4A95A

Plasmodium vivax n-myristoyltransferase with quinoline inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Plasmodium Vivax N-Myristoyltransferase Inhibitors: Screening, Synthesis, and Structural Characterization of Their Binding Mode.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a95A00
5G22A 3IWEA 2YNEA 4B13A 3IU1A 4C2ZA 4CGLA 4B11A 5G1ZA 4CAFA 5A27A 4A2ZA 2WSAA 4A31A 4C7HA 5A28A 4C2XA 3IU2A 5G20A 4CAEA 4CYNA 4BBHA 4CYOA 4B12A 5AG6A 4C68A 2YNCC 4A32A 4CYQA 4A33A 3H5ZA 5AG5A 4CGMA 4A30A 4UFWA 4B14A 3JTKA 4UFXA 4A95A 5AGEA 5G21A 4CGPA 4C2YA 4UCMA 4CYPA 4B10A 2WUUA 4UCNA 4C7IA 4CGOA 2YNDA 2YNCA 4UFVA 4CGNA 4UCPA 5AG4A 5AG7A
chains in the Genus database with same CATH superfamily
2PJ0A 2JDCA 4MI4A 4ONWA 4MFPA 2B3VA 4UIBA 4RN7A 2BL1A 3IWGA 2V8HA 2ZEPA 3IJ3A 4IHMA 1HEEA 3S6KA 4E8OA 3PZJA 1VKCA 1P0HA 1XBUA 2ZEDA 4GM5A 1IU8A 4ZBGA 3KR5A 3DDDA 3KQZA 4GXHA 1S3ZA 4CRZB 2D4OA 2PIZA 2QMLA 3E0KA 3NFZA 4WJBA 3S6HA 1UFHA 4CS0B 3RAMA 1CPXA 5G21A 2CY2A 4IF5A 3PB4X 3SJEA 4AB7A 1ZG8A 5J8FA 2AFSA 4CGOA 3D2PA 4P4EA 3QAHA 4KUAA 3T8WA 1ZLIA 4M3SA 1QSNA 4P45A 4R87A 1FNOA 1Y0RA 4OC4A 4B13A 3OWCA 5BWAB 3VARA 1S7LA 1IYKA 4MCRA 1TKHA 5F48A 3RZAA 4NJQA 3NA6A 2QIRA 1Q2DA 1WWZA 1S7KA 2ZPAA 3SI0A 1K4JA 4NGRA 3MN8A 3WABA 3FH4A 3FYNA 4NFRA 4OC2A 2BCOA 4PSXA 2ANPA 2CTCA 2IJZA 2WYRA 3F8KA 4NGMA 2O53A 3QB8A 4UIAA 1HDUA 1YR0A 2C6GA 4JYWA 1S7FA 3EO4A 4Y49B 5LRGA 2IMOA 1GYTA 1ZLHA 4ZY2A 1P4NA 3FBUA 4H2KA 1B87A 4LUAA 4A94A 4Q38A 2Q44A 2ZEMA 2ZW7A 3D66A 2Z3PA 1Z8TA 1RO5A 2BUEA 3FJUA 1R43A 3I9SA 4PV6A 1TKFA 4AG9A 4CAWA 1VGYA 3TE4A 2I3CA 4M6HA 1YGHA 2BSWA 4CAXA 1OZPA 4BINA 4UWJA 5KTDA 1YW6A 1H8LA 3GYAA 5A27A 2FT0A 4NCZA 5K8NA 2Z3LA 4M6IA 2Z3OA 2P6FA 4F0YA 2R1IA 1MJAA 2D4PA 2G0BA 2Q51A 2VXKA 4NXYA 2OU2A 2CNMA 4LX9A 3MRUA 3H8FA 4R3KA 1CP7A 3BHXA 4A32A 2OB0A 2FL4A 3CZXA 3I1UA 3PB9X 1M1DA 1QSRA 3R96A 1Z8LA 4UA3A 4J3GA 4CYPA 5JQ4A 5C82A 1MK4A 2ZEOA 3CPXA 1KUVA 4MMOA 3RBUA 3WC5A 8CPAA 2PJ5A 4EWTA 3RO0A 4RUHA 3TFYA 4WWVA 1AYEA 4NGTA 1V0CA 4FD4A 3S6FA 4OLLA 4HNWB 4QBJA 3SI2A 4IAVA 4M6GA 1LFWA 1XRYA 1XEBA 1NMTA 2Z3KA 1Z8WA 3DGVA 3R9GA 1QQ9A 1YREA 3TX8A 2PJ3A 3SXNA 4F8ZA 2B4DA 4HNXB 4OC1A 4BBHA 5AG6A 5HVFA 2DPTA 5IX3A 1Z2LA 1I1DA 4AG7A 2FIAA 1AUGA 2J8NA 1M4IA 4UFWA 5THWA 1XE4A 3KR4A 4FAIA 4Q7AA 1R57A 3SJGA 3CT9A 2HC9A 4R3LA 3KQXA 4F0XA 3VWDA 4KOTA 5F46A 4A39A 3NH4A 4UCPA 3P2FA 5LYIA 1X12A 4E2AA 5G22A 1IIDA 1RXTA 3IC1A 3SJFA 4JXRA 2VI7A 3D68A 4PSWA 4KOWA 2QJ8A 4RI1A 1QSOA 4Z65A 5IV0A 5CPAA 3TC8A 3TO7A 1EE3P 1XIXA 2ZEHA 2AFWA 4KSAA 2P6EA 2Q04A 3L2NA 2Q7BA 2V77A 3WC6A 2EWBA 1SQHA 2PJ4A 3D7HA 1CPSA 4MXUA 3SI1A 2GIVA 4NEXA 3D7FA 3BXMA 1QSTA 2GREA 2G3AA 4A30A 4II9A 3DR6A 2ABZA 3GKRA 4MFKA 3R9FA 5JH9A 4FD6A 1F2PA 4KLWA 1QSMA 1CG2A 3GY9A 4JZ0A 3BJ8A 2RB7A 2FVGA 4PQAA 4CGNA 1BPNA 2VBQA 5F09A 2FIWA 1YX0A 4HKFA 5LRJA 2PC1A 2OH1A 3GUXA 1NSAA 3IU1A 2F5IA 2V8GA 4TWEA 4BMHA 2Z10A 4KOYA 4MY0A 4CAFA 4JLYA 3NE8A 1JQGA 1QMUA 2WSAA 3K2KA 4A31A 5A28A 5ELYA 1TIQA 2WPWA 3IU2A 4KUBA 5DWNA 3HUVA 5GCNA 2ZW5A 4OIDA 4L89A 4MHNA 2EO8A 4MFJA 2PCUA 3FMCA 3JVNA 1U6MA 2CTBA 2VZZA 4R9MA 5H84A 3TO6A 3FVLA 4XNHC 5D8NA 1ON0A 2DXQA 1GHEA 3EC4A 4GS4A 3F5BA 5J8CA 4UCMA 3SXOA 2PRBA 4JXQA 4K3NA 3VH9A 4I49A 4AVCA 2WPXA 1KUXA 2Z3NA 4XPDB 4EVYA 4FD7A 2YNEA 5F47A 3VWEA 2PJ6A 2G3TA 3ISXA 4JD6A 3R95A 4UF4A 4ZX9A 2B4DB 2C27A 3W91A 2X7BA 3R9EA 4F9VA 3N5FA 4C7HA 1LANA 2I79A 2PJ1A 2XEGA 1BLLE 2GU2A 4MRIA 5KTAA 1Y9KA 2ZELA 4CRYB 1CJWA 3CPAA 2EUIA 3PGPA 3PFEA 2VZYA 5AG5A 6CPAA 4B14A 2GE3A 2QVPA 1XFOA 1YVOA 4CGPA 2ZEEA 1BAVA 2PDOA 4NGSA 1VHOA 3R1KA 4ZYQA 4LQGA 2DEAA 4MFZA 2DF5A 5CBMA 4U5YA 2PJ2A 3FIXA 1BO4A 4MCSA 3S9MA 3D7GA 3IIBA 3WC7A 4C2ZA 4P44A 4XPLA 3NH5A 3PB7X 3C26A 4JWPA 5EBVA 2GANA 3WR7A 3FEEA 2Q7SA 2O28A 2C6CA 2GLFA 4PXCA 1HDQA 2AFZA 2G9DA 2F8HA 2JBJA 2DPSA 4DNCA 1Z9UA 2PJ8A 4KORA 4KVOE 2REEA 2OZUA 4Y49C 3IWWA 3PRTA 4UWIA 5EMIA 2PR1A 5FVJA 4P4JA 4UFXA 4KOSA 4OC0A 2JBKA 5C88A 1Z5RA 2XEFA 1Z4EA 1YLOA 2CXAA 3GLJA 4KZTA 1LRZA 2BO9A 1F2OA 4H6UA 4MHDA 4UFVA 1DTDA 1FT7A 1N71A 1XJOA 2OZGA 3KL9A 5K8MA 4AVAA 2P0WA 5LYDA 3FF3A 4PXDA 4ZI6A 3G3SA 2J9AA 3SHPA 4X5KA 1IOFA 1YW4A 1UWYA 3JRUA 3PBBA 4Q36A 4R8FA 4E0AA 3KGQA 3GIUA 1KUYA 3B3CA 2REFA 5G20A 2CIJA 4CYNA 1ARMA 3KASA 2F7VA 4OAEA 2NMTA 2Q4ZA 1IB1E 4ORFA 1S7NA 3ZZIA 2ZEFA 1IICA 3LWUA 3TOAA 4ZY1A 1PCAA 3LMSA 3DSBA 4M85A 1M4DA 4YFJA 2B58A 2WUUA 1YK3A 4UCNA 3TOBA 5K8PA 1ZG9A 1XMBA 5I0CA 2FXFA 2HQYA 2Y0MA 4KOXA 2C1CA 2JDDA 5HXDA 1YSJA 3V8IA 4G1PA 2CNSA 3H8GA 2ZOGA 2PSWA 3PB6X 4MJ8A 4ZX8A 2Q4YA 2OR4A 1X10A 4C2XA 3A9LA 3D8PA 4EMEA 3JUWA 1PU9A 4B12A 3HLPA 3EFAA 2P6GA 3KHZA 2HV2A 5H86A 3VATA 2RC4A 1KZFA 3LACA 3JTKA 4W9YA 3FNCA 2A4NA 2QECA 4P4IA 4B5OA 3KZWA 4MCQA 2GFQA 4MBUA 3CXSA 4C7IA 4P6YA 2PJBA 1FY7A 2YNDA 4LQ6A 4AXVA 2O4HA 1Q2CA 3CXQA 4MFQA 4YGOA 3IWEA 4UBRA 3FB3A 5JM6A 2NYQA 3ZJ0A 5LYFA 3B2YA 4RS2A 4B11A 2R8VA 1LAPA 1PYTB 3V7ZA 1CBXA 4ONUA 2C6PA 3DLJA 3KKWA 3PP9A 5DS0A 4KVXA 1IGBA 1VHEA 2H5MA 2FCKA 2JLMA 3FECA 4BD9A 4OC3A 1S60A 3FRMA 4O23A 3WT4A 2PRQA 2EBJA 2NSMA 2ZENA 3DNSA 4QB9A 1I21A 3PEIA 1IYLA 3NH8A 7CPAA 4MY3A 3T9YA 5I4MA 3BI1A 2FSRA 1M44A 4X8IA 4P10A 4TNUA 5K8OA 4UEFA 4IK2A 2PQ8A 2PR8A 4CGLA 2PVWA 2WZNA 4PK2A 3CXPA 2V8VA 2PJ9A 2VL1A 2Z0ZA 3D7DA 4R6TA 1M4GA 4HNYB 5J1QA 3D3SA 3N7ZA 5DWMA 3RNZA 4CYOA 3K9TA 1IOIA 1IY7A 4OC5A 1YVKA 4YU9A 2IL4A 3W6SA 3TO9A 4A38A 1RTQA 3H8EA 4QUSA 4CYQA 4A33A 4FD5A 4KVME 4NSQA 3UY5A 3S9NA 3LD2A 4QVTA 3S6GA 4R76A 3SJXA 4K30A 4CPAA 2EK9A 4R57A 1I12A 2YNCA 1MJ9A 1F57A 1TKJA 1VIXA 2FE7A 4XPDC 2PE3A 2Z3MA 4MHYA 2PJAA 2XEIA 5JGFA 3S9LA 1TXRA 1YMEA 1BPMA 4KLVA 1ELMP 1TF9A 5D29A 3G8WA 2YGWA 1ZG7A 2ODFA 4KSIA 2AE6A 3PB8X 4XPKA 4DJLA 2JEWA 1ZO0A 3GB0A 4H6ZA 1OBRA 1L0CA 3D2MA 1YQEA 1CM0A 1NSLA 1Y7RA 2HUZA 4HPSA 4PXEA 3RYOA 1VHSA 4A95A 2ZW4A 4MHPA 5LYLA 4MCPA 4QC6A 3TTHA 4U9YA 2Z11A 2BEIA 4KSFA 3KI9A 3QAYA 3D67A 4JJXA 5ISVA 1BOBA 1Y7EA 4NF1A 1LOKA 2GLJA 4MHZA 4DUKA 4R7MA 2V8DA 2CNTA 4F6AA 2QYVA 3PFOA 2FS5A 1WK4A 1KWMA 1ELLP 1MJBA 4EFDA 4P4DA 4A2ZA 3F0AA 4B5PB 3I3GA 2B5GB 4FUUA 5EC4A 2Q4VA 3KHXA 2ZEGA 5CNPA 3B7IA 2AFUA 3H4QA 4A37A 3IEHA 4ZY0A 2BOAA 2OOTA 1Y9WA 3H5ZA 3PBEA 3NE7A 4YWYA 4F9UA 1XF8A 1XOVA 4NGNA 4DYOA 3B3WA 3FEDA 4P4BA 3MGDA 4L8AA 3B35A 4KOUA 3TCVA 2EK8A 4AVBA 2AJ6A 3BJ7A 1B6BA 1Z8XA 3FXTA 1NE9A 5AG7A 5IB9A 3D4UA 2CF4A 2VQYA 2ARHA 5HH1A 4NGQA 5HVGA 3K9UA 1LCPA 4IUSA 3T90A 3B3TA 4NGPA 2EVNA 4PPZA 4UEEA 4FBEA 4B6ZA 4CAEA 2AFMA 2KCWA 2B3UA 2RFHA 5HMNA 3IFEA 4PXBA 1A2ZA 4C68A 1M4LA 2JEVA 4OMEA 1Y0YA 2ZW6A 2PJCA 1LAMA 1PUAA 4CGMA 4OP4A 4KS9A 2R98A 2POKA 2R7HA 1JWQA 3B3SA 2AFOA 2Q0YA 2XEJA 3IO1A 3IGRA 4MFLA 2HB6A 4KOVA 4C2YA 5LRKA 1S5KA 3CDXA 1Z4RA 5KTCA 1CP6A 1YLEA 4P4FA 1J4JA 2ZOFA 5AG4A 3B3VA 4OKOA 4OADA 2K5TA 2ATRA 3EXNA 4H89A 2AFXA 2Q43A 5F49A 3DR8A 5G1ZA 2J8MA 3QNVA 3LODA 2PVVA 5HVHA 3TT2A 3W6XA 1ARLA 4CAVA 2ZXVA 1R3NA 5IB0A 1Q2YA 3ISZA 2B4BA 2PIYA 3V38A 2VEZA 3BLNA 4OIWA 4NJRA 4X2TA 5E96A 5JPHA 2IQ6A 1CX8A 2YNCC 4B5PA 4U9ZA 2B5GA 3FX6A 4XNHB 4YRHA 5AGEA 1TF8A 2I00A 4X3RA 3B8GA 1Q7LA 4B10A 1DE4C 3EY5A 2J8RA 2OZHA 4FWUA 1XMTA 3P2HA 4ZGYB 4UEZA 4PK3A 1AMPA 2PJ7A 3BI0A
chains in the Genus database with same CATH topology
2JDCA 4MI4A 4MFPA 2B3VA 2BL1A 3IWGA 3S6KA 4E8OA 3PZJA 1VKCA 1P0HA 4ZBGA 3DDDA 1S3ZA 4CRZB 2D4OA 2QMLA 3E0KA 3S6HA 4CS0B 1UFHA 5G21A 2CY2A 4IF5A 4AB7A 5J8FA 4CGOA 3D2PA 3QAHA 4KUAA 4M3SA 1QSNA 4R87A 5BWAB 4B13A 3OWCA 1S7LA 1IYKA 5F48A 2QIRA 1Q2DA 1WWZA 1S7KA 2ZPAA 1K4JA 3FYNA 4PSXA 3F8KA 3QB8A 1YR0A 1S7FA 3EO4A 4Y49B 1P4NA 3FBUA 1B87A 4LUAA 4Q38A 2Q44A 2ZW7A 2Z3PA 1RO5A 2BUEA 3I9SA 4PV6A 4AG9A 4CAWA 3TE4A 1YGHA 2BSWA 4CAXA 1OZPA 4UWJA 5KTDA 3GYAA 5A27A 2FT0A 4NCZA 2Z3LA 2Z3OA 2P6FA 4F0YA 2R1IA 1MJAA 2D4PA 2G0BA 4NXYA 2VXKA 2OU2A 2CNMA 4LX9A 4R3KA 4A32A 2OB0A 2FL4A 1M1DA 1QSRA 3R96A 4UA3A 4J3GA 4CYPA 5JQ4A 5C82A 1MK4A 1KUVA 3TFYA 1V0CA 4FD4A 3S6FA 4OLLA 4HNWB 4QBJA 1XEBA 1NMTA 2Z3KA 3R9GA 1YREA 3SXNA 2B4DA 4HNXB 4BBHA 5AG6A 5IX3A 2DPTA 1I1DA 4AG7A 2FIAA 2J8NA 1M4IA 4UFWA 1XE4A 1R57A 4R3LA 4F0XA 3VWDA 4KOTA 5F46A 4UCPA 3P2FA 4E2AA 5G22A 1IIDA 1RXTA 4JXRA 2VI7A 4PSWA 4KOWA 4RI1A 1QSOA 5IV0A 3TO7A 1XIXA 4KSAA 2P6EA 2Q04A 2Q7BA 1SQHA 2GIVA 4NEXA 1QSTA 2G3AA 4A30A 4II9A 3DR6A 3GKRA 4MFKA 3R9FA 4FD6A 4KLWA 1QSMA 3GY9A 3BJ8A 4CGNA 2VBQA 2FIWA 1YX0A 4HKFA 2PC1A 2OH1A 3IU1A 2F5IA 4BMHA 2Z10A 4KOYA 4MY0A 4CAFA 4JLYA 2WSAA 4A31A 5A28A 1TIQA 2WPWA 3IU2A 4KUBA 5DWNA 5GCNA 2ZW5A 4L89A 4MFJA 3JVNA 1U6MA 2VZZA 4R9MA 5H84A 3TO6A 4XNHC 1ON0A 2DXQA 1GHEA 3EC4A 4GS4A 3F5BA 5J8CA 4UCMA 3SXOA 2PRBA 4JXQA 4I49A 4AVCA 2WPXA 1KUXA 2Z3NA 4XPDB 4EVYA 4FD7A 2YNEA 5F47A 3VWEA 4JD6A 2G3TA 3R95A 2B4DB 2C27A 3W91A 2X7BA 3R9EA 4C7HA 2I79A 5KTAA 1Y9KA 4CRYB 1CJWA 2EUIA 3PGPA 2VZYA 5AG5A 4B14A 2GE3A 1YVOA 4CGPA 2PDOA 3R1KA 4MFZA 4U5YA 3FIXA 1BO4A 4C2ZA 4XPLA 3C26A 4JWPA 5EBVA 2GANA 3WR7A 2O28A 2DPSA 4DNCA 1Z9UA 4KORA 4KVOE 2REEA 2OZUA 4Y49C 5FVJA 4UWIA 2PR1A 4UFXA 4KOSA 5C88A 1Z4EA 2CXAA 4KZTA 4MHDA 1LRZA 4H6UA 4UFVA 1N71A 2OZGA 4AVAA 2P0WA 3G3SA 3SHPA 4X5KA 4Q36A 4E0AA 1KUYA 2REFA 5G20A 4CYNA 4OAEA 2NMTA 1IB1E 4ORFA 1S7NA 3ZZIA 1IICA 3TOAA 3DSBA 4M85A 1M4DA 4YFJA 2B58A 2WUUA 1YK3A 4UCNA 3TOBA 5I0CA 2FXFA 2HQYA 2Y0MA 4KOXA 2JDDA 3V8IA 2CNSA 2PSWA 4MJ8A 2Q4YA 4C2XA 3A9LA 3D8PA 3JUWA 1PU9A 4B12A 3EFAA 2P6GA 2HV2A 5H86A 2RC4A 1KZFA 3JTKA 3FNCA 2A4NA 2QECA 4B5OA 4MBUA 3CXSA 4C7IA 1FY7A 2YNDA 1Q2CA 3CXQA 4MFQA 4YGOA 3IWEA 4UBRA 3FB3A 3ZJ0A 4RS2A 4B11A 2R8VA 4ONUA 3KKWA 3PP9A 4KVXA 2H5MA 2FCKA 2JLMA 1S60A 3FRMA 3DNSA 4QB9A 1I21A 1IYLA 4MY3A 3T9YA 2FSRA 1M44A 2PQ8A 2PR8A 4CGLA 4PK2A 3CXPA 2Z0ZA 1M4GA 4HNYB 3D3SA 3N7ZA 5DWMA 4CYOA 1YVKA 3W6SA 2IL4A 3TO9A 4QUSA 4CYQA 4A33A 4FD5A 4KVME 4NSQA 3UY5A 3LD2A 4QVTA 3S6GA 4K30A 4R57A 1I12A 2YNCA 1MJ9A 2FE7A 4XPDC 2Z3MA 4KLVA 3G8WA 2YGWA 2AE6A 4XPKA 1ZO0A 4H6ZA 1L0CA 3D2MA 1NSLA 1CM0A 1Y7RA 2HUZA 3RYOA 1VHSA 4A95A 2ZW4A 4QC6A 3TTHA 4U9YA 2Z11A 2BEIA 4KSFA 4JJXA 5ISVA 1BOBA 4NF1A 2CNTA 4F6AA 2FS5A 1WK4A 1MJBA 4A2ZA 3F0AA 4B5PB 3I3GA 2B5GB 5EC4A 2Q4VA 5CNPA 3H4QA 1Y9WA 3H5ZA 3NE7A 1XF8A 3MGDA 4L8AA 4KOUA 3TCVA 4AVBA 2AJ6A 3BJ7A 1B6BA 3FXTA 1NE9A 5AG7A 2VQYA 2ARHA 5HH1A 3K9UA 4IUSA 3T90A 2EVNA 4CAEA 2KCWA 2B3UA 5HMNA 4C68A 2JEVA 2ZW6A 4CGMA 1PUAA 4KS9A 2R98A 2R7HA 2Q0YA 4MFLA 3IGRA 4C2YA 4KOVA 1S5KA 1Z4RA 5KTCA 1YLEA 1J4JA 5AG4A 4OADA 2K5TA 2ATRA 3EXNA 4H89A 5F49A 5G1ZA 3DR8A 2J8MA 3LODA 3TT2A 3W6XA 4CAVA 2ZXVA 5IB0A 1Q2YA 2B4BA 2VEZA 3BLNA 5E96A 5JPHA 2YNCC 4B5PA 4U9ZA 2B5GA 4XNHB 4YRHA 5AGEA 2I00A 3B8GA 4B10A 3EY5A 2J8RA 2OZHA 1XMTA 3P2HA 4ZGYB 4PK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G22 A;  3IWE A;  2YNE A;  4B13 A;  3IU1 A;  4C2Z A;  4CGL A;  4B11 A;  5G1Z A;  4CAF A;  5A27 A;  4A2Z A;  2WSA A;  4A31 A;  4C7H A;  5A28 A;  4C2X A;  3IU2 A;  5G20 A;  4CAE A;  4CYN A;  4BBH A;  4CYO A;  4B12 A;  5AG6 A;  4C68 A;  2YNC C;  4A32 A;  4CYQ A;  4A33 A;  3H5Z A;  5AG5 A;  4CGM A;  4A30 A;  4UFW A;  4B14 A;  3JTK A;  4UFX A;  4A95 A;  5AGE A;  5G21 A;  4CGP A;  4C2Y A;  4UCM A;  4CYP A;  4B10 A;  2WUU A;  4UCN A;  4C7I A;  4CGO A;  2YND A;  2YNC A;  4UFV A;  4CGN A;  4UCP A;  5AG4 A;  5AG7 A; 
#chains in the Genus database with same CATH topology
 2PJ0 A;  2JDC A;  4MI4 A;  4ONW A;  4MFP A;  2B3V A;  4UIB A;  4RN7 A;  2BL1 A;  3IWG A;  2V8H A;  2ZEP A;  3IJ3 A;  4IHM A;  1HEE A;  3S6K A;  4E8O A;  3PZJ A;  1VKC A;  1P0H A;  1XBU A;  2ZED A;  4GM5 A;  1IU8 A;  4ZBG A;  3KR5 A;  3DDD A;  3KQZ A;  4GXH A;  1S3Z A;  4CRZ B;  2D4O A;  2PIZ A;  2QML A;  3E0K A;  3NFZ A;  4WJB A;  3S6H A;  1UFH A;  4CS0 B;  3RAM A;  1CPX A;  5G21 A;  2CY2 A;  4IF5 A;  3PB4 X;  3SJE A;  4AB7 A;  1ZG8 A;  5J8F A;  2AFS A;  4CGO A;  3D2P A;  4P4E A;  3QAH A;  4KUA A;  3T8W A;  1ZLI A;  4M3S A;  1QSN A;  4P45 A;  4R87 A;  1FNO A;  1Y0R A;  4OC4 A;  4B13 A;  3OWC A;  5BWA B;  3VAR A;  1S7L A;  1IYK A;  4MCR A;  1TKH A;  5F48 A;  3RZA A;  4NJQ A;  3NA6 A;  2QIR A;  1Q2D A;  1WWZ A;  1S7K A;  2ZPA A;  3SI0 A;  1K4J A;  4NGR A;  3MN8 A;  3WAB A;  3FH4 A;  3FYN A;  4NFR A;  4OC2 A;  2BCO A;  4PSX A;  2ANP A;  2CTC A;  2IJZ A;  2WYR A;  3F8K A;  4NGM A;  2O53 A;  3QB8 A;  4UIA A;  1HDU A;  1YR0 A;  2C6G A;  4JYW A;  1S7F A;  3EO4 A;  4Y49 B;  5LRG A;  2IMO A;  1GYT A;  1ZLH A;  4ZY2 A;  1P4N A;  3FBU A;  4H2K A;  1B87 A;  4LUA A;  4A94 A;  4Q38 A;  2Q44 A;  2ZEM A;  2ZW7 A;  3D66 A;  2Z3P A;  1Z8T A;  1RO5 A;  2BUE A;  3FJU A;  1R43 A;  3I9S A;  4PV6 A;  1TKF A;  4AG9 A;  4CAW A;  1VGY A;  3TE4 A;  2I3C A;  4M6H A;  1YGH A;  2BSW A;  4CAX A;  1OZP A;  4BIN A;  4UWJ A;  5KTD A;  1YW6 A;  1H8L A;  3GYA A;  5A27 A;  2FT0 A;  4NCZ A;  5K8N A;  2Z3L A;  4M6I A;  2Z3O A;  2P6F A;  4F0Y A;  2R1I A;  1MJA A;  2D4P A;  2G0B A;  2Q51 A;  2VXK A;  4NXY A;  2OU2 A;  2CNM A;  4LX9 A;  3MRU A;  3H8F A;  4R3K A;  1CP7 A;  3BHX A;  4A32 A;  2OB0 A;  2FL4 A;  3CZX A;  3I1U A;  3PB9 X;  1M1D A;  1QSR A;  3R96 A;  1Z8L A;  4UA3 A;  4J3G A;  4CYP A;  5JQ4 A;  5C82 A;  1MK4 A;  2ZEO A;  3CPX A;  1KUV A;  4MMO A;  3RBU A;  3WC5 A;  8CPA A;  2PJ5 A;  4EWT A;  3RO0 A;  4RUH A;  3TFY A;  4WWV A;  1AYE A;  4NGT A;  1V0C A;  4FD4 A;  3S6F A;  4OLL A;  4HNW B;  4QBJ A;  3SI2 A;  4IAV A;  4M6G A;  1LFW A;  1XRY A;  1XEB A;  1NMT A;  2Z3K A;  1Z8W A;  3DGV A;  3R9G A;  1QQ9 A;  1YRE A;  3TX8 A;  2PJ3 A;  3SXN A;  4F8Z A;  2B4D A;  4HNX B;  4OC1 A;  4BBH A;  5AG6 A;  5HVF A;  2DPT A;  5IX3 A;  1Z2L A;  1I1D A;  4AG7 A;  2FIA A;  1AUG A;  2J8N A;  1M4I A;  4UFW A;  5THW A;  1XE4 A;  3KR4 A;  4FAI A;  4Q7A A;  1R57 A;  3SJG A;  3CT9 A;  2HC9 A;  4R3L A;  3KQX A;  4F0X A;  3VWD A;  4KOT A;  5F46 A;  4A39 A;  3NH4 A;  4UCP A;  3P2F A;  5LYI A;  1X12 A;  4E2A A;  5G22 A;  1IID A;  1RXT A;  3IC1 A;  3SJF A;  4JXR A;  2VI7 A;  3D68 A;  4PSW A;  4KOW A;  2QJ8 A;  4RI1 A;  1QSO A;  4Z65 A;  5IV0 A;  5CPA A;  3TC8 A;  3TO7 A;  1EE3 P;  1XIX A;  2ZEH A;  2AFW A;  4KSA A;  2P6E A;  2Q04 A;  3L2N A;  2Q7B A;  2V77 A;  3WC6 A;  2EWB A;  1SQH A;  2PJ4 A;  3D7H A;  1CPS A;  4MXU A;  3SI1 A;  2GIV A;  4NEX A;  3D7F A;  3BXM A;  1QST A;  2GRE A;  2G3A A;  4A30 A;  4II9 A;  3DR6 A;  2ABZ A;  3GKR A;  4MFK A;  3R9F A;  5JH9 A;  4FD6 A;  1F2P A;  4KLW A;  1QSM A;  1CG2 A;  3GY9 A;  4JZ0 A;  3BJ8 A;  2RB7 A;  2FVG A;  4PQA A;  4CGN A;  1BPN A;  2VBQ A;  5F09 A;  2FIW A;  1YX0 A;  4HKF A;  5LRJ A;  2PC1 A;  2OH1 A;  3GUX A;  1NSA A;  3IU1 A;  2F5I A;  2V8G A;  4TWE A;  4BMH A;  2Z10 A;  4KOY A;  4MY0 A;  4CAF A;  4JLY A;  3NE8 A;  1JQG A;  1QMU A;  2WSA A;  3K2K A;  4A31 A;  5A28 A;  5ELY A;  1TIQ A;  2WPW A;  3IU2 A;  4KUB A;  5DWN A;  3HUV A;  5GCN A;  2ZW5 A;  4OID A;  4L89 A;  4MHN A;  2EO8 A;  4MFJ A;  2PCU A;  3FMC A;  3JVN A;  1U6M A;  2CTB A;  2VZZ A;  4R9M A;  5H84 A;  3TO6 A;  3FVL A;  4XNH C;  5D8N A;  1ON0 A;  2DXQ A;  1GHE A;  3EC4 A;  4GS4 A;  3F5B A;  5J8C A;  4UCM A;  3SXO A;  2PRB A;  4JXQ A;  4K3N A;  3VH9 A;  4I49 A;  4AVC A;  2WPX A;  1KUX A;  2Z3N A;  4XPD B;  4EVY A;  4FD7 A;  2YNE A;  5F47 A;  3VWE A;  2PJ6 A;  2G3T A;  3ISX A;  4JD6 A;  3R95 A;  4UF4 A;  4ZX9 A;  2B4D B;  2C27 A;  3W91 A;  2X7B A;  3R9E A;  4F9V A;  3N5F A;  4C7H A;  1LAN A;  2I79 A;  2PJ1 A;  2XEG A;  1BLL E;  2GU2 A;  4MRI A;  5KTA A;  1Y9K A;  2ZEL A;  4CRY B;  1CJW A;  3CPA A;  2EUI A;  3PGP A;  3PFE A;  2VZY A;  5AG5 A;  6CPA A;  4B14 A;  2GE3 A;  2QVP A;  1XFO A;  1YVO A;  4CGP A;  2ZEE A;  1BAV A;  2PDO A;  4NGS A;  1VHO A;  3R1K A;  4ZYQ A;  4LQG A;  2DEA A;  4MFZ A;  2DF5 A;  5CBM A;  4U5Y A;  2PJ2 A;  3FIX A;  1BO4 A;  4MCS A;  3S9M A;  3D7G A;  3IIB A;  3WC7 A;  4C2Z A;  4P44 A;  4XPL A;  3NH5 A;  3PB7 X;  3C26 A;  4JWP A;  5EBV A;  2GAN A;  3WR7 A;  3FEE A;  2Q7S A;  2O28 A;  2C6C A;  2GLF A;  4PXC A;  1HDQ A;  2AFZ A;  2G9D A;  2F8H A;  2JBJ A;  2DPS A;  4DNC A;  1Z9U A;  2PJ8 A;  4KOR A;  4KVO E;  2REE A;  2OZU A;  4Y49 C;  3IWW A;  3PRT A;  4UWI A;  5EMI A;  2PR1 A;  5FVJ A;  4P4J A;  4UFX A;  4KOS A;  4OC0 A;  2JBK A;  5C88 A;  1Z5R A;  2XEF A;  1Z4E A;  1YLO A;  2CXA A;  3GLJ A;  4KZT A;  1LRZ A;  2BO9 A;  1F2O A;  4H6U A;  4MHD A;  4UFV A;  1DTD A;  1FT7 A;  1N71 A;  1XJO A;  2OZG A;  3KL9 A;  5K8M A;  4AVA A;  2P0W A;  5LYD A;  3FF3 A;  4PXD A;  4ZI6 A;  3G3S A;  2J9A A;  3SHP A;  4X5K A;  1IOF A;  1YW4 A;  1UWY A;  3JRU A;  3PBB A;  4Q36 A;  4R8F A;  4E0A A;  3KGQ A;  3GIU A;  1KUY A;  3B3C A;  2REF A;  5G20 A;  2CIJ A;  4CYN A;  1ARM A;  3KAS A;  2F7V A;  4OAE A;  2NMT A;  2Q4Z A;  1IB1 E;  4ORF A;  1S7N A;  3ZZI A;  2ZEF A;  1IIC A;  3LWU A;  3TOA A;  4ZY1 A;  1PCA A;  3LMS A;  3DSB A;  4M85 A;  1M4D A;  4YFJ A;  2B58 A;  2WUU A;  1YK3 A;  4UCN A;  3TOB A;  5K8P A;  1ZG9 A;  1XMB A;  5I0C A;  2FXF A;  2HQY A;  2Y0M A;  4KOX A;  2C1C A;  2JDD A;  5HXD A;  1YSJ A;  3V8I A;  4G1P A;  2CNS A;  3H8G A;  2ZOG A;  2PSW A;  3PB6 X;  4MJ8 A;  4ZX8 A;  2Q4Y A;  2OR4 A;  1X10 A;  4C2X A;  3A9L A;  3D8P A;  4EME A;  3JUW A;  1PU9 A;  4B12 A;  3HLP A;  3EFA A;  2P6G A;  3KHZ A;  2HV2 A;  5H86 A;  3VAT A;  2RC4 A;  1KZF A;  3LAC A;  3JTK A;  4W9Y A;  3FNC A;  2A4N A;  2QEC A;  4P4I A;  4B5O A;  3KZW A;  4MCQ A;  2GFQ A;  4MBU A;  3CXS A;  4C7I A;  4P6Y A;  2PJB A;  1FY7 A;  2YND A;  4LQ6 A;  4AXV A;  2O4H A;  1Q2C A;  3CXQ A;  4MFQ A;  4YGO A;  3IWE A;  4UBR A;  3FB3 A;  5JM6 A;  2NYQ A;  3ZJ0 A;  5LYF A;  3B2Y A;  4RS2 A;  4B11 A;  2R8V A;  1LAP A;  1PYT B;  3V7Z A;  1CBX A;  4ONU A;  2C6P A;  3DLJ A;  3KKW A;  3PP9 A;  5DS0 A;  4KVX A;  1IGB A;  1VHE A;  2H5M A;  2FCK A;  2JLM A;  3FEC A;  4BD9 A;  4OC3 A;  1S60 A;  3FRM A;  4O23 A;  3WT4 A;  2PRQ A;  2EBJ A;  2NSM A;  2ZEN A;  3DNS A;  4QB9 A;  1I21 A;  3PEI A;  1IYL A;  3NH8 A;  7CPA A;  4MY3 A;  3T9Y A;  5I4M A;  3BI1 A;  2FSR A;  1M44 A;  4X8I A;  4P10 A;  4TNU A;  5K8O A;  4UEF A;  4IK2 A;  2PQ8 A;  2PR8 A;  4CGL A;  2PVW A;  2WZN A;  4PK2 A;  3CXP A;  2V8V A;  2PJ9 A;  2VL1 A;  2Z0Z A;  3D7D A;  4R6T A;  1M4G A;  4HNY B;  5J1Q A;  3D3S A;  3N7Z A;  5DWM A;  3RNZ A;  4CYO A;  3K9T A;  1IOI A;  1IY7 A;  4OC5 A;  1YVK A;  4YU9 A;  2IL4 A;  3W6S A;  3TO9 A;  4A38 A;  1RTQ A;  3H8E A;  4QUS A;  4CYQ A;  4A33 A;  4FD5 A;  4KVM E;  4NSQ A;  3UY5 A;  3S9N A;  3LD2 A;  4QVT A;  3S6G A;  4R76 A;  3SJX A;  4K30 A;  4CPA A;  2EK9 A;  4R57 A;  1I12 A;  2YNC A;  1MJ9 A;  1F57 A;  1TKJ A;  1VIX A;  2FE7 A;  4XPD C;  2PE3 A;  2Z3M A;  4MHY A;  2PJA A;  2XEI A;  5JGF A;  3S9L A;  1TXR A;  1YME A;  1BPM A;  4KLV A;  1ELM P;  1TF9 A;  5D29 A;  3G8W A;  2YGW A;  1ZG7 A;  2ODF A;  4KSI A;  2AE6 A;  3PB8 X;  4XPK A;  4DJL A;  2JEW A;  1ZO0 A;  3GB0 A;  4H6Z A;  1OBR A;  1L0C A;  3D2M A;  1YQE A;  1CM0 A;  1NSL A;  1Y7R A;  2HUZ A;  4HPS A;  4PXE A;  3RYO A;  1VHS A;  4A95 A;  2ZW4 A;  4MHP A;  5LYL A;  4MCP A;  4QC6 A;  3TTH A;  4U9Y A;  2Z11 A;  2BEI A;  4KSF A;  3KI9 A;  3QAY A;  3D67 A;  4JJX A;  5ISV A;  1BOB A;  1Y7E A;  4NF1 A;  1LOK A;  2GLJ A;  4MHZ A;  4DUK A;  4R7M A;  2V8D A;  2CNT A;  4F6A A;  2QYV A;  3PFO A;  2FS5 A;  1WK4 A;  1KWM A;  1ELL P;  1MJB A;  4EFD A;  4P4D A;  4A2Z A;  3F0A A;  4B5P B;  3I3G A;  2B5G B;  4FUU A;  5EC4 A;  2Q4V A;  3KHX A;  2ZEG A;  5CNP A;  3B7I A;  2AFU A;  3H4Q A;  4A37 A;  3IEH A;  4ZY0 A;  2BOA A;  2OOT A;  1Y9W A;  3H5Z A;  3PBE A;  3NE7 A;  4YWY A;  4F9U A;  1XF8 A;  1XOV A;  4NGN A;  4DYO A;  3B3W A;  3FED A;  4P4B A;  3MGD A;  4L8A A;  3B35 A;  4KOU A;  3TCV A;  2EK8 A;  4AVB A;  2AJ6 A;  3BJ7 A;  1B6B A;  1Z8X A;  3FXT A;  1NE9 A;  5AG7 A;  5IB9 A;  3D4U A;  2CF4 A;  2VQY A;  2ARH A;  5HH1 A;  4NGQ A;  5HVG A;  3K9U A;  1LCP A;  4IUS A;  3T90 A;  3B3T A;  4NGP A;  2EVN A;  4PPZ A;  4UEE A;  4FBE A;  4B6Z A;  4CAE A;  2AFM A;  2KCW A;  2B3U A;  2RFH A;  5HMN A;  3IFE A;  4PXB A;  1A2Z A;  4C68 A;  1M4L A;  2JEV A;  4OME A;  1Y0Y A;  2ZW6 A;  2PJC A;  1LAM A;  1PUA A;  4CGM A;  4OP4 A;  4KS9 A;  2R98 A;  2POK A;  2R7H A;  1JWQ A;  3B3S A;  2AFO A;  2Q0Y A;  2XEJ A;  3IO1 A;  3IGR A;  4MFL A;  2HB6 A;  4KOV A;  4C2Y A;  5LRK A;  1S5K A;  3CDX A;  1Z4R A;  5KTC A;  1CP6 A;  1YLE A;  4P4F A;  1J4J A;  2ZOF A;  5AG4 A;  3B3V A;  4OKO A;  4OAD A;  2K5T A;  2ATR A;  3EXN A;  4H89 A;  2AFX A;  2Q43 A;  5F49 A;  3DR8 A;  5G1Z A;  2J8M A;  3QNV A;  3LOD A;  2PVV A;  5HVH A;  3TT2 A;  3W6X A;  1ARL A;  4CAV A;  2ZXV A;  1R3N A;  5IB0 A;  1Q2Y A;  3ISZ A;  2B4B A;  2PIY A;  3V38 A;  2VEZ A;  3BLN A;  4OIW A;  4NJR A;  4X2T A;  5E96 A;  5JPH A;  2IQ6 A;  1CX8 A;  2YNC C;  4B5P A;  4U9Z A;  2B5G A;  3FX6 A;  4XNH B;  4YRH A;  5AGE A;  1TF8 A;  2I00 A;  4X3R A;  3B8G A;  1Q7L A;  4B10 A;  1DE4 C;  3EY5 A;  2J8R A;  2OZH A;  4FWU A;  1XMT A;  3P2H A;  4ZGY B;  4UEZ A;  4PK3 A;  1AMP A;  2PJ7 A;  3BI0 A; 
#chains in the Genus database with same CATH homology
 2JDC A;  4MI4 A;  4MFP A;  2B3V A;  2BL1 A;  3IWG A;  3S6K A;  4E8O A;  3PZJ A;  1VKC A;  1P0H A;  4ZBG A;  3DDD A;  1S3Z A;  4CRZ B;  2D4O A;  2QML A;  3E0K A;  3S6H A;  4CS0 B;  1UFH A;  5G21 A;  2CY2 A;  4IF5 A;  4AB7 A;  5J8F A;  4CGO A;  3D2P A;  3QAH A;  4KUA A;  4M3S A;  1QSN A;  4R87 A;  5BWA B;  4B13 A;  3OWC A;  1S7L A;  1IYK A;  5F48 A;  2QIR A;  1Q2D A;  1WWZ A;  1S7K A;  2ZPA A;  1K4J A;  3FYN A;  4PSX A;  3F8K A;  3QB8 A;  1YR0 A;  1S7F A;  3EO4 A;  4Y49 B;  1P4N A;  3FBU A;  1B87 A;  4LUA A;  4Q38 A;  2Q44 A;  2ZW7 A;  2Z3P A;  1RO5 A;  2BUE A;  3I9S A;  4PV6 A;  4AG9 A;  4CAW A;  3TE4 A;  1YGH A;  2BSW A;  4CAX A;  1OZP A;  4UWJ A;  5KTD A;  3GYA A;  5A27 A;  2FT0 A;  4NCZ A;  2Z3L A;  2Z3O A;  2P6F A;  4F0Y A;  2R1I A;  1MJA A;  2D4P A;  2G0B A;  4NXY A;  2VXK A;  2OU2 A;  2CNM A;  4LX9 A;  4R3K A;  4A32 A;  2OB0 A;  2FL4 A;  1M1D A;  1QSR A;  3R96 A;  4UA3 A;  4J3G A;  4CYP A;  5JQ4 A;  5C82 A;  1MK4 A;  1KUV A;  3TFY A;  1V0C A;  4FD4 A;  3S6F A;  4OLL A;  4HNW B;  4QBJ A;  1XEB A;  1NMT A;  2Z3K A;  3R9G A;  1YRE A;  3SXN A;  2B4D A;  4HNX B;  4BBH A;  5AG6 A;  5IX3 A;  2DPT A;  1I1D A;  4AG7 A;  2FIA A;  2J8N A;  1M4I A;  4UFW A;  1XE4 A;  1R57 A;  4R3L A;  4F0X A;  3VWD A;  4KOT A;  5F46 A;  4UCP A;  3P2F A;  4E2A A;  5G22 A;  1IID A;  1RXT A;  4JXR A;  2VI7 A;  4PSW A;  4KOW A;  4RI1 A;  1QSO A;  5IV0 A;  3TO7 A;  1XIX A;  4KSA A;  2P6E A;  2Q04 A;  2Q7B A;  1SQH A;  2GIV A;  4NEX A;  1QST A;  2G3A A;  4A30 A;  4II9 A;  3DR6 A;  3GKR A;  4MFK A;  3R9F A;  4FD6 A;  4KLW A;  1QSM A;  3GY9 A;  3BJ8 A;  4CGN A;  2VBQ A;  2FIW A;  1YX0 A;  4HKF A;  2PC1 A;  2OH1 A;  3IU1 A;  2F5I A;  4BMH A;  2Z10 A;  4KOY A;  4MY0 A;  4CAF A;  4JLY A;  2WSA A;  4A31 A;  5A28 A;  1TIQ A;  2WPW A;  3IU2 A;  4KUB A;  5DWN A;  5GCN A;  2ZW5 A;  4L89 A;  4MFJ A;  3JVN A;  1U6M A;  2VZZ A;  4R9M A;  5H84 A;  3TO6 A;  4XNH C;  1ON0 A;  2DXQ A;  1GHE A;  3EC4 A;  4GS4 A;  3F5B A;  5J8C A;  4UCM A;  3SXO A;  2PRB A;  4JXQ A;  4I49 A;  4AVC A;  2WPX A;  1KUX A;  2Z3N A;  4XPD B;  4EVY A;  4FD7 A;  2YNE A;  5F47 A;  3VWE A;  4JD6 A;  2G3T A;  3R95 A;  2B4D B;  2C27 A;  3W91 A;  2X7B A;  3R9E A;  4C7H A;  2I79 A;  5KTA A;  1Y9K A;  4CRY B;  1CJW A;  2EUI A;  3PGP A;  2VZY A;  5AG5 A;  4B14 A;  2GE3 A;  1YVO A;  4CGP A;  2PDO A;  3R1K A;  4MFZ A;  4U5Y A;  3FIX A;  1BO4 A;  4C2Z A;  4XPL A;  3C26 A;  4JWP A;  5EBV A;  2GAN A;  3WR7 A;  2O28 A;  2DPS A;  4DNC A;  1Z9U A;  4KOR A;  4KVO E;  2REE A;  2OZU A;  4Y49 C;  5FVJ A;  4UWI A;  2PR1 A;  4UFX A;  4KOS A;  5C88 A;  1Z4E A;  2CXA A;  4KZT A;  4MHD A;  1LRZ A;  4H6U A;  4UFV A;  1N71 A;  2OZG A;  4AVA A;  2P0W A;  3G3S A;  3SHP A;  4X5K A;  4Q36 A;  4E0A A;  1KUY A;  2REF A;  5G20 A;  4CYN A;  4OAE A;  2NMT A;  1IB1 E;  4ORF A;  1S7N A;  3ZZI A;  1IIC A;  3TOA A;  3DSB A;  4M85 A;  1M4D A;  4YFJ A;  2B58 A;  2WUU A;  1YK3 A;  4UCN A;  3TOB A;  5I0C A;  2FXF A;  2HQY A;  2Y0M A;  4KOX A;  2JDD A;  3V8I A;  2CNS A;  2PSW A;  4MJ8 A;  2Q4Y A;  4C2X A;  3A9L A;  3D8P A;  3JUW A;  1PU9 A;  4B12 A;  3EFA A;  2P6G A;  2HV2 A;  5H86 A;  2RC4 A;  1KZF A;  3JTK A;  3FNC A;  2A4N A;  2QEC A;  4B5O A;  4MBU A;  3CXS A;  4C7I A;  1FY7 A;  2YND A;  1Q2C A;  3CXQ A;  4MFQ A;  4YGO A;  3IWE A;  4UBR A;  3FB3 A;  3ZJ0 A;  4RS2 A;  4B11 A;  2R8V A;  4ONU A;  3KKW A;  3PP9 A;  4KVX A;  2H5M A;  2FCK A;  2JLM A;  1S60 A;  3FRM A;  3DNS A;  4QB9 A;  1I21 A;  1IYL A;  4MY3 A;  3T9Y A;  2FSR A;  1M44 A;  2PQ8 A;  2PR8 A;  4CGL A;  4PK2 A;  3CXP A;  2Z0Z A;  1M4G A;  4HNY B;  3D3S A;  3N7Z A;  5DWM A;  4CYO A;  1YVK A;  3W6S A;  2IL4 A;  3TO9 A;  4QUS A;  4CYQ A;  4A33 A;  4FD5 A;  4KVM E;  4NSQ A;  3UY5 A;  3LD2 A;  4QVT A;  3S6G A;  4K30 A;  4R57 A;  1I12 A;  2YNC A;  1MJ9 A;  2FE7 A;  4XPD C;  2Z3M A;  4KLV A;  3G8W A;  2YGW A;  2AE6 A;  4XPK A;  1ZO0 A;  4H6Z A;  1L0C A;  3D2M A;  1NSL A;  1CM0 A;  1Y7R A;  2HUZ A;  3RYO A;  1VHS A;  4A95 A;  2ZW4 A;  4QC6 A;  3TTH A;  4U9Y A;  2Z11 A;  2BEI A;  4KSF A;  4JJX A;  5ISV A;  1BOB A;  4NF1 A;  2CNT A;  4F6A A;  2FS5 A;  1WK4 A;  1MJB A;  4A2Z A;  3F0A A;  4B5P B;  3I3G A;  2B5G B;  5EC4 A;  2Q4V A;  5CNP A;  3H4Q A;  1Y9W A;  3H5Z A;  3NE7 A;  1XF8 A;  3MGD A;  4L8A A;  4KOU A;  3TCV A;  4AVB A;  2AJ6 A;  3BJ7 A;  1B6B A;  3FXT A;  1NE9 A;  5AG7 A;  2VQY A;  2ARH A;  5HH1 A;  3K9U A;  4IUS A;  3T90 A;  2EVN A;  4CAE A;  2KCW A;  2B3U A;  5HMN A;  4C68 A;  2JEV A;  2ZW6 A;  4CGM A;  1PUA A;  4KS9 A;  2R98 A;  2R7H A;  2Q0Y A;  4MFL A;  3IGR A;  4C2Y A;  4KOV A;  1S5K A;  1Z4R A;  5KTC A;  1YLE A;  1J4J A;  5AG4 A;  4OAD A;  2K5T A;  2ATR A;  3EXN A;  4H89 A;  5F49 A;  5G1Z A;  3DR8 A;  2J8M A;  3LOD A;  3TT2 A;  3W6X A;  4CAV A;  2ZXV A;  5IB0 A;  1Q2Y A;  2B4B A;  2VEZ A;  3BLN A;  5E96 A;  5JPH A;  2YNC C;  4B5P A;  4U9Z A;  2B5G A;  4XNH B;  4YRH A;  5AGE A;  2I00 A;  3B8G A;  4B10 A;  3EY5 A;  2J8R A;  2OZH A;  1XMT A;  3P2H A;  4ZGY B;  4PK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...