4A95A

Plasmodium vivax n-myristoyltransferase with quinoline inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Plasmodium Vivax N-Myristoyltransferase Inhibitors: Screening, Synthesis, and Structural Characterization of Their Binding Mode.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 119
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a95A00
4B11A 4UFXA 3IU2A 4UCPA 2YNCA 4A32A 4UCMA 5A27A 4CYPA 5A28A 5G22A 4A30A 4CGOA 4BBHA 4C7HA 4UFVA 4UFWA 3JTKA 4C2XA 4CGLA 4CYQA 3IU1A 5G21A 5G20A 4CAEA 5AG7A 4CAFA 4B14A 5G1ZA 4A33A 4C2YA 5AG5A 4B12A 2YNCC 2WUUA 2WSAA 4C7IA 4B13A 4CGPA 3H5ZA 5AG6A 4A95A 5AG4A 4A2ZA 2YNDA 4UCNA 4C2ZA 4CYOA 4CGNA 4CYNA 4A31A 4CGMA 4C68A 2YNEA 5AGEA 4B10A 3IWEA
chains in the Genus database with same CATH superfamily
3VATA 3IEHA 3RZAA 4A32A 1YSJA 2GANA 3R1KA 4OC3A 3ZZIA 3N7ZA 5THWA 2BL1A 1MJBA 1XMBA 2GLFA 2Z3NA 1XMTA 2J8NA 4JXQA 4K30A 4KUBA 4E2AA 4NJQA 2A4NA 5AG5A 2AFOA 2PIZA 4B12A 3WC5A 1CX8A 4H6UA 4EWTA 2RFHA 4CGPA 5K8MA 4QC6A 3FEEA 1F2PA 2JEVA 3L2NA 2Q0YA 4MBUA 1VGYA 1XOVA 3S6GA 4NFRA 2CIJA 3KR5A 3B7IA 2Q4VA 3MGDA 3SJXA 4WJBA 1IICA 4CGNA 4CRZB 3VH9A 5IB0A 3PFEA 1U6MA 1Y7EA 2CNSA 2B4BA 4ZY0A 5IV0A 1PUAA 3LODA 3S9LA 2FIAA 1UWYA 2Z3KA 2WZNA 4DJLA 2GIVA 5LYIA 2FXFA 3FBUA 3MN8A 4F0YA 1Q2YA 3PB9X 1K4JA 3KQXA 2ZELA 3R96A 3JUWA 4FUUA 3D4UA 4CYQA 4UEFA 2ZEOA 1BPNA 4HKFA 4Y49B 5G1ZA 3T8WA 2C6GA 3TE4A 4HNWB 4P4IA 4KVME 3VARA 1IOIA 3V8IA 4AVAA 4LX9A 4EFDA 2ZEDA 3C26A 3PBEA 3SJGA 1M4IA 4LQ6A 3T9YA 4KVOE 1CP7A 2B3UA 3PB7X 3B35A 1BPMA 3KL9A 3RYOA 3UY5A 4DNCA 4JXRA 3H8EA 2V8GA 1NMTA 5I0CA 3JRUA 4M6HA 2GFQA 2EWBA 4MCRA 4ZGYB 1LAMA 5JH9A 1X10A 2GU2A 2QECA 2AFXA 1YVKA 2IL4A 1WWZA 2GLJA 4R87A 5HMNA 2J8RA 2O53A 2FS5A 4ZY2A 4OIDA 4C2XA 4UIBA 3IU1A 3BI1A 1Q7LA 3GKRA 4FD7A 1J4JA 5DS0A 2ANPA 1ZLHA 2QYVA 1OBRA 1UFHA 5LRJA 4UIAA 4R9MA 2FE7A 1FNOA 3B8GA 3WABA 1XE4A 2VXKA 1FY7A 3PGPA 2PCUA 1S5KA 4M85A 4UWJA 2VI7A 3TOBA 1XF8A 1I1DA 1S3ZA 2PDOA 4UCNA 4IF5A 1LRZA 2J8MA 3PRTA 1KUYA 2PRBA 2ZPAA 2I3CA 3KGQA 2HUZA 4MMOA 2GREA 3V7ZA 4OC1A 2CNTA 4RI1A 2ZEHA 5CBMA 4UF4A 4KS9A 1Y9KA 4MXUA 3FMCA 5DWMA 5EBVA 5LYLA 2V8VA 5J1QA 4MY0A 1PYTB 2HV2A 3S9MA 2ZXVA 1YW4A 2HQYA 3F8KA 3K9TA 4MY3A 1IY7A 5D29A 1F57A 1Z4EA 5J8FA 1LOKA 1Z8XA 5DWNA 1ARLA 2YNDA 2OB0A 4JWPA 1M1DA 1NSLA 4NGTA 4OC4A 1YVOA 3S9NA 2WPWA 5CNPA 5JPHA 2AFSA 5AGEA 3D67A 1XJOA 3W6SA 2FVGA 2J9AA 2PC1A 4U9YA 5F47A 4B11A 3IIBA 5K8OA 2HB6A 4FAIA 4QB9A 5H86A 2XEGA 5A28A 4KORA 4CRYB 4OC2A 4LQGA 4R3KA 4YU9A 4UA3A 1GYTA 4R57A 4UFVA 4AB7A 2R7HA 1FT7A 2EVNA 4JD6A 2P6EA 1KZFA 4A39A 3OWCA 3SXOA 1ZG9A 5EMIA 4YFJA 3N5FA 2ZEMA 4P4FA 1MJAA 1HDQA 1LANA 2D4OA 4MHPA 3SI0A 2EO8A 1YW6A 2NMTA 4NEXA 2FIWA 2QMLA 4AVBA 1P4NA 2CF4A 2KCWA 2ZEPA 5LYDA 4MFZA 2B3VA 2Z3OA 4YWYA 1ELMP 3PFOA 4MRIA 4A38A 4AVCA 5J8CA 4UCMA 3FEDA 4PSXA 3H8FA 3F0AA 4HNYB 3BJ8A 3SI1A 2ZEEA 2PR8A 4IHMA 1NSAA 4KZTA 2PJAA 2DXQA 3FB3A 1BO4A 2C6PA 4KOYA 3FRMA 4XNHC 4XPLA 4FBEA 4RN7A 4B13A 3KR4A 3DSBA 2OU2A 3FX6A 1S7LA 1S7NA 2ATRA 4U9ZA 1XRYA 1CG2A 2IMOA 3PEIA 2XEFA 4CS0B 4ZBGA 4WWVA 2CTCA 4NGQA 2PJCA 4NSQA 3GYAA 2JBKA 2PSWA 1M4LA 4UCPA 3EFAA 2ABZA 3SI2A 3WT4A 5HVHA 1KUXA 1TKHA 2B5GB 2O28A 2REEA 4MHNA 4P6YA 4TNUA 4QBJA 5ISVA 4J3GA 2F5IA 5IX3A 5HXDA 2V8HA 3F5BA 1CJWA 3PP9A 5G21A 4KUAA 4CAFA 4NGRA 5F46A 4R3LA 2WUUA 4H89A 1P0HA 1YX0A 4HNXB 4M3SA 4MFKA 1Y0YA 2ZW4A 4PXDA 2PJ6A 3H4QA 5LYFA 3D8PA 2D4PA 3R9GA 2OR4A 5KTAA 2H5MA 4MHYA 2Q51A 5F49A 3TC8A 1JQGA 2OZGA 2JEWA 4JLYA 2Q4YA 3DDDA 4CAWA 3FJUA 5F48A 4MHZA 2K5TA 4P10A 4OP4A 3RAMA 2JBJA 4NGNA 2ZENA 2G0BA 2OZUA 3TX8A 3SXNA 4X3RA 3E0KA 4A33A 2RC4A 3D3SA 1KWMA 4B5OA 1Q2CA 1LCPA 2VZYA 5IB9A 2DF5A 2JDCA 1B6BA 3CZXA 3G3SA 5AG6A 4Q7AA 4A95A 3GIUA 1I12A 1RXTA 1LFWA 3KHZA 3B3WA 2ARHA 1S7KA 4F9UA 3GB0A 4K3NA 3GUXA 2QIRA 1QSTA 3IO1A 4E0AA 2OH1A 2FL4A 1A2ZA 1RTQA 2R1IA 1KUVA 2AFZA 3EC4A 2BSWA 3G8WA 3IFEA 3TO6A 4ZX9A 2ZW7A 4UWIA 2BOAA 3KHXA 2ZOGA 4R76A 1MJ9A 4KLWA 3SJEA 1RO5A 5C82A 4OC0A 3CXSA 4YGOA 5G20A 4CAVA 3K2KA 2Q7SA 2EUIA 2JDDA 4R7MA 5C88A 1TF8A 4JYWA 2FCKA 3D7DA 3KKWA 4PSWA 4KOVA 4PXEA 4FWUA 5HVGA 5BWAB 2C1CA 2REFA 4AG7A 4XPDB 4XNHB 2QVPA 3KZWA 1IU8A 1XFOA 3CT9A 1OZPA 4A31A 2PJ0A 3W91A 4C68A 2Z3PA 2EBJA 4DUKA 3H8GA 4OLLA 2F8HA 4NGPA 2ZOFA 1CM0A 3NA6A 2PJ9A 4F9VA 4KSFA 2DPSA 5D8NA 4CGOA 2VQYA 4C7HA 1DTDA 4KOXA 4LUAA 4IUSA 1R3NA 4GS4A 1S60A 3WC6A 1BLLE 4R8FA 2HC9A 2YNCC 1HEEA 5F09A 6CPAA 4IK2A 4ONUA 2PJ4A 4G1PA 4ZX8A 1Z2LA 3D2MA 2OOTA 5AG4A 2PJ3A 4MI4A 2NSMA 3B3TA 1NE9A 2BUEA 2VEZA 4H2KA 4NCZA 4II9A 3PB6X 5CPAA 2Y0MA 2PE3A 3LD2A 2ZEGA 5I4MA 2VL1A 4UEEA 2PVWA 4MFLA 1I21A 1XBUA 2QJ8A 4KVXA 5G22A 4UFXA 1M4DA 1V0CA 1Z8WA 2AE6A 2NYQA 1XIXA 3ISZA 3B3VA 4X2TA 4BBHA 4EVYA 3TT2A 4CGLA 3JTKA 3FH4A 3D7FA 5H84A 2JLMA 2IQ6A 5AG7A 3MRUA 1IGBA 3IC1A 3IWWA 4BMHA 1AYEA 1ZG7A 2PJ8A 2Q43A 4GXHA 2V77A 3K9UA 3FECA 2Q04A 3VWEA 4B5PB 2CY2A 3NE7A 3GY9A 4R6TA 4A37A 4F8ZA 3DR8A 1SQHA 1CBXA 4OIWA 5LRKA 1VHEA 4IAVA 4P4BA 3IWGA 2WPXA 1R43A 1XEBA 2BEIA 2OZHA 2PVVA 2YGWA 4E8OA 3FXTA 3ZJ0A 4CGMA 4MCSA 5ELYA 1ARMA 1F2OA 3EY5A 2FT0A 1ZO0A 1ZG8A 4P4JA 4CYPA 4CPAA 3FYNA 2F7VA 4X5KA 3CXQA 4I49A 5JQ4A 4B5PA 2POKA 4ZY1A 1LAPA 4CAEA 4KOTA 1TKFA 3P2HA 1YLOA 2ZW6A 3HUVA 2B4DB 2BO9A 2RB7A 4OKOA 3EXNA 3PBBA 4C7IA 4QVTA 3H5ZA 3I1UA 5EC4A 4FD4A 2PJ2A 1X12A 4NF1A 1M44A 4NXYA 2Q4ZA 1VKCA 2FSRA 2C6CA 1CPSA 2IJZA 2R98A 3NH4A 3V38A 2G3TA 4GM5A 5GCNA 2AJ6A 3D2PA 3IWEA 2G3AA 2XEJA 3FF3A 1TF9A 1QSNA 2GE3A 1HDUA 2PR1A 2ZW5A 5JGFA 3NH5A 2PJ5A 2B4DA 1ELLP 4NGSA 3S6FA 4A30A 3PB4X 3QB8A 4ZYQA 3NFZA 3LMSA 4P45A 3S6HA 3KQZA 3SJFA 1AUGA 1Q2DA 2P6FA 3DNSA 1S7FA 3RO0A 1N71A 4L8AA 3TO7A 4X8IA 2CNMA 3D7HA 3R95A 4BD9A 4YRHA 4A2ZA 5K8NA 2X7BA 5KTDA 3DGVA 2C27A 3WR7A 4DYOA 3TFYA 1IYLA 4TWEA 1QSOA 4KOUA 3FIXA 5FVJA 4C2ZA 4CYOA 3DR6A 4CYNA 4P4DA 4RUHA 4KSAA 4L89A 4NGMA 2YNEA 2G9DA 1Y7RA 2BCOA 4B10A 4ZI6A 7CPAA 1JWQA 2PJBA 2CXAA 1Z8TA 3BLNA 4M6GA 1YK3A 5LRGA 5A27A 3P2FA 3CPAA 4RS2A 1Z9UA 1M4GA 4M6IA 1Z8LA 2AFWA 4UFWA 3S6KA 4MFJA 4OC5A 4PXCA 2O4HA 3FVLA 4P44A 1VHSA 3TTHA 3I9SA 5JM6A 4CAXA 3IGRA 1QQ9A 1Y9WA 4NJRA 3D68A 4UBRA 2AFMA 4Z65A 4MCQA 3ISXA 1GHEA 4EMEA 1YQEA 3NE8A 4OAEA 5E96A 1EE3P 4PK2A 1B87A 1IYKA 3PZJA 3NH8A 3D66A 4KLVA 1BAVA 1YLEA 3CPXA 3D7GA 3EO4A 3T90A 2Z3MA 1ZLIA 2Z3LA 1QMUA 2ZEFA 3B2YA 3BHXA 1ON0A 4KSIA 3GLJA 3BI0A 4MJ8A 4Q36A 3VWDA 2Z0ZA 3IU2A 1Z5RA 2PJ7A 2YNCA 4W9YA 5HH1A 3FNCA 1VHOA 2DPTA 4Y49C 4PXBA 1QSRA 1YMEA 3B3SA 2P6GA 1R57A 4MFQA 1IOFA 3KASA 3QAHA 1BOBA 4B14A 4PQAA 1PU9A 4PK3A 4F6AA 2EK8A 8CPAA 3R9EA 2WSAA 3BXMA 2I00A 4H6ZA 4XPKA 3R9FA 2PIYA 3HLPA 4MHDA 1CP6A 4FD5A 4BINA 3B3CA 3TOAA 3QAYA 3BJ7A 1PCAA 2R8VA 4Q38A 4XPDC 1WK4A 1AMPA 4FD6A 5HVFA 4HPSA 2WYRA 1IIDA 2I79A 2Q44A 4OMEA 2Q7BA 1TKJA 1TIQA 2PJ1A 2XEIA 1CPXA 3QNVA 4JZ0A 3DLJA 2DEAA 1Z4RA 4ONWA 4PV6A 3W6XA 2PRQA 3SHPA 3CDXA 4MCPA 2ODFA 1TXRA 4U5YA 3LWUA 1QSMA 4AG9A 4KOSA 3JVNA 4C2YA 1H8LA 1MK4A 3IJ3A 3TCVA 1Y0RA 3KI9A 4JJXA 1YREA 4P4EA 3RNZA 4AXVA 2V8DA 3CXPA 4QUSA 1IB1E 2B58A 2EK9A 2CTBA 1YGHA 2AFUA 2P0WA 1VIXA 1L0CA 3LACA 3PB8X 3RBUA 3WC7A 4B6ZA 2B5GA 3I3GA 3TO9A 2PQ8A 4UEZA 1DE4C 4KOWA 2Z11A 2VZZA 4MFPA 4PPZA 4F0XA 1YR0A 2VBQA 5KTCA 4O23A 4ORFA 5K8PA 4OADA 2Z10A 3A9LA 4A94A
chains in the Genus database with same CATH topology
4A32A 2GANA 3R1KA 3ZZIA 3N7ZA 2BL1A 1MJBA 2Z3NA 4JXQA 4K30A 1XMTA 2J8NA 4KUBA 4E2AA 2A4NA 5AG5A 4B12A 4H6UA 4CGPA 4QC6A 2JEVA 2Q0YA 4MBUA 3S6GA 4CRZB 2Q4VA 3MGDA 1IICA 4CGNA 5IB0A 1U6MA 2CNSA 2B4BA 5IV0A 1PUAA 3LODA 2FIAA 2Z3KA 2GIVA 2FXFA 3FBUA 4F0YA 1Q2YA 1K4JA 3R96A 3JUWA 4CYQA 3TE4A 4HKFA 4Y49B 5G1ZA 4HNWB 4KVME 3V8IA 4AVAA 4LX9A 3C26A 1M4IA 3T9YA 4KVOE 2B3UA 3RYOA 4DNCA 3UY5A 4JXRA 1NMTA 5I0CA 4ZGYB 4R87A 2QECA 1YVKA 2IL4A 1WWZA 5HMNA 2J8RA 2FS5A 4C2XA 3IU1A 3GKRA 4FD7A 1J4JA 1UFHA 4R9MA 2FE7A 3B8GA 1XE4A 2VXKA 1FY7A 3PGPA 1S5KA 4UWJA 2VI7A 3TOBA 1XF8A 1I1DA 1S3ZA 2PDOA 4UCNA 4IF5A 1LRZA 2J8MA 1KUYA 2PRBA 2ZPAA 2HUZA 2CNTA 4RI1A 4KS9A 1Y9KA 5DWMA 5EBVA 4MY0A 2HV2A 2ZXVA 2HQYA 3F8KA 4MY3A 1Z4EA 5J8FA 5DWNA 4JWPA 2OB0A 2YNDA 1M1DA 1NSLA 1YVOA 2WPWA 5CNPA 5JPHA 5AGEA 3W6SA 4U9YA 2PC1A 4B11A 5F47A 4QB9A 5H86A 5A28A 4KORA 4CRYB 4R3KA 4UA3A 4R57A 4UFVA 4AB7A 2R7HA 2EVNA 4JD6A 2P6EA 1KZFA 3OWCA 3SXOA 4YFJA 1MJAA 2D4OA 2NMTA 4NEXA 2FIWA 2QMLA 4AVBA 1P4NA 2KCWA 4MFZA 2B3VA 2Z3OA 4AVCA 5J8CA 4UCMA 4PSXA 3F0AA 4HNYB 3BJ8A 2PR8A 4KZTA 2DXQA 3FB3A 1BO4A 4KOYA 3FRMA 4XNHC 4XPLA 4B13A 3DSBA 2OU2A 1S7LA 1S7NA 2ATRA 4U9ZA 4CS0B 4ZBGA 4NSQA 3GYAA 2PSWA 4UCPA 3EFAA 1KUXA 2B5GB 4QBJA 2O28A 2REEA 5ISVA 4J3GA 2F5IA 5IX3A 3PP9A 3F5BA 1CJWA 5G21A 4KUAA 4CAFA 5F46A 4R3LA 2WUUA 4H89A 1P0HA 1YX0A 4HNXB 4MFKA 4M3SA 2ZW4A 3H4QA 3D8PA 2D4PA 3R9GA 5KTAA 2H5MA 5F49A 2OZGA 4JLYA 2Q4YA 3DDDA 4CAWA 5F48A 2K5TA 2G0BA 2OZUA 3SXNA 3E0KA 4A33A 2RC4A 3D3SA 4B5OA 1Q2CA 2VZYA 1B6BA 2JDCA 3G3SA 5AG6A 4A95A 1I12A 1RXTA 2ARHA 1S7KA 2QIRA 1QSTA 4E0AA 2OH1A 2FL4A 2R1IA 1KUVA 3EC4A 2BSWA 3G8WA 3TO6A 2ZW7A 4UWIA 1MJ9A 4KLWA 1RO5A 5C82A 3CXSA 4YGOA 5G20A 4CAVA 2EUIA 2JDDA 5C88A 2FCKA 3KKWA 4PSWA 4KOVA 5BWAB 2REFA 4AG7A 4XPDB 4XNHB 1OZPA 4A31A 3W91A 4C68A 2Z3PA 4OLLA 1CM0A 4KSFA 2DPSA 2VQYA 4C7HA 4KOXA 4LUAA 4IUSA 4GS4A 1S60A 2YNCC 4ONUA 3D2MA 5AG4A 4MI4A 1NE9A 2BUEA 2VEZA 4NCZA 4II9A 2Y0MA 3LD2A 4MFLA 1I21A 4KVXA 5G22A 4UFXA 1M4DA 1V0CA 2AE6A 1XIXA 4BBHA 4EVYA 3TT2A 4CGLA 3JTKA 5H84A 2JLMA 5AG7A 4BMHA 3K9UA 2Q04A 3VWEA 4B5PB 2CY2A 3NE7A 3GY9A 3DR8A 1SQHA 3IWGA 2WPXA 1XEBA 2BEIA 2OZHA 2YGWA 4E8OA 3FXTA 3ZJ0A 4CGMA 3EY5A 2FT0A 1ZO0A 4CYPA 3FYNA 4X5KA 3CXQA 4I49A 5JQ4A 4B5PA 4CAEA 4KOTA 3P2HA 2ZW6A 2B4DB 3EXNA 4C7IA 4QVTA 3H5ZA 5EC4A 4FD4A 4NF1A 1M44A 4NXYA 1VKCA 2FSRA 2R98A 2G3TA 5GCNA 3IWEA 3D2PA 2AJ6A 2G3AA 1QSNA 2GE3A 2PR1A 2ZW5A 3S6FA 2B4DA 4A30A 3QB8A 3S6HA 1Q2DA 2P6FA 3DNSA 1S7FA 1N71A 4L8AA 3TO7A 2CNMA 3R95A 4YRHA 4A2ZA 2X7BA 5KTDA 3WR7A 2C27A 3TFYA 1IYLA 1QSOA 4KOUA 3FIXA 5FVJA 4C2ZA 4CYOA 3DR6A 4CYNA 4KSAA 4L89A 2YNEA 1Y7RA 4B10A 2CXAA 3BLNA 5A27A 1YK3A 3P2FA 4RS2A 1Z9UA 1M4GA 4UFWA 3S6KA 4MFJA 3TTHA 1VHSA 3I9SA 4CAXA 3IGRA 1Y9WA 4UBRA 1GHEA 4OAEA 5E96A 4PK2A 1B87A 1IYKA 3PZJA 4KLVA 1YLEA 3EO4A 3T90A 2Z3MA 4M85A 2Z3LA 4CGOA 1ON0A 4Q36A 4MJ8A 3VWDA 2Z0ZA 3IU2A 5HH1A 2YNCA 3FNCA 2DPTA 4Y49C 1QSRA 2P6GA 4MFQA 1R57A 3QAHA 1BOBA 4B14A 1PU9A 4PK3A 4F6AA 3R9EA 2WSAA 2I00A 4H6ZA 4XPKA 3R9FA 4MHDA 4FD5A 3TOAA 3BJ7A 2R8VA 4Q38A 4XPDC 1WK4A 4FD6A 1IIDA 2I79A 2Q44A 2Q7BA 1TIQA 1Z4RA 4PV6A 3W6XA 3SHPA 4U5YA 4AG9A 1QSMA 4KOSA 3JVNA 4C2YA 1MK4A 3TCVA 4JJXA 1YREA 3CXPA 4QUSA 1IB1E 1YGHA 2B58A 2P0WA 1L0CA 2B5GA 3I3GA 3TO9A 2PQ8A 4KOWA 2Z11A 2VZZA 4MFPA 4F0XA 1YR0A 2VBQA 5KTCA 4ORFA 4OADA 2Z10A 3A9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  4UFX A;  3IU2 A;  4UCP A;  2YNC A;  4A32 A;  4UCM A;  5A27 A;  4CYP A;  5A28 A;  5G22 A;  4A30 A;  4CGO A;  4BBH A;  4C7H A;  4UFV A;  4UFW A;  3JTK A;  4C2X A;  4CGL A;  4CYQ A;  3IU1 A;  5G21 A;  5G20 A;  4CAE A;  5AG7 A;  4CAF A;  4B14 A;  5G1Z A;  4A33 A;  4C2Y A;  5AG5 A;  4B12 A;  2YNC C;  2WUU A;  2WSA A;  4C7I A;  4B13 A;  4CGP A;  3H5Z A;  5AG6 A;  4A95 A;  5AG4 A;  4A2Z A;  2YND A;  4UCN A;  4C2Z A;  4CYO A;  4CGN A;  4CYN A;  4A31 A;  4CGM A;  4C68 A;  2YNE A;  5AGE A;  4B10 A;  3IWE A; 
#chains in the Genus database with same CATH topology
 3VAT A;  3IEH A;  3RZA A;  4A32 A;  1YSJ A;  2GAN A;  3R1K A;  4OC3 A;  3ZZI A;  3N7Z A;  5THW A;  2BL1 A;  1MJB A;  1XMB A;  2GLF A;  2Z3N A;  1XMT A;  2J8N A;  4JXQ A;  4K30 A;  4KUB A;  4E2A A;  4NJQ A;  2A4N A;  5AG5 A;  2AFO A;  2PIZ A;  4B12 A;  3WC5 A;  1CX8 A;  4H6U A;  4EWT A;  2RFH A;  4CGP A;  5K8M A;  4QC6 A;  3FEE A;  1F2P A;  2JEV A;  3L2N A;  2Q0Y A;  4MBU A;  1VGY A;  1XOV A;  3S6G A;  4NFR A;  2CIJ A;  3KR5 A;  3B7I A;  2Q4V A;  3MGD A;  3SJX A;  4WJB A;  1IIC A;  4CGN A;  4CRZ B;  3VH9 A;  5IB0 A;  3PFE A;  1U6M A;  1Y7E A;  2CNS A;  2B4B A;  4ZY0 A;  5IV0 A;  1PUA A;  3LOD A;  3S9L A;  2FIA A;  1UWY A;  2Z3K A;  2WZN A;  4DJL A;  2GIV A;  5LYI A;  2FXF A;  3FBU A;  3MN8 A;  4F0Y A;  1Q2Y A;  3PB9 X;  1K4J A;  3KQX A;  2ZEL A;  3R96 A;  3JUW A;  4FUU A;  3D4U A;  4CYQ A;  4UEF A;  2ZEO A;  1BPN A;  4HKF A;  4Y49 B;  5G1Z A;  3T8W A;  2C6G A;  3TE4 A;  4HNW B;  4P4I A;  4KVM E;  3VAR A;  1IOI A;  3V8I A;  4AVA A;  4LX9 A;  4EFD A;  2ZED A;  3C26 A;  3PBE A;  3SJG A;  1M4I A;  4LQ6 A;  3T9Y A;  4KVO E;  1CP7 A;  2B3U A;  3PB7 X;  3B35 A;  1BPM A;  3KL9 A;  3RYO A;  3UY5 A;  4DNC A;  4JXR A;  3H8E A;  2V8G A;  1NMT A;  5I0C A;  3JRU A;  4M6H A;  2GFQ A;  2EWB A;  4MCR A;  4ZGY B;  1LAM A;  5JH9 A;  1X10 A;  2GU2 A;  2QEC A;  2AFX A;  1YVK A;  2IL4 A;  1WWZ A;  2GLJ A;  4R87 A;  5HMN A;  2J8R A;  2O53 A;  2FS5 A;  4ZY2 A;  4OID A;  4C2X A;  4UIB A;  3IU1 A;  3BI1 A;  1Q7L A;  3GKR A;  4FD7 A;  1J4J A;  5DS0 A;  2ANP A;  1ZLH A;  2QYV A;  1OBR A;  1UFH A;  5LRJ A;  4UIA A;  4R9M A;  2FE7 A;  1FNO A;  3B8G A;  3WAB A;  1XE4 A;  2VXK A;  1FY7 A;  3PGP A;  2PCU A;  1S5K A;  4M85 A;  4UWJ A;  2VI7 A;  3TOB A;  1XF8 A;  1I1D A;  1S3Z A;  2PDO A;  4UCN A;  4IF5 A;  1LRZ A;  2J8M A;  3PRT A;  1KUY A;  2PRB A;  2ZPA A;  2I3C A;  3KGQ A;  2HUZ A;  4MMO A;  2GRE A;  3V7Z A;  4OC1 A;  2CNT A;  4RI1 A;  2ZEH A;  5CBM A;  4UF4 A;  4KS9 A;  1Y9K A;  4MXU A;  3FMC A;  5DWM A;  5EBV A;  5LYL A;  2V8V A;  5J1Q A;  4MY0 A;  1PYT B;  2HV2 A;  3S9M A;  2ZXV A;  1YW4 A;  2HQY A;  3F8K A;  3K9T A;  4MY3 A;  1IY7 A;  5D29 A;  1F57 A;  1Z4E A;  5J8F A;  1LOK A;  1Z8X A;  5DWN A;  1ARL A;  2YND A;  2OB0 A;  4JWP A;  1M1D A;  1NSL A;  4NGT A;  4OC4 A;  1YVO A;  3S9N A;  2WPW A;  5CNP A;  5JPH A;  2AFS A;  5AGE A;  3D67 A;  1XJO A;  3W6S A;  2FVG A;  2J9A A;  2PC1 A;  4U9Y A;  5F47 A;  4B11 A;  3IIB A;  5K8O A;  2HB6 A;  4FAI A;  4QB9 A;  5H86 A;  2XEG A;  5A28 A;  4KOR A;  4CRY B;  4OC2 A;  4LQG A;  4R3K A;  4YU9 A;  4UA3 A;  1GYT A;  4R57 A;  4UFV A;  4AB7 A;  2R7H A;  1FT7 A;  2EVN A;  4JD6 A;  2P6E A;  1KZF A;  4A39 A;  3OWC A;  3SXO A;  1ZG9 A;  5EMI A;  4YFJ A;  3N5F A;  2ZEM A;  4P4F A;  1MJA A;  1HDQ A;  1LAN A;  2D4O A;  4MHP A;  3SI0 A;  2EO8 A;  1YW6 A;  2NMT A;  4NEX A;  2FIW A;  2QML A;  4AVB A;  1P4N A;  2CF4 A;  2KCW A;  2ZEP A;  5LYD A;  4MFZ A;  2B3V A;  2Z3O A;  4YWY A;  1ELM P;  3PFO A;  4MRI A;  4A38 A;  4AVC A;  5J8C A;  4UCM A;  3FED A;  4PSX A;  3H8F A;  3F0A A;  4HNY B;  3BJ8 A;  3SI1 A;  2ZEE A;  2PR8 A;  4IHM A;  1NSA A;  4KZT A;  2PJA A;  2DXQ A;  3FB3 A;  1BO4 A;  2C6P A;  4KOY A;  3FRM A;  4XNH C;  4XPL A;  4FBE A;  4RN7 A;  4B13 A;  3KR4 A;  3DSB A;  2OU2 A;  3FX6 A;  1S7L A;  1S7N A;  2ATR A;  4U9Z A;  1XRY A;  1CG2 A;  2IMO A;  3PEI A;  2XEF A;  4CS0 B;  4ZBG A;  4WWV A;  2CTC A;  4NGQ A;  2PJC A;  4NSQ A;  3GYA A;  2JBK A;  2PSW A;  1M4L A;  4UCP A;  3EFA A;  2ABZ A;  3SI2 A;  3WT4 A;  5HVH A;  1KUX A;  1TKH A;  2B5G B;  2O28 A;  2REE A;  4MHN A;  4P6Y A;  4TNU A;  4QBJ A;  5ISV A;  4J3G A;  2F5I A;  5IX3 A;  5HXD A;  2V8H A;  3F5B A;  1CJW A;  3PP9 A;  5G21 A;  4KUA A;  4CAF A;  4NGR A;  5F46 A;  4R3L A;  2WUU A;  4H89 A;  1P0H A;  1YX0 A;  4HNX B;  4M3S A;  4MFK A;  1Y0Y A;  2ZW4 A;  4PXD A;  2PJ6 A;  3H4Q A;  5LYF A;  3D8P A;  2D4P A;  3R9G A;  2OR4 A;  5KTA A;  2H5M A;  4MHY A;  2Q51 A;  5F49 A;  3TC8 A;  1JQG A;  2OZG A;  2JEW A;  4JLY A;  2Q4Y A;  3DDD A;  4CAW A;  3FJU A;  5F48 A;  4MHZ A;  2K5T A;  4P10 A;  4OP4 A;  3RAM A;  2JBJ A;  4NGN A;  2ZEN A;  2G0B A;  2OZU A;  3TX8 A;  3SXN A;  4X3R A;  3E0K A;  4A33 A;  2RC4 A;  3D3S A;  1KWM A;  4B5O A;  1Q2C A;  1LCP A;  2VZY A;  5IB9 A;  2DF5 A;  2JDC A;  1B6B A;  3CZX A;  3G3S A;  5AG6 A;  4Q7A A;  4A95 A;  3GIU A;  1I12 A;  1RXT A;  1LFW A;  3KHZ A;  3B3W A;  2ARH A;  1S7K A;  4F9U A;  3GB0 A;  4K3N A;  3GUX A;  2QIR A;  1QST A;  3IO1 A;  4E0A A;  2OH1 A;  2FL4 A;  1A2Z A;  1RTQ A;  2R1I A;  1KUV A;  2AFZ A;  3EC4 A;  2BSW A;  3G8W A;  3IFE A;  3TO6 A;  4ZX9 A;  2ZW7 A;  4UWI A;  2BOA A;  3KHX A;  2ZOG A;  4R76 A;  1MJ9 A;  4KLW A;  3SJE A;  1RO5 A;  5C82 A;  4OC0 A;  3CXS A;  4YGO A;  5G20 A;  4CAV A;  3K2K A;  2Q7S A;  2EUI A;  2JDD A;  4R7M A;  5C88 A;  1TF8 A;  4JYW A;  2FCK A;  3D7D A;  3KKW A;  4PSW A;  4KOV A;  4PXE A;  4FWU A;  5HVG A;  5BWA B;  2C1C A;  2REF A;  4AG7 A;  4XPD B;  4XNH B;  2QVP A;  3KZW A;  1IU8 A;  1XFO A;  3CT9 A;  1OZP A;  4A31 A;  2PJ0 A;  3W91 A;  4C68 A;  2Z3P A;  2EBJ A;  4DUK A;  3H8G A;  4OLL A;  2F8H A;  4NGP A;  2ZOF A;  1CM0 A;  3NA6 A;  2PJ9 A;  4F9V A;  4KSF A;  2DPS A;  5D8N A;  4CGO A;  2VQY A;  4C7H A;  1DTD A;  4KOX A;  4LUA A;  4IUS A;  1R3N A;  4GS4 A;  1S60 A;  3WC6 A;  1BLL E;  4R8F A;  2HC9 A;  2YNC C;  1HEE A;  5F09 A;  6CPA A;  4IK2 A;  4ONU A;  2PJ4 A;  4G1P A;  4ZX8 A;  1Z2L A;  3D2M A;  2OOT A;  5AG4 A;  2PJ3 A;  4MI4 A;  2NSM A;  3B3T A;  1NE9 A;  2BUE A;  2VEZ A;  4H2K A;  4NCZ A;  4II9 A;  3PB6 X;  5CPA A;  2Y0M A;  2PE3 A;  3LD2 A;  2ZEG A;  5I4M A;  2VL1 A;  4UEE A;  2PVW A;  4MFL A;  1I21 A;  1XBU A;  2QJ8 A;  4KVX A;  5G22 A;  4UFX A;  1M4D A;  1V0C A;  1Z8W A;  2AE6 A;  2NYQ A;  1XIX A;  3ISZ A;  3B3V A;  4X2T A;  4BBH A;  4EVY A;  3TT2 A;  4CGL A;  3JTK A;  3FH4 A;  3D7F A;  5H84 A;  2JLM A;  2IQ6 A;  5AG7 A;  3MRU A;  1IGB A;  3IC1 A;  3IWW A;  4BMH A;  1AYE A;  1ZG7 A;  2PJ8 A;  2Q43 A;  4GXH A;  2V77 A;  3K9U A;  3FEC A;  2Q04 A;  3VWE A;  4B5P B;  2CY2 A;  3NE7 A;  3GY9 A;  4R6T A;  4A37 A;  4F8Z A;  3DR8 A;  1SQH A;  1CBX A;  4OIW A;  5LRK A;  1VHE A;  4IAV A;  4P4B A;  3IWG A;  2WPX A;  1R43 A;  1XEB A;  2BEI A;  2OZH A;  2PVV A;  2YGW A;  4E8O A;  3FXT A;  3ZJ0 A;  4CGM A;  4MCS A;  5ELY A;  1ARM A;  1F2O A;  3EY5 A;  2FT0 A;  1ZO0 A;  1ZG8 A;  4P4J A;  4CYP A;  4CPA A;  3FYN A;  2F7V A;  4X5K A;  3CXQ A;  4I49 A;  5JQ4 A;  4B5P A;  2POK A;  4ZY1 A;  1LAP A;  4CAE A;  4KOT A;  1TKF A;  3P2H A;  1YLO A;  2ZW6 A;  3HUV A;  2B4D B;  2BO9 A;  2RB7 A;  4OKO A;  3EXN A;  3PBB A;  4C7I A;  4QVT A;  3H5Z A;  3I1U A;  5EC4 A;  4FD4 A;  2PJ2 A;  1X12 A;  4NF1 A;  1M44 A;  4NXY A;  2Q4Z A;  1VKC A;  2FSR A;  2C6C A;  1CPS A;  2IJZ A;  2R98 A;  3NH4 A;  3V38 A;  2G3T A;  4GM5 A;  5GCN A;  2AJ6 A;  3D2P A;  3IWE A;  2G3A A;  2XEJ A;  3FF3 A;  1TF9 A;  1QSN A;  2GE3 A;  1HDU A;  2PR1 A;  2ZW5 A;  5JGF A;  3NH5 A;  2PJ5 A;  2B4D A;  1ELL P;  4NGS A;  3S6F A;  4A30 A;  3PB4 X;  3QB8 A;  4ZYQ A;  3NFZ A;  3LMS A;  4P45 A;  3S6H A;  3KQZ A;  3SJF A;  1AUG A;  1Q2D A;  2P6F A;  3DNS A;  1S7F A;  3RO0 A;  1N71 A;  4L8A A;  3TO7 A;  4X8I A;  2CNM A;  3D7H A;  3R95 A;  4BD9 A;  4YRH A;  4A2Z A;  5K8N A;  2X7B A;  5KTD A;  3DGV A;  2C27 A;  3WR7 A;  4DYO A;  3TFY A;  1IYL A;  4TWE A;  1QSO A;  4KOU A;  3FIX A;  5FVJ A;  4C2Z A;  4CYO A;  3DR6 A;  4CYN A;  4P4D A;  4RUH A;  4KSA A;  4L89 A;  4NGM A;  2YNE A;  2G9D A;  1Y7R A;  2BCO A;  4B10 A;  4ZI6 A;  7CPA A;  1JWQ A;  2PJB A;  2CXA A;  1Z8T A;  3BLN A;  4M6G A;  1YK3 A;  5LRG A;  5A27 A;  3P2F A;  3CPA A;  4RS2 A;  1Z9U A;  1M4G A;  4M6I A;  1Z8L A;  2AFW A;  4UFW A;  3S6K A;  4MFJ A;  4OC5 A;  4PXC A;  2O4H A;  3FVL A;  4P44 A;  1VHS A;  3TTH A;  3I9S A;  5JM6 A;  4CAX A;  3IGR A;  1QQ9 A;  1Y9W A;  4NJR A;  3D68 A;  4UBR A;  2AFM A;  4Z65 A;  4MCQ A;  3ISX A;  1GHE A;  4EME A;  1YQE A;  3NE8 A;  4OAE A;  5E96 A;  1EE3 P;  4PK2 A;  1B87 A;  1IYK A;  3PZJ A;  3NH8 A;  3D66 A;  4KLV A;  1BAV A;  1YLE A;  3CPX A;  3D7G A;  3EO4 A;  3T90 A;  2Z3M A;  1ZLI A;  2Z3L A;  1QMU A;  2ZEF A;  3B2Y A;  3BHX A;  1ON0 A;  4KSI A;  3GLJ A;  3BI0 A;  4MJ8 A;  4Q36 A;  3VWD A;  2Z0Z A;  3IU2 A;  1Z5R A;  2PJ7 A;  2YNC A;  4W9Y A;  5HH1 A;  3FNC A;  1VHO A;  2DPT A;  4Y49 C;  4PXB A;  1QSR A;  1YME A;  3B3S A;  2P6G A;  1R57 A;  4MFQ A;  1IOF A;  3KAS A;  3QAH A;  1BOB A;  4B14 A;  4PQA A;  1PU9 A;  4PK3 A;  4F6A A;  2EK8 A;  8CPA A;  3R9E A;  2WSA A;  3BXM A;  2I00 A;  4H6Z A;  4XPK A;  3R9F A;  2PIY A;  3HLP A;  4MHD A;  1CP6 A;  4FD5 A;  4BIN A;  3B3C A;  3TOA A;  3QAY A;  3BJ7 A;  1PCA A;  2R8V A;  4Q38 A;  4XPD C;  1WK4 A;  1AMP A;  4FD6 A;  5HVF A;  4HPS A;  2WYR A;  1IID A;  2I79 A;  2Q44 A;  4OME A;  2Q7B A;  1TKJ A;  1TIQ A;  2PJ1 A;  2XEI A;  1CPX A;  3QNV A;  4JZ0 A;  3DLJ A;  2DEA A;  1Z4R A;  4ONW A;  4PV6 A;  3W6X A;  2PRQ A;  3SHP A;  3CDX A;  4MCP A;  2ODF A;  1TXR A;  4U5Y A;  3LWU A;  1QSM A;  4AG9 A;  4KOS A;  3JVN A;  4C2Y A;  1H8L A;  1MK4 A;  3IJ3 A;  3TCV A;  1Y0R A;  3KI9 A;  4JJX A;  1YRE A;  4P4E A;  3RNZ A;  4AXV A;  2V8D A;  3CXP A;  4QUS A;  1IB1 E;  2B58 A;  2EK9 A;  2CTB A;  1YGH A;  2AFU A;  2P0W A;  1VIX A;  1L0C A;  3LAC A;  3PB8 X;  3RBU A;  3WC7 A;  4B6Z A;  2B5G A;  3I3G A;  3TO9 A;  2PQ8 A;  4UEZ A;  1DE4 C;  4KOW A;  2Z11 A;  2VZZ A;  4MFP A;  4PPZ A;  4F0X A;  1YR0 A;  2VBQ A;  5KTC A;  4O23 A;  4ORF A;  5K8P A;  4OAD A;  2Z10 A;  3A9L A;  4A94 A; 
#chains in the Genus database with same CATH homology
 4A32 A;  2GAN A;  3R1K A;  3ZZI A;  3N7Z A;  2BL1 A;  1MJB A;  2Z3N A;  4JXQ A;  4K30 A;  1XMT A;  2J8N A;  4KUB A;  4E2A A;  2A4N A;  5AG5 A;  4B12 A;  4H6U A;  4CGP A;  4QC6 A;  2JEV A;  2Q0Y A;  4MBU A;  3S6G A;  4CRZ B;  2Q4V A;  3MGD A;  1IIC A;  4CGN A;  5IB0 A;  1U6M A;  2CNS A;  2B4B A;  5IV0 A;  1PUA A;  3LOD A;  2FIA A;  2Z3K A;  2GIV A;  2FXF A;  3FBU A;  4F0Y A;  1Q2Y A;  1K4J A;  3R96 A;  3JUW A;  4CYQ A;  3TE4 A;  4HKF A;  4Y49 B;  5G1Z A;  4HNW B;  4KVM E;  3V8I A;  4AVA A;  4LX9 A;  3C26 A;  1M4I A;  3T9Y A;  4KVO E;  2B3U A;  3RYO A;  4DNC A;  3UY5 A;  4JXR A;  1NMT A;  5I0C A;  4ZGY B;  4R87 A;  2QEC A;  1YVK A;  2IL4 A;  1WWZ A;  5HMN A;  2J8R A;  2FS5 A;  4C2X A;  3IU1 A;  3GKR A;  4FD7 A;  1J4J A;  1UFH A;  4R9M A;  2FE7 A;  3B8G A;  1XE4 A;  2VXK A;  1FY7 A;  3PGP A;  1S5K A;  4UWJ A;  2VI7 A;  3TOB A;  1XF8 A;  1I1D A;  1S3Z A;  2PDO A;  4UCN A;  4IF5 A;  1LRZ A;  2J8M A;  1KUY A;  2PRB A;  2ZPA A;  2HUZ A;  2CNT A;  4RI1 A;  4KS9 A;  1Y9K A;  5DWM A;  5EBV A;  4MY0 A;  2HV2 A;  2ZXV A;  2HQY A;  3F8K A;  4MY3 A;  1Z4E A;  5J8F A;  5DWN A;  4JWP A;  2OB0 A;  2YND A;  1M1D A;  1NSL A;  1YVO A;  2WPW A;  5CNP A;  5JPH A;  5AGE A;  3W6S A;  4U9Y A;  2PC1 A;  4B11 A;  5F47 A;  4QB9 A;  5H86 A;  5A28 A;  4KOR A;  4CRY B;  4R3K A;  4UA3 A;  4R57 A;  4UFV A;  4AB7 A;  2R7H A;  2EVN A;  4JD6 A;  2P6E A;  1KZF A;  3OWC A;  3SXO A;  4YFJ A;  1MJA A;  2D4O A;  2NMT A;  4NEX A;  2FIW A;  2QML A;  4AVB A;  1P4N A;  2KCW A;  4MFZ A;  2B3V A;  2Z3O A;  4AVC A;  5J8C A;  4UCM A;  4PSX A;  3F0A A;  4HNY B;  3BJ8 A;  2PR8 A;  4KZT A;  2DXQ A;  3FB3 A;  1BO4 A;  4KOY A;  3FRM A;  4XNH C;  4XPL A;  4B13 A;  3DSB A;  2OU2 A;  1S7L A;  1S7N A;  2ATR A;  4U9Z A;  4CS0 B;  4ZBG A;  4NSQ A;  3GYA A;  2PSW A;  4UCP A;  3EFA A;  1KUX A;  2B5G B;  4QBJ A;  2O28 A;  2REE A;  5ISV A;  4J3G A;  2F5I A;  5IX3 A;  3PP9 A;  3F5B A;  1CJW A;  5G21 A;  4KUA A;  4CAF A;  5F46 A;  4R3L A;  2WUU A;  4H89 A;  1P0H A;  1YX0 A;  4HNX B;  4MFK A;  4M3S A;  2ZW4 A;  3H4Q A;  3D8P A;  2D4P A;  3R9G A;  5KTA A;  2H5M A;  5F49 A;  2OZG A;  4JLY A;  2Q4Y A;  3DDD A;  4CAW A;  5F48 A;  2K5T A;  2G0B A;  2OZU A;  3SXN A;  3E0K A;  4A33 A;  2RC4 A;  3D3S A;  4B5O A;  1Q2C A;  2VZY A;  1B6B A;  2JDC A;  3G3S A;  5AG6 A;  4A95 A;  1I12 A;  1RXT A;  2ARH A;  1S7K A;  2QIR A;  1QST A;  4E0A A;  2OH1 A;  2FL4 A;  2R1I A;  1KUV A;  3EC4 A;  2BSW A;  3G8W A;  3TO6 A;  2ZW7 A;  4UWI A;  1MJ9 A;  4KLW A;  1RO5 A;  5C82 A;  3CXS A;  4YGO A;  5G20 A;  4CAV A;  2EUI A;  2JDD A;  5C88 A;  2FCK A;  3KKW A;  4PSW A;  4KOV A;  5BWA B;  2REF A;  4AG7 A;  4XPD B;  4XNH B;  1OZP A;  4A31 A;  3W91 A;  4C68 A;  2Z3P A;  4OLL A;  1CM0 A;  4KSF A;  2DPS A;  2VQY A;  4C7H A;  4KOX A;  4LUA A;  4IUS A;  4GS4 A;  1S60 A;  2YNC C;  4ONU A;  3D2M A;  5AG4 A;  4MI4 A;  1NE9 A;  2BUE A;  2VEZ A;  4NCZ A;  4II9 A;  2Y0M A;  3LD2 A;  4MFL A;  1I21 A;  4KVX A;  5G22 A;  4UFX A;  1M4D A;  1V0C A;  2AE6 A;  1XIX A;  4BBH A;  4EVY A;  3TT2 A;  4CGL A;  3JTK A;  5H84 A;  2JLM A;  5AG7 A;  4BMH A;  3K9U A;  2Q04 A;  3VWE A;  4B5P B;  2CY2 A;  3NE7 A;  3GY9 A;  3DR8 A;  1SQH A;  3IWG A;  2WPX A;  1XEB A;  2BEI A;  2OZH A;  2YGW A;  4E8O A;  3FXT A;  3ZJ0 A;  4CGM A;  3EY5 A;  2FT0 A;  1ZO0 A;  4CYP A;  3FYN A;  4X5K A;  3CXQ A;  4I49 A;  5JQ4 A;  4B5P A;  4CAE A;  4KOT A;  3P2H A;  2ZW6 A;  2B4D B;  3EXN A;  4C7I A;  4QVT A;  3H5Z A;  5EC4 A;  4FD4 A;  4NF1 A;  1M44 A;  4NXY A;  1VKC A;  2FSR A;  2R98 A;  2G3T A;  5GCN A;  3IWE A;  3D2P A;  2AJ6 A;  2G3A A;  1QSN A;  2GE3 A;  2PR1 A;  2ZW5 A;  3S6F A;  2B4D A;  4A30 A;  3QB8 A;  3S6H A;  1Q2D A;  2P6F A;  3DNS A;  1S7F A;  1N71 A;  4L8A A;  3TO7 A;  2CNM A;  3R95 A;  4YRH A;  4A2Z A;  2X7B A;  5KTD A;  3WR7 A;  2C27 A;  3TFY A;  1IYL A;  1QSO A;  4KOU A;  3FIX A;  5FVJ A;  4C2Z A;  4CYO A;  3DR6 A;  4CYN A;  4KSA A;  4L89 A;  2YNE A;  1Y7R A;  4B10 A;  2CXA A;  3BLN A;  5A27 A;  1YK3 A;  3P2F A;  4RS2 A;  1Z9U A;  1M4G A;  4UFW A;  3S6K A;  4MFJ A;  3TTH A;  1VHS A;  3I9S A;  4CAX A;  3IGR A;  1Y9W A;  4UBR A;  1GHE A;  4OAE A;  5E96 A;  4PK2 A;  1B87 A;  1IYK A;  3PZJ A;  4KLV A;  1YLE A;  3EO4 A;  3T90 A;  2Z3M A;  4M85 A;  2Z3L A;  4CGO A;  1ON0 A;  4Q36 A;  4MJ8 A;  3VWD A;  2Z0Z A;  3IU2 A;  5HH1 A;  2YNC A;  3FNC A;  2DPT A;  4Y49 C;  1QSR A;  2P6G A;  4MFQ A;  1R57 A;  3QAH A;  1BOB A;  4B14 A;  1PU9 A;  4PK3 A;  4F6A A;  3R9E A;  2WSA A;  2I00 A;  4H6Z A;  4XPK A;  3R9F A;  4MHD A;  4FD5 A;  3TOA A;  3BJ7 A;  2R8V A;  4Q38 A;  4XPD C;  1WK4 A;  4FD6 A;  1IID A;  2I79 A;  2Q44 A;  2Q7B A;  1TIQ A;  1Z4R A;  4PV6 A;  3W6X A;  3SHP A;  4U5Y A;  4AG9 A;  1QSM A;  4KOS A;  3JVN A;  4C2Y A;  1MK4 A;  3TCV A;  4JJX A;  1YRE A;  3CXP A;  4QUS A;  1IB1 E;  1YGH A;  2B58 A;  2P0W A;  1L0C A;  2B5G A;  3I3G A;  3TO9 A;  2PQ8 A;  4KOW A;  2Z11 A;  2VZZ A;  4MFP A;  4F0X A;  1YR0 A;  2VBQ A;  5KTC A;  4ORF A;  4OAD A;  2Z10 A;  3A9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...