5IX3A

Crystal structure of n-acetyltransferase from staphylococcus aureus.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
AMKLRALEYSDLLFVHELNNEYSIMSYWFEEPYESLTELQHLFDKHLLDESERRFIVEDENQVVGIVELVEINYIHRNCEIQIIIKPEFSGKGYAKFAFEKAIIYAFNILNMHKIYLYVDADNKKAIHIYESEGFKTEGLLKEQFYTKGKYKDAYFMSLLKSEYIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine N-acetyltransferase
publication title Crystal structure of N-acetyltransferase from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ix3A00
4QB9A 2J8MA 2ZW5A 1I21A 4R57A 1VHSA 4AG9A 1PUAA 2HUZA 3TT2A 1XMTA 2Y0MA 4H6ZA 4NF1A 4PK3A 1KUYA 2ZW6A 4E0AA 1KZFA 1TIQA 1YLEA 1U6MA 2C27A 2JDCA 5I0CA 5IB0A 1QSTA 5IV0A 3QB8A 3BJ7A 1VKCA 1YK3A 4L89A 1I1DA 5DWNA 3S6KA 4E2AA 1FY7A 5EBVA 2VZYA 2OZGA 3FB3A 2JLMA 3GKRA 3TO9A 4CRYB 1V0CA 2J8RA 3MGDA 1M1DA 3EC4A 2B58A 1S60A 4ORFA 2ARHA 1NSLA 5HMNA 4IUSA 4PK2A 2Q44A 2FCKA 2CNTA 3SXOA 4KOUA 4L8AA 4KLVA 4UWIA 5J8FA 2I00A 3FNCA 4RS2A 1IIDA 2OH1A 3I3GA 4ZBGA 4MI4A 3BJ8A 4K30A 1M4IA 1WWZA 4MBUA 2PRBA 2VXKA 5DWMA 2X7BA 4I49A 4KORA 2OU2A 1S3ZA 4B5PB 4QC6A 3P2FA 2FE7A 1QSRA 1Z4EA 3F5BA 4EVYA 3DDDA 1IB1E 2Q7BA 3KKWA 3TO7A 3TOAA 2R98A 3G3SA 4XPLA 4DNCA 4CRZB 3JVNA 1Z9UA 2K5TA 1XE4A 2Q0YA 4JJXA 3R9GA 4X5KA 5F47A 3GY9A 3GYAA 1KUXA 2VBQA 1YX0A 4J3GA 5KTAA 4UBRA 3T9YA 4PSXA 2Z10A 1BOBA 1B6BA 3NE7A 5CNPA 5F48A 2AE6A 2D4PA 4YRHA 1YVKA 2HQYA 3CXQA 3R96A 1P0HA 2HV2A 4KVXA 3EO4A 3S6FA 1RXTA 5C88A 1Z4RA 3SXNA 4CAVA 4KUAA 4NSQA 4M3SA 1Q2CA 4YFJA 5H84A 2CNSA 2JEVA 5ISVA 4B5OA 1LRZA 1MJAA 1CM0A 2G3AA 4UWJA 4QUSA 2VEZA 3DNSA 1Q2DA 4JXRA 1YVOA 3N7ZA 2IL4A 1J4JA 2RC4A 4UA3A 4F6AA 3VWEA 3W6XA 1N71A 4PSWA 5EC4A 4AVAA 3PZJA 2B3VA 2G0BA 3EY5A 3JUWA 2B5GA 2PQ8A 3QAHA 1MJBA 1MK4A 1K4JA 4OAEA 4JD6A 4KOTA 4NEXA 1B87A 2GE3A 2O28A 3FRMA 1S7LA 3R1KA 3F8KA 2B4DA 4JLYA 3P2HA 1NE9A 3S6GA 1Y7RA 2CNMA 1WK4A 2CY2A 2VZZA 4XPDB 3RYOA 3EFAA 2EUIA 4KOWA 3PP9A 3TFYA 1XEBA 4CAXA 4XPKA 2BSWA 3C26A 4U9YA 1IYLA 1ON0A 2J8NA 2Q04A 3FIXA 3PGPA 2WPWA 4PV6A 2FL4A 4KVOE 4R3KA 4F0YA 2OZHA 2QMLA 1M4GA 1Q2YA 3TOBA 5E96A 4GS4A 4HKFA 4AVCA 1PU9A 3FBUA 1QSOA 3TTHA 2PR1A 4JXQA 3IGRA 4H6UA 3B8GA 1GHEA 3CXPA 3UY5A 2ZXVA 4MY0A 4OADA 2G3TA 4AB7A 4CAWA 4LUAA 1L0CA 1QSMA 4U5YA 3SHPA 4MY3A 1S7NA 2F5IA 4BMHA 2Z0ZA 2REEA 1I12A 1XF8A 1CJWA 3ZZIA 4FD5A 2GIVA 4JWPA 3W91A 2PR8A 1RO5A 1XIXA 2A4NA 4HNXB 5KTCA 2OZUA 4ONUA 2P6FA 1IYKA 3IWGA 2WPXA 3FYNA 4H89A 4M85A 2FSRA 2QIRA 3BLNA 2ZW7A 2PC1A 1MJ9A 2Q4YA 3R9EA 2ZPAA 2Q4VA 4XNHB 2D4OA 5J8CA 3OWCA 3EXNA 4OLLA 2BEIA 3TE4A 4QVTA 4KUBA 2NMTA 4MHDA 4Y49B 2FS5A 2DXQA 3TCVA 4CS0B 4R9MA 2R7HA 5FVJA 3LD2A 1YGHA 5C82A 2FT0A 2JDDA 4KOYA 4U9ZA 2ATRA 3FXTA 1KUVA 2BL1A 1Y9WA 4KOXA 1Y9KA 2B5GB 1M4DA 4HNYB 3D2MA 2FIAA 3T90A 3DR8A 1SQHA 2AJ6A 4KLWA 3DSBA 4FD4A 4II9A 2QECA 2B4DB 5GCNA 5JQ4A 2PSWA 4YGOA 4NXYA 1YR0A 1UFHA 3E0KA 3S6HA 2R8VA 3WR7A 1P4NA 4E8OA 4XNHC 3ZJ0A 4R3LA 4MJ8A 1BO4A 1QSNA 2FIWA 3D3SA 4LX9A 4NCZA 4Y49C 2GANA 4B5PA 1S7KA 1M44A 2EVNA 2P0WA 4RI1A 2ZW4A 3W6SA 2H5MA 4AG7A 2P6GA 2Z11A 2VI7A 1S7FA 4FD6A 5IX3A 2KCWA 1R57A 4FD7A 3LODA 3R9FA 2PDOA 1S5KA 3TO6A 2REFA 3D2PA 3D8PA 5F49A 4QBJA 3I9SA 5KTDA 4XPDC 4R87A 4KOVA 3G8WA 4KZTA 4IF5A 4KOSA 1NMTA 5JPHA 5HH1A 2P6EA 5F46A 2BUEA 1OZPA 3H4QA 4AVBA 3CXSA 3V8IA 2B4BA 3F0AA 2VQYA 5H86A 4HNWB 2OB0A 3DR6A 3K9UA 2FXFA 2R1IA 3R95A 2I79A 1YREA 2B3UA 4KVME 3VWDA 1IICA
chains in the Genus database with same CATH superfamily
2PE3A 2J8MA 2HC9A 4QB9A 2ZW5A 3B2YA 1I21A 3KASA 4R57A 1VHSA 3DGVA 4AG9A 2BCOA 3NFZA 1ZG7A 5HVHA 4RN7A 4FWUA 3L2NA 3KQZA 4MFQA 1PUAA 1TXRA 1XMBA 2HUZA 4UFXA 3TT2A 1XMTA 2Y0MA 3K9TA 4LQ6A 4H6ZA 4NF1A 4PK3A 1KUYA 1IOFA 2ZW6A 4NGPA 3FJUA 1KZFA 4E0AA 1TIQA 2PJ3A 1YLEA 2EWBA 1U6MA 2C27A 5G1ZA 4CYQA 2V8VA 4A30A 2JDCA 5I0CA 5LYIA 5IB0A 1QSTA 5IV0A 3QB8A 5HVGA 4UEFA 3BJ7A 3IFEA 2YGWA 1VKCA 2J9AA 4CYNA 1YK3A 4L89A 1I1DA 5DWNA 3S6KA 5LRGA 4CAEA 1LAMA 1FY7A 5EBVA 4E2AA 2VZYA 1R43A 2OZGA 3FB3A 2JLMA 4MMOA 3GKRA 3IIBA 2DPSA 3TO9A 4CRYB 2CTBA 2PJ5A 4A38A 1V0CA 1YSJA 2FVGA 2J8RA 3B3TA 3MGDA 1M1DA 4TNUA 3EC4A 2B58A 3PEIA 4JYWA 5LYDA 3BI1A 1S60A 1NSAA 4ORFA 2VL1A 2ARHA 1NSLA 5HMNA 4IUSA 4PK2A 2Q44A 2FCKA 2CNTA 3LWUA 3SXOA 4KOUA 4L8AA 3H8FA 3IJ3A 4KLVA 3B3CA 1A2ZA 4UWIA 3SJGA 5J8FA 2Z3KA 1HDQA 2I00A 3FNCA 4KSAA 1XFOA 2AFOA 3FH4A 4RS2A 2GFQA 1IIDA 2OH1A 1X12A 4B12A 3I3GA 2Z3MA 2PJCA 4MI4A 4ZBGA 3BJ8A 4K30A 7CPAA 1M4IA 1R3NA 5AG7A 2G9DA 2JEWA 1PYTB 1TF8A 1WWZA 4ZX8A 4MBUA 2PRBA 5LRJA 2VXKA 5DWMA 4A32A 4P4BA 2X7BA 4I49A 4KORA 1IU8A 2OU2A 1S3ZA 3LACA 2ZEFA 3QAYA 4QC6A 5D8NA 4B5PB 3P2FA 3CPAA 2FE7A 4NGNA 4X2TA 1QSRA 4P4IA 2XEIA 1TKHA 1XRYA 1Y7EA 1Z4EA 3D7GA 3I1UA 3F5BA 3FECA 4EWTA 3H5ZA 4EVYA 3DDDA 1IB1E 4Q38A 2CF4A 2EO8A 5CPAA 4YWYA 2Q7BA 1YW6A 4C2YA 3FMCA 3KKWA 3TO7A 2ZENA 3SI2A 3FF3A 4OC1A 3TOAA 4CGLA 4BD9A 4W9YA 2R98A 5JM6A 3G3SA 3CPXA 2Q43A 1GYTA 3KQXA 1ZLIA 4XPLA 4DNCA 3V7ZA 4CRZB 3JVNA 2V8HA 1Z9UA 5AG5A 5LYFA 1IOIA 1XE4A 2K5TA 2Q0YA 4BBHA 4OC0A 2Q7SA 4JJXA 3R9GA 4X5KA 2PJAA 1LCPA 3H8GA 3PB9X 5HVFA 1QQ9A 5F47A 3KZWA 2EBJA 2YNCC 5LYLA 3GY9A 3NH4A 3VH9A 4MCSA 4A39A 2V8DA 2BOAA 2PJ6A 3GYAA 4HPSA 4R8FA 1YW4A 1CP7A 1KUXA 2ZEDA 2VBQA 1YX0A 2WYRA 2Q51A 1X10A 3RBUA 4J3GA 5KTAA 4UBRA 3T9YA 3N5FA 2AFXA 2OOTA 1TKFA 4PSXA 2Z10A 2Z3NA 1AYEA 5ELYA 1BOBA 1B6BA 3GIUA 2PJBA 1VIXA 3NE7A 5CNPA 5F48A 2AE6A 2D4PA 2V8GA 3CDXA 1AUGA 4P45A 4YRHA 1YVKA 4EMEA 2HQYA 3CXQA 3R96A 1P0HA 4MHNA 2HV2A 3KHXA 2V77A 4KVXA 3EO4A 4OKOA 2PJ7A 4CGPA 2WSAA 3IEHA 3S6FA 1RXTA 4MFPA 5C88A 1LAPA 1Z4RA 3RNZA 3SXNA 4CAVA 5G22A 2Z3LA 5K8MA 1IGBA 4Z65A 4KUAA 4NSQA 2PRQA 2IJZA 4B11A 3LMSA 4MFJA 4M3SA 1Q2CA 5JH9A 3S9LA 4YFJA 1LFWA 2ZEHA 5H84A 2CNSA 2JEVA 5D29A 1BAVA 5ISVA 4B5OA 4UFVA 3B35A 1LRZA 4FAIA 5K8NA 1MJAA 4R7MA 1CM0A 2G3AA 4CPAA 2Q4ZA 3IU1A 4UWJA 4BINA 4QUSA 4CGOA 1Z8WA 4DJLA 2ZOGA 4PPZA 4M6IA 4NJQA 2VEZA 3DNSA 4KS9A 1ZO0A 1H8LA 3FVLA 4CYOA 3CZXA 1Q2DA 4JXRA 1BLLE 1YVOA 3N7ZA 1YQEA 2IL4A 1ZG8A 4PQAA 3B3WA 3S9NA 3SJEA 1J4JA 1CG2A 2RC4A 4UA3A 3RZAA 4F9UA 4OIWA 3VWEA 2ZOFA 3W6XA 4F6AA 1N71A 4PSWA 2XEJA 2ZEEA 5EC4A 3PZJA 2B3VA 3NH8A 3VATA 4AVAA 2G0BA 4EFDA 4MHYA 3EY5A 3JUWA 4CGNA 1HDUA 2PJ2A 2B5GA 2PQ8A 2POKA 3QAHA 1MJBA 4P4DA 1MK4A 1TKJA 2XEFA 4JZ0A 1K4JA 5THWA 4OAEA 4JD6A 4OC2A 4KOTA 4NEXA 3PB6X 1B87A 2GE3A 2O28A 5A28A 4NGTA 3FRMA 4NGMA 2Z3PA 1S7LA 1Y0RA 3D66A 1QMUA 3R1KA 3F8KA 4A94A 2B4DA 2YNCA 4JLYA 2IMOA 3P2HA 1AMPA 1NE9A 3H8EA 3S6GA 1ELLP 4NFRA 1Y7RA 4UFWA 2CNMA 1WK4A 2CY2A 2VZZA 3BHXA 4XPDB 3RYOA 3EFAA 2EUIA 4KOWA 3PP9A 3TFYA 1XEBA 5K8OA 2IQ6A 4Q36A 4CAXA 1Z2LA 3D68A 2EK9A 4XPKA 2BSWA 4NGQA 3PB8X 1UWYA 1Z5RA 2BO9A 4ZI6A 3C26A 4NJRA 4U9YA 2GLFA 2JBJA 1IYLA 1BPNA 1ON0A 2J8NA 6CPAA 2Q04A 3JTKA 3FIXA 3PGPA 3PFEA 4ZY0A 4F0XA 3ISXA 2GU2A 2WPWA 1Z8TA 3PFOA 3WC7A 2AFMA 4PV6A 1XBUA 2FL4A 2OR4A 4KVOE 4R3KA 4ZY2A 2YNDA 4C68A 4MCRA 4F0YA 3PB4X 2PIZA 4A2ZA 2OZHA 1DTDA 4RUHA 1Y0YA 2QMLA 2WZNA 4MRIA 3SI1A 1M4GA 1Q2YA 3FEEA 4KVME 3TOBA 5E96A 3WABA 4O23A 4GS4A 4HKFA 4AVCA 2PVVA 1PU9A 3D4UA 3FBUA 2RB7A 4NGSA 1QSOA 3TTHA 4M6HA 2PR1A 3PBEA 4JXQA 2ODFA 4X3RA 3IGRA 4H6UA 4Q7AA 3B8GA 1GHEA 3CXPA 3K2KA 3UY5A 2ZXVA 4MY0A 4FUUA 4OADA 2G3TA 4DUKA 4AB7A 4C7HA 3BI0A 2C1CA 5BWAB 4CAWA 4LUAA 1L0CA 1QSMA 1BPMA 4U5YA 3SHPA 4MY3A 4P4JA 4A33A 3SJFA 1S7NA 5CBMA 2F5IA 4OC5A 2HB6A 4IHMA 1VHOA 5LRKA 4BMHA 2Z0ZA 4B14A 2REEA 1I12A 5DS0A 1VHEA 4F8ZA 3GLJA 1XF8A 1CJWA 1ELMP 3ZZIA 2YNEA 2GIVA 4FD5A 4JWPA 3W91A 2PR8A 1RO5A 1XIXA 3KR5A 2A4NA 1Q7LA 2DPTA 3QNVA 3NE8A 4HNXB 4A37A 5KTCA 2OZUA 2Z3OA 4ONUA 3SJXA 2P6FA 4OIDA 1IYKA 3IWGA 2WPXA 3FYNA 4OP4A 3IU2A 2NYQA 4PXCA 4H89A 4M85A 4UEZA 4OMEA 2AFWA 3PBBA 1LANA 2FSRA 2ZELA 3SI0A 4K3NA 2QIRA 5G21A 2PJ4A 3BLNA 2ZW7A 4MHZA 2QVPA 4P44A 4GXHA 5AGEA 2PC1A 1MJ9A 2Q4YA 3R9EA 3KI9A 2ZPAA 4IK2A 1VGYA 2Q4VA 4XNHB 2D4OA 4KSFA 3V38A 5J8CA 3OWCA 1PCAA 1Z8XA 3EXNA 4M6GA 4OLLA 2BEIA 5J1QA 4UIBA 1CPSA 1CPXA 2GLJA 3PRTA 4TWEA 3D7FA 4C7IA 3TE4A 3JRUA 4QVTA 4KUBA 2NMTA 1JWQA 4MFKA 3NH5A 4MHDA 4Y49B 3D67A 4P4EA 2FS5A 5AG6A 4ZY1A 2NSMA 2CTCA 3KL9A 4MXUA 4UF4A 2DXQA 4B10A 4PXBA 3TCVA 4PXEA 4C2ZA 4CS0B 3B3VA 4R9MA 2R7HA 1ARLA 4A31A 5FVJA 4B13A 3D7HA 4H2KA 3LD2A 2PCUA 1YGHA 5K8PA 5C82A 2FT0A 4WWVA 2GREA 2JDDA 4KOYA 4UCPA 4U9ZA 2JBKA 3RAMA 2ATRA 3FXTA 3MN8A 1KUVA 2BL1A 1Y9WA 1XJOA 2PJ1A 1RTQA 3FX6A 2RFHA 3GUXA 4KOXA 1F2PA 2CIJA 1Y9KA 2B5GB 3B3SA 3RO0A 2DF5A 1M4DA 4MCQA 4HNYB 3D2MA 4R76A 5EMIA 4OC3A 4MFLA 2FIAA 4ZGYB 2PJ9A 3T90A 1JQGA 5HXDA 1CBXA 1HEEA 1XOVA 2PIYA 2ABZA 3DR8A 1SQHA 2AFSA 1F2OA 2AJ6A 4KLWA 5G20A 3S9MA 3DSBA 2EK8A 4LQGA 4FD4A 3NA6A 2ZEOA 3IO1A 4P4FA 4II9A 2QECA 4KSIA 1KWMA 2B4DB 4WJBA 5GCNA 2O4HA 5JQ4A 2PSWA 3MRUA 4B6ZA 3D7DA 2ANPA 4YGOA 4ZX9A 3HUVA 4NXYA 1YR0A 1UFHA 3E0KA 3S6HA 1CP6A 3HLPA 2R8VA 3WC5A 1P4NA 4MHPA 3ISZA 3WR7A 3DLJA 4E8OA 1YLOA 4XNHC 4YU9A 3IWWA 8CPAA 2QYVA 2QJ8A 3ZJ0A 4R3LA 4CGMA 3KGQA 1CX8A 2AFUA 2PJ0A 4MJ8A 1BO4A 1QSNA 5I4MA 1EE3P 2FIWA 3D3SA 2C6PA 4LX9A 4A95A 4NCZA 2XEGA 4Y49C 2GANA 1FT7A 4B5PA 4UEEA 1DE4C 1S7KA 4ZYQA 1IY7A 1M44A 2EVNA 3IWEA 4C2XA 4X8IA 2P0WA 5F09A 4RI1A 2ZW4A 3W6SA 2H5MA 4NGRA 3B7IA 1TF9A 4AG7A 4F9VA 4G1PA 1ZG9A 1FNOA 2AFZA 2ZEGA 2P6GA 4UIAA 2Z11A 3VARA 4CYPA 2VI7A 1S7FA 4FD6A 5IX3A 2I3CA 2KCWA 1R57A 2F7VA 3A9LA 3LODA 2PDOA 1S5KA 4FD7A 3R9FA 2DEAA 3TO6A 2REFA 3KHZA 2PJ8A 3KR4A 2F8HA 3D2PA 4UCNA 3WT4A 5A27A 5AG4A 3D8PA 5F49A 4P6YA 3TC8A 1YMEA 4P10A 4MFZA 4QBJA 4OC4A 3CT9A 3I9SA 1Z8LA 4MCPA 2PVWA 5KTDA 5JGFA 2C6CA 2ZEPA 4XPDC 4R87A 4KOVA 2CXAA 3PB7X 4R6TA 3G8WA 4KZTA 2ZEMA 4IF5A 4AXVA 4IAVA 4KOSA 1M4LA 1NMTA 5JPHA 5HH1A 2P6EA 3GB0A 5F46A 2BUEA 3TX8A 1F57A 1OZPA 3H4QA 2WUUA 4AVBA 4GM5A 3CXSA 3V8IA 2B4BA 3F0AA 3FEDA 2VQYA 5H86A 4HNWB 2OB0A 3DR6A 3K9UA 1OBRA 2FXFA 3T8WA 3WC6A 4DYOA 1ARMA 2C6GA 2R1IA 3R95A 3IC1A 2I79A 1YREA 2B3UA 2O53A 4PXDA 3BXMA 4UCMA 4ONWA 4FBEA 4CAFA 1ZLHA 3VWDA 1LOKA 1IICA 5IB9A
chains in the Genus database with same CATH topology
4QB9A 2J8MA 2ZW5A 1I21A 4R57A 1VHSA 4AG9A 4MFQA 1PUAA 2HUZA 3TT2A 4UFXA 1XMTA 2Y0MA 4H6ZA 4NF1A 4PK3A 1KUYA 2ZW6A 4E0AA 1KZFA 1TIQA 1YLEA 1U6MA 2C27A 5G1ZA 4CYQA 4A30A 2JDCA 5I0CA 5IB0A 1QSTA 5IV0A 3QB8A 3BJ7A 2YGWA 1VKCA 4CYNA 1YK3A 4L89A 1I1DA 5DWNA 3S6KA 4CAEA 4E2AA 1FY7A 5EBVA 2VZYA 2OZGA 3FB3A 2JLMA 3GKRA 2DPSA 3TO9A 4CRYB 1V0CA 2J8RA 3MGDA 1M1DA 3EC4A 2B58A 1S60A 4ORFA 2ARHA 1NSLA 5HMNA 4IUSA 4PK2A 2Q44A 2FCKA 2CNTA 3SXOA 4KOUA 4L8AA 4KLVA 4UWIA 5J8FA 2Z3KA 2I00A 3FNCA 4KSAA 4RS2A 1IIDA 2OH1A 4B12A 3I3GA 2Z3MA 4ZBGA 4MI4A 3BJ8A 4K30A 1M4IA 5AG7A 1WWZA 4MBUA 2PRBA 2VXKA 5DWMA 4A32A 2X7BA 4I49A 4KORA 2OU2A 1S3ZA 4B5PB 4QC6A 3P2FA 2FE7A 1QSRA 1Z4EA 3F5BA 3H5ZA 4EVYA 3DDDA 1IB1E 4Q38A 2Q7BA 4C2YA 3KKWA 3TO7A 3TOAA 4CGLA 2R98A 3G3SA 4XPLA 4DNCA 4CRZB 3JVNA 1Z9UA 5AG5A 2K5TA 1XE4A 2Q0YA 4BBHA 4JJXA 3R9GA 4X5KA 5F47A 2YNCC 3GY9A 3GYAA 1KUXA 2VBQA 1YX0A 4J3GA 5KTAA 4UBRA 3T9YA 4PSXA 2Z10A 2Z3NA 1BOBA 1B6BA 3NE7A 5CNPA 5F48A 2AE6A 2D4PA 4YRHA 1YVKA 2HQYA 3CXQA 3R96A 1P0HA 2HV2A 4KVXA 3EO4A 4CGPA 2WSAA 3S6FA 1RXTA 4MFPA 5C88A 1Z4RA 3SXNA 4CAVA 5G22A 2Z3LA 4KUAA 4NSQA 4B11A 4MFJA 4M3SA 1Q2CA 4YFJA 5H84A 2CNSA 2JEVA 5ISVA 4B5OA 4UFVA 1LRZA 1MJAA 1CM0A 2G3AA 4CGOA 3IU1A 4UWJA 4QUSA 2VEZA 3DNSA 4KS9A 1ZO0A 4CYOA 1Q2DA 4JXRA 1YVOA 3N7ZA 2IL4A 1J4JA 2RC4A 4UA3A 4F6AA 3VWEA 3W6XA 1N71A 4PSWA 5EC4A 4AVAA 3PZJA 2B3VA 2G0BA 3EY5A 3JUWA 4CGNA 2B5GA 2PQ8A 3QAHA 1MJBA 1MK4A 1K4JA 4OAEA 4JD6A 4KOTA 4NEXA 1B87A 2GE3A 2O28A 5A28A 3FRMA 2Z3PA 1S7LA 3R1KA 3F8KA 2B4DA 2YNCA 4JLYA 3P2HA 1NE9A 3S6GA 1Y7RA 4UFWA 2CNMA 1WK4A 2CY2A 2VZZA 4XPDB 3RYOA 3EFAA 2EUIA 4KOWA 3PP9A 3TFYA 1XEBA 4Q36A 4CAXA 4XPKA 2BSWA 3C26A 4U9YA 1IYLA 1ON0A 2J8NA 2Q04A 3JTKA 3FIXA 3PGPA 4F0XA 2WPWA 4PV6A 2FL4A 4KVOE 4C68A 4R3KA 2YNDA 4F0YA 4A2ZA 2OZHA 2QMLA 1M4GA 1Q2YA 3TOBA 5E96A 4GS4A 4HKFA 4AVCA 1PU9A 3FBUA 1QSOA 3TTHA 2PR1A 4JXQA 3IGRA 4H6UA 3B8GA 1GHEA 3CXPA 3UY5A 2ZXVA 4MY0A 4OADA 2G3TA 4AB7A 4C7HA 5BWAB 4CAWA 4LUAA 1L0CA 1QSMA 4U5YA 3SHPA 4MY3A 4A33A 1S7NA 2F5IA 4BMHA 2Z0ZA 4B14A 2REEA 1I12A 1XF8A 1CJWA 3ZZIA 2YNEA 2GIVA 4FD5A 4JWPA 3W91A 2PR8A 1RO5A 1XIXA 2A4NA 2DPTA 4HNXB 5KTCA 2OZUA 2Z3OA 4ONUA 2P6FA 1IYKA 3IWGA 2WPXA 3FYNA 3IU2A 4H89A 4M85A 2FSRA 2QIRA 5G21A 3BLNA 2ZW7A 5AGEA 2PC1A 1MJ9A 2Q4YA 3R9EA 2ZPAA 2Q4VA 4XNHB 2D4OA 4KSFA 5J8CA 3OWCA 3EXNA 4OLLA 2BEIA 4C7IA 3TE4A 4QVTA 4KUBA 2NMTA 4MFKA 4MHDA 4Y49B 2FS5A 5AG6A 2DXQA 4B10A 3TCVA 4C2ZA 4CS0B 4R9MA 2R7HA 4A31A 5FVJA 4B13A 3LD2A 1YGHA 5C82A 2FT0A 2JDDA 4KOYA 4UCPA 4U9ZA 2ATRA 3FXTA 1KUVA 2BL1A 1Y9WA 4KOXA 1Y9KA 2B5GB 1M4DA 4HNYB 3D2MA 4ZGYB 4MFLA 2FIAA 3T90A 3DR8A 1SQHA 2AJ6A 4KLWA 5G20A 3DSBA 4FD4A 4II9A 2QECA 2B4DB 5GCNA 5JQ4A 2PSWA 4YGOA 4NXYA 1YR0A 1UFHA 3E0KA 3S6HA 2R8VA 3WR7A 1P4NA 4E8OA 4XNHC 3ZJ0A 4R3LA 4CGMA 4MJ8A 1BO4A 1QSNA 2FIWA 3D3SA 4LX9A 4A95A 4NCZA 4Y49C 2GANA 4B5PA 1S7KA 1M44A 2EVNA 3IWEA 4C2XA 2P0WA 4RI1A 2ZW4A 3W6SA 2H5MA 4AG7A 2P6GA 4CYPA 2Z11A 2VI7A 1S7FA 4FD6A 5IX3A 2KCWA 4FD7A 1R57A 3A9LA 3LODA 2PDOA 1S5KA 3R9FA 3TO6A 2REFA 3D2PA 4UCNA 5A27A 5AG4A 3D8PA 5F49A 4MFZA 4QBJA 3I9SA 5KTDA 4XPDC 4R87A 4KOVA 2CXAA 3G8WA 4KZTA 4IF5A 4KOSA 1NMTA 5JPHA 5HH1A 2P6EA 5F46A 2BUEA 1OZPA 3H4QA 2WUUA 4AVBA 3CXSA 3V8IA 2B4BA 3F0AA 2VQYA 5H86A 4HNWB 2OB0A 3DR6A 3K9UA 2FXFA 2R1IA 3R95A 2I79A 1YREA 2B3UA 4UCMA 4CAFA 4KVME 3VWDA 1IICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB9 A;  2J8M A;  2ZW5 A;  1I21 A;  4R57 A;  1VHS A;  4AG9 A;  1PUA A;  2HUZ A;  3TT2 A;  1XMT A;  2Y0M A;  4H6Z A;  4NF1 A;  4PK3 A;  1KUY A;  2ZW6 A;  4E0A A;  1KZF A;  1TIQ A;  1YLE A;  1U6M A;  2C27 A;  2JDC A;  5I0C A;  5IB0 A;  1QST A;  5IV0 A;  3QB8 A;  3BJ7 A;  1VKC A;  1YK3 A;  4L89 A;  1I1D A;  5DWN A;  3S6K A;  4E2A A;  1FY7 A;  5EBV A;  2VZY A;  2OZG A;  3FB3 A;  2JLM A;  3GKR A;  3TO9 A;  4CRY B;  1V0C A;  2J8R A;  3MGD A;  1M1D A;  3EC4 A;  2B58 A;  1S60 A;  4ORF A;  2ARH A;  1NSL A;  5HMN A;  4IUS A;  4PK2 A;  2Q44 A;  2FCK A;  2CNT A;  3SXO A;  4KOU A;  4L8A A;  4KLV A;  4UWI A;  5J8F A;  2I00 A;  3FNC A;  4RS2 A;  1IID A;  2OH1 A;  3I3G A;  4ZBG A;  4MI4 A;  3BJ8 A;  4K30 A;  1M4I A;  1WWZ A;  4MBU A;  2PRB A;  2VXK A;  5DWM A;  2X7B A;  4I49 A;  4KOR A;  2OU2 A;  1S3Z A;  4B5P B;  4QC6 A;  3P2F A;  2FE7 A;  1QSR A;  1Z4E A;  3F5B A;  4EVY A;  3DDD A;  1IB1 E;  2Q7B A;  3KKW A;  3TO7 A;  3TOA A;  2R98 A;  3G3S A;  4XPL A;  4DNC A;  4CRZ B;  3JVN A;  1Z9U A;  2K5T A;  1XE4 A;  2Q0Y A;  4JJX A;  3R9G A;  4X5K A;  5F47 A;  3GY9 A;  3GYA A;  1KUX A;  2VBQ A;  1YX0 A;  4J3G A;  5KTA A;  4UBR A;  3T9Y A;  4PSX A;  2Z10 A;  1BOB A;  1B6B A;  3NE7 A;  5CNP A;  5F48 A;  2AE6 A;  2D4P A;  4YRH A;  1YVK A;  2HQY A;  3CXQ A;  3R96 A;  1P0H A;  2HV2 A;  4KVX A;  3EO4 A;  3S6F A;  1RXT A;  5C88 A;  1Z4R A;  3SXN A;  4CAV A;  4KUA A;  4NSQ A;  4M3S A;  1Q2C A;  4YFJ A;  5H84 A;  2CNS A;  2JEV A;  5ISV A;  4B5O A;  1LRZ A;  1MJA A;  1CM0 A;  2G3A A;  4UWJ A;  4QUS A;  2VEZ A;  3DNS A;  1Q2D A;  4JXR A;  1YVO A;  3N7Z A;  2IL4 A;  1J4J A;  2RC4 A;  4UA3 A;  4F6A A;  3VWE A;  3W6X A;  1N71 A;  4PSW A;  5EC4 A;  4AVA A;  3PZJ A;  2B3V A;  2G0B A;  3EY5 A;  3JUW A;  2B5G A;  2PQ8 A;  3QAH A;  1MJB A;  1MK4 A;  1K4J A;  4OAE A;  4JD6 A;  4KOT A;  4NEX A;  1B87 A;  2GE3 A;  2O28 A;  3FRM A;  1S7L A;  3R1K A;  3F8K A;  2B4D A;  4JLY A;  3P2H A;  1NE9 A;  3S6G A;  1Y7R A;  2CNM A;  1WK4 A;  2CY2 A;  2VZZ A;  4XPD B;  3RYO A;  3EFA A;  2EUI A;  4KOW A;  3PP9 A;  3TFY A;  1XEB A;  4CAX A;  4XPK A;  2BSW A;  3C26 A;  4U9Y A;  1IYL A;  1ON0 A;  2J8N A;  2Q04 A;  3FIX A;  3PGP A;  2WPW A;  4PV6 A;  2FL4 A;  4KVO E;  4R3K A;  4F0Y A;  2OZH A;  2QML A;  1M4G A;  1Q2Y A;  3TOB A;  5E96 A;  4GS4 A;  4HKF A;  4AVC A;  1PU9 A;  3FBU A;  1QSO A;  3TTH A;  2PR1 A;  4JXQ A;  3IGR A;  4H6U A;  3B8G A;  1GHE A;  3CXP A;  3UY5 A;  2ZXV A;  4MY0 A;  4OAD A;  2G3T A;  4AB7 A;  4CAW A;  4LUA A;  1L0C A;  1QSM A;  4U5Y A;  3SHP A;  4MY3 A;  1S7N A;  2F5I A;  4BMH A;  2Z0Z A;  2REE A;  1I12 A;  1XF8 A;  1CJW A;  3ZZI A;  4FD5 A;  2GIV A;  4JWP A;  3W91 A;  2PR8 A;  1RO5 A;  1XIX A;  2A4N A;  4HNX B;  5KTC A;  2OZU A;  4ONU A;  2P6F A;  1IYK A;  3IWG A;  2WPX A;  3FYN A;  4H89 A;  4M85 A;  2FSR A;  2QIR A;  3BLN A;  2ZW7 A;  2PC1 A;  1MJ9 A;  2Q4Y A;  3R9E A;  2ZPA A;  2Q4V A;  4XNH B;  2D4O A;  5J8C A;  3OWC A;  3EXN A;  4OLL A;  2BEI A;  3TE4 A;  4QVT A;  4KUB A;  2NMT A;  4MHD A;  4Y49 B;  2FS5 A;  2DXQ A;  3TCV A;  4CS0 B;  4R9M A;  2R7H A;  5FVJ A;  3LD2 A;  1YGH A;  5C82 A;  2FT0 A;  2JDD A;  4KOY A;  4U9Z A;  2ATR A;  3FXT A;  1KUV A;  2BL1 A;  1Y9W A;  4KOX A;  1Y9K A;  2B5G B;  1M4D A;  4HNY B;  3D2M A;  2FIA A;  3T90 A;  3DR8 A;  1SQH A;  2AJ6 A;  4KLW A;  3DSB A;  4FD4 A;  4II9 A;  2QEC A;  2B4D B;  5GCN A;  5JQ4 A;  2PSW A;  4YGO A;  4NXY A;  1YR0 A;  1UFH A;  3E0K A;  3S6H A;  2R8V A;  3WR7 A;  1P4N A;  4E8O A;  4XNH C;  3ZJ0 A;  4R3L A;  4MJ8 A;  1BO4 A;  1QSN A;  2FIW A;  3D3S A;  4LX9 A;  4NCZ A;  4Y49 C;  2GAN A;  4B5P A;  1S7K A;  1M44 A;  2EVN A;  2P0W A;  4RI1 A;  2ZW4 A;  3W6S A;  2H5M A;  4AG7 A;  2P6G A;  2Z11 A;  2VI7 A;  1S7F A;  4FD6 A;  5IX3 A;  2KCW A;  1R57 A;  4FD7 A;  3LOD A;  3R9F A;  2PDO A;  1S5K A;  3TO6 A;  2REF A;  3D2P A;  3D8P A;  5F49 A;  4QBJ A;  3I9S A;  5KTD A;  4XPD C;  4R87 A;  4KOV A;  3G8W A;  4KZT A;  4IF5 A;  4KOS A;  1NMT A;  5JPH A;  5HH1 A;  2P6E A;  5F46 A;  2BUE A;  1OZP A;  3H4Q A;  4AVB A;  3CXS A;  3V8I A;  2B4B A;  3F0A A;  2VQY A;  5H86 A;  4HNW B;  2OB0 A;  3DR6 A;  3K9U A;  2FXF A;  2R1I A;  3R95 A;  2I79 A;  1YRE A;  2B3U A;  4KVM E;  3VWD A;  1IIC A; 
#chains in the Genus database with same CATH topology
 2PE3 A;  2J8M A;  2HC9 A;  4QB9 A;  2ZW5 A;  3B2Y A;  1I21 A;  3KAS A;  4R57 A;  1VHS A;  3DGV A;  4AG9 A;  2BCO A;  3NFZ A;  1ZG7 A;  5HVH A;  4RN7 A;  4FWU A;  3L2N A;  3KQZ A;  4MFQ A;  1PUA A;  1TXR A;  1XMB A;  2HUZ A;  4UFX A;  3TT2 A;  1XMT A;  2Y0M A;  3K9T A;  4LQ6 A;  4H6Z A;  4NF1 A;  4PK3 A;  1KUY A;  1IOF A;  2ZW6 A;  4NGP A;  3FJU A;  1KZF A;  4E0A A;  1TIQ A;  2PJ3 A;  1YLE A;  2EWB A;  1U6M A;  2C27 A;  5G1Z A;  4CYQ A;  2V8V A;  4A30 A;  2JDC A;  5I0C A;  5LYI A;  5IB0 A;  1QST A;  5IV0 A;  3QB8 A;  5HVG A;  4UEF A;  3BJ7 A;  3IFE A;  2YGW A;  1VKC A;  2J9A A;  4CYN A;  1YK3 A;  4L89 A;  1I1D A;  5DWN A;  3S6K A;  5LRG A;  4CAE A;  1LAM A;  1FY7 A;  5EBV A;  4E2A A;  2VZY A;  1R43 A;  2OZG A;  3FB3 A;  2JLM A;  4MMO A;  3GKR A;  3IIB A;  2DPS A;  3TO9 A;  4CRY B;  2CTB A;  2PJ5 A;  4A38 A;  1V0C A;  1YSJ A;  2FVG A;  2J8R A;  3B3T A;  3MGD A;  1M1D A;  4TNU A;  3EC4 A;  2B58 A;  3PEI A;  4JYW A;  5LYD A;  3BI1 A;  1S60 A;  1NSA A;  4ORF A;  2VL1 A;  2ARH A;  1NSL A;  5HMN A;  4IUS A;  4PK2 A;  2Q44 A;  2FCK A;  2CNT A;  3LWU A;  3SXO A;  4KOU A;  4L8A A;  3H8F A;  3IJ3 A;  4KLV A;  3B3C A;  1A2Z A;  4UWI A;  3SJG A;  5J8F A;  2Z3K A;  1HDQ A;  2I00 A;  3FNC A;  4KSA A;  1XFO A;  2AFO A;  3FH4 A;  4RS2 A;  2GFQ A;  1IID A;  2OH1 A;  1X12 A;  4B12 A;  3I3G A;  2Z3M A;  2PJC A;  4MI4 A;  4ZBG A;  3BJ8 A;  4K30 A;  7CPA A;  1M4I A;  1R3N A;  5AG7 A;  2G9D A;  2JEW A;  1PYT B;  1TF8 A;  1WWZ A;  4ZX8 A;  4MBU A;  2PRB A;  5LRJ A;  2VXK A;  5DWM A;  4A32 A;  4P4B A;  2X7B A;  4I49 A;  4KOR A;  1IU8 A;  2OU2 A;  1S3Z A;  3LAC A;  2ZEF A;  3QAY A;  4QC6 A;  5D8N A;  4B5P B;  3P2F A;  3CPA A;  2FE7 A;  4NGN A;  4X2T A;  1QSR A;  4P4I A;  2XEI A;  1TKH A;  1XRY A;  1Y7E A;  1Z4E A;  3D7G A;  3I1U A;  3F5B A;  3FEC A;  4EWT A;  3H5Z A;  4EVY A;  3DDD A;  1IB1 E;  4Q38 A;  2CF4 A;  2EO8 A;  5CPA A;  4YWY A;  2Q7B A;  1YW6 A;  4C2Y A;  3FMC A;  3KKW A;  3TO7 A;  2ZEN A;  3SI2 A;  3FF3 A;  4OC1 A;  3TOA A;  4CGL A;  4BD9 A;  4W9Y A;  2R98 A;  5JM6 A;  3G3S A;  3CPX A;  2Q43 A;  1GYT A;  3KQX A;  1ZLI A;  4XPL A;  4DNC A;  3V7Z A;  4CRZ B;  3JVN A;  2V8H A;  1Z9U A;  5AG5 A;  5LYF A;  1IOI A;  1XE4 A;  2K5T A;  2Q0Y A;  4BBH A;  4OC0 A;  2Q7S A;  4JJX A;  3R9G A;  4X5K A;  2PJA A;  1LCP A;  3H8G A;  3PB9 X;  5HVF A;  1QQ9 A;  5F47 A;  3KZW A;  2EBJ A;  2YNC C;  5LYL A;  3GY9 A;  3NH4 A;  3VH9 A;  4MCS A;  4A39 A;  2V8D A;  2BOA A;  2PJ6 A;  3GYA A;  4HPS A;  4R8F A;  1YW4 A;  1CP7 A;  1KUX A;  2ZED A;  2VBQ A;  1YX0 A;  2WYR A;  2Q51 A;  1X10 A;  3RBU A;  4J3G A;  5KTA A;  4UBR A;  3T9Y A;  3N5F A;  2AFX A;  2OOT A;  1TKF A;  4PSX A;  2Z10 A;  2Z3N A;  1AYE A;  5ELY A;  1BOB A;  1B6B A;  3GIU A;  2PJB A;  1VIX A;  3NE7 A;  5CNP A;  5F48 A;  2AE6 A;  2D4P A;  2V8G A;  3CDX A;  1AUG A;  4P45 A;  4YRH A;  1YVK A;  4EME A;  2HQY A;  3CXQ A;  3R96 A;  1P0H A;  4MHN A;  2HV2 A;  3KHX A;  2V77 A;  4KVX A;  3EO4 A;  4OKO A;  2PJ7 A;  4CGP A;  2WSA A;  3IEH A;  3S6F A;  1RXT A;  4MFP A;  5C88 A;  1LAP A;  1Z4R A;  3RNZ A;  3SXN A;  4CAV A;  5G22 A;  2Z3L A;  5K8M A;  1IGB A;  4Z65 A;  4KUA A;  4NSQ A;  2PRQ A;  2IJZ A;  4B11 A;  3LMS A;  4MFJ A;  4M3S A;  1Q2C A;  5JH9 A;  3S9L A;  4YFJ A;  1LFW A;  2ZEH A;  5H84 A;  2CNS A;  2JEV A;  5D29 A;  1BAV A;  5ISV A;  4B5O A;  4UFV A;  3B35 A;  1LRZ A;  4FAI A;  5K8N A;  1MJA A;  4R7M A;  1CM0 A;  2G3A A;  4CPA A;  2Q4Z A;  3IU1 A;  4UWJ A;  4BIN A;  4QUS A;  4CGO A;  1Z8W A;  4DJL A;  2ZOG A;  4PPZ A;  4M6I A;  4NJQ A;  2VEZ A;  3DNS A;  4KS9 A;  1ZO0 A;  1H8L A;  3FVL A;  4CYO A;  3CZX A;  1Q2D A;  4JXR A;  1BLL E;  1YVO A;  3N7Z A;  1YQE A;  2IL4 A;  1ZG8 A;  4PQA A;  3B3W A;  3S9N A;  3SJE A;  1J4J A;  1CG2 A;  2RC4 A;  4UA3 A;  3RZA A;  4F9U A;  4OIW A;  3VWE A;  2ZOF A;  3W6X A;  4F6A A;  1N71 A;  4PSW A;  2XEJ A;  2ZEE A;  5EC4 A;  3PZJ A;  2B3V A;  3NH8 A;  3VAT A;  4AVA A;  2G0B A;  4EFD A;  4MHY A;  3EY5 A;  3JUW A;  4CGN A;  1HDU A;  2PJ2 A;  2B5G A;  2PQ8 A;  2POK A;  3QAH A;  1MJB A;  4P4D A;  1MK4 A;  1TKJ A;  2XEF A;  4JZ0 A;  1K4J A;  5THW A;  4OAE A;  4JD6 A;  4OC2 A;  4KOT A;  4NEX A;  3PB6 X;  1B87 A;  2GE3 A;  2O28 A;  5A28 A;  4NGT A;  3FRM A;  4NGM A;  2Z3P A;  1S7L A;  1Y0R A;  3D66 A;  1QMU A;  3R1K A;  3F8K A;  4A94 A;  2B4D A;  2YNC A;  4JLY A;  2IMO A;  3P2H A;  1AMP A;  1NE9 A;  3H8E A;  3S6G A;  1ELL P;  4NFR A;  1Y7R A;  4UFW A;  2CNM A;  1WK4 A;  2CY2 A;  2VZZ A;  3BHX A;  4XPD B;  3RYO A;  3EFA A;  2EUI A;  4KOW A;  3PP9 A;  3TFY A;  1XEB A;  5K8O A;  2IQ6 A;  4Q36 A;  4CAX A;  1Z2L A;  3D68 A;  2EK9 A;  4XPK A;  2BSW A;  4NGQ A;  3PB8 X;  1UWY A;  1Z5R A;  2BO9 A;  4ZI6 A;  3C26 A;  4NJR A;  4U9Y A;  2GLF A;  2JBJ A;  1IYL A;  1BPN A;  1ON0 A;  2J8N A;  6CPA A;  2Q04 A;  3JTK A;  3FIX A;  3PGP A;  3PFE A;  4ZY0 A;  4F0X A;  3ISX A;  2GU2 A;  2WPW A;  1Z8T A;  3PFO A;  3WC7 A;  2AFM A;  4PV6 A;  1XBU A;  2FL4 A;  2OR4 A;  4KVO E;  4R3K A;  4ZY2 A;  2YND A;  4C68 A;  4MCR A;  4F0Y A;  3PB4 X;  2PIZ A;  4A2Z A;  2OZH A;  1DTD A;  4RUH A;  1Y0Y A;  2QML A;  2WZN A;  4MRI A;  3SI1 A;  1M4G A;  1Q2Y A;  3FEE A;  4KVM E;  3TOB A;  5E96 A;  3WAB A;  4O23 A;  4GS4 A;  4HKF A;  4AVC A;  2PVV A;  1PU9 A;  3D4U A;  3FBU A;  2RB7 A;  4NGS A;  1QSO A;  3TTH A;  4M6H A;  2PR1 A;  3PBE A;  4JXQ A;  2ODF A;  4X3R A;  3IGR A;  4H6U A;  4Q7A A;  3B8G A;  1GHE A;  3CXP A;  3K2K A;  3UY5 A;  2ZXV A;  4MY0 A;  4FUU A;  4OAD A;  2G3T A;  4DUK A;  4AB7 A;  4C7H A;  3BI0 A;  2C1C A;  5BWA B;  4CAW A;  4LUA A;  1L0C A;  1QSM A;  1BPM A;  4U5Y A;  3SHP A;  4MY3 A;  4P4J A;  4A33 A;  3SJF A;  1S7N A;  5CBM A;  2F5I A;  4OC5 A;  2HB6 A;  4IHM A;  1VHO A;  5LRK A;  4BMH A;  2Z0Z A;  4B14 A;  2REE A;  1I12 A;  5DS0 A;  1VHE A;  4F8Z A;  3GLJ A;  1XF8 A;  1CJW A;  1ELM P;  3ZZI A;  2YNE A;  2GIV A;  4FD5 A;  4JWP A;  3W91 A;  2PR8 A;  1RO5 A;  1XIX A;  3KR5 A;  2A4N A;  1Q7L A;  2DPT A;  3QNV A;  3NE8 A;  4HNX B;  4A37 A;  5KTC A;  2OZU A;  2Z3O A;  4ONU A;  3SJX A;  2P6F A;  4OID A;  1IYK A;  3IWG A;  2WPX A;  3FYN A;  4OP4 A;  3IU2 A;  2NYQ A;  4PXC A;  4H89 A;  4M85 A;  4UEZ A;  4OME A;  2AFW A;  3PBB A;  1LAN A;  2FSR A;  2ZEL A;  3SI0 A;  4K3N A;  2QIR A;  5G21 A;  2PJ4 A;  3BLN A;  2ZW7 A;  4MHZ A;  2QVP A;  4P44 A;  4GXH A;  5AGE A;  2PC1 A;  1MJ9 A;  2Q4Y A;  3R9E A;  3KI9 A;  2ZPA A;  4IK2 A;  1VGY A;  2Q4V A;  4XNH B;  2D4O A;  4KSF A;  3V38 A;  5J8C A;  3OWC A;  1PCA A;  1Z8X A;  3EXN A;  4M6G A;  4OLL A;  2BEI A;  5J1Q A;  4UIB A;  1CPS A;  1CPX A;  2GLJ A;  3PRT A;  4TWE A;  3D7F A;  4C7I A;  3TE4 A;  3JRU A;  4QVT A;  4KUB A;  2NMT A;  1JWQ A;  4MFK A;  3NH5 A;  4MHD A;  4Y49 B;  3D67 A;  4P4E A;  2FS5 A;  5AG6 A;  4ZY1 A;  2NSM A;  2CTC A;  3KL9 A;  4MXU A;  4UF4 A;  2DXQ A;  4B10 A;  4PXB A;  3TCV A;  4PXE A;  4C2Z A;  4CS0 B;  3B3V A;  4R9M A;  2R7H A;  1ARL A;  4A31 A;  5FVJ A;  4B13 A;  3D7H A;  4H2K A;  3LD2 A;  2PCU A;  1YGH A;  5K8P A;  5C82 A;  2FT0 A;  4WWV A;  2GRE A;  2JDD A;  4KOY A;  4UCP A;  4U9Z A;  2JBK A;  3RAM A;  2ATR A;  3FXT A;  3MN8 A;  1KUV A;  2BL1 A;  1Y9W A;  1XJO A;  2PJ1 A;  1RTQ A;  3FX6 A;  2RFH A;  3GUX A;  4KOX A;  1F2P A;  2CIJ A;  1Y9K A;  2B5G B;  3B3S A;  3RO0 A;  2DF5 A;  1M4D A;  4MCQ A;  4HNY B;  3D2M A;  4R76 A;  5EMI A;  4OC3 A;  4MFL A;  2FIA A;  4ZGY B;  2PJ9 A;  3T90 A;  1JQG A;  5HXD A;  1CBX A;  1HEE A;  1XOV A;  2PIY A;  2ABZ A;  3DR8 A;  1SQH A;  2AFS A;  1F2O A;  2AJ6 A;  4KLW A;  5G20 A;  3S9M A;  3DSB A;  2EK8 A;  4LQG A;  4FD4 A;  3NA6 A;  2ZEO A;  3IO1 A;  4P4F A;  4II9 A;  2QEC A;  4KSI A;  1KWM A;  2B4D B;  4WJB A;  5GCN A;  2O4H A;  5JQ4 A;  2PSW A;  3MRU A;  4B6Z A;  3D7D A;  2ANP A;  4YGO A;  4ZX9 A;  3HUV A;  4NXY A;  1YR0 A;  1UFH A;  3E0K A;  3S6H A;  1CP6 A;  3HLP A;  2R8V A;  3WC5 A;  1P4N A;  4MHP A;  3ISZ A;  3WR7 A;  3DLJ A;  4E8O A;  1YLO A;  4XNH C;  4YU9 A;  3IWW A;  8CPA A;  2QYV A;  2QJ8 A;  3ZJ0 A;  4R3L A;  4CGM A;  3KGQ A;  1CX8 A;  2AFU A;  2PJ0 A;  4MJ8 A;  1BO4 A;  1QSN A;  5I4M A;  1EE3 P;  2FIW A;  3D3S A;  2C6P A;  4LX9 A;  4A95 A;  4NCZ A;  2XEG A;  4Y49 C;  2GAN A;  1FT7 A;  4B5P A;  4UEE A;  1DE4 C;  1S7K A;  4ZYQ A;  1IY7 A;  1M44 A;  2EVN A;  3IWE A;  4C2X A;  4X8I A;  2P0W A;  5F09 A;  4RI1 A;  2ZW4 A;  3W6S A;  2H5M A;  4NGR A;  3B7I A;  1TF9 A;  4AG7 A;  4F9V A;  4G1P A;  1ZG9 A;  1FNO A;  2AFZ A;  2ZEG A;  2P6G A;  4UIA A;  2Z11 A;  3VAR A;  4CYP A;  2VI7 A;  1S7F A;  4FD6 A;  5IX3 A;  2I3C A;  2KCW A;  1R57 A;  2F7V A;  3A9L A;  3LOD A;  2PDO A;  1S5K A;  4FD7 A;  3R9F A;  2DEA A;  3TO6 A;  2REF A;  3KHZ A;  2PJ8 A;  3KR4 A;  2F8H A;  3D2P A;  4UCN A;  3WT4 A;  5A27 A;  5AG4 A;  3D8P A;  5F49 A;  4P6Y A;  3TC8 A;  1YME A;  4P10 A;  4MFZ A;  4QBJ A;  4OC4 A;  3CT9 A;  3I9S A;  1Z8L A;  4MCP A;  2PVW A;  5KTD A;  5JGF A;  2C6C A;  2ZEP A;  4XPD C;  4R87 A;  4KOV A;  2CXA A;  3PB7 X;  4R6T A;  3G8W A;  4KZT A;  2ZEM A;  4IF5 A;  4AXV A;  4IAV A;  4KOS A;  1M4L A;  1NMT A;  5JPH A;  5HH1 A;  2P6E A;  3GB0 A;  5F46 A;  2BUE A;  3TX8 A;  1F57 A;  1OZP A;  3H4Q A;  2WUU A;  4AVB A;  4GM5 A;  3CXS A;  3V8I A;  2B4B A;  3F0A A;  3FED A;  2VQY A;  5H86 A;  4HNW B;  2OB0 A;  3DR6 A;  3K9U A;  1OBR A;  2FXF A;  3T8W A;  3WC6 A;  4DYO A;  1ARM A;  2C6G A;  2R1I A;  3R95 A;  3IC1 A;  2I79 A;  1YRE A;  2B3U A;  2O53 A;  4PXD A;  3BXM A;  4UCM A;  4ONW A;  4FBE A;  4CAF A;  1ZLH A;  3VWD A;  1LOK A;  1IIC A;  5IB9 A; 
#chains in the Genus database with same CATH homology
 4QB9 A;  2J8M A;  2ZW5 A;  1I21 A;  4R57 A;  1VHS A;  4AG9 A;  4MFQ A;  1PUA A;  2HUZ A;  3TT2 A;  4UFX A;  1XMT A;  2Y0M A;  4H6Z A;  4NF1 A;  4PK3 A;  1KUY A;  2ZW6 A;  4E0A A;  1KZF A;  1TIQ A;  1YLE A;  1U6M A;  2C27 A;  5G1Z A;  4CYQ A;  4A30 A;  2JDC A;  5I0C A;  5IB0 A;  1QST A;  5IV0 A;  3QB8 A;  3BJ7 A;  2YGW A;  1VKC A;  4CYN A;  1YK3 A;  4L89 A;  1I1D A;  5DWN A;  3S6K A;  4CAE A;  4E2A A;  1FY7 A;  5EBV A;  2VZY A;  2OZG A;  3FB3 A;  2JLM A;  3GKR A;  2DPS A;  3TO9 A;  4CRY B;  1V0C A;  2J8R A;  3MGD A;  1M1D A;  3EC4 A;  2B58 A;  1S60 A;  4ORF A;  2ARH A;  1NSL A;  5HMN A;  4IUS A;  4PK2 A;  2Q44 A;  2FCK A;  2CNT A;  3SXO A;  4KOU A;  4L8A A;  4KLV A;  4UWI A;  5J8F A;  2Z3K A;  2I00 A;  3FNC A;  4KSA A;  4RS2 A;  1IID A;  2OH1 A;  4B12 A;  3I3G A;  2Z3M A;  4ZBG A;  4MI4 A;  3BJ8 A;  4K30 A;  1M4I A;  5AG7 A;  1WWZ A;  4MBU A;  2PRB A;  2VXK A;  5DWM A;  4A32 A;  2X7B A;  4I49 A;  4KOR A;  2OU2 A;  1S3Z A;  4B5P B;  4QC6 A;  3P2F A;  2FE7 A;  1QSR A;  1Z4E A;  3F5B A;  3H5Z A;  4EVY A;  3DDD A;  1IB1 E;  4Q38 A;  2Q7B A;  4C2Y A;  3KKW A;  3TO7 A;  3TOA A;  4CGL A;  2R98 A;  3G3S A;  4XPL A;  4DNC A;  4CRZ B;  3JVN A;  1Z9U A;  5AG5 A;  2K5T A;  1XE4 A;  2Q0Y A;  4BBH A;  4JJX A;  3R9G A;  4X5K A;  5F47 A;  2YNC C;  3GY9 A;  3GYA A;  1KUX A;  2VBQ A;  1YX0 A;  4J3G A;  5KTA A;  4UBR A;  3T9Y A;  4PSX A;  2Z10 A;  2Z3N A;  1BOB A;  1B6B A;  3NE7 A;  5CNP A;  5F48 A;  2AE6 A;  2D4P A;  4YRH A;  1YVK A;  2HQY A;  3CXQ A;  3R96 A;  1P0H A;  2HV2 A;  4KVX A;  3EO4 A;  4CGP A;  2WSA A;  3S6F A;  1RXT A;  4MFP A;  5C88 A;  1Z4R A;  3SXN A;  4CAV A;  5G22 A;  2Z3L A;  4KUA A;  4NSQ A;  4B11 A;  4MFJ A;  4M3S A;  1Q2C A;  4YFJ A;  5H84 A;  2CNS A;  2JEV A;  5ISV A;  4B5O A;  4UFV A;  1LRZ A;  1MJA A;  1CM0 A;  2G3A A;  4CGO A;  3IU1 A;  4UWJ A;  4QUS A;  2VEZ A;  3DNS A;  4KS9 A;  1ZO0 A;  4CYO A;  1Q2D A;  4JXR A;  1YVO A;  3N7Z A;  2IL4 A;  1J4J A;  2RC4 A;  4UA3 A;  4F6A A;  3VWE A;  3W6X A;  1N71 A;  4PSW A;  5EC4 A;  4AVA A;  3PZJ A;  2B3V A;  2G0B A;  3EY5 A;  3JUW A;  4CGN A;  2B5G A;  2PQ8 A;  3QAH A;  1MJB A;  1MK4 A;  1K4J A;  4OAE A;  4JD6 A;  4KOT A;  4NEX A;  1B87 A;  2GE3 A;  2O28 A;  5A28 A;  3FRM A;  2Z3P A;  1S7L A;  3R1K A;  3F8K A;  2B4D A;  2YNC A;  4JLY A;  3P2H A;  1NE9 A;  3S6G A;  1Y7R A;  4UFW A;  2CNM A;  1WK4 A;  2CY2 A;  2VZZ A;  4XPD B;  3RYO A;  3EFA A;  2EUI A;  4KOW A;  3PP9 A;  3TFY A;  1XEB A;  4Q36 A;  4CAX A;  4XPK A;  2BSW A;  3C26 A;  4U9Y A;  1IYL A;  1ON0 A;  2J8N A;  2Q04 A;  3JTK A;  3FIX A;  3PGP A;  4F0X A;  2WPW A;  4PV6 A;  2FL4 A;  4KVO E;  4C68 A;  4R3K A;  2YND A;  4F0Y A;  4A2Z A;  2OZH A;  2QML A;  1M4G A;  1Q2Y A;  3TOB A;  5E96 A;  4GS4 A;  4HKF A;  4AVC A;  1PU9 A;  3FBU A;  1QSO A;  3TTH A;  2PR1 A;  4JXQ A;  3IGR A;  4H6U A;  3B8G A;  1GHE A;  3CXP A;  3UY5 A;  2ZXV A;  4MY0 A;  4OAD A;  2G3T A;  4AB7 A;  4C7H A;  5BWA B;  4CAW A;  4LUA A;  1L0C A;  1QSM A;  4U5Y A;  3SHP A;  4MY3 A;  4A33 A;  1S7N A;  2F5I A;  4BMH A;  2Z0Z A;  4B14 A;  2REE A;  1I12 A;  1XF8 A;  1CJW A;  3ZZI A;  2YNE A;  2GIV A;  4FD5 A;  4JWP A;  3W91 A;  2PR8 A;  1RO5 A;  1XIX A;  2A4N A;  2DPT A;  4HNX B;  5KTC A;  2OZU A;  2Z3O A;  4ONU A;  2P6F A;  1IYK A;  3IWG A;  2WPX A;  3FYN A;  3IU2 A;  4H89 A;  4M85 A;  2FSR A;  2QIR A;  5G21 A;  3BLN A;  2ZW7 A;  5AGE A;  2PC1 A;  1MJ9 A;  2Q4Y A;  3R9E A;  2ZPA A;  2Q4V A;  4XNH B;  2D4O A;  4KSF A;  5J8C A;  3OWC A;  3EXN A;  4OLL A;  2BEI A;  4C7I A;  3TE4 A;  4QVT A;  4KUB A;  2NMT A;  4MFK A;  4MHD A;  4Y49 B;  2FS5 A;  5AG6 A;  2DXQ A;  4B10 A;  3TCV A;  4C2Z A;  4CS0 B;  4R9M A;  2R7H A;  4A31 A;  5FVJ A;  4B13 A;  3LD2 A;  1YGH A;  5C82 A;  2FT0 A;  2JDD A;  4KOY A;  4UCP A;  4U9Z A;  2ATR A;  3FXT A;  1KUV A;  2BL1 A;  1Y9W A;  4KOX A;  1Y9K A;  2B5G B;  1M4D A;  4HNY B;  3D2M A;  4ZGY B;  4MFL A;  2FIA A;  3T90 A;  3DR8 A;  1SQH A;  2AJ6 A;  4KLW A;  5G20 A;  3DSB A;  4FD4 A;  4II9 A;  2QEC A;  2B4D B;  5GCN A;  5JQ4 A;  2PSW A;  4YGO A;  4NXY A;  1YR0 A;  1UFH A;  3E0K A;  3S6H A;  2R8V A;  3WR7 A;  1P4N A;  4E8O A;  4XNH C;  3ZJ0 A;  4R3L A;  4CGM A;  4MJ8 A;  1BO4 A;  1QSN A;  2FIW A;  3D3S A;  4LX9 A;  4A95 A;  4NCZ A;  4Y49 C;  2GAN A;  4B5P A;  1S7K A;  1M44 A;  2EVN A;  3IWE A;  4C2X A;  2P0W A;  4RI1 A;  2ZW4 A;  3W6S A;  2H5M A;  4AG7 A;  2P6G A;  4CYP A;  2Z11 A;  2VI7 A;  1S7F A;  4FD6 A;  5IX3 A;  2KCW A;  4FD7 A;  1R57 A;  3A9L A;  3LOD A;  2PDO A;  1S5K A;  3R9F A;  3TO6 A;  2REF A;  3D2P A;  4UCN A;  5A27 A;  5AG4 A;  3D8P A;  5F49 A;  4MFZ A;  4QBJ A;  3I9S A;  5KTD A;  4XPD C;  4R87 A;  4KOV A;  2CXA A;  3G8W A;  4KZT A;  4IF5 A;  4KOS A;  1NMT A;  5JPH A;  5HH1 A;  2P6E A;  5F46 A;  2BUE A;  1OZP A;  3H4Q A;  2WUU A;  4AVB A;  3CXS A;  3V8I A;  2B4B A;  3F0A A;  2VQY A;  5H86 A;  4HNW B;  2OB0 A;  3DR6 A;  3K9U A;  2FXF A;  2R1I A;  3R95 A;  2I79 A;  1YRE A;  2B3U A;  4UCM A;  4CAF A;  4KVM E;  3VWD A;  1IIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...