2ZEFA

Crystal structure of the human glutaminyl cyclase mutant e201d at 1.67 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGDEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zefA00
3IIBA 4ZYQA 4P4DA 3I1UA 3FF3A 2F8HA 4UF4A 5D8NA 3IFEA 2AFMA 4A39A 3NH4A 1Q7LA 4ONWA 1VIXA 3WC7A 4P6YA 4IK2A 3SJGA 1R3NA 4MHYA 1YSJA 4OMEA 2RB7A 3KL9A 5LYIA 5HVHA 2O53A 1YLOA 3LWUA 3PB7X 4ZY1A 1CPSA 4UEZA 3B35A 1YW6A 1BPMA 3TC8A 2C1CA 1GYTA 3S9LA 3D7DA 4ZY0A 2AFUA 1LANA 3B2YA 4IAVA 3FEDA 4Z65A 3B3VA 4K3NA 4G1PA 4WJBA 2GLJA 2ZENA 2O4HA 5LYDA 4PPZA 5DS0A 3PEIA 4OC3A 3RZAA 4OIDA 3PFOA 4A38A 2PJ6A 2AFZA 1FT7A 4EWTA 2AFXA 4ZX9A 3HLPA 3SJFA 4NJQA 1PYTB 2OR4A 5LYLA 4FUUA 4UEEA 4MCRA 4NGSA 3GB0A 4O23A 3BHXA 4MRIA 3KQZA 2V8DA 2AFSA 5I4MA 4WWVA 2PVVA 2HB6A 1XRYA 2PJ9A 2ZEDA 2BO9A 3KGQA 3D68A 4JYWA 3VARA 1HDQA 2PJ8A 2ZOFA 2ZEGA 2QYVA 3RBUA 3V38A 3FJUA 5JM6A 2C6PA 4R76A 1BPNA 2CF4A 4PXCA 1VGYA 2PJ4A 1ARMA 2ANPA 2ABZA 1LAMA 3CPXA 5HVGA 4PXDA 2JBJA 2OOTA 1CX8A 2ZELA 3MRUA 3SI2A 2VL1A 4P4IA 3ISZA 2PJ5A 2PE3A 4BD9A 3BXMA 1LFWA 1YW4A 3PBBA 4OP4A 4ZI6A 4F9VA 4KSIA 2G9DA 2GU2A 3N5FA 3PB6X 4ZX8A 4F9UA 1TXRA 5LRGA 3KI9A 2V8VA 4MHZA 5D29A 4A37A 2WZNA 3K2KA 2CTCA 3FMCA 2ZEFA 4R7MA 5J1QA 2ZEHA 1YMEA 2IMOA 3LMSA 4UIBA 1AYEA 1BLLE 4OKOA 3DLJA 1XFOA 1Y0RA 1ZG9A 3RAMA 4MHNA 5K8OA 4UIAA 4OC5A 2JEWA 4P44A 4NGQA 4P4JA 1F2PA 3SI0A 2C6GA 5JH9A 2HC9A 4B6ZA 2NYQA 3D4UA 1Y7EA 2GREA 1Z5RA 3HUVA 5LRKA 4AXVA 7CPAA 1TKHA 3FECA 3SJEA 2ZEEA 4P4FA 5IB9A 3CT9A 1RTQA 4W9YA 8CPAA 4X8IA 3IEHA 1Z8LA 2PJ2A 3KASA 3IC1A 3FX6A 1QQ9A 4RUHA 3D66A 4ZY2A 4H2KA 4YU9A 2PVWA 1LCPA 3B3WA 4MCPA 3NH8A 3KQXA 3MN8A 1DTDA 4IHMA 4OC1A 3WC6A 4P4EA 1CP7A 4X3RA 3WC5A 3D7GA 2I3CA 1XMBA 3TX8A 1ELMP 2Q51A 2XEGA 1DE4C 1XBUA 1ZLIA 1ARLA 3IJ3A 5JGFA 1ZG7A 3PB9X 3B3TA 4UEFA 2IJZA 1FNOA 5THWA 3NA6A 4Q7AA 3SI1A 4MHPA 3IO1A 5LRJA 4P45A 1NSAA 2BCOA 3VH9A 1OBRA 1VHOA 4EMEA 4LQGA 5K8MA 4NGMA 4FBEA 5CBMA 3H8GA 1CPXA 2XEFA 2JBKA 4NFRA 3FH4A 1LOKA 3KZWA 1IGBA 5ELYA 4FAIA 5CPAA 2C6CA 3PBEA 1HDUA 1AMPA 3GLJA 2ZEOA 1CG2A 2PJ7A 2Q43A 3WABA 1IY7A 2POKA 3VATA 4DJLA 3KHXA 6CPAA 1JQGA 4NJRA 1CP6A 4YWYA 1M4LA 4EFDA 3JRUA 2GLFA 1CBXA 3WT4A 2CTBA 3QNVA 5LYFA 4P4BA 1ZLHA 3PFEA 2J9AA 1Z2LA 3H8EA 3SJXA 4FWUA 3V7ZA 2DEAA 2PIZA 1ZG8A 3PB4X 2EK8A 3S9MA 4X2TA 2CIJA 1XJOA 2PRQA 2ZEMA 3KR5A 3B3SA 2V77A 3B3CA 1H8LA 4A94A 2FVGA 3L2NA 1UWYA 4JZ0A 2QJ8A 1LAPA 5HVFA 1PCAA 2PJ3A 3GUXA 5K8PA 4P10A 2PJ1A 5HXDA 3BI1A 3T8WA 3CDXA 1VHEA 1TF9A 3B7IA 2PJAA 4OC0A 4MMOA 4F8ZA 4TNUA 3K9TA 3KHZA 4PXBA 2ZOGA 3DGVA 1TKFA 3KR4A 4PQAA 1BAVA 4NGRA 2WYRA 5K8NA 3S9NA 4OC2A 2BOAA 1EE3P 2NSMA 4NGNA 4MCSA 2XEIA 4OIWA 4MCQA 1R43A 2QVPA 2AFWA 2RFHA 3ISXA 3PRTA 4R8FA 3NFZA 1TKJA 2XEJA 3IWWA 4NGPA 2PJCA 2PIYA 2V8HA 3BI0A 4NGTA 1F2OA 1F57A 2V8GA 4PXEA 1ELLP 2PCUA 1Y0YA 2IQ6A 3NH5A 1HEEA 1QMUA 3FEEA 3D7HA 4OC4A 4MXUA 3H8FA 3FVLA 2ZEPA 4DYOA 1KWMA 4DUKA 2Q4ZA 4GM5A 3CPAA 4CPAA 2AFOA 4R6TA 2F7VA 3D67A 4TWEA 3PB8X 2PJBA 2EK9A 2PJ0A 5F09A 1TF8A 3D7FA 2EWBA
chains in the Genus database with same CATH superfamily
5F47A 2K5TA 3IIBA 4ZYQA 1I12A 4P4DA 3I1UA 3FF3A 2F8HA 2RC4A 4UF4A 5D8NA 3FB3A 3IFEA 2AFMA 2HQYA 2HUZA 4A39A 3NH4A 1Q7LA 4ONWA 1VIXA 3WC7A 4H6ZA 4QC6A 4P6YA 4IK2A 3SJGA 1R3NA 4MHYA 2QMLA 1YSJA 4YGOA 2FL4A 2Q0YA 4OMEA 4RS2A 1K4JA 2I00A 2RB7A 4JXRA 3KL9A 4CRZB 5A28A 1P0HA 5LYIA 5HVHA 4IF5A 2O53A 1YLOA 2ZXVA 3JTKA 3LWUA 3PB7X 3DDDA 3ZZIA 4ZY1A 1CPSA 1QSOA 3B35A 4UEZA 1PU9A 1YW6A 1BPMA 3TC8A 3OWCA 2EO8A 1ON0A 2C1CA 1SQHA 5JPHA 1GYTA 4UCMA 3D7DA 4UFWA 3S9LA 4Q36A 4ZY0A 2AFUA 4F6AA 4FD7A 1LANA 3B2YA 2GFQA 4IAVA 4KOVA 4A30A 1S7KA 3FEDA 1BO4A 4Z65A 3B3VA 4K3NA 4G1PA 4NEXA 4MHDA 4WJBA 4HNXB 5GCNA 3N7ZA 5CNPA 2GLJA 2ZENA 2O4HA 5E96A 1VKCA 5EC4A 1MJ9A 5LYDA 4B5PB 4PPZA 4XPKA 2CY2A 3K9UA 4MFLA 3PEIA 5DS0A 3RO0A 4CAXA 4OC3A 1S3ZA 3RZAA 4OIDA 3PFOA 4CYQA 2KCWA 4A38A 4KVME 2AE6A 4KOWA 4KSAA 1S5KA 4BBHA 1TIQA 2PJ6A 4MBUA 2EVNA 2AFZA 1FT7A 3DSBA 1A2ZA 4EWTA 1CJWA 2AFXA 2PR1A 3HLPA 4ZX9A 3SJFA 3R95A 4XPDB 4NJQA 1PYTB 2PC1A 2OR4A 3FBUA 3V8IA 5LYLA 4FUUA 4UEEA 1P4NA 4MCRA 5IV0A 4NGSA 1L0CA 4MFJA 3UY5A 3GB0A 3KKWA 4O23A 3BHXA 4CYOA 2Z3OA 3KQZA 3CXPA 4MRIA 2V8DA 4CGPA 1M4DA 2YNEA 1Z8WA 2AFSA 3TO9A 4WWVA 5I4MA 4B11A 4ZGYB 2PVVA 1YQEA 2HB6A 1XRYA 2PJ9A 4F0YA 2J8RA 2ZEDA 1NE9A 2BO9A 5G22A 1IB1E 3KGQA 3D68A 4CAVA 4JYWA 3VARA 4RN7A 5KTAA 4M6IA 3WR7A 1HDQA 3W91A 2PJ8A 1Q2CA 2Z3KA 2ZOFA 4JJXA 2Z3PA 5ISVA 1WK4A 1YR0A 2OU2A 2ZEGA 2QYVA 1FY7A 3RBUA 2CNSA 3V38A 3E0KA 3W6XA 2ZPAA 3FJUA 5JM6A 2C6PA 3SXOA 4R76A 1BPNA 1Y7RA 2CF4A 2YGWA 2PQ8A 3CZXA 4PSXA 4PXCA 4QVTA 3F0AA 1VGYA 1N71A 2PJ4A 1VHSA 2WPXA 2WUUA 1ARMA 3EXNA 2ANPA 2ABZA 2I79A 1LAMA 1ZO0A 2EBJA 3CPXA 5HVGA 1Q2YA 1IICA 1KUVA 4PXDA 2JBJA 2D4OA 2ZW5A 1MJBA 1CX8A 2OOTA 2ZELA 3TOBA 3MRUA 3S6HA 3CXQA 3GY9A 3SI2A 2C27A 4UFXA 5AG6A 2VL1A 1IYKA 4P4IA 3ISZA 2B3UA 2ATRA 2PJ5A 3P2FA 2PE3A 4BD9A 3BXMA 3QB8A 3EC4A 1LFWA 1YW4A 2Q4VA 3PBBA 4OP4A 3RNZA 4ZI6A 4CRYB 4Y49B 2OZHA 4F9VA 2Q7SA 4KS9A 4KSIA 2G9DA 2GU2A 3N5FA 3PB6X 4ZBGA 4ZX8A 4F9UA 1TXRA 4MFQA 4AG9A 2PR8A 1KUYA 4XPDC 5LRGA 4MFKA 1B6BA 4OAEA 3KI9A 2GE3A 2V8VA 4MFPA 4MHZA 5D29A 4A37A 2WZNA 1YLEA 4KUBA 4NCZA 2P6GA 2O28A 3K2KA 2CTCA 3FMCA 3H4QA 3GKRA 2R98A 2Q04A 4IUSA 2ZEFA 5C88A 4E0AA 2G3AA 4MY0A 4R7MA 4CGMA 3P2HA 2WSAA 5J1QA 3I3GA 2ZEHA 1YMEA 2IMOA 3F8KA 3LMSA 1WWZA 4U9YA 4UIBA 5AG7A 5IX3A 1AYEA 3R9FA 1BLLE 4OKOA 3DLJA 4B5PA 1XFOA 1Y0RA 1ZG9A 2DF5A 4MHNA 3RAMA 5K8OA 4UIAA 4R9MA 4A95A 4OC5A 2OZGA 2JEWA 4P44A 4NGQA 4P4JA 1F2PA 2CXAA 3SI0A 5HMNA 2C6GA 4BMHA 5JH9A 2HC9A 4CGOA 4B6ZA 3S6FA 2NYQA 3D4UA 4C2YA 1Y7EA 4KOXA 2GIVA 2Q44A 3EO4A 2GREA 4C7IA 1U6MA 1Z5RA 4FD6A 4CAEA 4KOUA 5HH1A 3HUVA 5LRKA 2JDDA 4CAFA 4PK2A 1MK4A 4AXVA 3TT2A 3A9LA 2NMTA 3D2PA 4OADA 7CPAA 1XF8A 1S60A 1TKHA 1KUXA 3FECA 4HNWB 3SJEA 5F46A 2FIAA 1Z4RA 3TCVA 2ZEEA 4P4FA 4Q38A 2FIWA 4AVAA 5IB9A 3CT9A 4XPLA 2J8MA 1IYLA 1RTQA 4W9YA 5G21A 4AG7A 8CPAA 2VEZA 4X8IA 3IEHA 3C26A 1Z8LA 2PJ2A 4Y49C 4CYNA 3KASA 3IC1A 4MJ8A 3PGPA 3H5ZA 2IL4A 2VBQA 3ZJ0A 1M44A 4M85A 3FX6A 1QQ9A 4RUHA 3D66A 4J3GA 4H2KA 4YU9A 3BJ8A 4ZY2A 1UFHA 2Z10A 4RI1A 2PVWA 4HKFA 4B13A 3VWEA 1LCPA 3B3WA 3LACA 4MCPA 1J4JA 3NH8A 3T9YA 2BEIA 3KQXA 1DTDA 1QSRA 1XEBA 3MN8A 4IHMA 5AG5A 4A33A 3D8PA 4OC1A 3WC6A 4KVXA 4P4EA 3G8WA 1CP7A 4X3RA 4HNYB 4KOTA 4MI4A 3WC5A 2B5GA 3D7GA 2R7HA 5AG4A 2FS5A 2I3CA 3IU1A 2VZZA 1XMBA 2QECA 1XMTA 5KTCA 3TX8A 1ELMP 2B58A 2Q51A 2XEGA 4R3KA 3BLNA 1DE4C 1XBUA 1ZLIA 1ARLA 3IJ3A 2Z3MA 5JGFA 1ZG7A 2DPSA 1Z4EA 3GIUA 5FVJA 2YNCA 3PB9X 3B3TA 4UEFA 2IJZA 4BINA 1FNOA 3TTHA 4A32A 3JUWA 5THWA 4B5OA 2B5GB 1R57A 1YGHA 4FD5A 2BUEA 2EUIA 1YX0A 3NA6A 3EFAA 4Q7AA 2F5IA 3SI1A 4MHPA 3DR8A 4KOSA 3IO1A 2ARHA 5LRJA 4NSQA 4P45A 4U9ZA 1NSAA 2BCOA 2FCKA 2FE7A 3VH9A 5JQ4A 4QUSA 1OBRA 5G20A 1VHOA 3NE8A 4MFZA 1IU8A 4EMEA 4LQGA 4XNHB 2J8NA 4H6UA 4JXQA 2WPWA 4NGMA 5K8MA 4FBEA 5CBMA 1S7LA 3H8GA 4M6GA 1Z9UA 2A4NA 1CPXA 1XOVA 2PDOA 2XEFA 1KZFA 2ZW7A 3TOAA 4AVCA 2JBKA 4E8OA 3TO6A 4AVBA 4NFRA 2Q7BA 3FH4A 1B87A 1LOKA 1XE4A 2JLMA 3KZWA 2OB0A 1IGBA 5ELYA 1LRZA 4FAIA 5CPAA 2C6CA 3FRMA 1YVKA 3PBEA 3VWDA 1HDUA 4F0XA 4QB9A 1AMPA 3TE4A 3GLJA 2ZEOA 1CG2A 3FXTA 4C2XA 2PJ7A 2Q43A 3WABA 1IY7A 2QIRA 1Y9KA 3QAHA 2POKA 4UCNA 3VATA 2ZW4A 4DJLA 3KHXA 1QSTA 4GXHA 6CPAA 3IU2A 1JQGA 4NJRA 1CP6A 2GANA 4R57A 4YWYA 4U5YA 4KUAA 1M4LA 4KOYA 2B4DB 2OZUA 3IWEA 4MY3A 2B3VA 4EFDA 4X5KA 3JRUA 2GLFA 1CBXA 3WT4A 4CS0B 1RXTA 2CTBA 3QNVA 5LYFA 5C82A 4P4BA 1ZLHA 3PFEA 2J9AA 1Z2LA 4I49A 3H8EA 2DPTA 3FIXA 3SJXA 4II9A 4C68A 3IGRA 4FWUA 2JEVA 3EY5A 3V7ZA 2VQYA 2DEAA 2PIZA 1ZG8A 5F49A 1X10A 3CXSA 4PV6A 3PB4X 1IOFA 2EK8A 3S9MA 1RO5A 1M4GA 2PRBA 2CIJA 1XJOA 3FYNA 4X2TA 4A2ZA 2D4PA 4KSFA 3R9GA 5DWNA 2PRQA 3PZJA 2ZEMA 3SXNA 2G0BA 3KR5A 3B3SA 2V77A 3B3CA 4QBJA 5KTDA 4UWIA 1H8LA 5BWAB 1CM0A 4GS4A 4KLWA 4A94A 4L89A 4HPSA 3S6KA 2FVGA 3W6SA 5A27A 4A31A 1YVOA 1Q2DA 3L2NA 1UWYA 3JVNA 4H89A 4NXYA 4CGNA 4JZ0A 2B4BA 3G3SA 2X7BA 2PSWA 2QJ8A 1LAPA 5HVFA 3LODA 4XNHC 1MJAA 2JDCA 3T90A 4C2ZA 1PCAA 1S7NA 2YNCC 2PJ3A 2R8VA 4YRHA 4ONUA 3F5BA 2REEA 3IWGA 1Y9WA 2OH1A 3GUXA 5K8PA 1M4IA 1V0CA 4K30A 4P10A 2PJ1A 1M1DA 4JWPA 5HXDA 3BI1A 3R1KA 3TFYA 4YFJA 2FSRA 3T8WA 3CDXA 2CNTA 1PUAA 1VHEA 4B12A 4L8AA 2P6FA 2HV2A 1TF9A 3B7IA 4R87A 2PJAA 4PSWA 3B8GA 5J8FA 3DNSA 4OC0A 4FD4A 4MMOA 4F8ZA 4E2AA 2REFA 4TNUA 4UWJA 2ZW6A 3FNCA 3K9TA 3KHZA 4PXBA 2ZOGA 5EMIA 3DGVA 4JD6A 1TKFA 4OLLA 3KR4A 2BL1A 4PQAA 2AJ6A 2DXQA 1BAVA 4DNCA 4NF1A 2Z11A 1Z8TA 4NGRA 4ORFA 5H86A 2BSWA 2WYRA 2VXKA 4KORA 5K8NA 3S9NA 4UBRA 3PP9A 4B14A 4OC2A 4AB7A 1X12A 2BOAA 1I1DA 2FXFA 4C7HA 3GYAA 1EE3P 4UFVA 2NSMA 1QSNA 2H5MA 4NGNA 4MCSA 2XEIA 3D3SA 5AGEA 4UA3A 5G1ZA 3SHPA 4OIWA 1IIDA 1AUGA 4MCQA 1OZPA 3LD2A 4LUAA 3MGDA 1NMTA 4PK3A 2P0WA 2R1IA 1R43A 4JLYA 2QVPA 2AFWA 2RFHA 3ISXA 3PRTA 4R8FA 4UCPA 1IOIA 3QAYA 1YK3A 3NFZA 1XIXA 1TKJA 2Q4YA 2XEJA 1S7FA 1JWQA 4KZTA 4M3SA 2YNDA 3IWWA 5I0CA 2VZYA 4NGPA 5DWMA 2ODFA 2PJCA 2Y0MA 4LX9A 5IB0A 2PIYA 2V8HA 3BI0A 2B4DA 4NGTA 1F2OA 1F57A 2V8GA 4EVYA 4PXEA 4KLVA 2G3TA 1ELLP 2P6EA 4CAWA 5F48A 2PCUA 3R96A 2VI7A 5EBVA 3S6GA 3I9SA 1Y0YA 4KVOE 3DR6A 2IQ6A 2CNMA 4R3LA 3NH5A 4CYPA 1HEEA 3TO7A 1QMUA 3BJ7A 3D7HA 3FEEA 4OC4A 4MXUA 3H8FA 3FVLA 2ZEPA 4B10A 4DYOA 1KWMA 4DUKA 2Z0ZA 2Q4ZA 4M6HA 2Z3LA 3RYOA 2Z3NA 4GM5A 3CPAA 1NSLA 1I21A 4CGLA 3NE7A 4CPAA 1BOBA 2AFOA 4R6TA 4LQ6A 2F7VA 3D67A 4TWEA 3PB8X 1QSMA 2PJBA 5J8CA 3D2MA 2EK9A 1YREA 2PJ0A 5F09A 5H84A 1TF8A 1Z8XA 1GHEA 3D7FA 2FT0A 2EWBA 3R9EA
chains in the Genus database with same CATH topology
3IIBA 4ZYQA 4P4DA 3I1UA 3FF3A 2F8HA 4UF4A 5D8NA 3IFEA 2AFMA 4A39A 3NH4A 1Q7LA 4ONWA 1VIXA 3WC7A 4P6YA 4IK2A 3SJGA 1R3NA 4MHYA 1YSJA 4OMEA 2RB7A 3KL9A 5LYIA 5HVHA 2O53A 1YLOA 3LWUA 3PB7X 4ZY1A 1CPSA 4UEZA 3B35A 1YW6A 1BPMA 3TC8A 2C1CA 1GYTA 3S9LA 3D7DA 4ZY0A 2AFUA 1LANA 3B2YA 4IAVA 3FEDA 4Z65A 3B3VA 4K3NA 4G1PA 4WJBA 2GLJA 2ZENA 2O4HA 5LYDA 4PPZA 5DS0A 3PEIA 4OC3A 3RZAA 4OIDA 3PFOA 4A38A 2PJ6A 2AFZA 1FT7A 4EWTA 2AFXA 4ZX9A 3HLPA 3SJFA 4NJQA 1PYTB 2OR4A 5LYLA 4FUUA 4UEEA 4MCRA 4NGSA 3GB0A 4O23A 3BHXA 4MRIA 3KQZA 2V8DA 2AFSA 5I4MA 4WWVA 2PVVA 2HB6A 1XRYA 2PJ9A 2ZEDA 2BO9A 3KGQA 3D68A 4JYWA 3VARA 1HDQA 2PJ8A 2ZOFA 2ZEGA 2QYVA 3RBUA 3V38A 3FJUA 5JM6A 2C6PA 4R76A 1BPNA 2CF4A 4PXCA 1VGYA 2PJ4A 1ARMA 2ANPA 2ABZA 1LAMA 3CPXA 5HVGA 4PXDA 2JBJA 2OOTA 1CX8A 2ZELA 3MRUA 3SI2A 2VL1A 4P4IA 3ISZA 2PJ5A 2PE3A 4BD9A 3BXMA 1LFWA 1YW4A 3PBBA 4OP4A 4ZI6A 4F9VA 4KSIA 2G9DA 2GU2A 3N5FA 3PB6X 4ZX8A 4F9UA 1TXRA 5LRGA 3KI9A 2V8VA 4MHZA 5D29A 4A37A 2WZNA 3K2KA 2CTCA 3FMCA 2ZEFA 4R7MA 5J1QA 2ZEHA 1YMEA 2IMOA 3LMSA 4UIBA 1AYEA 1BLLE 4OKOA 3DLJA 1XFOA 1Y0RA 1ZG9A 3RAMA 4MHNA 5K8OA 4UIAA 4OC5A 2JEWA 4P44A 4NGQA 4P4JA 1F2PA 3SI0A 2C6GA 5JH9A 2HC9A 4B6ZA 2NYQA 3D4UA 1Y7EA 2GREA 1Z5RA 3HUVA 5LRKA 4AXVA 7CPAA 1TKHA 3FECA 3SJEA 2ZEEA 4P4FA 5IB9A 3CT9A 1RTQA 4W9YA 8CPAA 4X8IA 3IEHA 1Z8LA 2PJ2A 3KASA 3IC1A 3FX6A 1QQ9A 4RUHA 3D66A 4ZY2A 4H2KA 4YU9A 2PVWA 1LCPA 3B3WA 4MCPA 3NH8A 3KQXA 3MN8A 1DTDA 4IHMA 4OC1A 3WC6A 4P4EA 1CP7A 4X3RA 3WC5A 3D7GA 2I3CA 1XMBA 3TX8A 1ELMP 2Q51A 2XEGA 1DE4C 1XBUA 1ZLIA 1ARLA 3IJ3A 5JGFA 1ZG7A 3PB9X 3B3TA 4UEFA 2IJZA 1FNOA 5THWA 3NA6A 4Q7AA 3SI1A 4MHPA 3IO1A 5LRJA 4P45A 1NSAA 2BCOA 3VH9A 1OBRA 1VHOA 4EMEA 4LQGA 5K8MA 4NGMA 4FBEA 5CBMA 3H8GA 1CPXA 2XEFA 2JBKA 4NFRA 3FH4A 1LOKA 3KZWA 1IGBA 5ELYA 4FAIA 5CPAA 2C6CA 3PBEA 1HDUA 1AMPA 3GLJA 2ZEOA 1CG2A 2PJ7A 2Q43A 3WABA 1IY7A 2POKA 3VATA 4DJLA 3KHXA 6CPAA 1JQGA 4NJRA 1CP6A 4YWYA 1M4LA 4EFDA 3JRUA 2GLFA 1CBXA 3WT4A 2CTBA 3QNVA 5LYFA 4P4BA 1ZLHA 3PFEA 2J9AA 1Z2LA 3H8EA 3SJXA 4FWUA 3V7ZA 2DEAA 2PIZA 1ZG8A 3PB4X 2EK8A 3S9MA 4X2TA 2CIJA 1XJOA 2PRQA 2ZEMA 3KR5A 3B3SA 2V77A 3B3CA 1H8LA 4A94A 2FVGA 3L2NA 1UWYA 4JZ0A 2QJ8A 1LAPA 5HVFA 1PCAA 2PJ3A 3GUXA 5K8PA 4P10A 2PJ1A 5HXDA 3BI1A 3T8WA 3CDXA 1VHEA 1TF9A 3B7IA 2PJAA 4OC0A 4MMOA 4F8ZA 4TNUA 3K9TA 3KHZA 4PXBA 2ZOGA 3DGVA 1TKFA 3KR4A 4PQAA 1BAVA 4NGRA 2WYRA 5K8NA 3S9NA 4OC2A 2BOAA 1EE3P 2NSMA 4NGNA 4MCSA 2XEIA 4OIWA 4MCQA 1R43A 2QVPA 2AFWA 2RFHA 3ISXA 3PRTA 4R8FA 3NFZA 1TKJA 2XEJA 3IWWA 4NGPA 2PJCA 2PIYA 2V8HA 3BI0A 4NGTA 1F2OA 1F57A 2V8GA 4PXEA 1ELLP 2PCUA 1Y0YA 2IQ6A 3NH5A 1HEEA 1QMUA 3FEEA 3D7HA 4OC4A 4MXUA 3H8FA 3FVLA 2ZEPA 4DYOA 1KWMA 4DUKA 2Q4ZA 4GM5A 3CPAA 4CPAA 2AFOA 4R6TA 2F7VA 3D67A 4TWEA 3PB8X 2PJBA 2EK9A 2PJ0A 5F09A 1TF8A 3D7FA 2EWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIB A;  4ZYQ A;  4P4D A;  3I1U A;  3FF3 A;  2F8H A;  4UF4 A;  5D8N A;  3IFE A;  2AFM A;  4A39 A;  3NH4 A;  1Q7L A;  4ONW A;  1VIX A;  3WC7 A;  4P6Y A;  4IK2 A;  3SJG A;  1R3N A;  4MHY A;  1YSJ A;  4OME A;  2RB7 A;  3KL9 A;  5LYI A;  5HVH A;  2O53 A;  1YLO A;  3LWU A;  3PB7 X;  4ZY1 A;  1CPS A;  4UEZ A;  3B35 A;  1YW6 A;  1BPM A;  3TC8 A;  2C1C A;  1GYT A;  3S9L A;  3D7D A;  4ZY0 A;  2AFU A;  1LAN A;  3B2Y A;  4IAV A;  3FED A;  4Z65 A;  3B3V A;  4K3N A;  4G1P A;  4WJB A;  2GLJ A;  2ZEN A;  2O4H A;  5LYD A;  4PPZ A;  5DS0 A;  3PEI A;  4OC3 A;  3RZA A;  4OID A;  3PFO A;  4A38 A;  2PJ6 A;  2AFZ A;  1FT7 A;  4EWT A;  2AFX A;  4ZX9 A;  3HLP A;  3SJF A;  4NJQ A;  1PYT B;  2OR4 A;  5LYL A;  4FUU A;  4UEE A;  4MCR A;  4NGS A;  3GB0 A;  4O23 A;  3BHX A;  4MRI A;  3KQZ A;  2V8D A;  2AFS A;  5I4M A;  4WWV A;  2PVV A;  2HB6 A;  1XRY A;  2PJ9 A;  2ZED A;  2BO9 A;  3KGQ A;  3D68 A;  4JYW A;  3VAR A;  1HDQ A;  2PJ8 A;  2ZOF A;  2ZEG A;  2QYV A;  3RBU A;  3V38 A;  3FJU A;  5JM6 A;  2C6P A;  4R76 A;  1BPN A;  2CF4 A;  4PXC A;  1VGY A;  2PJ4 A;  1ARM A;  2ANP A;  2ABZ A;  1LAM A;  3CPX A;  5HVG A;  4PXD A;  2JBJ A;  2OOT A;  1CX8 A;  2ZEL A;  3MRU A;  3SI2 A;  2VL1 A;  4P4I A;  3ISZ A;  2PJ5 A;  2PE3 A;  4BD9 A;  3BXM A;  1LFW A;  1YW4 A;  3PBB A;  4OP4 A;  4ZI6 A;  4F9V A;  4KSI A;  2G9D A;  2GU2 A;  3N5F A;  3PB6 X;  4ZX8 A;  4F9U A;  1TXR A;  5LRG A;  3KI9 A;  2V8V A;  4MHZ A;  5D29 A;  4A37 A;  2WZN A;  3K2K A;  2CTC A;  3FMC A;  2ZEF A;  4R7M A;  5J1Q A;  2ZEH A;  1YME A;  2IMO A;  3LMS A;  4UIB A;  1AYE A;  1BLL E;  4OKO A;  3DLJ A;  1XFO A;  1Y0R A;  1ZG9 A;  3RAM A;  4MHN A;  5K8O A;  4UIA A;  4OC5 A;  2JEW A;  4P44 A;  4NGQ A;  4P4J A;  1F2P A;  3SI0 A;  2C6G A;  5JH9 A;  2HC9 A;  4B6Z A;  2NYQ A;  3D4U A;  1Y7E A;  2GRE A;  1Z5R A;  3HUV A;  5LRK A;  4AXV A;  7CPA A;  1TKH A;  3FEC A;  3SJE A;  2ZEE A;  4P4F A;  5IB9 A;  3CT9 A;  1RTQ A;  4W9Y A;  8CPA A;  4X8I A;  3IEH A;  1Z8L A;  2PJ2 A;  3KAS A;  3IC1 A;  3FX6 A;  1QQ9 A;  4RUH A;  3D66 A;  4ZY2 A;  4H2K A;  4YU9 A;  2PVW A;  1LCP A;  3B3W A;  4MCP A;  3NH8 A;  3KQX A;  3MN8 A;  1DTD A;  4IHM A;  4OC1 A;  3WC6 A;  4P4E A;  1CP7 A;  4X3R A;  3WC5 A;  3D7G A;  2I3C A;  1XMB A;  3TX8 A;  1ELM P;  2Q51 A;  2XEG A;  1DE4 C;  1XBU A;  1ZLI A;  1ARL A;  3IJ3 A;  5JGF A;  1ZG7 A;  3PB9 X;  3B3T A;  4UEF A;  2IJZ A;  1FNO A;  5THW A;  3NA6 A;  4Q7A A;  3SI1 A;  4MHP A;  3IO1 A;  5LRJ A;  4P45 A;  1NSA A;  2BCO A;  3VH9 A;  1OBR A;  1VHO A;  4EME A;  4LQG A;  5K8M A;  4NGM A;  4FBE A;  5CBM A;  3H8G A;  1CPX A;  2XEF A;  2JBK A;  4NFR A;  3FH4 A;  1LOK A;  3KZW A;  1IGB A;  5ELY A;  4FAI A;  5CPA A;  2C6C A;  3PBE A;  1HDU A;  1AMP A;  3GLJ A;  2ZEO A;  1CG2 A;  2PJ7 A;  2Q43 A;  3WAB A;  1IY7 A;  2POK A;  3VAT A;  4DJL A;  3KHX A;  6CPA A;  1JQG A;  4NJR A;  1CP6 A;  4YWY A;  1M4L A;  4EFD A;  3JRU A;  2GLF A;  1CBX A;  3WT4 A;  2CTB A;  3QNV A;  5LYF A;  4P4B A;  1ZLH A;  3PFE A;  2J9A A;  1Z2L A;  3H8E A;  3SJX A;  4FWU A;  3V7Z A;  2DEA A;  2PIZ A;  1ZG8 A;  3PB4 X;  2EK8 A;  3S9M A;  4X2T A;  2CIJ A;  1XJO A;  2PRQ A;  2ZEM A;  3KR5 A;  3B3S A;  2V77 A;  3B3C A;  1H8L A;  4A94 A;  2FVG A;  3L2N A;  1UWY A;  4JZ0 A;  2QJ8 A;  1LAP A;  5HVF A;  1PCA A;  2PJ3 A;  3GUX A;  5K8P A;  4P10 A;  2PJ1 A;  5HXD A;  3BI1 A;  3T8W A;  3CDX A;  1VHE A;  1TF9 A;  3B7I A;  2PJA A;  4OC0 A;  4MMO A;  4F8Z A;  4TNU A;  3K9T A;  3KHZ A;  4PXB A;  2ZOG A;  3DGV A;  1TKF A;  3KR4 A;  4PQA A;  1BAV A;  4NGR A;  2WYR A;  5K8N A;  3S9N A;  4OC2 A;  2BOA A;  1EE3 P;  2NSM A;  4NGN A;  4MCS A;  2XEI A;  4OIW A;  4MCQ A;  1R43 A;  2QVP A;  2AFW A;  2RFH A;  3ISX A;  3PRT A;  4R8F A;  3NFZ A;  1TKJ A;  2XEJ A;  3IWW A;  4NGP A;  2PJC A;  2PIY A;  2V8H A;  3BI0 A;  4NGT A;  1F2O A;  1F57 A;  2V8G A;  4PXE A;  1ELL P;  2PCU A;  1Y0Y A;  2IQ6 A;  3NH5 A;  1HEE A;  1QMU A;  3FEE A;  3D7H A;  4OC4 A;  4MXU A;  3H8F A;  3FVL A;  2ZEP A;  4DYO A;  1KWM A;  4DUK A;  2Q4Z A;  4GM5 A;  3CPA A;  4CPA A;  2AFO A;  4R6T A;  2F7V A;  3D67 A;  4TWE A;  3PB8 X;  2PJB A;  2EK9 A;  2PJ0 A;  5F09 A;  1TF8 A;  3D7F A;  2EWB A; 
#chains in the Genus database with same CATH topology
 5F47 A;  2K5T A;  3IIB A;  4ZYQ A;  1I12 A;  4P4D A;  3I1U A;  3FF3 A;  2F8H A;  2RC4 A;  4UF4 A;  5D8N A;  3FB3 A;  3IFE A;  2AFM A;  2HQY A;  2HUZ A;  4A39 A;  3NH4 A;  1Q7L A;  4ONW A;  1VIX A;  3WC7 A;  4H6Z A;  4QC6 A;  4P6Y A;  4IK2 A;  3SJG A;  1R3N A;  4MHY A;  2QML A;  1YSJ A;  4YGO A;  2FL4 A;  2Q0Y A;  4OME A;  4RS2 A;  1K4J A;  2I00 A;  2RB7 A;  4JXR A;  3KL9 A;  4CRZ B;  5A28 A;  1P0H A;  5LYI A;  5HVH A;  4IF5 A;  2O53 A;  1YLO A;  2ZXV A;  3JTK A;  3LWU A;  3PB7 X;  3DDD A;  3ZZI A;  4ZY1 A;  1CPS A;  1QSO A;  3B35 A;  4UEZ A;  1PU9 A;  1YW6 A;  1BPM A;  3TC8 A;  3OWC A;  2EO8 A;  1ON0 A;  2C1C A;  1SQH A;  5JPH A;  1GYT A;  4UCM A;  3D7D A;  4UFW A;  3S9L A;  4Q36 A;  4ZY0 A;  2AFU A;  4F6A A;  4FD7 A;  1LAN A;  3B2Y A;  2GFQ A;  4IAV A;  4KOV A;  4A30 A;  1S7K A;  3FED A;  1BO4 A;  4Z65 A;  3B3V A;  4K3N A;  4G1P A;  4NEX A;  4MHD A;  4WJB A;  4HNX B;  5GCN A;  3N7Z A;  5CNP A;  2GLJ A;  2ZEN A;  2O4H A;  5E96 A;  1VKC A;  5EC4 A;  1MJ9 A;  5LYD A;  4B5P B;  4PPZ A;  4XPK A;  2CY2 A;  3K9U A;  4MFL A;  3PEI A;  5DS0 A;  3RO0 A;  4CAX A;  4OC3 A;  1S3Z A;  3RZA A;  4OID A;  3PFO A;  4CYQ A;  2KCW A;  4A38 A;  4KVM E;  2AE6 A;  4KOW A;  4KSA A;  1S5K A;  4BBH A;  1TIQ A;  2PJ6 A;  4MBU A;  2EVN A;  2AFZ A;  1FT7 A;  3DSB A;  1A2Z A;  4EWT A;  1CJW A;  2AFX A;  2PR1 A;  3HLP A;  4ZX9 A;  3SJF A;  3R95 A;  4XPD B;  4NJQ A;  1PYT B;  2PC1 A;  2OR4 A;  3FBU A;  3V8I A;  5LYL A;  4FUU A;  4UEE A;  1P4N A;  4MCR A;  5IV0 A;  4NGS A;  1L0C A;  4MFJ A;  3UY5 A;  3GB0 A;  3KKW A;  4O23 A;  3BHX A;  4CYO A;  2Z3O A;  3KQZ A;  3CXP A;  4MRI A;  2V8D A;  4CGP A;  1M4D A;  2YNE A;  1Z8W A;  2AFS A;  3TO9 A;  4WWV A;  5I4M A;  4B11 A;  4ZGY B;  2PVV A;  1YQE A;  2HB6 A;  1XRY A;  2PJ9 A;  4F0Y A;  2J8R A;  2ZED A;  1NE9 A;  2BO9 A;  5G22 A;  1IB1 E;  3KGQ A;  3D68 A;  4CAV A;  4JYW A;  3VAR A;  4RN7 A;  5KTA A;  4M6I A;  3WR7 A;  1HDQ A;  3W91 A;  2PJ8 A;  1Q2C A;  2Z3K A;  2ZOF A;  4JJX A;  2Z3P A;  5ISV A;  1WK4 A;  1YR0 A;  2OU2 A;  2ZEG A;  2QYV A;  1FY7 A;  3RBU A;  2CNS A;  3V38 A;  3E0K A;  3W6X A;  2ZPA A;  3FJU A;  5JM6 A;  2C6P A;  3SXO A;  4R76 A;  1BPN A;  1Y7R A;  2CF4 A;  2YGW A;  2PQ8 A;  3CZX A;  4PSX A;  4PXC A;  4QVT A;  3F0A A;  1VGY A;  1N71 A;  2PJ4 A;  1VHS A;  2WPX A;  2WUU A;  1ARM A;  3EXN A;  2ANP A;  2ABZ A;  2I79 A;  1LAM A;  1ZO0 A;  2EBJ A;  3CPX A;  5HVG A;  1Q2Y A;  1IIC A;  1KUV A;  4PXD A;  2JBJ A;  2D4O A;  2ZW5 A;  1MJB A;  1CX8 A;  2OOT A;  2ZEL A;  3TOB A;  3MRU A;  3S6H A;  3CXQ A;  3GY9 A;  3SI2 A;  2C27 A;  4UFX A;  5AG6 A;  2VL1 A;  1IYK A;  4P4I A;  3ISZ A;  2B3U A;  2ATR A;  2PJ5 A;  3P2F A;  2PE3 A;  4BD9 A;  3BXM A;  3QB8 A;  3EC4 A;  1LFW A;  1YW4 A;  2Q4V A;  3PBB A;  4OP4 A;  3RNZ A;  4ZI6 A;  4CRY B;  4Y49 B;  2OZH A;  4F9V A;  2Q7S A;  4KS9 A;  4KSI A;  2G9D A;  2GU2 A;  3N5F A;  3PB6 X;  4ZBG A;  4ZX8 A;  4F9U A;  1TXR A;  4MFQ A;  4AG9 A;  2PR8 A;  1KUY A;  4XPD C;  5LRG A;  4MFK A;  1B6B A;  4OAE A;  3KI9 A;  2GE3 A;  2V8V A;  4MFP A;  4MHZ A;  5D29 A;  4A37 A;  2WZN A;  1YLE A;  4KUB A;  4NCZ A;  2P6G A;  2O28 A;  3K2K A;  2CTC A;  3FMC A;  3H4Q A;  3GKR A;  2R98 A;  2Q04 A;  4IUS A;  2ZEF A;  5C88 A;  4E0A A;  2G3A A;  4MY0 A;  4R7M A;  4CGM A;  3P2H A;  2WSA A;  5J1Q A;  3I3G A;  2ZEH A;  1YME A;  2IMO A;  3F8K A;  3LMS A;  1WWZ A;  4U9Y A;  4UIB A;  5AG7 A;  5IX3 A;  1AYE A;  3R9F A;  1BLL E;  4OKO A;  3DLJ A;  4B5P A;  1XFO A;  1Y0R A;  1ZG9 A;  2DF5 A;  4MHN A;  3RAM A;  5K8O A;  4UIA A;  4R9M A;  4A95 A;  4OC5 A;  2OZG A;  2JEW A;  4P44 A;  4NGQ A;  4P4J A;  1F2P A;  2CXA A;  3SI0 A;  5HMN A;  2C6G A;  4BMH A;  5JH9 A;  2HC9 A;  4CGO A;  4B6Z A;  3S6F A;  2NYQ A;  3D4U A;  4C2Y A;  1Y7E A;  4KOX A;  2GIV A;  2Q44 A;  3EO4 A;  2GRE A;  4C7I A;  1U6M A;  1Z5R A;  4FD6 A;  4CAE A;  4KOU A;  5HH1 A;  3HUV A;  5LRK A;  2JDD A;  4CAF A;  4PK2 A;  1MK4 A;  4AXV A;  3TT2 A;  3A9L A;  2NMT A;  3D2P A;  4OAD A;  7CPA A;  1XF8 A;  1S60 A;  1TKH A;  1KUX A;  3FEC A;  4HNW B;  3SJE A;  5F46 A;  2FIA A;  1Z4R A;  3TCV A;  2ZEE A;  4P4F A;  4Q38 A;  2FIW A;  4AVA A;  5IB9 A;  3CT9 A;  4XPL A;  2J8M A;  1IYL A;  1RTQ A;  4W9Y A;  5G21 A;  4AG7 A;  8CPA A;  2VEZ A;  4X8I A;  3IEH A;  3C26 A;  1Z8L A;  2PJ2 A;  4Y49 C;  4CYN A;  3KAS A;  3IC1 A;  4MJ8 A;  3PGP A;  3H5Z A;  2IL4 A;  2VBQ A;  3ZJ0 A;  1M44 A;  4M85 A;  3FX6 A;  1QQ9 A;  4RUH A;  3D66 A;  4J3G A;  4H2K A;  4YU9 A;  3BJ8 A;  4ZY2 A;  1UFH A;  2Z10 A;  4RI1 A;  2PVW A;  4HKF A;  4B13 A;  3VWE A;  1LCP A;  3B3W A;  3LAC A;  4MCP A;  1J4J A;  3NH8 A;  3T9Y A;  2BEI A;  3KQX A;  1DTD A;  1QSR A;  1XEB A;  3MN8 A;  4IHM A;  5AG5 A;  4A33 A;  3D8P A;  4OC1 A;  3WC6 A;  4KVX A;  4P4E A;  3G8W A;  1CP7 A;  4X3R A;  4HNY B;  4KOT A;  4MI4 A;  3WC5 A;  2B5G A;  3D7G A;  2R7H A;  5AG4 A;  2FS5 A;  2I3C A;  3IU1 A;  2VZZ A;  1XMB A;  2QEC A;  1XMT A;  5KTC A;  3TX8 A;  1ELM P;  2B58 A;  2Q51 A;  2XEG A;  4R3K A;  3BLN A;  1DE4 C;  1XBU A;  1ZLI A;  1ARL A;  3IJ3 A;  2Z3M A;  5JGF A;  1ZG7 A;  2DPS A;  1Z4E A;  3GIU A;  5FVJ A;  2YNC A;  3PB9 X;  3B3T A;  4UEF A;  2IJZ A;  4BIN A;  1FNO A;  3TTH A;  4A32 A;  3JUW A;  5THW A;  4B5O A;  2B5G B;  1R57 A;  1YGH A;  4FD5 A;  2BUE A;  2EUI A;  1YX0 A;  3NA6 A;  3EFA A;  4Q7A A;  2F5I A;  3SI1 A;  4MHP A;  3DR8 A;  4KOS A;  3IO1 A;  2ARH A;  5LRJ A;  4NSQ A;  4P45 A;  4U9Z A;  1NSA A;  2BCO A;  2FCK A;  2FE7 A;  3VH9 A;  5JQ4 A;  4QUS A;  1OBR A;  5G20 A;  1VHO A;  3NE8 A;  4MFZ A;  1IU8 A;  4EME A;  4LQG A;  4XNH B;  2J8N A;  4H6U A;  4JXQ A;  2WPW A;  4NGM A;  5K8M A;  4FBE A;  5CBM A;  1S7L A;  3H8G A;  4M6G A;  1Z9U A;  2A4N A;  1CPX A;  1XOV A;  2PDO A;  2XEF A;  1KZF A;  2ZW7 A;  3TOA A;  4AVC A;  2JBK A;  4E8O A;  3TO6 A;  4AVB A;  4NFR A;  2Q7B A;  3FH4 A;  1B87 A;  1LOK A;  1XE4 A;  2JLM A;  3KZW A;  2OB0 A;  1IGB A;  5ELY A;  1LRZ A;  4FAI A;  5CPA A;  2C6C A;  3FRM A;  1YVK A;  3PBE A;  3VWD A;  1HDU A;  4F0X A;  4QB9 A;  1AMP A;  3TE4 A;  3GLJ A;  2ZEO A;  1CG2 A;  3FXT A;  4C2X A;  2PJ7 A;  2Q43 A;  3WAB A;  1IY7 A;  2QIR A;  1Y9K A;  3QAH A;  2POK A;  4UCN A;  3VAT A;  2ZW4 A;  4DJL A;  3KHX A;  1QST A;  4GXH A;  6CPA A;  3IU2 A;  1JQG A;  4NJR A;  1CP6 A;  2GAN A;  4R57 A;  4YWY A;  4U5Y A;  4KUA A;  1M4L A;  4KOY A;  2B4D B;  2OZU A;  3IWE A;  4MY3 A;  2B3V A;  4EFD A;  4X5K A;  3JRU A;  2GLF A;  1CBX A;  3WT4 A;  4CS0 B;  1RXT A;  2CTB A;  3QNV A;  5LYF A;  5C82 A;  4P4B A;  1ZLH A;  3PFE A;  2J9A A;  1Z2L A;  4I49 A;  3H8E A;  2DPT A;  3FIX A;  3SJX A;  4II9 A;  4C68 A;  3IGR A;  4FWU A;  2JEV A;  3EY5 A;  3V7Z A;  2VQY A;  2DEA A;  2PIZ A;  1ZG8 A;  5F49 A;  1X10 A;  3CXS A;  4PV6 A;  3PB4 X;  1IOF A;  2EK8 A;  3S9M A;  1RO5 A;  1M4G A;  2PRB A;  2CIJ A;  1XJO A;  3FYN A;  4X2T A;  4A2Z A;  2D4P A;  4KSF A;  3R9G A;  5DWN A;  2PRQ A;  3PZJ A;  2ZEM A;  3SXN A;  2G0B A;  3KR5 A;  3B3S A;  2V77 A;  3B3C A;  4QBJ A;  5KTD A;  4UWI A;  1H8L A;  5BWA B;  1CM0 A;  4GS4 A;  4KLW A;  4A94 A;  4L89 A;  4HPS A;  3S6K A;  2FVG A;  3W6S A;  5A27 A;  4A31 A;  1YVO A;  1Q2D A;  3L2N A;  1UWY A;  3JVN A;  4H89 A;  4NXY A;  4CGN A;  4JZ0 A;  2B4B A;  3G3S A;  2X7B A;  2PSW A;  2QJ8 A;  1LAP A;  5HVF A;  3LOD A;  4XNH C;  1MJA A;  2JDC A;  3T90 A;  4C2Z A;  1PCA A;  1S7N A;  2YNC C;  2PJ3 A;  2R8V A;  4YRH A;  4ONU A;  3F5B A;  2REE A;  3IWG A;  1Y9W A;  2OH1 A;  3GUX A;  5K8P A;  1M4I A;  1V0C A;  4K30 A;  4P10 A;  2PJ1 A;  1M1D A;  4JWP A;  5HXD A;  3BI1 A;  3R1K A;  3TFY A;  4YFJ A;  2FSR A;  3T8W A;  3CDX A;  2CNT A;  1PUA A;  1VHE A;  4B12 A;  4L8A A;  2P6F A;  2HV2 A;  1TF9 A;  3B7I A;  4R87 A;  2PJA A;  4PSW A;  3B8G A;  5J8F A;  3DNS A;  4OC0 A;  4FD4 A;  4MMO A;  4F8Z A;  4E2A A;  2REF A;  4TNU A;  4UWJ A;  2ZW6 A;  3FNC A;  3K9T A;  3KHZ A;  4PXB A;  2ZOG A;  5EMI A;  3DGV A;  4JD6 A;  1TKF A;  4OLL A;  3KR4 A;  2BL1 A;  4PQA A;  2AJ6 A;  2DXQ A;  1BAV A;  4DNC A;  4NF1 A;  2Z11 A;  1Z8T A;  4NGR A;  4ORF A;  5H86 A;  2BSW A;  2WYR A;  2VXK A;  4KOR A;  5K8N A;  3S9N A;  4UBR A;  3PP9 A;  4B14 A;  4OC2 A;  4AB7 A;  1X12 A;  2BOA A;  1I1D A;  2FXF A;  4C7H A;  3GYA A;  1EE3 P;  4UFV A;  2NSM A;  1QSN A;  2H5M A;  4NGN A;  4MCS A;  2XEI A;  3D3S A;  5AGE A;  4UA3 A;  5G1Z A;  3SHP A;  4OIW A;  1IID A;  1AUG A;  4MCQ A;  1OZP A;  3LD2 A;  4LUA A;  3MGD A;  1NMT A;  4PK3 A;  2P0W A;  2R1I A;  1R43 A;  4JLY A;  2QVP A;  2AFW A;  2RFH A;  3ISX A;  3PRT A;  4R8F A;  4UCP A;  1IOI A;  3QAY A;  1YK3 A;  3NFZ A;  1XIX A;  1TKJ A;  2Q4Y A;  2XEJ A;  1S7F A;  1JWQ A;  4KZT A;  4M3S A;  2YND A;  3IWW A;  5I0C A;  2VZY A;  4NGP A;  5DWM A;  2ODF A;  2PJC A;  2Y0M A;  4LX9 A;  5IB0 A;  2PIY A;  2V8H A;  3BI0 A;  2B4D A;  4NGT A;  1F2O A;  1F57 A;  2V8G A;  4EVY A;  4PXE A;  4KLV A;  2G3T A;  1ELL P;  2P6E A;  4CAW A;  5F48 A;  2PCU A;  3R96 A;  2VI7 A;  5EBV A;  3S6G A;  3I9S A;  1Y0Y A;  4KVO E;  3DR6 A;  2IQ6 A;  2CNM A;  4R3L A;  3NH5 A;  4CYP A;  1HEE A;  3TO7 A;  1QMU A;  3BJ7 A;  3D7H A;  3FEE A;  4OC4 A;  4MXU A;  3H8F A;  3FVL A;  2ZEP A;  4B10 A;  4DYO A;  1KWM A;  4DUK A;  2Z0Z A;  2Q4Z A;  4M6H A;  2Z3L A;  3RYO A;  2Z3N A;  4GM5 A;  3CPA A;  1NSL A;  1I21 A;  4CGL A;  3NE7 A;  4CPA A;  1BOB A;  2AFO A;  4R6T A;  4LQ6 A;  2F7V A;  3D67 A;  4TWE A;  3PB8 X;  1QSM A;  2PJB A;  5J8C A;  3D2M A;  2EK9 A;  1YRE A;  2PJ0 A;  5F09 A;  5H84 A;  1TF8 A;  1Z8X A;  1GHE A;  3D7F A;  2FT0 A;  2EWB A;  3R9E A; 
#chains in the Genus database with same CATH homology
 3IIB A;  4ZYQ A;  4P4D A;  3I1U A;  3FF3 A;  2F8H A;  4UF4 A;  5D8N A;  3IFE A;  2AFM A;  4A39 A;  3NH4 A;  1Q7L A;  4ONW A;  1VIX A;  3WC7 A;  4P6Y A;  4IK2 A;  3SJG A;  1R3N A;  4MHY A;  1YSJ A;  4OME A;  2RB7 A;  3KL9 A;  5LYI A;  5HVH A;  2O53 A;  1YLO A;  3LWU A;  3PB7 X;  4ZY1 A;  1CPS A;  4UEZ A;  3B35 A;  1YW6 A;  1BPM A;  3TC8 A;  2C1C A;  1GYT A;  3S9L A;  3D7D A;  4ZY0 A;  2AFU A;  1LAN A;  3B2Y A;  4IAV A;  3FED A;  4Z65 A;  3B3V A;  4K3N A;  4G1P A;  4WJB A;  2GLJ A;  2ZEN A;  2O4H A;  5LYD A;  4PPZ A;  5DS0 A;  3PEI A;  4OC3 A;  3RZA A;  4OID A;  3PFO A;  4A38 A;  2PJ6 A;  2AFZ A;  1FT7 A;  4EWT A;  2AFX A;  4ZX9 A;  3HLP A;  3SJF A;  4NJQ A;  1PYT B;  2OR4 A;  5LYL A;  4FUU A;  4UEE A;  4MCR A;  4NGS A;  3GB0 A;  4O23 A;  3BHX A;  4MRI A;  3KQZ A;  2V8D A;  2AFS A;  5I4M A;  4WWV A;  2PVV A;  2HB6 A;  1XRY A;  2PJ9 A;  2ZED A;  2BO9 A;  3KGQ A;  3D68 A;  4JYW A;  3VAR A;  1HDQ A;  2PJ8 A;  2ZOF A;  2ZEG A;  2QYV A;  3RBU A;  3V38 A;  3FJU A;  5JM6 A;  2C6P A;  4R76 A;  1BPN A;  2CF4 A;  4PXC A;  1VGY A;  2PJ4 A;  1ARM A;  2ANP A;  2ABZ A;  1LAM A;  3CPX A;  5HVG A;  4PXD A;  2JBJ A;  2OOT A;  1CX8 A;  2ZEL A;  3MRU A;  3SI2 A;  2VL1 A;  4P4I A;  3ISZ A;  2PJ5 A;  2PE3 A;  4BD9 A;  3BXM A;  1LFW A;  1YW4 A;  3PBB A;  4OP4 A;  4ZI6 A;  4F9V A;  4KSI A;  2G9D A;  2GU2 A;  3N5F A;  3PB6 X;  4ZX8 A;  4F9U A;  1TXR A;  5LRG A;  3KI9 A;  2V8V A;  4MHZ A;  5D29 A;  4A37 A;  2WZN A;  3K2K A;  2CTC A;  3FMC A;  2ZEF A;  4R7M A;  5J1Q A;  2ZEH A;  1YME A;  2IMO A;  3LMS A;  4UIB A;  1AYE A;  1BLL E;  4OKO A;  3DLJ A;  1XFO A;  1Y0R A;  1ZG9 A;  3RAM A;  4MHN A;  5K8O A;  4UIA A;  4OC5 A;  2JEW A;  4P44 A;  4NGQ A;  4P4J A;  1F2P A;  3SI0 A;  2C6G A;  5JH9 A;  2HC9 A;  4B6Z A;  2NYQ A;  3D4U A;  1Y7E A;  2GRE A;  1Z5R A;  3HUV A;  5LRK A;  4AXV A;  7CPA A;  1TKH A;  3FEC A;  3SJE A;  2ZEE A;  4P4F A;  5IB9 A;  3CT9 A;  1RTQ A;  4W9Y A;  8CPA A;  4X8I A;  3IEH A;  1Z8L A;  2PJ2 A;  3KAS A;  3IC1 A;  3FX6 A;  1QQ9 A;  4RUH A;  3D66 A;  4ZY2 A;  4H2K A;  4YU9 A;  2PVW A;  1LCP A;  3B3W A;  4MCP A;  3NH8 A;  3KQX A;  3MN8 A;  1DTD A;  4IHM A;  4OC1 A;  3WC6 A;  4P4E A;  1CP7 A;  4X3R A;  3WC5 A;  3D7G A;  2I3C A;  1XMB A;  3TX8 A;  1ELM P;  2Q51 A;  2XEG A;  1DE4 C;  1XBU A;  1ZLI A;  1ARL A;  3IJ3 A;  5JGF A;  1ZG7 A;  3PB9 X;  3B3T A;  4UEF A;  2IJZ A;  1FNO A;  5THW A;  3NA6 A;  4Q7A A;  3SI1 A;  4MHP A;  3IO1 A;  5LRJ A;  4P45 A;  1NSA A;  2BCO A;  3VH9 A;  1OBR A;  1VHO A;  4EME A;  4LQG A;  5K8M A;  4NGM A;  4FBE A;  5CBM A;  3H8G A;  1CPX A;  2XEF A;  2JBK A;  4NFR A;  3FH4 A;  1LOK A;  3KZW A;  1IGB A;  5ELY A;  4FAI A;  5CPA A;  2C6C A;  3PBE A;  1HDU A;  1AMP A;  3GLJ A;  2ZEO A;  1CG2 A;  2PJ7 A;  2Q43 A;  3WAB A;  1IY7 A;  2POK A;  3VAT A;  4DJL A;  3KHX A;  6CPA A;  1JQG A;  4NJR A;  1CP6 A;  4YWY A;  1M4L A;  4EFD A;  3JRU A;  2GLF A;  1CBX A;  3WT4 A;  2CTB A;  3QNV A;  5LYF A;  4P4B A;  1ZLH A;  3PFE A;  2J9A A;  1Z2L A;  3H8E A;  3SJX A;  4FWU A;  3V7Z A;  2DEA A;  2PIZ A;  1ZG8 A;  3PB4 X;  2EK8 A;  3S9M A;  4X2T A;  2CIJ A;  1XJO A;  2PRQ A;  2ZEM A;  3KR5 A;  3B3S A;  2V77 A;  3B3C A;  1H8L A;  4A94 A;  2FVG A;  3L2N A;  1UWY A;  4JZ0 A;  2QJ8 A;  1LAP A;  5HVF A;  1PCA A;  2PJ3 A;  3GUX A;  5K8P A;  4P10 A;  2PJ1 A;  5HXD A;  3BI1 A;  3T8W A;  3CDX A;  1VHE A;  1TF9 A;  3B7I A;  2PJA A;  4OC0 A;  4MMO A;  4F8Z A;  4TNU A;  3K9T A;  3KHZ A;  4PXB A;  2ZOG A;  3DGV A;  1TKF A;  3KR4 A;  4PQA A;  1BAV A;  4NGR A;  2WYR A;  5K8N A;  3S9N A;  4OC2 A;  2BOA A;  1EE3 P;  2NSM A;  4NGN A;  4MCS A;  2XEI A;  4OIW A;  4MCQ A;  1R43 A;  2QVP A;  2AFW A;  2RFH A;  3ISX A;  3PRT A;  4R8F A;  3NFZ A;  1TKJ A;  2XEJ A;  3IWW A;  4NGP A;  2PJC A;  2PIY A;  2V8H A;  3BI0 A;  4NGT A;  1F2O A;  1F57 A;  2V8G A;  4PXE A;  1ELL P;  2PCU A;  1Y0Y A;  2IQ6 A;  3NH5 A;  1HEE A;  1QMU A;  3FEE A;  3D7H A;  4OC4 A;  4MXU A;  3H8F A;  3FVL A;  2ZEP A;  4DYO A;  1KWM A;  4DUK A;  2Q4Z A;  4GM5 A;  3CPA A;  4CPA A;  2AFO A;  4R6T A;  2F7V A;  3D67 A;  4TWE A;  3PB8 X;  2PJB A;  2EK9 A;  2PJ0 A;  5F09 A;  1TF8 A;  3D7F A;  2EWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...