4A95A

Plasmodium vivax n-myristoyltransferase with quinoline inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
384
Chain Sequence
b'DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Plasmodium Vivax N-Myristoyltransferase Inhibitors: Screening, Synthesis, and Structural Characterization of Their Binding Mode.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 384
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a95A00
4C2ZA 4B12A 4B10A 2YNDA 4A30A 5A27A 2YNEA 5G21A 3IWEA 5G20A 4UFWA 4B14A 4CGPA 5AG4A 2YNCA 4B13A 4CYPA 4CAFA 4A31A 4C2XA 4C7IA 4UCPA 4A95A 4UCNA 4CAEA 4A2ZA 2WUUA 4CGMA 5A28A 5AGEA 5AG5A 4A33A 4UFXA 4CYQA 4A32A 4CYNA 3JTKA 2WSAA 5AG6A 4UCMA 4CYOA 4CGNA 5AG7A 4UFVA 4C2YA 2YNCC 4CGOA 4CGLA 4C68A 3IU1A 3IU2A 4B11A 5G1ZA 5G22A 4C7HA 4BBHA 3H5ZA
chains in the Genus database with same CATH superfamily
2QVPA 3QB8A 3H8FA 4XPDC 4YRHA 2YGWA 5G20A 4B14A 1MJAA 4FD7A 3V38A 4OC4A 4CAFA 5HMNA 1AMPA 2AFWA 3FXTA 1KWMA 1M4DA 4MFKA 4HNWB 5JH9A 2PJ8A 4R57A 4CAEA 1HEEA 1DE4C 1U6MA 1YW6A 2OZUA 2R7HA 4KOXA 4QBJA 2R1IA 4IUSA 4B5PB 4CYNA 3PZJA 4MFJA 5LYDA 1HDQA 3QNVA 1N71A 2Q4ZA 2FVGA 3LD2A 4CGNA 4W9YA 4JJXA 4M6GA 1Q2DA 3PB6X 5HVFA 4FD4A 1YVKA 4B5OA 4P10A 4B11A 2VL1A 3FX6A 2EK8A 3NA6A 3NH8A 4PK2A 2PC1A 2ZXVA 1JWQA 4K30A 4B10A 5F49A 4TWEA 3KL9A 2Q4YA 5A27A 4IHMA 3TC8A 2XEIA 5THWA 4UBRA 4AB7A 2PCUA 3PBEA 4NF1A 1SQHA 2V8DA 3B3WA 3EXNA 4UWJA 5JGFA 2VI7A 3CXQA 4JYWA 3LMSA 4UCPA 1GHEA 1NSAA 1ZG9A 1Y0RA 3IIBA 1YK3A 5ELYA 2XEJA 4UFXA 2EWBA 2NMTA 4ONUA 2K5TA 2EUIA 2H5MA 3R9EA 3CPXA 4UFVA 2OOTA 2GFQA 4YWYA 4P4IA 3TE4A 2V8GA 2FE7A 2ZENA 4MRIA 2Q4VA 5E96A 3WT4A 2CXAA 4WWVA 2AFOA 3FH4A 4PXCA 2YNDA 4NGNA 1MK4A 3LWUA 3K2KA 3PB7X 3PBBA 3TX8A 3VWDA 3D66A 3IWEA 3P2HA 4UFWA 3QAYA 2OR4A 5J8CA 4P4DA 2C6GA 2I79A 4XPLA 3BLNA 1ON0A 2OZHA 3PB4X 4YGOA 2ZELA 3PGPA 5EBVA 1NE9A 3G8WA 1LAMA 4HPSA 2EK9A 4L89A 2ABZA 2WUUA 3CXSA 4H89A 4TNUA 4KSFA 4A32A 4NGSA 4MI4A 4RN7A 4LQ6A 4MY3A 4PSXA 4KOWA 3TT2A 3SXNA 3SXOA 3IU1A 4MHPA 1YX0A 4C7HA 3I9SA 3PP9A 4B5PA 4E0AA 4YU9A 4UIBA 5CBMA 4MMOA 1QSMA 2ZEFA 3KKWA 2KCWA 2Q0YA 3FMCA 3L2NA 2HC9A 4OADA 4R3LA 3B8GA 2PJ2A 2Z3MA 5F48A 1IICA 4Y49C 1MJ9A 2P6FA 4B13A 3TFYA 3F8KA 3RBUA 2J8MA 1H8LA 2QIRA 4NXYA 1XEBA 4Q7AA 2CF4A 4NCZA 4OMEA 2HUZA 1XMTA 3BI0A 2IQ6A 3LODA 2Q44A 5LRJA 2FIWA 1S7KA 5HVHA 5LRKA 3FBUA 5FVJA 4MHDA 3IFEA 4XNHC 3VWEA 3WR7A 4E2AA 4C68A 1TKFA 4JXQA 4OKOA 1I21A 2PE3A 3H5ZA 4EMEA 1YW4A 4PXBA 1RO5A 3OWCA 4UWIA 1CP6A 5I0CA 2VZYA 4U5YA 4CRZB 2YNEA 4KOYA 4NFRA 1ZLHA 1JQGA 5LRGA 2G0BA 1YGHA 3P2FA 2PIZA 4KOUA 4FD6A 4M3SA 3MGDA 2JEWA 4KS9A 1CJWA 3R95A 4F9VA 3CPAA 3FVLA 3IGRA 2WPWA 4A38A 4CPAA 2D4PA 3TCVA 5AG5A 2Z3OA 2OZGA 3H8GA 3V7ZA 1GYTA 1PUAA 1UWYA 3R1KA 2POKA 2WSAA 5AG6A 4CYOA 4YFJA 2FL4A 1FNOA 1CM0A 2PJ9A 2DF5A 2HV2A 3B35A 5KTDA 2F7VA 4HKFA 2OU2A 3RZAA 2Z3NA 2Y0MA 1I1DA 3WC5A 1PU9A 1YLEA 4NJQA 2PJAA 2VZZA 1AYEA 3PB9X 4WJBA 3WABA 3D8PA 5C82A 1Y7EA 2CNSA 2ZPAA 3TOAA 1Z5RA 4MFPA 2GE3A 1ELLP 2NSMA 2GREA 3HLPA 4A94A 5IB9A 1Z2LA 3HUVA 3NH5A 3MRUA 3NE8A 3KHXA 1P4NA 4R9MA 2PSWA 3NE7A 3NH4A 2GLFA 1Q7LA 1VHOA 2JDDA 1CPXA 1XBUA 3D67A 4KOTA 1IU8A 4KSAA 4P4EA 2BSWA 1CG2A 4ZX9A 4AG7A 3WC7A 3DLJA 2REFA 1TIQA 1HDUA 2OH1A 1P0HA 4QUSA 3R9FA 3S6HA 1Z8XA 2XEFA 3D7DA 2QMLA 3FEDA 2BOAA 4MXUA 4LUAA 3W91A 2BEIA 1QSRA 4OAEA 4OP4A 5J8FA 3FRMA 1YQEA 2CNTA 2A4NA 4PPZA 3NFZA 2B5GB 1Z4EA 2GLJA 3GB0A 3ZZIA 2PRBA 2O4HA 3VATA 1IYKA 5AG7A 2ZW5A 3TO6A 5I4MA 1QSOA 5LYLA 3D7GA 1IY7A 2ATRA 2DXQA 2Q43A 1WK4A 2CTBA 3GLJA 4UEEA 4KUAA 5CPAA 1CX8A 1BOBA 4C2ZA 2BO9A 2X7BA 3VARA 4IK2A 3IEHA 1M44A 1F2OA 1BAVA 5D29A 1M4LA 5F09A 2ZEPA 5JQ4A 1S60A 4MFQA 1LANA 1A2ZA 3S9MA 3EC4A 3ISZA 5ISVA 3W6XA 2ARHA 3R9GA 2Q7BA 3CXPA 5GCNA 1YR0A 3H4QA 1B6BA 2AFUA 2Q51A 4P4BA 1LCPA 2Z3KA 1J4JA 5KTCA 1B87A 4MCQA 1BO4A 2QYVA 2ZEEA 4KZTA 4MBUA 1X12A 3DR8A 1S5KA 2DEAA 3SJGA 4I49A 2AE6A 4M6HA 3D2MA 3BHXA 1PCAA 1Q2YA 3IU2A 5G1ZA 4JWPA 4ZY0A 2BL1A 2PDOA 2Z3LA 4XPDB 4B12A 2F8HA 3LACA 4IF5A 4R6TA 2JBKA 1TKJA 3KQZA 3I1UA 2ZW6A 5C88A 2VXKA 4KUBA 4AG9A 1Z4RA 1TF8A 2I00A 1M4GA 2PVWA 4KVOE 2ANPA 1QMUA 2FT0A 1IIDA 3DR6A 4HNXB 4C2XA 4LX9A 3ISXA 4PQAA 4CAXA 5DWNA 2PRQA 3S6GA 2IL4A 2WZNA 1XF8A 3FF3A 2C6PA 3SI0A 4P45A 1VHSA 3KASA 5EMIA 2G9DA 4EWTA 3KR4A 2OB0A 2G3TA 1ZLIA 4C2YA 2VEZA 5LYFA 3F5BA 1IOIA 3N7ZA 4ONWA 3B2YA 4NGPA 5H84A 2Q7SA 2D4OA 2B5GA 1CPSA 4U9ZA 2IMOA 2GU2A 1UFHA 3GIUA 4FUUA 5DS0A 5BWAB 4RI1A 3GY9A 3PRTA 3CT9A 3F0AA 6CPAA 3BJ7A 3EFAA 3B3TA 4G1PA 5K8MA 2R98A 3FJUA 4R8FA 2AFSA 3B3VA 3N5FA 4ZBGA 4RS2A 3D4UA 5K8NA 3K9UA 1Y9KA 3JVNA 5AGEA 2ZOFA 4B6ZA 3TTHA 4O23A 3IWWA 4MCPA 4ZGYB 2PIYA 3KZWA 4OC1A 2J9AA 4FD5A 4CAWA 1Y0YA 2BUEA 4KORA 3RNZA 3T90A 4Q36A 4MY0A 4LQGA 4BD9A 4MHYA 1YREA 1FT7A 4KSIA 3DSBA 3RYOA 2QJ8A 2WYRA 4DUKA 2B4DB 4BBHA 3H8EA 4FBEA 5F47A 1KUXA 5D8NA 2V77A 4R87A 4BINA 5G21A 3KR5A 5H86A 1KZFA 7CPAA 1R57A 3IC1A 2ZEMA 1BLLE 2HQYA 1VIXA 2J8RA 3GKRA 2PJ4A 1ARMA 2FSRA 2O53A 4AXVA 4R3KA 4QC6A 3PFEA 4AVCA 2RFHA 3S9NA 2RB7A 1WWZA 2PJ3A 1ARLA 3R96A 3SI2A 4OC3A 3JUWA 5DWMA 3TO9A 1KUYA 3G3SA 4P4JA 2PR1A 3D7FA 4DYOA 4PK3A 1S3ZA 4JD6A 4ZY1A 4PXEA 2NYQA 3S6FA 1XE4A 2EBJA 3EY5A 3SJXA 4H6ZA 5HVGA 1I12A 2JBJA 1FY7A 1YVOA 3GYAA 2EVNA 2F5IA 3FB3A 4UA3A 4MHZA 4A37A 4OLLA 5J1QA 2BCOA 1F57A 4P6YA 2JLMA 4Q38A 3D2PA 4F9UA 1M1DA 4Y49B 4FAIA 3BI1A 3FEEA 2PJ6A 5AG4A 2REEA 3DGVA 3B3CA 1XOVA 1AUGA 1MJBA 3KHZA 2V8HA 3PFOA 4M85A 3ZJ0A 4MCRA 4KVME 4CAVA 3TOBA 3IJ3A 1CP7A 4U9YA 2P6EA 4II9A 4A2ZA 2B3UA 4X2TA 3D7HA 4X5KA 3S9LA 3VH9A 3B3SA 4P4FA 4R7MA 4CS0B 4EVYA 2PJCA 4NGMA 4F6AA 4OIDA 1TKHA 1XRYA 1YMEA 4GM5A 4XNHB 3RAMA 3SJFA 3I3GA 3WC6A 3FIXA 3KQXA 2EO8A 5G22A 4RUHA 2AJ6A 1XJOA 1ZG7A 1X10A 4ZYQA 1ZG8A 2Z10A 2ZEHA 4KLWA 4OIWA 1LAPA 4CRYB 1IOFA 3FYNA 1QQ9A 3MN8A 4NSQA 4MCSA 4A30A 1Q2CA 2ODFA 3CZXA 1K4JA 1XIXA 5HH1A 4KLVA 2P6GA 2ZW4A 2PJ7A 1VHEA 4ZY2A 2PJ1A 2PJBA 2ZEDA 3B7IA 1Z9UA 2B4DA 4FWUA 3EO4A 5LYIA 1XMBA 2Z0ZA 3C26A 5CNPA 8CPAA 5IV0A 4NGRA 2PJ5A 4CGMA 4PXDA 4A33A 4MFLA 4GXHA 1M4IA 3SI1A 4MHNA 3V8IA 1QSNA 4IAVA 2GANA 1S7FA 2C27A 4UCMA 5JPHA 2FCKA 2VBQA 1Y9WA 1R3NA 4CGLA 1KUVA 2ZEOA 4NGTA 5IX3A 3D3SA 1OBRA 3DDDA 1Y7RA 2Q04A 3CDXA 3BXMA 3KGQA 1PYTB 1YSJA 1R43A 3T8WA 1LRZA 4EFDA 4KVXA 2DPSA 2VQYA 4CGPA 4ZI6A 4DJLA 4MJ8A 2B58A 4CYPA 1NSLA 2AFXA 1BPMA 2RC4A 2FS5A 2XEGA 1OZPA 4UIAA 4A39A 3W6SA 4QB9A 4QVTA 2AFMA 2J8NA 3DNSA 1IGBA 3IO1A 4AVAA 2P0WA 4PV6A 2Z11A 2C1CA 4CYQA 3JTKA 4ORFA 3GUXA 2Z3PA 1Z8TA 2O28A 3S6KA 3T9YA 5K8PA 2FXFA 1IYLA 1ZO0A 4UF4A 2QECA 1DTDA 2AFZA 5IB0A 4KOVA 1BPNA 4OC5A 3KI9A 4NGQA 1YLOA 3RO0A 1L0CA 1IB1E 4R76A 3SHPA 1CBXA 4NJRA 4JXRA 1S7LA 1F2PA 4DNCA 1TF9A 4KOSA 2CNMA 1Z8WA 4Z65A 1RTQA 4OC0A 4E8OA 3FNCA 3JRUA 3BJ8A 3IWGA 2B4BA 4H2KA 1RXTA 2JEVA 4A95A 3E0KA 5EC4A 2IJZA 5A28A 3D68A 4K3NA 3UY5A 1VGYA 2I3CA 2CTCA 4NEXA 2PVVA 4L8AA 3K9TA 4JLYA 4X8IA 2GIVA 1XFOA 4JZ0A 1QSTA 4H6UA 2JDCA 4X3RA 2C6CA 4XPKA 4ZX8A 2PQ8A 5HXDA 1Z8LA 4F8ZA 5K8OA 2V8VA 1VKCA 4M6IA 1NMTA 2PR8A 4J3GA 4BMHA 1EE3P 4AVBA 5F46A 4HNYB 2B3VA 4UEZA 2HB6A 2R8VA 3PEIA 4UEFA 3TO7A 4F0XA 2YNCA 4PSWA 4P44A 2DPTA 1LFWA 1V0CA 2ZOGA 3SJEA 2CIJA 4A31A 2PJ0A 4C7IA 1ELMP 2CY2A 4UCNA 2ZEGA 4GS4A 5KTAA 4MFZA 1LOKA 3QAHA 1S7NA 4OC2A 2G3AA 1TXRA 2FIAA 3FECA 4F0YA 4CGOA 5JM6A 2YNCC 3PB8X 2ZW7A 2WPXA 3A9LA
chains in the Genus database with same CATH topology
3QB8A 4XPDC 4YRHA 2YGWA 5G20A 4B14A 1MJAA 4FD7A 4CAFA 5HMNA 3FXTA 4MFKA 1M4DA 4HNWB 4R57A 4CAEA 1U6MA 2OZUA 2R7HA 4KOXA 4QBJA 2R1IA 4IUSA 4B5PB 4CYNA 3PZJA 4MFJA 1N71A 3LD2A 4CGNA 4JJXA 1Q2DA 4FD4A 1YVKA 4B5OA 4B11A 4PK2A 2PC1A 2ZXVA 4K30A 4B10A 5F49A 2Q4YA 5A27A 4UBRA 4AB7A 4NF1A 1SQHA 4UWJA 3EXNA 2VI7A 3CXQA 4UCPA 1GHEA 1YK3A 4UFXA 2NMTA 4ONUA 2K5TA 2EUIA 2H5MA 3R9EA 4UFVA 3TE4A 2FE7A 2Q4VA 5E96A 2CXAA 2YNDA 1MK4A 3VWDA 3IWEA 3P2HA 4UFWA 5J8CA 2I79A 4XPLA 3BLNA 1ON0A 2OZHA 4YGOA 5EBVA 3PGPA 1NE9A 3G8WA 4L89A 2WUUA 3CXSA 4H89A 4KSFA 4A32A 4MI4A 4MY3A 4PSXA 4KOWA 3TT2A 3SXNA 3SXOA 3IU1A 1YX0A 4C7HA 3I9SA 3PP9A 4B5PA 4E0AA 1QSMA 3KKWA 2KCWA 2Q0YA 4OADA 4R3LA 3B8GA 2Z3MA 5F48A 1IICA 4Y49C 1MJ9A 2P6FA 4B13A 3TFYA 3F8KA 2J8MA 2QIRA 4NXYA 1XEBA 4NCZA 2HUZA 1XMTA 3LODA 2Q44A 2FIWA 1S7KA 3FBUA 5FVJA 4MHDA 4XNHC 3VWEA 3WR7A 4E2AA 4C68A 4JXQA 1I21A 3H5ZA 1RO5A 3OWCA 4UWIA 5I0CA 2VZYA 4U5YA 4CRZB 2YNEA 4KOYA 2G0BA 1YGHA 3P2FA 4KOUA 4FD6A 4M3SA 3MGDA 4KS9A 3R95A 1CJWA 3IGRA 2WPWA 2D4PA 3TCVA 5AG5A 2Z3OA 2OZGA 1PUAA 3R1KA 2WSAA 5AG6A 4CYOA 4YFJA 2FL4A 1CM0A 2HV2A 5KTDA 4HKFA 2OU2A 2Z3NA 2Y0MA 1I1DA 1PU9A 1YLEA 2VZZA 3D8PA 5C82A 2CNSA 2ZPAA 3TOAA 4MFPA 2GE3A 1P4NA 4R9MA 2PSWA 3NE7A 2JDDA 4KOTA 4KSAA 2BSWA 4AG7A 2REFA 1TIQA 2OH1A 1P0HA 4QUSA 3R9FA 3S6HA 2QMLA 4LUAA 3W91A 2BEIA 1QSRA 4OAEA 5J8FA 3FRMA 2CNTA 2A4NA 2B5GB 1Z4EA 3ZZIA 2PRBA 1IYKA 5AG7A 2ZW5A 3TO6A 1QSOA 2DXQA 2ATRA 1WK4A 4C2ZA 4KUAA 1BOBA 2X7BA 1M44A 5JQ4A 1S60A 4MFQA 5ISVA 3EC4A 3W6XA 2ARHA 3R9GA 2Q7BA 3CXPA 5GCNA 1YR0A 3H4QA 1B6BA 5KTCA 2Z3KA 1J4JA 1B87A 1BO4A 4MBUA 4KZTA 3DR8A 1S5KA 4I49A 2AE6A 3D2MA 3IU2A 1Q2YA 5G1ZA 4JWPA 2BL1A 2PDOA 2Z3LA 4XPDB 4B12A 4IF5A 2ZW6A 5C88A 2VXKA 4KUBA 4AG9A 1Z4RA 4KVOE 2I00A 1M4GA 2FT0A 1IIDA 3DR6A 4HNXB 4C2XA 4LX9A 4CAXA 5DWNA 3S6GA 2IL4A 1XF8A 1VHSA 2OB0A 2G3TA 4C2YA 2VEZA 3F5BA 3N7ZA 5H84A 2D4OA 2B5GA 4U9ZA 1UFHA 5BWAB 4RI1A 3GY9A 3F0AA 3BJ7A 3EFAA 2R98A 4ZBGA 4RS2A 3K9UA 1Y9KA 3JVNA 5AGEA 3TTHA 4ZGYB 4FD5A 4CAWA 2BUEA 4KORA 3T90A 4Q36A 4MY0A 1YREA 3RYOA 3DSBA 2B4DB 4BBHA 5F47A 1KUXA 4R87A 5G21A 5H86A 1KZFA 1R57A 2HQYA 2J8RA 3GKRA 2FSRA 4R3KA 4QC6A 4AVCA 1WWZA 3R96A 3JUWA 5DWMA 3TO9A 1KUYA 3G3SA 2PR1A 4PK3A 1S3ZA 4JD6A 3S6FA 1XE4A 3EY5A 4H6ZA 1I12A 1FY7A 1YVOA 3GYAA 2EVNA 2F5IA 3FB3A 4UA3A 4OLLA 2JLMA 4Q38A 3D2PA 1M1DA 4Y49B 5AG4A 2REEA 1MJBA 4M85A 3ZJ0A 4KVME 4CAVA 3TOBA 4II9A 4U9YA 2P6EA 4A2ZA 2B3UA 4X5KA 4EVYA 4CS0B 4F6AA 4XNHB 3I3GA 3FIXA 5G22A 2AJ6A 2Z10A 4KLWA 4CRYB 3FYNA 4A30A 4NSQA 1Q2CA 1K4JA 1XIXA 5HH1A 4KLVA 2P6GA 2ZW4A 1Z9UA 2B4DA 3EO4A 2Z0ZA 3C26A 5CNPA 5IV0A 4CGMA 4A33A 4MFLA 1M4IA 3V8IA 1QSNA 2GANA 1S7FA 2C27A 4UCMA 5JPHA 2FCKA 2VBQA 1Y9WA 4CGLA 1KUVA 5IX3A 3D3SA 3DDDA 1Y7RA 2Q04A 1LRZA 4KVXA 2DPSA 2VQYA 4CGPA 4MJ8A 2B58A 4CYPA 1NSLA 2RC4A 2FS5A 1OZPA 3W6SA 4QB9A 4QVTA 2J8NA 3DNSA 4AVAA 2P0WA 4PV6A 2Z11A 4CYQA 3JTKA 4ORFA 2Z3PA 3T9YA 2O28A 3S6KA 2FXFA 1IYLA 1ZO0A 2QECA 5IB0A 4KOVA 1L0CA 1IB1E 3SHPA 4JXRA 1S7LA 4DNCA 4KOSA 2CNMA 4E8OA 3FNCA 3BJ8A 3IWGA 2B4BA 1RXTA 2JEVA 4A95A 3E0KA 5EC4A 5A28A 3UY5A 4NEXA 4L8AA 4JLYA 2GIVA 1QSTA 4H6UA 2JDCA 4XPKA 2PQ8A 1VKCA 1NMTA 2PR8A 4J3GA 4BMHA 4AVBA 5F46A 4HNYB 2B3VA 2R8VA 3TO7A 4F0XA 2YNCA 4PSWA 2DPTA 1V0CA 4A31A 4C7IA 2CY2A 4UCNA 5KTAA 4GS4A 4MFZA 3QAHA 1S7NA 2G3AA 2FIAA 4F0YA 4CGOA 2YNCC 2ZW7A 2WPXA 3A9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2Z A;  4B12 A;  4B10 A;  2YND A;  4A30 A;  5A27 A;  2YNE A;  5G21 A;  3IWE A;  5G20 A;  4UFW A;  4B14 A;  4CGP A;  5AG4 A;  2YNC A;  4B13 A;  4CYP A;  4CAF A;  4A31 A;  4C2X A;  4C7I A;  4UCP A;  4A95 A;  4UCN A;  4CAE A;  4A2Z A;  2WUU A;  4CGM A;  5A28 A;  5AGE A;  5AG5 A;  4A33 A;  4UFX A;  4CYQ A;  4A32 A;  4CYN A;  3JTK A;  2WSA A;  5AG6 A;  4UCM A;  4CYO A;  4CGN A;  5AG7 A;  4UFV A;  4C2Y A;  2YNC C;  4CGO A;  4CGL A;  4C68 A;  3IU1 A;  3IU2 A;  4B11 A;  5G1Z A;  5G22 A;  4C7H A;  4BBH A;  3H5Z A; 
#chains in the Genus database with same CATH topology
 2QVP A;  3QB8 A;  3H8F A;  4XPD C;  4YRH A;  2YGW A;  5G20 A;  4B14 A;  1MJA A;  4FD7 A;  3V38 A;  4OC4 A;  4CAF A;  5HMN A;  1AMP A;  2AFW A;  3FXT A;  1KWM A;  1M4D A;  4MFK A;  4HNW B;  5JH9 A;  2PJ8 A;  4R57 A;  4CAE A;  1HEE A;  1DE4 C;  1U6M A;  1YW6 A;  2OZU A;  2R7H A;  4KOX A;  4QBJ A;  2R1I A;  4IUS A;  4B5P B;  4CYN A;  3PZJ A;  4MFJ A;  5LYD A;  1HDQ A;  3QNV A;  1N71 A;  2Q4Z A;  2FVG A;  3LD2 A;  4CGN A;  4W9Y A;  4JJX A;  4M6G A;  1Q2D A;  3PB6 X;  5HVF A;  4FD4 A;  1YVK A;  4B5O A;  4P10 A;  4B11 A;  2VL1 A;  3FX6 A;  2EK8 A;  3NA6 A;  3NH8 A;  4PK2 A;  2PC1 A;  2ZXV A;  1JWQ A;  4K30 A;  4B10 A;  5F49 A;  4TWE A;  3KL9 A;  2Q4Y A;  5A27 A;  4IHM A;  3TC8 A;  2XEI A;  5THW A;  4UBR A;  4AB7 A;  2PCU A;  3PBE A;  4NF1 A;  1SQH A;  2V8D A;  3B3W A;  3EXN A;  4UWJ A;  5JGF A;  2VI7 A;  3CXQ A;  4JYW A;  3LMS A;  4UCP A;  1GHE A;  1NSA A;  1ZG9 A;  1Y0R A;  3IIB A;  1YK3 A;  5ELY A;  2XEJ A;  4UFX A;  2EWB A;  2NMT A;  4ONU A;  2K5T A;  2EUI A;  2H5M A;  3R9E A;  3CPX A;  4UFV A;  2OOT A;  2GFQ A;  4YWY A;  4P4I A;  3TE4 A;  2V8G A;  2FE7 A;  2ZEN A;  4MRI A;  2Q4V A;  5E96 A;  3WT4 A;  2CXA A;  4WWV A;  2AFO A;  3FH4 A;  4PXC A;  2YND A;  4NGN A;  1MK4 A;  3LWU A;  3K2K A;  3PB7 X;  3PBB A;  3TX8 A;  3VWD A;  3D66 A;  3IWE A;  3P2H A;  4UFW A;  3QAY A;  2OR4 A;  5J8C A;  4P4D A;  2C6G A;  2I79 A;  4XPL A;  3BLN A;  1ON0 A;  2OZH A;  3PB4 X;  4YGO A;  2ZEL A;  3PGP A;  5EBV A;  1NE9 A;  3G8W A;  1LAM A;  4HPS A;  2EK9 A;  4L89 A;  2ABZ A;  2WUU A;  3CXS A;  4H89 A;  4TNU A;  4KSF A;  4A32 A;  4NGS A;  4MI4 A;  4RN7 A;  4LQ6 A;  4MY3 A;  4PSX A;  4KOW A;  3TT2 A;  3SXN A;  3SXO A;  3IU1 A;  4MHP A;  1YX0 A;  4C7H A;  3I9S A;  3PP9 A;  4B5P A;  4E0A A;  4YU9 A;  4UIB A;  5CBM A;  4MMO A;  1QSM A;  2ZEF A;  3KKW A;  2KCW A;  2Q0Y A;  3FMC A;  3L2N A;  2HC9 A;  4OAD A;  4R3L A;  3B8G A;  2PJ2 A;  2Z3M A;  5F48 A;  1IIC A;  4Y49 C;  1MJ9 A;  2P6F A;  4B13 A;  3TFY A;  3F8K A;  3RBU A;  2J8M A;  1H8L A;  2QIR A;  4NXY A;  1XEB A;  4Q7A A;  2CF4 A;  4NCZ A;  4OME A;  2HUZ A;  1XMT A;  3BI0 A;  2IQ6 A;  3LOD A;  2Q44 A;  5LRJ A;  2FIW A;  1S7K A;  5HVH A;  5LRK A;  3FBU A;  5FVJ A;  4MHD A;  3IFE A;  4XNH C;  3VWE A;  3WR7 A;  4E2A A;  4C68 A;  1TKF A;  4JXQ A;  4OKO A;  1I21 A;  2PE3 A;  3H5Z A;  4EME A;  1YW4 A;  4PXB A;  1RO5 A;  3OWC A;  4UWI A;  1CP6 A;  5I0C A;  2VZY A;  4U5Y A;  4CRZ B;  2YNE A;  4KOY A;  4NFR A;  1ZLH A;  1JQG A;  5LRG A;  2G0B A;  1YGH A;  3P2F A;  2PIZ A;  4KOU A;  4FD6 A;  4M3S A;  3MGD A;  2JEW A;  4KS9 A;  1CJW A;  3R95 A;  4F9V A;  3CPA A;  3FVL A;  3IGR A;  2WPW A;  4A38 A;  4CPA A;  2D4P A;  3TCV A;  5AG5 A;  2Z3O A;  2OZG A;  3H8G A;  3V7Z A;  1GYT A;  1PUA A;  1UWY A;  3R1K A;  2POK A;  2WSA A;  5AG6 A;  4CYO A;  4YFJ A;  2FL4 A;  1FNO A;  1CM0 A;  2PJ9 A;  2DF5 A;  2HV2 A;  3B35 A;  5KTD A;  2F7V A;  4HKF A;  2OU2 A;  3RZA A;  2Z3N A;  2Y0M A;  1I1D A;  3WC5 A;  1PU9 A;  1YLE A;  4NJQ A;  2PJA A;  2VZZ A;  1AYE A;  3PB9 X;  4WJB A;  3WAB A;  3D8P A;  5C82 A;  1Y7E A;  2CNS A;  2ZPA A;  3TOA A;  1Z5R A;  4MFP A;  2GE3 A;  1ELL P;  2NSM A;  2GRE A;  3HLP A;  4A94 A;  5IB9 A;  1Z2L A;  3HUV A;  3NH5 A;  3MRU A;  3NE8 A;  3KHX A;  1P4N A;  4R9M A;  2PSW A;  3NE7 A;  3NH4 A;  2GLF A;  1Q7L A;  1VHO A;  2JDD A;  1CPX A;  1XBU A;  3D67 A;  4KOT A;  1IU8 A;  4KSA A;  4P4E A;  2BSW A;  1CG2 A;  4ZX9 A;  4AG7 A;  3WC7 A;  3DLJ A;  2REF A;  1TIQ A;  1HDU A;  2OH1 A;  1P0H A;  4QUS A;  3R9F A;  3S6H A;  1Z8X A;  2XEF A;  3D7D A;  2QML A;  3FED A;  2BOA A;  4MXU A;  4LUA A;  3W91 A;  2BEI A;  1QSR A;  4OAE A;  4OP4 A;  5J8F A;  3FRM A;  1YQE A;  2CNT A;  2A4N A;  4PPZ A;  3NFZ A;  2B5G B;  1Z4E A;  2GLJ A;  3GB0 A;  3ZZI A;  2PRB A;  2O4H A;  3VAT A;  1IYK A;  5AG7 A;  2ZW5 A;  3TO6 A;  5I4M A;  1QSO A;  5LYL A;  3D7G A;  1IY7 A;  2ATR A;  2DXQ A;  2Q43 A;  1WK4 A;  2CTB A;  3GLJ A;  4UEE A;  4KUA A;  5CPA A;  1CX8 A;  1BOB A;  4C2Z A;  2BO9 A;  2X7B A;  3VAR A;  4IK2 A;  3IEH A;  1M44 A;  1F2O A;  1BAV A;  5D29 A;  1M4L A;  5F09 A;  2ZEP A;  5JQ4 A;  1S60 A;  4MFQ A;  1LAN A;  1A2Z A;  3S9M A;  3EC4 A;  3ISZ A;  5ISV A;  3W6X A;  2ARH A;  3R9G A;  2Q7B A;  3CXP A;  5GCN A;  1YR0 A;  3H4Q A;  1B6B A;  2AFU A;  2Q51 A;  4P4B A;  1LCP A;  2Z3K A;  1J4J A;  5KTC A;  1B87 A;  4MCQ A;  1BO4 A;  2QYV A;  2ZEE A;  4KZT A;  4MBU A;  1X12 A;  3DR8 A;  1S5K A;  2DEA A;  3SJG A;  4I49 A;  2AE6 A;  4M6H A;  3D2M A;  3BHX A;  1PCA A;  1Q2Y A;  3IU2 A;  5G1Z A;  4JWP A;  4ZY0 A;  2BL1 A;  2PDO A;  2Z3L A;  4XPD B;  4B12 A;  2F8H A;  3LAC A;  4IF5 A;  4R6T A;  2JBK A;  1TKJ A;  3KQZ A;  3I1U A;  2ZW6 A;  5C88 A;  2VXK A;  4KUB A;  4AG9 A;  1Z4R A;  1TF8 A;  2I00 A;  1M4G A;  2PVW A;  4KVO E;  2ANP A;  1QMU A;  2FT0 A;  1IID A;  3DR6 A;  4HNX B;  4C2X A;  4LX9 A;  3ISX A;  4PQA A;  4CAX A;  5DWN A;  2PRQ A;  3S6G A;  2IL4 A;  2WZN A;  1XF8 A;  3FF3 A;  2C6P A;  3SI0 A;  4P45 A;  1VHS A;  3KAS A;  5EMI A;  2G9D A;  4EWT A;  3KR4 A;  2OB0 A;  2G3T A;  1ZLI A;  4C2Y A;  2VEZ A;  5LYF A;  3F5B A;  1IOI A;  3N7Z A;  4ONW A;  3B2Y A;  4NGP A;  5H84 A;  2Q7S A;  2D4O A;  2B5G A;  1CPS A;  4U9Z A;  2IMO A;  2GU2 A;  1UFH A;  3GIU A;  4FUU A;  5DS0 A;  5BWA B;  4RI1 A;  3GY9 A;  3PRT A;  3CT9 A;  3F0A A;  6CPA A;  3BJ7 A;  3EFA A;  3B3T A;  4G1P A;  5K8M A;  2R98 A;  3FJU A;  4R8F A;  2AFS A;  3B3V A;  3N5F A;  4ZBG A;  4RS2 A;  3D4U A;  5K8N A;  3K9U A;  1Y9K A;  3JVN A;  5AGE A;  2ZOF A;  4B6Z A;  3TTH A;  4O23 A;  3IWW A;  4MCP A;  4ZGY B;  2PIY A;  3KZW A;  4OC1 A;  2J9A A;  4FD5 A;  4CAW A;  1Y0Y A;  2BUE A;  4KOR A;  3RNZ A;  3T90 A;  4Q36 A;  4MY0 A;  4LQG A;  4BD9 A;  4MHY A;  1YRE A;  1FT7 A;  4KSI A;  3DSB A;  3RYO A;  2QJ8 A;  2WYR A;  4DUK A;  2B4D B;  4BBH A;  3H8E A;  4FBE A;  5F47 A;  1KUX A;  5D8N A;  2V77 A;  4R87 A;  4BIN A;  5G21 A;  3KR5 A;  5H86 A;  1KZF A;  7CPA A;  1R57 A;  3IC1 A;  2ZEM A;  1BLL E;  2HQY A;  1VIX A;  2J8R A;  3GKR A;  2PJ4 A;  1ARM A;  2FSR A;  2O53 A;  4AXV A;  4R3K A;  4QC6 A;  3PFE A;  4AVC A;  2RFH A;  3S9N A;  2RB7 A;  1WWZ A;  2PJ3 A;  1ARL A;  3R96 A;  3SI2 A;  4OC3 A;  3JUW A;  5DWM A;  3TO9 A;  1KUY A;  3G3S A;  4P4J A;  2PR1 A;  3D7F A;  4DYO A;  4PK3 A;  1S3Z A;  4JD6 A;  4ZY1 A;  4PXE A;  2NYQ A;  3S6F A;  1XE4 A;  2EBJ A;  3EY5 A;  3SJX A;  4H6Z A;  5HVG A;  1I12 A;  2JBJ A;  1FY7 A;  1YVO A;  3GYA A;  2EVN A;  2F5I A;  3FB3 A;  4UA3 A;  4MHZ A;  4A37 A;  4OLL A;  5J1Q A;  2BCO A;  1F57 A;  4P6Y A;  2JLM A;  4Q38 A;  3D2P A;  4F9U A;  1M1D A;  4Y49 B;  4FAI A;  3BI1 A;  3FEE A;  2PJ6 A;  5AG4 A;  2REE A;  3DGV A;  3B3C A;  1XOV A;  1AUG A;  1MJB A;  3KHZ A;  2V8H A;  3PFO A;  4M85 A;  3ZJ0 A;  4MCR A;  4KVM E;  4CAV A;  3TOB A;  3IJ3 A;  1CP7 A;  4U9Y A;  2P6E A;  4II9 A;  4A2Z A;  2B3U A;  4X2T A;  3D7H A;  4X5K A;  3S9L A;  3VH9 A;  3B3S A;  4P4F A;  4R7M A;  4CS0 B;  4EVY A;  2PJC A;  4NGM A;  4F6A A;  4OID A;  1TKH A;  1XRY A;  1YME A;  4GM5 A;  4XNH B;  3RAM A;  3SJF A;  3I3G A;  3WC6 A;  3FIX A;  3KQX A;  2EO8 A;  5G22 A;  4RUH A;  2AJ6 A;  1XJO A;  1ZG7 A;  1X10 A;  4ZYQ A;  1ZG8 A;  2Z10 A;  2ZEH A;  4KLW A;  4OIW A;  1LAP A;  4CRY B;  1IOF A;  3FYN A;  1QQ9 A;  3MN8 A;  4NSQ A;  4MCS A;  4A30 A;  1Q2C A;  2ODF A;  3CZX A;  1K4J A;  1XIX A;  5HH1 A;  4KLV A;  2P6G A;  2ZW4 A;  2PJ7 A;  1VHE A;  4ZY2 A;  2PJ1 A;  2PJB A;  2ZED A;  3B7I A;  1Z9U A;  2B4D A;  4FWU A;  3EO4 A;  5LYI A;  1XMB A;  2Z0Z A;  3C26 A;  5CNP A;  8CPA A;  5IV0 A;  4NGR A;  2PJ5 A;  4CGM A;  4PXD A;  4A33 A;  4MFL A;  4GXH A;  1M4I A;  3SI1 A;  4MHN A;  3V8I A;  1QSN A;  4IAV A;  2GAN A;  1S7F A;  2C27 A;  4UCM A;  5JPH A;  2FCK A;  2VBQ A;  1Y9W A;  1R3N A;  4CGL A;  1KUV A;  2ZEO A;  4NGT A;  5IX3 A;  3D3S A;  1OBR A;  3DDD A;  1Y7R A;  2Q04 A;  3CDX A;  3BXM A;  3KGQ A;  1PYT B;  1YSJ A;  1R43 A;  3T8W A;  1LRZ A;  4EFD A;  4KVX A;  2DPS A;  2VQY A;  4CGP A;  4ZI6 A;  4DJL A;  4MJ8 A;  2B58 A;  4CYP A;  1NSL A;  2AFX A;  1BPM A;  2RC4 A;  2FS5 A;  2XEG A;  1OZP A;  4UIA A;  4A39 A;  3W6S A;  4QB9 A;  4QVT A;  2AFM A;  2J8N A;  3DNS A;  1IGB A;  3IO1 A;  4AVA A;  2P0W A;  4PV6 A;  2Z11 A;  2C1C A;  4CYQ A;  3JTK A;  4ORF A;  3GUX A;  2Z3P A;  1Z8T A;  2O28 A;  3S6K A;  3T9Y A;  5K8P A;  2FXF A;  1IYL A;  1ZO0 A;  4UF4 A;  2QEC A;  1DTD A;  2AFZ A;  5IB0 A;  4KOV A;  1BPN A;  4OC5 A;  3KI9 A;  4NGQ A;  1YLO A;  3RO0 A;  1L0C A;  1IB1 E;  4R76 A;  3SHP A;  1CBX A;  4NJR A;  4JXR A;  1S7L A;  1F2P A;  4DNC A;  1TF9 A;  4KOS A;  2CNM A;  1Z8W A;  4Z65 A;  1RTQ A;  4OC0 A;  4E8O A;  3FNC A;  3JRU A;  3BJ8 A;  3IWG A;  2B4B A;  4H2K A;  1RXT A;  2JEV A;  4A95 A;  3E0K A;  5EC4 A;  2IJZ A;  5A28 A;  3D68 A;  4K3N A;  3UY5 A;  1VGY A;  2I3C A;  2CTC A;  4NEX A;  2PVV A;  4L8A A;  3K9T A;  4JLY A;  4X8I A;  2GIV A;  1XFO A;  4JZ0 A;  1QST A;  4H6U A;  2JDC A;  4X3R A;  2C6C A;  4XPK A;  4ZX8 A;  2PQ8 A;  5HXD A;  1Z8L A;  4F8Z A;  5K8O A;  2V8V A;  1VKC A;  4M6I A;  1NMT A;  2PR8 A;  4J3G A;  4BMH A;  1EE3 P;  4AVB A;  5F46 A;  4HNY B;  2B3V A;  4UEZ A;  2HB6 A;  2R8V A;  3PEI A;  4UEF A;  3TO7 A;  4F0X A;  2YNC A;  4PSW A;  4P44 A;  2DPT A;  1LFW A;  1V0C A;  2ZOG A;  3SJE A;  2CIJ A;  4A31 A;  2PJ0 A;  4C7I A;  1ELM P;  2CY2 A;  4UCN A;  2ZEG A;  4GS4 A;  5KTA A;  4MFZ A;  1LOK A;  3QAH A;  1S7N A;  4OC2 A;  2G3A A;  1TXR A;  2FIA A;  3FEC A;  4F0Y A;  4CGO A;  5JM6 A;  2YNC C;  3PB8 X;  2ZW7 A;  2WPX A;  3A9L A; 
#chains in the Genus database with same CATH homology
 3QB8 A;  4XPD C;  4YRH A;  2YGW A;  5G20 A;  4B14 A;  1MJA A;  4FD7 A;  4CAF A;  5HMN A;  3FXT A;  4MFK A;  1M4D A;  4HNW B;  4R57 A;  4CAE A;  1U6M A;  2OZU A;  2R7H A;  4KOX A;  4QBJ A;  2R1I A;  4IUS A;  4B5P B;  4CYN A;  3PZJ A;  4MFJ A;  1N71 A;  3LD2 A;  4CGN A;  4JJX A;  1Q2D A;  4FD4 A;  1YVK A;  4B5O A;  4B11 A;  4PK2 A;  2PC1 A;  2ZXV A;  4K30 A;  4B10 A;  5F49 A;  2Q4Y A;  5A27 A;  4UBR A;  4AB7 A;  4NF1 A;  1SQH A;  4UWJ A;  3EXN A;  2VI7 A;  3CXQ A;  4UCP A;  1GHE A;  1YK3 A;  4UFX A;  2NMT A;  4ONU A;  2K5T A;  2EUI A;  2H5M A;  3R9E A;  4UFV A;  3TE4 A;  2FE7 A;  2Q4V A;  5E96 A;  2CXA A;  2YND A;  1MK4 A;  3VWD A;  3IWE A;  3P2H A;  4UFW A;  5J8C A;  2I79 A;  4XPL A;  3BLN A;  1ON0 A;  2OZH A;  4YGO A;  5EBV A;  3PGP A;  1NE9 A;  3G8W A;  4L89 A;  2WUU A;  3CXS A;  4H89 A;  4KSF A;  4A32 A;  4MI4 A;  4MY3 A;  4PSX A;  4KOW A;  3TT2 A;  3SXN A;  3SXO A;  3IU1 A;  1YX0 A;  4C7H A;  3I9S A;  3PP9 A;  4B5P A;  4E0A A;  1QSM A;  3KKW A;  2KCW A;  2Q0Y A;  4OAD A;  4R3L A;  3B8G A;  2Z3M A;  5F48 A;  1IIC A;  4Y49 C;  1MJ9 A;  2P6F A;  4B13 A;  3TFY A;  3F8K A;  2J8M A;  2QIR A;  4NXY A;  1XEB A;  4NCZ A;  2HUZ A;  1XMT A;  3LOD A;  2Q44 A;  2FIW A;  1S7K A;  3FBU A;  5FVJ A;  4MHD A;  4XNH C;  3VWE A;  3WR7 A;  4E2A A;  4C68 A;  4JXQ A;  1I21 A;  3H5Z A;  1RO5 A;  3OWC A;  4UWI A;  5I0C A;  2VZY A;  4U5Y A;  4CRZ B;  2YNE A;  4KOY A;  2G0B A;  1YGH A;  3P2F A;  4KOU A;  4FD6 A;  4M3S A;  3MGD A;  4KS9 A;  3R95 A;  1CJW A;  3IGR A;  2WPW A;  2D4P A;  3TCV A;  5AG5 A;  2Z3O A;  2OZG A;  1PUA A;  3R1K A;  2WSA A;  5AG6 A;  4CYO A;  4YFJ A;  2FL4 A;  1CM0 A;  2HV2 A;  5KTD A;  4HKF A;  2OU2 A;  2Z3N A;  2Y0M A;  1I1D A;  1PU9 A;  1YLE A;  2VZZ A;  3D8P A;  5C82 A;  2CNS A;  2ZPA A;  3TOA A;  4MFP A;  2GE3 A;  1P4N A;  4R9M A;  2PSW A;  3NE7 A;  2JDD A;  4KOT A;  4KSA A;  2BSW A;  4AG7 A;  2REF A;  1TIQ A;  2OH1 A;  1P0H A;  4QUS A;  3R9F A;  3S6H A;  2QML A;  4LUA A;  3W91 A;  2BEI A;  1QSR A;  4OAE A;  5J8F A;  3FRM A;  2CNT A;  2A4N A;  2B5G B;  1Z4E A;  3ZZI A;  2PRB A;  1IYK A;  5AG7 A;  2ZW5 A;  3TO6 A;  1QSO A;  2DXQ A;  2ATR A;  1WK4 A;  4C2Z A;  4KUA A;  1BOB A;  2X7B A;  1M44 A;  5JQ4 A;  1S60 A;  4MFQ A;  5ISV A;  3EC4 A;  3W6X A;  2ARH A;  3R9G A;  2Q7B A;  3CXP A;  5GCN A;  1YR0 A;  3H4Q A;  1B6B A;  5KTC A;  2Z3K A;  1J4J A;  1B87 A;  1BO4 A;  4MBU A;  4KZT A;  3DR8 A;  1S5K A;  4I49 A;  2AE6 A;  3D2M A;  3IU2 A;  1Q2Y A;  5G1Z A;  4JWP A;  2BL1 A;  2PDO A;  2Z3L A;  4XPD B;  4B12 A;  4IF5 A;  2ZW6 A;  5C88 A;  2VXK A;  4KUB A;  4AG9 A;  1Z4R A;  4KVO E;  2I00 A;  1M4G A;  2FT0 A;  1IID A;  3DR6 A;  4HNX B;  4C2X A;  4LX9 A;  4CAX A;  5DWN A;  3S6G A;  2IL4 A;  1XF8 A;  1VHS A;  2OB0 A;  2G3T A;  4C2Y A;  2VEZ A;  3F5B A;  3N7Z A;  5H84 A;  2D4O A;  2B5G A;  4U9Z A;  1UFH A;  5BWA B;  4RI1 A;  3GY9 A;  3F0A A;  3BJ7 A;  3EFA A;  2R98 A;  4ZBG A;  4RS2 A;  3K9U A;  1Y9K A;  3JVN A;  5AGE A;  3TTH A;  4ZGY B;  4FD5 A;  4CAW A;  2BUE A;  4KOR A;  3T90 A;  4Q36 A;  4MY0 A;  1YRE A;  3RYO A;  3DSB A;  2B4D B;  4BBH A;  5F47 A;  1KUX A;  4R87 A;  5G21 A;  5H86 A;  1KZF A;  1R57 A;  2HQY A;  2J8R A;  3GKR A;  2FSR A;  4R3K A;  4QC6 A;  4AVC A;  1WWZ A;  3R96 A;  3JUW A;  5DWM A;  3TO9 A;  1KUY A;  3G3S A;  2PR1 A;  4PK3 A;  1S3Z A;  4JD6 A;  3S6F A;  1XE4 A;  3EY5 A;  4H6Z A;  1I12 A;  1FY7 A;  1YVO A;  3GYA A;  2EVN A;  2F5I A;  3FB3 A;  4UA3 A;  4OLL A;  2JLM A;  4Q38 A;  3D2P A;  1M1D A;  4Y49 B;  5AG4 A;  2REE A;  1MJB A;  4M85 A;  3ZJ0 A;  4KVM E;  4CAV A;  3TOB A;  4II9 A;  4U9Y A;  2P6E A;  4A2Z A;  2B3U A;  4X5K A;  4EVY A;  4CS0 B;  4F6A A;  4XNH B;  3I3G A;  3FIX A;  5G22 A;  2AJ6 A;  2Z10 A;  4KLW A;  4CRY B;  3FYN A;  4A30 A;  4NSQ A;  1Q2C A;  1K4J A;  1XIX A;  5HH1 A;  4KLV A;  2P6G A;  2ZW4 A;  1Z9U A;  2B4D A;  3EO4 A;  2Z0Z A;  3C26 A;  5CNP A;  5IV0 A;  4CGM A;  4A33 A;  4MFL A;  1M4I A;  3V8I A;  1QSN A;  2GAN A;  1S7F A;  2C27 A;  4UCM A;  5JPH A;  2FCK A;  2VBQ A;  1Y9W A;  4CGL A;  1KUV A;  5IX3 A;  3D3S A;  3DDD A;  1Y7R A;  2Q04 A;  1LRZ A;  4KVX A;  2DPS A;  2VQY A;  4CGP A;  4MJ8 A;  2B58 A;  4CYP A;  1NSL A;  2RC4 A;  2FS5 A;  1OZP A;  3W6S A;  4QB9 A;  4QVT A;  2J8N A;  3DNS A;  4AVA A;  2P0W A;  4PV6 A;  2Z11 A;  4CYQ A;  3JTK A;  4ORF A;  2Z3P A;  3T9Y A;  2O28 A;  3S6K A;  2FXF A;  1IYL A;  1ZO0 A;  2QEC A;  5IB0 A;  4KOV A;  1L0C A;  1IB1 E;  3SHP A;  4JXR A;  1S7L A;  4DNC A;  4KOS A;  2CNM A;  4E8O A;  3FNC A;  3BJ8 A;  3IWG A;  2B4B A;  1RXT A;  2JEV A;  4A95 A;  3E0K A;  5EC4 A;  5A28 A;  3UY5 A;  4NEX A;  4L8A A;  4JLY A;  2GIV A;  1QST A;  4H6U A;  2JDC A;  4XPK A;  2PQ8 A;  1VKC A;  1NMT A;  2PR8 A;  4J3G A;  4BMH A;  4AVB A;  5F46 A;  4HNY B;  2B3V A;  2R8V A;  3TO7 A;  4F0X A;  2YNC A;  4PSW A;  2DPT A;  1V0C A;  4A31 A;  4C7I A;  2CY2 A;  4UCN A;  5KTA A;  4GS4 A;  4MFZ A;  3QAH A;  1S7N A;  2G3A A;  2FIA A;  4F0Y A;  4CGO A;  2YNC C;  2ZW7 A;  2WPX A;  3A9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...