1M4IA

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and kanamycin a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 2'-N-acetyltransferase
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 52
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m4iA00
3S6KA 2Z0ZA 2B4BA 2OB0A 1M4GA 1YK3A 2CY2A 2FXFA 3TO9A 2VQYA 2FIWA 4NEXA 4UBRA 4KOYA 1CJWA 2FE7A 3DNSA 4XPDB 2REFA 3LD2A 4PK2A 4HNWB 4I49A 3SXOA 3BJ8A 4NSQA 3RYOA 4DNCA 1S5KA 4OADA 3F8KA 4XNHB 1S7FA 1Z4RA 3F0AA 3F5BA 1S60A 3FRMA 4CRYB 4YGOA 1IB1E 2Q44A 2JDDA 1VHSA 4X5KA 2QIRA 3GKRA 1GHEA 2ZPAA 2ZW6A 3TO6A 3FXTA 3DR6A 4YRHA 3G3SA 3TT2A 4KZTA 2PC1A 1N71A 4H6ZA 3W6XA 2JDCA 2P6GA 3TTHA 4B5PB 5KTCA 4CS0B 4HNYB 3QAHA 1J4JA 1M44A 3FNCA 3TOBA 2Q04A 1QSMA 5EC4A 2BL1A 4JJXA 1Q2YA 5C82A 4KOSA 2ZW4A 3LODA 2GE3A 2FCKA 3IWGA 1XMTA 2O28A 4B5OA 4M3SA 4OLLA 3VWEA 3WR7A 4KUBA 2VZYA 4RI1A 1K4JA 1L0CA 1YVOA 2CNTA 1S7KA 2G3TA 2FT0A 3QB8A 4K30A 4Y49C 4CAXA 1R57A 1KUYA 5JPHA 4R3LA 5IV0A 2VBQA 4Y49B 2VI7A 4HNXB 2B5GA 3I9SA 2CNMA 5JQ4A 3DDDA 5ISVA 3B8GA 3D3SA 2BSWA 1WWZA 1YVKA 2DXQA 2P0WA 2G3AA 2H5MA 3D2MA 2A4NA 2I00A 1PUAA 2GANA 5HMNA 3S6GA 3I3GA 4ONUA 4MY3A 4KVXA 5H84A 3FBUA 2P6EA 3H4QA 4CRZB 1KUXA 4FD7A 4XPLA 4AG9A 4FD5A 4XPDC 3S6HA 2OZGA 3IGRA 3T9YA 2J8RA 1XEBA 2B4DA 2HV2A 4R57A 2HQYA 2ZW7A 4R9MA 2Q4YA 1SQHA 5F48A 2FL4A 4F6AA 3CXQA 4KOVA 3JVNA 4AVCA 4PK3A 2ATRA 4JWPA 4XNHC 5I0CA 1Y9WA 4AB7A 4UWJA 2PR1A 4PSWA 1BOBA 3EO4A 1XE4A 2PRBA 3UY5A 3V8IA 4R3KA 3MGDA 4CAVA 3CXSA 3W91A 4H6UA 4KLWA 4U5YA 3BLNA 3PGPA 5EBVA 4MI4A 3R9FA 2HUZA 1CM0A 4UA3A 5IX3A 4IF5A 3TE4A 2C27A 4F0YA 3R95A 3TO7A 1XIXA 1KUVA 1M4IA 2AE6A 3W6SA 5GCNA 5DWMA 2QECA 2WPWA 2OZUA 3JUWA 4NF1A 1OZPA 4AG7A 4QB9A 4XPKA 2ZW5A 2P6FA 1B87A 3K9UA 4MJ8A 3SXNA 1WK4A 1RXTA 1IIDA 4KORA 1IICA 1MJ9A 5KTDA 2EUIA 2FS5A 1S7NA 1Q2CA 2PQ8A 4NCZA 1V0CA 5E96A 1P0HA 1P4NA 4ORFA 3SHPA 3R96A 3N7ZA 1S3ZA 1I21A 2Z10A 2JLMA 1Z4EA 4L8AA 4QC6A 1Y7RA 1VKCA 5C88A 3ZJ0A 5J8FA 3EFAA 4JXRA 2R7HA 4RS2A 2D4PA 1I12A 3DSBA 2R98A 2WPXA 3ZZIA 3D2PA 2ARHA 2REEA 1Q2DA 5CNPA 2ZXVA 4JD6A 4YFJA 4KUAA 2IL4A 1MJAA 1M4DA 4BMHA 1U6MA 3P2HA 3T90A 4ZBGA 2J8NA 2KCWA 3GY9A 4QBJA 2R1IA 3VWDA 3EY5A 5DWNA 1YGHA 2BEIA 1IYLA 1NE9A 3CXPA 1LRZA 4PSXA 4H89A 2AJ6A 4JLYA 2PDOA 3PZJA 4KLVA 3FYNA 3C26A 2OU2A 1B6BA 3R1KA 4L89A 2OH1A 2Q0YA 1PU9A 5FVJA 4LUAA 1RO5A 3GYAA 2K5TA 4II9A 3P2FA 1IYKA 1UFHA 3TCVA 1KZFA 2G0BA 4FD6A 2VZZA 1QSNA 1MK4A 2PR8A 3TFYA 2GIVA 4U9YA 2NMTA 2RC4A 1Y9KA 4QUSA 4AVAA 4KOWA 4CAWA 3EXNA 2B3VA 2EVNA 4KOTA 2B58A 3FIXA 3R9EA 2BUEA 4NXYA 1FY7A 4KVOE 4KOXA 1XF8A 2PSWA 3G8WA 4PV6A 4E0AA 4E2AA 1QSTA 2D4OA 2JEVA 2FSRA 2CNSA 4KVME 4JXQA 2FIAA 4MHDA 1YREA 1MJBA 2Q4VA 2VEZA 4J3GA 3DR8A 1YX0A 3PP9A 3EC4A 4B5PA 3D8PA 2F5IA 2OZHA 4MBUA 4LX9A 4QVTA 1BO4A 3FB3A 1I1DA 4KOUA 1ON0A 3KKWA 5F47A 1QSRA 5IB0A 4MY0A 1QSOA 3TOAA 2B3UA 2Y0MA 5F49A 2VXKA 1S7LA 1Z9UA 5KTAA 2J8MA 4U9ZA 4E8OA 2B5GB 5H86A 4IUSA 4R87A 2Z11A 5J8CA 4M85A 5HH1A 2I79A 4GS4A 4EVYA 1YR0A 2X7BA 3OWCA 4AVBA 2R8VA 1NMTA 4UWIA 5F46A 3BJ7A 4FD4A 1TIQA 4HKFA 2B4DB 1M1DA 2Q7BA 3R9GA 4OAEA 1NSLA 3S6FA 3E0KA 3NE7A 1YLEA 2QMLA
chains in the Genus database with same CATH superfamily
3KR5A 4GXHA 3WC5A 3S6KA 1ELLP 2B4BA 2Z0ZA 4MFKA 4OC2A 3RNZA 2OB0A 2RB7A 2BO9A 1M4GA 1YK3A 2PJ0A 2CY2A 1CP6A 3FMCA 4OC1A 2FXFA 3TO9A 2VQYA 4B13A 2FIWA 3ISXA 3GIUA 4NEXA 1PCAA 1Z8TA 2WZNA 4KOYA 4UBRA 4CGLA 2O53A 4ZX9A 1CJWA 3LACA 2FE7A 4KSIA 3KR4A 3DNSA 1YW6A 2ANPA 2PJ3A 1ZO0A 3GLJA 3QAYA 4NJQA 4XPDB 2REFA 5EMIA 4MCQA 3LD2A 5J1QA 4PK2A 4DJLA 4HNWB 4I49A 2V77A 3BHXA 4OC0A 3BJ8A 3SXOA 4Z65A 5JM6A 3B2YA 1TF8A 4NSQA 3RYOA 4DNCA 5AG4A 1BLLE 4P4DA 1S5KA 5HVFA 4NGPA 4OADA 2AFXA 3F8KA 4XNHB 1S7FA 4FUUA 1Z4RA 4UEZA 1ZLHA 3F0AA 3NH5A 3F5BA 1S60A 4R76A 4C2YA 3D67A 3FRMA 4M6IA 4YGOA 1IB1E 1VGYA 1AYEA 4CRYB 1CP7A 5AGEA 1IOIA 1M4LA 2Z3NA 2Q44A 2JDDA 2PVWA 3FJUA 1XBUA 4NGRA 1VHSA 1PYTB 2ZEPA 4HPSA 4X5KA 2QIRA 3GKRA 3D7FA 3KHZA 3KASA 1GHEA 3D7HA 5AG5A 2ZPAA 2ZW6A 1Q7LA 4P4BA 3TO6A 3FXTA 4KSAA 4CYOA 3DR6A 4YRHA 3G3SA 5LRKA 3TT2A 2CIJA 4KZTA 1ZLIA 3IIBA 2PC1A 1N71A 4H6ZA 3DGVA 2HC9A 4C2ZA 3GUXA 3W6XA 2JDCA 2P6GA 3TTHA 4JZ0A 4B5PB 3KHXA 4PXCA 5KTCA 2GREA 4A37A 4CS0B 1XFOA 2V8HA 4HNYB 3FX6A 5HVHA 3QAHA 2ODFA 2PJ1A 1F2PA 1J4JA 3I1UA 1AUGA 1M44A 3FNCA 3HUVA 4CAFA 4NGMA 2AFMA 3T8WA 3TOBA 2J9AA 3D68A 3VH9A 2Q04A 3IU1A 1QSMA 1XJOA 1LCPA 2VL1A 5EC4A 2PJAA 2BL1A 4JJXA 3BXMA 1Q2YA 4MFQA 5C82A 4OC3A 4KOSA 2ZW4A 3LODA 3CT9A 4CAEA 4P44A 2GE3A 1Y0YA 2FCKA 2XEIA 3IWGA 1LANA 3FECA 4MHPA 1X10A 3SI0A 1XMTA 5LYDA 2O28A 3S9LA 4A2ZA 4B5OA 4P4EA 4RN7A 4M3SA 4C2XA 2EK9A 4A33A 1TKJA 4OLLA 3VWEA 4OIWA 3WR7A 4KUBA 2V8GA 2VZYA 1RTQA 3JRUA 2PIYA 4A95A 4FAIA 4RI1A 1XOVA 3SJFA 1K4JA 4GM5A 3B3WA 3PBEA 4X8IA 3PB7X 1L0CA 1YVOA 2GLJA 2CNTA 1S7KA 3RBUA 2Q43A 4OC5A 2G3TA 2FT0A 3QB8A 4K30A 4Y49C 4CYPA 1X12A 4NGSA 2AFUA 4UCMA 4CAXA 1R57A 1KUYA 5JPHA 3WC6A 4R3LA 2ABZA 1A2ZA 2GFQA 4B11A 4ZI6A 2G9DA 5IV0A 3H8GA 2ZEFA 4WJBA 4BINA 2VBQA 4Y49B 4UEEA 1TKHA 3GB0A 2VI7A 5JH9A 4HNXB 2AFZA 2B5GA 3I9SA 2CNMA 5JQ4A 6CPAA 5G21A 1BAVA 3DDDA 5ISVA 5G20A 2BCOA 3B8GA 2BSWA 3D3SA 1WWZA 1YVKA 2DXQA 4NGNA 4Q36A 4UEFA 2P0WA 1FNOA 2G3AA 2H5MA 2ZEHA 3D2MA 2A4NA 2I00A 4OIDA 1PUAA 1IOFA 4ZY0A 4FWUA 2GANA 5HMNA 1F2OA 4W9YA 2PE3A 3S6GA 1CBXA 3I3GA 4ONUA 4MY3A 1Z2LA 3PBBA 4KVXA 4MCSA 5H84A 3FBUA 2P6EA 3H4QA 2BOAA 4CRZB 1KUXA 3CZXA 2QYVA 4FD7A 4OP4A 4XPLA 2ZENA 4FD5A 4MFLA 4AG9A 4PQAA 4XPDC 4OKOA 3S6HA 2OZGA 3IGRA 3T9YA 2J8RA 1XEBA 2B4DA 2EK8A 2HV2A 2HQYA 2PRQA 2ZW7A 4M6HA 4R57A 3D7GA 2POKA 4R9MA 5THWA 2Q4YA 1SQHA 5F48A 2FL4A 1CG2A 1HEEA 4MCRA 3CXQA 4KOVA 4F6AA 3IC1A 3JVNA 1R3NA 4MHYA 4PK3A 3S9MA 4AVCA 5DS0A 2ATRA 5ELYA 4JWPA 4XNHC 5I0CA 1ZG7A 1Y9WA 2CTBA 4P10A 4AB7A 4UWJA 2PR1A 4PSWA 1BOBA 3JTKA 2PJ9A 3EO4A 4ZGYB 1XE4A 2Z3MA 1NSAA 4Q38A 3MN8A 3PB9X 3SJXA 1YW4A 3PB4X 2PRBA 1F57A 5AG6A 3UY5A 3MRUA 4ZX8A 4P4FA 3V8IA 4R3KA 3MGDA 4CAVA 3CXSA 2WYRA 3FVLA 4H6UA 4KLWA 3W91A 4U5YA 3BLNA 3PGPA 4OC4A 2PCUA 5EBVA 2ZELA 2Q7SA 4MI4A 3R9FA 1TKFA 2HUZA 2JBJA 2YNCC 1CM0A 2ZOFA 4IHMA 3D4UA 3IWEA 4UA3A 5IX3A 1LAPA 4IF5A 3S9NA 3TE4A 2C27A 4F0YA 1CX8A 2DF5A 3R95A 3TO7A 4F9UA 1XIXA 1HDUA 4P6YA 1DE4C 1KUVA 4G1PA 4A38A 3K2KA 4YU9A 1GYTA 4MRIA 5I4MA 1M4IA 2ZEMA 2AE6A 3W6SA 3B3VA 5GCNA 2PJ7A 4O23A 4PXBA 5DWMA 5IB9A 2QECA 5LYLA 2WPWA 2OZUA 3JUWA 2YGWA 4NF1A 2Z3PA 1OZPA 4AG7A 4QB9A 4XPKA 5D29A 2OR4A 2ZW5A 2P6FA 3RZAA 1B87A 3FEEA 3K9UA 4MJ8A 2QVPA 2PJ2A 3SXNA 4EMEA 1WK4A 1RXTA 1IIDA 4UFWA 4P45A 5G22A 4KORA 4B10A 2EO8A 1IICA 2FVGA 5AG7A 4ZY1A 4MMOA 1MJ9A 3KL9A 2YNCA 4IAVA 5G1ZA 3VATA 5KTDA 2EUIA 2FS5A 2AFWA 5CPAA 1S7NA 1HDQA 4X2TA 1Q2CA 4CPAA 1KWMA 8CPAA 4P4IA 3SJGA 2GU2A 2PQ8A 4NCZA 1V0CA 3FEDA 5E96A 4A32A 1P0HA 1P4NA 2V8DA 4TWEA 2AFSA 1ARMA 2PJBA 5LRGA 3RAMA 2CTCA 3WABA 4ORFA 1H8LA 4PPZA 4ZYQA 3SHPA 3R96A 1YLOA 3LMSA 3N7ZA 4M6GA 4NGQA 4F0XA 1S3ZA 1I21A 1ZG8A 2DPSA 2DEAA 2Z10A 2JLMA 1Z4EA 4L8AA 4QC6A 1Y7RA 1VKCA 2Z3KA 5C88A 3ZJ0A 5J8FA 2PVVA 3B3TA 2R7HA 1ELMP 3EFAA 4JXRA 4RS2A 2D4PA 1I12A 3DSBA 2R98A 2WPXA 4B6ZA 1TF9A 2PIZA 3B3CA 3D2PA 3ZZIA 3SJEA 3HLPA 2ARHA 3PB8X 2REEA 2CXAA 1Q2DA 4UFVA 5CNPA 4KSFA 2ZXVA 4JD6A 3N5FA 4YFJA 1YQEA 1BPNA 2YNDA 4KUAA 2IL4A 1MJAA 1M4DA 4BMHA 4C7IA 1U6MA 4A39A 1LFWA 3P2HA 4ZBGA 2XEFA 3T90A 4A30A 2XEGA 1VHEA 2J8NA 2KCWA 3GY9A 3H5ZA 3BI1A 4QBJA 4MFPA 3B7IA 4NGTA 4UIAA 4UCNA 2R1IA 1AMPA 3EY5A 2EWBA 5DWNA 3VWDA 2QJ8A 1YGHA 2BEIA 1IYLA 3IFEA 2HB6A 1NE9A 3CXPA 4K3NA 1LRZA 4ONWA 4PSXA 4H89A 2AJ6A 4JLYA 3VARA 4X3RA 2PDOA 3PZJA 3WT4A 5K8OA 4KLVA 3FYNA 3C26A 2Q4ZA 3SI1A 2OU2A 4R7MA 2XEJA 4WWVA 1B6BA 2PJ5A 5CBMA 1DTDA 3R1KA 4NJRA 4L89A 2OH1A 2Q0YA 2Z3OA 4PXDA 2PJ8A 3D7DA 1PU9A 5FVJA 5D8NA 4LUAA 1RO5A 1JWQA 3GYAA 1LAMA 2K5TA 1XMBA 5A28A 7CPAA 4R6TA 1ARLA 4IK2A 4BD9A 4F9VA 4II9A 2YNEA 3P2FA 2WSAA 3IWWA 3H8EA 1IYKA 1UFHA 2Z3LA 4TNUA 3TCVA 1KZFA 2G0BA 4FD6A 5A27A 1Y0RA 2VZZA 3FH4A 1QSNA 1MK4A 4ZY2A 2PR8A 4A31A 3TFYA 4NFRA 2C6GA 4YWYA 3WC7A 5K8MA 4CYNA 5K8PA 2GIVA 1XRYA 4MHZA 4U9YA 4MXUA 2IMOA 3NH8A 2NMTA 1TXRA 2RC4A 1QMUA 1VHOA 1Y9KA 4QUSA 2Q51A 2V8VA 4KOWA 4AVAA 4DUKA 1R43A 4CAWA 3EXNA 2B3VA 2EVNA 4KOTA 5JGFA 2B58A 1Z8LA 3KZWA 2GLFA 3FIXA 4KS9A 4EFDA 3R9EA 1OBRA 2O4HA 4UFXA 2BUEA 2ZEGA 2ZEDA 4NXYA 1FY7A 3L2NA 4RUHA 4CGPA 1VIXA 4KOXA 4KVOE 4UF4A 2JEWA 4BBHA 1XF8A 2F8HA 2PSWA 2NYQA 3G8WA 4AXVA 4PV6A 4E0AA 2ZOGA 4JYWA 1FT7A 4E2AA 1Y7EA 1QSTA 5K8NA 2D4OA 2IQ6A 2JEVA 3DLJA 1IU8A 3ISZA 2FSRA 4FBEA 3CDXA 2CNSA 4B14A 4KVME 4JXQA 2FIAA 1BPMA 1QQ9A 2ZEEA 1CPXA 4MHDA 1YREA 4B12A 1MJBA 1UWYA 2PJ4A 2Q4VA 2VEZA 4J3GA 4Q7AA 2DPTA 3DR8A 3KQXA 3NE8A 1YX0A 4LQGA 5LYFA 5BWAB 3B35A 2IJZA 4CGNA 3PP9A 3K9TA 3EC4A 1Z8WA 4P4JA 4B5PA 4C7HA 1Z8XA 3D66A 1IY7A 2WUUA 3IEHA 1EE3P 2F7VA 5LRJA 3D8PA 2OOTA 2F5IA 2OZHA 2EBJA 1CPSA 2I3CA 4MBUA 4LX9A 4QVTA 1BO4A 3FB3A 3H8FA 3PB6X 1I1DA 4PXEA 5HXDA 4KOUA 2C6PA 2C1CA 4H2KA 1IGBA 1ON0A 2CF4A 3B3SA 1QSRA 3KKWA 5F47A 4CYQA 5IB0A 4MY0A 4MHNA 1QSOA 3TOAA 2B3UA 2Y0MA 5F49A 4MFZA 2PJCA 2VXKA 1S7LA 1Z9UA 4MFJA 5KTAA 2J8MA 4OMEA 3TX8A 2NSMA 4U9ZA 4E8OA 2B5GB 5H86A 3V7ZA 1LOKA 1Z5RA 3IU2A 4IUSA 3PFEA 4R87A 2Z11A 4CGMA 2JBKA 3CPAA 5LYIA 4C68A 4MCPA 3NFZA 4M85A 4UIBA 5J8CA 3PRTA 5HH1A 2I79A 5F09A 4GS4A 4EVYA 1YR0A 3LWUA 2X7BA 3FF3A 2AFOA 3OWCA 2R8VA 3TC8A 4AVBA 4EWTA 4F8ZA 1YSJA 1NMTA 4UWIA 5F46A 2RFHA 3NA6A 3IO1A 3BJ7A 4DYOA 1YMEA 3KI9A 3QNVA 4LQ6A 4FD4A 3V38A 2PJ6A 1TIQA 4HKFA 2B4DB 1M1DA 3KQZA 3NH4A 2Q7BA 3KGQA 3R9GA 3PFOA 3SI2A 4OAEA 3A9LA 1NSLA 3S6FA 4A94A 3E0KA 4UCPA 1ZG9A 3PEIA 3BI0A 3CPXA 2ZEOA 3RO0A 4CGOA 1JQGA 2C6CA 3NE7A 4R8FA 3IJ3A 5HVGA 1YLEA 2QMLA
chains in the Genus database with same CATH topology
3S6KA 2Z0ZA 2B4BA 4MFKA 2OB0A 1M4GA 1YK3A 2CY2A 2FXFA 3TO9A 2VQYA 4B13A 2FIWA 4NEXA 4UBRA 4KOYA 4CGLA 1CJWA 2FE7A 3DNSA 1ZO0A 4XPDB 2REFA 3LD2A 4PK2A 4HNWB 4I49A 3SXOA 3BJ8A 4NSQA 3RYOA 4DNCA 5AG4A 1S5KA 4OADA 3F8KA 4XNHB 1S7FA 1Z4RA 3F0AA 3F5BA 1S60A 4C2YA 3FRMA 4CRYB 4YGOA 1IB1E 5AGEA 2Z3NA 2Q44A 2JDDA 1VHSA 4X5KA 2QIRA 3GKRA 1GHEA 5AG5A 2ZPAA 2ZW6A 3TO6A 3FXTA 4KSAA 4CYOA 3DR6A 4YRHA 3G3SA 3TT2A 4KZTA 2PC1A 1N71A 4H6ZA 4C2ZA 3W6XA 2JDCA 2P6GA 3TTHA 4B5PB 5KTCA 4CS0B 4HNYB 3QAHA 1J4JA 1M44A 3FNCA 4CAFA 3TOBA 2Q04A 3IU1A 1QSMA 5EC4A 2BL1A 4JJXA 1Q2YA 4MFQA 5C82A 4KOSA 2ZW4A 3LODA 4CAEA 2GE3A 2FCKA 3IWGA 1XMTA 2O28A 4A2ZA 4B5OA 4C2XA 4M3SA 4A33A 4OLLA 3VWEA 3WR7A 4KUBA 2VZYA 4A95A 4RI1A 1K4JA 1L0CA 1YVOA 2CNTA 1S7KA 2G3TA 2FT0A 3QB8A 4K30A 4Y49C 4CYPA 4CAXA 4UCMA 1R57A 1KUYA 5JPHA 4R3LA 4B11A 5IV0A 2VBQA 4Y49B 2VI7A 4HNXB 2B5GA 3I9SA 2CNMA 5JQ4A 5G21A 3DDDA 5ISVA 5G20A 3B8GA 3D3SA 2BSWA 1WWZA 1YVKA 2DXQA 4Q36A 2P0WA 2G3AA 2H5MA 3D2MA 2A4NA 2I00A 1PUAA 2GANA 5HMNA 3S6GA 3I3GA 4ONUA 4MY3A 4KVXA 5H84A 3FBUA 2P6EA 3H4QA 4CRZB 1KUXA 4FD7A 4XPLA 4AG9A 4FD5A 4MFLA 4XPDC 3S6HA 2OZGA 3IGRA 3T9YA 2J8RA 1XEBA 2B4DA 2HV2A 4R57A 2HQYA 2ZW7A 4R9MA 2Q4YA 1SQHA 5F48A 2FL4A 4F6AA 3CXQA 4KOVA 3JVNA 4AVCA 4PK3A 2ATRA 4JWPA 4XNHC 5I0CA 1Y9WA 4AB7A 4UWJA 2PR1A 4PSWA 3JTKA 1BOBA 3EO4A 4ZGYB 1XE4A 2Z3MA 4Q38A 5AG6A 2PRBA 3UY5A 3V8IA 4R3KA 3MGDA 4CAVA 3CXSA 3W91A 4H6UA 4KLWA 4U5YA 3BLNA 3PGPA 5EBVA 4MI4A 3R9FA 2HUZA 2YNCC 1CM0A 3IWEA 4UA3A 5IX3A 4IF5A 3TE4A 2C27A 4F0YA 3R95A 3TO7A 1XIXA 1KUVA 1M4IA 2AE6A 3W6SA 5GCNA 5DWMA 2QECA 2WPWA 2OZUA 3JUWA 2YGWA 4NF1A 2Z3PA 1OZPA 4AG7A 4QB9A 4XPKA 2ZW5A 2P6FA 1B87A 3K9UA 4MJ8A 3SXNA 1WK4A 1RXTA 1IIDA 4UFWA 5G22A 4KORA 4B10A 1IICA 5AG7A 1MJ9A 2YNCA 5G1ZA 5KTDA 2EUIA 2FS5A 1S7NA 1Q2CA 2PQ8A 4NCZA 1V0CA 5E96A 4A32A 1P0HA 1P4NA 4ORFA 3SHPA 3R96A 3N7ZA 4F0XA 1S3ZA 1I21A 2DPSA 2Z10A 2JLMA 1Z4EA 4L8AA 4QC6A 1Y7RA 1VKCA 2Z3KA 5C88A 3ZJ0A 5J8FA 3EFAA 4JXRA 2R7HA 4RS2A 2D4PA 1I12A 3DSBA 2R98A 2WPXA 3ZZIA 3D2PA 2ARHA 2REEA 2CXAA 1Q2DA 4UFVA 5CNPA 4KSFA 2ZXVA 4JD6A 4YFJA 2YNDA 4KUAA 2IL4A 1MJAA 1M4DA 4BMHA 4C7IA 1U6MA 3P2HA 3T90A 4ZBGA 4A30A 2J8NA 2KCWA 3GY9A 3H5ZA 4QBJA 4MFPA 4UCNA 2R1IA 3VWDA 3EY5A 5DWNA 1YGHA 2BEIA 1IYLA 1NE9A 3CXPA 1LRZA 4PSXA 4H89A 2AJ6A 4JLYA 2PDOA 3PZJA 4KLVA 3FYNA 3C26A 2OU2A 1B6BA 3R1KA 4L89A 2OH1A 2Q0YA 2Z3OA 1PU9A 5FVJA 4LUAA 1RO5A 3GYAA 2K5TA 5A28A 4II9A 2YNEA 3P2FA 2WSAA 1IYKA 1UFHA 2Z3LA 3TCVA 1KZFA 2G0BA 4FD6A 5A27A 2VZZA 1QSNA 1MK4A 2PR8A 4A31A 3TFYA 4CYNA 2GIVA 4U9YA 2NMTA 2RC4A 1Y9KA 4QUSA 4AVAA 4KOWA 4CAWA 3EXNA 2B3VA 2EVNA 4KOTA 2B58A 3FIXA 4KS9A 3R9EA 4UFXA 2BUEA 4NXYA 1FY7A 4CGPA 4KVOE 4KOXA 4BBHA 1XF8A 2PSWA 3G8WA 4PV6A 4E0AA 4E2AA 1QSTA 2D4OA 2JEVA 2FSRA 2CNSA 4B14A 4KVME 4JXQA 2FIAA 4MHDA 1YREA 4B12A 1MJBA 2Q4VA 2VEZA 4J3GA 2DPTA 3DR8A 1YX0A 5BWAB 4CGNA 3PP9A 3EC4A 4B5PA 4C7HA 2WUUA 3D8PA 2F5IA 2OZHA 4MBUA 4LX9A 4QVTA 1BO4A 3FB3A 1I1DA 4KOUA 1ON0A 3KKWA 5F47A 1QSRA 4CYQA 5IB0A 4MY0A 1QSOA 3TOAA 2B3UA 2Y0MA 5F49A 4MFZA 2VXKA 1S7LA 1Z9UA 4MFJA 5KTAA 2J8MA 4U9ZA 4E8OA 2B5GB 5H86A 3IU2A 4IUSA 4R87A 2Z11A 4CGMA 4C68A 5J8CA 4M85A 5HH1A 2I79A 4GS4A 4EVYA 1YR0A 2X7BA 3OWCA 4AVBA 2R8VA 1NMTA 4UWIA 5F46A 3BJ7A 4FD4A 1TIQA 4HKFA 2B4DB 1M1DA 2Q7BA 3R9GA 4OAEA 3A9LA 1NSLA 3S6FA 3E0KA 4UCPA 4CGOA 3NE7A 1YLEA 2QMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6K A;  2Z0Z A;  2B4B A;  2OB0 A;  1M4G A;  1YK3 A;  2CY2 A;  2FXF A;  3TO9 A;  2VQY A;  2FIW A;  4NEX A;  4UBR A;  4KOY A;  1CJW A;  2FE7 A;  3DNS A;  4XPD B;  2REF A;  3LD2 A;  4PK2 A;  4HNW B;  4I49 A;  3SXO A;  3BJ8 A;  4NSQ A;  3RYO A;  4DNC A;  1S5K A;  4OAD A;  3F8K A;  4XNH B;  1S7F A;  1Z4R A;  3F0A A;  3F5B A;  1S60 A;  3FRM A;  4CRY B;  4YGO A;  1IB1 E;  2Q44 A;  2JDD A;  1VHS A;  4X5K A;  2QIR A;  3GKR A;  1GHE A;  2ZPA A;  2ZW6 A;  3TO6 A;  3FXT A;  3DR6 A;  4YRH A;  3G3S A;  3TT2 A;  4KZT A;  2PC1 A;  1N71 A;  4H6Z A;  3W6X A;  2JDC A;  2P6G A;  3TTH A;  4B5P B;  5KTC A;  4CS0 B;  4HNY B;  3QAH A;  1J4J A;  1M44 A;  3FNC A;  3TOB A;  2Q04 A;  1QSM A;  5EC4 A;  2BL1 A;  4JJX A;  1Q2Y A;  5C82 A;  4KOS A;  2ZW4 A;  3LOD A;  2GE3 A;  2FCK A;  3IWG A;  1XMT A;  2O28 A;  4B5O A;  4M3S A;  4OLL A;  3VWE A;  3WR7 A;  4KUB A;  2VZY A;  4RI1 A;  1K4J A;  1L0C A;  1YVO A;  2CNT A;  1S7K A;  2G3T A;  2FT0 A;  3QB8 A;  4K30 A;  4Y49 C;  4CAX A;  1R57 A;  1KUY A;  5JPH A;  4R3L A;  5IV0 A;  2VBQ A;  4Y49 B;  2VI7 A;  4HNX B;  2B5G A;  3I9S A;  2CNM A;  5JQ4 A;  3DDD A;  5ISV A;  3B8G A;  3D3S A;  2BSW A;  1WWZ A;  1YVK A;  2DXQ A;  2P0W A;  2G3A A;  2H5M A;  3D2M A;  2A4N A;  2I00 A;  1PUA A;  2GAN A;  5HMN A;  3S6G A;  3I3G A;  4ONU A;  4MY3 A;  4KVX A;  5H84 A;  3FBU A;  2P6E A;  3H4Q A;  4CRZ B;  1KUX A;  4FD7 A;  4XPL A;  4AG9 A;  4FD5 A;  4XPD C;  3S6H A;  2OZG A;  3IGR A;  3T9Y A;  2J8R A;  1XEB A;  2B4D A;  2HV2 A;  4R57 A;  2HQY A;  2ZW7 A;  4R9M A;  2Q4Y A;  1SQH A;  5F48 A;  2FL4 A;  4F6A A;  3CXQ A;  4KOV A;  3JVN A;  4AVC A;  4PK3 A;  2ATR A;  4JWP A;  4XNH C;  5I0C A;  1Y9W A;  4AB7 A;  4UWJ A;  2PR1 A;  4PSW A;  1BOB A;  3EO4 A;  1XE4 A;  2PRB A;  3UY5 A;  3V8I A;  4R3K A;  3MGD A;  4CAV A;  3CXS A;  3W91 A;  4H6U A;  4KLW A;  4U5Y A;  3BLN A;  3PGP A;  5EBV A;  4MI4 A;  3R9F A;  2HUZ A;  1CM0 A;  4UA3 A;  5IX3 A;  4IF5 A;  3TE4 A;  2C27 A;  4F0Y A;  3R95 A;  3TO7 A;  1XIX A;  1KUV A;  1M4I A;  2AE6 A;  3W6S A;  5GCN A;  5DWM A;  2QEC A;  2WPW A;  2OZU A;  3JUW A;  4NF1 A;  1OZP A;  4AG7 A;  4QB9 A;  4XPK A;  2ZW5 A;  2P6F A;  1B87 A;  3K9U A;  4MJ8 A;  3SXN A;  1WK4 A;  1RXT A;  1IID A;  4KOR A;  1IIC A;  1MJ9 A;  5KTD A;  2EUI A;  2FS5 A;  1S7N A;  1Q2C A;  2PQ8 A;  4NCZ A;  1V0C A;  5E96 A;  1P0H A;  1P4N A;  4ORF A;  3SHP A;  3R96 A;  3N7Z A;  1S3Z A;  1I21 A;  2Z10 A;  2JLM A;  1Z4E A;  4L8A A;  4QC6 A;  1Y7R A;  1VKC A;  5C88 A;  3ZJ0 A;  5J8F A;  3EFA A;  4JXR A;  2R7H A;  4RS2 A;  2D4P A;  1I12 A;  3DSB A;  2R98 A;  2WPX A;  3ZZI A;  3D2P A;  2ARH A;  2REE A;  1Q2D A;  5CNP A;  2ZXV A;  4JD6 A;  4YFJ A;  4KUA A;  2IL4 A;  1MJA A;  1M4D A;  4BMH A;  1U6M A;  3P2H A;  3T90 A;  4ZBG A;  2J8N A;  2KCW A;  3GY9 A;  4QBJ A;  2R1I A;  3VWD A;  3EY5 A;  5DWN A;  1YGH A;  2BEI A;  1IYL A;  1NE9 A;  3CXP A;  1LRZ A;  4PSX A;  4H89 A;  2AJ6 A;  4JLY A;  2PDO A;  3PZJ A;  4KLV A;  3FYN A;  3C26 A;  2OU2 A;  1B6B A;  3R1K A;  4L89 A;  2OH1 A;  2Q0Y A;  1PU9 A;  5FVJ A;  4LUA A;  1RO5 A;  3GYA A;  2K5T A;  4II9 A;  3P2F A;  1IYK A;  1UFH A;  3TCV A;  1KZF A;  2G0B A;  4FD6 A;  2VZZ A;  1QSN A;  1MK4 A;  2PR8 A;  3TFY A;  2GIV A;  4U9Y A;  2NMT A;  2RC4 A;  1Y9K A;  4QUS A;  4AVA A;  4KOW A;  4CAW A;  3EXN A;  2B3V A;  2EVN A;  4KOT A;  2B58 A;  3FIX A;  3R9E A;  2BUE A;  4NXY A;  1FY7 A;  4KVO E;  4KOX A;  1XF8 A;  2PSW A;  3G8W A;  4PV6 A;  4E0A A;  4E2A A;  1QST A;  2D4O A;  2JEV A;  2FSR A;  2CNS A;  4KVM E;  4JXQ A;  2FIA A;  4MHD A;  1YRE A;  1MJB A;  2Q4V A;  2VEZ A;  4J3G A;  3DR8 A;  1YX0 A;  3PP9 A;  3EC4 A;  4B5P A;  3D8P A;  2F5I A;  2OZH A;  4MBU A;  4LX9 A;  4QVT A;  1BO4 A;  3FB3 A;  1I1D A;  4KOU A;  1ON0 A;  3KKW A;  5F47 A;  1QSR A;  5IB0 A;  4MY0 A;  1QSO A;  3TOA A;  2B3U A;  2Y0M A;  5F49 A;  2VXK A;  1S7L A;  1Z9U A;  5KTA A;  2J8M A;  4U9Z A;  4E8O A;  2B5G B;  5H86 A;  4IUS A;  4R87 A;  2Z11 A;  5J8C A;  4M85 A;  5HH1 A;  2I79 A;  4GS4 A;  4EVY A;  1YR0 A;  2X7B A;  3OWC A;  4AVB A;  2R8V A;  1NMT A;  4UWI A;  5F46 A;  3BJ7 A;  4FD4 A;  1TIQ A;  4HKF A;  2B4D B;  1M1D A;  2Q7B A;  3R9G A;  4OAE A;  1NSL A;  3S6F A;  3E0K A;  3NE7 A;  1YLE A;  2QML A; 
#chains in the Genus database with same CATH topology
 3KR5 A;  4GXH A;  3WC5 A;  3S6K A;  1ELL P;  2B4B A;  2Z0Z A;  4MFK A;  4OC2 A;  3RNZ A;  2OB0 A;  2RB7 A;  2BO9 A;  1M4G A;  1YK3 A;  2PJ0 A;  2CY2 A;  1CP6 A;  3FMC A;  4OC1 A;  2FXF A;  3TO9 A;  2VQY A;  4B13 A;  2FIW A;  3ISX A;  3GIU A;  4NEX A;  1PCA A;  1Z8T A;  2WZN A;  4KOY A;  4UBR A;  4CGL A;  2O53 A;  4ZX9 A;  1CJW A;  3LAC A;  2FE7 A;  4KSI A;  3KR4 A;  3DNS A;  1YW6 A;  2ANP A;  2PJ3 A;  1ZO0 A;  3GLJ A;  3QAY A;  4NJQ A;  4XPD B;  2REF A;  5EMI A;  4MCQ A;  3LD2 A;  5J1Q A;  4PK2 A;  4DJL A;  4HNW B;  4I49 A;  2V77 A;  3BHX A;  4OC0 A;  3BJ8 A;  3SXO A;  4Z65 A;  5JM6 A;  3B2Y A;  1TF8 A;  4NSQ A;  3RYO A;  4DNC A;  5AG4 A;  1BLL E;  4P4D A;  1S5K A;  5HVF A;  4NGP A;  4OAD A;  2AFX A;  3F8K A;  4XNH B;  1S7F A;  4FUU A;  1Z4R A;  4UEZ A;  1ZLH A;  3F0A A;  3NH5 A;  3F5B A;  1S60 A;  4R76 A;  4C2Y A;  3D67 A;  3FRM A;  4M6I A;  4YGO A;  1IB1 E;  1VGY A;  1AYE A;  4CRY B;  1CP7 A;  5AGE A;  1IOI A;  1M4L A;  2Z3N A;  2Q44 A;  2JDD A;  2PVW A;  3FJU A;  1XBU A;  4NGR A;  1VHS A;  1PYT B;  2ZEP A;  4HPS A;  4X5K A;  2QIR A;  3GKR A;  3D7F A;  3KHZ A;  3KAS A;  1GHE A;  3D7H A;  5AG5 A;  2ZPA A;  2ZW6 A;  1Q7L A;  4P4B A;  3TO6 A;  3FXT A;  4KSA A;  4CYO A;  3DR6 A;  4YRH A;  3G3S A;  5LRK A;  3TT2 A;  2CIJ A;  4KZT A;  1ZLI A;  3IIB A;  2PC1 A;  1N71 A;  4H6Z A;  3DGV A;  2HC9 A;  4C2Z A;  3GUX A;  3W6X A;  2JDC A;  2P6G A;  3TTH A;  4JZ0 A;  4B5P B;  3KHX A;  4PXC A;  5KTC A;  2GRE A;  4A37 A;  4CS0 B;  1XFO A;  2V8H A;  4HNY B;  3FX6 A;  5HVH A;  3QAH A;  2ODF A;  2PJ1 A;  1F2P A;  1J4J A;  3I1U A;  1AUG A;  1M44 A;  3FNC A;  3HUV A;  4CAF A;  4NGM A;  2AFM A;  3T8W A;  3TOB A;  2J9A A;  3D68 A;  3VH9 A;  2Q04 A;  3IU1 A;  1QSM A;  1XJO A;  1LCP A;  2VL1 A;  5EC4 A;  2PJA A;  2BL1 A;  4JJX A;  3BXM A;  1Q2Y A;  4MFQ A;  5C82 A;  4OC3 A;  4KOS A;  2ZW4 A;  3LOD A;  3CT9 A;  4CAE A;  4P44 A;  2GE3 A;  1Y0Y A;  2FCK A;  2XEI A;  3IWG A;  1LAN A;  3FEC A;  4MHP A;  1X10 A;  3SI0 A;  1XMT A;  5LYD A;  2O28 A;  3S9L A;  4A2Z A;  4B5O A;  4P4E A;  4RN7 A;  4M3S A;  4C2X A;  2EK9 A;  4A33 A;  1TKJ A;  4OLL A;  3VWE A;  4OIW A;  3WR7 A;  4KUB A;  2V8G A;  2VZY A;  1RTQ A;  3JRU A;  2PIY A;  4A95 A;  4FAI A;  4RI1 A;  1XOV A;  3SJF A;  1K4J A;  4GM5 A;  3B3W A;  3PBE A;  4X8I A;  3PB7 X;  1L0C A;  1YVO A;  2GLJ A;  2CNT A;  1S7K A;  3RBU A;  2Q43 A;  4OC5 A;  2G3T A;  2FT0 A;  3QB8 A;  4K30 A;  4Y49 C;  4CYP A;  1X12 A;  4NGS A;  2AFU A;  4UCM A;  4CAX A;  1R57 A;  1KUY A;  5JPH A;  3WC6 A;  4R3L A;  2ABZ A;  1A2Z A;  2GFQ A;  4B11 A;  4ZI6 A;  2G9D A;  5IV0 A;  3H8G A;  2ZEF A;  4WJB A;  4BIN A;  2VBQ A;  4Y49 B;  4UEE A;  1TKH A;  3GB0 A;  2VI7 A;  5JH9 A;  4HNX B;  2AFZ A;  2B5G A;  3I9S A;  2CNM A;  5JQ4 A;  6CPA A;  5G21 A;  1BAV A;  3DDD A;  5ISV A;  5G20 A;  2BCO A;  3B8G A;  2BSW A;  3D3S A;  1WWZ A;  1YVK A;  2DXQ A;  4NGN A;  4Q36 A;  4UEF A;  2P0W A;  1FNO A;  2G3A A;  2H5M A;  2ZEH A;  3D2M A;  2A4N A;  2I00 A;  4OID A;  1PUA A;  1IOF A;  4ZY0 A;  4FWU A;  2GAN A;  5HMN A;  1F2O A;  4W9Y A;  2PE3 A;  3S6G A;  1CBX A;  3I3G A;  4ONU A;  4MY3 A;  1Z2L A;  3PBB A;  4KVX A;  4MCS A;  5H84 A;  3FBU A;  2P6E A;  3H4Q A;  2BOA A;  4CRZ B;  1KUX A;  3CZX A;  2QYV A;  4FD7 A;  4OP4 A;  4XPL A;  2ZEN A;  4FD5 A;  4MFL A;  4AG9 A;  4PQA A;  4XPD C;  4OKO A;  3S6H A;  2OZG A;  3IGR A;  3T9Y A;  2J8R A;  1XEB A;  2B4D A;  2EK8 A;  2HV2 A;  2HQY A;  2PRQ A;  2ZW7 A;  4M6H A;  4R57 A;  3D7G A;  2POK A;  4R9M A;  5THW A;  2Q4Y A;  1SQH A;  5F48 A;  2FL4 A;  1CG2 A;  1HEE A;  4MCR A;  3CXQ A;  4KOV A;  4F6A A;  3IC1 A;  3JVN A;  1R3N A;  4MHY A;  4PK3 A;  3S9M A;  4AVC A;  5DS0 A;  2ATR A;  5ELY A;  4JWP A;  4XNH C;  5I0C A;  1ZG7 A;  1Y9W A;  2CTB A;  4P10 A;  4AB7 A;  4UWJ A;  2PR1 A;  4PSW A;  1BOB A;  3JTK A;  2PJ9 A;  3EO4 A;  4ZGY B;  1XE4 A;  2Z3M A;  1NSA A;  4Q38 A;  3MN8 A;  3PB9 X;  3SJX A;  1YW4 A;  3PB4 X;  2PRB A;  1F57 A;  5AG6 A;  3UY5 A;  3MRU A;  4ZX8 A;  4P4F A;  3V8I A;  4R3K A;  3MGD A;  4CAV A;  3CXS A;  2WYR A;  3FVL A;  4H6U A;  4KLW A;  3W91 A;  4U5Y A;  3BLN A;  3PGP A;  4OC4 A;  2PCU A;  5EBV A;  2ZEL A;  2Q7S A;  4MI4 A;  3R9F A;  1TKF A;  2HUZ A;  2JBJ A;  2YNC C;  1CM0 A;  2ZOF A;  4IHM A;  3D4U A;  3IWE A;  4UA3 A;  5IX3 A;  1LAP A;  4IF5 A;  3S9N A;  3TE4 A;  2C27 A;  4F0Y A;  1CX8 A;  2DF5 A;  3R95 A;  3TO7 A;  4F9U A;  1XIX A;  1HDU A;  4P6Y A;  1DE4 C;  1KUV A;  4G1P A;  4A38 A;  3K2K A;  4YU9 A;  1GYT A;  4MRI A;  5I4M A;  1M4I A;  2ZEM A;  2AE6 A;  3W6S A;  3B3V A;  5GCN A;  2PJ7 A;  4O23 A;  4PXB A;  5DWM A;  5IB9 A;  2QEC A;  5LYL A;  2WPW A;  2OZU A;  3JUW A;  2YGW A;  4NF1 A;  2Z3P A;  1OZP A;  4AG7 A;  4QB9 A;  4XPK A;  5D29 A;  2OR4 A;  2ZW5 A;  2P6F A;  3RZA A;  1B87 A;  3FEE A;  3K9U A;  4MJ8 A;  2QVP A;  2PJ2 A;  3SXN A;  4EME A;  1WK4 A;  1RXT A;  1IID A;  4UFW A;  4P45 A;  5G22 A;  4KOR A;  4B10 A;  2EO8 A;  1IIC A;  2FVG A;  5AG7 A;  4ZY1 A;  4MMO A;  1MJ9 A;  3KL9 A;  2YNC A;  4IAV A;  5G1Z A;  3VAT A;  5KTD A;  2EUI A;  2FS5 A;  2AFW A;  5CPA A;  1S7N A;  1HDQ A;  4X2T A;  1Q2C A;  4CPA A;  1KWM A;  8CPA A;  4P4I A;  3SJG A;  2GU2 A;  2PQ8 A;  4NCZ A;  1V0C A;  3FED A;  5E96 A;  4A32 A;  1P0H A;  1P4N A;  2V8D A;  4TWE A;  2AFS A;  1ARM A;  2PJB A;  5LRG A;  3RAM A;  2CTC A;  3WAB A;  4ORF A;  1H8L A;  4PPZ A;  4ZYQ A;  3SHP A;  3R96 A;  1YLO A;  3LMS A;  3N7Z A;  4M6G A;  4NGQ A;  4F0X A;  1S3Z A;  1I21 A;  1ZG8 A;  2DPS A;  2DEA A;  2Z10 A;  2JLM A;  1Z4E A;  4L8A A;  4QC6 A;  1Y7R A;  1VKC A;  2Z3K A;  5C88 A;  3ZJ0 A;  5J8F A;  2PVV A;  3B3T A;  2R7H A;  1ELM P;  3EFA A;  4JXR A;  4RS2 A;  2D4P A;  1I12 A;  3DSB A;  2R98 A;  2WPX A;  4B6Z A;  1TF9 A;  2PIZ A;  3B3C A;  3D2P A;  3ZZI A;  3SJE A;  3HLP A;  2ARH A;  3PB8 X;  2REE A;  2CXA A;  1Q2D A;  4UFV A;  5CNP A;  4KSF A;  2ZXV A;  4JD6 A;  3N5F A;  4YFJ A;  1YQE A;  1BPN A;  2YND A;  4KUA A;  2IL4 A;  1MJA A;  1M4D A;  4BMH A;  4C7I A;  1U6M A;  4A39 A;  1LFW A;  3P2H A;  4ZBG A;  2XEF A;  3T90 A;  4A30 A;  2XEG A;  1VHE A;  2J8N A;  2KCW A;  3GY9 A;  3H5Z A;  3BI1 A;  4QBJ A;  4MFP A;  3B7I A;  4NGT A;  4UIA A;  4UCN A;  2R1I A;  1AMP A;  3EY5 A;  2EWB A;  5DWN A;  3VWD A;  2QJ8 A;  1YGH A;  2BEI A;  1IYL A;  3IFE A;  2HB6 A;  1NE9 A;  3CXP A;  4K3N A;  1LRZ A;  4ONW A;  4PSX A;  4H89 A;  2AJ6 A;  4JLY A;  3VAR A;  4X3R A;  2PDO A;  3PZJ A;  3WT4 A;  5K8O A;  4KLV A;  3FYN A;  3C26 A;  2Q4Z A;  3SI1 A;  2OU2 A;  4R7M A;  2XEJ A;  4WWV A;  1B6B A;  2PJ5 A;  5CBM A;  1DTD A;  3R1K A;  4NJR A;  4L89 A;  2OH1 A;  2Q0Y A;  2Z3O A;  4PXD A;  2PJ8 A;  3D7D A;  1PU9 A;  5FVJ A;  5D8N A;  4LUA A;  1RO5 A;  1JWQ A;  3GYA A;  1LAM A;  2K5T A;  1XMB A;  5A28 A;  7CPA A;  4R6T A;  1ARL A;  4IK2 A;  4BD9 A;  4F9V A;  4II9 A;  2YNE A;  3P2F A;  2WSA A;  3IWW A;  3H8E A;  1IYK A;  1UFH A;  2Z3L A;  4TNU A;  3TCV A;  1KZF A;  2G0B A;  4FD6 A;  5A27 A;  1Y0R A;  2VZZ A;  3FH4 A;  1QSN A;  1MK4 A;  4ZY2 A;  2PR8 A;  4A31 A;  3TFY A;  4NFR A;  2C6G A;  4YWY A;  3WC7 A;  5K8M A;  4CYN A;  5K8P A;  2GIV A;  1XRY A;  4MHZ A;  4U9Y A;  4MXU A;  2IMO A;  3NH8 A;  2NMT A;  1TXR A;  2RC4 A;  1QMU A;  1VHO A;  1Y9K A;  4QUS A;  2Q51 A;  2V8V A;  4KOW A;  4AVA A;  4DUK A;  1R43 A;  4CAW A;  3EXN A;  2B3V A;  2EVN A;  4KOT A;  5JGF A;  2B58 A;  1Z8L A;  3KZW A;  2GLF A;  3FIX A;  4KS9 A;  4EFD A;  3R9E A;  1OBR A;  2O4H A;  4UFX A;  2BUE A;  2ZEG A;  2ZED A;  4NXY A;  1FY7 A;  3L2N A;  4RUH A;  4CGP A;  1VIX A;  4KOX A;  4KVO E;  4UF4 A;  2JEW A;  4BBH A;  1XF8 A;  2F8H A;  2PSW A;  2NYQ A;  3G8W A;  4AXV A;  4PV6 A;  4E0A A;  2ZOG A;  4JYW A;  1FT7 A;  4E2A A;  1Y7E A;  1QST A;  5K8N A;  2D4O A;  2IQ6 A;  2JEV A;  3DLJ A;  1IU8 A;  3ISZ A;  2FSR A;  4FBE A;  3CDX A;  2CNS A;  4B14 A;  4KVM E;  4JXQ A;  2FIA A;  1BPM A;  1QQ9 A;  2ZEE A;  1CPX A;  4MHD A;  1YRE A;  4B12 A;  1MJB A;  1UWY A;  2PJ4 A;  2Q4V A;  2VEZ A;  4J3G A;  4Q7A A;  2DPT A;  3DR8 A;  3KQX A;  3NE8 A;  1YX0 A;  4LQG A;  5LYF A;  5BWA B;  3B35 A;  2IJZ A;  4CGN A;  3PP9 A;  3K9T A;  3EC4 A;  1Z8W A;  4P4J A;  4B5P A;  4C7H A;  1Z8X A;  3D66 A;  1IY7 A;  2WUU A;  3IEH A;  1EE3 P;  2F7V A;  5LRJ A;  3D8P A;  2OOT A;  2F5I A;  2OZH A;  2EBJ A;  1CPS A;  2I3C A;  4MBU A;  4LX9 A;  4QVT A;  1BO4 A;  3FB3 A;  3H8F A;  3PB6 X;  1I1D A;  4PXE A;  5HXD A;  4KOU A;  2C6P A;  2C1C A;  4H2K A;  1IGB A;  1ON0 A;  2CF4 A;  3B3S A;  1QSR A;  3KKW A;  5F47 A;  4CYQ A;  5IB0 A;  4MY0 A;  4MHN A;  1QSO A;  3TOA A;  2B3U A;  2Y0M A;  5F49 A;  4MFZ A;  2PJC A;  2VXK A;  1S7L A;  1Z9U A;  4MFJ A;  5KTA A;  2J8M A;  4OME A;  3TX8 A;  2NSM A;  4U9Z A;  4E8O A;  2B5G B;  5H86 A;  3V7Z A;  1LOK A;  1Z5R A;  3IU2 A;  4IUS A;  3PFE A;  4R87 A;  2Z11 A;  4CGM A;  2JBK A;  3CPA A;  5LYI A;  4C68 A;  4MCP A;  3NFZ A;  4M85 A;  4UIB A;  5J8C A;  3PRT A;  5HH1 A;  2I79 A;  5F09 A;  4GS4 A;  4EVY A;  1YR0 A;  3LWU A;  2X7B A;  3FF3 A;  2AFO A;  3OWC A;  2R8V A;  3TC8 A;  4AVB A;  4EWT A;  4F8Z A;  1YSJ A;  1NMT A;  4UWI A;  5F46 A;  2RFH A;  3NA6 A;  3IO1 A;  3BJ7 A;  4DYO A;  1YME A;  3KI9 A;  3QNV A;  4LQ6 A;  4FD4 A;  3V38 A;  2PJ6 A;  1TIQ A;  4HKF A;  2B4D B;  1M1D A;  3KQZ A;  3NH4 A;  2Q7B A;  3KGQ A;  3R9G A;  3PFO A;  3SI2 A;  4OAE A;  3A9L A;  1NSL A;  3S6F A;  4A94 A;  3E0K A;  4UCP A;  1ZG9 A;  3PEI A;  3BI0 A;  3CPX A;  2ZEO A;  3RO0 A;  4CGO A;  1JQG A;  2C6C A;  3NE7 A;  4R8F A;  3IJ3 A;  5HVG A;  1YLE A;  2QML A; 
#chains in the Genus database with same CATH homology
 3S6K A;  2Z0Z A;  2B4B A;  4MFK A;  2OB0 A;  1M4G A;  1YK3 A;  2CY2 A;  2FXF A;  3TO9 A;  2VQY A;  4B13 A;  2FIW A;  4NEX A;  4UBR A;  4KOY A;  4CGL A;  1CJW A;  2FE7 A;  3DNS A;  1ZO0 A;  4XPD B;  2REF A;  3LD2 A;  4PK2 A;  4HNW B;  4I49 A;  3SXO A;  3BJ8 A;  4NSQ A;  3RYO A;  4DNC A;  5AG4 A;  1S5K A;  4OAD A;  3F8K A;  4XNH B;  1S7F A;  1Z4R A;  3F0A A;  3F5B A;  1S60 A;  4C2Y A;  3FRM A;  4CRY B;  4YGO A;  1IB1 E;  5AGE A;  2Z3N A;  2Q44 A;  2JDD A;  1VHS A;  4X5K A;  2QIR A;  3GKR A;  1GHE A;  5AG5 A;  2ZPA A;  2ZW6 A;  3TO6 A;  3FXT A;  4KSA A;  4CYO A;  3DR6 A;  4YRH A;  3G3S A;  3TT2 A;  4KZT A;  2PC1 A;  1N71 A;  4H6Z A;  4C2Z A;  3W6X A;  2JDC A;  2P6G A;  3TTH A;  4B5P B;  5KTC A;  4CS0 B;  4HNY B;  3QAH A;  1J4J A;  1M44 A;  3FNC A;  4CAF A;  3TOB A;  2Q04 A;  3IU1 A;  1QSM A;  5EC4 A;  2BL1 A;  4JJX A;  1Q2Y A;  4MFQ A;  5C82 A;  4KOS A;  2ZW4 A;  3LOD A;  4CAE A;  2GE3 A;  2FCK A;  3IWG A;  1XMT A;  2O28 A;  4A2Z A;  4B5O A;  4C2X A;  4M3S A;  4A33 A;  4OLL A;  3VWE A;  3WR7 A;  4KUB A;  2VZY A;  4A95 A;  4RI1 A;  1K4J A;  1L0C A;  1YVO A;  2CNT A;  1S7K A;  2G3T A;  2FT0 A;  3QB8 A;  4K30 A;  4Y49 C;  4CYP A;  4CAX A;  4UCM A;  1R57 A;  1KUY A;  5JPH A;  4R3L A;  4B11 A;  5IV0 A;  2VBQ A;  4Y49 B;  2VI7 A;  4HNX B;  2B5G A;  3I9S A;  2CNM A;  5JQ4 A;  5G21 A;  3DDD A;  5ISV A;  5G20 A;  3B8G A;  3D3S A;  2BSW A;  1WWZ A;  1YVK A;  2DXQ A;  4Q36 A;  2P0W A;  2G3A A;  2H5M A;  3D2M A;  2A4N A;  2I00 A;  1PUA A;  2GAN A;  5HMN A;  3S6G A;  3I3G A;  4ONU A;  4MY3 A;  4KVX A;  5H84 A;  3FBU A;  2P6E A;  3H4Q A;  4CRZ B;  1KUX A;  4FD7 A;  4XPL A;  4AG9 A;  4FD5 A;  4MFL A;  4XPD C;  3S6H A;  2OZG A;  3IGR A;  3T9Y A;  2J8R A;  1XEB A;  2B4D A;  2HV2 A;  4R57 A;  2HQY A;  2ZW7 A;  4R9M A;  2Q4Y A;  1SQH A;  5F48 A;  2FL4 A;  4F6A A;  3CXQ A;  4KOV A;  3JVN A;  4AVC A;  4PK3 A;  2ATR A;  4JWP A;  4XNH C;  5I0C A;  1Y9W A;  4AB7 A;  4UWJ A;  2PR1 A;  4PSW A;  3JTK A;  1BOB A;  3EO4 A;  4ZGY B;  1XE4 A;  2Z3M A;  4Q38 A;  5AG6 A;  2PRB A;  3UY5 A;  3V8I A;  4R3K A;  3MGD A;  4CAV A;  3CXS A;  3W91 A;  4H6U A;  4KLW A;  4U5Y A;  3BLN A;  3PGP A;  5EBV A;  4MI4 A;  3R9F A;  2HUZ A;  2YNC C;  1CM0 A;  3IWE A;  4UA3 A;  5IX3 A;  4IF5 A;  3TE4 A;  2C27 A;  4F0Y A;  3R95 A;  3TO7 A;  1XIX A;  1KUV A;  1M4I A;  2AE6 A;  3W6S A;  5GCN A;  5DWM A;  2QEC A;  2WPW A;  2OZU A;  3JUW A;  2YGW A;  4NF1 A;  2Z3P A;  1OZP A;  4AG7 A;  4QB9 A;  4XPK A;  2ZW5 A;  2P6F A;  1B87 A;  3K9U A;  4MJ8 A;  3SXN A;  1WK4 A;  1RXT A;  1IID A;  4UFW A;  5G22 A;  4KOR A;  4B10 A;  1IIC A;  5AG7 A;  1MJ9 A;  2YNC A;  5G1Z A;  5KTD A;  2EUI A;  2FS5 A;  1S7N A;  1Q2C A;  2PQ8 A;  4NCZ A;  1V0C A;  5E96 A;  4A32 A;  1P0H A;  1P4N A;  4ORF A;  3SHP A;  3R96 A;  3N7Z A;  4F0X A;  1S3Z A;  1I21 A;  2DPS A;  2Z10 A;  2JLM A;  1Z4E A;  4L8A A;  4QC6 A;  1Y7R A;  1VKC A;  2Z3K A;  5C88 A;  3ZJ0 A;  5J8F A;  3EFA A;  4JXR A;  2R7H A;  4RS2 A;  2D4P A;  1I12 A;  3DSB A;  2R98 A;  2WPX A;  3ZZI A;  3D2P A;  2ARH A;  2REE A;  2CXA A;  1Q2D A;  4UFV A;  5CNP A;  4KSF A;  2ZXV A;  4JD6 A;  4YFJ A;  2YND A;  4KUA A;  2IL4 A;  1MJA A;  1M4D A;  4BMH A;  4C7I A;  1U6M A;  3P2H A;  3T90 A;  4ZBG A;  4A30 A;  2J8N A;  2KCW A;  3GY9 A;  3H5Z A;  4QBJ A;  4MFP A;  4UCN A;  2R1I A;  3VWD A;  3EY5 A;  5DWN A;  1YGH A;  2BEI A;  1IYL A;  1NE9 A;  3CXP A;  1LRZ A;  4PSX A;  4H89 A;  2AJ6 A;  4JLY A;  2PDO A;  3PZJ A;  4KLV A;  3FYN A;  3C26 A;  2OU2 A;  1B6B A;  3R1K A;  4L89 A;  2OH1 A;  2Q0Y A;  2Z3O A;  1PU9 A;  5FVJ A;  4LUA A;  1RO5 A;  3GYA A;  2K5T A;  5A28 A;  4II9 A;  2YNE A;  3P2F A;  2WSA A;  1IYK A;  1UFH A;  2Z3L A;  3TCV A;  1KZF A;  2G0B A;  4FD6 A;  5A27 A;  2VZZ A;  1QSN A;  1MK4 A;  2PR8 A;  4A31 A;  3TFY A;  4CYN A;  2GIV A;  4U9Y A;  2NMT A;  2RC4 A;  1Y9K A;  4QUS A;  4AVA A;  4KOW A;  4CAW A;  3EXN A;  2B3V A;  2EVN A;  4KOT A;  2B58 A;  3FIX A;  4KS9 A;  3R9E A;  4UFX A;  2BUE A;  4NXY A;  1FY7 A;  4CGP A;  4KVO E;  4KOX A;  4BBH A;  1XF8 A;  2PSW A;  3G8W A;  4PV6 A;  4E0A A;  4E2A A;  1QST A;  2D4O A;  2JEV A;  2FSR A;  2CNS A;  4B14 A;  4KVM E;  4JXQ A;  2FIA A;  4MHD A;  1YRE A;  4B12 A;  1MJB A;  2Q4V A;  2VEZ A;  4J3G A;  2DPT A;  3DR8 A;  1YX0 A;  5BWA B;  4CGN A;  3PP9 A;  3EC4 A;  4B5P A;  4C7H A;  2WUU A;  3D8P A;  2F5I A;  2OZH A;  4MBU A;  4LX9 A;  4QVT A;  1BO4 A;  3FB3 A;  1I1D A;  4KOU A;  1ON0 A;  3KKW A;  5F47 A;  1QSR A;  4CYQ A;  5IB0 A;  4MY0 A;  1QSO A;  3TOA A;  2B3U A;  2Y0M A;  5F49 A;  4MFZ A;  2VXK A;  1S7L A;  1Z9U A;  4MFJ A;  5KTA A;  2J8M A;  4U9Z A;  4E8O A;  2B5G B;  5H86 A;  3IU2 A;  4IUS A;  4R87 A;  2Z11 A;  4CGM A;  4C68 A;  5J8C A;  4M85 A;  5HH1 A;  2I79 A;  4GS4 A;  4EVY A;  1YR0 A;  2X7B A;  3OWC A;  4AVB A;  2R8V A;  1NMT A;  4UWI A;  5F46 A;  3BJ7 A;  4FD4 A;  1TIQ A;  4HKF A;  2B4D B;  1M1D A;  2Q7B A;  3R9G A;  4OAE A;  3A9L A;  1NSL A;  3S6F A;  3E0K A;  4UCP A;  4CGO A;  3NE7 A;  1YLE A;  2QML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...