4A95A

Plasmodium vivax n-myristoyltransferase with quinoline inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Plasmodium Vivax N-Myristoyltransferase Inhibitors: Screening, Synthesis, and Structural Characterization of Their Binding Mode.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 119
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a95A00
4CGLA 4CGOA 4CAFA 4BBHA 3IU1A 5G20A 2YNCC 4CGMA 4UCNA 5G21A 2YNDA 4CGNA 4CYNA 3IU2A 4CYPA 5AG6A 5G1ZA 5AG5A 5AG4A 4C7HA 4UFXA 4UFVA 4CYQA 3IWEA 4B10A 4C7IA 4UCPA 4B14A 4C2ZA 5A28A 2YNCA 4A95A 4A2ZA 4A33A 4A32A 4A31A 4B11A 4CYOA 4C2XA 3H5ZA 5G22A 4C2YA 4B13A 5AGEA 4CAEA 4C68A 4UFWA 4CGPA 5A27A 4A30A 4UCMA 4B12A 2WSAA 2WUUA 2YNEA 5AG7A 3JTKA
chains in the Genus database with same CATH superfamily
5JH9A 2K5TA 2BL1A 1Z8XA 2JLMA 1AMPA 3HUVA 2CIJA 4IHMA 5JGFA 2O28A 5LRJA 3ZZIA 1L0CA 3EO4A 5JPHA 5IB9A 3FEEA 4TNUA 5AG6A 2ZEDA 4UWJA 3B3VA 4ZY1A 1DTDA 3KHZA 4CYQA 1Z2LA 4OMEA 4EVYA 5THWA 4AVAA 2A4NA 2ZEGA 4BMHA 3GIUA 4ORFA 1VHEA 3TO6A 4MBUA 2AJ6A 3IWGA 3S6FA 3IGRA 4C2XA 2R1IA 4MFLA 4DJLA 4KSAA 3S9NA 2AFZA 3JRUA 2VL1A 3JUWA 2WPXA 3LODA 4UFWA 4JXRA 4DYOA 4MHNA 2FVGA 5HH1A 3RYOA 1ELLP 2WPWA 1CPXA 3IWWA 4ONWA 3LD2A 1KUYA 4PXDA 3TO9A 3RNZA 2J9AA 2QMLA 4XNHB 4CGMA 1TKHA 2QVPA 3FXTA 2CTBA 5HXDA 3SI0A 4IK2A 4KOWA 2AFMA 3D66A 1BLLE 4NGRA 5F09A 5AG4A 2Z3OA 4QVTA 1I12A 4KVXA 1Z4EA 3DNSA 4NF1A 1M4DA 2ZW6A 3N7ZA 2AFXA 4JXQA 4DUKA 5A28A 2PJ6A 2EK9A 4IAVA 5K8MA 2AFOA 4M6HA 4A32A 4FUUA 4CAVA 1ZLIA 3I1UA 2OH1A 4AXVA 1ELMP 1XFOA 2POKA 4EFDA 2CTCA 2OB0A 2EO8A 4U9ZA 4UWIA 3CZXA 2B3UA 2ZEPA 1M1DA 4FD5A 4NGQA 4RS2A 3S6HA 4YRHA 3PFEA 2WZNA 2F5IA 4PXBA 1MJAA 2O4HA 1YW6A 2PJ3A 2YNCC 4MI4A 4MCPA 1Y7EA 1CX8A 1GYTA 1XMTA 2Q4YA 4CRZB 4FAIA 2HB6A 1ARMA 2Z11A 4KOUA 4UFVA 1TF8A 3BXMA 5H86A 2R7HA 4NGMA 4UCPA 4B14A 3FIXA 5H84A 5K8OA 3SHPA 2Z3MA 4CAXA 2V8VA 4NGPA 3F5BA 5G22A 2FT0A 4XPDC 4RI1A 1DE4C 1QSTA 3PB9X 3DGVA 2PRQA 2OU2A 3CPAA 2Q4VA 4LX9A 3D3SA 3KR4A 2GU2A 2C6GA 1UFHA 2NMTA 4OC1A 2I00A 1YQEA 2GFQA 3H8FA 4GXHA 2FXFA 3PZJA 4H2KA 1BO4A 1F57A 2WYRA 3GY9A 2EWBA 4MFJA 2BCOA 5I4MA 3LMSA 2XEJA 4HNWB 1NE9A 1YSJA 2D4PA 2IMOA 2FL4A 3BI1A 4P4BA 4UFXA 5EBVA 2R98A 3WC6A 2FE7A 2PJ8A 4MFQA 4O23A 4Y49C 1YMEA 3MGDA 1F2PA 1NMTA 2QJ8A 3KI9A 1ZLHA 4CYOA 1JWQA 3RAMA 1CP7A 1YLEA 2P6EA 3H5ZA 3P2FA 4B13A 2G0BA 4CAEA 3B3WA 3D7GA 2OZUA 3EXNA 1R3NA 3WC7A 3FRMA 2OR4A 3V7ZA 2PE3A 4B5PB 4NGSA 4WWVA 1Q2CA 3GKRA 4KOTA 3FX6A 2XEGA 3KGQA 4KS9A 1VGYA 4Q38A 4AVCA 2OOTA 2QECA 1TKJA 2J8RA 2YNDA 4CPAA 4R3LA 2PSWA 4H89A 3W6SA 1TIQA 2IQ6A 3H8EA 4OIWA 2B3VA 2GREA 1HDQA 2DF5A 1XIXA 2HV2A 3TFYA 1S7NA 2BOAA 2GLFA 2VBQA 1BOBA 3BI0A 3GUXA 3KQZA 1TF9A 4P10A 4OIDA 1YK3A 3WC5A 3PEIA 4KUBA 3A9LA 4MY3A 2GIVA 3FBUA 2PR8A 1M4IA 2GE3A 3EC4A 2EBJA 3FNCA 2DEAA 4PSXA 2PIZA 1EE3P 5HVFA 2QYVA 4LQGA 1OZPA 1S7FA 3TOBA 5LYLA 1NSAA 2EK8A 2H5MA 5ELYA 1Q2DA 4R3KA 3KKWA 3FJUA 3MRUA 2PJ5A 4F0YA 2Z10A 2VQYA 5AG5A 1ZG9A 1RXTA 3G3SA 4KOSA 4PXEA 5CNPA 1XBUA 3T90A 2X7BA 2VZZA 3MN8A 3WR7A 2I79A 4BINA 1X10A 2I3CA 2J8MA 1PUAA 2CNSA 1Q2YA 3T8WA 1ZG7A 2ABZA 4I49A 4UEEA 3WABA 4A95A 3D8PA 4ZBGA 3TO7A 4JYWA 4QBJA 5LRKA 2WUUA 3NH4A 4FD6A 4KORA 3N5FA 3SXNA 2PVWA 3SJEA 2CF4A 1Y7RA 1NSLA 4OP4A 1LAMA 2DXQA 3UY5A 4UCNA 4X2TA 2ZEHA 3H4QA 1YVOA 3FYNA 1KUXA 1B87A 1XF8A 1Y0RA 5LYDA 1S5KA 4P4EA 5F46A 1S7KA 4W9YA 3IC1A 4QUSA 2BO9A 4GS4A 5J8FA 5F49A 1K4JA 4OLLA 4MCSA 4A33A 4UEFA 4F6AA 3EFAA 4KZTA 3SJXA 1QSRA 2JBJA 4MCRA 3DR8A 2PJ2A 4FD7A 2C27A 4LQ6A 4C68A 4R9MA 2Q0YA 4X5KA 5KTCA 4PQAA 4MCQA 4X8IA 3TE4A 3GB0A 2P6GA 4PSWA 1X12A 1IICA 4XNHC 5F47A 4ONUA 3IO1A 2PJ1A 3FVLA 3SI2A 5KTDA 4NCZA 1BPNA 2VZYA 3B8GA 4NGTA 1H8LA 4M85A 4CGNA 5HVGA 4B5PA 1LANA 1F2OA 4WJBA 5LYFA 3PB6X 2OZGA 4JJXA 3ISZA 2PC1A 4A39A 4C7HA 4YFJA 1AUGA 4HNXB 4U5YA 2JBKA 1Z5RA 1LAPA 4NJQA 4C2ZA 6CPAA 2Z3LA 3KL9A 1MK4A 4ZY2A 3KR5A 5CBMA 3R9GA 2VEZA 2XEIA 3QNVA 1QMUA 3KZWA 2B4DB 2PVVA 2FSRA 4AVBA 4RN7A 3L2NA 3TCVA 1I21A 3QB8A 4GM5A 4MFZA 3IIBA 3EY5A 2AE6A 2PJAA 4U9YA 2ZEEA 4KSFA 5EMIA 1Y0YA 2DPTA 3D67A 4UBRA 4BBHA 2C6PA 3PGPA 4HKFA 4X3RA 3TTHA 4KSIA 2P0WA 3BJ7A 2CXAA 2PQ8A 1ON0A 1R57A 4P45A 1IIDA 1CG2A 1QSOA 1KWMA 1OBRA 4NXYA 3LACA 4YU9A 2PJ4A 4PK3A 1Y9WA 1XMBA 3IWEA 4M6IA 3ZJ0A 4OC4A 4B10A 4NFRA 4ZI6A 5K8PA 2FIWA 1HDUA 4EWTA 1PYTB 4QC6A 2R8VA 3QAHA 2ZELA 4Y49B 3V38A 3S9LA 3FB3A 2VXKA 3BLNA 4II9A 5J8CA 3TOAA 2Q7SA 1Z4RA 3VWDA 2ZW7A 4B12A 1GHEA 2ZW5A 2HC9A 3GYAA 4F0XA 3PBBA 1VIXA 3IU1A 1ZO0A 3P2HA 5FVJA 1M4GA 3ISXA 4J3GA 1N71A 4BD9A 4PPZA 4R6TA 4CYPA 4ZY0A 4OKOA 5LYIA 5G1ZA 5DWNA 5F48A 2G3TA 3KHXA 1LCPA 4QB9A 4UF4A 3CT9A 3SJGA 3PB7X 1Z9UA 4A94A 1R43A 2ZEMA 5K8NA 4A2ZA 2GLJA 4LUAA 5D29A 3DR6A 3RO0A 4M3SA 1IOFA 2Z3KA 1Z8TA 3F8KA 3VARA 4MRIA 5LRGA 1XEBA 2NSMA 2HQYA 1BPMA 4FD4A 2PRBA 2CNTA 2V8DA 4OC0A 4Q36A 4P4IA 4CGLA 3OWCA 3K9UA 2XEFA 2Z3PA 2C1CA 3R96A 3K2KA 1IOIA 4PK2A 1IGBA 3D4UA 4OC3A 4P4JA 3FH4A 1MJ9A 5G21A 4A37A 2ZOFA 1YW4A 1KZFA 3W6XA 2KCWA 2GANA 3SI1A 4FWUA 3B2YA 1KUVA 1Z8LA 4ZX8A 1CP6A 2Q4ZA 2V8GA 4HNYB 4UIBA 2CNMA 4TWEA 3VWEA 3V8IA 1S7LA 2FIAA 3FMCA 4OADA 2PR1A 1FY7A 4NEXA 3SJFA 3CPXA 5DWMA 5KTAA 2G3AA 2C6CA 3PFOA 3NH8A 5C82A 5AGEA 8CPAA 1S60A 2ARHA 1YGHA 3JVNA 3DLJA 5EC4A 2ZEOA 4UCMA 2CY2A 2HUZA 4KOXA 3R95A 1XRYA 4R76A 2D4OA 4K3NA 3B3SA 4PXCA 3PP9A 3IFEA 5E96A 1BAVA 2B4DA 3D7HA 4CAFA 4CGOA 4HPSA 5HMNA 2PJ7A 2OZHA 4KVME 1IYKA 1LRZA 4NGNA 5G20A 3B3TA 5GCNA 2Q7BA 4M6GA 5IV0A 3PBEA 3H8GA 3IU2A 1YLOA 4EMEA 4OC5A 3FF3A 1FNOA 1UWYA 1XJOA 1FT7A 2ZW4A 4KOYA 3GLJA 4MJ8A 3C26A 2BEIA 4MFKA 1RO5A 1WWZA 2ATRA 2B5GB 4MHPA 2EVNA 3NA6A 4P4FA 1A2ZA 1CM0A 2PJBA 1ARLA 4C2YA 2B58A 4AB7A 4F9UA 2BSWA 1PU9A 2WSAA 4P44A 2AFSA 1YREA 2ZEFA 3R1KA 4DNCA 2V8HA 4R57A 1Y9KA 2AFWA 4B5OA 3SXOA 3QAYA 1TXRA 4MHDA 7CPAA 1IYLA 1VHOA 4JD6A 1QQ9A 4F8ZA 4CYNA 3VH9A 3D68A 4P6YA 4AG9A 1B6BA 1J4JA 3W91A 3IEHA 1TKFA 5DS0A 4ZGYB 1U6MA 2PJ0A 2ZXVA 4F9VA 1Z8WA 3F0AA 3PB8X 4MY0A 3FEDA 5ISVA 1YX0A 4ZYQA 4KOVA 4Q7AA 2PCUA 4A31A 4B11A 2FS5A 5BWAB 4XPKA 3IJ3A 2EUIA 3K9TA 4IF5A 3LWUA 4CRYB 4RUHA 1ZG8A 2ODFA 4R87A 4Z65A 2RB7A 2Y0MA 1MJBA 4XPDB 3R9EA 4E2AA 1P4NA 4UA3A 1PCAA 3BJ8A 3CDXA 5J1QA 5JM6A 3VATA 5C88A 2IL4A 3NE8A 1IU8A 4K30A 3B7IA 4MHZA 1I1DA 5CPAA 1XOVA 3CXQA 4KLVA 3NFZA 2JEWA 4MMOA 1HEEA 3BHXA 2DPSA 2YGWA 4C7IA 3S6GA 3DDDA 2RFHA 4MHYA 4G1PA 4AG7A 4XPLA 3DSBA 3G8WA 4ZX9A 4B6ZA 3B3CA 2REFA 4A38A 5A27A 3NH5A 4H6UA 2B4BA 2ZOGA 2J8NA 2PDOA 2PJCA 3S9MA 2REEA 3JTKA 3T9YA 5HVHA 2Z3NA 5D8NA 4YGOA 4CAWA 4E8OA 1IY7A 3R9FA 3HLPA 3NE7A 4OC2A 3D2MA 1JQGA 5JQ4A 1CPSA 4YWYA 1CJWA 2ZENA 1YR0A 4JZ0A 1RTQA 1QSNA 4R7MA 3B35A 1P0HA 4E0AA 4JLYA 3WT4A 3KQXA 2AFUA 3KASA 3TT2A 5I0CA 2PJ9A 1WK4A 2ANPA 3CXPA 3RBUA 2O53A 2P6FA 4OAEA 2F7VA 2Q43A 2Z0ZA 4NJRA 3TX8A 2Q51A 4KLWA 1IB1E 2VI7A 2Q44A 2YNEA 5AG7A 1VKCA 3RZAA 2QIRA 2B5GA 2JDCA 3PRTA 4CS0B 3CXSA 5IX3A 1XE4A 4KUAA 1LFWA 3D7FA 3PB4X 1AYEA 3FECA 2FCKA 3I3GA 4IUSA 2BUEA 2G9DA 2PIYA 2RC4A 3I9SA 4UEZA 1CBXA 2F8HA 4L8AA 4KVOE 3E0KA 4UIAA 1S3ZA 1V0CA 2ZPAA 1SQHA 3D2PA 4R8FA 5IB0A 1VHSA 1QSMA 1M44A 4JWPA 2YNCA 2IJZA 1Q7LA 4MFPA 1LOKA 3D7DA 3S6KA 2JEVA 2Q04A 4CGPA 4A30A 4FBEA 4MXUA 2JDDA 4PV6A 1YVKA 4H6ZA 4P4DA 3TC8A 2NYQA 2V77A 4L89A 1M4LA 4NSQA
chains in the Genus database with same CATH topology
2K5TA 2BL1A 2JLMA 2O28A 3ZZIA 1L0CA 3EO4A 5JPHA 5AG6A 4UWJA 4CYQA 4EVYA 4AVAA 2A4NA 4BMHA 3TO6A 4ORFA 4MBUA 2AJ6A 3IWGA 3S6FA 3IGRA 4C2XA 2R1IA 4MFLA 4KSAA 3LODA 3JUWA 2WPXA 4UFWA 4JXRA 3RYOA 5HH1A 2WPWA 3LD2A 1KUYA 3TO9A 2QMLA 4XNHB 4CGMA 3FXTA 4KOWA 5AG4A 2Z3OA 4QVTA 1I12A 4KVXA 1Z4EA 3DNSA 4NF1A 1M4DA 2ZW6A 3N7ZA 4JXQA 5A28A 4A32A 4CAVA 2OH1A 2OB0A 4U9ZA 4UWIA 4FD5A 2B3UA 1M1DA 4RS2A 3S6HA 4YRHA 2F5IA 1MJAA 2YNCC 4MI4A 2Q4YA 1XMTA 4CRZB 2Z11A 4KOUA 4UFVA 5H86A 2R7HA 4UCPA 4B14A 3FIXA 5H84A 3SHPA 2Z3MA 4CAXA 3F5BA 5G22A 2FT0A 4XPDC 4RI1A 1QSTA 2OU2A 2Q4VA 4LX9A 3D3SA 1UFHA 2NMTA 2I00A 2FXFA 3PZJA 1BO4A 3GY9A 4MFJA 4HNWB 1NE9A 2D4PA 5EBVA 2FL4A 4UFXA 2R98A 2FE7A 4MFQA 4Y49C 3MGDA 1NMTA 4CYOA 1YLEA 2P6EA 3H5ZA 3P2FA 4B13A 2G0BA 4CAEA 2OZUA 3EXNA 3FRMA 4B5PB 1Q2CA 3GKRA 4KOTA 4KS9A 4Q38A 4AVCA 2QECA 2J8RA 2YNDA 4R3LA 2PSWA 4H89A 3W6SA 1TIQA 2B3VA 1XIXA 2HV2A 3TFYA 1S7NA 2VBQA 1BOBA 4A95A 1YK3A 4KUBA 3A9LA 4MY3A 2GIVA 3FBUA 2PR8A 1M4IA 2GE3A 3EC4A 3FNCA 4PSXA 1OZPA 1S7FA 3TOBA 2H5MA 1Q2DA 4R3KA 3KKWA 4F0YA 2Z10A 2VQYA 5AG5A 1RXTA 3G3SA 4KOSA 5CNPA 3T90A 2X7BA 2VZZA 3WR7A 2I79A 2J8MA 1PUAA 2CNSA 1Q2YA 4I49A 3D8PA 4ZBGA 3TO7A 4QBJA 2WUUA 4FD6A 4KORA 3SXNA 1Y7RA 1NSLA 2DXQA 3UY5A 4UCNA 3H4QA 1YVOA 3FYNA 1B87A 1KUXA 1XF8A 1S5KA 5F46A 1S7KA 4QUSA 5J8FA 4GS4A 5F49A 1K4JA 4OLLA 4A33A 4F6AA 3EFAA 4KZTA 1QSRA 3DR8A 4FD7A 2C27A 4C68A 5KTCA 4R9MA 2Q0YA 4X5KA 3TE4A 2P6GA 4PSWA 1IICA 4XNHC 5F47A 4ONUA 5KTDA 4NCZA 2VZYA 3B8GA 4M85A 4CGNA 4B5PA 2OZGA 4JJXA 2PC1A 4C7HA 4YFJA 4HNXB 4U5YA 4C2ZA 2Z3LA 1MK4A 3R9GA 2VEZA 2B4DB 2FSRA 4AVBA 3TCVA 1I21A 3QB8A 4MFZA 3EY5A 2AE6A 4U9YA 4KSFA 2DPTA 4UBRA 4BBHA 3PGPA 4HKFA 3TTHA 2P0WA 3BJ7A 2CXAA 2PQ8A 1ON0A 1R57A 1IIDA 1QSOA 4NXYA 4PK3A 1Y9WA 3IWEA 3ZJ0A 4B10A 2FIWA 4QC6A 2R8VA 3QAHA 4Y49B 3FB3A 2VXKA 3BLNA 4II9A 5J8CA 3TOAA 3VWDA 1Z4RA 4B12A 2ZW7A 1GHEA 2ZW5A 3GYAA 4F0XA 3IU1A 1ZO0A 3P2HA 5FVJA 1M4GA 4J3GA 1N71A 4CYPA 5G1ZA 5DWNA 5F48A 2G3TA 4QB9A 1Z9UA 4A2ZA 4LUAA 3DR6A 4M3SA 2Z3KA 3F8KA 1XEBA 2HQYA 4FD4A 2PRBA 2CNTA 4Q36A 4CGLA 3OWCA 3K9UA 2Z3PA 3R96A 4PK2A 1MJ9A 5G21A 3W6XA 1KZFA 2KCWA 2GANA 1KUVA 4HNYB 2CNMA 3VWEA 3V8IA 1S7LA 2FIAA 4OADA 2PR1A 1FY7A 4NEXA 5KTAA 5DWMA 2G3AA 5C82A 5AGEA 1S60A 2ARHA 1YGHA 3JVNA 5EC4A 4UCMA 2CY2A 2HUZA 4KOXA 3R95A 2D4OA 3PP9A 5E96A 5HMNA 2B4DA 4CGOA 4CAFA 2OZHA 4KVME 1IYKA 1LRZA 5G20A 2Q7BA 5GCNA 5IV0A 3IU2A 2ZW4A 4KOYA 4MJ8A 3C26A 2BEIA 4MFKA 1RO5A 1WWZA 2ATRA 2B5GB 4C2YA 2EVNA 1CM0A 2B58A 4AB7A 2BSWA 1PU9A 2WSAA 1YREA 3R1KA 4DNCA 4R57A 1Y9KA 4B5OA 3SXOA 4MHDA 1IYLA 4JD6A 4CYNA 4AG9A 1B6BA 1J4JA 3W91A 4ZGYB 1U6MA 2ZXVA 3F0AA 4MY0A 5ISVA 1YX0A 4KOVA 4A31A 4B11A 2FS5A 5BWAB 4XPKA 2EUIA 4IF5A 4CRYB 4R87A 2Y0MA 1MJBA 4XPDB 3R9EA 4E2AA 1P4NA 4UA3A 3BJ8A 5C88A 2IL4A 4K30A 1I1DA 3CXQA 4KLVA 2DPSA 2YGWA 4C7IA 3S6GA 3DDDA 4AG7A 4XPLA 3DSBA 3G8WA 2REFA 5A27A 4H6UA 2B4BA 2J8NA 2PDOA 2REEA 3JTKA 3T9YA 2Z3NA 4YGOA 4CAWA 4E8OA 3R9FA 3NE7A 3D2MA 5JQ4A 1CJWA 1YR0A 1QSNA 1P0HA 4E0AA 4JLYA 3TT2A 5I0CA 1WK4A 3CXPA 2P6FA 4OAEA 2Z0ZA 4KLWA 1IB1E 2VI7A 2Q44A 2YNEA 5AG7A 1VKCA 5IX3A 2QIRA 2B5GA 2JDCA 4CS0B 3CXSA 1XE4A 4KUAA 2FCKA 3I3GA 4IUSA 2BUEA 2RC4A 3I9SA 4L8AA 4KVOE 3E0KA 1S3ZA 1V0CA 2ZPAA 1SQHA 3D2PA 5IB0A 1VHSA 1QSMA 1M44A 4JWPA 2YNCA 4MFPA 3S6KA 2JEVA 2Q04A 4CGPA 4A30A 2JDDA 4PV6A 1YVKA 4H6ZA 4L89A 4NSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGL A;  4CGO A;  4CAF A;  4BBH A;  3IU1 A;  5G20 A;  2YNC C;  4CGM A;  4UCN A;  5G21 A;  2YND A;  4CGN A;  4CYN A;  3IU2 A;  4CYP A;  5AG6 A;  5G1Z A;  5AG5 A;  5AG4 A;  4C7H A;  4UFX A;  4UFV A;  4CYQ A;  3IWE A;  4B10 A;  4C7I A;  4UCP A;  4B14 A;  4C2Z A;  5A28 A;  2YNC A;  4A95 A;  4A2Z A;  4A33 A;  4A32 A;  4A31 A;  4B11 A;  4CYO A;  4C2X A;  3H5Z A;  5G22 A;  4C2Y A;  4B13 A;  5AGE A;  4CAE A;  4C68 A;  4UFW A;  4CGP A;  5A27 A;  4A30 A;  4UCM A;  4B12 A;  2WSA A;  2WUU A;  2YNE A;  5AG7 A;  3JTK A; 
#chains in the Genus database with same CATH topology
 5JH9 A;  2K5T A;  2BL1 A;  1Z8X A;  2JLM A;  1AMP A;  3HUV A;  2CIJ A;  4IHM A;  5JGF A;  2O28 A;  5LRJ A;  3ZZI A;  1L0C A;  3EO4 A;  5JPH A;  5IB9 A;  3FEE A;  4TNU A;  5AG6 A;  2ZED A;  4UWJ A;  3B3V A;  4ZY1 A;  1DTD A;  3KHZ A;  4CYQ A;  1Z2L A;  4OME A;  4EVY A;  5THW A;  4AVA A;  2A4N A;  2ZEG A;  4BMH A;  3GIU A;  4ORF A;  1VHE A;  3TO6 A;  4MBU A;  2AJ6 A;  3IWG A;  3S6F A;  3IGR A;  4C2X A;  2R1I A;  4MFL A;  4DJL A;  4KSA A;  3S9N A;  2AFZ A;  3JRU A;  2VL1 A;  3JUW A;  2WPX A;  3LOD A;  4UFW A;  4JXR A;  4DYO A;  4MHN A;  2FVG A;  5HH1 A;  3RYO A;  1ELL P;  2WPW A;  1CPX A;  3IWW A;  4ONW A;  3LD2 A;  1KUY A;  4PXD A;  3TO9 A;  3RNZ A;  2J9A A;  2QML A;  4XNH B;  4CGM A;  1TKH A;  2QVP A;  3FXT A;  2CTB A;  5HXD A;  3SI0 A;  4IK2 A;  4KOW A;  2AFM A;  3D66 A;  1BLL E;  4NGR A;  5F09 A;  5AG4 A;  2Z3O A;  4QVT A;  1I12 A;  4KVX A;  1Z4E A;  3DNS A;  4NF1 A;  1M4D A;  2ZW6 A;  3N7Z A;  2AFX A;  4JXQ A;  4DUK A;  5A28 A;  2PJ6 A;  2EK9 A;  4IAV A;  5K8M A;  2AFO A;  4M6H A;  4A32 A;  4FUU A;  4CAV A;  1ZLI A;  3I1U A;  2OH1 A;  4AXV A;  1ELM P;  1XFO A;  2POK A;  4EFD A;  2CTC A;  2OB0 A;  2EO8 A;  4U9Z A;  4UWI A;  3CZX A;  2B3U A;  2ZEP A;  1M1D A;  4FD5 A;  4NGQ A;  4RS2 A;  3S6H A;  4YRH A;  3PFE A;  2WZN A;  2F5I A;  4PXB A;  1MJA A;  2O4H A;  1YW6 A;  2PJ3 A;  2YNC C;  4MI4 A;  4MCP A;  1Y7E A;  1CX8 A;  1GYT A;  1XMT A;  2Q4Y A;  4CRZ B;  4FAI A;  2HB6 A;  1ARM A;  2Z11 A;  4KOU A;  4UFV A;  1TF8 A;  3BXM A;  5H86 A;  2R7H A;  4NGM A;  4UCP A;  4B14 A;  3FIX A;  5H84 A;  5K8O A;  3SHP A;  2Z3M A;  4CAX A;  2V8V A;  4NGP A;  3F5B A;  5G22 A;  2FT0 A;  4XPD C;  4RI1 A;  1DE4 C;  1QST A;  3PB9 X;  3DGV A;  2PRQ A;  2OU2 A;  3CPA A;  2Q4V A;  4LX9 A;  3D3S A;  3KR4 A;  2GU2 A;  2C6G A;  1UFH A;  2NMT A;  4OC1 A;  2I00 A;  1YQE A;  2GFQ A;  3H8F A;  4GXH A;  2FXF A;  3PZJ A;  4H2K A;  1BO4 A;  1F57 A;  2WYR A;  3GY9 A;  2EWB A;  4MFJ A;  2BCO A;  5I4M A;  3LMS A;  2XEJ A;  4HNW B;  1NE9 A;  1YSJ A;  2D4P A;  2IMO A;  2FL4 A;  3BI1 A;  4P4B A;  4UFX A;  5EBV A;  2R98 A;  3WC6 A;  2FE7 A;  2PJ8 A;  4MFQ A;  4O23 A;  4Y49 C;  1YME A;  3MGD A;  1F2P A;  1NMT A;  2QJ8 A;  3KI9 A;  1ZLH A;  4CYO A;  1JWQ A;  3RAM A;  1CP7 A;  1YLE A;  2P6E A;  3H5Z A;  3P2F A;  4B13 A;  2G0B A;  4CAE A;  3B3W A;  3D7G A;  2OZU A;  3EXN A;  1R3N A;  3WC7 A;  3FRM A;  2OR4 A;  3V7Z A;  2PE3 A;  4B5P B;  4NGS A;  4WWV A;  1Q2C A;  3GKR A;  4KOT A;  3FX6 A;  2XEG A;  3KGQ A;  4KS9 A;  1VGY A;  4Q38 A;  4AVC A;  2OOT A;  2QEC A;  1TKJ A;  2J8R A;  2YND A;  4CPA A;  4R3L A;  2PSW A;  4H89 A;  3W6S A;  1TIQ A;  2IQ6 A;  3H8E A;  4OIW A;  2B3V A;  2GRE A;  1HDQ A;  2DF5 A;  1XIX A;  2HV2 A;  3TFY A;  1S7N A;  2BOA A;  2GLF A;  2VBQ A;  1BOB A;  3BI0 A;  3GUX A;  3KQZ A;  1TF9 A;  4P10 A;  4OID A;  1YK3 A;  3WC5 A;  3PEI A;  4KUB A;  3A9L A;  4MY3 A;  2GIV A;  3FBU A;  2PR8 A;  1M4I A;  2GE3 A;  3EC4 A;  2EBJ A;  3FNC A;  2DEA A;  4PSX A;  2PIZ A;  1EE3 P;  5HVF A;  2QYV A;  4LQG A;  1OZP A;  1S7F A;  3TOB A;  5LYL A;  1NSA A;  2EK8 A;  2H5M A;  5ELY A;  1Q2D A;  4R3K A;  3KKW A;  3FJU A;  3MRU A;  2PJ5 A;  4F0Y A;  2Z10 A;  2VQY A;  5AG5 A;  1ZG9 A;  1RXT A;  3G3S A;  4KOS A;  4PXE A;  5CNP A;  1XBU A;  3T90 A;  2X7B A;  2VZZ A;  3MN8 A;  3WR7 A;  2I79 A;  4BIN A;  1X10 A;  2I3C A;  2J8M A;  1PUA A;  2CNS A;  1Q2Y A;  3T8W A;  1ZG7 A;  2ABZ A;  4I49 A;  4UEE A;  3WAB A;  4A95 A;  3D8P A;  4ZBG A;  3TO7 A;  4JYW A;  4QBJ A;  5LRK A;  2WUU A;  3NH4 A;  4FD6 A;  4KOR A;  3N5F A;  3SXN A;  2PVW A;  3SJE A;  2CF4 A;  1Y7R A;  1NSL A;  4OP4 A;  1LAM A;  2DXQ A;  3UY5 A;  4UCN A;  4X2T A;  2ZEH A;  3H4Q A;  1YVO A;  3FYN A;  1KUX A;  1B87 A;  1XF8 A;  1Y0R A;  5LYD A;  1S5K A;  4P4E A;  5F46 A;  1S7K A;  4W9Y A;  3IC1 A;  4QUS A;  2BO9 A;  4GS4 A;  5J8F A;  5F49 A;  1K4J A;  4OLL A;  4MCS A;  4A33 A;  4UEF A;  4F6A A;  3EFA A;  4KZT A;  3SJX A;  1QSR A;  2JBJ A;  4MCR A;  3DR8 A;  2PJ2 A;  4FD7 A;  2C27 A;  4LQ6 A;  4C68 A;  4R9M A;  2Q0Y A;  4X5K A;  5KTC A;  4PQA A;  4MCQ A;  4X8I A;  3TE4 A;  3GB0 A;  2P6G A;  4PSW A;  1X12 A;  1IIC A;  4XNH C;  5F47 A;  4ONU A;  3IO1 A;  2PJ1 A;  3FVL A;  3SI2 A;  5KTD A;  4NCZ A;  1BPN A;  2VZY A;  3B8G A;  4NGT A;  1H8L A;  4M85 A;  4CGN A;  5HVG A;  4B5P A;  1LAN A;  1F2O A;  4WJB A;  5LYF A;  3PB6 X;  2OZG A;  4JJX A;  3ISZ A;  2PC1 A;  4A39 A;  4C7H A;  4YFJ A;  1AUG A;  4HNX B;  4U5Y A;  2JBK A;  1Z5R A;  1LAP A;  4NJQ A;  4C2Z A;  6CPA A;  2Z3L A;  3KL9 A;  1MK4 A;  4ZY2 A;  3KR5 A;  5CBM A;  3R9G A;  2VEZ A;  2XEI A;  3QNV A;  1QMU A;  3KZW A;  2B4D B;  2PVV A;  2FSR A;  4AVB A;  4RN7 A;  3L2N A;  3TCV A;  1I21 A;  3QB8 A;  4GM5 A;  4MFZ A;  3IIB A;  3EY5 A;  2AE6 A;  2PJA A;  4U9Y A;  2ZEE A;  4KSF A;  5EMI A;  1Y0Y A;  2DPT A;  3D67 A;  4UBR A;  4BBH A;  2C6P A;  3PGP A;  4HKF A;  4X3R A;  3TTH A;  4KSI A;  2P0W A;  3BJ7 A;  2CXA A;  2PQ8 A;  1ON0 A;  1R57 A;  4P45 A;  1IID A;  1CG2 A;  1QSO A;  1KWM A;  1OBR A;  4NXY A;  3LAC A;  4YU9 A;  2PJ4 A;  4PK3 A;  1Y9W A;  1XMB A;  3IWE A;  4M6I A;  3ZJ0 A;  4OC4 A;  4B10 A;  4NFR A;  4ZI6 A;  5K8P A;  2FIW A;  1HDU A;  4EWT A;  1PYT B;  4QC6 A;  2R8V A;  3QAH A;  2ZEL A;  4Y49 B;  3V38 A;  3S9L A;  3FB3 A;  2VXK A;  3BLN A;  4II9 A;  5J8C A;  3TOA A;  2Q7S A;  1Z4R A;  3VWD A;  2ZW7 A;  4B12 A;  1GHE A;  2ZW5 A;  2HC9 A;  3GYA A;  4F0X A;  3PBB A;  1VIX A;  3IU1 A;  1ZO0 A;  3P2H A;  5FVJ A;  1M4G A;  3ISX A;  4J3G A;  1N71 A;  4BD9 A;  4PPZ A;  4R6T A;  4CYP A;  4ZY0 A;  4OKO A;  5LYI A;  5G1Z A;  5DWN A;  5F48 A;  2G3T A;  3KHX A;  1LCP A;  4QB9 A;  4UF4 A;  3CT9 A;  3SJG A;  3PB7 X;  1Z9U A;  4A94 A;  1R43 A;  2ZEM A;  5K8N A;  4A2Z A;  2GLJ A;  4LUA A;  5D29 A;  3DR6 A;  3RO0 A;  4M3S A;  1IOF A;  2Z3K A;  1Z8T A;  3F8K A;  3VAR A;  4MRI A;  5LRG A;  1XEB A;  2NSM A;  2HQY A;  1BPM A;  4FD4 A;  2PRB A;  2CNT A;  2V8D A;  4OC0 A;  4Q36 A;  4P4I A;  4CGL A;  3OWC A;  3K9U A;  2XEF A;  2Z3P A;  2C1C A;  3R96 A;  3K2K A;  1IOI A;  4PK2 A;  1IGB A;  3D4U A;  4OC3 A;  4P4J A;  3FH4 A;  1MJ9 A;  5G21 A;  4A37 A;  2ZOF A;  1YW4 A;  1KZF A;  3W6X A;  2KCW A;  2GAN A;  3SI1 A;  4FWU A;  3B2Y A;  1KUV A;  1Z8L A;  4ZX8 A;  1CP6 A;  2Q4Z A;  2V8G A;  4HNY B;  4UIB A;  2CNM A;  4TWE A;  3VWE A;  3V8I A;  1S7L A;  2FIA A;  3FMC A;  4OAD A;  2PR1 A;  1FY7 A;  4NEX A;  3SJF A;  3CPX A;  5DWM A;  5KTA A;  2G3A A;  2C6C A;  3PFO A;  3NH8 A;  5C82 A;  5AGE A;  8CPA A;  1S60 A;  2ARH A;  1YGH A;  3JVN A;  3DLJ A;  5EC4 A;  2ZEO A;  4UCM A;  2CY2 A;  2HUZ A;  4KOX A;  3R95 A;  1XRY A;  4R76 A;  2D4O A;  4K3N A;  3B3S A;  4PXC A;  3PP9 A;  3IFE A;  5E96 A;  1BAV A;  2B4D A;  3D7H A;  4CAF A;  4CGO A;  4HPS A;  5HMN A;  2PJ7 A;  2OZH A;  4KVM E;  1IYK A;  1LRZ A;  4NGN A;  5G20 A;  3B3T A;  5GCN A;  2Q7B A;  4M6G A;  5IV0 A;  3PBE A;  3H8G A;  3IU2 A;  1YLO A;  4EME A;  4OC5 A;  3FF3 A;  1FNO A;  1UWY A;  1XJO A;  1FT7 A;  2ZW4 A;  4KOY A;  3GLJ A;  4MJ8 A;  3C26 A;  2BEI A;  4MFK A;  1RO5 A;  1WWZ A;  2ATR A;  2B5G B;  4MHP A;  2EVN A;  3NA6 A;  4P4F A;  1A2Z A;  1CM0 A;  2PJB A;  1ARL A;  4C2Y A;  2B58 A;  4AB7 A;  4F9U A;  2BSW A;  1PU9 A;  2WSA A;  4P44 A;  2AFS A;  1YRE A;  2ZEF A;  3R1K A;  4DNC A;  2V8H A;  4R57 A;  1Y9K A;  2AFW A;  4B5O A;  3SXO A;  3QAY A;  1TXR A;  4MHD A;  7CPA A;  1IYL A;  1VHO A;  4JD6 A;  1QQ9 A;  4F8Z A;  4CYN A;  3VH9 A;  3D68 A;  4P6Y A;  4AG9 A;  1B6B A;  1J4J A;  3W91 A;  3IEH A;  1TKF A;  5DS0 A;  4ZGY B;  1U6M A;  2PJ0 A;  2ZXV A;  4F9V A;  1Z8W A;  3F0A A;  3PB8 X;  4MY0 A;  3FED A;  5ISV A;  1YX0 A;  4ZYQ A;  4KOV A;  4Q7A A;  2PCU A;  4A31 A;  4B11 A;  2FS5 A;  5BWA B;  4XPK A;  3IJ3 A;  2EUI A;  3K9T A;  4IF5 A;  3LWU A;  4CRY B;  4RUH A;  1ZG8 A;  2ODF A;  4R87 A;  4Z65 A;  2RB7 A;  2Y0M A;  1MJB A;  4XPD B;  3R9E A;  4E2A A;  1P4N A;  4UA3 A;  1PCA A;  3BJ8 A;  3CDX A;  5J1Q A;  5JM6 A;  3VAT A;  5C88 A;  2IL4 A;  3NE8 A;  1IU8 A;  4K30 A;  3B7I A;  4MHZ A;  1I1D A;  5CPA A;  1XOV A;  3CXQ A;  4KLV A;  3NFZ A;  2JEW A;  4MMO A;  1HEE A;  3BHX A;  2DPS A;  2YGW A;  4C7I A;  3S6G A;  3DDD A;  2RFH A;  4MHY A;  4G1P A;  4AG7 A;  4XPL A;  3DSB A;  3G8W A;  4ZX9 A;  4B6Z A;  3B3C A;  2REF A;  4A38 A;  5A27 A;  3NH5 A;  4H6U A;  2B4B A;  2ZOG A;  2J8N A;  2PDO A;  2PJC A;  3S9M A;  2REE A;  3JTK A;  3T9Y A;  5HVH A;  2Z3N A;  5D8N A;  4YGO A;  4CAW A;  4E8O A;  1IY7 A;  3R9F A;  3HLP A;  3NE7 A;  4OC2 A;  3D2M A;  1JQG A;  5JQ4 A;  1CPS A;  4YWY A;  1CJW A;  2ZEN A;  1YR0 A;  4JZ0 A;  1RTQ A;  1QSN A;  4R7M A;  3B35 A;  1P0H A;  4E0A A;  4JLY A;  3WT4 A;  3KQX A;  2AFU A;  3KAS A;  3TT2 A;  5I0C A;  2PJ9 A;  1WK4 A;  2ANP A;  3CXP A;  3RBU A;  2O53 A;  2P6F A;  4OAE A;  2F7V A;  2Q43 A;  2Z0Z A;  4NJR A;  3TX8 A;  2Q51 A;  4KLW A;  1IB1 E;  2VI7 A;  2Q44 A;  2YNE A;  5AG7 A;  1VKC A;  3RZA A;  2QIR A;  2B5G A;  2JDC A;  3PRT A;  4CS0 B;  3CXS A;  5IX3 A;  1XE4 A;  4KUA A;  1LFW A;  3D7F A;  3PB4 X;  1AYE A;  3FEC A;  2FCK A;  3I3G A;  4IUS A;  2BUE A;  2G9D A;  2PIY A;  2RC4 A;  3I9S A;  4UEZ A;  1CBX A;  2F8H A;  4L8A A;  4KVO E;  3E0K A;  4UIA A;  1S3Z A;  1V0C A;  2ZPA A;  1SQH A;  3D2P A;  4R8F A;  5IB0 A;  1VHS A;  1QSM A;  1M44 A;  4JWP A;  2YNC A;  2IJZ A;  1Q7L A;  4MFP A;  1LOK A;  3D7D A;  3S6K A;  2JEV A;  2Q04 A;  4CGP A;  4A30 A;  4FBE A;  4MXU A;  2JDD A;  4PV6 A;  1YVK A;  4H6Z A;  4P4D A;  3TC8 A;  2NYQ A;  2V77 A;  4L89 A;  1M4L A;  4NSQ A; 
#chains in the Genus database with same CATH homology
 2K5T A;  2BL1 A;  2JLM A;  2O28 A;  3ZZI A;  1L0C A;  3EO4 A;  5JPH A;  5AG6 A;  4UWJ A;  4CYQ A;  4EVY A;  4AVA A;  2A4N A;  4BMH A;  3TO6 A;  4ORF A;  4MBU A;  2AJ6 A;  3IWG A;  3S6F A;  3IGR A;  4C2X A;  2R1I A;  4MFL A;  4KSA A;  3LOD A;  3JUW A;  2WPX A;  4UFW A;  4JXR A;  3RYO A;  5HH1 A;  2WPW A;  3LD2 A;  1KUY A;  3TO9 A;  2QML A;  4XNH B;  4CGM A;  3FXT A;  4KOW A;  5AG4 A;  2Z3O A;  4QVT A;  1I12 A;  4KVX A;  1Z4E A;  3DNS A;  4NF1 A;  1M4D A;  2ZW6 A;  3N7Z A;  4JXQ A;  5A28 A;  4A32 A;  4CAV A;  2OH1 A;  2OB0 A;  4U9Z A;  4UWI A;  4FD5 A;  2B3U A;  1M1D A;  4RS2 A;  3S6H A;  4YRH A;  2F5I A;  1MJA A;  2YNC C;  4MI4 A;  2Q4Y A;  1XMT A;  4CRZ B;  2Z11 A;  4KOU A;  4UFV A;  5H86 A;  2R7H A;  4UCP A;  4B14 A;  3FIX A;  5H84 A;  3SHP A;  2Z3M A;  4CAX A;  3F5B A;  5G22 A;  2FT0 A;  4XPD C;  4RI1 A;  1QST A;  2OU2 A;  2Q4V A;  4LX9 A;  3D3S A;  1UFH A;  2NMT A;  2I00 A;  2FXF A;  3PZJ A;  1BO4 A;  3GY9 A;  4MFJ A;  4HNW B;  1NE9 A;  2D4P A;  5EBV A;  2FL4 A;  4UFX A;  2R98 A;  2FE7 A;  4MFQ A;  4Y49 C;  3MGD A;  1NMT A;  4CYO A;  1YLE A;  2P6E A;  3H5Z A;  3P2F A;  4B13 A;  2G0B A;  4CAE A;  2OZU A;  3EXN A;  3FRM A;  4B5P B;  1Q2C A;  3GKR A;  4KOT A;  4KS9 A;  4Q38 A;  4AVC A;  2QEC A;  2J8R A;  2YND A;  4R3L A;  2PSW A;  4H89 A;  3W6S A;  1TIQ A;  2B3V A;  1XIX A;  2HV2 A;  3TFY A;  1S7N A;  2VBQ A;  1BOB A;  4A95 A;  1YK3 A;  4KUB A;  3A9L A;  4MY3 A;  2GIV A;  3FBU A;  2PR8 A;  1M4I A;  2GE3 A;  3EC4 A;  3FNC A;  4PSX A;  1OZP A;  1S7F A;  3TOB A;  2H5M A;  1Q2D A;  4R3K A;  3KKW A;  4F0Y A;  2Z10 A;  2VQY A;  5AG5 A;  1RXT A;  3G3S A;  4KOS A;  5CNP A;  3T90 A;  2X7B A;  2VZZ A;  3WR7 A;  2I79 A;  2J8M A;  1PUA A;  2CNS A;  1Q2Y A;  4I49 A;  3D8P A;  4ZBG A;  3TO7 A;  4QBJ A;  2WUU A;  4FD6 A;  4KOR A;  3SXN A;  1Y7R A;  1NSL A;  2DXQ A;  3UY5 A;  4UCN A;  3H4Q A;  1YVO A;  3FYN A;  1B87 A;  1KUX A;  1XF8 A;  1S5K A;  5F46 A;  1S7K A;  4QUS A;  5J8F A;  4GS4 A;  5F49 A;  1K4J A;  4OLL A;  4A33 A;  4F6A A;  3EFA A;  4KZT A;  1QSR A;  3DR8 A;  4FD7 A;  2C27 A;  4C68 A;  5KTC A;  4R9M A;  2Q0Y A;  4X5K A;  3TE4 A;  2P6G A;  4PSW A;  1IIC A;  4XNH C;  5F47 A;  4ONU A;  5KTD A;  4NCZ A;  2VZY A;  3B8G A;  4M85 A;  4CGN A;  4B5P A;  2OZG A;  4JJX A;  2PC1 A;  4C7H A;  4YFJ A;  4HNX B;  4U5Y A;  4C2Z A;  2Z3L A;  1MK4 A;  3R9G A;  2VEZ A;  2B4D B;  2FSR A;  4AVB A;  3TCV A;  1I21 A;  3QB8 A;  4MFZ A;  3EY5 A;  2AE6 A;  4U9Y A;  4KSF A;  2DPT A;  4UBR A;  4BBH A;  3PGP A;  4HKF A;  3TTH A;  2P0W A;  3BJ7 A;  2CXA A;  2PQ8 A;  1ON0 A;  1R57 A;  1IID A;  1QSO A;  4NXY A;  4PK3 A;  1Y9W A;  3IWE A;  3ZJ0 A;  4B10 A;  2FIW A;  4QC6 A;  2R8V A;  3QAH A;  4Y49 B;  3FB3 A;  2VXK A;  3BLN A;  4II9 A;  5J8C A;  3TOA A;  3VWD A;  1Z4R A;  4B12 A;  2ZW7 A;  1GHE A;  2ZW5 A;  3GYA A;  4F0X A;  3IU1 A;  1ZO0 A;  3P2H A;  5FVJ A;  1M4G A;  4J3G A;  1N71 A;  4CYP A;  5G1Z A;  5DWN A;  5F48 A;  2G3T A;  4QB9 A;  1Z9U A;  4A2Z A;  4LUA A;  3DR6 A;  4M3S A;  2Z3K A;  3F8K A;  1XEB A;  2HQY A;  4FD4 A;  2PRB A;  2CNT A;  4Q36 A;  4CGL A;  3OWC A;  3K9U A;  2Z3P A;  3R96 A;  4PK2 A;  1MJ9 A;  5G21 A;  3W6X A;  1KZF A;  2KCW A;  2GAN A;  1KUV A;  4HNY B;  2CNM A;  3VWE A;  3V8I A;  1S7L A;  2FIA A;  4OAD A;  2PR1 A;  1FY7 A;  4NEX A;  5KTA A;  5DWM A;  2G3A A;  5C82 A;  5AGE A;  1S60 A;  2ARH A;  1YGH A;  3JVN A;  5EC4 A;  4UCM A;  2CY2 A;  2HUZ A;  4KOX A;  3R95 A;  2D4O A;  3PP9 A;  5E96 A;  5HMN A;  2B4D A;  4CGO A;  4CAF A;  2OZH A;  4KVM E;  1IYK A;  1LRZ A;  5G20 A;  2Q7B A;  5GCN A;  5IV0 A;  3IU2 A;  2ZW4 A;  4KOY A;  4MJ8 A;  3C26 A;  2BEI A;  4MFK A;  1RO5 A;  1WWZ A;  2ATR A;  2B5G B;  4C2Y A;  2EVN A;  1CM0 A;  2B58 A;  4AB7 A;  2BSW A;  1PU9 A;  2WSA A;  1YRE A;  3R1K A;  4DNC A;  4R57 A;  1Y9K A;  4B5O A;  3SXO A;  4MHD A;  1IYL A;  4JD6 A;  4CYN A;  4AG9 A;  1B6B A;  1J4J A;  3W91 A;  4ZGY B;  1U6M A;  2ZXV A;  3F0A A;  4MY0 A;  5ISV A;  1YX0 A;  4KOV A;  4A31 A;  4B11 A;  2FS5 A;  5BWA B;  4XPK A;  2EUI A;  4IF5 A;  4CRY B;  4R87 A;  2Y0M A;  1MJB A;  4XPD B;  3R9E A;  4E2A A;  1P4N A;  4UA3 A;  3BJ8 A;  5C88 A;  2IL4 A;  4K30 A;  1I1D A;  3CXQ A;  4KLV A;  2DPS A;  2YGW A;  4C7I A;  3S6G A;  3DDD A;  4AG7 A;  4XPL A;  3DSB A;  3G8W A;  2REF A;  5A27 A;  4H6U A;  2B4B A;  2J8N A;  2PDO A;  2REE A;  3JTK A;  3T9Y A;  2Z3N A;  4YGO A;  4CAW A;  4E8O A;  3R9F A;  3NE7 A;  3D2M A;  5JQ4 A;  1CJW A;  1YR0 A;  1QSN A;  1P0H A;  4E0A A;  4JLY A;  3TT2 A;  5I0C A;  1WK4 A;  3CXP A;  2P6F A;  4OAE A;  2Z0Z A;  4KLW A;  1IB1 E;  2VI7 A;  2Q44 A;  2YNE A;  5AG7 A;  1VKC A;  5IX3 A;  2QIR A;  2B5G A;  2JDC A;  4CS0 B;  3CXS A;  1XE4 A;  4KUA A;  2FCK A;  3I3G A;  4IUS A;  2BUE A;  2RC4 A;  3I9S A;  4L8A A;  4KVO E;  3E0K A;  1S3Z A;  1V0C A;  2ZPA A;  1SQH A;  3D2P A;  5IB0 A;  1VHS A;  1QSM A;  1M44 A;  4JWP A;  2YNC A;  4MFP A;  3S6K A;  2JEV A;  2Q04 A;  4CGP A;  4A30 A;  2JDD A;  4PV6 A;  1YVK A;  4H6Z A;  4L89 A;  4NSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...