2ZEFA

Crystal structure of the human glutaminyl cyclase mutant e201d at 1.67 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGDEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zefA00
2AFSA 2PJ3A 3SJFA 4ZYQA 2GLFA 2OOTA 4ONWA 1CPSA 4NGNA 5LRJA 7CPAA 2XEJA 5LYIA 2NYQA 4AXVA 4B6ZA 4OC2A 4P45A 4F8ZA 1VGYA 3H8EA 1LFWA 1YSJA 1BAVA 5D8NA 3RAMA 2WYRA 4LQGA 4F9UA 4MCQA 4P4EA 1ARLA 3FVLA 2ZEMA 4F9VA 3CPAA 3L2NA 4ZY1A 1YW4A 4MCSA 3RZAA 4UEEA 1AYEA 3PB4X 4YWYA 4NGQA 3B3CA 3D66A 4PXDA 2GU2A 2JBJA 1CG2A 4OKOA 5I4MA 1FNOA 3IEHA 3PB7X 1XJOA 1AMPA 2JEWA 3ISXA 2C6CA 3PB6X 1YMEA 2Q43A 2ZEEA 2ABZA 3BXMA 3KHXA 3FH4A 3FMCA 3H8GA 1QQ9A 1ZG8A 1ARMA 3ISZA 2F7VA 4FUUA 2PJ6A 4MHPA 4A38A 6CPAA 4K3NA 4DJLA 4EWTA 4KSIA 1LCPA 2BOAA 3PFEA 2ZELA 2PJ8A 3DGVA 1R43A 3MN8A 1PCAA 1H8LA 3FECA 1IY7A 3VATA 4MXUA 3V38A 4MMOA 2IMOA 2C6GA 2PJ9A 2POKA 3LWUA 3N5FA 2EK8A 5LYDA 2C1CA 3KQXA 2PJ5A 4PXBA 2J9AA 4UEFA 2O53A 4FAIA 4R7MA 1Y0RA 3H8FA 4IK2A 3PBEA 5HVFA 3SJGA 1CP7A 1CX8A 1CBXA 8CPAA 4NGMA 2EWBA 3I1UA 1PYTB 1F57A 2AFZA 2Q4ZA 5J1QA 4RUHA 5LRGA 5JH9A 4MHYA 4UEZA 1LANA 4O23A 3B3WA 4OC1A 1CP6A 4A39A 4P6YA 3FEDA 2CIJA 2ZEFA 3SJEA 2RFHA 3BI1A 4IAVA 2ANPA 3DLJA 1QMUA 4A94A 1TF9A 3B3SA 3KZWA 4CPAA 3WABA 3KI9A 3B35A 1M4LA 3KL9A 3B3TA 4G1PA 3FEEA 3HLPA 4MHNA 3IWWA 5JGFA 2ZEHA 2PRQA 2FVGA 4NGPA 3BI0A 3IC1A 3FF3A 1HEEA 1R3NA 4EMEA 3GUXA 1VHOA 2GLJA 2QVPA 5K8MA 3D7DA 5D29A 4OIDA 1Q7LA 3D7FA 4Z65A 3CDXA 3D4UA 1KWMA 3NA6A 3S9NA 4R8FA 4P4IA 2ZEOA 1TF8A 2AFXA 2GREA 4GM5A 4ZX8A 1F2OA 2ZEDA 1HDUA 4PQAA 3WC5A 3GB0A 2I3CA 4EFDA 4NGSA 4P4DA 2AFUA 4BD9A 2QJ8A 1CPXA 3T8WA 3KHZA 3CPXA 3SI1A 4H2KA 2PVVA 1OBRA 1GYTA 3JRUA 2V8VA 4TNUA 2AFOA 1XFOA 1XBUA 2F8HA 3IJ3A 4ZY0A 4TWEA 4R76A 5THWA 4OMEA 1DTDA 3FX6A 3QNVA 2PCUA 4WJBA 2ZOGA 1VHEA 2V8DA 1Z8LA 1ZLHA 1Z2LA 4OC0A 1BPNA 4MHZA 1TXRA 1VIXA 3WT4A 4PPZA 1BLLE 2EK9A 2CF4A 2ZENA 2CTBA 2IJZA 4A37A 1FT7A 2CTCA 2PJBA 3WC7A 5ELYA 2ZOFA 2PJCA 5K8OA 3NFZA 5F09A 1XMBA 1F2PA 2QYVA 4DUKA 2PJ7A 4OIWA 3HUVA 3S9LA 1ZG7A 3TC8A 1YW6A 2DEAA 4P4JA 4X3RA 2PVWA 3PRTA 3B2YA 2AFMA 2PJ4A 3D67A 1Y7EA 2HB6A 3FJUA 4OC4A 1LAPA 1Z5RA 3CT9A 2O4HA 3KGQA 4W9YA 4ZY2A 5K8PA 4MCPA 2V77A 4PXCA 3K9TA 3GLJA 2VL1A 3SI2A 4X2TA 3B7IA 5JM6A 3IIBA 4X8IA 4ZX9A 5IB9A 3LMSA 1NSAA 2BO9A 5HXDA 2WZNA 2ZEPA 3IFEA 1XRYA 2PE3A 3VARA 4FWUA 1IGBA 5HVHA 2HC9A 2IQ6A 4NJRA 3WC6A 2PJ0A 3RBUA 2C6PA 3MRUA 1UWYA 3BHXA 3PFOA 4Q7AA 3D68A 3NH4A 3D7HA 3TX8A 2PJ2A 4MRIA 4NGRA 3KR4A 1TKHA 5DS0A 2PIYA 3KQZA 2OR4A 4ZI6A 5LYLA 1TKFA 4UF4A 5CPAA 2AFWA 1ELLP 2RB7A 5HVGA 2ZEGA 2XEIA 2V8HA 3KASA 2G9DA 3SJXA 4NFRA 1HDQA 3S9MA 4OP4A 1DE4C 1TKJA 4P44A 3K2KA 4IHMA 2V8GA 4UIAA 3SI0A 5CBMA 3D7GA 1EE3P 2XEFA 4UIBA 1RTQA 5LRKA 4P4BA 4NGTA 4P10A 1YLOA 3PEIA 3KR5A 2PIZA 4R6TA 3PB8X 1BPMA 3PBBA 3NH8A 4YU9A 1ZG9A 1ELMP 1LAMA 1Y0YA 5K8NA 4MCRA 3IO1A 3B3VA 2PJAA 1JQGA 1LOKA 4P4FA 3VH9A 2XEGA 1ZLIA 4NJQA 2NSMA 3PB9X 4OC5A 4JYWA 4WWVA 4DYOA 5LYFA 4JZ0A 3V7ZA 2BCOA 2PJ1A 4FBEA 4OC3A 2JBKA 3NH5A 4PXEA 2Q51A
chains in the Genus database with same CATH superfamily
2AFSA 2PJ3A 3W91A 2G3TA 3SJFA 4ZYQA 2GLFA 2OOTA 4ONWA 1A2ZA 5EMIA 4KOSA 1CPSA 1L0CA 4NGNA 5LRJA 3D8PA 3R95A 7CPAA 2Z11A 2XEJA 3JVNA 4Q38A 2NYQA 5LYIA 3DR6A 4AXVA 4B6ZA 1Y9WA 2HUZA 4OC2A 4P45A 5A28A 3CZXA 4JD6A 4F8ZA 2K5TA 1VGYA 5J8CA 1WK4A 2RC4A 3F8KA 3H8EA 4A32A 1LFWA 1S60A 4XNHB 1YK3A 1YSJA 2B5GB 1BAVA 5D8NA 4UWJA 2FS5A 4PK2A 3RAMA 2HQYA 2WYRA 4LQGA 4F9UA 4MCQA 4P4EA 3D2MA 1ARLA 3FVLA 4EVYA 3SHPA 3W6SA 3EY5A 2ZEMA 4YRHA 4F9VA 2CY2A 5IB0A 2B3UA 1ZO0A 4FD6A 2R98A 3CPAA 4HKFA 2Z10A 2PRBA 4KOYA 3L2NA 3TO7A 4ZY1A 1YW4A 4MCSA 3RZAA 4LX9A 4UEEA 1AYEA 1BOBA 3FBUA 1SQHA 3PB4X 4HNWB 4YWYA 3TE4A 4NGQA 3B3CA 1MK4A 4M85A 3D66A 4PXDA 4JWPA 2GU2A 4UFWA 2D4OA 1CG2A 2JBJA 4OLLA 4OKOA 5I4MA 5HH1A 3E0KA 1FNOA 1Z8TA 2VQYA 3IEHA 3PB7X 5EC4A 2B4BA 4Y49B 3BJ8A 2B4DA 3H4QA 3VWEA 1XJOA 4CYOA 1CJWA 1AMPA 3NH5A 4UA3A 4QVTA 4XPDC 2AJ6A 2JEWA 2Q7BA 2OB0A 3ISXA 2C6CA 3PB6X 1RXTA 1YMEA 2Q43A 2ZEEA 3ZJ0A 4JXQA 2ABZA 2J8RA 3BXMA 2GFQA 3FH4A 3FMCA 3KHXA 3H8GA 1QQ9A 1BO4A 1XF8A 1ZG8A 4MI4A 3TT2A 1ARMA 3ISZA 4AG7A 3FIXA 2F7VA 5E96A 4FUUA 1KUVA 2PJ6A 4MHPA 3SXOA 3DR8A 4A38A 6CPAA 2NMTA 4K3NA 2VZYA 3IWGA 4KSFA 4R3LA 3TFYA 4DJLA 4EWTA 4KSIA 3D3SA 4E0AA 1S7KA 1LCPA 5CPAA 2BSWA 2BOAA 3PFEA 2G3AA 2ZELA 2PJ8A 3DGVA 4AVAA 1R43A 3MN8A 1PCAA 3R9FA 1H8LA 1IYLA 3FNCA 3V8IA 3FECA 3QAYA 1IY7A 4B12A 4UFVA 3VATA 4CAVA 5ISVA 2WUUA 2FE7A 4MXUA 4KLWA 3BJ7A 3V38A 3K9UA 1V0CA 2IMOA 4MMOA 2C6GA 4R9MA 4A31A 3T9YA 2QIRA 2PJ9A 2POKA 4UFXA 3LWUA 4KLVA 3N5FA 2IL4A 3IGRA 4RI1A 2EK8A 5LYDA 2Z3LA 3ZZIA 2WPXA 2C1CA 3KQXA 2FIAA 2PJ5A 4PXBA 2YNEA 2J9AA 4CRZB 4UEFA 4AVCA 2O53A 2VXKA 4FAIA 4KOTA 4R7MA 1Y0RA 2O28A 3H8FA 4IK2A 3PBEA 4FD5A 5HVFA 4A95A 2CNTA 2FT0A 2CNMA 2P0WA 3SJGA 4B5PA 4KVME 1CP7A 2X7BA 1CX8A 1VKCA 1Y7RA 1CBXA 2B5GA 3CXQA 8CPAA 4NGMA 2EWBA 3I1UA 1PYTB 1F57A 2AFZA 3RO0A 2Q4ZA 5J1QA 1XIXA 1P4NA 5LRGA 2B3VA 4MHYA 4UEZA 4RUHA 1LANA 1KUXA 2FL4A 5JH9A 4L89A 2ZPAA 4O23A 3B3WA 4OC1A 3LACA 4JXRA 5F48A 1CP6A 4A39A 4P6YA 3FEDA 1WWZA 2CIJA 3H5ZA 3RNZA 2ZEFA 2WPWA 1Z8XA 4R87A 3SJEA 2RFHA 5IV0A 3BI1A 4IAVA 2H5MA 2ANPA 3DLJA 1QMUA 3DNSA 4A94A 1TF9A 3B3SA 3KZWA 4CPAA 3WABA 1IYKA 3KI9A 4MBUA 2WSAA 4PSXA 3B35A 1M4LA 4CGPA 4II9A 2P6EA 3KL9A 4E2AA 3JUWA 3B3TA 3S6KA 3CXSA 4G1PA 1M44A 4KUAA 3FEEA 1M1DA 4X5KA 2FCKA 2D4PA 3HLPA 4MY3A 4CAWA 4MHNA 3BLNA 2ZW4A 3IWWA 1YR0A 2GIVA 3F0AA 4LUAA 3NE7A 4B5PB 2ZEHA 2PRQA 4I49A 5JGFA 2FVGA 4NGPA 3BI0A 5C88A 1YX0A 3IC1A 4MFPA 3FF3A 1NE9A 1HEEA 3UY5A 1PUAA 1R3NA 4QB9A 5DWMA 4EMEA 5C82A 3GUXA 1U6MA 1VHOA 5F49A 3FYNA 5JQ4A 2GLJA 2GANA 2QVPA 4M6GA 5EBVA 5K8MA 3D7DA 5D29A 4OIDA 1Q7LA 3D7FA 1ON0A 4Z65A 1YREA 3CDXA 3R1KA 1S7NA 3D4UA 1KWMA 3S6FA 3NA6A 4NSQA 1QSNA 1UFHA 1XE4A 5J8FA 3S9NA 4R8FA 3G8WA 4P4IA 2PC1A 5CNPA 4B14A 3R96A 5HMNA 2ZEOA 1TF8A 1S3ZA 2KCWA 2AFXA 2ZXVA 2GREA 4GM5A 4ZX8A 2QECA 4CYNA 2YNCC 1F2OA 2ZEDA 1HDUA 1YLEA 1KUYA 4KSAA 4PQAA 3WC5A 3GB0A 2I3CA 1I21A 4MFQA 1YQEA 2EVNA 4EFDA 4NGSA 4P4DA 2FXFA 4PK3A 4U9YA 1J4JA 3S6HA 5AGEA 2AFUA 4XPDB 4BD9A 3IU2A 4CGLA 4RN7A 4AB7A 2QJ8A 1CPXA 3T8WA 3KHZA 4GXHA 3PZJA 3CPXA 2Z3PA 4BBHA 2ODFA 4Y49C 2OZHA 4M6IA 2FSRA 3SI1A 4C2YA 4H2KA 2PVVA 4YFJA 1Z8WA 4TNUA 1OBRA 4PXEA 1GYTA 3JRUA 2V8VA 2VZZA 2BEIA 2AFOA 1Y9KA 1XFOA 1XBUA 1PU9A 4JLYA 2F8HA 3T90A 4MY0A 3IJ3A 5AG6A 4ZY0A 2ATRA 4RS2A 2R8VA 5AG7A 4TWEA 4R76A 5THWA 4ORFA 4OMEA 1DTDA 3FX6A 4BMHA 3QNVA 2PCUA 5FVJA 1B6BA 4IUSA 1IB1E 2Z3MA 2Z3KA 2ZOGA 4WJBA 3W6XA 4A30A 1VHEA 2REEA 4B10A 2V8DA 1Z8LA 1M4GA 5JPHA 1ZLHA 2JLMA 3QAHA 4MFKA 1Z2LA 4OC0A 1BPNA 2I79A 4MHZA 1TXRA 1VIXA 4HNXB 4H6ZA 4F0XA 3IWEA 3TO6A 4CYQA 1CM0A 1MJBA 5KTAA 5G22A 3WT4A 4PPZA 1BLLE 2EK9A 5G1ZA 2CF4A 4E8OA 2ARHA 2ZENA 2CTBA 2IJZA 4XPLA 4A37A 1B87A 1FT7A 2F5IA 3B8GA 3RYOA 5F46A 2CTCA 1AUGA 2PJBA 3EC4A 4QUSA 1YGHA 4KZTA 1YVOA 5G21A 3WC7A 1Z4EA 4FD7A 5ELYA 2ZOFA 2PJCA 4K30A 4U5YA 3TOAA 2PDOA 2PQ8A 2Q4VA 4M6HA 3NFZA 4AG9A 3KKWA 5F09A 5K8OA 1XMBA 2Z0ZA 1F2PA 3OWCA 3GIUA 3FRMA 2QYVA 2YNDA 4DUKA 4MJ8A 5BWAB 2PJ7A 4OIWA 3JTKA 4IF5A 5AG5A 3HUVA 4YGOA 4UCNA 5AG4A 1ZG7A 2PR1A 2R1IA 1YW6A 3TC8A 3LODA 3S9LA 2DEAA 3LD2A 4FD4A 4P4JA 2PVWA 4X3RA 4UCMA 4CYPA 3PRTA 3B2YA 3QB8A 2AFMA 2PJ4A 2OH1A 3D67A 4GS4A 1Y7EA 2HB6A 4F6AA 4J3GA 3FJUA 3GY9A 4OC4A 1LAPA 1Z5RA 3CT9A 2O4HA 3KGQA 1OZPA 4W9YA 1TIQA 4KUBA 1IOFA 4ZY2A 5K8PA 4MCPA 1IOIA 1RO5A 2V77A 2OZGA 3GKRA 3K9TA 4PXCA 3VWDA 3I3GA 3GLJA 4QBJA 2VL1A 3SI2A 4MFZA 4X2TA 3B7IA 2CXAA 3EO4A 3I9SA 4H89A 5JM6A 3IIBA 3MGDA 4X8IA 3IU1A 3FXTA 4ZX9A 5IB9A 3LMSA 4XNHC 4CGNA 1NSAA 2BO9A 5HXDA 2A4NA 2WZNA 2GE3A 2ZEPA 3IFEA 1XRYA 2Y0MA 5DWNA 4KOXA 4M3SA 3EFAA 5G20A 4C68A 2J8MA 2AE6A 2PE3A 4XPKA 3VARA 4MFLA 4FWUA 4KVOE 4R3KA 1Q2CA 1IGBA 1N71A 1M4DA 4ZBGA 3R9EA 5HVHA 2HC9A 3NE8A 5H86A 2IQ6A 4C2ZA 4NJRA 3WC6A 4ZGYB 5KTCA 2PJ0A 4R57A 3RBUA 2G0BA 2C6PA 1IU8A 3R9GA 3MRUA 5GCNA 4NEXA 1UWYA 2Q0YA 3BHXA 3PFOA 4HPSA 4Q7AA 2EO8A 1M4IA 4KOVA 5H84A 3D68A 3NH4A 3PGPA 1QSTA 5I0CA 1MJAA 3D7HA 3P2HA 2Z3OA 4PSWA 3D2PA 3TCVA 4LQ6A 4A2ZA 3TX8A 1XEBA 2B58A 2PJ2A 1P0HA 2BUEA 4MRIA 5A27A 4NGRA 4ONUA 4U9ZA 4PV6A 1X12A 3KR4A 1TKHA 2BL1A 2VBQA 2ZW5A 5DS0A 2PIYA 4CAFA 1Z9UA 3KQZA 4KORA 4UBRA 3SXNA 2OR4A 4ZI6A 3PP9A 5LYLA 4UCPA 4KOWA 1TKFA 4HNYB 4UF4A 4UWIA 2Q44A 1IICA 4Q36A 2AFWA 4NXYA 1I1DA 2REFA 1ELLP 2Q7SA 2RB7A 2HV2A 3P2FA 1FY7A 5F47A 4H6UA 5HVGA 2ZW6A 2ZEGA 2XEIA 2PR8A 2Q4YA 2OZUA 2V8HA 2VEZA 3KASA 2DPSA 2FIWA 1S7LA 2I00A 1Z4RA 2P6FA 1X10A 2G9DA 3SJXA 1S5KA 2CNSA 4NFRA 1NMTA 1KZFA 1HDQA 4OP4A 3S9MA 1IIDA 1DE4C 4BINA 4CAXA 1QSRA 4B13A 3TO9A 4NCZA 3S6GA 4CRYB 2P6GA 2JEVA 3FB3A 1TKJA 4QC6A 3EXNA 4P44A 3K2KA 2DPTA 4IHMA 2Q04A 2V8GA 3CXPA 4UIAA 3SI0A 4DNCA 2R7HA 3D7GA 5CBMA 4KVXA 4OADA 1EE3P 2XEFA 4UIBA 1RTQA 1NSLA 5LRKA 2B4DB 4F0YA 4P4BA 3A9LA 4NF1A 4NGTA 4P10A 1YLOA 1YVKA 3PEIA 3KR5A 2PIZA 4R6TA 2JDDA 2YGWA 3N7ZA 1QSMA 1GHEA 3PB8X 1BPMA 3DSBA 1R57A 1Q2YA 3PBBA 3TOBA 2DF5A 4B5OA 4CS0B 3NH8A 4C7HA 2QMLA 1K4JA 4YU9A 4MFJA 3DDDA 1ZG9A 1ELMP 1LAMA 2OU2A 5IX3A 4C2XA 1Y0YA 5K8NA 4MCRA 1VHSA 1MJ9A 1XOVA 3IO1A 3B3VA 1LRZA 1JWQA 2PJAA 2PSWA 1JQGA 4JJXA 4L8AA 1QSOA 2DXQA 3F5BA 2EBJA 3TTHA 1LOKA 4P4FA 2VI7A 3VH9A 2XEGA 4CGMA 4CGOA 4C7IA 5KTDA 2EUIA 4B11A 4A33A 1ZLIA 4NJQA 2NSMA 3PB9X 4OC5A 2JDCA 1S7FA 1XMTA 4JYWA 4WWVA 4DYOA 3WR7A 2ZW7A 3C26A 5LYFA 4JZ0A 3V7ZA 2BCOA 1I12A 2J8NA 3GYAA 4CAEA 2PJ1A 4FBEA 4OAEA 2YNCA 4KOUA 4OC3A 2JBKA 2Z3NA 3G3SA 4AVBA 1Q2DA 2C27A 4MHDA 2Q51A 4KS9A
chains in the Genus database with same CATH topology
2AFSA 2PJ3A 3SJFA 4ZYQA 2GLFA 2OOTA 4ONWA 1CPSA 4NGNA 5LRJA 7CPAA 2XEJA 5LYIA 2NYQA 4AXVA 4B6ZA 4OC2A 4P45A 4F8ZA 1VGYA 3H8EA 1LFWA 1YSJA 1BAVA 5D8NA 3RAMA 2WYRA 4LQGA 4F9UA 4MCQA 4P4EA 1ARLA 3FVLA 2ZEMA 4F9VA 3CPAA 3L2NA 4ZY1A 1YW4A 4MCSA 3RZAA 4UEEA 1AYEA 3PB4X 4YWYA 4NGQA 3B3CA 3D66A 4PXDA 2GU2A 2JBJA 1CG2A 4OKOA 5I4MA 1FNOA 3IEHA 3PB7X 1XJOA 1AMPA 2JEWA 3ISXA 2C6CA 3PB6X 1YMEA 2Q43A 2ZEEA 2ABZA 3BXMA 3KHXA 3FH4A 3FMCA 3H8GA 1QQ9A 1ZG8A 1ARMA 3ISZA 2F7VA 4FUUA 2PJ6A 4MHPA 4A38A 6CPAA 4K3NA 4DJLA 4EWTA 4KSIA 1LCPA 2BOAA 3PFEA 2ZELA 2PJ8A 3DGVA 1R43A 3MN8A 1PCAA 1H8LA 3FECA 1IY7A 3VATA 4MXUA 3V38A 4MMOA 2IMOA 2C6GA 2PJ9A 2POKA 3LWUA 3N5FA 2EK8A 5LYDA 2C1CA 3KQXA 2PJ5A 4PXBA 2J9AA 4UEFA 2O53A 4FAIA 4R7MA 1Y0RA 3H8FA 4IK2A 3PBEA 5HVFA 3SJGA 1CP7A 1CX8A 1CBXA 8CPAA 4NGMA 2EWBA 3I1UA 1PYTB 1F57A 2AFZA 2Q4ZA 5J1QA 4RUHA 5LRGA 5JH9A 4MHYA 4UEZA 1LANA 4O23A 3B3WA 4OC1A 1CP6A 4A39A 4P6YA 3FEDA 2CIJA 2ZEFA 3SJEA 2RFHA 3BI1A 4IAVA 2ANPA 3DLJA 1QMUA 4A94A 1TF9A 3B3SA 3KZWA 4CPAA 3WABA 3KI9A 3B35A 1M4LA 3KL9A 3B3TA 4G1PA 3FEEA 3HLPA 4MHNA 3IWWA 5JGFA 2ZEHA 2PRQA 2FVGA 4NGPA 3BI0A 3IC1A 3FF3A 1HEEA 1R3NA 4EMEA 3GUXA 1VHOA 2GLJA 2QVPA 5K8MA 3D7DA 5D29A 4OIDA 1Q7LA 3D7FA 4Z65A 3CDXA 3D4UA 1KWMA 3NA6A 3S9NA 4R8FA 4P4IA 2ZEOA 1TF8A 2AFXA 2GREA 4GM5A 4ZX8A 1F2OA 2ZEDA 1HDUA 4PQAA 3WC5A 3GB0A 2I3CA 4EFDA 4NGSA 4P4DA 2AFUA 4BD9A 2QJ8A 1CPXA 3T8WA 3KHZA 3CPXA 3SI1A 4H2KA 2PVVA 1OBRA 1GYTA 3JRUA 2V8VA 4TNUA 2AFOA 1XFOA 1XBUA 2F8HA 3IJ3A 4ZY0A 4TWEA 4R76A 5THWA 4OMEA 1DTDA 3FX6A 3QNVA 2PCUA 4WJBA 2ZOGA 1VHEA 2V8DA 1Z8LA 1ZLHA 1Z2LA 4OC0A 1BPNA 4MHZA 1TXRA 1VIXA 3WT4A 4PPZA 1BLLE 2EK9A 2CF4A 2ZENA 2CTBA 2IJZA 4A37A 1FT7A 2CTCA 2PJBA 3WC7A 5ELYA 2ZOFA 2PJCA 5K8OA 3NFZA 5F09A 1XMBA 1F2PA 2QYVA 4DUKA 2PJ7A 4OIWA 3HUVA 3S9LA 1ZG7A 3TC8A 1YW6A 2DEAA 4P4JA 4X3RA 2PVWA 3PRTA 3B2YA 2AFMA 2PJ4A 3D67A 1Y7EA 2HB6A 3FJUA 4OC4A 1LAPA 1Z5RA 3CT9A 2O4HA 3KGQA 4W9YA 4ZY2A 5K8PA 4MCPA 2V77A 4PXCA 3K9TA 3GLJA 2VL1A 3SI2A 4X2TA 3B7IA 5JM6A 3IIBA 4X8IA 4ZX9A 5IB9A 3LMSA 1NSAA 2BO9A 5HXDA 2WZNA 2ZEPA 3IFEA 1XRYA 2PE3A 3VARA 4FWUA 1IGBA 5HVHA 2HC9A 2IQ6A 4NJRA 3WC6A 2PJ0A 3RBUA 2C6PA 3MRUA 1UWYA 3BHXA 3PFOA 4Q7AA 3D68A 3NH4A 3D7HA 3TX8A 2PJ2A 4MRIA 4NGRA 3KR4A 1TKHA 5DS0A 2PIYA 3KQZA 2OR4A 4ZI6A 5LYLA 1TKFA 4UF4A 5CPAA 2AFWA 1ELLP 2RB7A 5HVGA 2ZEGA 2XEIA 2V8HA 3KASA 2G9DA 3SJXA 4NFRA 1HDQA 3S9MA 4OP4A 1DE4C 1TKJA 4P44A 3K2KA 4IHMA 2V8GA 4UIAA 3SI0A 5CBMA 3D7GA 1EE3P 2XEFA 4UIBA 1RTQA 5LRKA 4P4BA 4NGTA 4P10A 1YLOA 3PEIA 3KR5A 2PIZA 4R6TA 3PB8X 1BPMA 3PBBA 3NH8A 4YU9A 1ZG9A 1ELMP 1LAMA 1Y0YA 5K8NA 4MCRA 3IO1A 3B3VA 2PJAA 1JQGA 1LOKA 4P4FA 3VH9A 2XEGA 1ZLIA 4NJQA 2NSMA 3PB9X 4OC5A 4JYWA 4WWVA 4DYOA 5LYFA 4JZ0A 3V7ZA 2BCOA 2PJ1A 4FBEA 4OC3A 2JBKA 3NH5A 4PXEA 2Q51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFS A;  2PJ3 A;  3SJF A;  4ZYQ A;  2GLF A;  2OOT A;  4ONW A;  1CPS A;  4NGN A;  5LRJ A;  7CPA A;  2XEJ A;  5LYI A;  2NYQ A;  4AXV A;  4B6Z A;  4OC2 A;  4P45 A;  4F8Z A;  1VGY A;  3H8E A;  1LFW A;  1YSJ A;  1BAV A;  5D8N A;  3RAM A;  2WYR A;  4LQG A;  4F9U A;  4MCQ A;  4P4E A;  1ARL A;  3FVL A;  2ZEM A;  4F9V A;  3CPA A;  3L2N A;  4ZY1 A;  1YW4 A;  4MCS A;  3RZA A;  4UEE A;  1AYE A;  3PB4 X;  4YWY A;  4NGQ A;  3B3C A;  3D66 A;  4PXD A;  2GU2 A;  2JBJ A;  1CG2 A;  4OKO A;  5I4M A;  1FNO A;  3IEH A;  3PB7 X;  1XJO A;  1AMP A;  2JEW A;  3ISX A;  2C6C A;  3PB6 X;  1YME A;  2Q43 A;  2ZEE A;  2ABZ A;  3BXM A;  3KHX A;  3FH4 A;  3FMC A;  3H8G A;  1QQ9 A;  1ZG8 A;  1ARM A;  3ISZ A;  2F7V A;  4FUU A;  2PJ6 A;  4MHP A;  4A38 A;  6CPA A;  4K3N A;  4DJL A;  4EWT A;  4KSI A;  1LCP A;  2BOA A;  3PFE A;  2ZEL A;  2PJ8 A;  3DGV A;  1R43 A;  3MN8 A;  1PCA A;  1H8L A;  3FEC A;  1IY7 A;  3VAT A;  4MXU A;  3V38 A;  4MMO A;  2IMO A;  2C6G A;  2PJ9 A;  2POK A;  3LWU A;  3N5F A;  2EK8 A;  5LYD A;  2C1C A;  3KQX A;  2PJ5 A;  4PXB A;  2J9A A;  4UEF A;  2O53 A;  4FAI A;  4R7M A;  1Y0R A;  3H8F A;  4IK2 A;  3PBE A;  5HVF A;  3SJG A;  1CP7 A;  1CX8 A;  1CBX A;  8CPA A;  4NGM A;  2EWB A;  3I1U A;  1PYT B;  1F57 A;  2AFZ A;  2Q4Z A;  5J1Q A;  4RUH A;  5LRG A;  5JH9 A;  4MHY A;  4UEZ A;  1LAN A;  4O23 A;  3B3W A;  4OC1 A;  1CP6 A;  4A39 A;  4P6Y A;  3FED A;  2CIJ A;  2ZEF A;  3SJE A;  2RFH A;  3BI1 A;  4IAV A;  2ANP A;  3DLJ A;  1QMU A;  4A94 A;  1TF9 A;  3B3S A;  3KZW A;  4CPA A;  3WAB A;  3KI9 A;  3B35 A;  1M4L A;  3KL9 A;  3B3T A;  4G1P A;  3FEE A;  3HLP A;  4MHN A;  3IWW A;  5JGF A;  2ZEH A;  2PRQ A;  2FVG A;  4NGP A;  3BI0 A;  3IC1 A;  3FF3 A;  1HEE A;  1R3N A;  4EME A;  3GUX A;  1VHO A;  2GLJ A;  2QVP A;  5K8M A;  3D7D A;  5D29 A;  4OID A;  1Q7L A;  3D7F A;  4Z65 A;  3CDX A;  3D4U A;  1KWM A;  3NA6 A;  3S9N A;  4R8F A;  4P4I A;  2ZEO A;  1TF8 A;  2AFX A;  2GRE A;  4GM5 A;  4ZX8 A;  1F2O A;  2ZED A;  1HDU A;  4PQA A;  3WC5 A;  3GB0 A;  2I3C A;  4EFD A;  4NGS A;  4P4D A;  2AFU A;  4BD9 A;  2QJ8 A;  1CPX A;  3T8W A;  3KHZ A;  3CPX A;  3SI1 A;  4H2K A;  2PVV A;  1OBR A;  1GYT A;  3JRU A;  2V8V A;  4TNU A;  2AFO A;  1XFO A;  1XBU A;  2F8H A;  3IJ3 A;  4ZY0 A;  4TWE A;  4R76 A;  5THW A;  4OME A;  1DTD A;  3FX6 A;  3QNV A;  2PCU A;  4WJB A;  2ZOG A;  1VHE A;  2V8D A;  1Z8L A;  1ZLH A;  1Z2L A;  4OC0 A;  1BPN A;  4MHZ A;  1TXR A;  1VIX A;  3WT4 A;  4PPZ A;  1BLL E;  2EK9 A;  2CF4 A;  2ZEN A;  2CTB A;  2IJZ A;  4A37 A;  1FT7 A;  2CTC A;  2PJB A;  3WC7 A;  5ELY A;  2ZOF A;  2PJC A;  5K8O A;  3NFZ A;  5F09 A;  1XMB A;  1F2P A;  2QYV A;  4DUK A;  2PJ7 A;  4OIW A;  3HUV A;  3S9L A;  1ZG7 A;  3TC8 A;  1YW6 A;  2DEA A;  4P4J A;  4X3R A;  2PVW A;  3PRT A;  3B2Y A;  2AFM A;  2PJ4 A;  3D67 A;  1Y7E A;  2HB6 A;  3FJU A;  4OC4 A;  1LAP A;  1Z5R A;  3CT9 A;  2O4H A;  3KGQ A;  4W9Y A;  4ZY2 A;  5K8P A;  4MCP A;  2V77 A;  4PXC A;  3K9T A;  3GLJ A;  2VL1 A;  3SI2 A;  4X2T A;  3B7I A;  5JM6 A;  3IIB A;  4X8I A;  4ZX9 A;  5IB9 A;  3LMS A;  1NSA A;  2BO9 A;  5HXD A;  2WZN A;  2ZEP A;  3IFE A;  1XRY A;  2PE3 A;  3VAR A;  4FWU A;  1IGB A;  5HVH A;  2HC9 A;  2IQ6 A;  4NJR A;  3WC6 A;  2PJ0 A;  3RBU A;  2C6P A;  3MRU A;  1UWY A;  3BHX A;  3PFO A;  4Q7A A;  3D68 A;  3NH4 A;  3D7H A;  3TX8 A;  2PJ2 A;  4MRI A;  4NGR A;  3KR4 A;  1TKH A;  5DS0 A;  2PIY A;  3KQZ A;  2OR4 A;  4ZI6 A;  5LYL A;  1TKF A;  4UF4 A;  5CPA A;  2AFW A;  1ELL P;  2RB7 A;  5HVG A;  2ZEG A;  2XEI A;  2V8H A;  3KAS A;  2G9D A;  3SJX A;  4NFR A;  1HDQ A;  3S9M A;  4OP4 A;  1DE4 C;  1TKJ A;  4P44 A;  3K2K A;  4IHM A;  2V8G A;  4UIA A;  3SI0 A;  5CBM A;  3D7G A;  1EE3 P;  2XEF A;  4UIB A;  1RTQ A;  5LRK A;  4P4B A;  4NGT A;  4P10 A;  1YLO A;  3PEI A;  3KR5 A;  2PIZ A;  4R6T A;  3PB8 X;  1BPM A;  3PBB A;  3NH8 A;  4YU9 A;  1ZG9 A;  1ELM P;  1LAM A;  1Y0Y A;  5K8N A;  4MCR A;  3IO1 A;  3B3V A;  2PJA A;  1JQG A;  1LOK A;  4P4F A;  3VH9 A;  2XEG A;  1ZLI A;  4NJQ A;  2NSM A;  3PB9 X;  4OC5 A;  4JYW A;  4WWV A;  4DYO A;  5LYF A;  4JZ0 A;  3V7Z A;  2BCO A;  2PJ1 A;  4FBE A;  4OC3 A;  2JBK A;  3NH5 A;  4PXE A;  2Q51 A; 
#chains in the Genus database with same CATH topology
 2AFS A;  2PJ3 A;  3W91 A;  2G3T A;  3SJF A;  4ZYQ A;  2GLF A;  2OOT A;  4ONW A;  1A2Z A;  5EMI A;  4KOS A;  1CPS A;  1L0C A;  4NGN A;  5LRJ A;  3D8P A;  3R95 A;  7CPA A;  2Z11 A;  2XEJ A;  3JVN A;  4Q38 A;  2NYQ A;  5LYI A;  3DR6 A;  4AXV A;  4B6Z A;  1Y9W A;  2HUZ A;  4OC2 A;  4P45 A;  5A28 A;  3CZX A;  4JD6 A;  4F8Z A;  2K5T A;  1VGY A;  5J8C A;  1WK4 A;  2RC4 A;  3F8K A;  3H8E A;  4A32 A;  1LFW A;  1S60 A;  4XNH B;  1YK3 A;  1YSJ A;  2B5G B;  1BAV A;  5D8N A;  4UWJ A;  2FS5 A;  4PK2 A;  3RAM A;  2HQY A;  2WYR A;  4LQG A;  4F9U A;  4MCQ A;  4P4E A;  3D2M A;  1ARL A;  3FVL A;  4EVY A;  3SHP A;  3W6S A;  3EY5 A;  2ZEM A;  4YRH A;  4F9V A;  2CY2 A;  5IB0 A;  2B3U A;  1ZO0 A;  4FD6 A;  2R98 A;  3CPA A;  4HKF A;  2Z10 A;  2PRB A;  4KOY A;  3L2N A;  3TO7 A;  4ZY1 A;  1YW4 A;  4MCS A;  3RZA A;  4LX9 A;  4UEE A;  1AYE A;  1BOB A;  3FBU A;  1SQH A;  3PB4 X;  4HNW B;  4YWY A;  3TE4 A;  4NGQ A;  3B3C A;  1MK4 A;  4M85 A;  3D66 A;  4PXD A;  4JWP A;  2GU2 A;  4UFW A;  2D4O A;  1CG2 A;  2JBJ A;  4OLL A;  4OKO A;  5I4M A;  5HH1 A;  3E0K A;  1FNO A;  1Z8T A;  2VQY A;  3IEH A;  3PB7 X;  5EC4 A;  2B4B A;  4Y49 B;  3BJ8 A;  2B4D A;  3H4Q A;  3VWE A;  1XJO A;  4CYO A;  1CJW A;  1AMP A;  3NH5 A;  4UA3 A;  4QVT A;  4XPD C;  2AJ6 A;  2JEW A;  2Q7B A;  2OB0 A;  3ISX A;  2C6C A;  3PB6 X;  1RXT A;  1YME A;  2Q43 A;  2ZEE A;  3ZJ0 A;  4JXQ A;  2ABZ A;  2J8R A;  3BXM A;  2GFQ A;  3FH4 A;  3FMC A;  3KHX A;  3H8G A;  1QQ9 A;  1BO4 A;  1XF8 A;  1ZG8 A;  4MI4 A;  3TT2 A;  1ARM A;  3ISZ A;  4AG7 A;  3FIX A;  2F7V A;  5E96 A;  4FUU A;  1KUV A;  2PJ6 A;  4MHP A;  3SXO A;  3DR8 A;  4A38 A;  6CPA A;  2NMT A;  4K3N A;  2VZY A;  3IWG A;  4KSF A;  4R3L A;  3TFY A;  4DJL A;  4EWT A;  4KSI A;  3D3S A;  4E0A A;  1S7K A;  1LCP A;  5CPA A;  2BSW A;  2BOA A;  3PFE A;  2G3A A;  2ZEL A;  2PJ8 A;  3DGV A;  4AVA A;  1R43 A;  3MN8 A;  1PCA A;  3R9F A;  1H8L A;  1IYL A;  3FNC A;  3V8I A;  3FEC A;  3QAY A;  1IY7 A;  4B12 A;  4UFV A;  3VAT A;  4CAV A;  5ISV A;  2WUU A;  2FE7 A;  4MXU A;  4KLW A;  3BJ7 A;  3V38 A;  3K9U A;  1V0C A;  2IMO A;  4MMO A;  2C6G A;  4R9M A;  4A31 A;  3T9Y A;  2QIR A;  2PJ9 A;  2POK A;  4UFX A;  3LWU A;  4KLV A;  3N5F A;  2IL4 A;  3IGR A;  4RI1 A;  2EK8 A;  5LYD A;  2Z3L A;  3ZZI A;  2WPX A;  2C1C A;  3KQX A;  2FIA A;  2PJ5 A;  4PXB A;  2YNE A;  2J9A A;  4CRZ B;  4UEF A;  4AVC A;  2O53 A;  2VXK A;  4FAI A;  4KOT A;  4R7M A;  1Y0R A;  2O28 A;  3H8F A;  4IK2 A;  3PBE A;  4FD5 A;  5HVF A;  4A95 A;  2CNT A;  2FT0 A;  2CNM A;  2P0W A;  3SJG A;  4B5P A;  4KVM E;  1CP7 A;  2X7B A;  1CX8 A;  1VKC A;  1Y7R A;  1CBX A;  2B5G A;  3CXQ A;  8CPA A;  4NGM A;  2EWB A;  3I1U A;  1PYT B;  1F57 A;  2AFZ A;  3RO0 A;  2Q4Z A;  5J1Q A;  1XIX A;  1P4N A;  5LRG A;  2B3V A;  4MHY A;  4UEZ A;  4RUH A;  1LAN A;  1KUX A;  2FL4 A;  5JH9 A;  4L89 A;  2ZPA A;  4O23 A;  3B3W A;  4OC1 A;  3LAC A;  4JXR A;  5F48 A;  1CP6 A;  4A39 A;  4P6Y A;  3FED A;  1WWZ A;  2CIJ A;  3H5Z A;  3RNZ A;  2ZEF A;  2WPW A;  1Z8X A;  4R87 A;  3SJE A;  2RFH A;  5IV0 A;  3BI1 A;  4IAV A;  2H5M A;  2ANP A;  3DLJ A;  1QMU A;  3DNS A;  4A94 A;  1TF9 A;  3B3S A;  3KZW A;  4CPA A;  3WAB A;  1IYK A;  3KI9 A;  4MBU A;  2WSA A;  4PSX A;  3B35 A;  1M4L A;  4CGP A;  4II9 A;  2P6E A;  3KL9 A;  4E2A A;  3JUW A;  3B3T A;  3S6K A;  3CXS A;  4G1P A;  1M44 A;  4KUA A;  3FEE A;  1M1D A;  4X5K A;  2FCK A;  2D4P A;  3HLP A;  4MY3 A;  4CAW A;  4MHN A;  3BLN A;  2ZW4 A;  3IWW A;  1YR0 A;  2GIV A;  3F0A A;  4LUA A;  3NE7 A;  4B5P B;  2ZEH A;  2PRQ A;  4I49 A;  5JGF A;  2FVG A;  4NGP A;  3BI0 A;  5C88 A;  1YX0 A;  3IC1 A;  4MFP A;  3FF3 A;  1NE9 A;  1HEE A;  3UY5 A;  1PUA A;  1R3N A;  4QB9 A;  5DWM A;  4EME A;  5C82 A;  3GUX A;  1U6M A;  1VHO A;  5F49 A;  3FYN A;  5JQ4 A;  2GLJ A;  2GAN A;  2QVP A;  4M6G A;  5EBV A;  5K8M A;  3D7D A;  5D29 A;  4OID A;  1Q7L A;  3D7F A;  1ON0 A;  4Z65 A;  1YRE A;  3CDX A;  3R1K A;  1S7N A;  3D4U A;  1KWM A;  3S6F A;  3NA6 A;  4NSQ A;  1QSN A;  1UFH A;  1XE4 A;  5J8F A;  3S9N A;  4R8F A;  3G8W A;  4P4I A;  2PC1 A;  5CNP A;  4B14 A;  3R96 A;  5HMN A;  2ZEO A;  1TF8 A;  1S3Z A;  2KCW A;  2AFX A;  2ZXV A;  2GRE A;  4GM5 A;  4ZX8 A;  2QEC A;  4CYN A;  2YNC C;  1F2O A;  2ZED A;  1HDU A;  1YLE A;  1KUY A;  4KSA A;  4PQA A;  3WC5 A;  3GB0 A;  2I3C A;  1I21 A;  4MFQ A;  1YQE A;  2EVN A;  4EFD A;  4NGS A;  4P4D A;  2FXF A;  4PK3 A;  4U9Y A;  1J4J A;  3S6H A;  5AGE A;  2AFU A;  4XPD B;  4BD9 A;  3IU2 A;  4CGL A;  4RN7 A;  4AB7 A;  2QJ8 A;  1CPX A;  3T8W A;  3KHZ A;  4GXH A;  3PZJ A;  3CPX A;  2Z3P A;  4BBH A;  2ODF A;  4Y49 C;  2OZH A;  4M6I A;  2FSR A;  3SI1 A;  4C2Y A;  4H2K A;  2PVV A;  4YFJ A;  1Z8W A;  4TNU A;  1OBR A;  4PXE A;  1GYT A;  3JRU A;  2V8V A;  2VZZ A;  2BEI A;  2AFO A;  1Y9K A;  1XFO A;  1XBU A;  1PU9 A;  4JLY A;  2F8H A;  3T90 A;  4MY0 A;  3IJ3 A;  5AG6 A;  4ZY0 A;  2ATR A;  4RS2 A;  2R8V A;  5AG7 A;  4TWE A;  4R76 A;  5THW A;  4ORF A;  4OME A;  1DTD A;  3FX6 A;  4BMH A;  3QNV A;  2PCU A;  5FVJ A;  1B6B A;  4IUS A;  1IB1 E;  2Z3M A;  2Z3K A;  2ZOG A;  4WJB A;  3W6X A;  4A30 A;  1VHE A;  2REE A;  4B10 A;  2V8D A;  1Z8L A;  1M4G A;  5JPH A;  1ZLH A;  2JLM A;  3QAH A;  4MFK A;  1Z2L A;  4OC0 A;  1BPN A;  2I79 A;  4MHZ A;  1TXR A;  1VIX A;  4HNX B;  4H6Z A;  4F0X A;  3IWE A;  3TO6 A;  4CYQ A;  1CM0 A;  1MJB A;  5KTA A;  5G22 A;  3WT4 A;  4PPZ A;  1BLL E;  2EK9 A;  5G1Z A;  2CF4 A;  4E8O A;  2ARH A;  2ZEN A;  2CTB A;  2IJZ A;  4XPL A;  4A37 A;  1B87 A;  1FT7 A;  2F5I A;  3B8G A;  3RYO A;  5F46 A;  2CTC A;  1AUG A;  2PJB A;  3EC4 A;  4QUS A;  1YGH A;  4KZT A;  1YVO A;  5G21 A;  3WC7 A;  1Z4E A;  4FD7 A;  5ELY A;  2ZOF A;  2PJC A;  4K30 A;  4U5Y A;  3TOA A;  2PDO A;  2PQ8 A;  2Q4V A;  4M6H A;  3NFZ A;  4AG9 A;  3KKW A;  5F09 A;  5K8O A;  1XMB A;  2Z0Z A;  1F2P A;  3OWC A;  3GIU A;  3FRM A;  2QYV A;  2YND A;  4DUK A;  4MJ8 A;  5BWA B;  2PJ7 A;  4OIW A;  3JTK A;  4IF5 A;  5AG5 A;  3HUV A;  4YGO A;  4UCN A;  5AG4 A;  1ZG7 A;  2PR1 A;  2R1I A;  1YW6 A;  3TC8 A;  3LOD A;  3S9L A;  2DEA A;  3LD2 A;  4FD4 A;  4P4J A;  2PVW A;  4X3R A;  4UCM A;  4CYP A;  3PRT A;  3B2Y A;  3QB8 A;  2AFM A;  2PJ4 A;  2OH1 A;  3D67 A;  4GS4 A;  1Y7E A;  2HB6 A;  4F6A A;  4J3G A;  3FJU A;  3GY9 A;  4OC4 A;  1LAP A;  1Z5R A;  3CT9 A;  2O4H A;  3KGQ A;  1OZP A;  4W9Y A;  1TIQ A;  4KUB A;  1IOF A;  4ZY2 A;  5K8P A;  4MCP A;  1IOI A;  1RO5 A;  2V77 A;  2OZG A;  3GKR A;  3K9T A;  4PXC A;  3VWD A;  3I3G A;  3GLJ A;  4QBJ A;  2VL1 A;  3SI2 A;  4MFZ A;  4X2T A;  3B7I A;  2CXA A;  3EO4 A;  3I9S A;  4H89 A;  5JM6 A;  3IIB A;  3MGD A;  4X8I A;  3IU1 A;  3FXT A;  4ZX9 A;  5IB9 A;  3LMS A;  4XNH C;  4CGN A;  1NSA A;  2BO9 A;  5HXD A;  2A4N A;  2WZN A;  2GE3 A;  2ZEP A;  3IFE A;  1XRY A;  2Y0M A;  5DWN A;  4KOX A;  4M3S A;  3EFA A;  5G20 A;  4C68 A;  2J8M A;  2AE6 A;  2PE3 A;  4XPK A;  3VAR A;  4MFL A;  4FWU A;  4KVO E;  4R3K A;  1Q2C A;  1IGB A;  1N71 A;  1M4D A;  4ZBG A;  3R9E A;  5HVH A;  2HC9 A;  3NE8 A;  5H86 A;  2IQ6 A;  4C2Z A;  4NJR A;  3WC6 A;  4ZGY B;  5KTC A;  2PJ0 A;  4R57 A;  3RBU A;  2G0B A;  2C6P A;  1IU8 A;  3R9G A;  3MRU A;  5GCN A;  4NEX A;  1UWY A;  2Q0Y A;  3BHX A;  3PFO A;  4HPS A;  4Q7A A;  2EO8 A;  1M4I A;  4KOV A;  5H84 A;  3D68 A;  3NH4 A;  3PGP A;  1QST A;  5I0C A;  1MJA A;  3D7H A;  3P2H A;  2Z3O A;  4PSW A;  3D2P A;  3TCV A;  4LQ6 A;  4A2Z A;  3TX8 A;  1XEB A;  2B58 A;  2PJ2 A;  1P0H A;  2BUE A;  4MRI A;  5A27 A;  4NGR A;  4ONU A;  4U9Z A;  4PV6 A;  1X12 A;  3KR4 A;  1TKH A;  2BL1 A;  2VBQ A;  2ZW5 A;  5DS0 A;  2PIY A;  4CAF A;  1Z9U A;  3KQZ A;  4KOR A;  4UBR A;  3SXN A;  2OR4 A;  4ZI6 A;  3PP9 A;  5LYL A;  4UCP A;  4KOW A;  1TKF A;  4HNY B;  4UF4 A;  4UWI A;  2Q44 A;  1IIC A;  4Q36 A;  2AFW A;  4NXY A;  1I1D A;  2REF A;  1ELL P;  2Q7S A;  2RB7 A;  2HV2 A;  3P2F A;  1FY7 A;  5F47 A;  4H6U A;  5HVG A;  2ZW6 A;  2ZEG A;  2XEI A;  2PR8 A;  2Q4Y A;  2OZU A;  2V8H A;  2VEZ A;  3KAS A;  2DPS A;  2FIW A;  1S7L A;  2I00 A;  1Z4R A;  2P6F A;  1X10 A;  2G9D A;  3SJX A;  1S5K A;  2CNS A;  4NFR A;  1NMT A;  1KZF A;  1HDQ A;  4OP4 A;  3S9M A;  1IID A;  1DE4 C;  4BIN A;  4CAX A;  1QSR A;  4B13 A;  3TO9 A;  4NCZ A;  3S6G A;  4CRY B;  2P6G A;  2JEV A;  3FB3 A;  1TKJ A;  4QC6 A;  3EXN A;  4P44 A;  3K2K A;  2DPT A;  4IHM A;  2Q04 A;  2V8G A;  3CXP A;  4UIA A;  3SI0 A;  4DNC A;  2R7H A;  3D7G A;  5CBM A;  4KVX A;  4OAD A;  1EE3 P;  2XEF A;  4UIB A;  1RTQ A;  1NSL A;  5LRK A;  2B4D B;  4F0Y A;  4P4B A;  3A9L A;  4NF1 A;  4NGT A;  4P10 A;  1YLO A;  1YVK A;  3PEI A;  3KR5 A;  2PIZ A;  4R6T A;  2JDD A;  2YGW A;  3N7Z A;  1QSM A;  1GHE A;  3PB8 X;  1BPM A;  3DSB A;  1R57 A;  1Q2Y A;  3PBB A;  3TOB A;  2DF5 A;  4B5O A;  4CS0 B;  3NH8 A;  4C7H A;  2QML A;  1K4J A;  4YU9 A;  4MFJ A;  3DDD A;  1ZG9 A;  1ELM P;  1LAM A;  2OU2 A;  5IX3 A;  4C2X A;  1Y0Y A;  5K8N A;  4MCR A;  1VHS A;  1MJ9 A;  1XOV A;  3IO1 A;  3B3V A;  1LRZ A;  1JWQ A;  2PJA A;  2PSW A;  1JQG A;  4JJX A;  4L8A A;  1QSO A;  2DXQ A;  3F5B A;  2EBJ A;  3TTH A;  1LOK A;  4P4F A;  2VI7 A;  3VH9 A;  2XEG A;  4CGM A;  4CGO A;  4C7I A;  5KTD A;  2EUI A;  4B11 A;  4A33 A;  1ZLI A;  4NJQ A;  2NSM A;  3PB9 X;  4OC5 A;  2JDC A;  1S7F A;  1XMT A;  4JYW A;  4WWV A;  4DYO A;  3WR7 A;  2ZW7 A;  3C26 A;  5LYF A;  4JZ0 A;  3V7Z A;  2BCO A;  1I12 A;  2J8N A;  3GYA A;  4CAE A;  2PJ1 A;  4FBE A;  4OAE A;  2YNC A;  4KOU A;  4OC3 A;  2JBK A;  2Z3N A;  3G3S A;  4AVB A;  1Q2D A;  2C27 A;  4MHD A;  2Q51 A;  4KS9 A; 
#chains in the Genus database with same CATH homology
 2AFS A;  2PJ3 A;  3SJF A;  4ZYQ A;  2GLF A;  2OOT A;  4ONW A;  1CPS A;  4NGN A;  5LRJ A;  7CPA A;  2XEJ A;  5LYI A;  2NYQ A;  4AXV A;  4B6Z A;  4OC2 A;  4P45 A;  4F8Z A;  1VGY A;  3H8E A;  1LFW A;  1YSJ A;  1BAV A;  5D8N A;  3RAM A;  2WYR A;  4LQG A;  4F9U A;  4MCQ A;  4P4E A;  1ARL A;  3FVL A;  2ZEM A;  4F9V A;  3CPA A;  3L2N A;  4ZY1 A;  1YW4 A;  4MCS A;  3RZA A;  4UEE A;  1AYE A;  3PB4 X;  4YWY A;  4NGQ A;  3B3C A;  3D66 A;  4PXD A;  2GU2 A;  2JBJ A;  1CG2 A;  4OKO A;  5I4M A;  1FNO A;  3IEH A;  3PB7 X;  1XJO A;  1AMP A;  2JEW A;  3ISX A;  2C6C A;  3PB6 X;  1YME A;  2Q43 A;  2ZEE A;  2ABZ A;  3BXM A;  3KHX A;  3FH4 A;  3FMC A;  3H8G A;  1QQ9 A;  1ZG8 A;  1ARM A;  3ISZ A;  2F7V A;  4FUU A;  2PJ6 A;  4MHP A;  4A38 A;  6CPA A;  4K3N A;  4DJL A;  4EWT A;  4KSI A;  1LCP A;  2BOA A;  3PFE A;  2ZEL A;  2PJ8 A;  3DGV A;  1R43 A;  3MN8 A;  1PCA A;  1H8L A;  3FEC A;  1IY7 A;  3VAT A;  4MXU A;  3V38 A;  4MMO A;  2IMO A;  2C6G A;  2PJ9 A;  2POK A;  3LWU A;  3N5F A;  2EK8 A;  5LYD A;  2C1C A;  3KQX A;  2PJ5 A;  4PXB A;  2J9A A;  4UEF A;  2O53 A;  4FAI A;  4R7M A;  1Y0R A;  3H8F A;  4IK2 A;  3PBE A;  5HVF A;  3SJG A;  1CP7 A;  1CX8 A;  1CBX A;  8CPA A;  4NGM A;  2EWB A;  3I1U A;  1PYT B;  1F57 A;  2AFZ A;  2Q4Z A;  5J1Q A;  4RUH A;  5LRG A;  5JH9 A;  4MHY A;  4UEZ A;  1LAN A;  4O23 A;  3B3W A;  4OC1 A;  1CP6 A;  4A39 A;  4P6Y A;  3FED A;  2CIJ A;  2ZEF A;  3SJE A;  2RFH A;  3BI1 A;  4IAV A;  2ANP A;  3DLJ A;  1QMU A;  4A94 A;  1TF9 A;  3B3S A;  3KZW A;  4CPA A;  3WAB A;  3KI9 A;  3B35 A;  1M4L A;  3KL9 A;  3B3T A;  4G1P A;  3FEE A;  3HLP A;  4MHN A;  3IWW A;  5JGF A;  2ZEH A;  2PRQ A;  2FVG A;  4NGP A;  3BI0 A;  3IC1 A;  3FF3 A;  1HEE A;  1R3N A;  4EME A;  3GUX A;  1VHO A;  2GLJ A;  2QVP A;  5K8M A;  3D7D A;  5D29 A;  4OID A;  1Q7L A;  3D7F A;  4Z65 A;  3CDX A;  3D4U A;  1KWM A;  3NA6 A;  3S9N A;  4R8F A;  4P4I A;  2ZEO A;  1TF8 A;  2AFX A;  2GRE A;  4GM5 A;  4ZX8 A;  1F2O A;  2ZED A;  1HDU A;  4PQA A;  3WC5 A;  3GB0 A;  2I3C A;  4EFD A;  4NGS A;  4P4D A;  2AFU A;  4BD9 A;  2QJ8 A;  1CPX A;  3T8W A;  3KHZ A;  3CPX A;  3SI1 A;  4H2K A;  2PVV A;  1OBR A;  1GYT A;  3JRU A;  2V8V A;  4TNU A;  2AFO A;  1XFO A;  1XBU A;  2F8H A;  3IJ3 A;  4ZY0 A;  4TWE A;  4R76 A;  5THW A;  4OME A;  1DTD A;  3FX6 A;  3QNV A;  2PCU A;  4WJB A;  2ZOG A;  1VHE A;  2V8D A;  1Z8L A;  1ZLH A;  1Z2L A;  4OC0 A;  1BPN A;  4MHZ A;  1TXR A;  1VIX A;  3WT4 A;  4PPZ A;  1BLL E;  2EK9 A;  2CF4 A;  2ZEN A;  2CTB A;  2IJZ A;  4A37 A;  1FT7 A;  2CTC A;  2PJB A;  3WC7 A;  5ELY A;  2ZOF A;  2PJC A;  5K8O A;  3NFZ A;  5F09 A;  1XMB A;  1F2P A;  2QYV A;  4DUK A;  2PJ7 A;  4OIW A;  3HUV A;  3S9L A;  1ZG7 A;  3TC8 A;  1YW6 A;  2DEA A;  4P4J A;  4X3R A;  2PVW A;  3PRT A;  3B2Y A;  2AFM A;  2PJ4 A;  3D67 A;  1Y7E A;  2HB6 A;  3FJU A;  4OC4 A;  1LAP A;  1Z5R A;  3CT9 A;  2O4H A;  3KGQ A;  4W9Y A;  4ZY2 A;  5K8P A;  4MCP A;  2V77 A;  4PXC A;  3K9T A;  3GLJ A;  2VL1 A;  3SI2 A;  4X2T A;  3B7I A;  5JM6 A;  3IIB A;  4X8I A;  4ZX9 A;  5IB9 A;  3LMS A;  1NSA A;  2BO9 A;  5HXD A;  2WZN A;  2ZEP A;  3IFE A;  1XRY A;  2PE3 A;  3VAR A;  4FWU A;  1IGB A;  5HVH A;  2HC9 A;  2IQ6 A;  4NJR A;  3WC6 A;  2PJ0 A;  3RBU A;  2C6P A;  3MRU A;  1UWY A;  3BHX A;  3PFO A;  4Q7A A;  3D68 A;  3NH4 A;  3D7H A;  3TX8 A;  2PJ2 A;  4MRI A;  4NGR A;  3KR4 A;  1TKH A;  5DS0 A;  2PIY A;  3KQZ A;  2OR4 A;  4ZI6 A;  5LYL A;  1TKF A;  4UF4 A;  5CPA A;  2AFW A;  1ELL P;  2RB7 A;  5HVG A;  2ZEG A;  2XEI A;  2V8H A;  3KAS A;  2G9D A;  3SJX A;  4NFR A;  1HDQ A;  3S9M A;  4OP4 A;  1DE4 C;  1TKJ A;  4P44 A;  3K2K A;  4IHM A;  2V8G A;  4UIA A;  3SI0 A;  5CBM A;  3D7G A;  1EE3 P;  2XEF A;  4UIB A;  1RTQ A;  5LRK A;  4P4B A;  4NGT A;  4P10 A;  1YLO A;  3PEI A;  3KR5 A;  2PIZ A;  4R6T A;  3PB8 X;  1BPM A;  3PBB A;  3NH8 A;  4YU9 A;  1ZG9 A;  1ELM P;  1LAM A;  1Y0Y A;  5K8N A;  4MCR A;  3IO1 A;  3B3V A;  2PJA A;  1JQG A;  1LOK A;  4P4F A;  3VH9 A;  2XEG A;  1ZLI A;  4NJQ A;  2NSM A;  3PB9 X;  4OC5 A;  4JYW A;  4WWV A;  4DYO A;  5LYF A;  4JZ0 A;  3V7Z A;  2BCO A;  2PJ1 A;  4FBE A;  4OC3 A;  2JBK A;  3NH5 A;  4PXE A;  2Q51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...