2ZEFA

Crystal structure of the human glutaminyl cyclase mutant e201d at 1.67 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGDEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zefA00
2WZNA 4ZY0A 2PJ0A 2ZEEA 1XRYA 1RTQA 3FJUA 3PB8X 2OOTA 3SI2A 3FMCA 2ZENA 4WWVA 3KHZA 1PCAA 5LYLA 2PJ1A 3ISXA 2PVVA 4R76A 3VH9A 6CPAA 3B3VA 3SI1A 4OIWA 4P10A 1YMEA 2PCUA 1LOKA 2GLFA 3BI0A 2EWBA 1DE4C 2O4HA 4F9VA 2PJ7A 2V8DA 4NGRA 2Q43A 4OC1A 1CPSA 4X3RA 1TKHA 2ZEDA 3PB4X 1VGYA 4RUHA 5F09A 2PIYA 4OC2A 3KZWA 3PBBA 4UIBA 2PJBA 4MCPA 4NGQA 4P45A 3WC6A 2NYQA 3H8FA 4UEZA 1ZLHA 3D66A 3CPAA 1R3NA 3BXMA 3TC8A 1XJOA 2ZEPA 1AMPA 2AFSA 5LRKA 4MHPA 1IGBA 3D67A 4Z65A 4X2TA 5LRGA 1M4LA 2PJ3A 4MXUA 2ZEFA 4MHYA 3PBEA 2OR4A 2CTBA 1Y0YA 3GLJA 2GLJA 5LRJA 3HUVA 4A37A 4A39A 2ZELA 1Z2LA 1LAPA 1PYTB 2ZOGA 4A38A 4IAVA 5JGFA 3KL9A 4ZX9A 4EMEA 4MCQA 2AFZA 4OC3A 3H8EA 2BCOA 2V77A 5HVFA 4FWUA 3NFZA 4F9UA 1R43A 3CPXA 4JYWA 1ARLA 4MHZA 4MRIA 2JEWA 1CBXA 1Z8LA 2GU2A 3DGVA 4P44A 3PEIA 4PXEA 1BPNA 3MN8A 4NGTA 4OIDA 3CT9A 4OC0A 1VHOA 4F8ZA 4WJBA 2EK9A 1HEEA 3KHXA 4PXBA 3B35A 2V8GA 2CF4A 4W9YA 4ZY2A 2C6CA 2XEIA 3SJXA 1GYTA 5CPAA 3FEEA 2ANPA 3B3CA 5LYFA 3B2YA 2PIZA 4YU9A 1UWYA 2HC9A 3WT4A 3FF3A 2F7VA 3IFEA 3GB0A 2C6GA 1HDQA 4ZI6A 3D7DA 5HVHA 4PPZA 2CTCA 4DJLA 2XEGA 2PJ8A 5HVGA 1ELLP 3KR4A 3T8WA 1BLLE 2JBKA 3PFOA 2CIJA 5THWA 4NGMA 4PQAA 4DYOA 1LANA 3KI9A 5D29A 3L2NA 4NGSA 3WABA 2PE3A 3BI1A 2JBJA 1VIXA 3FECA 3MRUA 5CBMA 5LYDA 2ZEMA 3I1UA 4OKOA 3H8GA 2BOAA 2GREA 4MHNA 3N5FA 1TF9A 3LWUA 4BD9A 4MCRA 1YSJA 2QJ8A 4IHMA 2G9DA 3NH5A 4R8FA 1XFOA 2NSMA 5K8MA 4ONWA 1ZG7A 3B7IA 1JQGA 1CPXA 5HXDA 4FUUA 2BO9A 1IY7A 3D4UA 3SJFA 1TKFA 4OMEA 3S9NA 3PB9X 2J9AA 1NSAA 1VHEA 4R7MA 4AXVA 4R6TA 1Y7EA 3SJGA 4YWYA 3NH8A 1KWMA 2PVWA 2WYRA 2PJ9A 3PB7X 3TX8A 5JM6A 1YW6A 3GUXA 4TNUA 5ELYA 5JH9A 1LFWA 3LMSA 4P4IA 2AFMA 4UEEA 2FVGA 2DEAA 3IIBA 1ZLIA 5J1QA 3DLJA 3KGQA 3PRTA 2ZEGA 1LAMA 4EWTA 1TKJA 4PXCA 2HB6A 3PB6X 4JZ0A 2PRQA 2V8HA 3IO1A 4P4BA 1Q7LA 1AYEA 5D8NA 8CPAA 3NA6A 4UEFA 1F2OA 3IJ3A 4P4DA 1QQ9A 1EE3P 3CDXA 3RZAA 4UIAA 3SJEA 4P4FA 3HLPA 3B3SA 1DTDA 1ZG9A 2IQ6A 4NFRA 1QMUA 2O53A 4NJRA 1FNOA 3V38A 4G1PA 4MMOA 1F2PA 3WC7A 1YW4A 3IC1A 2Q4ZA 4O23A 2VL1A 2XEJA 3IEHA 2ZEHA 2Q51A 5K8PA 3QNVA 2AFXA 2RFHA 1ELMP 2EK8A 2RB7A 2POKA 2AFUA 2ZOFA 1XBUA 2PJ4A 4MCSA 3IWWA 1OBRA 3D7FA 1TXRA 4PXDA 3VATA 3RAMA 2I3CA 1ARMA 1CG2A 2C6PA 3S9MA 3B3WA 2PJCA 3KQZA 3RBUA 2PJ5A 2PJ6A 4ZYQA 3PFEA 4NGPA 2IJZA 5K8NA 5DS0A 3FH4A 1CP7A 2F8HA 1CP6A 4P4EA 4NGNA 1Z5RA 1H8LA 3VARA 2C1CA 3KQXA 4FBEA 3S9LA 3D68A 4KSIA 4IK2A 7CPAA 2ABZA 2PJAA 4FAIA 3D7GA 4P4JA 3KASA 4UF4A 1TF8A 2AFOA 4P6YA 3WC5A 3K2KA 4A94A 1F57A 1CX8A 2PJ2A 4Q7AA 1XMBA 3FEDA 3NH4A 4OP4A 3BHXA 1BPMA 1ZG8A 3SI0A 5LYIA 3K9TA 4K3NA 3KR5A 4B6ZA 4EFDA 2V8VA 1LCPA 1BAVA 3V7ZA 4DUKA 4H2KA 3ISZA 1HDUA 4CPAA 4ZY1A 4LQGA 3D7HA 2XEFA 4ZX8A 4GM5A 2ZEOA 1FT7A 1Y0RA 5K8OA 5I4MA 2QYVA 4NJQA 2QVPA 3JRUA 5IB9A 3B3TA 2AFWA 3FVLA 3FX6A 4OC5A 4X8IA 2IMOA 4OC4A 1YLOA 4TWEA
chains in the Genus database with same CATH superfamily
2WZNA 4ZY0A 1S60A 2EVNA 2JDCA 3EFAA 2PJ0A 2ZEEA 3LACA 1XRYA 1RTQA 3FJUA 3P2FA 2JLMA 3PB8X 2OOTA 3UY5A 1ON0A 4F6AA 2X7BA 4KVOE 1XE4A 3SI2A 2CXAA 2DPSA 3FMCA 4UFXA 2ZENA 2Z3PA 4WWVA 4B11A 3KHZA 1PCAA 4NXYA 2FXFA 3S6HA 1S3ZA 5F47A 1M4GA 2PJ1A 3ISXA 5LYLA 2PVVA 4R76A 4CAXA 3VH9A 6CPAA 4Y49B 2HUZA 4MFKA 5I0CA 3B3VA 3SI1A 2PDOA 3W6XA 4LUAA 4HNWB 4OIWA 1YMEA 4P10A 2PCUA 2PR1A 1LOKA 2GLFA 3BI0A 2EWBA 1DE4C 1YK3A 2O4HA 4JWPA 4F9VA 4M85A 2CNMA 2PJ7A 2V8DA 4NGRA 2Q43A 3I9SA 1CPSA 4OC1A 4X3RA 1Y7RA 4UCMA 1TKHA 2ZEDA 1PUAA 1VGYA 3PB4X 2ZW7A 4RUHA 2PC1A 4YRHA 1IB1E 5F09A 3R95A 2YNDA 1S5KA 4MFZA 2PIYA 4CGMA 1TIQA 4OC2A 3KZWA 4QBJA 4FD7A 1N71A 3PBBA 3BJ7A 4XNHB 2F5IA 2ATRA 2Z3KA 1ZO0A 4UIBA 3TCVA 2CY2A 2PJBA 4MCPA 4NGQA 3R9EA 4YFJA 4P45A 1VKCA 3WC6A 3DDDA 1M4DA 5ISVA 2NYQA 3H8FA 4AG7A 2R1IA 4UEZA 1ZLHA 3D66A 5C88A 3CPAA 1NMTA 1R3NA 3BXMA 2AJ6A 2VI7A 5G22A 3TC8A 2BSWA 1XJOA 2ZEPA 1AMPA 1Y9KA 2AFSA 3CXQA 2Q7SA 3GKRA 3CZXA 1NSLA 5EC4A 2REEA 3EY5A 4M3SA 4CAVA 5LRKA 1QSTA 4MHPA 4MFQA 1MJAA 4HNYB 2OB0A 1IGBA 3D67A 3EXNA 3FB3A 4X2TA 4XPKA 4Z65A 5EMIA 4KOSA 5LRGA 1M4LA 2PJ3A 4MXUA 2RC4A 2ZEFA 4MHYA 2P6GA 3PBEA 1Y9WA 2OR4A 2CTBA 2YGWA 4MFJA 5FVJA 4MFPA 1KUVA 2P0WA 4M6HA 5KTCA 1Y0YA 3GLJA 2GLJA 2Z0ZA 3IGRA 4QC6A 5LRJA 2VBQA 4CRZB 1YX0A 2ZW4A 2GE3A 3FXTA 3HUVA 4A37A 4A39A 2ZELA 4CYOA 2VEZA 1Z2LA 1LAPA 1PYTB 2ZOGA 4A38A 4IAVA 1MK4A 2B4DB 5H84A 5JGFA 1AUGA 3KL9A 4ZX9A 3R9FA 4EMEA 3SHPA 1L0CA 4MCQA 1I21A 4AVAA 2PQ8A 2AFZA 4OC3A 3H8EA 2BCOA 2BL1A 4UA3A 2V77A 5HVFA 4FWUA 2WPWA 3NFZA 1YVKA 4F9UA 4KLWA 1R43A 4H89A 2EUIA 3CPXA 4LQ6A 4CRYB 3D3SA 4JYWA 1ARLA 2CNTA 4MHZA 4CYQA 3TOBA 4MJ8A 4MRIA 2B4BA 1M44A 4A2ZA 2JEWA 4CAWA 1WK4A 2OZGA 4C7IA 1CBXA 1Z8LA 4JXRA 2GU2A 1PU9A 3DGVA 5G20A 2OU2A 1B6BA 4UFWA 1Q2CA 3NE7A 2OZHA 4P44A 3IU1A 3PEIA 4UWJA 1K4JA 4PXEA 1BPNA 3MN8A 1UFHA 2D4PA 3CXSA 4NGTA 2B3VA 4OIDA 4UWIA 3CT9A 2I79A 2ZXVA 4OC0A 1VHOA 4F8ZA 4CGPA 4WJBA 3CXPA 4KSAA 4CYPA 2EK9A 1HEEA 3GY9A 3KHXA 4PXBA 3B35A 1RXTA 4BINA 2K5TA 2V8GA 4CGOA 3F0AA 2CF4A 4KOYA 3H4QA 2NMTA 2Z11A 1V0CA 2WPXA 4W9YA 2Q4VA 4ZY2A 3TO7A 2C6CA 2XEIA 3SJXA 1GYTA 3FNCA 3JVNA 5CPAA 3FEEA 4A33A 3FBUA 2ANPA 4JXQA 1R57A 1S7LA 1S7NA 3B3CA 2PR8A 3R9GA 5LYFA 2GIVA 3DNSA 4QVTA 2Z3OA 4J3GA 4KOVA 3B2YA 2PIZA 4YU9A 4M6IA 1YLEA 4PK3A 3B8GA 2FIWA 4FD4A 3T90A 3JTKA 1UWYA 5CNPA 2HC9A 3WT4A 3RNZA 3FF3A 2QIRA 2FT0A 1BOBA 2Q7BA 2F7VA 3OWCA 3IFEA 3GB0A 2Y0MA 2C6GA 1HDQA 3RYOA 4ZI6A 1KUXA 3D7DA 3DSBA 2QMLA 5HVHA 4JJXA 4PPZA 1IICA 4KUBA 3DR6A 4GXHA 2CTCA 3WR7A 5A28A 2HQYA 4DJLA 5DWNA 2BEIA 2B58A 4NEXA 4FD5A 3D8PA 3TE4A 2XEGA 5G21A 2PJ8A 5HVGA 2FIAA 3IWGA 2GFQA 1ELLP 3ZZIA 2Z3LA 4H6UA 5GCNA 1XMTA 3KR4A 3T8WA 1BLLE 1Z4EA 1CJWA 2JBKA 3PFOA 4Y49C 4E0AA 3N7ZA 4KSFA 1FY7A 3ZJ0A 2CIJA 5THWA 4NGMA 1MJ9A 4PQAA 4XPDB 2YNCA 4DYOA 2FCKA 1LANA 3KI9A 1A2ZA 1JWQA 3L2NA 5D29A 4B5OA 3G3SA 2Z3MA 4NGSA 1KZFA 2PE3A 3BI1A 3F5BA 2JBJA 2G0BA 4HNXB 3S6GA 3TT2A 3WABA 1VIXA 5BWAB 3FECA 3MRUA 5CBMA 5EBVA 1CM0A 2ZEMA 3I1UA 4I49A 4OKOA 3H8GA 2BOAA 1WWZA 5LYDA 3LD2A 2GREA 4MHNA 2DPTA 3N5FA 3RO0A 1TF9A 3LWUA 4II9A 4KOUA 1YREA 4MY3A 4BD9A 4BBHA 2B4DA 2QECA 1I12A 4MCRA 1YSJA 1Z8XA 2QJ8A 4IHMA 2Z10A 2G9DA 3NH5A 4R8FA 4Q36A 1XFOA 3FIXA 1M4IA 4B10A 3PP9A 1YVOA 2Q0YA 1P4NA 2EBJA 2NSMA 5JQ4A 1QSRA 5K8MA 4ONWA 2P6EA 1ZG7A 2Q44A 3B7IA 1JQGA 3TO9A 3VWDA 1CPXA 5J8CA 1S7FA 4CS0B 5HXDA 4FUUA 2BO9A 1IY7A 3D4UA 3SJFA 1TKFA 4OMEA 3S9NA 3PB9X 5H86A 4AG9A 2J9AA 2G3TA 4L89A 1NSAA 1VHEA 4R7MA 4AXVA 2YNEA 3G8WA 1SQHA 4R6TA 1Y7EA 3SJGA 4NF1A 2OZUA 3LODA 4R9MA 4YWYA 4EVYA 3NH8A 1KWMA 2ZPAA 2D4OA 4U5YA 4AVBA 3P2HA 2PVWA 4L8AA 4CPAA 2WYRA 4HPSA 2PJ9A 3PB7X 4Q38A 3TX8A 5JM6A 4R3LA 2C27A 1YW6A 3GUXA 3GIUA 4TNUA 5ELYA 5IX3A 1LFWA 3LMSA 2J8NA 4P4IA 5JH9A 2AFMA 4AVCA 4E8OA 4UEEA 4A32A 3IWEA 2FVGA 1IU8A 2DEAA 3IIBA 1ZLIA 3DR8A 1QSOA 3V8IA 5J1QA 3TO6A 3DLJA 3NE8A 3KGQA 4C7HA 3PRTA 3TFYA 2ZEGA 1LAMA 4EWTA 1TKJA 2R8VA 4PXCA 2HB6A 3PB6X 3EO4A 4K30A 5KTAA 4JZ0A 2PRQA 4JD6A 1X12A 2V8HA 1Q2YA 3IO1A 4P4BA 3SXNA 1Q7LA 4B14A 1AYEA 4CYNA 4OADA 4MHDA 5D8NA 4A95A 4TWEA 8CPAA 5HH1A 3NA6A 4UEFA 1F2OA 4IF5A 3IJ3A 5E96A 4P4DA 1QQ9A 1EE3P 3CDXA 3RZAA 4UIAA 3D2PA 3SJEA 4P4FA 1B87A 3HLPA 4H6ZA 4A31A 2ZW6A 3B3SA 4MI4A 4OAEA 5F49A 4PK2A 1DTDA 4A30A 5K8OA 1ZG9A 2IQ6A 3BLNA 1BO4A 4NFRA 4DNCA 1QMUA 2Q04A 2Z3NA 2O53A 4NJRA 4XPLA 4KUAA 2G3AA 4PSXA 4F0YA 3QAYA 1FNOA 4ZBGA 3V38A 4B13A 5DWMA 1IIDA 4G1PA 2ODFA 1Z8TA 4ZY1A 4MMOA 3SXOA 1F2PA 3WC7A 2A4NA 1YW4A 3IC1A 5AG7A 2Q4ZA 2VL1A 2XEJA 4O23A 3E0KA 4KOXA 3IEHA 2ZEHA 2P6FA 2WUUA 2Q51A 3H5ZA 5K8PA 2WSAA 2FS5A 3QNVA 2AFXA 5AG6A 1MJBA 2RFHA 1ELMP 4KVME 2EK8A 2PSWA 2RB7A 2POKA 4HKFA 4C68A 4ZGYB 2AFUA 1XBUA 2ZOFA 3QB8A 4R57A 4BMHA 1P0HA 1YGHA 4R87A 2I00A 4M6GA 2PJ4A 4MCSA 1LRZA 1U6MA 3IWWA 1OBRA 3D7FA 3S6KA 1QSNA 1TXRA 4YGOA 1IYLA 4KOWA 4U9ZA 4PXDA 3VATA 4MY0A 3RAMA 5F46A 2I3CA 2Q4YA 3TOAA 2B5GA 2HV2A 3R1KA 1QSMA 5IV0A 4KZTA 1ARMA 4OLLA 1CG2A 2C6PA 4QUSA 2AE6A 3S9MA 3B3WA 2PJCA 3KQZA 4MBUA 3RBUA 2ARHA 1Z4RA 2PJ5A 5AG4A 1YR0A 2JEVA 3K9UA 2O28A 2PJ6A 3F8KA 3PFEA 4NGPA 4ZYQA 2DF5A 1IOFA 2IJZA 4B12A 5DS0A 3FH4A 4ORFA 4PV6A 5K8NA 3C26A 4KORA 1CP7A 4XNHC 3A9LA 2VZYA 1IOIA 2VXKA 2F8HA 2VQYA 1IYKA 1S7KA 2B5GB 5IB0A 3KKWA 5HMNA 3BJ8A 2KCWA 2H5MA 4NCZA 1CP6A 1VHSA 4P4EA 3QAHA 5F48A 1J4JA 4NGNA 1Z5RA 4XPDC 1H8LA 3IU2A 1XF8A 3VARA 2C1CA 1KUYA 3KQXA 5J8FA 4U9YA 4KS9A 4CAEA 4FBEA 1Z9UA 3S9LA 3TTHA 3D68A 1RO5A 1I1DA 2OH1A 2BUEA 3EC4A 2J8MA 4KSIA 4E2AA 1Q2DA 2J8RA 4F0XA 4IK2A 7CPAA 2ABZA 1GHEA 3VWEA 1M1DA 4KOTA 2JDDA 2PJAA 3MGDA 3D7GA 4P4JA 3KASA 4UF4A 2REFA 1TF8A 2EO8A 4CGNA 4FAIA 1OZPA 2AFOA 4RI1A 2FSRA 3D2MA 4P6YA 4JLYA 3WC5A 3K2KA 4A94A 4B5PA 4UFVA 1F57A 2YNCC 1CX8A 2PJ2A 4NSQA 4Q7AA 2VZZA 1XMBA 3W6SA 4RN7A 3PGPA 3FEDA 4X5KA 3GYAA 3NH4A 4OP4A 3BHXA 1NE9A 4PSWA 2ZW5A 2FE7A 2FL4A 1BPMA 1ZG8A 3SI0A 2CNSA 4UCPA 5LYIA 4C2ZA 3K9TA 2GANA 4K3NA 1XIXA 4MFLA 3KR5A 3FYNA 2IL4A 4B6ZA 4EFDA 4CGLA 2V8VA 1LCPA 2PRBA 1BAVA 4IUSA 4B5PB 3V7ZA 4CAFA 2DXQA 4R3KA 4UCNA 2R7HA 4RS2A 3T9YA 4DUKA 4H2KA 2R98A 1HDUA 3ISZA 3PZJA 1Z8WA 5AG5A 5G1ZA 4LQGA 3S6FA 4AB7A 4GS4A 3I3GA 3D7HA 2XEFA 3FRMA 4GM5A 4ZX8A 2ZEOA 4ONUA 1FT7A 1Y0RA 2B3UA 3R96A 2QYVA 1X10A 5AGEA 3W91A 4UBRA 5I4MA 4NJQA 5C82A 4KVXA 1XEBA 2QVPA 4LX9A 4QB9A 3JRUA 5IB9A 3B3TA 2AFWA 3JUWA 5KTDA 5JPHA 4C2YA 3FVLA 3FX6A 4FD6A 4OC5A 4X8IA 1YQEA 2IMOA 4OC4A 4C2XA 1XOVA 1YLOA 5A27A 4KLVA
chains in the Genus database with same CATH topology
2WZNA 4ZY0A 2PJ0A 2ZEEA 1XRYA 1RTQA 3FJUA 3PB8X 2OOTA 3SI2A 3FMCA 2ZENA 4WWVA 3KHZA 1PCAA 5LYLA 2PJ1A 3ISXA 2PVVA 4R76A 3VH9A 6CPAA 3B3VA 3SI1A 4OIWA 4P10A 1YMEA 2PCUA 1LOKA 2GLFA 3BI0A 2EWBA 1DE4C 2O4HA 4F9VA 2PJ7A 2V8DA 4NGRA 2Q43A 4OC1A 1CPSA 4X3RA 1TKHA 2ZEDA 3PB4X 1VGYA 4RUHA 5F09A 2PIYA 4OC2A 3KZWA 3PBBA 4UIBA 2PJBA 4MCPA 4NGQA 4P45A 3WC6A 2NYQA 3H8FA 4UEZA 1ZLHA 3D66A 3CPAA 1R3NA 3BXMA 3TC8A 1XJOA 2ZEPA 1AMPA 2AFSA 5LRKA 4MHPA 1IGBA 3D67A 4Z65A 4X2TA 5LRGA 1M4LA 2PJ3A 4MXUA 2ZEFA 4MHYA 3PBEA 2OR4A 2CTBA 1Y0YA 3GLJA 2GLJA 5LRJA 3HUVA 4A37A 4A39A 2ZELA 1Z2LA 1LAPA 1PYTB 2ZOGA 4A38A 4IAVA 5JGFA 3KL9A 4ZX9A 4EMEA 4MCQA 2AFZA 4OC3A 3H8EA 2BCOA 2V77A 5HVFA 4FWUA 3NFZA 4F9UA 1R43A 3CPXA 4JYWA 1ARLA 4MHZA 4MRIA 2JEWA 1CBXA 1Z8LA 2GU2A 3DGVA 4P44A 3PEIA 4PXEA 1BPNA 3MN8A 4NGTA 4OIDA 3CT9A 4OC0A 1VHOA 4F8ZA 4WJBA 2EK9A 1HEEA 3KHXA 4PXBA 3B35A 2V8GA 2CF4A 4W9YA 4ZY2A 2C6CA 2XEIA 3SJXA 1GYTA 5CPAA 3FEEA 2ANPA 3B3CA 5LYFA 3B2YA 2PIZA 4YU9A 1UWYA 2HC9A 3WT4A 3FF3A 2F7VA 3IFEA 3GB0A 2C6GA 1HDQA 4ZI6A 3D7DA 5HVHA 4PPZA 2CTCA 4DJLA 2XEGA 2PJ8A 5HVGA 1ELLP 3KR4A 3T8WA 1BLLE 2JBKA 3PFOA 2CIJA 5THWA 4NGMA 4PQAA 4DYOA 1LANA 3KI9A 5D29A 3L2NA 4NGSA 3WABA 2PE3A 3BI1A 2JBJA 1VIXA 3FECA 3MRUA 5CBMA 5LYDA 2ZEMA 3I1UA 4OKOA 3H8GA 2BOAA 2GREA 4MHNA 3N5FA 1TF9A 3LWUA 4BD9A 4MCRA 1YSJA 2QJ8A 4IHMA 2G9DA 3NH5A 4R8FA 1XFOA 2NSMA 5K8MA 4ONWA 1ZG7A 3B7IA 1JQGA 1CPXA 5HXDA 4FUUA 2BO9A 1IY7A 3D4UA 3SJFA 1TKFA 4OMEA 3S9NA 3PB9X 2J9AA 1NSAA 1VHEA 4R7MA 4AXVA 4R6TA 1Y7EA 3SJGA 4YWYA 3NH8A 1KWMA 2PVWA 2WYRA 2PJ9A 3PB7X 3TX8A 5JM6A 1YW6A 3GUXA 4TNUA 5ELYA 5JH9A 1LFWA 3LMSA 4P4IA 2AFMA 4UEEA 2FVGA 2DEAA 3IIBA 1ZLIA 5J1QA 3DLJA 3KGQA 3PRTA 2ZEGA 1LAMA 4EWTA 1TKJA 4PXCA 2HB6A 3PB6X 4JZ0A 2PRQA 2V8HA 3IO1A 4P4BA 1Q7LA 1AYEA 5D8NA 8CPAA 3NA6A 4UEFA 1F2OA 3IJ3A 4P4DA 1QQ9A 1EE3P 3CDXA 3RZAA 4UIAA 3SJEA 4P4FA 3HLPA 3B3SA 1DTDA 1ZG9A 2IQ6A 4NFRA 1QMUA 2O53A 4NJRA 1FNOA 3V38A 4G1PA 4MMOA 1F2PA 3WC7A 1YW4A 3IC1A 2Q4ZA 4O23A 2VL1A 2XEJA 3IEHA 2ZEHA 2Q51A 5K8PA 3QNVA 2AFXA 2RFHA 1ELMP 2EK8A 2RB7A 2POKA 2AFUA 2ZOFA 1XBUA 2PJ4A 4MCSA 3IWWA 1OBRA 3D7FA 1TXRA 4PXDA 3VATA 3RAMA 2I3CA 1ARMA 1CG2A 2C6PA 3S9MA 3B3WA 2PJCA 3KQZA 3RBUA 2PJ5A 2PJ6A 4ZYQA 3PFEA 4NGPA 2IJZA 5K8NA 5DS0A 3FH4A 1CP7A 2F8HA 1CP6A 4P4EA 4NGNA 1Z5RA 1H8LA 3VARA 2C1CA 3KQXA 4FBEA 3S9LA 3D68A 4KSIA 4IK2A 7CPAA 2ABZA 2PJAA 4FAIA 3D7GA 4P4JA 3KASA 4UF4A 1TF8A 2AFOA 4P6YA 3WC5A 3K2KA 4A94A 1F57A 1CX8A 2PJ2A 4Q7AA 1XMBA 3FEDA 3NH4A 4OP4A 3BHXA 1BPMA 1ZG8A 3SI0A 5LYIA 3K9TA 4K3NA 3KR5A 4B6ZA 4EFDA 2V8VA 1LCPA 1BAVA 3V7ZA 4DUKA 4H2KA 3ISZA 1HDUA 4CPAA 4ZY1A 4LQGA 3D7HA 2XEFA 4ZX8A 4GM5A 2ZEOA 1FT7A 1Y0RA 5K8OA 5I4MA 2QYVA 4NJQA 2QVPA 3JRUA 5IB9A 3B3TA 2AFWA 3FVLA 3FX6A 4OC5A 4X8IA 2IMOA 4OC4A 1YLOA 4TWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZN A;  4ZY0 A;  2PJ0 A;  2ZEE A;  1XRY A;  1RTQ A;  3FJU A;  3PB8 X;  2OOT A;  3SI2 A;  3FMC A;  2ZEN A;  4WWV A;  3KHZ A;  1PCA A;  5LYL A;  2PJ1 A;  3ISX A;  2PVV A;  4R76 A;  3VH9 A;  6CPA A;  3B3V A;  3SI1 A;  4OIW A;  4P10 A;  1YME A;  2PCU A;  1LOK A;  2GLF A;  3BI0 A;  2EWB A;  1DE4 C;  2O4H A;  4F9V A;  2PJ7 A;  2V8D A;  4NGR A;  2Q43 A;  4OC1 A;  1CPS A;  4X3R A;  1TKH A;  2ZED A;  3PB4 X;  1VGY A;  4RUH A;  5F09 A;  2PIY A;  4OC2 A;  3KZW A;  3PBB A;  4UIB A;  2PJB A;  4MCP A;  4NGQ A;  4P45 A;  3WC6 A;  2NYQ A;  3H8F A;  4UEZ A;  1ZLH A;  3D66 A;  3CPA A;  1R3N A;  3BXM A;  3TC8 A;  1XJO A;  2ZEP A;  1AMP A;  2AFS A;  5LRK A;  4MHP A;  1IGB A;  3D67 A;  4Z65 A;  4X2T A;  5LRG A;  1M4L A;  2PJ3 A;  4MXU A;  2ZEF A;  4MHY A;  3PBE A;  2OR4 A;  2CTB A;  1Y0Y A;  3GLJ A;  2GLJ A;  5LRJ A;  3HUV A;  4A37 A;  4A39 A;  2ZEL A;  1Z2L A;  1LAP A;  1PYT B;  2ZOG A;  4A38 A;  4IAV A;  5JGF A;  3KL9 A;  4ZX9 A;  4EME A;  4MCQ A;  2AFZ A;  4OC3 A;  3H8E A;  2BCO A;  2V77 A;  5HVF A;  4FWU A;  3NFZ A;  4F9U A;  1R43 A;  3CPX A;  4JYW A;  1ARL A;  4MHZ A;  4MRI A;  2JEW A;  1CBX A;  1Z8L A;  2GU2 A;  3DGV A;  4P44 A;  3PEI A;  4PXE A;  1BPN A;  3MN8 A;  4NGT A;  4OID A;  3CT9 A;  4OC0 A;  1VHO A;  4F8Z A;  4WJB A;  2EK9 A;  1HEE A;  3KHX A;  4PXB A;  3B35 A;  2V8G A;  2CF4 A;  4W9Y A;  4ZY2 A;  2C6C A;  2XEI A;  3SJX A;  1GYT A;  5CPA A;  3FEE A;  2ANP A;  3B3C A;  5LYF A;  3B2Y A;  2PIZ A;  4YU9 A;  1UWY A;  2HC9 A;  3WT4 A;  3FF3 A;  2F7V A;  3IFE A;  3GB0 A;  2C6G A;  1HDQ A;  4ZI6 A;  3D7D A;  5HVH A;  4PPZ A;  2CTC A;  4DJL A;  2XEG A;  2PJ8 A;  5HVG A;  1ELL P;  3KR4 A;  3T8W A;  1BLL E;  2JBK A;  3PFO A;  2CIJ A;  5THW A;  4NGM A;  4PQA A;  4DYO A;  1LAN A;  3KI9 A;  5D29 A;  3L2N A;  4NGS A;  3WAB A;  2PE3 A;  3BI1 A;  2JBJ A;  1VIX A;  3FEC A;  3MRU A;  5CBM A;  5LYD A;  2ZEM A;  3I1U A;  4OKO A;  3H8G A;  2BOA A;  2GRE A;  4MHN A;  3N5F A;  1TF9 A;  3LWU A;  4BD9 A;  4MCR A;  1YSJ A;  2QJ8 A;  4IHM A;  2G9D A;  3NH5 A;  4R8F A;  1XFO A;  2NSM A;  5K8M A;  4ONW A;  1ZG7 A;  3B7I A;  1JQG A;  1CPX A;  5HXD A;  4FUU A;  2BO9 A;  1IY7 A;  3D4U A;  3SJF A;  1TKF A;  4OME A;  3S9N A;  3PB9 X;  2J9A A;  1NSA A;  1VHE A;  4R7M A;  4AXV A;  4R6T A;  1Y7E A;  3SJG A;  4YWY A;  3NH8 A;  1KWM A;  2PVW A;  2WYR A;  2PJ9 A;  3PB7 X;  3TX8 A;  5JM6 A;  1YW6 A;  3GUX A;  4TNU A;  5ELY A;  5JH9 A;  1LFW A;  3LMS A;  4P4I A;  2AFM A;  4UEE A;  2FVG A;  2DEA A;  3IIB A;  1ZLI A;  5J1Q A;  3DLJ A;  3KGQ A;  3PRT A;  2ZEG A;  1LAM A;  4EWT A;  1TKJ A;  4PXC A;  2HB6 A;  3PB6 X;  4JZ0 A;  2PRQ A;  2V8H A;  3IO1 A;  4P4B A;  1Q7L A;  1AYE A;  5D8N A;  8CPA A;  3NA6 A;  4UEF A;  1F2O A;  3IJ3 A;  4P4D A;  1QQ9 A;  1EE3 P;  3CDX A;  3RZA A;  4UIA A;  3SJE A;  4P4F A;  3HLP A;  3B3S A;  1DTD A;  1ZG9 A;  2IQ6 A;  4NFR A;  1QMU A;  2O53 A;  4NJR A;  1FNO A;  3V38 A;  4G1P A;  4MMO A;  1F2P A;  3WC7 A;  1YW4 A;  3IC1 A;  2Q4Z A;  4O23 A;  2VL1 A;  2XEJ A;  3IEH A;  2ZEH A;  2Q51 A;  5K8P A;  3QNV A;  2AFX A;  2RFH A;  1ELM P;  2EK8 A;  2RB7 A;  2POK A;  2AFU A;  2ZOF A;  1XBU A;  2PJ4 A;  4MCS A;  3IWW A;  1OBR A;  3D7F A;  1TXR A;  4PXD A;  3VAT A;  3RAM A;  2I3C A;  1ARM A;  1CG2 A;  2C6P A;  3S9M A;  3B3W A;  2PJC A;  3KQZ A;  3RBU A;  2PJ5 A;  2PJ6 A;  4ZYQ A;  3PFE A;  4NGP A;  2IJZ A;  5K8N A;  5DS0 A;  3FH4 A;  1CP7 A;  2F8H A;  1CP6 A;  4P4E A;  4NGN A;  1Z5R A;  1H8L A;  3VAR A;  2C1C A;  3KQX A;  4FBE A;  3S9L A;  3D68 A;  4KSI A;  4IK2 A;  7CPA A;  2ABZ A;  2PJA A;  4FAI A;  3D7G A;  4P4J A;  3KAS A;  4UF4 A;  1TF8 A;  2AFO A;  4P6Y A;  3WC5 A;  3K2K A;  4A94 A;  1F57 A;  1CX8 A;  2PJ2 A;  4Q7A A;  1XMB A;  3FED A;  3NH4 A;  4OP4 A;  3BHX A;  1BPM A;  1ZG8 A;  3SI0 A;  5LYI A;  3K9T A;  4K3N A;  3KR5 A;  4B6Z A;  4EFD A;  2V8V A;  1LCP A;  1BAV A;  3V7Z A;  4DUK A;  4H2K A;  3ISZ A;  1HDU A;  4CPA A;  4ZY1 A;  4LQG A;  3D7H A;  2XEF A;  4ZX8 A;  4GM5 A;  2ZEO A;  1FT7 A;  1Y0R A;  5K8O A;  5I4M A;  2QYV A;  4NJQ A;  2QVP A;  3JRU A;  5IB9 A;  3B3T A;  2AFW A;  3FVL A;  3FX6 A;  4OC5 A;  4X8I A;  2IMO A;  4OC4 A;  1YLO A;  4TWE A; 
#chains in the Genus database with same CATH topology
 2WZN A;  4ZY0 A;  1S60 A;  2EVN A;  2JDC A;  3EFA A;  2PJ0 A;  2ZEE A;  3LAC A;  1XRY A;  1RTQ A;  3FJU A;  3P2F A;  2JLM A;  3PB8 X;  2OOT A;  3UY5 A;  1ON0 A;  4F6A A;  2X7B A;  4KVO E;  1XE4 A;  3SI2 A;  2CXA A;  2DPS A;  3FMC A;  4UFX A;  2ZEN A;  2Z3P A;  4WWV A;  4B11 A;  3KHZ A;  1PCA A;  4NXY A;  2FXF A;  3S6H A;  1S3Z A;  5F47 A;  1M4G A;  2PJ1 A;  3ISX A;  5LYL A;  2PVV A;  4R76 A;  4CAX A;  3VH9 A;  6CPA A;  4Y49 B;  2HUZ A;  4MFK A;  5I0C A;  3B3V A;  3SI1 A;  2PDO A;  3W6X A;  4LUA A;  4HNW B;  4OIW A;  1YME A;  4P10 A;  2PCU A;  2PR1 A;  1LOK A;  2GLF A;  3BI0 A;  2EWB A;  1DE4 C;  1YK3 A;  2O4H A;  4JWP A;  4F9V A;  4M85 A;  2CNM A;  2PJ7 A;  2V8D A;  4NGR A;  2Q43 A;  3I9S A;  1CPS A;  4OC1 A;  4X3R A;  1Y7R A;  4UCM A;  1TKH A;  2ZED A;  1PUA A;  1VGY A;  3PB4 X;  2ZW7 A;  4RUH A;  2PC1 A;  4YRH A;  1IB1 E;  5F09 A;  3R95 A;  2YND A;  1S5K A;  4MFZ A;  2PIY A;  4CGM A;  1TIQ A;  4OC2 A;  3KZW A;  4QBJ A;  4FD7 A;  1N71 A;  3PBB A;  3BJ7 A;  4XNH B;  2F5I A;  2ATR A;  2Z3K A;  1ZO0 A;  4UIB A;  3TCV A;  2CY2 A;  2PJB A;  4MCP A;  4NGQ A;  3R9E A;  4YFJ A;  4P45 A;  1VKC A;  3WC6 A;  3DDD A;  1M4D A;  5ISV A;  2NYQ A;  3H8F A;  4AG7 A;  2R1I A;  4UEZ A;  1ZLH A;  3D66 A;  5C88 A;  3CPA A;  1NMT A;  1R3N A;  3BXM A;  2AJ6 A;  2VI7 A;  5G22 A;  3TC8 A;  2BSW A;  1XJO A;  2ZEP A;  1AMP A;  1Y9K A;  2AFS A;  3CXQ A;  2Q7S A;  3GKR A;  3CZX A;  1NSL A;  5EC4 A;  2REE A;  3EY5 A;  4M3S A;  4CAV A;  5LRK A;  1QST A;  4MHP A;  4MFQ A;  1MJA A;  4HNY B;  2OB0 A;  1IGB A;  3D67 A;  3EXN A;  3FB3 A;  4X2T A;  4XPK A;  4Z65 A;  5EMI A;  4KOS A;  5LRG A;  1M4L A;  2PJ3 A;  4MXU A;  2RC4 A;  2ZEF A;  4MHY A;  2P6G A;  3PBE A;  1Y9W A;  2OR4 A;  2CTB A;  2YGW A;  4MFJ A;  5FVJ A;  4MFP A;  1KUV A;  2P0W A;  4M6H A;  5KTC A;  1Y0Y A;  3GLJ A;  2GLJ A;  2Z0Z A;  3IGR A;  4QC6 A;  5LRJ A;  2VBQ A;  4CRZ B;  1YX0 A;  2ZW4 A;  2GE3 A;  3FXT A;  3HUV A;  4A37 A;  4A39 A;  2ZEL A;  4CYO A;  2VEZ A;  1Z2L A;  1LAP A;  1PYT B;  2ZOG A;  4A38 A;  4IAV A;  1MK4 A;  2B4D B;  5H84 A;  5JGF A;  1AUG A;  3KL9 A;  4ZX9 A;  3R9F A;  4EME A;  3SHP A;  1L0C A;  4MCQ A;  1I21 A;  4AVA A;  2PQ8 A;  2AFZ A;  4OC3 A;  3H8E A;  2BCO A;  2BL1 A;  4UA3 A;  2V77 A;  5HVF A;  4FWU A;  2WPW A;  3NFZ A;  1YVK A;  4F9U A;  4KLW A;  1R43 A;  4H89 A;  2EUI A;  3CPX A;  4LQ6 A;  4CRY B;  3D3S A;  4JYW A;  1ARL A;  2CNT A;  4MHZ A;  4CYQ A;  3TOB A;  4MJ8 A;  4MRI A;  2B4B A;  1M44 A;  4A2Z A;  2JEW A;  4CAW A;  1WK4 A;  2OZG A;  4C7I A;  1CBX A;  1Z8L A;  4JXR A;  2GU2 A;  1PU9 A;  3DGV A;  5G20 A;  2OU2 A;  1B6B A;  4UFW A;  1Q2C A;  3NE7 A;  2OZH A;  4P44 A;  3IU1 A;  3PEI A;  4UWJ A;  1K4J A;  4PXE A;  1BPN A;  3MN8 A;  1UFH A;  2D4P A;  3CXS A;  4NGT A;  2B3V A;  4OID A;  4UWI A;  3CT9 A;  2I79 A;  2ZXV A;  4OC0 A;  1VHO A;  4F8Z A;  4CGP A;  4WJB A;  3CXP A;  4KSA A;  4CYP A;  2EK9 A;  1HEE A;  3GY9 A;  3KHX A;  4PXB A;  3B35 A;  1RXT A;  4BIN A;  2K5T A;  2V8G A;  4CGO A;  3F0A A;  2CF4 A;  4KOY A;  3H4Q A;  2NMT A;  2Z11 A;  1V0C A;  2WPX A;  4W9Y A;  2Q4V A;  4ZY2 A;  3TO7 A;  2C6C A;  2XEI A;  3SJX A;  1GYT A;  3FNC A;  3JVN A;  5CPA A;  3FEE A;  4A33 A;  3FBU A;  2ANP A;  4JXQ A;  1R57 A;  1S7L A;  1S7N A;  3B3C A;  2PR8 A;  3R9G A;  5LYF A;  2GIV A;  3DNS A;  4QVT A;  2Z3O A;  4J3G A;  4KOV A;  3B2Y A;  2PIZ A;  4YU9 A;  4M6I A;  1YLE A;  4PK3 A;  3B8G A;  2FIW A;  4FD4 A;  3T90 A;  3JTK A;  1UWY A;  5CNP A;  2HC9 A;  3WT4 A;  3RNZ A;  3FF3 A;  2QIR A;  2FT0 A;  1BOB A;  2Q7B A;  2F7V A;  3OWC A;  3IFE A;  3GB0 A;  2Y0M A;  2C6G A;  1HDQ A;  3RYO A;  4ZI6 A;  1KUX A;  3D7D A;  3DSB A;  2QML A;  5HVH A;  4JJX A;  4PPZ A;  1IIC A;  4KUB A;  3DR6 A;  4GXH A;  2CTC A;  3WR7 A;  5A28 A;  2HQY A;  4DJL A;  5DWN A;  2BEI A;  2B58 A;  4NEX A;  4FD5 A;  3D8P A;  3TE4 A;  2XEG A;  5G21 A;  2PJ8 A;  5HVG A;  2FIA A;  3IWG A;  2GFQ A;  1ELL P;  3ZZI A;  2Z3L A;  4H6U A;  5GCN A;  1XMT A;  3KR4 A;  3T8W A;  1BLL E;  1Z4E A;  1CJW A;  2JBK A;  3PFO A;  4Y49 C;  4E0A A;  3N7Z A;  4KSF A;  1FY7 A;  3ZJ0 A;  2CIJ A;  5THW A;  4NGM A;  1MJ9 A;  4PQA A;  4XPD B;  2YNC A;  4DYO A;  2FCK A;  1LAN A;  3KI9 A;  1A2Z A;  1JWQ A;  3L2N A;  5D29 A;  4B5O A;  3G3S A;  2Z3M A;  4NGS A;  1KZF A;  2PE3 A;  3BI1 A;  3F5B A;  2JBJ A;  2G0B A;  4HNX B;  3S6G A;  3TT2 A;  3WAB A;  1VIX A;  5BWA B;  3FEC A;  3MRU A;  5CBM A;  5EBV A;  1CM0 A;  2ZEM A;  3I1U A;  4I49 A;  4OKO A;  3H8G A;  2BOA A;  1WWZ A;  5LYD A;  3LD2 A;  2GRE A;  4MHN A;  2DPT A;  3N5F A;  3RO0 A;  1TF9 A;  3LWU A;  4II9 A;  4KOU A;  1YRE A;  4MY3 A;  4BD9 A;  4BBH A;  2B4D A;  2QEC A;  1I12 A;  4MCR A;  1YSJ A;  1Z8X A;  2QJ8 A;  4IHM A;  2Z10 A;  2G9D A;  3NH5 A;  4R8F A;  4Q36 A;  1XFO A;  3FIX A;  1M4I A;  4B10 A;  3PP9 A;  1YVO A;  2Q0Y A;  1P4N A;  2EBJ A;  2NSM A;  5JQ4 A;  1QSR A;  5K8M A;  4ONW A;  2P6E A;  1ZG7 A;  2Q44 A;  3B7I A;  1JQG A;  3TO9 A;  3VWD A;  1CPX A;  5J8C A;  1S7F A;  4CS0 B;  5HXD A;  4FUU A;  2BO9 A;  1IY7 A;  3D4U A;  3SJF A;  1TKF A;  4OME A;  3S9N A;  3PB9 X;  5H86 A;  4AG9 A;  2J9A A;  2G3T A;  4L89 A;  1NSA A;  1VHE A;  4R7M A;  4AXV A;  2YNE A;  3G8W A;  1SQH A;  4R6T A;  1Y7E A;  3SJG A;  4NF1 A;  2OZU A;  3LOD A;  4R9M A;  4YWY A;  4EVY A;  3NH8 A;  1KWM A;  2ZPA A;  2D4O A;  4U5Y A;  4AVB A;  3P2H A;  2PVW A;  4L8A A;  4CPA A;  2WYR A;  4HPS A;  2PJ9 A;  3PB7 X;  4Q38 A;  3TX8 A;  5JM6 A;  4R3L A;  2C27 A;  1YW6 A;  3GUX A;  3GIU A;  4TNU A;  5ELY A;  5IX3 A;  1LFW A;  3LMS A;  2J8N A;  4P4I A;  5JH9 A;  2AFM A;  4AVC A;  4E8O A;  4UEE A;  4A32 A;  3IWE A;  2FVG A;  1IU8 A;  2DEA A;  3IIB A;  1ZLI A;  3DR8 A;  1QSO A;  3V8I A;  5J1Q A;  3TO6 A;  3DLJ A;  3NE8 A;  3KGQ A;  4C7H A;  3PRT A;  3TFY A;  2ZEG A;  1LAM A;  4EWT A;  1TKJ A;  2R8V A;  4PXC A;  2HB6 A;  3PB6 X;  3EO4 A;  4K30 A;  5KTA A;  4JZ0 A;  2PRQ A;  4JD6 A;  1X12 A;  2V8H A;  1Q2Y A;  3IO1 A;  4P4B A;  3SXN A;  1Q7L A;  4B14 A;  1AYE A;  4CYN A;  4OAD A;  4MHD A;  5D8N A;  4A95 A;  4TWE A;  8CPA A;  5HH1 A;  3NA6 A;  4UEF A;  1F2O A;  4IF5 A;  3IJ3 A;  5E96 A;  4P4D A;  1QQ9 A;  1EE3 P;  3CDX A;  3RZA A;  4UIA A;  3D2P A;  3SJE A;  4P4F A;  1B87 A;  3HLP A;  4H6Z A;  4A31 A;  2ZW6 A;  3B3S A;  4MI4 A;  4OAE A;  5F49 A;  4PK2 A;  1DTD A;  4A30 A;  5K8O A;  1ZG9 A;  2IQ6 A;  3BLN A;  1BO4 A;  4NFR A;  4DNC A;  1QMU A;  2Q04 A;  2Z3N A;  2O53 A;  4NJR A;  4XPL A;  4KUA A;  2G3A A;  4PSX A;  4F0Y A;  3QAY A;  1FNO A;  4ZBG A;  3V38 A;  4B13 A;  5DWM A;  1IID A;  4G1P A;  2ODF A;  1Z8T A;  4ZY1 A;  4MMO A;  3SXO A;  1F2P A;  3WC7 A;  2A4N A;  1YW4 A;  3IC1 A;  5AG7 A;  2Q4Z A;  2VL1 A;  2XEJ A;  4O23 A;  3E0K A;  4KOX A;  3IEH A;  2ZEH A;  2P6F A;  2WUU A;  2Q51 A;  3H5Z A;  5K8P A;  2WSA A;  2FS5 A;  3QNV A;  2AFX A;  5AG6 A;  1MJB A;  2RFH A;  1ELM P;  4KVM E;  2EK8 A;  2PSW A;  2RB7 A;  2POK A;  4HKF A;  4C68 A;  4ZGY B;  2AFU A;  1XBU A;  2ZOF A;  3QB8 A;  4R57 A;  4BMH A;  1P0H A;  1YGH A;  4R87 A;  2I00 A;  4M6G A;  2PJ4 A;  4MCS A;  1LRZ A;  1U6M A;  3IWW A;  1OBR A;  3D7F A;  3S6K A;  1QSN A;  1TXR A;  4YGO A;  1IYL A;  4KOW A;  4U9Z A;  4PXD A;  3VAT A;  4MY0 A;  3RAM A;  5F46 A;  2I3C A;  2Q4Y A;  3TOA A;  2B5G A;  2HV2 A;  3R1K A;  1QSM A;  5IV0 A;  4KZT A;  1ARM A;  4OLL A;  1CG2 A;  2C6P A;  4QUS A;  2AE6 A;  3S9M A;  3B3W A;  2PJC A;  3KQZ A;  4MBU A;  3RBU A;  2ARH A;  1Z4R A;  2PJ5 A;  5AG4 A;  1YR0 A;  2JEV A;  3K9U A;  2O28 A;  2PJ6 A;  3F8K A;  3PFE A;  4NGP A;  4ZYQ A;  2DF5 A;  1IOF A;  2IJZ A;  4B12 A;  5DS0 A;  3FH4 A;  4ORF A;  4PV6 A;  5K8N A;  3C26 A;  4KOR A;  1CP7 A;  4XNH C;  3A9L A;  2VZY A;  1IOI A;  2VXK A;  2F8H A;  2VQY A;  1IYK A;  1S7K A;  2B5G B;  5IB0 A;  3KKW A;  5HMN A;  3BJ8 A;  2KCW A;  2H5M A;  4NCZ A;  1CP6 A;  1VHS A;  4P4E A;  3QAH A;  5F48 A;  1J4J A;  4NGN A;  1Z5R A;  4XPD C;  1H8L A;  3IU2 A;  1XF8 A;  3VAR A;  2C1C A;  1KUY A;  3KQX A;  5J8F A;  4U9Y A;  4KS9 A;  4CAE A;  4FBE A;  1Z9U A;  3S9L A;  3TTH A;  3D68 A;  1RO5 A;  1I1D A;  2OH1 A;  2BUE A;  3EC4 A;  2J8M A;  4KSI A;  4E2A A;  1Q2D A;  2J8R A;  4F0X A;  4IK2 A;  7CPA A;  2ABZ A;  1GHE A;  3VWE A;  1M1D A;  4KOT A;  2JDD A;  2PJA A;  3MGD A;  3D7G A;  4P4J A;  3KAS A;  4UF4 A;  2REF A;  1TF8 A;  2EO8 A;  4CGN A;  4FAI A;  1OZP A;  2AFO A;  4RI1 A;  2FSR A;  3D2M A;  4P6Y A;  4JLY A;  3WC5 A;  3K2K A;  4A94 A;  4B5P A;  4UFV A;  1F57 A;  2YNC C;  1CX8 A;  2PJ2 A;  4NSQ A;  4Q7A A;  2VZZ A;  1XMB A;  3W6S A;  4RN7 A;  3PGP A;  3FED A;  4X5K A;  3GYA A;  3NH4 A;  4OP4 A;  3BHX A;  1NE9 A;  4PSW A;  2ZW5 A;  2FE7 A;  2FL4 A;  1BPM A;  1ZG8 A;  3SI0 A;  2CNS A;  4UCP A;  5LYI A;  4C2Z A;  3K9T A;  2GAN A;  4K3N A;  1XIX A;  4MFL A;  3KR5 A;  3FYN A;  2IL4 A;  4B6Z A;  4EFD A;  4CGL A;  2V8V A;  1LCP A;  2PRB A;  1BAV A;  4IUS A;  4B5P B;  3V7Z A;  4CAF A;  2DXQ A;  4R3K A;  4UCN A;  2R7H A;  4RS2 A;  3T9Y A;  4DUK A;  4H2K A;  2R98 A;  1HDU A;  3ISZ A;  3PZJ A;  1Z8W A;  5AG5 A;  5G1Z A;  4LQG A;  3S6F A;  4AB7 A;  4GS4 A;  3I3G A;  3D7H A;  2XEF A;  3FRM A;  4GM5 A;  4ZX8 A;  2ZEO A;  4ONU A;  1FT7 A;  1Y0R A;  2B3U A;  3R96 A;  2QYV A;  1X10 A;  5AGE A;  3W91 A;  4UBR A;  5I4M A;  4NJQ A;  5C82 A;  4KVX A;  1XEB A;  2QVP A;  4LX9 A;  4QB9 A;  3JRU A;  5IB9 A;  3B3T A;  2AFW A;  3JUW A;  5KTD A;  5JPH A;  4C2Y A;  3FVL A;  3FX6 A;  4FD6 A;  4OC5 A;  4X8I A;  1YQE A;  2IMO A;  4OC4 A;  4C2X A;  1XOV A;  1YLO A;  5A27 A;  4KLV A; 
#chains in the Genus database with same CATH homology
 2WZN A;  4ZY0 A;  2PJ0 A;  2ZEE A;  1XRY A;  1RTQ A;  3FJU A;  3PB8 X;  2OOT A;  3SI2 A;  3FMC A;  2ZEN A;  4WWV A;  3KHZ A;  1PCA A;  5LYL A;  2PJ1 A;  3ISX A;  2PVV A;  4R76 A;  3VH9 A;  6CPA A;  3B3V A;  3SI1 A;  4OIW A;  4P10 A;  1YME A;  2PCU A;  1LOK A;  2GLF A;  3BI0 A;  2EWB A;  1DE4 C;  2O4H A;  4F9V A;  2PJ7 A;  2V8D A;  4NGR A;  2Q43 A;  4OC1 A;  1CPS A;  4X3R A;  1TKH A;  2ZED A;  3PB4 X;  1VGY A;  4RUH A;  5F09 A;  2PIY A;  4OC2 A;  3KZW A;  3PBB A;  4UIB A;  2PJB A;  4MCP A;  4NGQ A;  4P45 A;  3WC6 A;  2NYQ A;  3H8F A;  4UEZ A;  1ZLH A;  3D66 A;  3CPA A;  1R3N A;  3BXM A;  3TC8 A;  1XJO A;  2ZEP A;  1AMP A;  2AFS A;  5LRK A;  4MHP A;  1IGB A;  3D67 A;  4Z65 A;  4X2T A;  5LRG A;  1M4L A;  2PJ3 A;  4MXU A;  2ZEF A;  4MHY A;  3PBE A;  2OR4 A;  2CTB A;  1Y0Y A;  3GLJ A;  2GLJ A;  5LRJ A;  3HUV A;  4A37 A;  4A39 A;  2ZEL A;  1Z2L A;  1LAP A;  1PYT B;  2ZOG A;  4A38 A;  4IAV A;  5JGF A;  3KL9 A;  4ZX9 A;  4EME A;  4MCQ A;  2AFZ A;  4OC3 A;  3H8E A;  2BCO A;  2V77 A;  5HVF A;  4FWU A;  3NFZ A;  4F9U A;  1R43 A;  3CPX A;  4JYW A;  1ARL A;  4MHZ A;  4MRI A;  2JEW A;  1CBX A;  1Z8L A;  2GU2 A;  3DGV A;  4P44 A;  3PEI A;  4PXE A;  1BPN A;  3MN8 A;  4NGT A;  4OID A;  3CT9 A;  4OC0 A;  1VHO A;  4F8Z A;  4WJB A;  2EK9 A;  1HEE A;  3KHX A;  4PXB A;  3B35 A;  2V8G A;  2CF4 A;  4W9Y A;  4ZY2 A;  2C6C A;  2XEI A;  3SJX A;  1GYT A;  5CPA A;  3FEE A;  2ANP A;  3B3C A;  5LYF A;  3B2Y A;  2PIZ A;  4YU9 A;  1UWY A;  2HC9 A;  3WT4 A;  3FF3 A;  2F7V A;  3IFE A;  3GB0 A;  2C6G A;  1HDQ A;  4ZI6 A;  3D7D A;  5HVH A;  4PPZ A;  2CTC A;  4DJL A;  2XEG A;  2PJ8 A;  5HVG A;  1ELL P;  3KR4 A;  3T8W A;  1BLL E;  2JBK A;  3PFO A;  2CIJ A;  5THW A;  4NGM A;  4PQA A;  4DYO A;  1LAN A;  3KI9 A;  5D29 A;  3L2N A;  4NGS A;  3WAB A;  2PE3 A;  3BI1 A;  2JBJ A;  1VIX A;  3FEC A;  3MRU A;  5CBM A;  5LYD A;  2ZEM A;  3I1U A;  4OKO A;  3H8G A;  2BOA A;  2GRE A;  4MHN A;  3N5F A;  1TF9 A;  3LWU A;  4BD9 A;  4MCR A;  1YSJ A;  2QJ8 A;  4IHM A;  2G9D A;  3NH5 A;  4R8F A;  1XFO A;  2NSM A;  5K8M A;  4ONW A;  1ZG7 A;  3B7I A;  1JQG A;  1CPX A;  5HXD A;  4FUU A;  2BO9 A;  1IY7 A;  3D4U A;  3SJF A;  1TKF A;  4OME A;  3S9N A;  3PB9 X;  2J9A A;  1NSA A;  1VHE A;  4R7M A;  4AXV A;  4R6T A;  1Y7E A;  3SJG A;  4YWY A;  3NH8 A;  1KWM A;  2PVW A;  2WYR A;  2PJ9 A;  3PB7 X;  3TX8 A;  5JM6 A;  1YW6 A;  3GUX A;  4TNU A;  5ELY A;  5JH9 A;  1LFW A;  3LMS A;  4P4I A;  2AFM A;  4UEE A;  2FVG A;  2DEA A;  3IIB A;  1ZLI A;  5J1Q A;  3DLJ A;  3KGQ A;  3PRT A;  2ZEG A;  1LAM A;  4EWT A;  1TKJ A;  4PXC A;  2HB6 A;  3PB6 X;  4JZ0 A;  2PRQ A;  2V8H A;  3IO1 A;  4P4B A;  1Q7L A;  1AYE A;  5D8N A;  8CPA A;  3NA6 A;  4UEF A;  1F2O A;  3IJ3 A;  4P4D A;  1QQ9 A;  1EE3 P;  3CDX A;  3RZA A;  4UIA A;  3SJE A;  4P4F A;  3HLP A;  3B3S A;  1DTD A;  1ZG9 A;  2IQ6 A;  4NFR A;  1QMU A;  2O53 A;  4NJR A;  1FNO A;  3V38 A;  4G1P A;  4MMO A;  1F2P A;  3WC7 A;  1YW4 A;  3IC1 A;  2Q4Z A;  4O23 A;  2VL1 A;  2XEJ A;  3IEH A;  2ZEH A;  2Q51 A;  5K8P A;  3QNV A;  2AFX A;  2RFH A;  1ELM P;  2EK8 A;  2RB7 A;  2POK A;  2AFU A;  2ZOF A;  1XBU A;  2PJ4 A;  4MCS A;  3IWW A;  1OBR A;  3D7F A;  1TXR A;  4PXD A;  3VAT A;  3RAM A;  2I3C A;  1ARM A;  1CG2 A;  2C6P A;  3S9M A;  3B3W A;  2PJC A;  3KQZ A;  3RBU A;  2PJ5 A;  2PJ6 A;  4ZYQ A;  3PFE A;  4NGP A;  2IJZ A;  5K8N A;  5DS0 A;  3FH4 A;  1CP7 A;  2F8H A;  1CP6 A;  4P4E A;  4NGN A;  1Z5R A;  1H8L A;  3VAR A;  2C1C A;  3KQX A;  4FBE A;  3S9L A;  3D68 A;  4KSI A;  4IK2 A;  7CPA A;  2ABZ A;  2PJA A;  4FAI A;  3D7G A;  4P4J A;  3KAS A;  4UF4 A;  1TF8 A;  2AFO A;  4P6Y A;  3WC5 A;  3K2K A;  4A94 A;  1F57 A;  1CX8 A;  2PJ2 A;  4Q7A A;  1XMB A;  3FED A;  3NH4 A;  4OP4 A;  3BHX A;  1BPM A;  1ZG8 A;  3SI0 A;  5LYI A;  3K9T A;  4K3N A;  3KR5 A;  4B6Z A;  4EFD A;  2V8V A;  1LCP A;  1BAV A;  3V7Z A;  4DUK A;  4H2K A;  3ISZ A;  1HDU A;  4CPA A;  4ZY1 A;  4LQG A;  3D7H A;  2XEF A;  4ZX8 A;  4GM5 A;  2ZEO A;  1FT7 A;  1Y0R A;  5K8O A;  5I4M A;  2QYV A;  4NJQ A;  2QVP A;  3JRU A;  5IB9 A;  3B3T A;  2AFW A;  3FVL A;  3FX6 A;  4OC5 A;  4X8I A;  2IMO A;  4OC4 A;  1YLO A;  4TWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...