1SQHA

X-ray structure of drosophila malonogaster protein q9vr51 northeast structural genomics consortium target fr87.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
297
Chain Sequence
GDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLLAAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQKDLVNEWIKLVPNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein CG14615-PA
publication title X-RAY STRUCTURE OF DROSOPHILA MALONOGASTER PROTEIN Q9VR51 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET FR87
rcsb
source organism Drosophila melanogaster
total genus 89
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08445 FR47 FR47-like protein
A PF18713 DUF5645 Domain of unknown function (DUF5645)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1sqhA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1sqhA02
5E96A 3FIXA 1BO4A 2G3AA 4YGOA 2D4OA 5EC4A 4U5YA 1MJAA 4FD4A 5F48A 1NMTA 2WPWA 5JPHA 3S6FA 5F49A 2QIRA 3PP9A 1YGHA 1WK4A 2VZZA 2J8RA 1J4JA 5I0CA 4X5KA 2B3VA 4JLYA 4PV6A 4L89A 1IIDA 1FY7A 2OZHA 3BJ7A 3JVNA 3NE7A 1WWZA 4OAEA 2VZYA 1YLEA 1I12A 3FNCA 2REEA 4LUAA 2FIWA 3EC4A 3F5BA 4UA3A 4M3SA 2Q4YA 4KUBA 3ZJ0A 2ZPAA 5JQ4A 4PK3A 5KTAA 1Q2CA 2ZW4A 3EFAA 3N7ZA 2FSRA 2VBQA 4FD5A 1IB1E 2EVNA 2FXFA 4XPDB 4GS4A 2NMTA 3R95A 3FXTA 4KOSA 4L8AA 1XF8A 2PSWA 3UY5A 1XMTA 1L0CA 2R8VA 1OZPA 2G0BA 2OZUA 2J8MA 2CNSA 4KZTA 4BMHA 4AVCA 3I3GA 1YVOA 4CRZB 4YRHA 1TIQA 2ZW6A 4QUSA 3TCVA 1N71A 2B3UA 2P0WA 4J3GA 1S60A 1QSRA 1MK4A 2BSWA 1ON0A 1M4GA 2FIAA 2C27A 2OH1A 2P6GA 2PDOA 3C26A 4K30A 4E8OA 2H5MA 2PQ8A 4KOYA 2VI7A 2B58A 3GY9A 4MHDA 3LD2A 3R9FA 4CAXA 3G3SA 1IICA 1Z9UA 2PR8A 4H89A 4B5OA 3VWDA 3KKWA 2PR1A 2JLMA 2Q04A 2BUEA 1RO5A 4NSQA 2AE6A 4XPDC 5EBVA 2JEVA 2DXQA 1KZFA 4ORFA 2X7BA 3EO4A 4AVAA 4PSWA 4KOUA 5HMNA 3F8KA 3IWGA 1XEBA 4ZBGA 4YFJA 4KVOE 2Z0ZA 2WPXA 5FVJA 2VXKA 3QAHA 4NEXA 4M85A 5DWMA 3TO9A 2RC4A 3BJ8A 4AVBA 1QSMA 5CNPA 2GIVA 4KVXA 3CXSA 4JWPA 3OWCA 3FB3A 2Q44A 2ZXVA 5IV0A 4R3KA 2Z10A 2A4NA 4XNHC 1XIXA 2BEIA 4AB7A 2Q0YA 4R9MA 4HKFA 1YVKA 4EVYA 1S5KA 3P2FA 4JXRA 3WR7A 2Y0MA 4UWJA 3PGPA 1YX0A 4JD6A 3SXOA 3W6XA 2D4PA 2JDCA 5F47A 4H6UA 5ISVA 4JXQA 1Q2YA 4R87A 4JJXA 3K9UA 2R1IA 2O28A 1SQHA 2G3TA 3GYAA 4AG9A 4AG7A 4KOTA 3JUWA 4KOXA 3V8IA 3GKRA 1IYKA 2QECA 4HNWB 1M44A 5C88A 1S7NA 1PU9A 2PC1A 3TOAA 5DWNA 2F5IA 3FYNA 3PZJA 2FCKA 3QB8A 4KOVA 2P6EA 1QSOA 4KORA 4XNHB 1VKCA 4KVME 2R7HA 1U6MA 1YR0A 1CM0A 2OZGA 3I9SA 3TO7A 1VHSA 2PRBA 3SHPA 4LX9A 4H6ZA 3TOBA 4MI4A 4E0AA 3CXQA 4NXYA 1I1DA 4IUSA 2FS5A 1K4JA 1NSLA 4CAWA 5KTDA 1QSTA 3G8WA 1QSNA 5J8CA 4UWIA 1PUAA 1GHEA 3LODA 1YK3A 4XPKA 1Y7RA 4QBJA 2JDDA 4OLLA 4UBRA 4RS2A 3DSBA 3RYOA 2K5TA 1P0HA 4CRYB 1M4DA 4HNXB 2EUIA 1I21A 2HV2A 1UFHA 1IYLA 1RXTA 1MJ9A 1CJWA 3BLNA 4IF5A 5GCNA 3R1KA 3D2PA 4E2AA 1B87A 3D3SA 4KOWA 2QMLA 2REFA 4R3LA 3SXNA 1YREA 3T9YA 3S6HA 4CAVA 4XPLA 3R9GA 3TFYA 5IX3A 3TT2A 1S3ZA 1R57A 2ATRA 4Y49C 2B4DA 4OADA 1Y9KA 3EY5A 4QVTA 3TE4A 2ARHA 2CY2A 1B6BA 2R98A 2ZW7A 3VWEA 2GANA 4U9YA 3W6SA 5H86A 4FD6A 4F6AA 3W91A 2HUZA 4KLWA 3FRMA 3T90A 4PK2A 4II9A 3S6GA 2HQYA 1V0CA 3DR8A 3TO6A 4QB9A 3S6KA 4B5PA 2B4BA 4PSXA 1LRZA 4ONUA 5H84A 2BL1A 4MY0A 3EXNA 4R57A 2CNMA 4RI1A 2IL4A 1M4IA 1BOBA 3MGDA 4F0YA 1KUYA 1M1DA 3D8PA 3FBUA 2FL4A 2OB0A 1S7KA 3P2HA 4MJ8A 2VEZA 2B4DB 3IGRA 2B5GA 4HNYB 2FT0A 5C82A 4QC6A 1Z4EA 1Y9WA 5KTCA 1NE9A 2Z11A 2KCWA 4NCZA 3R96A 4Y49B 2CNTA 2GE3A 2J8NA 4DNCA 3E0KA 2I79A 5IB0A 1MJBA 3H4QA 3TTHA 3F0AA 4CS0B 3CXPA 3DDDA 4MY3A 5F46A 4I49A 3DR6A 4B5PB 1S7LA 2Q7BA 2VQYA 1KUXA 3R9EA 1KUVA 1P4NA 2OU2A 1Z4RA 2I00A 4MBUA 4KLVA 4FD7A 1XE4A 2P6FA 5J8FA 1Q2DA 4KUAA 2Q4VA 2AJ6A 3DNSA 2B5GB 3B8GA 3D2MA 1S7FA 4U9ZA 3ZZIA 2ZW5A 2FE7A 4NF1A 5HH1A
chains in the Genus database with same CATH superfamily
3KASA 5E96A 1IU8A 3FIXA 4WJBA 1BO4A 2G3AA 4BD9A 2EK8A 4NGTA 4YGOA 3QAYA 2D4OA 4MHZA 3DGVA 1TKJA 5EC4A 4MHNA 4U5YA 1MJAA 2Z3LA 4FD4A 5F48A 1NMTA 2WPWA 1AYEA 5JPHA 1IGBA 3S6FA 2ZEHA 2IMOA 5F49A 1NSAA 2QIRA 3PP9A 4FAIA 1YGHA 4B6ZA 3PB9X 3IEHA 3NH8A 4PPZA 2RFHA 1CP6A 4NGMA 1WK4A 2VZZA 2J8RA 4MFQA 1J4JA 3CT9A 4ZY0A 1PCAA 1YW6A 2V8HA 5G21A 4X5KA 5AG5A 2GFQA 2B3VA 5LRJA 2PJ7A 1R3NA 4A37A 3BI1A 4JLYA 4P4JA 4PV6A 4L89A 3WC7A 1IIDA 1FY7A 5A28A 1ZG8A 2OZHA 3BJ7A 4AXVA 3JVNA 3NE7A 4UFVA 1WWZA 2BOAA 2YNEA 4IAVA 2ZENA 4OAEA 1X12A 2VZYA 4P4BA 4R7MA 1YLEA 1AUGA 1I12A 4C7HA 3FNCA 2REEA 4CYPA 4LUAA 2FIWA 3EC4A 3F5BA 4UA3A 2YNCA 4M3SA 1TKFA 3D66A 4FBEA 5I0CA 3S9NA 3LACA 2Q4YA 2ZEGA 4KUBA 2ZPAA 2Z3NA 3ZJ0A 5JQ4A 3TC8A 4YWYA 4OC5A 4PK3A 4CYNA 5KTAA 1Q2CA 2ZW4A 2DPSA 3EFAA 3N7ZA 1PYTB 2FSRA 2VBQA 4FD5A 1IB1E 2EVNA 2FXFA 3L2NA 4Q7AA 2ZEPA 4XPDB 4GS4A 2NMTA 4MFZA 3R95A 5HVGA 3PFOA 3BHXA 3FXTA 2DEAA 1GYTA 4KOSA 5LYLA 4L8AA 4M6GA 2CF4A 1XF8A 4FUUA 1XJOA 3SJEA 2PSWA 4Q36A 3UY5A 5DS0A 4BBHA 5K8MA 1XMTA 1LANA 1L0CA 3PRTA 2R8VA 1ARLA 2EO8A 3GB0A 3KI9A 4BINA 3WT4A 1OZPA 2Q7SA 2G0BA 4KSAA 2OZUA 2Z3MA 2J8MA 4P6YA 2CNSA 2CTCA 4PXEA 4KZTA 4OC0A 4BMHA 1Z8WA 3S9MA 4ZY2A 4EWTA 4AVCA 3A9LA 4OC1A 3B35A 4CGLA 4MCPA 4P45A 3I3GA 1YVOA 1BAVA 5AGEA 3VARA 2C1CA 4UEZA 4CRZB 4YRHA 4OIDA 1TIQA 2AFOA 3D4UA 4WWVA 2ZW6A 4GM5A 4QUSA 4R76A 3RAMA 3TCVA 5J1QA 1N71A 2Q43A 3IIBA 1RTQA 2B3UA 1A2ZA 2P0WA 5HVFA 4J3GA 4MCRA 1S60A 2PJAA 4O23A 2AFMA 1QSRA 4LQ6A 1MK4A 2BSWA 3IC1A 3K2KA 2WYRA 1ON0A 1M4GA 2FIAA 2C27A 2EBJA 2XEGA 4OIWA 2OH1A 2P6GA 2PDOA 3C26A 4G1PA 4RN7A 4K30A 4E8OA 4NJQA 2H5MA 2PQ8A 3FF3A 4KOYA 3SJFA 3V7ZA 2VI7A 3CPXA 3H8FA 2PJ2A 4PXBA 2B58A 2ZELA 5LRKA 2V77A 4PXDA 8CPAA 3B3WA 1HEEA 3GY9A 4MHDA 3LD2A 3R9FA 3VH9A 3G3SA 1VHEA 3FECA 4CAXA 3H8GA 1IICA 4KSFA 4UEFA 1XFOA 1Z9UA 2PR8A 1Z8XA 3PB4X 4H89A 2ZOGA 4OC3A 2OOTA 3IJ3A 4B5OA 2Z3KA 4P4DA 3VWDA 3KKWA 5THWA 3KHZA 4C2ZA 1FT7A 4MHYA 2QJ8A 2PR1A 2JLMA 4PQAA 3WC5A 2Q04A 2BUEA 1RO5A 4NSQA 2AE6A 4XPDC 5EBVA 1KWMA 4DYOA 5A27A 2JEVA 3FEDA 2DXQA 5D8NA 1KZFA 3GUXA 2PJ6A 4ORFA 2XEIA 2X7BA 3EO4A 4AVAA 4PSWA 4KOUA 5HMNA 3B3VA 2EWBA 3F8KA 2HB6A 3SI1A 4UCMA 3IWGA 1XEBA 4ZBGA 4ONWA 1HDUA 4OKOA 3KL9A 4UEEA 4YFJA 1CX8A 2ABZA 4KVOE 2Z0ZA 2WPXA 5FVJA 3SJXA 2VXKA 3QAHA 4NEXA 4M85A 5DWMA 3TO9A 3GIUA 4MFJA 2RC4A 2V8DA 1YLOA 3BJ8A 4AVBA 4B10A 1QSMA 3IWEA 5CNPA 3RZAA 2GIVA 2PJ8A 4FWUA 4KVXA 3CXSA 4JWPA 3OWCA 3B3SA 3FB3A 2Q44A 4NGPA 2ZXVA 2YNCC 1Y0YA 4P4FA 3LWUA 4MXUA 4Q38A 2PCUA 5IV0A 4R3KA 2PJ5A 2Z10A 1ARMA 2A4NA 4ZY1A 4XNHC 1XIXA 2BEIA 4AB7A 1ZG7A 2I3CA 3KR4A 2Q0YA 4R9MA 4HKFA 1YVKA 4EVYA 2CIJA 1S5KA 3P2FA 3RBUA 4JXRA 4Z65A 4PXCA 4NFRA 3WR7A 5CBMA 3D7HA 2Y0MA 1Q7LA 4P10A 4UWJA 3PGPA 1YX0A 4JD6A 3SXOA 3W6XA 3JRUA 2D4PA 2Q51A 2JDCA 2PJ4A 6CPAA 1LAPA 5F47A 4H6UA 4MMOA 5IB9A 2VL1A 4NGSA 3GLJA 5ISVA 1DE4C 2PRQA 4JXQA 1Q2YA 4R87A 4JJXA 3K9UA 2R1IA 4MFPA 2IJZA 2O28A 1XMBA 1SQHA 2G3TA 2GLFA 2GREA 1F57A 2IQ6A 3GYAA 4AG9A 4AG7A 4F0XA 1F2PA 4KOTA 2ZEMA 2ZOFA 3JUWA 4KOXA 4NGNA 1H8LA 2NSMA 4ZYQA 3HUVA 3V8IA 2PJ1A 3GKRA 5JGFA 3RO0A 3PB8X 1BLLE 2C6PA 2J9AA 1QQ9A 1IYKA 3ISZA 2QECA 2PIYA 3TX8A 4HNWB 1M44A 2O53A 4C68A 5C88A 1YMEA 2PJBA 4IHMA 1S7NA 1PU9A 4GXHA 3D67A 2PC1A 3FH4A 2PJCA 3TOAA 5DWNA 1IY7A 2F5IA 1Z2LA 5LYIA 3RNZA 3FYNA 2CTBA 3PZJA 2YGWA 2FCKA 3QB8A 4W9YA 2AFWA 2P6EA 1QSOA 2JBJA 4KOVA 2Z3OA 4KORA 4XNHB 1VKCA 2CXAA 3CDXA 4KVME 3MN8A 2BCOA 2R7HA 4R8FA 1U6MA 1YR0A 4CPAA 4DJLA 1TF9A 1CM0A 2OZGA 3I9SA 5BWAB 1VGYA 3WC6A 4UFWA 4EMEA 3TO7A 1VHSA 4M6IA 2PRBA 3SHPA 2WZNA 1Z8LA 3MRUA 4B12A 3N5FA 3NH4A 4LX9A 4H6ZA 2O4HA 1Y7EA 1VIXA 3TOBA 3IU2A 4HPSA 4MI4A 1X10A 4E0AA 3B2YA 3CXQA 3FEEA 1Z5RA 4NXYA 4C7IA 3V38A 3B7IA 1I1DA 4IUSA 1TF8A 4P44A 2FS5A 1FNOA 4A95A 5D29A 4NJRA 4NGQA 1K4JA 1NSLA 4UF4A 4CAWA 3QNVA 4A39A 1QSTA 1JWQA 3G8WA 1QSNA 5KTDA 5J8CA 4UWIA 1PUAA 4MCSA 1GHEA 3LODA 1YK3A 2GLJA 1HDQA 1Y0RA 4CGMA 4MCQA 4XPKA 1Y7RA 4CAFA 4QBJA 3D68A 3D7DA 5ELYA 2JDDA 2PIZA 4OLLA 5LRGA 4UBRA 1CPXA 4RS2A 3DSBA 1R43A 2V8VA 3RYOA 2K5TA 1P0HA 4CGNA 3SI0A 4ZI6A 1QMUA 4UCPA 4CRYB 1M4DA 1AMPA 1DTDA 3JTKA 2PVVA 1IOIA 4ZX9A 3CPAA 2V8GA 4HNXB 4CYOA 2EUIA 1I21A 2HV2A 4ZGYB 1UFHA 1IYLA 2Q4ZA 1RXTA 1ZG9A 3LMSA 1MJ9A 1IOFA 4MFKA 3PBEA 1CJWA 3KQZA 3BLNA 4B5PB 2QYVA 2XEFA 3IFEA 4C2YA 2XEJA 4IF5A 3KHXA 4MFLA 3R1KA 5G1ZA 3BI0A 4JYWA 5GCNA 3D2PA 2WSAA 3NFZA 3T8WA 4E2AA 1B87A 3D3SA 4KOWA 2QMLA 2REFA 3PFEA 3B3TA 1F2OA 4P4EA 4R3LA 5LYFA 3SXNA 5I4MA 3PB6X 2F8HA 2PJ0A 1YREA 2WUUA 4CAEA 3IWWA 4OMEA 3T9YA 3KZWA 4OC4A 3HLPA 1XBUA 2AFZA 4LQGA 3S6HA 4CAVA 4CGPA 4XPLA 1LCPA 3R9GA 3TFYA 5IX3A 3TT2A 1M4LA 1S3ZA 2C6GA 1YSJA 1R57A 2ODFA 2ATRA 3PEIA 4Y49C 2PE3A 2ZEOA 2B4DA 4OADA 3BXMA 1CG2A 1Y9KA 3EY5A 4QVTA 4A33A 4RUHA 5K8OA 3TE4A 2NYQA 2ARHA 2CY2A 1B6BA 1EE3P 2R98A 4F9VA 3SJGA 3SI2A 2ZW7A 2AFUA 3VWEA 5K8PA 4F9UA 2GANA 4U9YA 3W6SA 5H86A 1VHOA 4MHPA 1BPMA 4FD6A 2AFSA 2DPTA 4F6AA 3W91A 2HUZA 2Z3PA 4A31A 4KLWA 2G9DA 3FRMA 3FX6A 5JH9A 3T90A 3KR5A 3KGQA 4PK2A 5EMIA 4II9A 3D7FA 1BPNA 3I1UA 3S6GA 2HQYA 1V0CA 3DR8A 3TO6A 4JZ0A 4QB9A 2EK9A 3S6KA 4B5PA 2B4BA 4PSXA 2DF5A 4UCNA 1CPSA 2C6CA 1LRZA 3B3CA 4ONUA 5H84A 4R6TA 1LFWA 2BL1A 4MY0A 1ZLIA 3EXNA 3NE8A 4C2XA 5HXDA 4R57A 2CNMA 4RI1A 2IL4A 3NH5A 4MRIA 1M4IA 1BOBA 3MGDA 4F0YA 3NA6A 3VATA 3IO1A 3PB7X 1ZLHA 1TXRA 1KUYA 4UIAA 3FVLA 3ISXA 1M1DA 3D8PA 3FBUA 2FL4A 2OB0A 1S7KA 3P2HA 5G22A 3PBBA 4MJ8A 2VEZA 4OC2A 2B4DB 3IGRA 2B5GA 2FVGA 2FT0A 4HNYB 4QC6A 5C82A 4ZX8A 1TKHA 1Z4EA 1Y9WA 5KTCA 1NE9A 2HC9A 4NGRA 3WABA 4A2ZA 3FJUA 5AG4A 2YNDA 4TWEA 1UWYA 2KCWA 2Z11A 4NCZA 3R96A 1CP7A 4Y49B 2CNTA 5LYDA 2BO9A 2GE3A 2J8NA 1JQGA 4DUKA 2F7VA 3E0KA 4DNCA 2I79A 5IB0A 1XOVA 1MJBA 1YQEA 2PJ3A 4TNUA 3H4QA 4IK2A 3TTHA 3F0AA 1LAMA 4CS0B 3CXPA 2ZEEA 3DDDA 4X2TA 2GU2A 2QVPA 4MY3A 4A38A 4B14A 5F46A 1ELMP 4I49A 3DR6A 3H8EA 1Z8TA 1S7LA 1ZO0A 4KS9A 1CBXA 2AFXA 3CZXA 5CPAA 2Q7BA 2VQYA 5AG7A 1KUXA 4F8ZA 1XRYA 5AG6A 3R9EA 1KUVA 1P4NA 2RB7A 4A32A 3H5ZA 2OU2A 1YW4A 1Z4RA 4UIBA 4CGOA 4B11A 4X8IA 2I00A 3FMCA 4M6HA 4MBUA 4P4IA 2OR4A 2ZEFA 5JM6A 4KLVA 5K8NA 2JBKA 1ELLP 4K3NA 4FD7A 4B13A 1XE4A 2P6FA 5J8FA 1Q2DA 4OP4A 4KUAA 2PJ9A 4KSIA 2JEWA 2ANPA 2AJ6A 2POKA 2Q4VA 3DNSA 7CPAA 1OBRA 2B5GB 3K9TA 4H2KA 1LOKA 3S9LA 3B8GA 5G20A 4A94A 3D2MA 4UFXA 3IU1A 4X3RA 4EFDA 1S7FA 2ZEDA 3DLJA 4U9ZA 4A30A 3KQXA 3ZZIA 2ZW5A 3D7GA 2FE7A 5HVHA 4YU9A 5F09A 4CYQA 4NF1A 2PVWA 5HH1A
chains in the Genus database with same CATH topology
5E96A 3FIXA 1BO4A 2G3AA 4YGOA 2D4OA 5EC4A 4U5YA 1MJAA 2Z3LA 4FD4A 5F48A 1NMTA 2WPWA 5JPHA 3S6FA 5F49A 2QIRA 3PP9A 1YGHA 1WK4A 2VZZA 2J8RA 4MFQA 1J4JA 5G21A 5I0CA 4X5KA 5AG5A 2B3VA 4JLYA 4PV6A 4L89A 1IIDA 1FY7A 5A28A 2OZHA 3BJ7A 3JVNA 3NE7A 4UFVA 1WWZA 2YNEA 4OAEA 2VZYA 1YLEA 1I12A 4C7HA 3FNCA 2REEA 4CYPA 4LUAA 2FIWA 3EC4A 3F5BA 4UA3A 2YNCA 4M3SA 2Q4YA 4KUBA 3ZJ0A 2ZPAA 2Z3NA 5JQ4A 4PK3A 4CYNA 5KTAA 1Q2CA 2ZW4A 2DPSA 3EFAA 3N7ZA 2FSRA 2VBQA 4FD5A 1IB1E 2EVNA 2FXFA 4XPDB 4GS4A 2NMTA 4MFZA 3R95A 3FXTA 4KOSA 4L8AA 1XF8A 2PSWA 4Q36A 3UY5A 4BBHA 1XMTA 1L0CA 2R8VA 1OZPA 2G0BA 4KSAA 2OZUA 2Z3MA 2J8MA 2CNSA 4KZTA 4BMHA 4AVCA 3A9LA 4CGLA 3I3GA 1YVOA 5AGEA 4CRZB 4YRHA 1TIQA 2ZW6A 4QUSA 3TCVA 1N71A 2B3UA 2P0WA 4J3GA 1S60A 1QSRA 1MK4A 2BSWA 1ON0A 1M4GA 2FIAA 2C27A 5G20A 2OH1A 2P6GA 2PDOA 3C26A 4K30A 4E8OA 2H5MA 2PQ8A 4KOYA 2VI7A 2B58A 3GY9A 4MHDA 3LD2A 3R9FA 4CAXA 3G3SA 1IICA 4KSFA 4B13A 1Z9UA 2PR8A 4H89A 4B5OA 2Z3KA 3VWDA 3KKWA 4C2ZA 2PR1A 2JLMA 2Q04A 2BUEA 1RO5A 4NSQA 2AE6A 4XPDC 5EBVA 5A27A 2JEVA 2DXQA 1KZFA 4ORFA 2X7BA 3EO4A 4AVAA 4PSWA 4KOUA 5HMNA 3F8KA 4UCMA 3IWGA 1XEBA 4ZBGA 4YFJA 4KVOE 2Z0ZA 2WPXA 5FVJA 2VXKA 3QAHA 4NEXA 4M85A 5DWMA 3TO9A 4MFJA 2RC4A 3BJ8A 4AVBA 4B10A 1QSMA 3IWEA 5CNPA 2GIVA 4KVXA 3CXSA 4JWPA 3OWCA 3FB3A 2Q44A 2ZXVA 2YNCC 4Q38A 5IV0A 4R3KA 2Z10A 2A4NA 4XNHC 1XIXA 2BEIA 4AB7A 2Q0YA 4R9MA 4HKFA 1YVKA 4EVYA 1S5KA 3P2FA 4JXRA 3WR7A 2Y0MA 4UWJA 3PGPA 1YX0A 4JD6A 3SXOA 3W6XA 2D4PA 2JDCA 5F47A 4H6UA 5ISVA 4JXQA 1Q2YA 4R87A 4JJXA 3K9UA 2R1IA 4MFPA 2O28A 1SQHA 2G3TA 3GYAA 4AG9A 4AG7A 4F0XA 4KOTA 3JUWA 4KOXA 3V8IA 3GKRA 1IYKA 2QECA 4HNWB 1M44A 4C68A 5C88A 1S7NA 1PU9A 2PC1A 3TOAA 5DWNA 2F5IA 3FYNA 3PZJA 2YGWA 2FCKA 3QB8A 4KOVA 2P6EA 1QSOA 4KORA 2Z3OA 4XNHB 1VKCA 2CXAA 4KVME 2R7HA 1U6MA 1YR0A 1CM0A 2OZGA 3I9SA 5BWAB 4UFWA 3TO7A 1VHSA 2PRBA 3SHPA 4B12A 4LX9A 4H6ZA 3TOBA 3IU2A 4MI4A 4E0AA 3CXQA 4NXYA 4C7IA 1I1DA 4IUSA 2FS5A 4A95A 1K4JA 1NSLA 4CAWA 5KTDA 1QSTA 3G8WA 1QSNA 5J8CA 4UWIA 1PUAA 1GHEA 3LODA 1YK3A 4CGMA 4XPKA 1Y7RA 4CAFA 4QBJA 2JDDA 4OLLA 4UBRA 4RS2A 3DSBA 3RYOA 2K5TA 1P0HA 4CGNA 4UCPA 4CRYB 1M4DA 3JTKA 4HNXB 4CYOA 2EUIA 1I21A 2HV2A 4ZGYB 1UFHA 1IYLA 4MFKA 1RXTA 1MJ9A 1CJWA 3BLNA 4C2YA 4IF5A 4MFLA 5GCNA 3R1KA 5G1ZA 3D2PA 2WSAA 4E2AA 1B87A 3D3SA 4KOWA 2QMLA 2REFA 4R3LA 3SXNA 1YREA 2WUUA 4CAEA 3T9YA 3S6HA 4CAVA 4CGPA 4XPLA 3R9GA 3TFYA 5IX3A 3TT2A 1S3ZA 1R57A 2ATRA 4Y49C 2B4DA 4OADA 1Y9KA 3EY5A 4QVTA 4A33A 3TE4A 2ARHA 2CY2A 1B6BA 2R98A 2ZW7A 3VWEA 2GANA 4U9YA 3W6SA 5H86A 4FD6A 2DPTA 4F6AA 3W91A 2HUZA 2Z3PA 4A31A 4KLWA 3FRMA 3T90A 4PK2A 4II9A 3S6GA 2HQYA 1V0CA 3DR8A 3TO6A 4QB9A 3S6KA 4B5PA 2B4BA 4PSXA 4UCNA 1LRZA 4ONUA 5H84A 2BL1A 4MY0A 3EXNA 4C2XA 4R57A 2CNMA 4RI1A 2IL4A 1M4IA 1BOBA 3MGDA 4F0YA 1KUYA 1M1DA 3D8PA 3FBUA 2FL4A 2OB0A 1S7KA 3P2HA 5G22A 4MJ8A 2VEZA 2B4DB 3IGRA 2B5GA 4HNYB 2FT0A 5C82A 4QC6A 1Z4EA 1Y9WA 5KTCA 1NE9A 4A2ZA 5AG4A 2YNDA 2Z11A 2KCWA 4NCZA 3R96A 4Y49B 2CNTA 2GE3A 2J8NA 4DNCA 3E0KA 2I79A 5IB0A 1MJBA 3H4QA 3TTHA 3F0AA 4CS0B 3CXPA 3DDDA 4MY3A 5F46A 4B14A 4I49A 3DR6A 4KS9A 1S7LA 1ZO0A 2Q7BA 4B5PB 2VQYA 5AG7A 1KUXA 5AG6A 3R9EA 1KUVA 1P4NA 4A32A 3H5ZA 2OU2A 1Z4RA 4CGOA 4B11A 2I00A 4MBUA 4KLVA 4FD7A 1XE4A 2P6FA 5J8FA 1Q2DA 4KUAA 2Q4VA 2AJ6A 3DNSA 2B5GB 3B8GA 3D2MA 4UFXA 3IU1A 1S7FA 4U9ZA 4A30A 3ZZIA 2ZW5A 2FE7A 4CYQA 4NF1A 5HH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E96 A;  3FIX A;  1BO4 A;  2G3A A;  4YGO A;  2D4O A;  5EC4 A;  4U5Y A;  1MJA A;  4FD4 A;  5F48 A;  1NMT A;  2WPW A;  5JPH A;  3S6F A;  5F49 A;  2QIR A;  3PP9 A;  1YGH A;  1WK4 A;  2VZZ A;  2J8R A;  1J4J A;  5I0C A;  4X5K A;  2B3V A;  4JLY A;  4PV6 A;  4L89 A;  1IID A;  1FY7 A;  2OZH A;  3BJ7 A;  3JVN A;  3NE7 A;  1WWZ A;  4OAE A;  2VZY A;  1YLE A;  1I12 A;  3FNC A;  2REE A;  4LUA A;  2FIW A;  3EC4 A;  3F5B A;  4UA3 A;  4M3S A;  2Q4Y A;  4KUB A;  3ZJ0 A;  2ZPA A;  5JQ4 A;  4PK3 A;  5KTA A;  1Q2C A;  2ZW4 A;  3EFA A;  3N7Z A;  2FSR A;  2VBQ A;  4FD5 A;  1IB1 E;  2EVN A;  2FXF A;  4XPD B;  4GS4 A;  2NMT A;  3R95 A;  3FXT A;  4KOS A;  4L8A A;  1XF8 A;  2PSW A;  3UY5 A;  1XMT A;  1L0C A;  2R8V A;  1OZP A;  2G0B A;  2OZU A;  2J8M A;  2CNS A;  4KZT A;  4BMH A;  4AVC A;  3I3G A;  1YVO A;  4CRZ B;  4YRH A;  1TIQ A;  2ZW6 A;  4QUS A;  3TCV A;  1N71 A;  2B3U A;  2P0W A;  4J3G A;  1S60 A;  1QSR A;  1MK4 A;  2BSW A;  1ON0 A;  1M4G A;  2FIA A;  2C27 A;  2OH1 A;  2P6G A;  2PDO A;  3C26 A;  4K30 A;  4E8O A;  2H5M A;  2PQ8 A;  4KOY A;  2VI7 A;  2B58 A;  3GY9 A;  4MHD A;  3LD2 A;  3R9F A;  4CAX A;  3G3S A;  1IIC A;  1Z9U A;  2PR8 A;  4H89 A;  4B5O A;  3VWD A;  3KKW A;  2PR1 A;  2JLM A;  2Q04 A;  2BUE A;  1RO5 A;  4NSQ A;  2AE6 A;  4XPD C;  5EBV A;  2JEV A;  2DXQ A;  1KZF A;  4ORF A;  2X7B A;  3EO4 A;  4AVA A;  4PSW A;  4KOU A;  5HMN A;  3F8K A;  3IWG A;  1XEB A;  4ZBG A;  4YFJ A;  4KVO E;  2Z0Z A;  2WPX A;  5FVJ A;  2VXK A;  3QAH A;  4NEX A;  4M85 A;  5DWM A;  3TO9 A;  2RC4 A;  3BJ8 A;  4AVB A;  1QSM A;  5CNP A;  2GIV A;  4KVX A;  3CXS A;  4JWP A;  3OWC A;  3FB3 A;  2Q44 A;  2ZXV A;  5IV0 A;  4R3K A;  2Z10 A;  2A4N A;  4XNH C;  1XIX A;  2BEI A;  4AB7 A;  2Q0Y A;  4R9M A;  4HKF A;  1YVK A;  4EVY A;  1S5K A;  3P2F A;  4JXR A;  3WR7 A;  2Y0M A;  4UWJ A;  3PGP A;  1YX0 A;  4JD6 A;  3SXO A;  3W6X A;  2D4P A;  2JDC A;  5F47 A;  4H6U A;  5ISV A;  4JXQ A;  1Q2Y A;  4R87 A;  4JJX A;  3K9U A;  2R1I A;  2O28 A;  1SQH A;  2G3T A;  3GYA A;  4AG9 A;  4AG7 A;  4KOT A;  3JUW A;  4KOX A;  3V8I A;  3GKR A;  1IYK A;  2QEC A;  4HNW B;  1M44 A;  5C88 A;  1S7N A;  1PU9 A;  2PC1 A;  3TOA A;  5DWN A;  2F5I A;  3FYN A;  3PZJ A;  2FCK A;  3QB8 A;  4KOV A;  2P6E A;  1QSO A;  4KOR A;  4XNH B;  1VKC A;  4KVM E;  2R7H A;  1U6M A;  1YR0 A;  1CM0 A;  2OZG A;  3I9S A;  3TO7 A;  1VHS A;  2PRB A;  3SHP A;  4LX9 A;  4H6Z A;  3TOB A;  4MI4 A;  4E0A A;  3CXQ A;  4NXY A;  1I1D A;  4IUS A;  2FS5 A;  1K4J A;  1NSL A;  4CAW A;  5KTD A;  1QST A;  3G8W A;  1QSN A;  5J8C A;  4UWI A;  1PUA A;  1GHE A;  3LOD A;  1YK3 A;  4XPK A;  1Y7R A;  4QBJ A;  2JDD A;  4OLL A;  4UBR A;  4RS2 A;  3DSB A;  3RYO A;  2K5T A;  1P0H A;  4CRY B;  1M4D A;  4HNX B;  2EUI A;  1I21 A;  2HV2 A;  1UFH A;  1IYL A;  1RXT A;  1MJ9 A;  1CJW A;  3BLN A;  4IF5 A;  5GCN A;  3R1K A;  3D2P A;  4E2A A;  1B87 A;  3D3S A;  4KOW A;  2QML A;  2REF A;  4R3L A;  3SXN A;  1YRE A;  3T9Y A;  3S6H A;  4CAV A;  4XPL A;  3R9G A;  3TFY A;  5IX3 A;  3TT2 A;  1S3Z A;  1R57 A;  2ATR A;  4Y49 C;  2B4D A;  4OAD A;  1Y9K A;  3EY5 A;  4QVT A;  3TE4 A;  2ARH A;  2CY2 A;  1B6B A;  2R98 A;  2ZW7 A;  3VWE A;  2GAN A;  4U9Y A;  3W6S A;  5H86 A;  4FD6 A;  4F6A A;  3W91 A;  2HUZ A;  4KLW A;  3FRM A;  3T90 A;  4PK2 A;  4II9 A;  3S6G A;  2HQY A;  1V0C A;  3DR8 A;  3TO6 A;  4QB9 A;  3S6K A;  4B5P A;  2B4B A;  4PSX A;  1LRZ A;  4ONU A;  5H84 A;  2BL1 A;  4MY0 A;  3EXN A;  4R57 A;  2CNM A;  4RI1 A;  2IL4 A;  1M4I A;  1BOB A;  3MGD A;  4F0Y A;  1KUY A;  1M1D A;  3D8P A;  3FBU A;  2FL4 A;  2OB0 A;  1S7K A;  3P2H A;  4MJ8 A;  2VEZ A;  2B4D B;  3IGR A;  2B5G A;  4HNY B;  2FT0 A;  5C82 A;  4QC6 A;  1Z4E A;  1Y9W A;  5KTC A;  1NE9 A;  2Z11 A;  2KCW A;  4NCZ A;  3R96 A;  4Y49 B;  2CNT A;  2GE3 A;  2J8N A;  4DNC A;  3E0K A;  2I79 A;  5IB0 A;  1MJB A;  3H4Q A;  3TTH A;  3F0A A;  4CS0 B;  3CXP A;  3DDD A;  4MY3 A;  5F46 A;  4I49 A;  3DR6 A;  4B5P B;  1S7L A;  2Q7B A;  2VQY A;  1KUX A;  3R9E A;  1KUV A;  1P4N A;  2OU2 A;  1Z4R A;  2I00 A;  4MBU A;  4KLV A;  4FD7 A;  1XE4 A;  2P6F A;  5J8F A;  1Q2D A;  4KUA A;  2Q4V A;  2AJ6 A;  3DNS A;  2B5G B;  3B8G A;  3D2M A;  1S7F A;  4U9Z A;  3ZZI A;  2ZW5 A;  2FE7 A;  4NF1 A;  5HH1 A; 
#chains in the Genus database with same CATH topology
 3KAS A;  5E96 A;  1IU8 A;  3FIX A;  4WJB A;  1BO4 A;  2G3A A;  4BD9 A;  2EK8 A;  4NGT A;  4YGO A;  3QAY A;  2D4O A;  4MHZ A;  3DGV A;  1TKJ A;  5EC4 A;  4MHN A;  4U5Y A;  1MJA A;  2Z3L A;  4FD4 A;  5F48 A;  1NMT A;  2WPW A;  1AYE A;  5JPH A;  1IGB A;  3S6F A;  2ZEH A;  2IMO A;  5F49 A;  1NSA A;  2QIR A;  3PP9 A;  4FAI A;  1YGH A;  4B6Z A;  3PB9 X;  3IEH A;  3NH8 A;  4PPZ A;  2RFH A;  1CP6 A;  4NGM A;  1WK4 A;  2VZZ A;  2J8R A;  4MFQ A;  1J4J A;  3CT9 A;  4ZY0 A;  1PCA A;  1YW6 A;  2V8H A;  5G21 A;  4X5K A;  5AG5 A;  2GFQ A;  2B3V A;  5LRJ A;  2PJ7 A;  1R3N A;  4A37 A;  3BI1 A;  4JLY A;  4P4J A;  4PV6 A;  4L89 A;  3WC7 A;  1IID A;  1FY7 A;  5A28 A;  1ZG8 A;  2OZH A;  3BJ7 A;  4AXV A;  3JVN A;  3NE7 A;  4UFV A;  1WWZ A;  2BOA A;  2YNE A;  4IAV A;  2ZEN A;  4OAE A;  1X12 A;  2VZY A;  4P4B A;  4R7M A;  1YLE A;  1AUG A;  1I12 A;  4C7H A;  3FNC A;  2REE A;  4CYP A;  4LUA A;  2FIW A;  3EC4 A;  3F5B A;  4UA3 A;  2YNC A;  4M3S A;  1TKF A;  3D66 A;  4FBE A;  5I0C A;  3S9N A;  3LAC A;  2Q4Y A;  2ZEG A;  4KUB A;  2ZPA A;  2Z3N A;  3ZJ0 A;  5JQ4 A;  3TC8 A;  4YWY A;  4OC5 A;  4PK3 A;  4CYN A;  5KTA A;  1Q2C A;  2ZW4 A;  2DPS A;  3EFA A;  3N7Z A;  1PYT B;  2FSR A;  2VBQ A;  4FD5 A;  1IB1 E;  2EVN A;  2FXF A;  3L2N A;  4Q7A A;  2ZEP A;  4XPD B;  4GS4 A;  2NMT A;  4MFZ A;  3R95 A;  5HVG A;  3PFO A;  3BHX A;  3FXT A;  2DEA A;  1GYT A;  4KOS A;  5LYL A;  4L8A A;  4M6G A;  2CF4 A;  1XF8 A;  4FUU A;  1XJO A;  3SJE A;  2PSW A;  4Q36 A;  3UY5 A;  5DS0 A;  4BBH A;  5K8M A;  1XMT A;  1LAN A;  1L0C A;  3PRT A;  2R8V A;  1ARL A;  2EO8 A;  3GB0 A;  3KI9 A;  4BIN A;  3WT4 A;  1OZP A;  2Q7S A;  2G0B A;  4KSA A;  2OZU A;  2Z3M A;  2J8M A;  4P6Y A;  2CNS A;  2CTC A;  4PXE A;  4KZT A;  4OC0 A;  4BMH A;  1Z8W A;  3S9M A;  4ZY2 A;  4EWT A;  4AVC A;  3A9L A;  4OC1 A;  3B35 A;  4CGL A;  4MCP A;  4P45 A;  3I3G A;  1YVO A;  1BAV A;  5AGE A;  3VAR A;  2C1C A;  4UEZ A;  4CRZ B;  4YRH A;  4OID A;  1TIQ A;  2AFO A;  3D4U A;  4WWV A;  2ZW6 A;  4GM5 A;  4QUS A;  4R76 A;  3RAM A;  3TCV A;  5J1Q A;  1N71 A;  2Q43 A;  3IIB A;  1RTQ A;  2B3U A;  1A2Z A;  2P0W A;  5HVF A;  4J3G A;  4MCR A;  1S60 A;  2PJA A;  4O23 A;  2AFM A;  1QSR A;  4LQ6 A;  1MK4 A;  2BSW A;  3IC1 A;  3K2K A;  2WYR A;  1ON0 A;  1M4G A;  2FIA A;  2C27 A;  2EBJ A;  2XEG A;  4OIW A;  2OH1 A;  2P6G A;  2PDO A;  3C26 A;  4G1P A;  4RN7 A;  4K30 A;  4E8O A;  4NJQ A;  2H5M A;  2PQ8 A;  3FF3 A;  4KOY A;  3SJF A;  3V7Z A;  2VI7 A;  3CPX A;  3H8F A;  2PJ2 A;  4PXB A;  2B58 A;  2ZEL A;  5LRK A;  2V77 A;  4PXD A;  8CPA A;  3B3W A;  1HEE A;  3GY9 A;  4MHD A;  3LD2 A;  3R9F A;  3VH9 A;  3G3S A;  1VHE A;  3FEC A;  4CAX A;  3H8G A;  1IIC A;  4KSF A;  4UEF A;  1XFO A;  1Z9U A;  2PR8 A;  1Z8X A;  3PB4 X;  4H89 A;  2ZOG A;  4OC3 A;  2OOT A;  3IJ3 A;  4B5O A;  2Z3K A;  4P4D A;  3VWD A;  3KKW A;  5THW A;  3KHZ A;  4C2Z A;  1FT7 A;  4MHY A;  2QJ8 A;  2PR1 A;  2JLM A;  4PQA A;  3WC5 A;  2Q04 A;  2BUE A;  1RO5 A;  4NSQ A;  2AE6 A;  4XPD C;  5EBV A;  1KWM A;  4DYO A;  5A27 A;  2JEV A;  3FED A;  2DXQ A;  5D8N A;  1KZF A;  3GUX A;  2PJ6 A;  4ORF A;  2XEI A;  2X7B A;  3EO4 A;  4AVA A;  4PSW A;  4KOU A;  5HMN A;  3B3V A;  2EWB A;  3F8K A;  2HB6 A;  3SI1 A;  4UCM A;  3IWG A;  1XEB A;  4ZBG A;  4ONW A;  1HDU A;  4OKO A;  3KL9 A;  4UEE A;  4YFJ A;  1CX8 A;  2ABZ A;  4KVO E;  2Z0Z A;  2WPX A;  5FVJ A;  3SJX A;  2VXK A;  3QAH A;  4NEX A;  4M85 A;  5DWM A;  3TO9 A;  3GIU A;  4MFJ A;  2RC4 A;  2V8D A;  1YLO A;  3BJ8 A;  4AVB A;  4B10 A;  1QSM A;  3IWE A;  5CNP A;  3RZA A;  2GIV A;  2PJ8 A;  4FWU A;  4KVX A;  3CXS A;  4JWP A;  3OWC A;  3B3S A;  3FB3 A;  2Q44 A;  4NGP A;  2ZXV A;  2YNC C;  1Y0Y A;  4P4F A;  3LWU A;  4MXU A;  4Q38 A;  2PCU A;  5IV0 A;  4R3K A;  2PJ5 A;  2Z10 A;  1ARM A;  2A4N A;  4ZY1 A;  4XNH C;  1XIX A;  2BEI A;  4AB7 A;  1ZG7 A;  2I3C A;  3KR4 A;  2Q0Y A;  4R9M A;  4HKF A;  1YVK A;  4EVY A;  2CIJ A;  1S5K A;  3P2F A;  3RBU A;  4JXR A;  4Z65 A;  4PXC A;  4NFR A;  3WR7 A;  5CBM A;  3D7H A;  2Y0M A;  1Q7L A;  4P10 A;  4UWJ A;  3PGP A;  1YX0 A;  4JD6 A;  3SXO A;  3W6X A;  3JRU A;  2D4P A;  2Q51 A;  2JDC A;  2PJ4 A;  6CPA A;  1LAP A;  5F47 A;  4H6U A;  4MMO A;  5IB9 A;  2VL1 A;  4NGS A;  3GLJ A;  5ISV A;  1DE4 C;  2PRQ A;  4JXQ A;  1Q2Y A;  4R87 A;  4JJX A;  3K9U A;  2R1I A;  4MFP A;  2IJZ A;  2O28 A;  1XMB A;  1SQH A;  2G3T A;  2GLF A;  2GRE A;  1F57 A;  2IQ6 A;  3GYA A;  4AG9 A;  4AG7 A;  4F0X A;  1F2P A;  4KOT A;  2ZEM A;  2ZOF A;  3JUW A;  4KOX A;  4NGN A;  1H8L A;  2NSM A;  4ZYQ A;  3HUV A;  3V8I A;  2PJ1 A;  3GKR A;  5JGF A;  3RO0 A;  3PB8 X;  1BLL E;  2C6P A;  2J9A A;  1QQ9 A;  1IYK A;  3ISZ A;  2QEC A;  2PIY A;  3TX8 A;  4HNW B;  1M44 A;  2O53 A;  4C68 A;  5C88 A;  1YME A;  2PJB A;  4IHM A;  1S7N A;  1PU9 A;  4GXH A;  3D67 A;  2PC1 A;  3FH4 A;  2PJC A;  3TOA A;  5DWN A;  1IY7 A;  2F5I A;  1Z2L A;  5LYI A;  3RNZ A;  3FYN A;  2CTB A;  3PZJ A;  2YGW A;  2FCK A;  3QB8 A;  4W9Y A;  2AFW A;  2P6E A;  1QSO A;  2JBJ A;  4KOV A;  2Z3O A;  4KOR A;  4XNH B;  1VKC A;  2CXA A;  3CDX A;  4KVM E;  3MN8 A;  2BCO A;  2R7H A;  4R8F A;  1U6M A;  1YR0 A;  4CPA A;  4DJL A;  1TF9 A;  1CM0 A;  2OZG A;  3I9S A;  5BWA B;  1VGY A;  3WC6 A;  4UFW A;  4EME A;  3TO7 A;  1VHS A;  4M6I A;  2PRB A;  3SHP A;  2WZN A;  1Z8L A;  3MRU A;  4B12 A;  3N5F A;  3NH4 A;  4LX9 A;  4H6Z A;  2O4H A;  1Y7E A;  1VIX A;  3TOB A;  3IU2 A;  4HPS A;  4MI4 A;  1X10 A;  4E0A A;  3B2Y A;  3CXQ A;  3FEE A;  1Z5R A;  4NXY A;  4C7I A;  3V38 A;  3B7I A;  1I1D A;  4IUS A;  1TF8 A;  4P44 A;  2FS5 A;  1FNO A;  4A95 A;  5D29 A;  4NJR A;  4NGQ A;  1K4J A;  1NSL A;  4UF4 A;  4CAW A;  3QNV A;  4A39 A;  1QST A;  1JWQ A;  3G8W A;  1QSN A;  5KTD A;  5J8C A;  4UWI A;  1PUA A;  4MCS A;  1GHE A;  3LOD A;  1YK3 A;  2GLJ A;  1HDQ A;  1Y0R A;  4CGM A;  4MCQ A;  4XPK A;  1Y7R A;  4CAF A;  4QBJ A;  3D68 A;  3D7D A;  5ELY A;  2JDD A;  2PIZ A;  4OLL A;  5LRG A;  4UBR A;  1CPX A;  4RS2 A;  3DSB A;  1R43 A;  2V8V A;  3RYO A;  2K5T A;  1P0H A;  4CGN A;  3SI0 A;  4ZI6 A;  1QMU A;  4UCP A;  4CRY B;  1M4D A;  1AMP A;  1DTD A;  3JTK A;  2PVV A;  1IOI A;  4ZX9 A;  3CPA A;  2V8G A;  4HNX B;  4CYO A;  2EUI A;  1I21 A;  2HV2 A;  4ZGY B;  1UFH A;  1IYL A;  2Q4Z A;  1RXT A;  1ZG9 A;  3LMS A;  1MJ9 A;  1IOF A;  4MFK A;  3PBE A;  1CJW A;  3KQZ A;  3BLN A;  4B5P B;  2QYV A;  2XEF A;  3IFE A;  4C2Y A;  2XEJ A;  4IF5 A;  3KHX A;  4MFL A;  3R1K A;  5G1Z A;  3BI0 A;  4JYW A;  5GCN A;  3D2P A;  2WSA A;  3NFZ A;  3T8W A;  4E2A A;  1B87 A;  3D3S A;  4KOW A;  2QML A;  2REF A;  3PFE A;  3B3T A;  1F2O A;  4P4E A;  4R3L A;  5LYF A;  3SXN A;  5I4M A;  3PB6 X;  2F8H A;  2PJ0 A;  1YRE A;  2WUU A;  4CAE A;  3IWW A;  4OME A;  3T9Y A;  3KZW A;  4OC4 A;  3HLP A;  1XBU A;  2AFZ A;  4LQG A;  3S6H A;  4CAV A;  4CGP A;  4XPL A;  1LCP A;  3R9G A;  3TFY A;  5IX3 A;  3TT2 A;  1M4L A;  1S3Z A;  2C6G A;  1YSJ A;  1R57 A;  2ODF A;  2ATR A;  3PEI A;  4Y49 C;  2PE3 A;  2ZEO A;  2B4D A;  4OAD A;  3BXM A;  1CG2 A;  1Y9K A;  3EY5 A;  4QVT A;  4A33 A;  4RUH A;  5K8O A;  3TE4 A;  2NYQ A;  2ARH A;  2CY2 A;  1B6B A;  1EE3 P;  2R98 A;  4F9V A;  3SJG A;  3SI2 A;  2ZW7 A;  2AFU A;  3VWE A;  5K8P A;  4F9U A;  2GAN A;  4U9Y A;  3W6S A;  5H86 A;  1VHO A;  4MHP A;  1BPM A;  4FD6 A;  2AFS A;  2DPT A;  4F6A A;  3W91 A;  2HUZ A;  2Z3P A;  4A31 A;  4KLW A;  2G9D A;  3FRM A;  3FX6 A;  5JH9 A;  3T90 A;  3KR5 A;  3KGQ A;  4PK2 A;  5EMI A;  4II9 A;  3D7F A;  1BPN A;  3I1U A;  3S6G A;  2HQY A;  1V0C A;  3DR8 A;  3TO6 A;  4JZ0 A;  4QB9 A;  2EK9 A;  3S6K A;  4B5P A;  2B4B A;  4PSX A;  2DF5 A;  4UCN A;  1CPS A;  2C6C A;  1LRZ A;  3B3C A;  4ONU A;  5H84 A;  4R6T A;  1LFW A;  2BL1 A;  4MY0 A;  1ZLI A;  3EXN A;  3NE8 A;  4C2X A;  5HXD A;  4R57 A;  2CNM A;  4RI1 A;  2IL4 A;  3NH5 A;  4MRI A;  1M4I A;  1BOB A;  3MGD A;  4F0Y A;  3NA6 A;  3VAT A;  3IO1 A;  3PB7 X;  1ZLH A;  1TXR A;  1KUY A;  4UIA A;  3FVL A;  3ISX A;  1M1D A;  3D8P A;  3FBU A;  2FL4 A;  2OB0 A;  1S7K A;  3P2H A;  5G22 A;  3PBB A;  4MJ8 A;  2VEZ A;  4OC2 A;  2B4D B;  3IGR A;  2B5G A;  2FVG A;  2FT0 A;  4HNY B;  4QC6 A;  5C82 A;  4ZX8 A;  1TKH A;  1Z4E A;  1Y9W A;  5KTC A;  1NE9 A;  2HC9 A;  4NGR A;  3WAB A;  4A2Z A;  3FJU A;  5AG4 A;  2YND A;  4TWE A;  1UWY A;  2KCW A;  2Z11 A;  4NCZ A;  3R96 A;  1CP7 A;  4Y49 B;  2CNT A;  5LYD A;  2BO9 A;  2GE3 A;  2J8N A;  1JQG A;  4DUK A;  2F7V A;  3E0K A;  4DNC A;  2I79 A;  5IB0 A;  1XOV A;  1MJB A;  1YQE A;  2PJ3 A;  4TNU A;  3H4Q A;  4IK2 A;  3TTH A;  3F0A A;  1LAM A;  4CS0 B;  3CXP A;  2ZEE A;  3DDD A;  4X2T A;  2GU2 A;  2QVP A;  4MY3 A;  4A38 A;  4B14 A;  5F46 A;  1ELM P;  4I49 A;  3DR6 A;  3H8E A;  1Z8T A;  1S7L A;  1ZO0 A;  4KS9 A;  1CBX A;  2AFX A;  3CZX A;  5CPA A;  2Q7B A;  2VQY A;  5AG7 A;  1KUX A;  4F8Z A;  1XRY A;  5AG6 A;  3R9E A;  1KUV A;  1P4N A;  2RB7 A;  4A32 A;  3H5Z A;  2OU2 A;  1YW4 A;  1Z4R A;  4UIB A;  4CGO A;  4B11 A;  4X8I A;  2I00 A;  3FMC A;  4M6H A;  4MBU A;  4P4I A;  2OR4 A;  2ZEF A;  5JM6 A;  4KLV A;  5K8N A;  2JBK A;  1ELL P;  4K3N A;  4FD7 A;  4B13 A;  1XE4 A;  2P6F A;  5J8F A;  1Q2D A;  4OP4 A;  4KUA A;  2PJ9 A;  4KSI A;  2JEW A;  2ANP A;  2AJ6 A;  2POK A;  2Q4V A;  3DNS A;  7CPA A;  1OBR A;  2B5G B;  3K9T A;  4H2K A;  1LOK A;  3S9L A;  3B8G A;  5G20 A;  4A94 A;  3D2M A;  4UFX A;  3IU1 A;  4X3R A;  4EFD A;  1S7F A;  2ZED A;  3DLJ A;  4U9Z A;  4A30 A;  3KQX A;  3ZZI A;  2ZW5 A;  3D7G A;  2FE7 A;  5HVH A;  4YU9 A;  5F09 A;  4CYQ A;  4NF1 A;  2PVW A;  5HH1 A; 
#chains in the Genus database with same CATH homology
 5E96 A;  3FIX A;  1BO4 A;  2G3A A;  4YGO A;  2D4O A;  5EC4 A;  4U5Y A;  1MJA A;  2Z3L A;  4FD4 A;  5F48 A;  1NMT A;  2WPW A;  5JPH A;  3S6F A;  5F49 A;  2QIR A;  3PP9 A;  1YGH A;  1WK4 A;  2VZZ A;  2J8R A;  4MFQ A;  1J4J A;  5G21 A;  5I0C A;  4X5K A;  5AG5 A;  2B3V A;  4JLY A;  4PV6 A;  4L89 A;  1IID A;  1FY7 A;  5A28 A;  2OZH A;  3BJ7 A;  3JVN A;  3NE7 A;  4UFV A;  1WWZ A;  2YNE A;  4OAE A;  2VZY A;  1YLE A;  1I12 A;  4C7H A;  3FNC A;  2REE A;  4CYP A;  4LUA A;  2FIW A;  3EC4 A;  3F5B A;  4UA3 A;  2YNC A;  4M3S A;  2Q4Y A;  4KUB A;  3ZJ0 A;  2ZPA A;  2Z3N A;  5JQ4 A;  4PK3 A;  4CYN A;  5KTA A;  1Q2C A;  2ZW4 A;  2DPS A;  3EFA A;  3N7Z A;  2FSR A;  2VBQ A;  4FD5 A;  1IB1 E;  2EVN A;  2FXF A;  4XPD B;  4GS4 A;  2NMT A;  4MFZ A;  3R95 A;  3FXT A;  4KOS A;  4L8A A;  1XF8 A;  2PSW A;  4Q36 A;  3UY5 A;  4BBH A;  1XMT A;  1L0C A;  2R8V A;  1OZP A;  2G0B A;  4KSA A;  2OZU A;  2Z3M A;  2J8M A;  2CNS A;  4KZT A;  4BMH A;  4AVC A;  3A9L A;  4CGL A;  3I3G A;  1YVO A;  5AGE A;  4CRZ B;  4YRH A;  1TIQ A;  2ZW6 A;  4QUS A;  3TCV A;  1N71 A;  2B3U A;  2P0W A;  4J3G A;  1S60 A;  1QSR A;  1MK4 A;  2BSW A;  1ON0 A;  1M4G A;  2FIA A;  2C27 A;  5G20 A;  2OH1 A;  2P6G A;  2PDO A;  3C26 A;  4K30 A;  4E8O A;  2H5M A;  2PQ8 A;  4KOY A;  2VI7 A;  2B58 A;  3GY9 A;  4MHD A;  3LD2 A;  3R9F A;  4CAX A;  3G3S A;  1IIC A;  4KSF A;  4B13 A;  1Z9U A;  2PR8 A;  4H89 A;  4B5O A;  2Z3K A;  3VWD A;  3KKW A;  4C2Z A;  2PR1 A;  2JLM A;  2Q04 A;  2BUE A;  1RO5 A;  4NSQ A;  2AE6 A;  4XPD C;  5EBV A;  5A27 A;  2JEV A;  2DXQ A;  1KZF A;  4ORF A;  2X7B A;  3EO4 A;  4AVA A;  4PSW A;  4KOU A;  5HMN A;  3F8K A;  4UCM A;  3IWG A;  1XEB A;  4ZBG A;  4YFJ A;  4KVO E;  2Z0Z A;  2WPX A;  5FVJ A;  2VXK A;  3QAH A;  4NEX A;  4M85 A;  5DWM A;  3TO9 A;  4MFJ A;  2RC4 A;  3BJ8 A;  4AVB A;  4B10 A;  1QSM A;  3IWE A;  5CNP A;  2GIV A;  4KVX A;  3CXS A;  4JWP A;  3OWC A;  3FB3 A;  2Q44 A;  2ZXV A;  2YNC C;  4Q38 A;  5IV0 A;  4R3K A;  2Z10 A;  2A4N A;  4XNH C;  1XIX A;  2BEI A;  4AB7 A;  2Q0Y A;  4R9M A;  4HKF A;  1YVK A;  4EVY A;  1S5K A;  3P2F A;  4JXR A;  3WR7 A;  2Y0M A;  4UWJ A;  3PGP A;  1YX0 A;  4JD6 A;  3SXO A;  3W6X A;  2D4P A;  2JDC A;  5F47 A;  4H6U A;  5ISV A;  4JXQ A;  1Q2Y A;  4R87 A;  4JJX A;  3K9U A;  2R1I A;  4MFP A;  2O28 A;  1SQH A;  2G3T A;  3GYA A;  4AG9 A;  4AG7 A;  4F0X A;  4KOT A;  3JUW A;  4KOX A;  3V8I A;  3GKR A;  1IYK A;  2QEC A;  4HNW B;  1M44 A;  4C68 A;  5C88 A;  1S7N A;  1PU9 A;  2PC1 A;  3TOA A;  5DWN A;  2F5I A;  3FYN A;  3PZJ A;  2YGW A;  2FCK A;  3QB8 A;  4KOV A;  2P6E A;  1QSO A;  4KOR A;  2Z3O A;  4XNH B;  1VKC A;  2CXA A;  4KVM E;  2R7H A;  1U6M A;  1YR0 A;  1CM0 A;  2OZG A;  3I9S A;  5BWA B;  4UFW A;  3TO7 A;  1VHS A;  2PRB A;  3SHP A;  4B12 A;  4LX9 A;  4H6Z A;  3TOB A;  3IU2 A;  4MI4 A;  4E0A A;  3CXQ A;  4NXY A;  4C7I A;  1I1D A;  4IUS A;  2FS5 A;  4A95 A;  1K4J A;  1NSL A;  4CAW A;  5KTD A;  1QST A;  3G8W A;  1QSN A;  5J8C A;  4UWI A;  1PUA A;  1GHE A;  3LOD A;  1YK3 A;  4CGM A;  4XPK A;  1Y7R A;  4CAF A;  4QBJ A;  2JDD A;  4OLL A;  4UBR A;  4RS2 A;  3DSB A;  3RYO A;  2K5T A;  1P0H A;  4CGN A;  4UCP A;  4CRY B;  1M4D A;  3JTK A;  4HNX B;  4CYO A;  2EUI A;  1I21 A;  2HV2 A;  4ZGY B;  1UFH A;  1IYL A;  4MFK A;  1RXT A;  1MJ9 A;  1CJW A;  3BLN A;  4C2Y A;  4IF5 A;  4MFL A;  5GCN A;  3R1K A;  5G1Z A;  3D2P A;  2WSA A;  4E2A A;  1B87 A;  3D3S A;  4KOW A;  2QML A;  2REF A;  4R3L A;  3SXN A;  1YRE A;  2WUU A;  4CAE A;  3T9Y A;  3S6H A;  4CAV A;  4CGP A;  4XPL A;  3R9G A;  3TFY A;  5IX3 A;  3TT2 A;  1S3Z A;  1R57 A;  2ATR A;  4Y49 C;  2B4D A;  4OAD A;  1Y9K A;  3EY5 A;  4QVT A;  4A33 A;  3TE4 A;  2ARH A;  2CY2 A;  1B6B A;  2R98 A;  2ZW7 A;  3VWE A;  2GAN A;  4U9Y A;  3W6S A;  5H86 A;  4FD6 A;  2DPT A;  4F6A A;  3W91 A;  2HUZ A;  2Z3P A;  4A31 A;  4KLW A;  3FRM A;  3T90 A;  4PK2 A;  4II9 A;  3S6G A;  2HQY A;  1V0C A;  3DR8 A;  3TO6 A;  4QB9 A;  3S6K A;  4B5P A;  2B4B A;  4PSX A;  4UCN A;  1LRZ A;  4ONU A;  5H84 A;  2BL1 A;  4MY0 A;  3EXN A;  4C2X A;  4R57 A;  2CNM A;  4RI1 A;  2IL4 A;  1M4I A;  1BOB A;  3MGD A;  4F0Y A;  1KUY A;  1M1D A;  3D8P A;  3FBU A;  2FL4 A;  2OB0 A;  1S7K A;  3P2H A;  5G22 A;  4MJ8 A;  2VEZ A;  2B4D B;  3IGR A;  2B5G A;  4HNY B;  2FT0 A;  5C82 A;  4QC6 A;  1Z4E A;  1Y9W A;  5KTC A;  1NE9 A;  4A2Z A;  5AG4 A;  2YND A;  2Z11 A;  2KCW A;  4NCZ A;  3R96 A;  4Y49 B;  2CNT A;  2GE3 A;  2J8N A;  4DNC A;  3E0K A;  2I79 A;  5IB0 A;  1MJB A;  3H4Q A;  3TTH A;  3F0A A;  4CS0 B;  3CXP A;  3DDD A;  4MY3 A;  5F46 A;  4B14 A;  4I49 A;  3DR6 A;  4KS9 A;  1S7L A;  1ZO0 A;  2Q7B A;  4B5P B;  2VQY A;  5AG7 A;  1KUX A;  5AG6 A;  3R9E A;  1KUV A;  1P4N A;  4A32 A;  3H5Z A;  2OU2 A;  1Z4R A;  4CGO A;  4B11 A;  2I00 A;  4MBU A;  4KLV A;  4FD7 A;  1XE4 A;  2P6F A;  5J8F A;  1Q2D A;  4KUA A;  2Q4V A;  2AJ6 A;  3DNS A;  2B5G B;  3B8G A;  3D2M A;  4UFX A;  3IU1 A;  1S7F A;  4U9Z A;  4A30 A;  3ZZI A;  2ZW5 A;  2FE7 A;  4CYQ A;  4NF1 A;  5HH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...