5IX3A

Crystal structure of n-acetyltransferase from staphylococcus aureus.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
AMKLRALEYSDLLFVHELNNEYSIMSYWFEEPYESLTELQHLFDKHLLDESERRFIVEDENQVVGIVELVEINYIHRNCEIQIIIKPEFSGKGYAKFAFEKAIIYAFNILNMHKIYLYVDADNKKAIHIYESEGFKTEGLLKEQFYTKGKYKDAYFMSLLKSEYIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine N-acetyltransferase
publication title Crystal structure of N-acetyltransferase from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ix3A00
4E2AA 4XNHB 1GHEA 1I12A 3FRMA 2FT0A 2Q04A 4KUBA 3ZZIA 4I49A 1LRZA 5F49A 1XE4A 4Y49C 3FIXA 1KZFA 2G3AA 1TIQA 2ZPAA 1R57A 2VZYA 1L0CA 2PC1A 2Z11A 4KORA 5H86A 4R3KA 2OU2A 4HNXB 1UFHA 2OH1A 2DXQA 1S7FA 1OZPA 4NF1A 4R3LA 2ZW7A 3R9FA 2Q7BA 4KUAA 2G0BA 1NSLA 3CXPA 2Z0ZA 4J3GA 4L8AA 4IUSA 3TCVA 1Z4RA 4FD4A 3WR7A 3BLNA 3V8IA 3TO9A 2R1IA 4RS2A 5JPHA 2C27A 4PSXA 2IL4A 3TOAA 3TO7A 4AG9A 2PDOA 4R9MA 3C26A 1J4JA 3BJ8A 1M4DA 4HKFA 1WK4A 1M4IA 4AVAA 4UWJA 3GKRA 3NE7A 4JXQA 3FBUA 4HNWB 3VWEA 3VWDA 2FSRA 3S6KA 1U6MA 3S6FA 5DWNA 5C88A 3R95A 4DNCA 4LUAA 1YK3A 2PR8A 3DNSA 2PR1A 3E0KA 5J8CA 4PK2A 3W6SA 3DSBA 1YREA 3P2FA 4NCZA 2FL4A 2P6GA 4FD6A 2REFA 1NMTA 5HMNA 2X7BA 3KKWA 1M1DA 2B58A 3CXSA 3ZJ0A 1YX0A 4QC6A 3GYAA 2WPXA 3FYNA 4M3SA 4JLYA 1M4GA 3W91A 1P0HA 4AVBA 2ZXVA 3EXNA 1PU9A 2J8MA 2B4BA 2B3UA 4KVME 1B87A 2NMTA 3B8GA 2GIVA 4KOWA 3TE4A 2B4DA 1I21A 2VQYA 5EBVA 4JD6A 1BO4A 3PP9A 4R87A 5CNPA 4OLLA 4YGOA 3TTHA 3OWCA 1KUYA 2P6EA 3R9EA 3QAHA 4U9ZA 2PSWA 2CNSA 1Q2YA 1QSTA 4KOUA 4CS0B 1N71A 1MK4A 2HQYA 4QVTA 1Q2CA 4AG7A 1Y9WA 4UWIA 2VZZA 2PRBA 4KOTA 4CAWA 1K4JA 4B5PA 3SXOA 1BOBA 3MGDA 4MJ8A 3CXQA 2KCWA 5KTCA 3IGRA 3K9UA 3EY5A 5IB0A 4PSWA 2R8VA 1ON0A 4RI1A 3F0AA 5KTAA 3SHPA 2REEA 4JXRA 4XPDB 4OADA 3IWGA 4XNHC 2JDDA 2JDCA 3D2PA 3P2HA 1B6BA 2RC4A 3F8KA 3LD2A 1QSOA 3G3SA 3N7ZA 3I9SA 2BL1A 2JLMA 2Q4VA 3T90A 4L89A 5E96A 2AJ6A 1IYKA 3R9GA 5IX3A 5H84A 3S6GA 1RO5A 4IF5A 2CNTA 4KOYA 4KOSA 2OZHA 1Q2DA 4ZBGA 4PK3A 2CY2A 2FIWA 2B3VA 4Y49B 3FB3A 4NXYA 2OZUA 1S7LA 4ONUA 1V0CA 2BEIA 4R57A 2QMLA 2GE3A 4CAVA 2I79A 1VKCA 5FVJA 2J8NA 4QBJA 4AVCA 1KUXA 2QECA 3R1KA 2D4PA 2ATRA 2AE6A 3PZJA 2Y0MA 4HNYB 2EUIA 2R7HA 1MJBA 1WWZA 2HV2A 1NE9A 1YVKA 1QSMA 2QIRA 1M44A 1YLEA 4UA3A 2B4DB 4JWPA 5IV0A 2B5GA 4U5YA 3BJ7A 4BMHA 2P0WA 4E8OA 4KLVA 4JJXA 4CAXA 1Y9KA 3FNCA 5HH1A 4XPDC 3LODA 2O28A 4M85A 1S3ZA 4YRHA 4UBRA 5ISVA 4B5OA 3RYOA 1S5KA 1Z9UA 3PGPA 4U9YA 3UY5A 5GCNA 4QB9A 5DWMA 3EFAA 4H89A 4KOVA 1RXTA 2BSWA 4E0AA 3SXNA 3W6XA 1VHSA 3TT2A 3EO4A 3D2MA 5EC4A 4B5PB 1S60A 5JQ4A 3QB8A 4PV6A 1S7KA 2P6FA 4GS4A 5KTDA 3H4QA 4H6UA 2A4NA 1QSNA 4MY0A 3DR8A 2VI7A 3JUWA 1SQHA 4LX9A 3T9YA 4MHDA 4X5KA 2ARHA 4KZTA 2I00A 4XPKA 5F46A 2ZW5A 2EVNA 1XEBA 1YVOA 3R96A 1MJ9A 3TO6A 3F5BA 4ORFA 2WPWA 3DR6A 3EC4A 4MY3A 1XMTA 1MJAA 2ZW4A 2K5TA 3G8WA 2Q4YA 4KVOE 1IICA 2FS5A 4NSQA 4FD5A 4QUSA 5I0CA 1IIDA 4OAEA 4XPLA 2GANA 4AB7A 1YR0A 2FIAA 2H5MA 4KVXA 4EVYA 2R98A 2PQ8A 2VXKA 4CRYB 1P4NA 1YGHA 1CJWA 4F0YA 3FXTA 3GY9A 4FD7A 2VEZA 1FY7A 1IB1E 2OB0A 4CRZB 2G3TA 2BUEA 1XIXA 3I3GA 3D8PA 4F6AA 2Z10A 5J8FA 3DDDA 2HUZA 1I1DA 4KOXA 2B5GB 2FXFA 2CNMA 2ZW6A 2JEVA 1KUVA 3S6HA 4YFJA 1QSRA 3JVNA 3D3SA 1CM0A 2OZGA 5C82A 4K30A 3TOBA 4H6ZA 4KLWA 4NEXA 2F5IA 1Z4EA 4MBUA 1Y7RA 1IYLA 2Q0YA 2J8RA 2VBQA 2FCKA 4MI4A 1XF8A 1PUAA 5F48A 2D4OA 2FE7A 3TFYA 1S7NA 4II9A 2Q44A 5F47A
chains in the Genus database with same CATH superfamily
3FF3A 3IIBA 4E2AA 2C6GA 4XNHB 4H2KA 4MMOA 1GHEA 3IFEA 1I12A 1IOIA 2PJ7A 1BAVA 4WJBA 3KHZA 4CYPA 2EK9A 3FRMA 2FT0A 4MCPA 2Q04A 4KUBA 1ARLA 3ZZIA 4I49A 1LRZA 2DPTA 4EFDA 5F49A 2DPSA 4A37A 1XE4A 4B13A 4Y49C 1ELLP 3FIXA 1LANA 4TNUA 2BCOA 2HC9A 5JGFA 4B11A 3FH4A 2CTCA 1KZFA 2GFQA 2G3AA 1YW4A 7CPAA 4EMEA 4FUUA 4NGMA 1YMEA 1TIQA 2ZPAA 4HPSA 1LOKA 2Z3PA 4UFWA 1R57A 5CBMA 5K8NA 2VZYA 4G1PA 1L0CA 3D4UA 2PC1A 2Z11A 4KORA 4A39A 4C2YA 5K8MA 5H86A 3D68A 4R3KA 2XEJA 2OU2A 4HNXB 5G21A 5A27A 1UFHA 2OH1A 3SI1A 2DXQA 2AFZA 1S7FA 3LACA 1OZPA 2GLJA 4NF1A 5HVHA 2GREA 2DF5A 4R3LA 3S9MA 2ZW7A 1FT7A 2POKA 4OC3A 3R9FA 2Q7BA 1IGBA 4KUAA 4PQAA 2G0BA 1NSLA 3CXPA 2Z0ZA 4J3GA 2YNCC 2JBJA 4L8AA 2JEWA 4IUSA 3TCVA 1Z4RA 4FD4A 4UEEA 3KQZA 4A95A 3WR7A 2XEIA 3BLNA 4B6ZA 4C68A 4CGNA 2YNDA 4DYOA 3V8IA 1IOFA 1TXRA 2R1IA 2AFUA 3BXMA 4RS2A 3TO9A 4BD9A 4ZY1A 5JPHA 2ZEPA 4M6GA 2C27A 2ZEMA 4PSXA 5AG5A 1ZLIA 2IL4A 3TOAA 3TO7A 4F9UA 4AG9A 2CF4A 2PDOA 1Z8LA 4R9MA 2CTBA 4CGLA 3C26A 1J4JA 2Q4ZA 3BJ8A 1YLOA 4MCRA 2PJ1A 4C2XA 1M4DA 4HKFA 3A9LA 5K8PA 1WK4A 1M4IA 5J1QA 3D7HA 4AVAA 4OMEA 4UWJA 4OC1A 1DTDA 2PE3A 5HVFA 1DE4C 2AFSA 3GKRA 3PB6X 1XJOA 5AGEA 3NE7A 3SI0A 1Z5RA 3FBUA 4JXQA 4PXDA 4HNWB 2QYVA 2HB6A 4NGPA 2FSRA 2Q51A 1U6MA 3S6KA 3VWEA 3VWDA 3FECA 3S6FA 4KSAA 5DWNA 3KGQA 5C88A 3B3WA 3R95A 4O23A 4DNCA 4LUAA 4LQ6A 1YK3A 2PR8A 3IWEA 1CX8A 3DNSA 3RAMA 5EMIA 2PR1A 3CPAA 4M6IA 4X8IA 4MCQA 1Y7EA 2ZEDA 2PJ6A 3E0KA 4F0XA 4NGTA 1BLLE 5J8CA 5LYDA 4PK2A 2ZOGA 3W6SA 3DSBA 5BWAB 5LRJA 1YREA 3P2FA 3VATA 4NCZA 4CPAA 4P4IA 2FL4A 3RNZA 2P6GA 2IMOA 4FD6A 2PJBA 4CAEA 2REFA 4MFQA 1NMTA 1IY7A 3QNVA 5HMNA 2X7BA 3KKWA 1GYTA 4X2TA 2RB7A 2AFOA 1M1DA 4PXEA 3L2NA 5JM6A 2C1CA 1LCPA 5K8OA 2B58A 1ELMP 3CXSA 3ZJ0A 1YX0A 2ZELA 4ZX8A 2ANPA 3NA6A 2J9AA 4QC6A 3GYAA 2WPXA 1F2OA 3FYNA 4M3SA 4JLYA 4W9YA 3ISXA 1M4GA 3W91A 3H5ZA 1XFOA 3D67A 1P0HA 2EO8A 2ZXVA 4AVBA 3EXNA 1LAPA 1PU9A 5ELYA 3S9LA 2J8MA 2B4BA 2C6PA 2PJ2A 2B3UA 6CPAA 4KVME 2V8VA 3FEDA 4ZYQA 1B87A 2NMTA 3B8GA 2GIVA 3PBEA 2XEFA 3PFOA 4KOWA 4OC5A 3TE4A 2B4DA 1I21A 2VQYA 1PCAA 4KSFA 5EBVA 1AYEA 1HDQA 1BPMA 3FMCA 3KHXA 4JD6A 4UCPA 4BINA 4MFKA 1BO4A 3PP9A 2YNCA 4R87A 5CNPA 3B3VA 3V7ZA 5IB9A 4OLLA 8CPAA 2FVGA 4YGOA 5JH9A 3TTHA 3OWCA 1KUYA 2AFMA 2P6EA 4ZY2A 3R9EA 3QAHA 2EK8A 4U9ZA 4MHZA 4UCMA 3PB7X 2PSWA 2VL1A 3RO0A 2CNSA 4A31A 1Q2YA 4MHYA 4P4BA 1CPSA 1QSTA 3IJ3A 4KOUA 1AMPA 3SJGA 2PJCA 4C7HA 1F57A 3NE8A 4CS0B 1N71A 1MK4A 2HQYA 1ZG9A 2CIJA 2I3CA 2Q7SA 4JZ0A 4QVTA 3VH9A 2F7VA 2G9DA 1Q2CA 2IQ6A 4EWTA 4AG7A 1Y9WA 2Z3OA 4UWIA 1RTQA 4ZY0A 1CPXA 4LQGA 2VZZA 4TWEA 1KWMA 2PRBA 3WC5A 4M6HA 3KI9A 4KOTA 4CAWA 4IAVA 4ONWA 1K4JA 4B5PA 3SXOA 2BO9A 4NGQA 1BOBA 4MFLA 1VHEA 3MGDA 4MXUA 2OOTA 4MJ8A 3CXQA 3FVLA 2KCWA 4Q38A 4BBHA 4UEZA 3NFZA 5KTCA 3IGRA 3B2YA 3K9UA 1Z2LA 1M4LA 4B10A 2BOAA 2PJ4A 4P4FA 3EY5A 4RN7A 5IB0A 3DGVA 4PSWA 3BHXA 4UCNA 2R8VA 1ON0A 3WABA 4A30A 4RI1A 2O53A 1YQEA 2NYQA 3F0AA 3K9TA 4PPZA 1AUGA 1CG2A 1TKFA 1Y0RA 4FWUA 5KTAA 3D7DA 3DLJA 4R76A 3SHPA 1LFWA 2REEA 2YGWA 4JXRA 1ZG8A 4XPDB 4OADA 2PRQA 3IWGA 3HUVA 4XNHC 4KSIA 2JDDA 2JDCA 4P4JA 2WUUA 2C6CA 2ZOFA 3D2PA 3P2HA 4MCSA 4OC0A 1B6BA 4C7IA 2RC4A 1HDUA 3F8KA 4CGPA 1CP7A 3LD2A 3N5FA 5HVGA 4B12A 3IU2A 2YNEA 1QSOA 1TF9A 2Z3KA 3G3SA 3RZAA 3D66A 3GLJA 4P44A 3PB9X 2QVPA 3N7ZA 4OC4A 3I9SA 2BL1A 2JLMA 2ODFA 2Q4VA 3T90A 4L89A 3IWWA 4Z65A 5E96A 4NGNA 4R7MA 2AJ6A 1IYKA 3R9GA 1ZG7A 3D7FA 5IX3A 5H84A 3S6GA 1RO5A 2NSMA 5A28A 3IEHA 4CYOA 4IF5A 4FBEA 2CNTA 4KOYA 4KOSA 2OZHA 1Q2DA 4ZBGA 1Z8WA 4PK3A 1A2ZA 4F9VA 2V8HA 2ABZA 3PBBA 2CY2A 2V8GA 2FIWA 3GUXA 4DUKA 2PVVA 2B3VA 3NH5A 4Y49B 3FB3A 3LWUA 3D7GA 4NXYA 2OZUA 1S7LA 2WYRA 1UWYA 2ZEFA 4ONUA 1V0CA 2BEIA 4GXHA 4R57A 4GM5A 2QMLA 4A2ZA 4ZGYB 2DEAA 2GE3A 1F2PA 4CAVA 4CYQA 2I79A 1VKCA 5FVJA 2ZEGA 3GIUA 2J8NA 2PJ0A 4NFRA 2PVWA 3MN8A 4QBJA 2AFWA 3CDXA 4AVCA 5LYFA 3FEEA 1TKJA 1KUXA 2QECA 2WZNA 3R1KA 2D4PA 2ATRA 4P4EA 2AE6A 1QMUA 3PZJA 2Y0MA 4HNYB 3H8FA 2GLFA 4P10A 2EUIA 2R7HA 4NJRA 1MJBA 1WWZA 2HV2A 1NE9A 4A38A 1YVKA 1QSMA 1YSJA 2QIRA 1M44A 1YLEA 4UA3A 2B4DB 4JWPA 3KR4A 5IV0A 4UFXA 1X12A 2B5GA 4U5YA 3BJ7A 4NGRA 5AG6A 4BMHA 2P0WA 4E8OA 3GB0A 4KLVA 4PXCA 1LAMA 2PJ9A 2F8HA 4A32A 5THWA 4JJXA 3TC8A 1CBXA 4DJLA 4CAXA 1Y9KA 3FNCA 5HH1A 5D8NA 4XPDC 3PRTA 3LODA 2O28A 4M85A 3WC7A 4P45A 1S3ZA 4YRHA 4Q7AA 4UBRA 5ISVA 4B5OA 3RYOA 1JQGA 2RFHA 4JYWA 1S5KA 3SJEA 2Z3MA 4CGOA 1Z9UA 3PGPA 4U9YA 3UY5A 5HXDA 2PIZA 2IJZA 5GCNA 3CPXA 4QB9A 5DWMA 3EFAA 4H89A 3JTKA 4KOVA 3IC1A 4IK2A 1RXTA 2BSWA 1ARMA 4IHMA 3WT4A 4E0AA 3NH4A 2CXAA 3JRUA 3SXNA 1VHOA 3W6XA 1VHSA 3BI0A 4ZI6A 3TT2A 3EO4A 2Z3NA 4MRIA 3D2MA 5EC4A 4B5PB 3LMSA 4A94A 1S60A 1H8LA 5LRKA 5JQ4A 3S9NA 4K3NA 5AG4A 4MFZA 3HLPA 3QB8A 4PV6A 4MFJA 1S7KA 1JWQA 2P6FA 4GS4A 1ZLHA 5KTDA 2OR4A 4MHNA 3H4QA 3PB8X 2A4NA 4H6UA 1QSNA 4MY0A 1TF8A 4OIDA 3DR8A 2VI7A 4CAFA 3JUWA 5F09A 1SQHA 3QAYA 4LX9A 5DS0A 1HEEA 3T9YA 1OBRA 3CZXA 4MHDA 5I4MA 4X5KA 2ARHA 3H8EA 2QJ8A 3MRUA 1Z8XA 4KZTA 2I00A 4OIWA 4ZX9A 1Y0YA 4XPKA 4P4DA 5F46A 3PFEA 4YU9A 2ZW5A 4R6TA 2EVNA 1XEBA 1YVOA 2V8DA 4KS9A 3R96A 3CT9A 1MJ9A 4UIAA 3TO6A 3FX6A 3F5BA 3T8WA 5D29A 1IU8A 4R8FA 4ORFA 2WPWA 1XBUA 5LYLA 3KZWA 4MFPA 4PXBA 3K2KA 1X10A 3DR6A 3KL9A 3EC4A 4MY3A 1XMTA 3BI1A 4OKOA 4OP4A 5G1ZA 1MJAA 3H8GA 4WWVA 2Z3LA 2V77A 2ZW4A 2K5TA 2PJ8A 3G8WA 4C2ZA 3B35A 5G20A 2Q4YA 2ZEHA 4KVOE 1IICA 2FS5A 4NSQA 4FD5A 3RBUA 1R43A 4QUSA 5I0CA 1IIDA 2ZEEA 4OC2A 3TX8A 4OAEA 4UIBA 5LYIA 4XPLA 2GANA 4AB7A 1XRYA 1YR0A 2FIAA 4CGMA 4B14A 1QQ9A 2H5MA 2WSAA 4KVXA 4EVYA 2R98A 4AXVA 2PQ8A 2VXKA 4UEFA 4CRYB 1PYTB 1P4NA 1YGHA 3B3SA 1CP6A 1CJWA 4YWYA 4P6YA 4F0YA 3FXTA 1YW6A 3GY9A 4FD7A 2VEZA 4Q36A 1EE3P 1FY7A 1IB1E 3SJFA 2OB0A 3PEIA 4CRZB 2G3TA 1Z8TA 2BUEA 3IO1A 3KR5A 1XIXA 3I3GA 4F8ZA 3D8PA 4F6AA 2JBKA 3KASA 2Z10A 5J8FA 2XEGA 4NGSA 3DDDA 2HUZA 1I1DA 1VGYA 2ZEOA 4KOXA 1BPNA 2B5GB 3B3CA 3IU1A 2FXFA 5G22A 3SI2A 1R3NA 3KQXA 1TKHA 2CNMA 4NJQA 4UF4A 2ZW6A 4FAIA 2JEVA 3ISZA 1KUVA 3PB4X 3S6HA 4YFJA 1FNOA 1QSRA 3JVNA 3SJXA 1XOVA 3D3SA 4UFVA 2PJ3A 5CPAA 3B7IA 1CM0A 1NSAA 3WC6A 2OZGA 2PCUA 1Q7LA 5C82A 4K30A 3VARA 3TOBA 1ZO0A 4H6ZA 4X3RA 4KLWA 4NEXA 4CYNA 2F5IA 2Q43A 2O4HA 1Z4EA 4MBUA 1Y7RA 3V38A 4A33A 2AFXA 1IYLA 2GU2A 2EWBA 2EBJA 2Q0YA 2J8RA 2VBQA 2FCKA 4MI4A 1XF8A 2ZENA 1XMBA 1PUAA 2PJ5A 3I1UA 5F48A 2D4OA 2FE7A 3FJUA 3TFYA 4MHPA 1S7NA 3B3TA 2PJAA 5AG7A 1VIXA 4II9A 2Q44A 5LRGA 3NH8A 2PIYA 5F47A 4RUHA
chains in the Genus database with same CATH topology
4E2AA 4XNHB 1GHEA 1I12A 4CYPA 3FRMA 2FT0A 2Q04A 4KUBA 3ZZIA 4I49A 1LRZA 2DPTA 5F49A 2DPSA 1XE4A 4B13A 4Y49C 3FIXA 4B11A 1KZFA 2G3AA 1TIQA 2ZPAA 2Z3PA 4UFWA 1R57A 2VZYA 1L0CA 2PC1A 2Z11A 4KORA 4C2YA 5H86A 4R3KA 2OU2A 4HNXB 5G21A 5A27A 1UFHA 2OH1A 2DXQA 1S7FA 1OZPA 4NF1A 4R3LA 2ZW7A 3R9FA 2Q7BA 4KUAA 2G0BA 1NSLA 3CXPA 2Z0ZA 4J3GA 2YNCC 4L8AA 4IUSA 3TCVA 1Z4RA 4FD4A 4A95A 3WR7A 3BLNA 4C68A 4CGNA 2YNDA 3V8IA 3TO9A 2R1IA 4RS2A 5JPHA 2C27A 4PSXA 5AG5A 2IL4A 3TOAA 3TO7A 4AG9A 2PDOA 4R9MA 4CGLA 3C26A 1J4JA 3BJ8A 4C2XA 1M4DA 4HKFA 3A9LA 1WK4A 1M4IA 4AVAA 4UWJA 3GKRA 5AGEA 3NE7A 4JXQA 3FBUA 4HNWB 3VWEA 3VWDA 2FSRA 3S6KA 1U6MA 3S6FA 4KSAA 5DWNA 5C88A 3R95A 4DNCA 4LUAA 1YK3A 2PR8A 3IWEA 3DNSA 2PR1A 3E0KA 4F0XA 5J8CA 4PK2A 3W6SA 3DSBA 5BWAB 1YREA 3P2FA 4NCZA 2FL4A 2P6GA 4CAEA 4FD6A 2REFA 4MFQA 1NMTA 5HMNA 2X7BA 3KKWA 1M1DA 2B58A 3CXSA 3ZJ0A 1YX0A 4QC6A 3GYAA 2WPXA 3FYNA 4M3SA 4JLYA 1M4GA 3W91A 3H5ZA 1P0HA 4AVBA 2ZXVA 3EXNA 1PU9A 2J8MA 2B4BA 2B3UA 4KVME 1B87A 2NMTA 3B8GA 2GIVA 4KOWA 3TE4A 2B4DA 1I21A 2VQYA 4KSFA 5EBVA 4JD6A 4UCPA 4MFKA 1BO4A 3PP9A 2YNCA 4R87A 5CNPA 4OLLA 4YGOA 3TTHA 3OWCA 1KUYA 2P6EA 3R9EA 3QAHA 4U9ZA 4UCMA 2PSWA 2CNSA 4A31A 1Q2YA 1QSTA 4KOUA 4C7HA 4CS0B 1N71A 1MK4A 2HQYA 4QVTA 1Q2CA 4AG7A 1Y9WA 2Z3OA 4UWIA 2VZZA 2PRBA 4KOTA 4CAWA 1K4JA 4B5PA 3SXOA 1BOBA 4MFLA 3MGDA 4MJ8A 3CXQA 2KCWA 4Q38A 4BBHA 5KTCA 3IGRA 3K9UA 4B10A 3EY5A 5IB0A 4PSWA 4UCNA 2R8VA 1ON0A 4A30A 4RI1A 3F0AA 5KTAA 3SHPA 2REEA 2YGWA 4JXRA 4XPDB 4OADA 3IWGA 4XNHC 2JDDA 2JDCA 2WUUA 3P2HA 3D2PA 4CGPA 4C7IA 5AG4A 1B6BA 2RC4A 3F8KA 3LD2A 4B12A 3IU2A 2YNEA 1QSOA 2Z3KA 3G3SA 3N7ZA 3I9SA 2BL1A 2JLMA 2Q4VA 3T90A 4L89A 5E96A 2AJ6A 1IYKA 3R9GA 5IX3A 5H84A 3S6GA 1RO5A 5A28A 4CYOA 4IF5A 2CNTA 4KOYA 4KOSA 2OZHA 1Q2DA 4ZBGA 4PK3A 2CY2A 2FIWA 2B3VA 4Y49B 3FB3A 4NXYA 2OZUA 1S7LA 4ONUA 1V0CA 2BEIA 4R57A 2QMLA 4A2ZA 4ZGYB 2GE3A 4CAVA 4CYQA 2I79A 1VKCA 5FVJA 2J8NA 4QBJA 4AVCA 1KUXA 2QECA 3R1KA 2D4PA 2ATRA 2AE6A 3PZJA 2Y0MA 4HNYB 2EUIA 2R7HA 1MJBA 1WWZA 2HV2A 1NE9A 1YVKA 1QSMA 2QIRA 1M44A 1YLEA 4UA3A 2B4DB 4JWPA 5IV0A 4UFXA 2B5GA 4U5YA 3BJ7A 5AG6A 4BMHA 2P0WA 4E8OA 4KLVA 4A32A 4JJXA 4CAXA 1Y9KA 3FNCA 5HH1A 4XPDC 3LODA 2O28A 4M85A 1S3ZA 4YRHA 4UBRA 5ISVA 4B5OA 3RYOA 1S5KA 4CGOA 2Z3MA 1Z9UA 3PGPA 4U9YA 3UY5A 5GCNA 4QB9A 5DWMA 3EFAA 4H89A 3JTKA 4KOVA 1RXTA 2BSWA 4E0AA 2CXAA 3SXNA 3W6XA 1VHSA 3TT2A 3EO4A 2Z3NA 3D2MA 5EC4A 4B5PB 1S60A 5JQ4A 4MFZA 3QB8A 4PV6A 4MFJA 1S7KA 2P6FA 4GS4A 5KTDA 3H4QA 4H6UA 2A4NA 1QSNA 4MY0A 3DR8A 2VI7A 4CAFA 3JUWA 1SQHA 4LX9A 3T9YA 4MHDA 4X5KA 2ARHA 4KZTA 2I00A 4XPKA 5F46A 2ZW5A 2EVNA 1XEBA 1YVOA 4KS9A 3R96A 1MJ9A 3TO6A 3F5BA 4ORFA 2WPWA 4MFPA 3DR6A 3EC4A 4MY3A 1XMTA 5G1ZA 1MJAA 2Z3LA 2ZW4A 2K5TA 4C2ZA 3G8WA 5G20A 2Q4YA 4KVOE 1IICA 2FS5A 4NSQA 4FD5A 4QUSA 5I0CA 1IIDA 4OAEA 4XPLA 2GANA 4AB7A 4CGMA 1YR0A 2FIAA 4B14A 2H5MA 2WSAA 4KVXA 4EVYA 2R98A 2PQ8A 2VXKA 4CRYB 1P4NA 1YGHA 1CJWA 4F0YA 3FXTA 3GY9A 4FD7A 2VEZA 4Q36A 1FY7A 1IB1E 2OB0A 4CRZB 2G3TA 2BUEA 1XIXA 3I3GA 3D8PA 4F6AA 2Z10A 5J8FA 3DDDA 2HUZA 1I1DA 4KOXA 2B5GB 3IU1A 2FXFA 5G22A 2CNMA 2ZW6A 2JEVA 1KUVA 3S6HA 4YFJA 1QSRA 3JVNA 3D3SA 4UFVA 1CM0A 2OZGA 5C82A 4K30A 3TOBA 1ZO0A 4H6ZA 4KLWA 4NEXA 4CYNA 2F5IA 1Z4EA 4MBUA 1Y7RA 4A33A 1IYLA 2Q0YA 2J8RA 2VBQA 2FCKA 4MI4A 1XF8A 1PUAA 5F48A 2D4OA 2FE7A 3TFYA 1S7NA 5AG7A 4II9A 2Q44A 5F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2A A;  4XNH B;  1GHE A;  1I12 A;  3FRM A;  2FT0 A;  2Q04 A;  4KUB A;  3ZZI A;  4I49 A;  1LRZ A;  5F49 A;  1XE4 A;  4Y49 C;  3FIX A;  1KZF A;  2G3A A;  1TIQ A;  2ZPA A;  1R57 A;  2VZY A;  1L0C A;  2PC1 A;  2Z11 A;  4KOR A;  5H86 A;  4R3K A;  2OU2 A;  4HNX B;  1UFH A;  2OH1 A;  2DXQ A;  1S7F A;  1OZP A;  4NF1 A;  4R3L A;  2ZW7 A;  3R9F A;  2Q7B A;  4KUA A;  2G0B A;  1NSL A;  3CXP A;  2Z0Z A;  4J3G A;  4L8A A;  4IUS A;  3TCV A;  1Z4R A;  4FD4 A;  3WR7 A;  3BLN A;  3V8I A;  3TO9 A;  2R1I A;  4RS2 A;  5JPH A;  2C27 A;  4PSX A;  2IL4 A;  3TOA A;  3TO7 A;  4AG9 A;  2PDO A;  4R9M A;  3C26 A;  1J4J A;  3BJ8 A;  1M4D A;  4HKF A;  1WK4 A;  1M4I A;  4AVA A;  4UWJ A;  3GKR A;  3NE7 A;  4JXQ A;  3FBU A;  4HNW B;  3VWE A;  3VWD A;  2FSR A;  3S6K A;  1U6M A;  3S6F A;  5DWN A;  5C88 A;  3R95 A;  4DNC A;  4LUA A;  1YK3 A;  2PR8 A;  3DNS A;  2PR1 A;  3E0K A;  5J8C A;  4PK2 A;  3W6S A;  3DSB A;  1YRE A;  3P2F A;  4NCZ A;  2FL4 A;  2P6G A;  4FD6 A;  2REF A;  1NMT A;  5HMN A;  2X7B A;  3KKW A;  1M1D A;  2B58 A;  3CXS A;  3ZJ0 A;  1YX0 A;  4QC6 A;  3GYA A;  2WPX A;  3FYN A;  4M3S A;  4JLY A;  1M4G A;  3W91 A;  1P0H A;  4AVB A;  2ZXV A;  3EXN A;  1PU9 A;  2J8M A;  2B4B A;  2B3U A;  4KVM E;  1B87 A;  2NMT A;  3B8G A;  2GIV A;  4KOW A;  3TE4 A;  2B4D A;  1I21 A;  2VQY A;  5EBV A;  4JD6 A;  1BO4 A;  3PP9 A;  4R87 A;  5CNP A;  4OLL A;  4YGO A;  3TTH A;  3OWC A;  1KUY A;  2P6E A;  3R9E A;  3QAH A;  4U9Z A;  2PSW A;  2CNS A;  1Q2Y A;  1QST A;  4KOU A;  4CS0 B;  1N71 A;  1MK4 A;  2HQY A;  4QVT A;  1Q2C A;  4AG7 A;  1Y9W A;  4UWI A;  2VZZ A;  2PRB A;  4KOT A;  4CAW A;  1K4J A;  4B5P A;  3SXO A;  1BOB A;  3MGD A;  4MJ8 A;  3CXQ A;  2KCW A;  5KTC A;  3IGR A;  3K9U A;  3EY5 A;  5IB0 A;  4PSW A;  2R8V A;  1ON0 A;  4RI1 A;  3F0A A;  5KTA A;  3SHP A;  2REE A;  4JXR A;  4XPD B;  4OAD A;  3IWG A;  4XNH C;  2JDD A;  2JDC A;  3D2P A;  3P2H A;  1B6B A;  2RC4 A;  3F8K A;  3LD2 A;  1QSO A;  3G3S A;  3N7Z A;  3I9S A;  2BL1 A;  2JLM A;  2Q4V A;  3T90 A;  4L89 A;  5E96 A;  2AJ6 A;  1IYK A;  3R9G A;  5IX3 A;  5H84 A;  3S6G A;  1RO5 A;  4IF5 A;  2CNT A;  4KOY A;  4KOS A;  2OZH A;  1Q2D A;  4ZBG A;  4PK3 A;  2CY2 A;  2FIW A;  2B3V A;  4Y49 B;  3FB3 A;  4NXY A;  2OZU A;  1S7L A;  4ONU A;  1V0C A;  2BEI A;  4R57 A;  2QML A;  2GE3 A;  4CAV A;  2I79 A;  1VKC A;  5FVJ A;  2J8N A;  4QBJ A;  4AVC A;  1KUX A;  2QEC A;  3R1K A;  2D4P A;  2ATR A;  2AE6 A;  3PZJ A;  2Y0M A;  4HNY B;  2EUI A;  2R7H A;  1MJB A;  1WWZ A;  2HV2 A;  1NE9 A;  1YVK A;  1QSM A;  2QIR A;  1M44 A;  1YLE A;  4UA3 A;  2B4D B;  4JWP A;  5IV0 A;  2B5G A;  4U5Y A;  3BJ7 A;  4BMH A;  2P0W A;  4E8O A;  4KLV A;  4JJX A;  4CAX A;  1Y9K A;  3FNC A;  5HH1 A;  4XPD C;  3LOD A;  2O28 A;  4M85 A;  1S3Z A;  4YRH A;  4UBR A;  5ISV A;  4B5O A;  3RYO A;  1S5K A;  1Z9U A;  3PGP A;  4U9Y A;  3UY5 A;  5GCN A;  4QB9 A;  5DWM A;  3EFA A;  4H89 A;  4KOV A;  1RXT A;  2BSW A;  4E0A A;  3SXN A;  3W6X A;  1VHS A;  3TT2 A;  3EO4 A;  3D2M A;  5EC4 A;  4B5P B;  1S60 A;  5JQ4 A;  3QB8 A;  4PV6 A;  1S7K A;  2P6F A;  4GS4 A;  5KTD A;  3H4Q A;  4H6U A;  2A4N A;  1QSN A;  4MY0 A;  3DR8 A;  2VI7 A;  3JUW A;  1SQH A;  4LX9 A;  3T9Y A;  4MHD A;  4X5K A;  2ARH A;  4KZT A;  2I00 A;  4XPK A;  5F46 A;  2ZW5 A;  2EVN A;  1XEB A;  1YVO A;  3R96 A;  1MJ9 A;  3TO6 A;  3F5B A;  4ORF A;  2WPW A;  3DR6 A;  3EC4 A;  4MY3 A;  1XMT A;  1MJA A;  2ZW4 A;  2K5T A;  3G8W A;  2Q4Y A;  4KVO E;  1IIC A;  2FS5 A;  4NSQ A;  4FD5 A;  4QUS A;  5I0C A;  1IID A;  4OAE A;  4XPL A;  2GAN A;  4AB7 A;  1YR0 A;  2FIA A;  2H5M A;  4KVX A;  4EVY A;  2R98 A;  2PQ8 A;  2VXK A;  4CRY B;  1P4N A;  1YGH A;  1CJW A;  4F0Y A;  3FXT A;  3GY9 A;  4FD7 A;  2VEZ A;  1FY7 A;  1IB1 E;  2OB0 A;  4CRZ B;  2G3T A;  2BUE A;  1XIX A;  3I3G A;  3D8P A;  4F6A A;  2Z10 A;  5J8F A;  3DDD A;  2HUZ A;  1I1D A;  4KOX A;  2B5G B;  2FXF A;  2CNM A;  2ZW6 A;  2JEV A;  1KUV A;  3S6H A;  4YFJ A;  1QSR A;  3JVN A;  3D3S A;  1CM0 A;  2OZG A;  5C82 A;  4K30 A;  3TOB A;  4H6Z A;  4KLW A;  4NEX A;  2F5I A;  1Z4E A;  4MBU A;  1Y7R A;  1IYL A;  2Q0Y A;  2J8R A;  2VBQ A;  2FCK A;  4MI4 A;  1XF8 A;  1PUA A;  5F48 A;  2D4O A;  2FE7 A;  3TFY A;  1S7N A;  4II9 A;  2Q44 A;  5F47 A; 
#chains in the Genus database with same CATH topology
 3FF3 A;  3IIB A;  4E2A A;  2C6G A;  4XNH B;  4H2K A;  4MMO A;  1GHE A;  3IFE A;  1I12 A;  1IOI A;  2PJ7 A;  1BAV A;  4WJB A;  3KHZ A;  4CYP A;  2EK9 A;  3FRM A;  2FT0 A;  4MCP A;  2Q04 A;  4KUB A;  1ARL A;  3ZZI A;  4I49 A;  1LRZ A;  2DPT A;  4EFD A;  5F49 A;  2DPS A;  4A37 A;  1XE4 A;  4B13 A;  4Y49 C;  1ELL P;  3FIX A;  1LAN A;  4TNU A;  2BCO A;  2HC9 A;  5JGF A;  4B11 A;  3FH4 A;  2CTC A;  1KZF A;  2GFQ A;  2G3A A;  1YW4 A;  7CPA A;  4EME A;  4FUU A;  4NGM A;  1YME A;  1TIQ A;  2ZPA A;  4HPS A;  1LOK A;  2Z3P A;  4UFW A;  1R57 A;  5CBM A;  5K8N A;  2VZY A;  4G1P A;  1L0C A;  3D4U A;  2PC1 A;  2Z11 A;  4KOR A;  4A39 A;  4C2Y A;  5K8M A;  5H86 A;  3D68 A;  4R3K A;  2XEJ A;  2OU2 A;  4HNX B;  5G21 A;  5A27 A;  1UFH A;  2OH1 A;  3SI1 A;  2DXQ A;  2AFZ A;  1S7F A;  3LAC A;  1OZP A;  2GLJ A;  4NF1 A;  5HVH A;  2GRE A;  2DF5 A;  4R3L A;  3S9M A;  2ZW7 A;  1FT7 A;  2POK A;  4OC3 A;  3R9F A;  2Q7B A;  1IGB A;  4KUA A;  4PQA A;  2G0B A;  1NSL A;  3CXP A;  2Z0Z A;  4J3G A;  2YNC C;  2JBJ A;  4L8A A;  2JEW A;  4IUS A;  3TCV A;  1Z4R A;  4FD4 A;  4UEE A;  3KQZ A;  4A95 A;  3WR7 A;  2XEI A;  3BLN A;  4B6Z A;  4C68 A;  4CGN A;  2YND A;  4DYO A;  3V8I A;  1IOF A;  1TXR A;  2R1I A;  2AFU A;  3BXM A;  4RS2 A;  3TO9 A;  4BD9 A;  4ZY1 A;  5JPH A;  2ZEP A;  4M6G A;  2C27 A;  2ZEM A;  4PSX A;  5AG5 A;  1ZLI A;  2IL4 A;  3TOA A;  3TO7 A;  4F9U A;  4AG9 A;  2CF4 A;  2PDO A;  1Z8L A;  4R9M A;  2CTB A;  4CGL A;  3C26 A;  1J4J A;  2Q4Z A;  3BJ8 A;  1YLO A;  4MCR A;  2PJ1 A;  4C2X A;  1M4D A;  4HKF A;  3A9L A;  5K8P A;  1WK4 A;  1M4I A;  5J1Q A;  3D7H A;  4AVA A;  4OME A;  4UWJ A;  4OC1 A;  1DTD A;  2PE3 A;  5HVF A;  1DE4 C;  2AFS A;  3GKR A;  3PB6 X;  1XJO A;  5AGE A;  3NE7 A;  3SI0 A;  1Z5R A;  3FBU A;  4JXQ A;  4PXD A;  4HNW B;  2QYV A;  2HB6 A;  4NGP A;  2FSR A;  2Q51 A;  1U6M A;  3S6K A;  3VWE A;  3VWD A;  3FEC A;  3S6F A;  4KSA A;  5DWN A;  3KGQ A;  5C88 A;  3B3W A;  3R95 A;  4O23 A;  4DNC A;  4LUA A;  4LQ6 A;  1YK3 A;  2PR8 A;  3IWE A;  1CX8 A;  3DNS A;  3RAM A;  5EMI A;  2PR1 A;  3CPA A;  4M6I A;  4X8I A;  4MCQ A;  1Y7E A;  2ZED A;  2PJ6 A;  3E0K A;  4F0X A;  4NGT A;  1BLL E;  5J8C A;  5LYD A;  4PK2 A;  2ZOG A;  3W6S A;  3DSB A;  5BWA B;  5LRJ A;  1YRE A;  3P2F A;  3VAT A;  4NCZ A;  4CPA A;  4P4I A;  2FL4 A;  3RNZ A;  2P6G A;  2IMO A;  4FD6 A;  2PJB A;  4CAE A;  2REF A;  4MFQ A;  1NMT A;  1IY7 A;  3QNV A;  5HMN A;  2X7B A;  3KKW A;  1GYT A;  4X2T A;  2RB7 A;  2AFO A;  1M1D A;  4PXE A;  3L2N A;  5JM6 A;  2C1C A;  1LCP A;  5K8O A;  2B58 A;  1ELM P;  3CXS A;  3ZJ0 A;  1YX0 A;  2ZEL A;  4ZX8 A;  2ANP A;  3NA6 A;  2J9A A;  4QC6 A;  3GYA A;  2WPX A;  1F2O A;  3FYN A;  4M3S A;  4JLY A;  4W9Y A;  3ISX A;  1M4G A;  3W91 A;  3H5Z A;  1XFO A;  3D67 A;  1P0H A;  2EO8 A;  2ZXV A;  4AVB A;  3EXN A;  1LAP A;  1PU9 A;  5ELY A;  3S9L A;  2J8M A;  2B4B A;  2C6P A;  2PJ2 A;  2B3U A;  6CPA A;  4KVM E;  2V8V A;  3FED A;  4ZYQ A;  1B87 A;  2NMT A;  3B8G A;  2GIV A;  3PBE A;  2XEF A;  3PFO A;  4KOW A;  4OC5 A;  3TE4 A;  2B4D A;  1I21 A;  2VQY A;  1PCA A;  4KSF A;  5EBV A;  1AYE A;  1HDQ A;  1BPM A;  3FMC A;  3KHX A;  4JD6 A;  4UCP A;  4BIN A;  4MFK A;  1BO4 A;  3PP9 A;  2YNC A;  4R87 A;  5CNP A;  3B3V A;  3V7Z A;  5IB9 A;  4OLL A;  8CPA A;  2FVG A;  4YGO A;  5JH9 A;  3TTH A;  3OWC A;  1KUY A;  2AFM A;  2P6E A;  4ZY2 A;  3R9E A;  3QAH A;  2EK8 A;  4U9Z A;  4MHZ A;  4UCM A;  3PB7 X;  2PSW A;  2VL1 A;  3RO0 A;  2CNS A;  4A31 A;  1Q2Y A;  4MHY A;  4P4B A;  1CPS A;  1QST A;  3IJ3 A;  4KOU A;  1AMP A;  3SJG A;  2PJC A;  4C7H A;  1F57 A;  3NE8 A;  4CS0 B;  1N71 A;  1MK4 A;  2HQY A;  1ZG9 A;  2CIJ A;  2I3C A;  2Q7S A;  4JZ0 A;  4QVT A;  3VH9 A;  2F7V A;  2G9D A;  1Q2C A;  2IQ6 A;  4EWT A;  4AG7 A;  1Y9W A;  2Z3O A;  4UWI A;  1RTQ A;  4ZY0 A;  1CPX A;  4LQG A;  2VZZ A;  4TWE A;  1KWM A;  2PRB A;  3WC5 A;  4M6H A;  3KI9 A;  4KOT A;  4CAW A;  4IAV A;  4ONW A;  1K4J A;  4B5P A;  3SXO A;  2BO9 A;  4NGQ A;  1BOB A;  4MFL A;  1VHE A;  3MGD A;  4MXU A;  2OOT A;  4MJ8 A;  3CXQ A;  3FVL A;  2KCW A;  4Q38 A;  4BBH A;  4UEZ A;  3NFZ A;  5KTC A;  3IGR A;  3B2Y A;  3K9U A;  1Z2L A;  1M4L A;  4B10 A;  2BOA A;  2PJ4 A;  4P4F A;  3EY5 A;  4RN7 A;  5IB0 A;  3DGV A;  4PSW A;  3BHX A;  4UCN A;  2R8V A;  1ON0 A;  3WAB A;  4A30 A;  4RI1 A;  2O53 A;  1YQE A;  2NYQ A;  3F0A A;  3K9T A;  4PPZ A;  1AUG A;  1CG2 A;  1TKF A;  1Y0R A;  4FWU A;  5KTA A;  3D7D A;  3DLJ A;  4R76 A;  3SHP A;  1LFW A;  2REE A;  2YGW A;  4JXR A;  1ZG8 A;  4XPD B;  4OAD A;  2PRQ A;  3IWG A;  3HUV A;  4XNH C;  4KSI A;  2JDD A;  2JDC A;  4P4J A;  2WUU A;  2C6C A;  2ZOF A;  3D2P A;  3P2H A;  4MCS A;  4OC0 A;  1B6B A;  4C7I A;  2RC4 A;  1HDU A;  3F8K A;  4CGP A;  1CP7 A;  3LD2 A;  3N5F A;  5HVG A;  4B12 A;  3IU2 A;  2YNE A;  1QSO A;  1TF9 A;  2Z3K A;  3G3S A;  3RZA A;  3D66 A;  3GLJ A;  4P44 A;  3PB9 X;  2QVP A;  3N7Z A;  4OC4 A;  3I9S A;  2BL1 A;  2JLM A;  2ODF A;  2Q4V A;  3T90 A;  4L89 A;  3IWW A;  4Z65 A;  5E96 A;  4NGN A;  4R7M A;  2AJ6 A;  1IYK A;  3R9G A;  1ZG7 A;  3D7F A;  5IX3 A;  5H84 A;  3S6G A;  1RO5 A;  2NSM A;  5A28 A;  3IEH A;  4CYO A;  4IF5 A;  4FBE A;  2CNT A;  4KOY A;  4KOS A;  2OZH A;  1Q2D A;  4ZBG A;  1Z8W A;  4PK3 A;  1A2Z A;  4F9V A;  2V8H A;  2ABZ A;  3PBB A;  2CY2 A;  2V8G A;  2FIW A;  3GUX A;  4DUK A;  2PVV A;  2B3V A;  3NH5 A;  4Y49 B;  3FB3 A;  3LWU A;  3D7G A;  4NXY A;  2OZU A;  1S7L A;  2WYR A;  1UWY A;  2ZEF A;  4ONU A;  1V0C A;  2BEI A;  4GXH A;  4R57 A;  4GM5 A;  2QML A;  4A2Z A;  4ZGY B;  2DEA A;  2GE3 A;  1F2P A;  4CAV A;  4CYQ A;  2I79 A;  1VKC A;  5FVJ A;  2ZEG A;  3GIU A;  2J8N A;  2PJ0 A;  4NFR A;  2PVW A;  3MN8 A;  4QBJ A;  2AFW A;  3CDX A;  4AVC A;  5LYF A;  3FEE A;  1TKJ A;  1KUX A;  2QEC A;  2WZN A;  3R1K A;  2D4P A;  2ATR A;  4P4E A;  2AE6 A;  1QMU A;  3PZJ A;  2Y0M A;  4HNY B;  3H8F A;  2GLF A;  4P10 A;  2EUI A;  2R7H A;  4NJR A;  1MJB A;  1WWZ A;  2HV2 A;  1NE9 A;  4A38 A;  1YVK A;  1QSM A;  1YSJ A;  2QIR A;  1M44 A;  1YLE A;  4UA3 A;  2B4D B;  4JWP A;  3KR4 A;  5IV0 A;  4UFX A;  1X12 A;  2B5G A;  4U5Y A;  3BJ7 A;  4NGR A;  5AG6 A;  4BMH A;  2P0W A;  4E8O A;  3GB0 A;  4KLV A;  4PXC A;  1LAM A;  2PJ9 A;  2F8H A;  4A32 A;  5THW A;  4JJX A;  3TC8 A;  1CBX A;  4DJL A;  4CAX A;  1Y9K A;  3FNC A;  5HH1 A;  5D8N A;  4XPD C;  3PRT A;  3LOD A;  2O28 A;  4M85 A;  3WC7 A;  4P45 A;  1S3Z A;  4YRH A;  4Q7A A;  4UBR A;  5ISV A;  4B5O A;  3RYO A;  1JQG A;  2RFH A;  4JYW A;  1S5K A;  3SJE A;  2Z3M A;  4CGO A;  1Z9U A;  3PGP A;  4U9Y A;  3UY5 A;  5HXD A;  2PIZ A;  2IJZ A;  5GCN A;  3CPX A;  4QB9 A;  5DWM A;  3EFA A;  4H89 A;  3JTK A;  4KOV A;  3IC1 A;  4IK2 A;  1RXT A;  2BSW A;  1ARM A;  4IHM A;  3WT4 A;  4E0A A;  3NH4 A;  2CXA A;  3JRU A;  3SXN A;  1VHO A;  3W6X A;  1VHS A;  3BI0 A;  4ZI6 A;  3TT2 A;  3EO4 A;  2Z3N A;  4MRI A;  3D2M A;  5EC4 A;  4B5P B;  3LMS A;  4A94 A;  1S60 A;  1H8L A;  5LRK A;  5JQ4 A;  3S9N A;  4K3N A;  5AG4 A;  4MFZ A;  3HLP A;  3QB8 A;  4PV6 A;  4MFJ A;  1S7K A;  1JWQ A;  2P6F A;  4GS4 A;  1ZLH A;  5KTD A;  2OR4 A;  4MHN A;  3H4Q A;  3PB8 X;  2A4N A;  4H6U A;  1QSN A;  4MY0 A;  1TF8 A;  4OID A;  3DR8 A;  2VI7 A;  4CAF A;  3JUW A;  5F09 A;  1SQH A;  3QAY A;  4LX9 A;  5DS0 A;  1HEE A;  3T9Y A;  1OBR A;  3CZX A;  4MHD A;  5I4M A;  4X5K A;  2ARH A;  3H8E A;  2QJ8 A;  3MRU A;  1Z8X A;  4KZT A;  2I00 A;  4OIW A;  4ZX9 A;  1Y0Y A;  4XPK A;  4P4D A;  5F46 A;  3PFE A;  4YU9 A;  2ZW5 A;  4R6T A;  2EVN A;  1XEB A;  1YVO A;  2V8D A;  4KS9 A;  3R96 A;  3CT9 A;  1MJ9 A;  4UIA A;  3TO6 A;  3FX6 A;  3F5B A;  3T8W A;  5D29 A;  1IU8 A;  4R8F A;  4ORF A;  2WPW A;  1XBU A;  5LYL A;  3KZW A;  4MFP A;  4PXB A;  3K2K A;  1X10 A;  3DR6 A;  3KL9 A;  3EC4 A;  4MY3 A;  1XMT A;  3BI1 A;  4OKO A;  4OP4 A;  5G1Z A;  1MJA A;  3H8G A;  4WWV A;  2Z3L A;  2V77 A;  2ZW4 A;  2K5T A;  2PJ8 A;  3G8W A;  4C2Z A;  3B35 A;  5G20 A;  2Q4Y A;  2ZEH A;  4KVO E;  1IIC A;  2FS5 A;  4NSQ A;  4FD5 A;  3RBU A;  1R43 A;  4QUS A;  5I0C A;  1IID A;  2ZEE A;  4OC2 A;  3TX8 A;  4OAE A;  4UIB A;  5LYI A;  4XPL A;  2GAN A;  4AB7 A;  1XRY A;  1YR0 A;  2FIA A;  4CGM A;  4B14 A;  1QQ9 A;  2H5M A;  2WSA A;  4KVX A;  4EVY A;  2R98 A;  4AXV A;  2PQ8 A;  2VXK A;  4UEF A;  4CRY B;  1PYT B;  1P4N A;  1YGH A;  3B3S A;  1CP6 A;  1CJW A;  4YWY A;  4P6Y A;  4F0Y A;  3FXT A;  1YW6 A;  3GY9 A;  4FD7 A;  2VEZ A;  4Q36 A;  1EE3 P;  1FY7 A;  1IB1 E;  3SJF A;  2OB0 A;  3PEI A;  4CRZ B;  2G3T A;  1Z8T A;  2BUE A;  3IO1 A;  3KR5 A;  1XIX A;  3I3G A;  4F8Z A;  3D8P A;  4F6A A;  2JBK A;  3KAS A;  2Z10 A;  5J8F A;  2XEG A;  4NGS A;  3DDD A;  2HUZ A;  1I1D A;  1VGY A;  2ZEO A;  4KOX A;  1BPN A;  2B5G B;  3B3C A;  3IU1 A;  2FXF A;  5G22 A;  3SI2 A;  1R3N A;  3KQX A;  1TKH A;  2CNM A;  4NJQ A;  4UF4 A;  2ZW6 A;  4FAI A;  2JEV A;  3ISZ A;  1KUV A;  3PB4 X;  3S6H A;  4YFJ A;  1FNO A;  1QSR A;  3JVN A;  3SJX A;  1XOV A;  3D3S A;  4UFV A;  2PJ3 A;  5CPA A;  3B7I A;  1CM0 A;  1NSA A;  3WC6 A;  2OZG A;  2PCU A;  1Q7L A;  5C82 A;  4K30 A;  3VAR A;  3TOB A;  1ZO0 A;  4H6Z A;  4X3R A;  4KLW A;  4NEX A;  4CYN A;  2F5I A;  2Q43 A;  2O4H A;  1Z4E A;  4MBU A;  1Y7R A;  3V38 A;  4A33 A;  2AFX A;  1IYL A;  2GU2 A;  2EWB A;  2EBJ A;  2Q0Y A;  2J8R A;  2VBQ A;  2FCK A;  4MI4 A;  1XF8 A;  2ZEN A;  1XMB A;  1PUA A;  2PJ5 A;  3I1U A;  5F48 A;  2D4O A;  2FE7 A;  3FJU A;  3TFY A;  4MHP A;  1S7N A;  3B3T A;  2PJA A;  5AG7 A;  1VIX A;  4II9 A;  2Q44 A;  5LRG A;  3NH8 A;  2PIY A;  5F47 A;  4RUH A; 
#chains in the Genus database with same CATH homology
 4E2A A;  4XNH B;  1GHE A;  1I12 A;  4CYP A;  3FRM A;  2FT0 A;  2Q04 A;  4KUB A;  3ZZI A;  4I49 A;  1LRZ A;  2DPT A;  5F49 A;  2DPS A;  1XE4 A;  4B13 A;  4Y49 C;  3FIX A;  4B11 A;  1KZF A;  2G3A A;  1TIQ A;  2ZPA A;  2Z3P A;  4UFW A;  1R57 A;  2VZY A;  1L0C A;  2PC1 A;  2Z11 A;  4KOR A;  4C2Y A;  5H86 A;  4R3K A;  2OU2 A;  4HNX B;  5G21 A;  5A27 A;  1UFH A;  2OH1 A;  2DXQ A;  1S7F A;  1OZP A;  4NF1 A;  4R3L A;  2ZW7 A;  3R9F A;  2Q7B A;  4KUA A;  2G0B A;  1NSL A;  3CXP A;  2Z0Z A;  4J3G A;  2YNC C;  4L8A A;  4IUS A;  3TCV A;  1Z4R A;  4FD4 A;  4A95 A;  3WR7 A;  3BLN A;  4C68 A;  4CGN A;  2YND A;  3V8I A;  3TO9 A;  2R1I A;  4RS2 A;  5JPH A;  2C27 A;  4PSX A;  5AG5 A;  2IL4 A;  3TOA A;  3TO7 A;  4AG9 A;  2PDO A;  4R9M A;  4CGL A;  3C26 A;  1J4J A;  3BJ8 A;  4C2X A;  1M4D A;  4HKF A;  3A9L A;  1WK4 A;  1M4I A;  4AVA A;  4UWJ A;  3GKR A;  5AGE A;  3NE7 A;  4JXQ A;  3FBU A;  4HNW B;  3VWE A;  3VWD A;  2FSR A;  3S6K A;  1U6M A;  3S6F A;  4KSA A;  5DWN A;  5C88 A;  3R95 A;  4DNC A;  4LUA A;  1YK3 A;  2PR8 A;  3IWE A;  3DNS A;  2PR1 A;  3E0K A;  4F0X A;  5J8C A;  4PK2 A;  3W6S A;  3DSB A;  5BWA B;  1YRE A;  3P2F A;  4NCZ A;  2FL4 A;  2P6G A;  4CAE A;  4FD6 A;  2REF A;  4MFQ A;  1NMT A;  5HMN A;  2X7B A;  3KKW A;  1M1D A;  2B58 A;  3CXS A;  3ZJ0 A;  1YX0 A;  4QC6 A;  3GYA A;  2WPX A;  3FYN A;  4M3S A;  4JLY A;  1M4G A;  3W91 A;  3H5Z A;  1P0H A;  4AVB A;  2ZXV A;  3EXN A;  1PU9 A;  2J8M A;  2B4B A;  2B3U A;  4KVM E;  1B87 A;  2NMT A;  3B8G A;  2GIV A;  4KOW A;  3TE4 A;  2B4D A;  1I21 A;  2VQY A;  4KSF A;  5EBV A;  4JD6 A;  4UCP A;  4MFK A;  1BO4 A;  3PP9 A;  2YNC A;  4R87 A;  5CNP A;  4OLL A;  4YGO A;  3TTH A;  3OWC A;  1KUY A;  2P6E A;  3R9E A;  3QAH A;  4U9Z A;  4UCM A;  2PSW A;  2CNS A;  4A31 A;  1Q2Y A;  1QST A;  4KOU A;  4C7H A;  4CS0 B;  1N71 A;  1MK4 A;  2HQY A;  4QVT A;  1Q2C A;  4AG7 A;  1Y9W A;  2Z3O A;  4UWI A;  2VZZ A;  2PRB A;  4KOT A;  4CAW A;  1K4J A;  4B5P A;  3SXO A;  1BOB A;  4MFL A;  3MGD A;  4MJ8 A;  3CXQ A;  2KCW A;  4Q38 A;  4BBH A;  5KTC A;  3IGR A;  3K9U A;  4B10 A;  3EY5 A;  5IB0 A;  4PSW A;  4UCN A;  2R8V A;  1ON0 A;  4A30 A;  4RI1 A;  3F0A A;  5KTA A;  3SHP A;  2REE A;  2YGW A;  4JXR A;  4XPD B;  4OAD A;  3IWG A;  4XNH C;  2JDD A;  2JDC A;  2WUU A;  3P2H A;  3D2P A;  4CGP A;  4C7I A;  5AG4 A;  1B6B A;  2RC4 A;  3F8K A;  3LD2 A;  4B12 A;  3IU2 A;  2YNE A;  1QSO A;  2Z3K A;  3G3S A;  3N7Z A;  3I9S A;  2BL1 A;  2JLM A;  2Q4V A;  3T90 A;  4L89 A;  5E96 A;  2AJ6 A;  1IYK A;  3R9G A;  5IX3 A;  5H84 A;  3S6G A;  1RO5 A;  5A28 A;  4CYO A;  4IF5 A;  2CNT A;  4KOY A;  4KOS A;  2OZH A;  1Q2D A;  4ZBG A;  4PK3 A;  2CY2 A;  2FIW A;  2B3V A;  4Y49 B;  3FB3 A;  4NXY A;  2OZU A;  1S7L A;  4ONU A;  1V0C A;  2BEI A;  4R57 A;  2QML A;  4A2Z A;  4ZGY B;  2GE3 A;  4CAV A;  4CYQ A;  2I79 A;  1VKC A;  5FVJ A;  2J8N A;  4QBJ A;  4AVC A;  1KUX A;  2QEC A;  3R1K A;  2D4P A;  2ATR A;  2AE6 A;  3PZJ A;  2Y0M A;  4HNY B;  2EUI A;  2R7H A;  1MJB A;  1WWZ A;  2HV2 A;  1NE9 A;  1YVK A;  1QSM A;  2QIR A;  1M44 A;  1YLE A;  4UA3 A;  2B4D B;  4JWP A;  5IV0 A;  4UFX A;  2B5G A;  4U5Y A;  3BJ7 A;  5AG6 A;  4BMH A;  2P0W A;  4E8O A;  4KLV A;  4A32 A;  4JJX A;  4CAX A;  1Y9K A;  3FNC A;  5HH1 A;  4XPD C;  3LOD A;  2O28 A;  4M85 A;  1S3Z A;  4YRH A;  4UBR A;  5ISV A;  4B5O A;  3RYO A;  1S5K A;  4CGO A;  2Z3M A;  1Z9U A;  3PGP A;  4U9Y A;  3UY5 A;  5GCN A;  4QB9 A;  5DWM A;  3EFA A;  4H89 A;  3JTK A;  4KOV A;  1RXT A;  2BSW A;  4E0A A;  2CXA A;  3SXN A;  3W6X A;  1VHS A;  3TT2 A;  3EO4 A;  2Z3N A;  3D2M A;  5EC4 A;  4B5P B;  1S60 A;  5JQ4 A;  4MFZ A;  3QB8 A;  4PV6 A;  4MFJ A;  1S7K A;  2P6F A;  4GS4 A;  5KTD A;  3H4Q A;  4H6U A;  2A4N A;  1QSN A;  4MY0 A;  3DR8 A;  2VI7 A;  4CAF A;  3JUW A;  1SQH A;  4LX9 A;  3T9Y A;  4MHD A;  4X5K A;  2ARH A;  4KZT A;  2I00 A;  4XPK A;  5F46 A;  2ZW5 A;  2EVN A;  1XEB A;  1YVO A;  4KS9 A;  3R96 A;  1MJ9 A;  3TO6 A;  3F5B A;  4ORF A;  2WPW A;  4MFP A;  3DR6 A;  3EC4 A;  4MY3 A;  1XMT A;  5G1Z A;  1MJA A;  2Z3L A;  2ZW4 A;  2K5T A;  4C2Z A;  3G8W A;  5G20 A;  2Q4Y A;  4KVO E;  1IIC A;  2FS5 A;  4NSQ A;  4FD5 A;  4QUS A;  5I0C A;  1IID A;  4OAE A;  4XPL A;  2GAN A;  4AB7 A;  4CGM A;  1YR0 A;  2FIA A;  4B14 A;  2H5M A;  2WSA A;  4KVX A;  4EVY A;  2R98 A;  2PQ8 A;  2VXK A;  4CRY B;  1P4N A;  1YGH A;  1CJW A;  4F0Y A;  3FXT A;  3GY9 A;  4FD7 A;  2VEZ A;  4Q36 A;  1FY7 A;  1IB1 E;  2OB0 A;  4CRZ B;  2G3T A;  2BUE A;  1XIX A;  3I3G A;  3D8P A;  4F6A A;  2Z10 A;  5J8F A;  3DDD A;  2HUZ A;  1I1D A;  4KOX A;  2B5G B;  3IU1 A;  2FXF A;  5G22 A;  2CNM A;  2ZW6 A;  2JEV A;  1KUV A;  3S6H A;  4YFJ A;  1QSR A;  3JVN A;  3D3S A;  4UFV A;  1CM0 A;  2OZG A;  5C82 A;  4K30 A;  3TOB A;  1ZO0 A;  4H6Z A;  4KLW A;  4NEX A;  4CYN A;  2F5I A;  1Z4E A;  4MBU A;  1Y7R A;  4A33 A;  1IYL A;  2Q0Y A;  2J8R A;  2VBQ A;  2FCK A;  4MI4 A;  1XF8 A;  1PUA A;  5F48 A;  2D4O A;  2FE7 A;  3TFY A;  1S7N A;  5AG7 A;  4II9 A;  2Q44 A;  5F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...