1SQHA

X-ray structure of drosophila malonogaster protein q9vr51 northeast structural genomics consortium target fr87.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
297
Chain Sequence
GDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLLAAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQKDLVNEWIKLVPNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein CG14615-PA
publication title X-RAY STRUCTURE OF DROSOPHILA MALONOGASTER PROTEIN Q9VR51 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET FR87
rcsb
source organism Drosophila melanogaster
molecule tags Structural genomics, unknown function
total genus 89
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08445 FR47 FR47-like protein
A PF18713 DUF5645 Domain of unknown function (DUF5645)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1sqhA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1sqhA02
1SQHA 3SXOA 2P6FA 3SXNA 3PGPA 1Z9UA 4YRHA 2Q04A 2FS5A 3TOBA 2J8MA 3GY9A 3UY5A 1KZFA 4AVAA 2OH1A 3LD2A 4YFJA 1N71A 3T9YA 4B5OA 1S7LA 3V8IA 3FBUA 3FRMA 4NEXA 4Y49C 2JDDA 5EC4A 4FD4A 2B5GA 5HH1A 4UWIA 5KTDA 5F49A 1ON0A 4R9MA 2I00A 2FT0A 2ZPAA 1MJAA 3TO6A 4QB9A 4NXYA 5IB0A 1Y9KA 2BL1A 1Y9WA 4OLLA 4R57A 3T90A 3I9SA 3F8KA 3GKRA 5IV0A 2J8NA 5E96A 2VQYA 3KKWA 3WR7A 4AVBA 4HKFA 1BOBA 3CXPA 2P6EA 2Z11A 3R1KA 2ARHA 1NE9A 1IYLA 2VEZA 2B5GB 4XNHC 1M4IA 2GIVA 3TOAA 4AG7A 3CXQA 1CM0A 3B8GA 4AB7A 1QSRA 1RO5A 2FCKA 3ZZIA 4JD6A 1Z4RA 4MHDA 1B6BA 2QMLA 2VXKA 3G3SA 4NCZA 1GHEA 5F48A 3QAHA 4L8AA 4QC6A 1CJWA 5IX3A 4EVYA 4ORFA 2PC1A 1KUXA 2Z0ZA 2OZGA 4NF1A 2PRBA 3TTHA 3NE7A 2REFA 4IUSA 2FIAA 2P0WA 3D2PA 4E0AA 2BUEA 3S6KA 4KUAA 4AVCA 1I21A 2ZW4A 2REEA 2GE3A 4CAVA 1S7FA 2RC4A 4JLYA 2R8VA 3N7ZA 3D2MA 3RYOA 4H6ZA 2ZXVA 4HNXB 4K30A 1L0CA 1Y7RA 1S60A 2AJ6A 2J8RA 4KVOE 3D3SA 2O28A 1WK4A 2ZW5A 4BMHA 2AE6A 1RXTA 5KTAA 3R96A 1S3ZA 4FD5A 2BEIA 4IF5A 4JXQA 2GANA 2BSWA 5HMNA 1PU9A 2A4NA 2Q4YA 1MK4A 3DR6A 2WPXA 2ATRA 2JLMA 1XEBA 3GYAA 2OZHA 4KVXA 3BJ7A 1J4JA 1IB1E 4U5YA 4RS2A 1XMTA 4PK3A 3JVNA 3R95A 1VHSA 2R98A 3TCVA 2KCWA 3FB3A 2G3TA 1OZPA 1U6MA 5C82A 1VKCA 5GCNA 2HUZA 2Q7BA 4CAWA 1Q2DA 3CXSA 4KOWA 1V0CA 2CNTA 4KOSA 4XPKA 1YR0A 2OU2A 2CY2A 2B4DA 1LRZA 1YVKA 4ONUA 2D4OA 2B58A 1IIDA 2FE7A 3EC4A 3EY5A 2D4PA 2HQYA 3EXNA 2FXFA 2PR8A 3IWGA 2G0BA 1S5KA 3R9EA 3W91A 4QUSA 2FIWA 4NSQA 4F6AA 1NSLA 5H84A 3DDDA 2ZW6A 2IL4A 4H89A 1FY7A 4FD7A 1YGHA 3TE4A 3EO4A 4KOUA 4KOTA 1WWZA 2PR1A 4B5PA 1NMTA 2B4BA 2ZW7A 3BLNA 1XE4A 3TFYA 4M85A 2B4DB 2B3VA 2CNMA 4RI1A 2H5MA 1MJBA 4PK2A 4UBRA 1IYKA 3DSBA 1K4JA 4CAXA 1YREA 2QECA 3W6SA 4KZTA 1MJ9A 3DR8A 3K9UA 4AG9A 1QSMA 3QB8A 4DNCA 1M1DA 2R1IA 1B87A 4JXRA 1M44A 1S7NA 4F0YA 5F47A 4B5PB 5ISVA 2Y0MA 1KUYA 4MJ8A 4UWJA 4R3LA 4UA3A 4H6UA 3E0KA 3EFAA 4CS0B 2NMTA 4PV6A 1IICA 2I79A 3P2FA 3JUWA 4KOVA 4J3GA 5DWNA 4CRYB 2Q44A 5KTCA 1Z4EA 4CRZB 5F46A 2FSRA 2X7BA 4KVME 3FIXA 1QSOA 2G3AA 2PSWA 4JWPA 2VI7A 5J8CA 4MBUA 4FD6A 3VWEA 1P4NA 3S6HA 3C26A 1PUAA 2CNSA 2Z10A 4MY0A 1R57A 5J8FA 4KORA 3F5BA 5I0CA 2HV2A 5C88A 3FNCA 3IGRA 3P2HA 3OWCA 3MGDA 4LUAA 3TO7A 5H86A 4ZBGA 3ZJ0A 3DNSA 2EUIA 3FXTA 5JQ4A 2EVNA 4XNHB 1YLEA 3TT2A 1BO4A 3F0AA 4XPDB 2Q0YA 5FVJA 4QVTA 4M3SA 4R87A 1UFHA 1I1DA 3LODA 4U9ZA 2WPWA 4KLWA 2OB0A 4PSXA 3I3GA 4L89A 3SHPA 2DXQA 2JDCA 2C27A 1I12A 4MI4A 2OZUA 5EBVA 4U9YA 4KOXA 5CNPA 2FL4A 2QIRA 3TO9A 4XPDC 4GS4A 2B3UA 1XF8A 1S7KA 1YK3A 3FYNA 1QSTA 2VBQA 4OADA 5DWMA 4KOYA 3PZJA 4PSWA 1KUVA 3S6FA 1YX0A 2Q4VA 3S6GA 4JJXA 3PP9A 1QSNA 1TIQA 4R3KA 3R9FA 4QBJA 4HNYB 2JEVA 1M4GA 1P0HA 4KLVA 1XIXA 2R7HA 3G8WA 3R9GA 3VWDA 4X5KA 3W6XA 1M4DA 4E8OA 1YVOA 3D8PA 1Q2YA 2VZYA 2VZZA 2F5IA 1Q2CA 2PQ8A 4OAEA 3BJ8A 4E2AA 4XPLA 4YGOA 2PDOA 4LX9A 4KUBA 2P6GA 3H4QA 4Y49B 4MY3A 4HNWB 2K5TA 4II9A 5JPHA 4I49A
chains in the Genus database with same CATH superfamily
1SQHA 3IWWA 3FJUA 2Z3OA 3SI0A 4IAVA 3IO1A 3D7DA 3SXOA 2YNCA 2P6FA 3SXNA 3PGPA 1ARMA 1Z9UA 1HEEA 4YRHA 4B14A 2Q04A 2FS5A 1BPMA 3TOBA 3SI2A 1Y0YA 2J8MA 4K3NA 4JZ0A 3GY9A 3UY5A 1KZFA 4AVAA 3MN8A 3KHXA 2ZEGA 2OH1A 4PXDA 3FEEA 3GB0A 1YW4A 3LD2A 4YFJA 1N71A 3T9YA 4B5OA 1FNOA 1S7LA 3LMSA 3V8IA 1H8LA 3RO0A 4A30A 2Z3PA 3FBUA 4CYOA 4MCPA 3FRMA 4NEXA 1TXRA 4Y49C 5LRGA 1BAVA 2JDDA 5AGEA 1GYTA 2BO9A 4C68A 2PJ7A 5EC4A 4CGMA 4FD4A 1IOIA 4B6ZA 2B5GA 5HH1A 4Q36A 5D29A 4UWIA 1VIXA 4MFKA 5KTDA 4CGPA 4UFXA 2XEGA 5F49A 1ON0A 4R9MA 5K8OA 2I00A 1ARLA 2FT0A 2ZPAA 2GFQA 1MJAA 4C2YA 3TO6A 4QB9A 2XEIA 3FF3A 1YLOA 4NXYA 2C6GA 5IB0A 4F9UA 1Y9KA 2BL1A 4TNUA 1Y9WA 4OLLA 1PYTB 4R57A 3T90A 3D4UA 3I9SA 1R3NA 2ANPA 3F8KA 3GKRA 4NJRA 5EMIA 5IV0A 2J8NA 4O23A 2VQYA 3KKWA 5E96A 3WR7A 3CPAA 4HKFA 4AVBA 3KASA 4AXVA 1BOBA 3ISXA 1F2PA 3CZXA 3CXPA 2P6EA 2Z11A 3R1KA 2AFSA 3RBUA 2ARHA 1NE9A 1IYLA 2VEZA 2B5GB 4XNHC 1M4IA 1NSAA 2CXAA 1XFOA 2PJ1A 4X3RA 3FMCA 3K9TA 4P6YA 4KSFA 3WT4A 4MHNA 2GIVA 2PJ4A 3TOAA 4AG7A 3CXQA 1CM0A 1KWMA 4P4EA 4MFZA 2PIYA 3B8GA 4HPSA 4AB7A 1QSRA 2PE3A 1RO5A 2FCKA 3ZZIA 3PFOA 3WC7A 4WJBA 3PB7X 1CX8A 3TC8A 4JD6A 2DF5A 1Z4RA 4MHDA 1B6BA 2PJ9A 2PJ8A 1F2OA 1ZLIA 1GHEA 2QMLA 2F8HA 2VXKA 3G3SA 2IQ6A 1UWYA 2PCUA 2PJ6A 3QAHA 4MCQA 5F48A 4L8AA 1TKHA 4QC6A 4C2XA 3PFEA 1CJWA 4OIDA 5IX3A 4EVYA 3JTKA 1CP7A 4ORFA 2PC1A 1KUXA 3FECA 2Z0ZA 2XEFA 2OZGA 4NF1A 4ZY0A 2PRBA 3KGQA 3NE7A 2PJ2A 3TTHA 4B10A 2REFA 4PXCA 4IUSA 1Z8LA 2FIAA 2P0WA 3D2PA 4A95A 4E0AA 2PJ5A 2BUEA 3S6KA 4KUAA 4AVCA 1I21A 1ZO0A 3QNVA 1YQEA 2ZW4A 4GXHA 1CBXA 4A33A 2REEA 2GE3A 4CAVA 2PJ0A 1S7FA 1IGBA 2PVVA 4Q7AA 3T8WA 2RC4A 2WUUA 1PCAA 3D7HA 4JLYA 4LQ6A 3I1UA 3IJ3A 4A2ZA 2QVPA 2R8VA 3N7ZA 3PB9X 3D2MA 3RYOA 4H6ZA 2ZXVA 4HNXB 3TX8A 4K30A 3NE8A 2HC9A 3KL9A 4DUKA 4CAFA 2RFHA 1XJOA 1L0CA 1Y7RA 3B2YA 1S60A 2OR4A 2AJ6A 4FAIA 4NCZA 3SJGA 2J8RA 4KVOE 3D3SA 3S9NA 1VHOA 2O28A 3D67A 1VHEA 1WK4A 2ZW5A 1LANA 2AE6A 4BMHA 5IB9A 1RXTA 5KTAA 3H5ZA 3R96A 2Q43A 4CGLA 4MCRA 1S3ZA 1CPXA 2BEIA 2G9DA 4FD5A 4P4BA 4IF5A 2BCOA 2C6CA 4JXQA 2GANA 2BSWA 5HMNA 1PU9A 3KQXA 2A4NA 3PBBA 4NGSA 2Q4YA 2AFXA 1MK4A 3DR6A 1XRYA 4H2KA 2WPXA 2ATRA 5JH9A 2JLMA 1XEBA 1AYEA 4KS9A 5HVFA 3GYAA 2OZHA 4MCSA 4P4JA 4ZI6A 2GLFA 2ZEEA 4CYNA 2ABZA 4KVXA 4B12A 5BWAB 3BJ7A 4FBEA 1J4JA 4OC4A 3B3VA 2AFZA 3S9LA 1IB1E 4U5YA 4BBHA 5CBMA 1RTQA 4RS2A 4CYPA 2O53A 1FT7A 1XMTA 4MXUA 4PK3A 3JVNA 4MHPA 3IFEA 3R95A 1VHSA 2R98A 3TCVA 2KCWA 3FB3A 1CG2A 3CDXA 4GM5A 3H8FA 2G3TA 2CTCA 4C7IA 1OZPA 1U6MA 2VL1A 2YNEA 1VKCA 5C82A 2QJ8A 5LYIA 3IU2A 2Z3MA 3V38A 2PJ3A 4F9VA 5GCNA 2V8GA 2HUZA 2Q7BA 4C7HA 4CAWA 4YWYA 5LYDA 1TKJA 1Q2DA 3CXSA 5AG7A 2IJZA 2YNDA 3NH4A 1V0CA 4KOWA 4P4FA 3HLPA 1ZG9A 4YU9A 2CNTA 1ELLP 2BOAA 5AG6A 4OC5A 3NH8A 4NGPA 2Q51A 5DS0A 4KOSA 4MHZA 2PJBA 4P45A 4XPKA 1YR0A 3PB8X 4UEEA 4MFPA 3SI1A 5LRKA 2OU2A 2CY2A 2PIZA 2B4DA 2V8HA 2YNCC 4UCMA 3IEHA 1LRZA 1YVKA 4ONUA 2D4OA 3IWEA 4IK2A 3B35A 2QYVA 4A39A 2B58A 1IIDA 2FE7A 3EC4A 4EWTA 3EY5A 2D4PA 2NYQA 2HQYA 4TWEA 4NGTA 4R7MA 2AFUA 2JBKA 5G20A 3EXNA 2FXFA 4NFRA 2PR8A 3IWGA 2G0BA 3SJEA 1S5KA 3R9EA 3W91A 4QUSA 2FIWA 2FVGA 4NSQA 4F6AA 2I3CA 2AFWA 3VH9A 2GU2A 4FWUA 2ZOGA 4IHMA 5J1QA 5G1ZA 1NSLA 3B3TA 3ISZA 4UEFA 5H84A 2WSAA 3DDDA 2ZW6A 4B11A 2O4HA 1EE3P 4UCNA 2V77A 3FX6A 2IL4A 5D8NA 2DPSA 4H89A 1JQGA 1FY7A 4FD7A 1YGHA 4MRIA 7CPAA 3EO4A 3TE4A 4KOUA 1A2ZA 1WWZA 2PR1A 2ODFA 4KOTA 4X8IA 5G21A 4B5PA 5K8PA 1NMTA 2B4BA 3B7IA 2ZW7A 3BLNA 3NH5A 1XE4A 3WABA 4BD9A 3KI9A 1ZG8A 4M85A 4CAEA 2B4DB 2B3VA 3TFYA 1YMEA 2CNMA 3A9LA 5CPAA 4RI1A 2Z3LA 2ZEDA 2V8DA 5K8NA 2H5MA 1MJBA 2J9AA 3LACA 4PK2A 4UBRA 1IYKA 3DSBA 3VATA 1K4JA 3RNZA 2EO8A 5F09A 5HVGA 3GLJA 4CAXA 1ZLHA 5AG5A 1XMBA 1YREA 2F7VA 5HXDA 4NGQA 1LAMA 2QECA 3W6SA 3KR4A 4A32A 1XOVA 4KZTA 1MJ9A 4A94A 4RUHA 3DR8A 3K9UA 4AG9A 3CT9A 1TF8A 2ZEFA 4PQAA 5LYFA 1QSMA 2CIJA 4A37A 4UCPA 2EK8A 1BPNA 1Z8XA 2Z3KA 3KZWA 3QB8A 4C2ZA 4DNCA 1M1DA 1F57A 2R1IA 2V8VA 1B87A 5K8MA 4JXRA 4R6TA 1M44A 1S7NA 2EBJA 4F0YA 1TKFA 1Y0RA 4R8FA 5JM6A 5F47A 4B5PB 5ISVA 2NSMA 1LOKA 2Y0MA 4A38A 1KUYA 4MJ8A 2PRQA 2ZEMA 2OOTA 4UWJA 4R3LA 4UA3A 2JEWA 2ZENA 4H6UA 3E0KA 3EFAA 4CS0B 2NMTA 4PV6A 1DE4C 1IICA 2DEAA 2IMOA 3PB4X 5LRJA 4ONWA 2I79A 3GUXA 1HDQA 3JUWA 3P2FA 4LQGA 4KOVA 4UFVA 3BI1A 3PB6X 2ZELA 4J3GA 5DWNA 4P44A 2Q44A 4CRYB 5KTCA 4PPZA 4OP4A 1Z4EA 4MMOA 4CRZB 5F46A 2FSRA 8CPAA 2X7BA 3B3SA 4PXBA 4KVME 3FIXA 2C6PA 3FVLA 1QSOA 2G3AA 2PSWA 4JWPA 4M6HA 2VI7A 3D7GA 3SJFA 3H8EA 4KSAA 6CPAA 5J8CA 4NJQA 4CYQA 1CP6A 3NFZA 3PRTA 4MBUA 3QAYA 2AFOA 4FD6A 2WZNA 3VWEA 1P4NA 3S6HA 4BINA 4DJLA 4OC1A 4NGRA 1PUAA 3C26A 2CNSA 2Z10A 4MY0A 3BXMA 1R57A 3VARA 4CPAA 2PJAA 3IIBA 5J8FA 4KORA 1XBUA 3F5BA 5A28A 5I0CA 2HV2A 5C88A 5JPHA 4Q38A 2Q4ZA 3FNCA 3JRUA 3IGRA 1M4LA 4UEZA 3RZAA 1BLLE 4OC3A 2Q7SA 3P2HA 3OWCA 1OBRA 3MGDA 4LUAA 3TO7A 3MRUA 3N5FA 3BHXA 1Z8WA 2JBJA 5H86A 4ZBGA 3ZJ0A 3KR5A 2ZEHA 3WC6A 3DNSA 2EUIA 3FXTA 4P4DA 1IY7A 2XEJA 5JQ4A 2EVNA 3DLJA 4OMEA 4XNHB 1YLEA 3TT2A 1BO4A 3F0AA 3GIUA 4XPDB 2Q0YA 1TF9A 2GLJA 5FVJA 2HB6A 4QVTA 4M3SA 4UIAA 4R87A 1UFHA 4EMEA 5ELYA 5THWA 4Z65A 5A27A 3H8GA 1LAPA 1I1DA 3LODA 4U9ZA 1R43A 2WPWA 3WC5A 4KLWA 2RB7A 4W9YA 2Z3NA 5AG4A 1Z8TA 2OB0A 4MFQA 2DPTA 5I4MA 3NA6A 3DGVA 4PSXA 4OC2A 3I3GA 4L89A 3SHPA 4MFJA 2DXQA 4F0XA 1YSJA 2JDCA 2C27A 1I12A 1Z2LA 4MI4A 1HDUA 2OZUA 2CF4A 5EBVA 4M6IA 2ZEPA 4U9YA 2PVWA 4KOXA 5CNPA 2PJCA 2FL4A 2QIRA 1Z5RA 3L2NA 1CPSA 3TO9A 3V7ZA 1Q7LA 2EK9A 3CPXA 3IU1A 4JYWA 3FH4A 4GS4A 4RN7A 4X2TA 4XPDC 4G1PA 2B3UA 1XF8A 2ZEOA 4ZGYB 1S7KA 1YK3A 2GREA 2YGWA 1QSTA 3FYNA 2VBQA 4OADA 4P4IA 4UF4A 5DWMA 4FUUA 4R76A 4WWVA 3S9MA 4CGNA 3B3WA 1DTDA 1QQ9A 4NGNA 4ZX9A 4B13A 4KOYA 3D7FA 3HUVA 3PZJA 1ZG7A 1KUVA 4PSWA 1YW6A 4UFWA 3S6FA 1YX0A 1JWQA 2Q4VA 3KHZA 5G22A 4PXEA 4M6GA 4P10A 4ZY2A 1ELMP 3S6GA 3IC1A 4JJXA 1QSNA 3PP9A 1TIQA 3K2KA 4OKOA 4R3KA 4KSIA 1AMPA 3R9FA 3B3CA 2EWBA 5HVHA 2C1CA 1VGYA 1LFWA 2WYRA 4HNYB 4QBJA 2JEVA 4ZYQA 1M4GA 1Y7EA 4NGMA 1P0HA 3PBEA 4KLVA 1X12A 2AFMA 1AUGA 3LWUA 1XIXA 2CTBA 4A31A 2R7HA 3G8WA 3R9GA 4OC0A 1IU8A 2POKA 4UIBA 3VWDA 1LCPA 4X5KA 1IOFA 1M4DA 3W6XA 4E8OA 1YVOA 4ZY1A 4DYOA 3D8PA 1Q2YA 1QMUA 2VZYA 3BI0A 3KQZA 2VZZA 4MFLA 4CGOA 2F5IA 4EFDA 1Q2CA 2PQ8A 4OAEA 4OIWA 3BJ8A 5JGFA 4E2AA 3FEDA 3D68A 4XPLA 2ZOFA 4YGOA 3RAMA 2PDOA 4MHYA 3D66A 4LX9A 4ZX8A 3SJXA 5LYLA 4KUBA 2P6GA 4F8ZA 3H4QA 4Y49B 4MY3A 4HNWB 2K5TA 4II9A 3PEIA 4I49A 1X10A
chains in the Genus database with same CATH topology
1SQHA 2Z3OA 3SXOA 2YNCA 2P6FA 3SXNA 3PGPA 1Z9UA 4YRHA 4B14A 2Q04A 2FS5A 3TOBA 2J8MA 3GY9A 3UY5A 1KZFA 4AVAA 2OH1A 3LD2A 4YFJA 1N71A 3T9YA 4B5OA 1S7LA 3V8IA 4A30A 2Z3PA 3FBUA 4CYOA 3FRMA 4NEXA 4Y49C 2JDDA 5AGEA 4C68A 5EC4A 4CGMA 4FD4A 2B5GA 5HH1A 4Q36A 4UWIA 4MFKA 5KTDA 4CGPA 4UFXA 5F49A 1ON0A 4R9MA 2I00A 2FT0A 2ZPAA 4C2YA 1MJAA 3TO6A 4QB9A 4NXYA 5IB0A 1Y9KA 2BL1A 1Y9WA 4OLLA 4R57A 3T90A 3I9SA 3F8KA 3GKRA 5IV0A 2J8NA 5E96A 2VQYA 3KKWA 3WR7A 4AVBA 4HKFA 1BOBA 3CXPA 2P6EA 2Z11A 3R1KA 2ARHA 1NE9A 1IYLA 2VEZA 2B5GB 4XNHC 1M4IA 2CXAA 4KSFA 2GIVA 3TOAA 4AG7A 3CXQA 1CM0A 4MFZA 3B8GA 4AB7A 1QSRA 1RO5A 2FCKA 3ZZIA 4JD6A 1Z4RA 4MHDA 1B6BA 2QMLA 2VXKA 3G3SA 4NCZA 1GHEA 5F48A 3QAHA 4L8AA 4QC6A 4C2XA 1CJWA 5IX3A 4EVYA 3JTKA 4ORFA 2PC1A 1KUXA 2Z0ZA 2OZGA 4NF1A 2PRBA 3TTHA 3NE7A 4B10A 2REFA 4IUSA 4A95A 2FIAA 2P0WA 3D2PA 4E0AA 2BUEA 3S6KA 4KUAA 4AVCA 1I21A 1ZO0A 2ZW4A 4A33A 2REEA 2GE3A 4CAVA 1S7FA 2RC4A 2WUUA 4JLYA 4A2ZA 2R8VA 3N7ZA 3D2MA 3RYOA 4H6ZA 2ZXVA 4HNXB 4K30A 4CAFA 1L0CA 1Y7RA 1S60A 2AJ6A 2J8RA 4KVOE 3D3SA 2O28A 1WK4A 2ZW5A 4BMHA 2AE6A 1RXTA 5KTAA 3H5ZA 3R96A 4CGLA 1S3ZA 4FD5A 2BEIA 4IF5A 4JXQA 2GANA 2BSWA 5HMNA 1PU9A 2A4NA 2Q4YA 1MK4A 3DR6A 2WPXA 2ATRA 2JLMA 1XEBA 4KS9A 3GYAA 2OZHA 4CYNA 4KVXA 4B12A 5BWAB 3BJ7A 1J4JA 1IB1E 4U5YA 4BBHA 4CYPA 4RS2A 1XMTA 4PK3A 3JVNA 3R95A 1VHSA 2R98A 3TCVA 2KCWA 3FB3A 2G3TA 4C7IA 1OZPA 1U6MA 2YNEA 5C82A 1VKCA 3IU2A 2Z3MA 5GCNA 4C7HA 2HUZA 2Q7BA 4CAWA 1Q2DA 3CXSA 5AG7A 2YNDA 4KOWA 1V0CA 2CNTA 5AG6A 4KOSA 4XPKA 1YR0A 4MFPA 2OU2A 2CY2A 2YNCC 2B4DA 4UCMA 1LRZA 1YVKA 4ONUA 2D4OA 3IWEA 2B58A 1IIDA 2FE7A 3EC4A 3EY5A 2D4PA 2HQYA 5G20A 3EXNA 2FXFA 2PR8A 3IWGA 2G0BA 1S5KA 3R9EA 3W91A 4QUSA 2FIWA 4NSQA 4F6AA 5G1ZA 1NSLA 5H84A 2WSAA 3DDDA 2ZW6A 4B11A 4UCNA 2IL4A 2DPSA 4H89A 1FY7A 4FD7A 1YGHA 3TE4A 3EO4A 4KOUA 4KOTA 1WWZA 2PR1A 5G21A 4B5PA 1NMTA 2B4BA 2ZW7A 3BLNA 1XE4A 3TFYA 4M85A 4CAEA 2B4DB 2B3VA 2CNMA 3A9LA 4RI1A 2Z3LA 2H5MA 1MJBA 4PK2A 4UBRA 1IYKA 3DSBA 1K4JA 4CAXA 5AG5A 1YREA 2QECA 4A32A 3W6SA 4KZTA 1MJ9A 3DR8A 3K9UA 4AG9A 1QSMA 4UCPA 2Z3KA 4C2ZA 3QB8A 4DNCA 1M1DA 2R1IA 1B87A 4JXRA 1M44A 1S7NA 4F0YA 5F47A 4B5PB 5ISVA 2Y0MA 1KUYA 4MJ8A 4UWJA 4R3LA 4UA3A 4H6UA 3E0KA 3EFAA 4CS0B 2NMTA 4PV6A 1IICA 2I79A 3P2FA 3JUWA 4KOVA 4UFVA 4J3GA 5DWNA 4CRYB 2Q44A 5KTCA 1Z4EA 4CRZB 5F46A 2FSRA 2X7BA 4KVME 3FIXA 1QSOA 2G3AA 2PSWA 4JWPA 2VI7A 5J8CA 4KSAA 4CYQA 4MBUA 4FD6A 3VWEA 1P4NA 3S6HA 3C26A 1PUAA 2CNSA 2Z10A 4MY0A 1R57A 5J8FA 4KORA 3F5BA 5A28A 5I0CA 2HV2A 5C88A 4Q38A 3FNCA 3IGRA 3P2HA 3OWCA 3MGDA 4LUAA 3TO7A 5H86A 4ZBGA 3ZJ0A 3DNSA 2EUIA 3FXTA 5JQ4A 2EVNA 4XNHB 1YLEA 3TT2A 1BO4A 3F0AA 4XPDB 2Q0YA 5FVJA 4QVTA 4M3SA 4R87A 1UFHA 5A27A 1I1DA 3LODA 4U9ZA 2WPWA 4KLWA 2Z3NA 5AG4A 2OB0A 4MFQA 2DPTA 4PSXA 3I3GA 4L89A 3SHPA 4MFJA 2DXQA 4F0XA 2JDCA 2C27A 1I12A 4MI4A 2OZUA 5EBVA 4U9YA 4KOXA 5CNPA 2FL4A 2QIRA 3TO9A 3IU1A 4XPDC 4GS4A 2B3UA 1XF8A 4ZGYB 1S7KA 1YK3A 2YGWA 3FYNA 1QSTA 2VBQA 4OADA 5DWMA 4CGNA 4B13A 4KOYA 3PZJA 4PSWA 1KUVA 3S6FA 4UFWA 1YX0A 2Q4VA 5G22A 3S6GA 4JJXA 3PP9A 1QSNA 1TIQA 4R3KA 3R9FA 4QBJA 4HNYB 2JEVA 1M4GA 1P0HA 4KLVA 1XIXA 4A31A 2R7HA 3G8WA 3R9GA 3VWDA 4X5KA 3W6XA 1M4DA 4E8OA 1YVOA 3D8PA 1Q2YA 2VZYA 4MFLA 2VZZA 4CGOA 2F5IA 1Q2CA 2PQ8A 4OAEA 3BJ8A 4E2AA 4XPLA 4YGOA 2PDOA 4LX9A 4KUBA 2P6GA 3H4QA 4Y49B 4MY3A 4HNWB 2K5TA 4II9A 5JPHA 4I49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQH A;  3SXO A;  2P6F A;  3SXN A;  3PGP A;  1Z9U A;  4YRH A;  2Q04 A;  2FS5 A;  3TOB A;  2J8M A;  3GY9 A;  3UY5 A;  1KZF A;  4AVA A;  2OH1 A;  3LD2 A;  4YFJ A;  1N71 A;  3T9Y A;  4B5O A;  1S7L A;  3V8I A;  3FBU A;  3FRM A;  4NEX A;  4Y49 C;  2JDD A;  5EC4 A;  4FD4 A;  2B5G A;  5HH1 A;  4UWI A;  5KTD A;  5F49 A;  1ON0 A;  4R9M A;  2I00 A;  2FT0 A;  2ZPA A;  1MJA A;  3TO6 A;  4QB9 A;  4NXY A;  5IB0 A;  1Y9K A;  2BL1 A;  1Y9W A;  4OLL A;  4R57 A;  3T90 A;  3I9S A;  3F8K A;  3GKR A;  5IV0 A;  2J8N A;  5E96 A;  2VQY A;  3KKW A;  3WR7 A;  4AVB A;  4HKF A;  1BOB A;  3CXP A;  2P6E A;  2Z11 A;  3R1K A;  2ARH A;  1NE9 A;  1IYL A;  2VEZ A;  2B5G B;  4XNH C;  1M4I A;  2GIV A;  3TOA A;  4AG7 A;  3CXQ A;  1CM0 A;  3B8G A;  4AB7 A;  1QSR A;  1RO5 A;  2FCK A;  3ZZI A;  4JD6 A;  1Z4R A;  4MHD A;  1B6B A;  2QML A;  2VXK A;  3G3S A;  4NCZ A;  1GHE A;  5F48 A;  3QAH A;  4L8A A;  4QC6 A;  1CJW A;  5IX3 A;  4EVY A;  4ORF A;  2PC1 A;  1KUX A;  2Z0Z A;  2OZG A;  4NF1 A;  2PRB A;  3TTH A;  3NE7 A;  2REF A;  4IUS A;  2FIA A;  2P0W A;  3D2P A;  4E0A A;  2BUE A;  3S6K A;  4KUA A;  4AVC A;  1I21 A;  2ZW4 A;  2REE A;  2GE3 A;  4CAV A;  1S7F A;  2RC4 A;  4JLY A;  2R8V A;  3N7Z A;  3D2M A;  3RYO A;  4H6Z A;  2ZXV A;  4HNX B;  4K30 A;  1L0C A;  1Y7R A;  1S60 A;  2AJ6 A;  2J8R A;  4KVO E;  3D3S A;  2O28 A;  1WK4 A;  2ZW5 A;  4BMH A;  2AE6 A;  1RXT A;  5KTA A;  3R96 A;  1S3Z A;  4FD5 A;  2BEI A;  4IF5 A;  4JXQ A;  2GAN A;  2BSW A;  5HMN A;  1PU9 A;  2A4N A;  2Q4Y A;  1MK4 A;  3DR6 A;  2WPX A;  2ATR A;  2JLM A;  1XEB A;  3GYA A;  2OZH A;  4KVX A;  3BJ7 A;  1J4J A;  1IB1 E;  4U5Y A;  4RS2 A;  1XMT A;  4PK3 A;  3JVN A;  3R95 A;  1VHS A;  2R98 A;  3TCV A;  2KCW A;  3FB3 A;  2G3T A;  1OZP A;  1U6M A;  5C82 A;  1VKC A;  5GCN A;  2HUZ A;  2Q7B A;  4CAW A;  1Q2D A;  3CXS A;  4KOW A;  1V0C A;  2CNT A;  4KOS A;  4XPK A;  1YR0 A;  2OU2 A;  2CY2 A;  2B4D A;  1LRZ A;  1YVK A;  4ONU A;  2D4O A;  2B58 A;  1IID A;  2FE7 A;  3EC4 A;  3EY5 A;  2D4P A;  2HQY A;  3EXN A;  2FXF A;  2PR8 A;  3IWG A;  2G0B A;  1S5K A;  3R9E A;  3W91 A;  4QUS A;  2FIW A;  4NSQ A;  4F6A A;  1NSL A;  5H84 A;  3DDD A;  2ZW6 A;  2IL4 A;  4H89 A;  1FY7 A;  4FD7 A;  1YGH A;  3TE4 A;  3EO4 A;  4KOU A;  4KOT A;  1WWZ A;  2PR1 A;  4B5P A;  1NMT A;  2B4B A;  2ZW7 A;  3BLN A;  1XE4 A;  3TFY A;  4M85 A;  2B4D B;  2B3V A;  2CNM A;  4RI1 A;  2H5M A;  1MJB A;  4PK2 A;  4UBR A;  1IYK A;  3DSB A;  1K4J A;  4CAX A;  1YRE A;  2QEC A;  3W6S A;  4KZT A;  1MJ9 A;  3DR8 A;  3K9U A;  4AG9 A;  1QSM A;  3QB8 A;  4DNC A;  1M1D A;  2R1I A;  1B87 A;  4JXR A;  1M44 A;  1S7N A;  4F0Y A;  5F47 A;  4B5P B;  5ISV A;  2Y0M A;  1KUY A;  4MJ8 A;  4UWJ A;  4R3L A;  4UA3 A;  4H6U A;  3E0K A;  3EFA A;  4CS0 B;  2NMT A;  4PV6 A;  1IIC A;  2I79 A;  3P2F A;  3JUW A;  4KOV A;  4J3G A;  5DWN A;  4CRY B;  2Q44 A;  5KTC A;  1Z4E A;  4CRZ B;  5F46 A;  2FSR A;  2X7B A;  4KVM E;  3FIX A;  1QSO A;  2G3A A;  2PSW A;  4JWP A;  2VI7 A;  5J8C A;  4MBU A;  4FD6 A;  3VWE A;  1P4N A;  3S6H A;  3C26 A;  1PUA A;  2CNS A;  2Z10 A;  4MY0 A;  1R57 A;  5J8F A;  4KOR A;  3F5B A;  5I0C A;  2HV2 A;  5C88 A;  3FNC A;  3IGR A;  3P2H A;  3OWC A;  3MGD A;  4LUA A;  3TO7 A;  5H86 A;  4ZBG A;  3ZJ0 A;  3DNS A;  2EUI A;  3FXT A;  5JQ4 A;  2EVN A;  4XNH B;  1YLE A;  3TT2 A;  1BO4 A;  3F0A A;  4XPD B;  2Q0Y A;  5FVJ A;  4QVT A;  4M3S A;  4R87 A;  1UFH A;  1I1D A;  3LOD A;  4U9Z A;  2WPW A;  4KLW A;  2OB0 A;  4PSX A;  3I3G A;  4L89 A;  3SHP A;  2DXQ A;  2JDC A;  2C27 A;  1I12 A;  4MI4 A;  2OZU A;  5EBV A;  4U9Y A;  4KOX A;  5CNP A;  2FL4 A;  2QIR A;  3TO9 A;  4XPD C;  4GS4 A;  2B3U A;  1XF8 A;  1S7K A;  1YK3 A;  3FYN A;  1QST A;  2VBQ A;  4OAD A;  5DWM A;  4KOY A;  3PZJ A;  4PSW A;  1KUV A;  3S6F A;  1YX0 A;  2Q4V A;  3S6G A;  4JJX A;  3PP9 A;  1QSN A;  1TIQ A;  4R3K A;  3R9F A;  4QBJ A;  4HNY B;  2JEV A;  1M4G A;  1P0H A;  4KLV A;  1XIX A;  2R7H A;  3G8W A;  3R9G A;  3VWD A;  4X5K A;  3W6X A;  1M4D A;  4E8O A;  1YVO A;  3D8P A;  1Q2Y A;  2VZY A;  2VZZ A;  2F5I A;  1Q2C A;  2PQ8 A;  4OAE A;  3BJ8 A;  4E2A A;  4XPL A;  4YGO A;  2PDO A;  4LX9 A;  4KUB A;  2P6G A;  3H4Q A;  4Y49 B;  4MY3 A;  4HNW B;  2K5T A;  4II9 A;  5JPH A;  4I49 A; 
#chains in the Genus database with same CATH topology
 1SQH A;  3IWW A;  3FJU A;  2Z3O A;  3SI0 A;  4IAV A;  3IO1 A;  3D7D A;  3SXO A;  2YNC A;  2P6F A;  3SXN A;  3PGP A;  1ARM A;  1Z9U A;  1HEE A;  4YRH A;  4B14 A;  2Q04 A;  2FS5 A;  1BPM A;  3TOB A;  3SI2 A;  1Y0Y A;  2J8M A;  4K3N A;  4JZ0 A;  3GY9 A;  3UY5 A;  1KZF A;  4AVA A;  3MN8 A;  3KHX A;  2ZEG A;  2OH1 A;  4PXD A;  3FEE A;  3GB0 A;  1YW4 A;  3LD2 A;  4YFJ A;  1N71 A;  3T9Y A;  4B5O A;  1FNO A;  1S7L A;  3LMS A;  3V8I A;  1H8L A;  3RO0 A;  4A30 A;  2Z3P A;  3FBU A;  4CYO A;  4MCP A;  3FRM A;  4NEX A;  1TXR A;  4Y49 C;  5LRG A;  1BAV A;  2JDD A;  5AGE A;  1GYT A;  2BO9 A;  4C68 A;  2PJ7 A;  5EC4 A;  4CGM A;  4FD4 A;  1IOI A;  4B6Z A;  2B5G A;  5HH1 A;  4Q36 A;  5D29 A;  4UWI A;  1VIX A;  4MFK A;  5KTD A;  4CGP A;  4UFX A;  2XEG A;  5F49 A;  1ON0 A;  4R9M A;  5K8O A;  2I00 A;  1ARL A;  2FT0 A;  2ZPA A;  2GFQ A;  1MJA A;  4C2Y A;  3TO6 A;  4QB9 A;  2XEI A;  3FF3 A;  1YLO A;  4NXY A;  2C6G A;  5IB0 A;  4F9U A;  1Y9K A;  2BL1 A;  4TNU A;  1Y9W A;  4OLL A;  1PYT B;  4R57 A;  3T90 A;  3D4U A;  3I9S A;  1R3N A;  2ANP A;  3F8K A;  3GKR A;  4NJR A;  5EMI A;  5IV0 A;  2J8N A;  4O23 A;  2VQY A;  3KKW A;  5E96 A;  3WR7 A;  3CPA A;  4HKF A;  4AVB A;  3KAS A;  4AXV A;  1BOB A;  3ISX A;  1F2P A;  3CZX A;  3CXP A;  2P6E A;  2Z11 A;  3R1K A;  2AFS A;  3RBU A;  2ARH A;  1NE9 A;  1IYL A;  2VEZ A;  2B5G B;  4XNH C;  1M4I A;  1NSA A;  2CXA A;  1XFO A;  2PJ1 A;  4X3R A;  3FMC A;  3K9T A;  4P6Y A;  4KSF A;  3WT4 A;  4MHN A;  2GIV A;  2PJ4 A;  3TOA A;  4AG7 A;  3CXQ A;  1CM0 A;  1KWM A;  4P4E A;  4MFZ A;  2PIY A;  3B8G A;  4HPS A;  4AB7 A;  1QSR A;  2PE3 A;  1RO5 A;  2FCK A;  3ZZI A;  3PFO A;  3WC7 A;  4WJB A;  3PB7 X;  1CX8 A;  3TC8 A;  4JD6 A;  2DF5 A;  1Z4R A;  4MHD A;  1B6B A;  2PJ9 A;  2PJ8 A;  1F2O A;  1ZLI A;  1GHE A;  2QML A;  2F8H A;  2VXK A;  3G3S A;  2IQ6 A;  1UWY A;  2PCU A;  2PJ6 A;  3QAH A;  4MCQ A;  5F48 A;  4L8A A;  1TKH A;  4QC6 A;  4C2X A;  3PFE A;  1CJW A;  4OID A;  5IX3 A;  4EVY A;  3JTK A;  1CP7 A;  4ORF A;  2PC1 A;  1KUX A;  3FEC A;  2Z0Z A;  2XEF A;  2OZG A;  4NF1 A;  4ZY0 A;  2PRB A;  3KGQ A;  3NE7 A;  2PJ2 A;  3TTH A;  4B10 A;  2REF A;  4PXC A;  4IUS A;  1Z8L A;  2FIA A;  2P0W A;  3D2P A;  4A95 A;  4E0A A;  2PJ5 A;  2BUE A;  3S6K A;  4KUA A;  4AVC A;  1I21 A;  1ZO0 A;  3QNV A;  1YQE A;  2ZW4 A;  4GXH A;  1CBX A;  4A33 A;  2REE A;  2GE3 A;  4CAV A;  2PJ0 A;  1S7F A;  1IGB A;  2PVV A;  4Q7A A;  3T8W A;  2RC4 A;  2WUU A;  1PCA A;  3D7H A;  4JLY A;  4LQ6 A;  3I1U A;  3IJ3 A;  4A2Z A;  2QVP A;  2R8V A;  3N7Z A;  3PB9 X;  3D2M A;  3RYO A;  4H6Z A;  2ZXV A;  4HNX B;  3TX8 A;  4K30 A;  3NE8 A;  2HC9 A;  3KL9 A;  4DUK A;  4CAF A;  2RFH A;  1XJO A;  1L0C A;  1Y7R A;  3B2Y A;  1S60 A;  2OR4 A;  2AJ6 A;  4FAI A;  4NCZ A;  3SJG A;  2J8R A;  4KVO E;  3D3S A;  3S9N A;  1VHO A;  2O28 A;  3D67 A;  1VHE A;  1WK4 A;  2ZW5 A;  1LAN A;  2AE6 A;  4BMH A;  5IB9 A;  1RXT A;  5KTA A;  3H5Z A;  3R96 A;  2Q43 A;  4CGL A;  4MCR A;  1S3Z A;  1CPX A;  2BEI A;  2G9D A;  4FD5 A;  4P4B A;  4IF5 A;  2BCO A;  2C6C A;  4JXQ A;  2GAN A;  2BSW A;  5HMN A;  1PU9 A;  3KQX A;  2A4N A;  3PBB A;  4NGS A;  2Q4Y A;  2AFX A;  1MK4 A;  3DR6 A;  1XRY A;  4H2K A;  2WPX A;  2ATR A;  5JH9 A;  2JLM A;  1XEB A;  1AYE A;  4KS9 A;  5HVF A;  3GYA A;  2OZH A;  4MCS A;  4P4J A;  4ZI6 A;  2GLF A;  2ZEE A;  4CYN A;  2ABZ A;  4KVX A;  4B12 A;  5BWA B;  3BJ7 A;  4FBE A;  1J4J A;  4OC4 A;  3B3V A;  2AFZ A;  3S9L A;  1IB1 E;  4U5Y A;  4BBH A;  5CBM A;  1RTQ A;  4RS2 A;  4CYP A;  2O53 A;  1FT7 A;  1XMT A;  4MXU A;  4PK3 A;  3JVN A;  4MHP A;  3IFE A;  3R95 A;  1VHS A;  2R98 A;  3TCV A;  2KCW A;  3FB3 A;  1CG2 A;  3CDX A;  4GM5 A;  3H8F A;  2G3T A;  2CTC A;  4C7I A;  1OZP A;  1U6M A;  2VL1 A;  2YNE A;  1VKC A;  5C82 A;  2QJ8 A;  5LYI A;  3IU2 A;  2Z3M A;  3V38 A;  2PJ3 A;  4F9V A;  5GCN A;  2V8G A;  2HUZ A;  2Q7B A;  4C7H A;  4CAW A;  4YWY A;  5LYD A;  1TKJ A;  1Q2D A;  3CXS A;  5AG7 A;  2IJZ A;  2YND A;  3NH4 A;  1V0C A;  4KOW A;  4P4F A;  3HLP A;  1ZG9 A;  4YU9 A;  2CNT A;  1ELL P;  2BOA A;  5AG6 A;  4OC5 A;  3NH8 A;  4NGP A;  2Q51 A;  5DS0 A;  4KOS A;  4MHZ A;  2PJB A;  4P45 A;  4XPK A;  1YR0 A;  3PB8 X;  4UEE A;  4MFP A;  3SI1 A;  5LRK A;  2OU2 A;  2CY2 A;  2PIZ A;  2B4D A;  2V8H A;  2YNC C;  4UCM A;  3IEH A;  1LRZ A;  1YVK A;  4ONU A;  2D4O A;  3IWE A;  4IK2 A;  3B35 A;  2QYV A;  4A39 A;  2B58 A;  1IID A;  2FE7 A;  3EC4 A;  4EWT A;  3EY5 A;  2D4P A;  2NYQ A;  2HQY A;  4TWE A;  4NGT A;  4R7M A;  2AFU A;  2JBK A;  5G20 A;  3EXN A;  2FXF A;  4NFR A;  2PR8 A;  3IWG A;  2G0B A;  3SJE A;  1S5K A;  3R9E A;  3W91 A;  4QUS A;  2FIW A;  2FVG A;  4NSQ A;  4F6A A;  2I3C A;  2AFW A;  3VH9 A;  2GU2 A;  4FWU A;  2ZOG A;  4IHM A;  5J1Q A;  5G1Z A;  1NSL A;  3B3T A;  3ISZ A;  4UEF A;  5H84 A;  2WSA A;  3DDD A;  2ZW6 A;  4B11 A;  2O4H A;  1EE3 P;  4UCN A;  2V77 A;  3FX6 A;  2IL4 A;  5D8N A;  2DPS A;  4H89 A;  1JQG A;  1FY7 A;  4FD7 A;  1YGH A;  4MRI A;  7CPA A;  3EO4 A;  3TE4 A;  4KOU A;  1A2Z A;  1WWZ A;  2PR1 A;  2ODF A;  4KOT A;  4X8I A;  5G21 A;  4B5P A;  5K8P A;  1NMT A;  2B4B A;  3B7I A;  2ZW7 A;  3BLN A;  3NH5 A;  1XE4 A;  3WAB A;  4BD9 A;  3KI9 A;  1ZG8 A;  4M85 A;  4CAE A;  2B4D B;  2B3V A;  3TFY A;  1YME A;  2CNM A;  3A9L A;  5CPA A;  4RI1 A;  2Z3L A;  2ZED A;  2V8D A;  5K8N A;  2H5M A;  1MJB A;  2J9A A;  3LAC A;  4PK2 A;  4UBR A;  1IYK A;  3DSB A;  3VAT A;  1K4J A;  3RNZ A;  2EO8 A;  5F09 A;  5HVG A;  3GLJ A;  4CAX A;  1ZLH A;  5AG5 A;  1XMB A;  1YRE A;  2F7V A;  5HXD A;  4NGQ A;  1LAM A;  2QEC A;  3W6S A;  3KR4 A;  4A32 A;  1XOV A;  4KZT A;  1MJ9 A;  4A94 A;  4RUH A;  3DR8 A;  3K9U A;  4AG9 A;  3CT9 A;  1TF8 A;  2ZEF A;  4PQA A;  5LYF A;  1QSM A;  2CIJ A;  4A37 A;  4UCP A;  2EK8 A;  1BPN A;  1Z8X A;  2Z3K A;  3KZW A;  3QB8 A;  4C2Z A;  4DNC A;  1M1D A;  1F57 A;  2R1I A;  2V8V A;  1B87 A;  5K8M A;  4JXR A;  4R6T A;  1M44 A;  1S7N A;  2EBJ A;  4F0Y A;  1TKF A;  1Y0R A;  4R8F A;  5JM6 A;  5F47 A;  4B5P B;  5ISV A;  2NSM A;  1LOK A;  2Y0M A;  4A38 A;  1KUY A;  4MJ8 A;  2PRQ A;  2ZEM A;  2OOT A;  4UWJ A;  4R3L A;  4UA3 A;  2JEW A;  2ZEN A;  4H6U A;  3E0K A;  3EFA A;  4CS0 B;  2NMT A;  4PV6 A;  1DE4 C;  1IIC A;  2DEA A;  2IMO A;  3PB4 X;  5LRJ A;  4ONW A;  2I79 A;  3GUX A;  1HDQ A;  3JUW A;  3P2F A;  4LQG A;  4KOV A;  4UFV A;  3BI1 A;  3PB6 X;  2ZEL A;  4J3G A;  5DWN A;  4P44 A;  2Q44 A;  4CRY B;  5KTC A;  4PPZ A;  4OP4 A;  1Z4E A;  4MMO A;  4CRZ B;  5F46 A;  2FSR A;  8CPA A;  2X7B A;  3B3S A;  4PXB A;  4KVM E;  3FIX A;  2C6P A;  3FVL A;  1QSO A;  2G3A A;  2PSW A;  4JWP A;  4M6H A;  2VI7 A;  3D7G A;  3SJF A;  3H8E A;  4KSA A;  6CPA A;  5J8C A;  4NJQ A;  4CYQ A;  1CP6 A;  3NFZ A;  3PRT A;  4MBU A;  3QAY A;  2AFO A;  4FD6 A;  2WZN A;  3VWE A;  1P4N A;  3S6H A;  4BIN A;  4DJL A;  4OC1 A;  4NGR A;  1PUA A;  3C26 A;  2CNS A;  2Z10 A;  4MY0 A;  3BXM A;  1R57 A;  3VAR A;  4CPA A;  2PJA A;  3IIB A;  5J8F A;  4KOR A;  1XBU A;  3F5B A;  5A28 A;  5I0C A;  2HV2 A;  5C88 A;  5JPH A;  4Q38 A;  2Q4Z A;  3FNC A;  3JRU A;  3IGR A;  1M4L A;  4UEZ A;  3RZA A;  1BLL E;  4OC3 A;  2Q7S A;  3P2H A;  3OWC A;  1OBR A;  3MGD A;  4LUA A;  3TO7 A;  3MRU A;  3N5F A;  3BHX A;  1Z8W A;  2JBJ A;  5H86 A;  4ZBG A;  3ZJ0 A;  3KR5 A;  2ZEH A;  3WC6 A;  3DNS A;  2EUI A;  3FXT A;  4P4D A;  1IY7 A;  2XEJ A;  5JQ4 A;  2EVN A;  3DLJ A;  4OME A;  4XNH B;  1YLE A;  3TT2 A;  1BO4 A;  3F0A A;  3GIU A;  4XPD B;  2Q0Y A;  1TF9 A;  2GLJ A;  5FVJ A;  2HB6 A;  4QVT A;  4M3S A;  4UIA A;  4R87 A;  1UFH A;  4EME A;  5ELY A;  5THW A;  4Z65 A;  5A27 A;  3H8G A;  1LAP A;  1I1D A;  3LOD A;  4U9Z A;  1R43 A;  2WPW A;  3WC5 A;  4KLW A;  2RB7 A;  4W9Y A;  2Z3N A;  5AG4 A;  1Z8T A;  2OB0 A;  4MFQ A;  2DPT A;  5I4M A;  3NA6 A;  3DGV A;  4PSX A;  4OC2 A;  3I3G A;  4L89 A;  3SHP A;  4MFJ A;  2DXQ A;  4F0X A;  1YSJ A;  2JDC A;  2C27 A;  1I12 A;  1Z2L A;  4MI4 A;  1HDU A;  2OZU A;  2CF4 A;  5EBV A;  4M6I A;  2ZEP A;  4U9Y A;  2PVW A;  4KOX A;  5CNP A;  2PJC A;  2FL4 A;  2QIR A;  1Z5R A;  3L2N A;  1CPS A;  3TO9 A;  3V7Z A;  1Q7L A;  2EK9 A;  3CPX A;  3IU1 A;  4JYW A;  3FH4 A;  4GS4 A;  4RN7 A;  4X2T A;  4XPD C;  4G1P A;  2B3U A;  1XF8 A;  2ZEO A;  4ZGY B;  1S7K A;  1YK3 A;  2GRE A;  2YGW A;  1QST A;  3FYN A;  2VBQ A;  4OAD A;  4P4I A;  4UF4 A;  5DWM A;  4FUU A;  4R76 A;  4WWV A;  3S9M A;  4CGN A;  3B3W A;  1DTD A;  1QQ9 A;  4NGN A;  4ZX9 A;  4B13 A;  4KOY A;  3D7F A;  3HUV A;  3PZJ A;  1ZG7 A;  1KUV A;  4PSW A;  1YW6 A;  4UFW A;  3S6F A;  1YX0 A;  1JWQ A;  2Q4V A;  3KHZ A;  5G22 A;  4PXE A;  4M6G A;  4P10 A;  4ZY2 A;  1ELM P;  3S6G A;  3IC1 A;  4JJX A;  1QSN A;  3PP9 A;  1TIQ A;  3K2K A;  4OKO A;  4R3K A;  4KSI A;  1AMP A;  3R9F A;  3B3C A;  2EWB A;  5HVH A;  2C1C A;  1VGY A;  1LFW A;  2WYR A;  4HNY B;  4QBJ A;  2JEV A;  4ZYQ A;  1M4G A;  1Y7E A;  4NGM A;  1P0H A;  3PBE A;  4KLV A;  1X12 A;  2AFM A;  1AUG A;  3LWU A;  1XIX A;  2CTB A;  4A31 A;  2R7H A;  3G8W A;  3R9G A;  4OC0 A;  1IU8 A;  2POK A;  4UIB A;  3VWD A;  1LCP A;  4X5K A;  1IOF A;  1M4D A;  3W6X A;  4E8O A;  1YVO A;  4ZY1 A;  4DYO A;  3D8P A;  1Q2Y A;  1QMU A;  2VZY A;  3BI0 A;  3KQZ A;  2VZZ A;  4MFL A;  4CGO A;  2F5I A;  4EFD A;  1Q2C A;  2PQ8 A;  4OAE A;  4OIW A;  3BJ8 A;  5JGF A;  4E2A A;  3FED A;  3D68 A;  4XPL A;  2ZOF A;  4YGO A;  3RAM A;  2PDO A;  4MHY A;  3D66 A;  4LX9 A;  4ZX8 A;  3SJX A;  5LYL A;  4KUB A;  2P6G A;  4F8Z A;  3H4Q A;  4Y49 B;  4MY3 A;  4HNW B;  2K5T A;  4II9 A;  3PEI A;  4I49 A;  1X10 A; 
#chains in the Genus database with same CATH homology
 1SQH A;  2Z3O A;  3SXO A;  2YNC A;  2P6F A;  3SXN A;  3PGP A;  1Z9U A;  4YRH A;  4B14 A;  2Q04 A;  2FS5 A;  3TOB A;  2J8M A;  3GY9 A;  3UY5 A;  1KZF A;  4AVA A;  2OH1 A;  3LD2 A;  4YFJ A;  1N71 A;  3T9Y A;  4B5O A;  1S7L A;  3V8I A;  4A30 A;  2Z3P A;  3FBU A;  4CYO A;  3FRM A;  4NEX A;  4Y49 C;  2JDD A;  5AGE A;  4C68 A;  5EC4 A;  4CGM A;  4FD4 A;  2B5G A;  5HH1 A;  4Q36 A;  4UWI A;  4MFK A;  5KTD A;  4CGP A;  4UFX A;  5F49 A;  1ON0 A;  4R9M A;  2I00 A;  2FT0 A;  2ZPA A;  4C2Y A;  1MJA A;  3TO6 A;  4QB9 A;  4NXY A;  5IB0 A;  1Y9K A;  2BL1 A;  1Y9W A;  4OLL A;  4R57 A;  3T90 A;  3I9S A;  3F8K A;  3GKR A;  5IV0 A;  2J8N A;  5E96 A;  2VQY A;  3KKW A;  3WR7 A;  4AVB A;  4HKF A;  1BOB A;  3CXP A;  2P6E A;  2Z11 A;  3R1K A;  2ARH A;  1NE9 A;  1IYL A;  2VEZ A;  2B5G B;  4XNH C;  1M4I A;  2CXA A;  4KSF A;  2GIV A;  3TOA A;  4AG7 A;  3CXQ A;  1CM0 A;  4MFZ A;  3B8G A;  4AB7 A;  1QSR A;  1RO5 A;  2FCK A;  3ZZI A;  4JD6 A;  1Z4R A;  4MHD A;  1B6B A;  2QML A;  2VXK A;  3G3S A;  4NCZ A;  1GHE A;  5F48 A;  3QAH A;  4L8A A;  4QC6 A;  4C2X A;  1CJW A;  5IX3 A;  4EVY A;  3JTK A;  4ORF A;  2PC1 A;  1KUX A;  2Z0Z A;  2OZG A;  4NF1 A;  2PRB A;  3TTH A;  3NE7 A;  4B10 A;  2REF A;  4IUS A;  4A95 A;  2FIA A;  2P0W A;  3D2P A;  4E0A A;  2BUE A;  3S6K A;  4KUA A;  4AVC A;  1I21 A;  1ZO0 A;  2ZW4 A;  4A33 A;  2REE A;  2GE3 A;  4CAV A;  1S7F A;  2RC4 A;  2WUU A;  4JLY A;  4A2Z A;  2R8V A;  3N7Z A;  3D2M A;  3RYO A;  4H6Z A;  2ZXV A;  4HNX B;  4K30 A;  4CAF A;  1L0C A;  1Y7R A;  1S60 A;  2AJ6 A;  2J8R A;  4KVO E;  3D3S A;  2O28 A;  1WK4 A;  2ZW5 A;  4BMH A;  2AE6 A;  1RXT A;  5KTA A;  3H5Z A;  3R96 A;  4CGL A;  1S3Z A;  4FD5 A;  2BEI A;  4IF5 A;  4JXQ A;  2GAN A;  2BSW A;  5HMN A;  1PU9 A;  2A4N A;  2Q4Y A;  1MK4 A;  3DR6 A;  2WPX A;  2ATR A;  2JLM A;  1XEB A;  4KS9 A;  3GYA A;  2OZH A;  4CYN A;  4KVX A;  4B12 A;  5BWA B;  3BJ7 A;  1J4J A;  1IB1 E;  4U5Y A;  4BBH A;  4CYP A;  4RS2 A;  1XMT A;  4PK3 A;  3JVN A;  3R95 A;  1VHS A;  2R98 A;  3TCV A;  2KCW A;  3FB3 A;  2G3T A;  4C7I A;  1OZP A;  1U6M A;  2YNE A;  5C82 A;  1VKC A;  3IU2 A;  2Z3M A;  5GCN A;  4C7H A;  2HUZ A;  2Q7B A;  4CAW A;  1Q2D A;  3CXS A;  5AG7 A;  2YND A;  4KOW A;  1V0C A;  2CNT A;  5AG6 A;  4KOS A;  4XPK A;  1YR0 A;  4MFP A;  2OU2 A;  2CY2 A;  2YNC C;  2B4D A;  4UCM A;  1LRZ A;  1YVK A;  4ONU A;  2D4O A;  3IWE A;  2B58 A;  1IID A;  2FE7 A;  3EC4 A;  3EY5 A;  2D4P A;  2HQY A;  5G20 A;  3EXN A;  2FXF A;  2PR8 A;  3IWG A;  2G0B A;  1S5K A;  3R9E A;  3W91 A;  4QUS A;  2FIW A;  4NSQ A;  4F6A A;  5G1Z A;  1NSL A;  5H84 A;  2WSA A;  3DDD A;  2ZW6 A;  4B11 A;  4UCN A;  2IL4 A;  2DPS A;  4H89 A;  1FY7 A;  4FD7 A;  1YGH A;  3TE4 A;  3EO4 A;  4KOU A;  4KOT A;  1WWZ A;  2PR1 A;  5G21 A;  4B5P A;  1NMT A;  2B4B A;  2ZW7 A;  3BLN A;  1XE4 A;  3TFY A;  4M85 A;  4CAE A;  2B4D B;  2B3V A;  2CNM A;  3A9L A;  4RI1 A;  2Z3L A;  2H5M A;  1MJB A;  4PK2 A;  4UBR A;  1IYK A;  3DSB A;  1K4J A;  4CAX A;  5AG5 A;  1YRE A;  2QEC A;  4A32 A;  3W6S A;  4KZT A;  1MJ9 A;  3DR8 A;  3K9U A;  4AG9 A;  1QSM A;  4UCP A;  2Z3K A;  4C2Z A;  3QB8 A;  4DNC A;  1M1D A;  2R1I A;  1B87 A;  4JXR A;  1M44 A;  1S7N A;  4F0Y A;  5F47 A;  4B5P B;  5ISV A;  2Y0M A;  1KUY A;  4MJ8 A;  4UWJ A;  4R3L A;  4UA3 A;  4H6U A;  3E0K A;  3EFA A;  4CS0 B;  2NMT A;  4PV6 A;  1IIC A;  2I79 A;  3P2F A;  3JUW A;  4KOV A;  4UFV A;  4J3G A;  5DWN A;  4CRY B;  2Q44 A;  5KTC A;  1Z4E A;  4CRZ B;  5F46 A;  2FSR A;  2X7B A;  4KVM E;  3FIX A;  1QSO A;  2G3A A;  2PSW A;  4JWP A;  2VI7 A;  5J8C A;  4KSA A;  4CYQ A;  4MBU A;  4FD6 A;  3VWE A;  1P4N A;  3S6H A;  3C26 A;  1PUA A;  2CNS A;  2Z10 A;  4MY0 A;  1R57 A;  5J8F A;  4KOR A;  3F5B A;  5A28 A;  5I0C A;  2HV2 A;  5C88 A;  4Q38 A;  3FNC A;  3IGR A;  3P2H A;  3OWC A;  3MGD A;  4LUA A;  3TO7 A;  5H86 A;  4ZBG A;  3ZJ0 A;  3DNS A;  2EUI A;  3FXT A;  5JQ4 A;  2EVN A;  4XNH B;  1YLE A;  3TT2 A;  1BO4 A;  3F0A A;  4XPD B;  2Q0Y A;  5FVJ A;  4QVT A;  4M3S A;  4R87 A;  1UFH A;  5A27 A;  1I1D A;  3LOD A;  4U9Z A;  2WPW A;  4KLW A;  2Z3N A;  5AG4 A;  2OB0 A;  4MFQ A;  2DPT A;  4PSX A;  3I3G A;  4L89 A;  3SHP A;  4MFJ A;  2DXQ A;  4F0X A;  2JDC A;  2C27 A;  1I12 A;  4MI4 A;  2OZU A;  5EBV A;  4U9Y A;  4KOX A;  5CNP A;  2FL4 A;  2QIR A;  3TO9 A;  3IU1 A;  4XPD C;  4GS4 A;  2B3U A;  1XF8 A;  4ZGY B;  1S7K A;  1YK3 A;  2YGW A;  3FYN A;  1QST A;  2VBQ A;  4OAD A;  5DWM A;  4CGN A;  4B13 A;  4KOY A;  3PZJ A;  4PSW A;  1KUV A;  3S6F A;  4UFW A;  1YX0 A;  2Q4V A;  5G22 A;  3S6G A;  4JJX A;  3PP9 A;  1QSN A;  1TIQ A;  4R3K A;  3R9F A;  4QBJ A;  4HNY B;  2JEV A;  1M4G A;  1P0H A;  4KLV A;  1XIX A;  4A31 A;  2R7H A;  3G8W A;  3R9G A;  3VWD A;  4X5K A;  3W6X A;  1M4D A;  4E8O A;  1YVO A;  3D8P A;  1Q2Y A;  2VZY A;  4MFL A;  2VZZ A;  4CGO A;  2F5I A;  1Q2C A;  2PQ8 A;  4OAE A;  3BJ8 A;  4E2A A;  4XPL A;  4YGO A;  2PDO A;  4LX9 A;  4KUB A;  2P6G A;  3H4Q A;  4Y49 B;  4MY3 A;  4HNW B;  2K5T A;  4II9 A;  5JPH A;  4I49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...