1SQHA

X-ray structure of drosophila malonogaster protein q9vr51 northeast structural genomics consortium target fr87.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
297
Chain Sequence
GDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLLAAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQKDLVNEWIKLVPNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein CG14615-PA
publication title X-RAY STRUCTURE OF DROSOPHILA MALONOGASTER PROTEIN Q9VR51 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET FR87
rcsb
source organism Drosophila melanogaster
molecule tags Structural genomics, unknown function
total genus 89
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08445 FR47 FR47-like protein
A PF18713 DUF5645 Domain of unknown function (DUF5645)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1sqhA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1sqhA02
4R57A 2REFA 4M3SA 1YVOA 2PSWA 2H5MA 4JD6A 3K9UA 3TOAA 3DDDA 3ZZIA 2JLMA 3S6HA 3CXQA 3N7ZA 3VWDA 2VQYA 1VHSA 2I00A 4JJXA 2K5TA 1LRZA 1M4GA 5IV0A 4CAWA 2QECA 2FE7A 3D3SA 2J8MA 4R87A 4IUSA 2GIVA 1RXTA 2HV2A 2B4BA 2DXQA 3PZJA 4FD4A 3FIXA 2G3TA 3D8PA 1K4JA 3NE7A 1P4NA 1UFHA 2OU2A 2OZHA 3GKRA 3T9YA 3FNCA 1XEBA 3F0AA 3DNSA 4NEXA 4AG7A 3IWGA 3CXSA 2GANA 2I79A 3TE4A 1PUAA 4LUAA 4NXYA 1V0CA 5JPHA 4QBJA 1TIQA 4X5KA 2BL1A 2B4DB 2P0WA 1CM0A 1MJBA 3E0KA 4L8AA 4MY3A 4FD6A 1IYKA 1M1DA 4KOTA 4NCZA 2B4DA 2EUIA 3F8KA 1IYLA 1IIDA 2PRBA 3LD2A 2NMTA 2OB0A 4R9MA 2HQYA 2J8NA 4MY0A 2D4PA 1S7LA 3T90A 2KCWA 4B5OA 1XE4A 4KZTA 2VEZA 1YGHA 4RS2A 4QVTA 4XNHC 2Z0ZA 4OADA 3R96A 5JQ4A 1KUVA 4CS0B 4PV6A 1XF8A 5H86A 3ZJ0A 2CNTA 2EVNA 4ZBGA 4QUSA 5E96A 2P6FA 4EVYA 1S5KA 4MBUA 1KUYA 3TOBA 4KVOE 3FRMA 1IICA 2VZZA 1S3ZA 3PGPA 2FL4A 3EFAA 4E8OA 4UA3A 2FIAA 4XPDB 4M85A 5CNPA 3FYNA 4B5PB 1ON0A 2REEA 5ISVA 2CNSA 5FVJA 4H6ZA 1J4JA 4U5YA 5EC4A 3S6FA 4B5PA 4H89A 1S60A 4GS4A 1WWZA 4KOUA 4HNWB 1Z9UA 4QB9A 1QSOA 2B58A 3SXNA 4PK2A 1YVKA 1Z4RA 5I0CA 4YGOA 3W91A 4XPKA 3PP9A 1N71A 5IX3A 1SQHA 2RC4A 3BLNA 1KUXA 3IGRA 4RI1A 2O28A 1CJWA 1YR0A 2R7HA 3KKWA 4PK3A 4MI4A 1NSLA 2OZUA 4KLWA 4BMHA 1Q2CA 4JXRA 3SXOA 4HNYB 4UWJA 3QB8A 1YREA 2ZW7A 4CAXA 1QSTA 1MK4A 1QSRA 2R1IA 2Q44A 1NE9A 3D2PA 4MHDA 2BUEA 1B87A 3MGDA 1R57A 3EXNA 1XMTA 2G0BA 2F5IA 1KZFA 5KTAA 4HKFA 4FD7A 4U9ZA 2Q0YA 3DR6A 4KVXA 2QIRA 2ZW5A 4KOSA 1S7NA 2X7BA 5DWMA 2Q04A 4AG9A 1B6BA 4II9A 1FY7A 3TO6A 3WR7A 3P2HA 3JUWA 3FBUA 3D2MA 4Y49B 3R1KA 3FB3A 3S6GA 4KUBA 4QC6A 3F5BA 2ZW6A 1YK3A 4ONUA 4AB7A 4KOWA 4E2AA 2P6EA 2G3AA 2VI7A 2PDOA 1RO5A 3S6KA 4KVME 4J3GA 1QSNA 1MJ9A 2PR1A 2FT0A 3DR8A 4OLLA 3CXPA 3W6SA 3BJ8A 3R9FA 2CY2A 4FD5A 3TT2A 4U9YA 2B3VA 2IL4A 3OWCA 4L89A 4XPLA 3R9EA 3TO7A 4CRYB 2A4NA 3EC4A 2WPWA 4XPDC 3TTHA 1I21A 1OZPA 4R3LA 2ZW4A 2ZPAA 3LODA 2GE3A 3DSBA 1Y9WA 2FS5A 5GCNA 1P0HA 2ZXVA 1MJAA 3UY5A 2JDDA 3GY9A 4NSQA 4JLYA 2Q4VA 1Q2YA 3EO4A 2VXKA 1Y9KA 2AE6A 1Q2DA 2VZYA 5F48A 3R9GA 2D4OA 1NMTA 4K30A 5F46A 4YRHA 5EBVA 2PR8A 3VWEA 1BO4A 2PQ8A 3R95A 2CNMA 2C27A 2FSRA 4PSXA 3SHPA 4IF5A 1XIXA 5F47A 4AVAA 3RYOA 4KUAA 1QSMA 1M4IA 1BOBA 2R8VA 1PU9A 2VBQA 1YLEA 2P6GA 3C26A 4NF1A 4F0YA 1VKCA 1IB1E 4I49A 5C88A 4AVCA 1Z4EA 2R98A 4LX9A 2JEVA 1I1DA 2B5GB 1U6MA 3B8GA 1S7KA 2B5GA 4PSWA 5DWNA 5HMNA 3P2FA 1YX0A 5J8FA 1L0CA 2BSWA 1I12A 4JXQA 4OAEA 1S7FA 2AJ6A 4CAVA 4KLVA 4E0AA 4DNCA 3GYAA 4KOVA 4H6UA 2Z10A 2FXFA 2B3UA 2Z11A 4Y49C 4YFJA 3H4QA 3I9SA 2PC1A 2Q4YA 5HH1A 3QAHA 5F49A 3FXTA 2JDCA 5H84A 2ARHA 5C82A 1GHEA 2ATRA 2J8RA 5J8CA 4AVBA 2Q7BA 4XNHB 2QMLA 4ORFA 4F6AA 2OH1A 4KOYA 3TO9A 3G8WA 4KOXA 2OZGA 4R3KA 3BJ7A 4KORA 4CRZB 2BEIA 3V8IA 2Y0MA 5IB0A 3TFYA 2FCKA 3EY5A 3JVNA 3TCVA 1Y7RA 4JWPA 3W6XA 1M4DA 4UBRA 1WK4A 4HNXB 5KTCA 2HUZA 1M44A 4MJ8A 4UWIA 3I3GA 3G3SA 2WPXA 5KTDA 2FIWA
chains in the Genus database with same CATH superfamily
4R57A 2Z3KA 2REFA 3IWWA 4X8IA 4MMOA 2C6CA 4M3SA 1YVOA 2GU2A 2PSWA 2Z3LA 4CYPA 2H5MA 4JD6A 3IO1A 4R8FA 2PJ5A 2ZEFA 3K9UA 3K9TA 4R6TA 3TOAA 2NYQA 3DDDA 3ZZIA 2JLMA 3S6HA 1Z2LA 2O53A 1A2ZA 3CXQA 3WC7A 3N7ZA 4AXVA 4ZI6A 3VWDA 2VQYA 1VHSA 3NA6A 2POKA 3S9NA 1CPSA 1XBUA 2IMOA 2I00A 4JJXA 2K5TA 1LRZA 3CDXA 5D8NA 1M4GA 3ISXA 4YWYA 5IV0A 1YW4A 3SI0A 5LRKA 4CAWA 4CPAA 1LCPA 2QECA 4NGRA 2FE7A 2C1CA 3D3SA 2J8MA 1ZG7A 2YNDA 4DJLA 4R87A 1F57A 4NGSA 3RZAA 3WC6A 4IUSA 2GIVA 2V8VA 4PXEA 1RXTA 2HV2A 1JWQA 2B4BA 2DXQA 2RB7A 3KQXA 3PZJA 4FD4A 4KSAA 4NGMA 5K8OA 3FIXA 2G3TA 3D8PA 1K4JA 3NE7A 4Q36A 1P4NA 1UFHA 2OU2A 2OZHA 4DYOA 3GKRA 3VATA 3T9YA 3FNCA 3H8EA 2ZEGA 5AG6A 1XEBA 3F0AA 3DNSA 4NEXA 4FAIA 4A95A 4AG7A 3GLJA 3IWGA 4UFWA 1DTDA 1AMPA 3CXSA 2EO8A 2GANA 2I79A 5K8MA 3TE4A 1PUAA 4NGQA 1AYEA 4LUAA 3CZXA 4NXYA 4OP4A 5LYLA 1V0CA 4A38A 1Z5RA 3ISZA 3PB6X 4NGTA 5JPHA 4QBJA 1TIQA 4X5KA 3D7GA 3FJUA 2BL1A 2B4DB 2P0WA 1CM0A 1MJBA 3E0KA 4L8AA 4MY3A 5G20A 5LYDA 1XMBA 1IYKA 1HEEA 1M1DA 3HLPA 4FD6A 4KOTA 4EWTA 4NCZA 2B4DA 2V8GA 2ANPA 2EUIA 3F8KA 1IYLA 4TNUA 4O23A 1IIDA 5BWAB 2PJ9A 1HDUA 2PRBA 3LD2A 4Z65A 1X10A 2NMTA 2OB0A 1XRYA 4R9MA 4UCMA 4MCSA 3D68A 3IWEA 2C6PA 3I1UA 1TKFA 2HQYA 2J8NA 3H8FA 4UEEA 6CPAA 3PEIA 4MY0A 2D4PA 5HXDA 1S7LA 3B3CA 4KS9A 3T90A 2V8HA 2KCWA 3KHXA 4NGNA 1IOIA 3VARA 4B5OA 1YQEA 4ZYQA 3WC5A 1XE4A 3B3WA 4B6ZA 4MHYA 2DEAA 4KZTA 2G9DA 3LMSA 4WJBA 2VEZA 5D29A 1H8LA 1TKHA 1XJOA 1YGHA 4OIDA 2YNEA 4QVTA 4RS2A 4XNHC 2Z0ZA 4Q38A 5JGFA 1Z8XA 2XEGA 1PCAA 4OADA 3R96A 5JQ4A 1KUVA 4CS0B 4PV6A 4P10A 2F8HA 2EK9A 3B35A 1XF8A 4Q7AA 1VIXA 3PB4X 2PJ4A 1XOVA 5H86A 3NH5A 1BPNA 4OIWA 3ZJ0A 2BCOA 2CNTA 3FEEA 4UFVA 5AGEA 1VHOA 2PJ8A 3JTKA 2EVNA 4B14A 4ZBGA 4QUSA 4YU9A 2P6FA 5E96A 4EVYA 2Q51A 3B7IA 5LRGA 2XEIA 3NH8A 1S5KA 4MBUA 1KUYA 3TOBA 4F0XA 4KVOE 2ZOGA 2PVVA 3FRMA 1IICA 5AG5A 2VZZA 2QJ8A 5HVFA 3KQZA 1S3ZA 3BHXA 1CBXA 4ZGYB 3PGPA 2FL4A 3EFAA 1M4LA 4F9UA 4E8OA 4UA3A 1ARMA 2FIAA 4XPDB 4M85A 5CNPA 1R43A 3KHZA 5G21A 1CPXA 3FYNA 4B5PB 1ON0A 2REEA 5ISVA 2CNSA 5FVJA 4H6ZA 1J4JA 4X2TA 1IY7A 4U5YA 2HC9A 5EC4A 3S6FA 1LAPA 4LQGA 4B5PA 4H89A 1S60A 4GS4A 2PJ6A 1WWZA 3IJ3A 3LACA 3MN8A 3KI9A 4KOUA 4MFLA 4HNWB 1Z9UA 3BXMA 4PXDA 4QB9A 5G1ZA 1QSOA 2B58A 2I3CA 3SXNA 2GLFA 1YLOA 4PK2A 2WYRA 1YVKA 4OC2A 1IU8A 1LFWA 1VHEA 1Z4RA 1AUGA 1IOFA 5I0CA 3SI1A 4MCQA 2QYVA 4HPSA 4YGOA 3A9LA 3B3SA 3W91A 4MXUA 4XPKA 3WT4A 3PP9A 3RAMA 1N71A 4CAEA 3PB8X 5IX3A 1SQHA 3LWUA 2RC4A 4RN7A 3BLNA 2ZEDA 3IEHA 1KUXA 3IGRA 2RFHA 4RI1A 2O28A 3CPXA 1CJWA 1YR0A 2R7HA 3KKWA 4OC0A 4MI4A 4PK3A 3HUVA 4R7MA 4F8ZA 1RTQA 1NSLA 2OZUA 2Z3PA 3IIBA 3TX8A 1Y0YA 1HDQA 4A31A 3B3VA 4MHPA 2Q4ZA 4P44A 5LYIA 5JH9A 2BO9A 1ARLA 4TWEA 2JBKA 3NH4A 4KLWA 4BMHA 1Q2CA 1ZG9A 2AFMA 4JXRA 4OC1A 3WABA 3SXOA 4HNYB 4UWJA 3QB8A 1YREA 4OMEA 4CAFA 2ZW7A 2ODFA 1JQGA 4B13A 4UFXA 4MFPA 4PPZA 1QSTA 4CAXA 4PXCA 1MK4A 1ZG8A 2C6GA 1QSRA 2R1IA 4W9YA 4ZY0A 4ZY1A 2ZEMA 2Q44A 5HVGA 1NE9A 3D2PA 3FH4A 2FVGA 4CGMA 7CPAA 4MHDA 2BUEA 1B87A 3MGDA 4LQ6A 4X3RA 3S9MA 8CPAA 3FECA 3D7FA 4C2XA 1R57A 5A28A 3EXNA 4H2KA 1XMTA 2G0BA 2F5IA 1KZFA 2ZEHA 4ZY2A 1TF8A 5KTAA 2JBJA 3D67A 1QMUA 4FD7A 4HKFA 4P4DA 2ZEEA 4P4JA 2Q0YA 3DR6A 4U9ZA 4M6IA 4KVXA 2QIRA 2GREA 2ZW5A 1IGBA 1S7NA 3D7DA 4IAVA 4KOSA 4JYWA 3SJEA 4DUKA 2X7BA 5DWMA 2Q04A 4AG9A 4P4EA 1B6BA 3IFEA 3B3TA 1KWMA 2DPTA 4UCPA 3RO0A 4M6HA 4II9A 2WSAA 5ELYA 1FY7A 2J9AA 3FX6A 3L2NA 3TO6A 3WR7A 3P2HA 4MCRA 3JUWA 3FBUA 3D2MA 4Y49B 3R1KA 3FB3A 2ZEOA 3H5ZA 2AFZA 1ZO0A 3IC1A 4KUBA 1F2OA 3GUXA 4QC6A 3F5BA 4CGLA 4BINA 3NE8A 3V38A 1OBRA 2ZW6A 4P45A 1BLLE 1YK3A 4ONUA 4AB7A 4KOWA 4E2AA 2ZENA 2P6EA 2G3AA 2VI7A 3TC8A 2PIYA 3D66A 2PDOA 1ELMP 1RO5A 3S6KA 4KVME 5F09A 2XEFA 3KZWA 4J3GA 1QSNA 3QAYA 1MJ9A 1CG2A 2PR1A 4MRIA 2FT0A 3RNZA 5THWA 2AFSA 2Z3MA 3DR8A 4PQAA 3V7ZA 4GXHA 4EFDA 4OLLA 2CIJA 1ELLP 1CP6A 3CXPA 3FF3A 3W6SA 4CGOA 2PE3A 3BJ8A 3R9FA 2CY2A 1ZLHA 1TXRA 4FD5A 4G1PA 1Z8LA 2QVPA 4A94A 3TT2A 2AFOA 4U9YA 3SJXA 2YGWA 3KR4A 3SJGA 4UIBA 2B3VA 2IL4A 3OWCA 4L89A 4XPLA 3R9EA 3TO7A 1DE4C 2A4NA 4IK2A 4CRYB 2PVWA 3PBBA 3EC4A 2WPWA 4XPDC 2WZNA 3TTHA 1I21A 1OZPA 4R3LA 1Y0RA 2ZW4A 2ZPAA 1LOKA 2WUUA 2GE3A 3LODA 3DSBA 1FT7A 1Y9WA 1ZLIA 1XFOA 2FS5A 5GCNA 3IU1A 2DF5A 1P0HA 3VH9A 2ZXVA 4KSFA 4P4FA 1MJAA 3UY5A 2JDDA 3GY9A 2EBJA 4NSQA 4ONWA 5A27A 4JLYA 2Q4VA 3PFOA 5K8NA 2AFUA 4K3NA 1Q2YA 3EO4A 4MCPA 1NSAA 1Y9KA 2VXKA 1EE3P 3KR5A 4MFZA 2AE6A 4KSIA 1Q2DA 2VZYA 1Z8TA 5F48A 3R9GA 2OOTA 4CYOA 2D4OA 1NMTA 4K30A 5F46A 3PRTA 4YRHA 5EBVA 2PR8A 3VWEA 1BAVA 1BO4A 3JRUA 5K8PA 2PQ8A 4OC4A 2PCUA 3R95A 1TKJA 2CNMA 3SI2A 4BBHA 3DLJA 2C27A 2FSRA 4PSXA 2ZELA 4IF5A 1XIXA 5F47A 3SHPA 4AVAA 3RYOA 4WWVA 4KUAA 4P4BA 3NFZA 3SJFA 1QSMA 1M4IA 4BD9A 5J1QA 1BOBA 2R8VA 2EWBA 4FBEA 1PU9A 2VBQA 2ABZA 1LANA 1YLEA 2P6GA 3C26A 3KL9A 3PB9X 1VKCA 1IB1E 4I49A 4NF1A 4F0YA 5C88A 4AVCA 2NSMA 2O4HA 2IJZA 3B2YA 3D7HA 2PJ1A 2PIZA 4C68A 2PJ2A 1Z4EA 2R98A 4LX9A 4A30A 4EMEA 2JEVA 5EMIA 1I1DA 5LRJA 4A2ZA 4F9VA 1BPMA 1VGYA 2B5GB 1Z8WA 1U6MA 4M6GA 1CP7A 3B8GA 2DPSA 4ZX9A 3S6GA 3CT9A 1S7KA 2B5GA 4PSWA 5I4MA 5DWNA 5HMNA 4CGPA 3P2FA 2CF4A 3T8WA 3FEDA 1YX0A 2Z3OA 3PFEA 2CTCA 2PJAA 5DS0A 2F7VA 1PYTB 3D4UA 1X12A 1CX8A 5J8FA 4B12A 1L0CA 4A33A 1TF9A 2XEJA 2BSWA 1I12A 4JXQA 4OAEA 4A39A 1S7FA 5LYFA 1LAMA 1YMEA 2AJ6A 4IHMA 2VL1A 4KLVA 2OR4A 4R76A 4CAVA 4GM5A 3RBUA 4E0AA 4DNCA 5IB9A 3GYAA 4H6UA 4KOVA 2Z10A 2FXFA 2B3UA 2Z11A 2PJ3A 4NJRA 4Y49C 2HB6A 4YFJA 3H4QA 3I9SA 2GFQA 2PC1A 2Q4YA 2BOAA 4CYNA 5JM6A 2CTBA 1GYTA 2IQ6A 5HH1A 2PJBA 3QAHA 4NGPA 4A37A 5F49A 4C2YA 3FXTA 2JDCA 3N5FA 4C7IA 5H84A 4CGNA 3PB7X 2ARHA 3KASA 3S9LA 3MRUA 5C82A 1GHEA 2ATRA 4UCNA 3FVLA 4NFRA 5HVHA 3K2KA 2PJCA 2J8RA 2Q7SA 4UIAA 4C2ZA 5J8CA 4AVBA 2Z3NA 2JEWA 2GLJA 2Q7BA 2AFXA 4MFJA 4OC5A 2QMLA 3KGQA 4XNHB 4B10A 4ORFA 4B11A 5AG4A 4CYQA 4F6AA 4OC3A 1QQ9A 3QNVA 3PBEA 2YNCC 1FNOA 1YW6A 2OH1A 4KOYA 3TO9A 3G8WA 4KOXA 2OZGA 1R3NA 4R3KA 2YNCA 3BI1A 2ZEPA 3BJ7A 4KORA 4JZ0A 4CRZB 2BEIA 4RUHA 2AFWA 4FUUA 1F2PA 4MFKA 1Y7EA 2PRQA 4P4IA 4MHZA 3V8IA 2Y0MA 3GIUA 5IB0A 3TFYA 3FMCA 5CBMA 2FCKA 3EY5A 3JVNA 2CXAA 4PXBA 4UEZA 5AG7A 4ZX8A 3BI0A 3TCVA 1Y7RA 4A32A 4JWPA 4FWUA 1YSJA 3W6XA 1M4DA 4UF4A 4UBRA 3IU2A 1Q7LA 1WK4A 4C7HA 4HNXB 2PJ7A 5CPAA 2HUZA 3H8GA 1M44A 3GB0A 5G22A 1UWYA 5KTCA 2PJ0A 4MFQA 4P6YA 3DGVA 2Q43A 2V77A 4MHNA 4MJ8A 4NJQA 4OKOA 4UWIA 3CPAA 3I3GA 3G3SA 2WPXA 5KTDA 2V8DA 4UEFA 2FIWA 2EK8A 2ZOFA
chains in the Genus database with same CATH topology
4R57A 2Z3KA 2REFA 4M3SA 1YVOA 2Z3LA 2PSWA 4CYPA 2H5MA 4JD6A 3K9UA 3TOAA 3DDDA 3ZZIA 2JLMA 3S6HA 3CXQA 3N7ZA 3VWDA 2VQYA 1VHSA 2I00A 4JJXA 2K5TA 1LRZA 1M4GA 5IV0A 4CAWA 2QECA 2FE7A 3D3SA 2J8MA 2YNDA 4R87A 4IUSA 2GIVA 1RXTA 2HV2A 2B4BA 2DXQA 4KSAA 3PZJA 4FD4A 3FIXA 2G3TA 3D8PA 1K4JA 3NE7A 4Q36A 1P4NA 1UFHA 2OU2A 2OZHA 3GKRA 3T9YA 3FNCA 5AG6A 1XEBA 3F0AA 3DNSA 4NEXA 4A95A 4AG7A 3IWGA 4UFWA 3CXSA 2GANA 2I79A 3TE4A 1PUAA 4LUAA 4NXYA 1V0CA 5JPHA 4QBJA 1TIQA 4X5KA 2BL1A 2B4DB 2P0WA 1CM0A 1MJBA 3E0KA 4L8AA 4MY3A 5G20A 4FD6A 1IYKA 1M1DA 4KOTA 4NCZA 2B4DA 2EUIA 3F8KA 1IYLA 1IIDA 5BWAB 2PRBA 3LD2A 2NMTA 2OB0A 4R9MA 4UCMA 3IWEA 2HQYA 2J8NA 4MY0A 2D4PA 1S7LA 4KS9A 3T90A 2KCWA 4B5OA 1XE4A 4KZTA 2VEZA 1YGHA 4RS2A 4QVTA 2YNEA 4XNHC 2Z0ZA 4Q38A 4OADA 3R96A 5JQ4A 1KUVA 4CS0B 4PV6A 1XF8A 5H86A 3ZJ0A 2CNTA 5AGEA 4UFVA 3JTKA 2EVNA 4B14A 4ZBGA 4QUSA 5E96A 2P6FA 4EVYA 4F0XA 1S5KA 4MBUA 1KUYA 3TOBA 4KVOE 3FRMA 1IICA 5AG5A 2VZZA 1S3ZA 4ZGYB 3PGPA 2FL4A 3EFAA 4E8OA 4UA3A 2FIAA 4XPDB 4M85A 5CNPA 5G21A 3FYNA 4B5PB 1ON0A 2REEA 5ISVA 2CNSA 5FVJA 4H6ZA 1J4JA 4U5YA 5EC4A 3S6FA 4B5PA 4H89A 1S60A 4GS4A 1WWZA 4MFLA 4KOUA 4HNWB 1Z9UA 4QB9A 5G1ZA 1QSOA 2B58A 3SXNA 4PK2A 1YVKA 1Z4RA 5I0CA 4YGOA 3A9LA 3W91A 4XPKA 3PP9A 1N71A 4CAEA 5IX3A 1SQHA 2RC4A 3BLNA 1KUXA 3IGRA 4RI1A 2O28A 1CJWA 1YR0A 2R7HA 3KKWA 4PK3A 4MI4A 1NSLA 2OZUA 2Z3PA 4A31A 4KLWA 4BMHA 1Q2CA 4JXRA 3SXOA 4HNYB 4UWJA 3QB8A 1YREA 4CAFA 2ZW7A 4B13A 4UFXA 4MFPA 4CAXA 1QSTA 1MK4A 1QSRA 2R1IA 2Q44A 1NE9A 3D2PA 4CGMA 4MHDA 2BUEA 1B87A 3MGDA 4C2XA 1R57A 5A28A 3EXNA 1XMTA 2G0BA 2F5IA 1KZFA 5KTAA 4HKFA 4FD7A 4U9ZA 2Q0YA 3DR6A 4KVXA 2QIRA 2ZW5A 4KOSA 1S7NA 2X7BA 5DWMA 2Q04A 4AG9A 1B6BA 2DPTA 4UCPA 4II9A 2WSAA 1FY7A 3TO6A 3WR7A 3P2HA 3JUWA 3FBUA 3D2MA 4Y49B 3R1KA 3FB3A 3H5ZA 3S6GA 1ZO0A 4KUBA 4CGLA 4QC6A 3F5BA 2ZW6A 1YK3A 4ONUA 4AB7A 4KOWA 4E2AA 2P6EA 2G3AA 2VI7A 2PDOA 1RO5A 3S6KA 4KVME 4J3GA 1QSNA 1MJ9A 2PR1A 2FT0A 2Z3MA 3DR8A 4OLLA 4CGOA 3CXPA 3W6SA 3BJ8A 3R9FA 2CY2A 4FD5A 3TT2A 4U9YA 2YGWA 2B3VA 2IL4A 3OWCA 4L89A 4XPLA 3R9EA 3TO7A 4CRYB 2A4NA 3EC4A 2WPWA 4XPDC 3TTHA 1I21A 1OZPA 4R3LA 2ZW4A 2ZPAA 2WUUA 3LODA 2GE3A 3DSBA 1Y9WA 2FS5A 5GCNA 3IU1A 1P0HA 2ZXVA 4KSFA 1MJAA 3UY5A 2JDDA 3GY9A 4NSQA 5A27A 4JLYA 2Q4VA 1Q2YA 3EO4A 2VXKA 1Y9KA 4MFZA 2AE6A 1Q2DA 2VZYA 5F48A 3R9GA 4CYOA 2D4OA 1NMTA 4K30A 5F46A 4YRHA 5EBVA 2PR8A 3VWEA 1BO4A 2PQ8A 3R95A 2CNMA 4BBHA 2C27A 2FSRA 4PSXA 3SHPA 4IF5A 1XIXA 5F47A 4AVAA 3RYOA 4KUAA 1QSMA 1M4IA 1BOBA 2R8VA 1PU9A 2VBQA 1YLEA 2P6GA 3C26A 4NF1A 4F0YA 1VKCA 1IB1E 4I49A 5C88A 4AVCA 4C68A 1Z4EA 2R98A 4LX9A 4A30A 2JEVA 1I1DA 4A2ZA 2B5GB 1U6MA 3B8GA 2DPSA 1S7KA 2B5GA 4PSWA 5DWNA 5HMNA 4CGPA 3P2FA 1YX0A 2Z3OA 5J8FA 4B12A 1L0CA 4A33A 2BSWA 1I12A 4JXQA 4OAEA 1S7FA 2AJ6A 4CAVA 4KLVA 4E0AA 4DNCA 3GYAA 4H6UA 4KOVA 2Z10A 2FXFA 2B3UA 2Z11A 4Y49C 4YFJA 3H4QA 3I9SA 2PC1A 2Q4YA 4CYNA 5HH1A 3QAHA 5F49A 4C2YA 3FXTA 2JDCA 4C7IA 5H84A 4CGNA 2ARHA 5C82A 1GHEA 2ATRA 4UCNA 2J8RA 4C2ZA 5J8CA 4AVBA 2Z3NA 2Q7BA 4MFJA 4XNHB 2QMLA 4B10A 4B11A 4ORFA 5AG4A 4CYQA 4F6AA 2YNCC 2OH1A 4KOYA 3TO9A 3G8WA 4KOXA 2OZGA 4R3KA 2YNCA 3BJ7A 4KORA 4CRZB 2BEIA 4MFKA 3V8IA 2Y0MA 5IB0A 3TFYA 2FCKA 3EY5A 3JVNA 2CXAA 5AG7A 3TCVA 1Y7RA 4A32A 4JWPA 3W6XA 1M4DA 4UBRA 3IU2A 1WK4A 4C7HA 4HNXB 5KTCA 2HUZA 1M44A 5G22A 4MFQA 4MJ8A 4UWIA 3I3GA 3G3SA 2WPXA 5KTDA 2FIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R57 A;  2REF A;  4M3S A;  1YVO A;  2PSW A;  2H5M A;  4JD6 A;  3K9U A;  3TOA A;  3DDD A;  3ZZI A;  2JLM A;  3S6H A;  3CXQ A;  3N7Z A;  3VWD A;  2VQY A;  1VHS A;  2I00 A;  4JJX A;  2K5T A;  1LRZ A;  1M4G A;  5IV0 A;  4CAW A;  2QEC A;  2FE7 A;  3D3S A;  2J8M A;  4R87 A;  4IUS A;  2GIV A;  1RXT A;  2HV2 A;  2B4B A;  2DXQ A;  3PZJ A;  4FD4 A;  3FIX A;  2G3T A;  3D8P A;  1K4J A;  3NE7 A;  1P4N A;  1UFH A;  2OU2 A;  2OZH A;  3GKR A;  3T9Y A;  3FNC A;  1XEB A;  3F0A A;  3DNS A;  4NEX A;  4AG7 A;  3IWG A;  3CXS A;  2GAN A;  2I79 A;  3TE4 A;  1PUA A;  4LUA A;  4NXY A;  1V0C A;  5JPH A;  4QBJ A;  1TIQ A;  4X5K A;  2BL1 A;  2B4D B;  2P0W A;  1CM0 A;  1MJB A;  3E0K A;  4L8A A;  4MY3 A;  4FD6 A;  1IYK A;  1M1D A;  4KOT A;  4NCZ A;  2B4D A;  2EUI A;  3F8K A;  1IYL A;  1IID A;  2PRB A;  3LD2 A;  2NMT A;  2OB0 A;  4R9M A;  2HQY A;  2J8N A;  4MY0 A;  2D4P A;  1S7L A;  3T90 A;  2KCW A;  4B5O A;  1XE4 A;  4KZT A;  2VEZ A;  1YGH A;  4RS2 A;  4QVT A;  4XNH C;  2Z0Z A;  4OAD A;  3R96 A;  5JQ4 A;  1KUV A;  4CS0 B;  4PV6 A;  1XF8 A;  5H86 A;  3ZJ0 A;  2CNT A;  2EVN A;  4ZBG A;  4QUS A;  5E96 A;  2P6F A;  4EVY A;  1S5K A;  4MBU A;  1KUY A;  3TOB A;  4KVO E;  3FRM A;  1IIC A;  2VZZ A;  1S3Z A;  3PGP A;  2FL4 A;  3EFA A;  4E8O A;  4UA3 A;  2FIA A;  4XPD B;  4M85 A;  5CNP A;  3FYN A;  4B5P B;  1ON0 A;  2REE A;  5ISV A;  2CNS A;  5FVJ A;  4H6Z A;  1J4J A;  4U5Y A;  5EC4 A;  3S6F A;  4B5P A;  4H89 A;  1S60 A;  4GS4 A;  1WWZ A;  4KOU A;  4HNW B;  1Z9U A;  4QB9 A;  1QSO A;  2B58 A;  3SXN A;  4PK2 A;  1YVK A;  1Z4R A;  5I0C A;  4YGO A;  3W91 A;  4XPK A;  3PP9 A;  1N71 A;  5IX3 A;  1SQH A;  2RC4 A;  3BLN A;  1KUX A;  3IGR A;  4RI1 A;  2O28 A;  1CJW A;  1YR0 A;  2R7H A;  3KKW A;  4PK3 A;  4MI4 A;  1NSL A;  2OZU A;  4KLW A;  4BMH A;  1Q2C A;  4JXR A;  3SXO A;  4HNY B;  4UWJ A;  3QB8 A;  1YRE A;  2ZW7 A;  4CAX A;  1QST A;  1MK4 A;  1QSR A;  2R1I A;  2Q44 A;  1NE9 A;  3D2P A;  4MHD A;  2BUE A;  1B87 A;  3MGD A;  1R57 A;  3EXN A;  1XMT A;  2G0B A;  2F5I A;  1KZF A;  5KTA A;  4HKF A;  4FD7 A;  4U9Z A;  2Q0Y A;  3DR6 A;  4KVX A;  2QIR A;  2ZW5 A;  4KOS A;  1S7N A;  2X7B A;  5DWM A;  2Q04 A;  4AG9 A;  1B6B A;  4II9 A;  1FY7 A;  3TO6 A;  3WR7 A;  3P2H A;  3JUW A;  3FBU A;  3D2M A;  4Y49 B;  3R1K A;  3FB3 A;  3S6G A;  4KUB A;  4QC6 A;  3F5B A;  2ZW6 A;  1YK3 A;  4ONU A;  4AB7 A;  4KOW A;  4E2A A;  2P6E A;  2G3A A;  2VI7 A;  2PDO A;  1RO5 A;  3S6K A;  4KVM E;  4J3G A;  1QSN A;  1MJ9 A;  2PR1 A;  2FT0 A;  3DR8 A;  4OLL A;  3CXP A;  3W6S A;  3BJ8 A;  3R9F A;  2CY2 A;  4FD5 A;  3TT2 A;  4U9Y A;  2B3V A;  2IL4 A;  3OWC A;  4L89 A;  4XPL A;  3R9E A;  3TO7 A;  4CRY B;  2A4N A;  3EC4 A;  2WPW A;  4XPD C;  3TTH A;  1I21 A;  1OZP A;  4R3L A;  2ZW4 A;  2ZPA A;  3LOD A;  2GE3 A;  3DSB A;  1Y9W A;  2FS5 A;  5GCN A;  1P0H A;  2ZXV A;  1MJA A;  3UY5 A;  2JDD A;  3GY9 A;  4NSQ A;  4JLY A;  2Q4V A;  1Q2Y A;  3EO4 A;  2VXK A;  1Y9K A;  2AE6 A;  1Q2D A;  2VZY A;  5F48 A;  3R9G A;  2D4O A;  1NMT A;  4K30 A;  5F46 A;  4YRH A;  5EBV A;  2PR8 A;  3VWE A;  1BO4 A;  2PQ8 A;  3R95 A;  2CNM A;  2C27 A;  2FSR A;  4PSX A;  3SHP A;  4IF5 A;  1XIX A;  5F47 A;  4AVA A;  3RYO A;  4KUA A;  1QSM A;  1M4I A;  1BOB A;  2R8V A;  1PU9 A;  2VBQ A;  1YLE A;  2P6G A;  3C26 A;  4NF1 A;  4F0Y A;  1VKC A;  1IB1 E;  4I49 A;  5C88 A;  4AVC A;  1Z4E A;  2R98 A;  4LX9 A;  2JEV A;  1I1D A;  2B5G B;  1U6M A;  3B8G A;  1S7K A;  2B5G A;  4PSW A;  5DWN A;  5HMN A;  3P2F A;  1YX0 A;  5J8F A;  1L0C A;  2BSW A;  1I12 A;  4JXQ A;  4OAE A;  1S7F A;  2AJ6 A;  4CAV A;  4KLV A;  4E0A A;  4DNC A;  3GYA A;  4KOV A;  4H6U A;  2Z10 A;  2FXF A;  2B3U A;  2Z11 A;  4Y49 C;  4YFJ A;  3H4Q A;  3I9S A;  2PC1 A;  2Q4Y A;  5HH1 A;  3QAH A;  5F49 A;  3FXT A;  2JDC A;  5H84 A;  2ARH A;  5C82 A;  1GHE A;  2ATR A;  2J8R A;  5J8C A;  4AVB A;  2Q7B A;  4XNH B;  2QML A;  4ORF A;  4F6A A;  2OH1 A;  4KOY A;  3TO9 A;  3G8W A;  4KOX A;  2OZG A;  4R3K A;  3BJ7 A;  4KOR A;  4CRZ B;  2BEI A;  3V8I A;  2Y0M A;  5IB0 A;  3TFY A;  2FCK A;  3EY5 A;  3JVN A;  3TCV A;  1Y7R A;  4JWP A;  3W6X A;  1M4D A;  4UBR A;  1WK4 A;  4HNX B;  5KTC A;  2HUZ A;  1M44 A;  4MJ8 A;  4UWI A;  3I3G A;  3G3S A;  2WPX A;  5KTD A;  2FIW A; 
#chains in the Genus database with same CATH topology
 4R57 A;  2Z3K A;  2REF A;  3IWW A;  4X8I A;  4MMO A;  2C6C A;  4M3S A;  1YVO A;  2GU2 A;  2PSW A;  2Z3L A;  4CYP A;  2H5M A;  4JD6 A;  3IO1 A;  4R8F A;  2PJ5 A;  2ZEF A;  3K9U A;  3K9T A;  4R6T A;  3TOA A;  2NYQ A;  3DDD A;  3ZZI A;  2JLM A;  3S6H A;  1Z2L A;  2O53 A;  1A2Z A;  3CXQ A;  3WC7 A;  3N7Z A;  4AXV A;  4ZI6 A;  3VWD A;  2VQY A;  1VHS A;  3NA6 A;  2POK A;  3S9N A;  1CPS A;  1XBU A;  2IMO A;  2I00 A;  4JJX A;  2K5T A;  1LRZ A;  3CDX A;  5D8N A;  1M4G A;  3ISX A;  4YWY A;  5IV0 A;  1YW4 A;  3SI0 A;  5LRK A;  4CAW A;  4CPA A;  1LCP A;  2QEC A;  4NGR A;  2FE7 A;  2C1C A;  3D3S A;  2J8M A;  1ZG7 A;  2YND A;  4DJL A;  4R87 A;  1F57 A;  4NGS A;  3RZA A;  3WC6 A;  4IUS A;  2GIV A;  2V8V A;  4PXE A;  1RXT A;  2HV2 A;  1JWQ A;  2B4B A;  2DXQ A;  2RB7 A;  3KQX A;  3PZJ A;  4FD4 A;  4KSA A;  4NGM A;  5K8O A;  3FIX A;  2G3T A;  3D8P A;  1K4J A;  3NE7 A;  4Q36 A;  1P4N A;  1UFH A;  2OU2 A;  2OZH A;  4DYO A;  3GKR A;  3VAT A;  3T9Y A;  3FNC A;  3H8E A;  2ZEG A;  5AG6 A;  1XEB A;  3F0A A;  3DNS A;  4NEX A;  4FAI A;  4A95 A;  4AG7 A;  3GLJ A;  3IWG A;  4UFW A;  1DTD A;  1AMP A;  3CXS A;  2EO8 A;  2GAN A;  2I79 A;  5K8M A;  3TE4 A;  1PUA A;  4NGQ A;  1AYE A;  4LUA A;  3CZX A;  4NXY A;  4OP4 A;  5LYL A;  1V0C A;  4A38 A;  1Z5R A;  3ISZ A;  3PB6 X;  4NGT A;  5JPH A;  4QBJ A;  1TIQ A;  4X5K A;  3D7G A;  3FJU A;  2BL1 A;  2B4D B;  2P0W A;  1CM0 A;  1MJB A;  3E0K A;  4L8A A;  4MY3 A;  5G20 A;  5LYD A;  1XMB A;  1IYK A;  1HEE A;  1M1D A;  3HLP A;  4FD6 A;  4KOT A;  4EWT A;  4NCZ A;  2B4D A;  2V8G A;  2ANP A;  2EUI A;  3F8K A;  1IYL A;  4TNU A;  4O23 A;  1IID A;  5BWA B;  2PJ9 A;  1HDU A;  2PRB A;  3LD2 A;  4Z65 A;  1X10 A;  2NMT A;  2OB0 A;  1XRY A;  4R9M A;  4UCM A;  4MCS A;  3D68 A;  3IWE A;  2C6P A;  3I1U A;  1TKF A;  2HQY A;  2J8N A;  3H8F A;  4UEE A;  6CPA A;  3PEI A;  4MY0 A;  2D4P A;  5HXD A;  1S7L A;  3B3C A;  4KS9 A;  3T90 A;  2V8H A;  2KCW A;  3KHX A;  4NGN A;  1IOI A;  3VAR A;  4B5O A;  1YQE A;  4ZYQ A;  3WC5 A;  1XE4 A;  3B3W A;  4B6Z A;  4MHY A;  2DEA A;  4KZT A;  2G9D A;  3LMS A;  4WJB A;  2VEZ A;  5D29 A;  1H8L A;  1TKH A;  1XJO A;  1YGH A;  4OID A;  2YNE A;  4QVT A;  4RS2 A;  4XNH C;  2Z0Z A;  4Q38 A;  5JGF A;  1Z8X A;  2XEG A;  1PCA A;  4OAD A;  3R96 A;  5JQ4 A;  1KUV A;  4CS0 B;  4PV6 A;  4P10 A;  2F8H A;  2EK9 A;  3B35 A;  1XF8 A;  4Q7A A;  1VIX A;  3PB4 X;  2PJ4 A;  1XOV A;  5H86 A;  3NH5 A;  1BPN A;  4OIW A;  3ZJ0 A;  2BCO A;  2CNT A;  3FEE A;  4UFV A;  5AGE A;  1VHO A;  2PJ8 A;  3JTK A;  2EVN A;  4B14 A;  4ZBG A;  4QUS A;  4YU9 A;  2P6F A;  5E96 A;  4EVY A;  2Q51 A;  3B7I A;  5LRG A;  2XEI A;  3NH8 A;  1S5K A;  4MBU A;  1KUY A;  3TOB A;  4F0X A;  4KVO E;  2ZOG A;  2PVV A;  3FRM A;  1IIC A;  5AG5 A;  2VZZ A;  2QJ8 A;  5HVF A;  3KQZ A;  1S3Z A;  3BHX A;  1CBX A;  4ZGY B;  3PGP A;  2FL4 A;  3EFA A;  1M4L A;  4F9U A;  4E8O A;  4UA3 A;  1ARM A;  2FIA A;  4XPD B;  4M85 A;  5CNP A;  1R43 A;  3KHZ A;  5G21 A;  1CPX A;  3FYN A;  4B5P B;  1ON0 A;  2REE A;  5ISV A;  2CNS A;  5FVJ A;  4H6Z A;  1J4J A;  4X2T A;  1IY7 A;  4U5Y A;  2HC9 A;  5EC4 A;  3S6F A;  1LAP A;  4LQG A;  4B5P A;  4H89 A;  1S60 A;  4GS4 A;  2PJ6 A;  1WWZ A;  3IJ3 A;  3LAC A;  3MN8 A;  3KI9 A;  4KOU A;  4MFL A;  4HNW B;  1Z9U A;  3BXM A;  4PXD A;  4QB9 A;  5G1Z A;  1QSO A;  2B58 A;  2I3C A;  3SXN A;  2GLF A;  1YLO A;  4PK2 A;  2WYR A;  1YVK A;  4OC2 A;  1IU8 A;  1LFW A;  1VHE A;  1Z4R A;  1AUG A;  1IOF A;  5I0C A;  3SI1 A;  4MCQ A;  2QYV A;  4HPS A;  4YGO A;  3A9L A;  3B3S A;  3W91 A;  4MXU A;  4XPK A;  3WT4 A;  3PP9 A;  3RAM A;  1N71 A;  4CAE A;  3PB8 X;  5IX3 A;  1SQH A;  3LWU A;  2RC4 A;  4RN7 A;  3BLN A;  2ZED A;  3IEH A;  1KUX A;  3IGR A;  2RFH A;  4RI1 A;  2O28 A;  3CPX A;  1CJW A;  1YR0 A;  2R7H A;  3KKW A;  4OC0 A;  4MI4 A;  4PK3 A;  3HUV A;  4R7M A;  4F8Z A;  1RTQ A;  1NSL A;  2OZU A;  2Z3P A;  3IIB A;  3TX8 A;  1Y0Y A;  1HDQ A;  4A31 A;  3B3V A;  4MHP A;  2Q4Z A;  4P44 A;  5LYI A;  5JH9 A;  2BO9 A;  1ARL A;  4TWE A;  2JBK A;  3NH4 A;  4KLW A;  4BMH A;  1Q2C A;  1ZG9 A;  2AFM A;  4JXR A;  4OC1 A;  3WAB A;  3SXO A;  4HNY B;  4UWJ A;  3QB8 A;  1YRE A;  4OME A;  4CAF A;  2ZW7 A;  2ODF A;  1JQG A;  4B13 A;  4UFX A;  4MFP A;  4PPZ A;  1QST A;  4CAX A;  4PXC A;  1MK4 A;  1ZG8 A;  2C6G A;  1QSR A;  2R1I A;  4W9Y A;  4ZY0 A;  4ZY1 A;  2ZEM A;  2Q44 A;  5HVG A;  1NE9 A;  3D2P A;  3FH4 A;  2FVG A;  4CGM A;  7CPA A;  4MHD A;  2BUE A;  1B87 A;  3MGD A;  4LQ6 A;  4X3R A;  3S9M A;  8CPA A;  3FEC A;  3D7F A;  4C2X A;  1R57 A;  5A28 A;  3EXN A;  4H2K A;  1XMT A;  2G0B A;  2F5I A;  1KZF A;  2ZEH A;  4ZY2 A;  1TF8 A;  5KTA A;  2JBJ A;  3D67 A;  1QMU A;  4FD7 A;  4HKF A;  4P4D A;  2ZEE A;  4P4J A;  2Q0Y A;  3DR6 A;  4U9Z A;  4M6I A;  4KVX A;  2QIR A;  2GRE A;  2ZW5 A;  1IGB A;  1S7N A;  3D7D A;  4IAV A;  4KOS A;  4JYW A;  3SJE A;  4DUK A;  2X7B A;  5DWM A;  2Q04 A;  4AG9 A;  4P4E A;  1B6B A;  3IFE A;  3B3T A;  1KWM A;  2DPT A;  4UCP A;  3RO0 A;  4M6H A;  4II9 A;  2WSA A;  5ELY A;  1FY7 A;  2J9A A;  3FX6 A;  3L2N A;  3TO6 A;  3WR7 A;  3P2H A;  4MCR A;  3JUW A;  3FBU A;  3D2M A;  4Y49 B;  3R1K A;  3FB3 A;  2ZEO A;  3H5Z A;  2AFZ A;  1ZO0 A;  3IC1 A;  4KUB A;  1F2O A;  3GUX A;  4QC6 A;  3F5B A;  4CGL A;  4BIN A;  3NE8 A;  3V38 A;  1OBR A;  2ZW6 A;  4P45 A;  1BLL E;  1YK3 A;  4ONU A;  4AB7 A;  4KOW A;  4E2A A;  2ZEN A;  2P6E A;  2G3A A;  2VI7 A;  3TC8 A;  2PIY A;  3D66 A;  2PDO A;  1ELM P;  1RO5 A;  3S6K A;  4KVM E;  5F09 A;  2XEF A;  3KZW A;  4J3G A;  1QSN A;  3QAY A;  1MJ9 A;  1CG2 A;  2PR1 A;  4MRI A;  2FT0 A;  3RNZ A;  5THW A;  2AFS A;  2Z3M A;  3DR8 A;  4PQA A;  3V7Z A;  4GXH A;  4EFD A;  4OLL A;  2CIJ A;  1ELL P;  1CP6 A;  3CXP A;  3FF3 A;  3W6S A;  4CGO A;  2PE3 A;  3BJ8 A;  3R9F A;  2CY2 A;  1ZLH A;  1TXR A;  4FD5 A;  4G1P A;  1Z8L A;  2QVP A;  4A94 A;  3TT2 A;  2AFO A;  4U9Y A;  3SJX A;  2YGW A;  3KR4 A;  3SJG A;  4UIB A;  2B3V A;  2IL4 A;  3OWC A;  4L89 A;  4XPL A;  3R9E A;  3TO7 A;  1DE4 C;  2A4N A;  4IK2 A;  4CRY B;  2PVW A;  3PBB A;  3EC4 A;  2WPW A;  4XPD C;  2WZN A;  3TTH A;  1I21 A;  1OZP A;  4R3L A;  1Y0R A;  2ZW4 A;  2ZPA A;  1LOK A;  2WUU A;  2GE3 A;  3LOD A;  3DSB A;  1FT7 A;  1Y9W A;  1ZLI A;  1XFO A;  2FS5 A;  5GCN A;  3IU1 A;  2DF5 A;  1P0H A;  3VH9 A;  2ZXV A;  4KSF A;  4P4F A;  1MJA A;  3UY5 A;  2JDD A;  3GY9 A;  2EBJ A;  4NSQ A;  4ONW A;  5A27 A;  4JLY A;  2Q4V A;  3PFO A;  5K8N A;  2AFU A;  4K3N A;  1Q2Y A;  3EO4 A;  4MCP A;  1NSA A;  1Y9K A;  2VXK A;  1EE3 P;  3KR5 A;  4MFZ A;  2AE6 A;  4KSI A;  1Q2D A;  2VZY A;  1Z8T A;  5F48 A;  3R9G A;  2OOT A;  4CYO A;  2D4O A;  1NMT A;  4K30 A;  5F46 A;  3PRT A;  4YRH A;  5EBV A;  2PR8 A;  3VWE A;  1BAV A;  1BO4 A;  3JRU A;  5K8P A;  2PQ8 A;  4OC4 A;  2PCU A;  3R95 A;  1TKJ A;  2CNM A;  3SI2 A;  4BBH A;  3DLJ A;  2C27 A;  2FSR A;  4PSX A;  2ZEL A;  4IF5 A;  1XIX A;  5F47 A;  3SHP A;  4AVA A;  3RYO A;  4WWV A;  4KUA A;  4P4B A;  3NFZ A;  3SJF A;  1QSM A;  1M4I A;  4BD9 A;  5J1Q A;  1BOB A;  2R8V A;  2EWB A;  4FBE A;  1PU9 A;  2VBQ A;  2ABZ A;  1LAN A;  1YLE A;  2P6G A;  3C26 A;  3KL9 A;  3PB9 X;  1VKC A;  1IB1 E;  4I49 A;  4NF1 A;  4F0Y A;  5C88 A;  4AVC A;  2NSM A;  2O4H A;  2IJZ A;  3B2Y A;  3D7H A;  2PJ1 A;  2PIZ A;  4C68 A;  2PJ2 A;  1Z4E A;  2R98 A;  4LX9 A;  4A30 A;  4EME A;  2JEV A;  5EMI A;  1I1D A;  5LRJ A;  4A2Z A;  4F9V A;  1BPM A;  1VGY A;  2B5G B;  1Z8W A;  1U6M A;  4M6G A;  1CP7 A;  3B8G A;  2DPS A;  4ZX9 A;  3S6G A;  3CT9 A;  1S7K A;  2B5G A;  4PSW A;  5I4M A;  5DWN A;  5HMN A;  4CGP A;  3P2F A;  2CF4 A;  3T8W A;  3FED A;  1YX0 A;  2Z3O A;  3PFE A;  2CTC A;  2PJA A;  5DS0 A;  2F7V A;  1PYT B;  3D4U A;  1X12 A;  1CX8 A;  5J8F A;  4B12 A;  1L0C A;  4A33 A;  1TF9 A;  2XEJ A;  2BSW A;  1I12 A;  4JXQ A;  4OAE A;  4A39 A;  1S7F A;  5LYF A;  1LAM A;  1YME A;  2AJ6 A;  4IHM A;  2VL1 A;  4KLV A;  2OR4 A;  4R76 A;  4CAV A;  4GM5 A;  3RBU A;  4E0A A;  4DNC A;  5IB9 A;  3GYA A;  4H6U A;  4KOV A;  2Z10 A;  2FXF A;  2B3U A;  2Z11 A;  2PJ3 A;  4NJR A;  4Y49 C;  2HB6 A;  4YFJ A;  3H4Q A;  3I9S A;  2GFQ A;  2PC1 A;  2Q4Y A;  2BOA A;  4CYN A;  5JM6 A;  2CTB A;  1GYT A;  2IQ6 A;  5HH1 A;  2PJB A;  3QAH A;  4NGP A;  4A37 A;  5F49 A;  4C2Y A;  3FXT A;  2JDC A;  3N5F A;  4C7I A;  5H84 A;  4CGN A;  3PB7 X;  2ARH A;  3KAS A;  3S9L A;  3MRU A;  5C82 A;  1GHE A;  2ATR A;  4UCN A;  3FVL A;  4NFR A;  5HVH A;  3K2K A;  2PJC A;  2J8R A;  2Q7S A;  4UIA A;  4C2Z A;  5J8C A;  4AVB A;  2Z3N A;  2JEW A;  2GLJ A;  2Q7B A;  2AFX A;  4MFJ A;  4OC5 A;  2QML A;  3KGQ A;  4XNH B;  4B10 A;  4ORF A;  4B11 A;  5AG4 A;  4CYQ A;  4F6A A;  4OC3 A;  1QQ9 A;  3QNV A;  3PBE A;  2YNC C;  1FNO A;  1YW6 A;  2OH1 A;  4KOY A;  3TO9 A;  3G8W A;  4KOX A;  2OZG A;  1R3N A;  4R3K A;  2YNC A;  3BI1 A;  2ZEP A;  3BJ7 A;  4KOR A;  4JZ0 A;  4CRZ B;  2BEI A;  4RUH A;  2AFW A;  4FUU A;  1F2P A;  4MFK A;  1Y7E A;  2PRQ A;  4P4I A;  4MHZ A;  3V8I A;  2Y0M A;  3GIU A;  5IB0 A;  3TFY A;  3FMC A;  5CBM A;  2FCK A;  3EY5 A;  3JVN A;  2CXA A;  4PXB A;  4UEZ A;  5AG7 A;  4ZX8 A;  3BI0 A;  3TCV A;  1Y7R A;  4A32 A;  4JWP A;  4FWU A;  1YSJ A;  3W6X A;  1M4D A;  4UF4 A;  4UBR A;  3IU2 A;  1Q7L A;  1WK4 A;  4C7H A;  4HNX B;  2PJ7 A;  5CPA A;  2HUZ A;  3H8G A;  1M44 A;  3GB0 A;  5G22 A;  1UWY A;  5KTC A;  2PJ0 A;  4MFQ A;  4P6Y A;  3DGV A;  2Q43 A;  2V77 A;  4MHN A;  4MJ8 A;  4NJQ A;  4OKO A;  4UWI A;  3CPA A;  3I3G A;  3G3S A;  2WPX A;  5KTD A;  2V8D A;  4UEF A;  2FIW A;  2EK8 A;  2ZOF A; 
#chains in the Genus database with same CATH homology
 4R57 A;  2Z3K A;  2REF A;  4M3S A;  1YVO A;  2Z3L A;  2PSW A;  4CYP A;  2H5M A;  4JD6 A;  3K9U A;  3TOA A;  3DDD A;  3ZZI A;  2JLM A;  3S6H A;  3CXQ A;  3N7Z A;  3VWD A;  2VQY A;  1VHS A;  2I00 A;  4JJX A;  2K5T A;  1LRZ A;  1M4G A;  5IV0 A;  4CAW A;  2QEC A;  2FE7 A;  3D3S A;  2J8M A;  2YND A;  4R87 A;  4IUS A;  2GIV A;  1RXT A;  2HV2 A;  2B4B A;  2DXQ A;  4KSA A;  3PZJ A;  4FD4 A;  3FIX A;  2G3T A;  3D8P A;  1K4J A;  3NE7 A;  4Q36 A;  1P4N A;  1UFH A;  2OU2 A;  2OZH A;  3GKR A;  3T9Y A;  3FNC A;  5AG6 A;  1XEB A;  3F0A A;  3DNS A;  4NEX A;  4A95 A;  4AG7 A;  3IWG A;  4UFW A;  3CXS A;  2GAN A;  2I79 A;  3TE4 A;  1PUA A;  4LUA A;  4NXY A;  1V0C A;  5JPH A;  4QBJ A;  1TIQ A;  4X5K A;  2BL1 A;  2B4D B;  2P0W A;  1CM0 A;  1MJB A;  3E0K A;  4L8A A;  4MY3 A;  5G20 A;  4FD6 A;  1IYK A;  1M1D A;  4KOT A;  4NCZ A;  2B4D A;  2EUI A;  3F8K A;  1IYL A;  1IID A;  5BWA B;  2PRB A;  3LD2 A;  2NMT A;  2OB0 A;  4R9M A;  4UCM A;  3IWE A;  2HQY A;  2J8N A;  4MY0 A;  2D4P A;  1S7L A;  4KS9 A;  3T90 A;  2KCW A;  4B5O A;  1XE4 A;  4KZT A;  2VEZ A;  1YGH A;  4RS2 A;  4QVT A;  2YNE A;  4XNH C;  2Z0Z A;  4Q38 A;  4OAD A;  3R96 A;  5JQ4 A;  1KUV A;  4CS0 B;  4PV6 A;  1XF8 A;  5H86 A;  3ZJ0 A;  2CNT A;  5AGE A;  4UFV A;  3JTK A;  2EVN A;  4B14 A;  4ZBG A;  4QUS A;  5E96 A;  2P6F A;  4EVY A;  4F0X A;  1S5K A;  4MBU A;  1KUY A;  3TOB A;  4KVO E;  3FRM A;  1IIC A;  5AG5 A;  2VZZ A;  1S3Z A;  4ZGY B;  3PGP A;  2FL4 A;  3EFA A;  4E8O A;  4UA3 A;  2FIA A;  4XPD B;  4M85 A;  5CNP A;  5G21 A;  3FYN A;  4B5P B;  1ON0 A;  2REE A;  5ISV A;  2CNS A;  5FVJ A;  4H6Z A;  1J4J A;  4U5Y A;  5EC4 A;  3S6F A;  4B5P A;  4H89 A;  1S60 A;  4GS4 A;  1WWZ A;  4MFL A;  4KOU A;  4HNW B;  1Z9U A;  4QB9 A;  5G1Z A;  1QSO A;  2B58 A;  3SXN A;  4PK2 A;  1YVK A;  1Z4R A;  5I0C A;  4YGO A;  3A9L A;  3W91 A;  4XPK A;  3PP9 A;  1N71 A;  4CAE A;  5IX3 A;  1SQH A;  2RC4 A;  3BLN A;  1KUX A;  3IGR A;  4RI1 A;  2O28 A;  1CJW A;  1YR0 A;  2R7H A;  3KKW A;  4PK3 A;  4MI4 A;  1NSL A;  2OZU A;  2Z3P A;  4A31 A;  4KLW A;  4BMH A;  1Q2C A;  4JXR A;  3SXO A;  4HNY B;  4UWJ A;  3QB8 A;  1YRE A;  4CAF A;  2ZW7 A;  4B13 A;  4UFX A;  4MFP A;  4CAX A;  1QST A;  1MK4 A;  1QSR A;  2R1I A;  2Q44 A;  1NE9 A;  3D2P A;  4CGM A;  4MHD A;  2BUE A;  1B87 A;  3MGD A;  4C2X A;  1R57 A;  5A28 A;  3EXN A;  1XMT A;  2G0B A;  2F5I A;  1KZF A;  5KTA A;  4HKF A;  4FD7 A;  4U9Z A;  2Q0Y A;  3DR6 A;  4KVX A;  2QIR A;  2ZW5 A;  4KOS A;  1S7N A;  2X7B A;  5DWM A;  2Q04 A;  4AG9 A;  1B6B A;  2DPT A;  4UCP A;  4II9 A;  2WSA A;  1FY7 A;  3TO6 A;  3WR7 A;  3P2H A;  3JUW A;  3FBU A;  3D2M A;  4Y49 B;  3R1K A;  3FB3 A;  3H5Z A;  3S6G A;  1ZO0 A;  4KUB A;  4CGL A;  4QC6 A;  3F5B A;  2ZW6 A;  1YK3 A;  4ONU A;  4AB7 A;  4KOW A;  4E2A A;  2P6E A;  2G3A A;  2VI7 A;  2PDO A;  1RO5 A;  3S6K A;  4KVM E;  4J3G A;  1QSN A;  1MJ9 A;  2PR1 A;  2FT0 A;  2Z3M A;  3DR8 A;  4OLL A;  4CGO A;  3CXP A;  3W6S A;  3BJ8 A;  3R9F A;  2CY2 A;  4FD5 A;  3TT2 A;  4U9Y A;  2YGW A;  2B3V A;  2IL4 A;  3OWC A;  4L89 A;  4XPL A;  3R9E A;  3TO7 A;  4CRY B;  2A4N A;  3EC4 A;  2WPW A;  4XPD C;  3TTH A;  1I21 A;  1OZP A;  4R3L A;  2ZW4 A;  2ZPA A;  2WUU A;  3LOD A;  2GE3 A;  3DSB A;  1Y9W A;  2FS5 A;  5GCN A;  3IU1 A;  1P0H A;  2ZXV A;  4KSF A;  1MJA A;  3UY5 A;  2JDD A;  3GY9 A;  4NSQ A;  5A27 A;  4JLY A;  2Q4V A;  1Q2Y A;  3EO4 A;  2VXK A;  1Y9K A;  4MFZ A;  2AE6 A;  1Q2D A;  2VZY A;  5F48 A;  3R9G A;  4CYO A;  2D4O A;  1NMT A;  4K30 A;  5F46 A;  4YRH A;  5EBV A;  2PR8 A;  3VWE A;  1BO4 A;  2PQ8 A;  3R95 A;  2CNM A;  4BBH A;  2C27 A;  2FSR A;  4PSX A;  3SHP A;  4IF5 A;  1XIX A;  5F47 A;  4AVA A;  3RYO A;  4KUA A;  1QSM A;  1M4I A;  1BOB A;  2R8V A;  1PU9 A;  2VBQ A;  1YLE A;  2P6G A;  3C26 A;  4NF1 A;  4F0Y A;  1VKC A;  1IB1 E;  4I49 A;  5C88 A;  4AVC A;  4C68 A;  1Z4E A;  2R98 A;  4LX9 A;  4A30 A;  2JEV A;  1I1D A;  4A2Z A;  2B5G B;  1U6M A;  3B8G A;  2DPS A;  1S7K A;  2B5G A;  4PSW A;  5DWN A;  5HMN A;  4CGP A;  3P2F A;  1YX0 A;  2Z3O A;  5J8F A;  4B12 A;  1L0C A;  4A33 A;  2BSW A;  1I12 A;  4JXQ A;  4OAE A;  1S7F A;  2AJ6 A;  4CAV A;  4KLV A;  4E0A A;  4DNC A;  3GYA A;  4H6U A;  4KOV A;  2Z10 A;  2FXF A;  2B3U A;  2Z11 A;  4Y49 C;  4YFJ A;  3H4Q A;  3I9S A;  2PC1 A;  2Q4Y A;  4CYN A;  5HH1 A;  3QAH A;  5F49 A;  4C2Y A;  3FXT A;  2JDC A;  4C7I A;  5H84 A;  4CGN A;  2ARH A;  5C82 A;  1GHE A;  2ATR A;  4UCN A;  2J8R A;  4C2Z A;  5J8C A;  4AVB A;  2Z3N A;  2Q7B A;  4MFJ A;  4XNH B;  2QML A;  4B10 A;  4B11 A;  4ORF A;  5AG4 A;  4CYQ A;  4F6A A;  2YNC C;  2OH1 A;  4KOY A;  3TO9 A;  3G8W A;  4KOX A;  2OZG A;  4R3K A;  2YNC A;  3BJ7 A;  4KOR A;  4CRZ B;  2BEI A;  4MFK A;  3V8I A;  2Y0M A;  5IB0 A;  3TFY A;  2FCK A;  3EY5 A;  3JVN A;  2CXA A;  5AG7 A;  3TCV A;  1Y7R A;  4A32 A;  4JWP A;  3W6X A;  1M4D A;  4UBR A;  3IU2 A;  1WK4 A;  4C7H A;  4HNX B;  5KTC A;  2HUZ A;  1M44 A;  5G22 A;  4MFQ A;  4MJ8 A;  4UWI A;  3I3G A;  3G3S A;  2WPX A;  5KTD A;  2FIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...