9F A;  3BJ8 A;  3BLN A;  3D2M A;  2P0W A;  1N71 A;  3TO6 A;  2EUI A;  4R57 A;  2JLM A;  4AVC A;  2CNS A;  5G22 A;  2R98 A;  1M4I A;  2Z3O A;  3P2H A;  4MFZ A;  4PV6 A;  2OH1 A;  4HNY B;  1TIQ A;  3IU1 A;  3RYO A;  4LUA A;  3GKR A;  2VXK A;  3B8G A;  1MJ9 A;  1QSR A;  1S7F A;  2HUZ A;  2WSA A;  4M85 A;  1NMT A;  2YGW A;  5J8C A;  4KOR A;  2CNT A;  4CGP A;  3S6K A;  4KS9 A;  4HNW B;  3H4Q A;  3ZJ0 A;  4CAX A;  3QB8 A;  5KTA A;  2DPS A;  3PP9 A;  3TOB A;  4E2A A;  2BEI A;  5A27 A;  2Q44 A;  3JTK A;  1BO4 A;  4UWJ A;  3D3S A;  5G20 A;  2A4N A;  4RS2 A;  4MY3 A;  5IV0 A;  5G21 A;  1Z4E A;  4UCM A;  2R7H A;  4QC6 A;  2FCK A;  3F8K A;  2PQ8 A;  4JLY A;  3EY5 A;  3I3G A;  4MY0 A;  3SXN A;  3FB3 A;  2Z3L A;  3F0A A;  4A2Z A;  5H86 A;  1YK3 A;  2R1I A;  4KLW A;  4CAV A;  2ATR A;  3H5Z A;  4U9Y A;  4A33 A;  1KZF A;  2ARH A;  2FE7 A;  4Q38 A;  1Z9U A;  2YND A;  2OZH A;  4KOU A;  2VI7 A;  2PC1 A;  2I00 A;  1YLE A;  2ZW6 A;  3FXT A;  3PGP A;  4II9 A;  4BBH A;  5A28 A;  3C26 A;  4MHD A;  3SHP A;  1IYL A;  4ZGY B;  4AVA A;  2CNM A;  4KOV A;  2ZW4 A;  3TFY A;  3P2F A;  3CXQ A;  3TTH A;  2F5I A;  3VWD A;  2P6G A;  3D8P A;  5AG4 A;  5F49 A;  1R57 A;  2KCW A;  1RXT A;  4CGL A;  2VEZ A;  1QSO A;  4KUB A;  2Z3M A;  4MJ8 A;  2PR1 A;  4YFJ A;  5GCN A;  5HMN A;  2REE A;  3GYA A;  4HNX B;  4CGO A;  1J4J A;  4MFK A;  2G0B A;  2Q04 A;  3TE4 A;  1QSM A;  2VBQ A;  1YRE A;  5EBV A;  1XF8 A;  3R9G A;  1I1D A;  2OZG A;  3DDD A;  2CXA A;  5C88 A;  4QVT A;  1M44 A;  4A95 A;  1S7L A;  3CXS A;  4CGN A;  4NEX A;  1YVO A;  4NCZ A;  4PSX A;  4XNH B;  2FSR A;  4RI1 A;  4UFX A;  5J8F A;  4U5Y A;  1V0C A;  3WR7 A;  4CAW A;  3D2P A;  4UWI A;  4XNH C;  3TO9 A;  3G3S A;  4KOS A;  4B11 A;  5CNP A;  1MJA A;  1CM0 A;  3F5B A;  4JXQ A;  4MBU A;  1Z4R A;  5EC4 A;  2P6E A;  1LRZ A;  2WPX A;  1RO5 A;  2FIA A;  2WUU A;  2BSW A;  4F0X A;  2G3A A;  1S5K A;  4R87 A;  4H6U A;  2DPT A;  4KOT A;  4KOX A;  4R3L A;  4R9M A;  4F6A A;  5G1Z A;  3QAH A;  3IGR A;  2D4P A;  4YGO A;  4B5O A;  2CY2 A;  4PK2 A;  2Q7B A;  4CYO A;  3EXN A;  4FD6 A;  3FNC A;  3W91 A;  2AJ6 A;  4KVM E;  3S6F A;  4OAD A;  2J8M A;  1OZP A;  2FIW A;  4KVX A;  4L8A A;  4OLL A;  5IB0 A;  4CRZ B;  5KTC A;  4IUS A;  4AVB A;  4M3S A;  2FS5 A;  3LOD A;  4C2X A;  4XPL A;  1YVK A;  3S6G A;  4JXR A;  1FY7 A;  4CYQ A;  5HH1 A;  3BJ7 A;  2B3V A;  5C82 A;  4FD5 A;  5FVJ A;  3S6H A;  2OU2 A;  2FL4 A;  4AG9 A;  3UY5 A;  1Y9W A;  2Z11 A;  1I12 A;  4FD4 A;  2Y0M A;  4UFV A;  4F0Y A;  3IU2 A;  3DNS A;  2B3U A;  4MFJ A;  4MFQ A;  4ZBG A;  5F46 A;  3JUW A;  4NSQ A;  4UFW A;  5IX3 A;  4C7H A;  4K30 A;  2YNC C;  4CRY B;  4E0A A;  2X7B A;  3DR8 A;  1M4D A;  1U6M A;  2D4O A;  1Y7R A;  3JVN A;  2NMT A;  1KUY A;  4A32 A;  2P6F A;  5AGE A;  4UCP A;  2J8R A;  1MJB A;  4X5K A;  2PDO A;  2ZXV A;  2AE6 A;  2B5G B;  5BWA B;  4B13 A;  2Q4V A;  4KSA A;  4KOY A;  4E8O A;  3K9U A;  2Z3N A;  3FYN A;  1XMT A;  1Y9K A;  2ZW5 A;  2GAN A;  4C2Y A;  4KLV A;  3GY9 A;  4LX9 A;  4QB9 A;  1B87 A;  1VHS A;  3OWC A;  3CXP A;  4UA3 A;  1QST A;  3EO4 A;  4MFL A;  2FXF A;  4NXY A;  1L0C A;  2H5M A;  4MFP A;  3G8W A;  3I9S A;  1WK4 A;  2YNC A;  3W6S A;  4DNC A;  2Z3K A;  3PZJ A;  1MK4 A;  3SXO A;  4AB7 A;  4NF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...