1M4IA

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and kanamycin a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Aminoglycoside 2'-N-acetyltransferase
total genus 52
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m4iA00
2P0WA 4KOVA 2FIWA 4RI1A 3P2HA 1PUAA 2OZHA 4QUSA 1YREA 4KUBA 1MJBA 3BLNA 3S6GA 1SQHA 3TTHA 2FIAA 2Q4YA 2KCWA 2FCKA 2OZGA 1WWZA 3KKWA 4EVYA 4MI4A 2D4OA 4MBUA 2G0BA 2G3AA 4XPKA 2JDDA 1WK4A 4R3LA 3B8GA 3TOBA 1S7KA 4YFJA 3TT2A 3EFAA 3G8WA 4E8OA 4KOTA 1RO5A 2ZW6A 2P6EA 3PP9A 4FD4A 4HNXB 4JXQA 2CNSA 3G3SA 4U9YA 4YRHA 3LODA 4CRZB 3JUWA 3T90A 2I79A 4LX9A 3VWEA 4MHDA 1QSTA 5EC4A 4QB9A 4AVCA 1S7NA 3TOAA 1QSNA 4XPDB 4KOWA 1XF8A 3FNCA 4H6UA 1BO4A 4AVBA 1MK4A 2Q4VA 3ZZIA 2R1IA 2FT0A 4UWIA 2ZPAA 3SHPA 2PC1A 4QC6A 3E0KA 4GS4A 2P6GA 4CRYB 1LRZA 4I49A 3OWCA 3CXSA 2EUIA 4K30A 4XNHC 2B5GA 3S6HA 4QBJA 4PSXA 2Z10A 3JVNA 5KTDA 2ZW4A 2PR8A 1Y9WA 2VZYA 3DR8A 2VQYA 1UFHA 2OH1A 3FIXA 2R8VA 5IV0A 2ZW5A 3IGRA 4AVAA 2B4BA 3FRMA 4BMHA 3PGPA 4HNYB 4NF1A 4IUSA 3BJ7A 1XMTA 3FBUA 4R87A 3NE7A 4B5PA 2VXKA 2D4PA 5KTCA 4E2AA 4PSWA 1I1DA 5H86A 4NEXA 3R95A 4JLYA 3CXQA 3W91A 4CAVA 2QMLA 2FXFA 3TE4A 4U5YA 2GIVA 2VBQA 3D8PA 1FY7A 4CAXA 1Q2DA 5JPHA 2FE7A 1IICA 5F46A 5F48A 3FB3A 2ZW7A 2H5MA 1ON0A 2NMTA 2DXQA 3EXNA 4II9A 4MY0A 2O28A 4KORA 4LUAA 1KUVA 1KZFA 4MJ8A 4ONUA 5C82A 2Y0MA 1CM0A 1M4GA 1IYKA 5JQ4A 4Y49C 2CNTA 2JLMA 1Z9UA 3R9FA 4AB7A 4OADA 2EVNA 3IWGA 4R57A 2R98A 4PK2A 3VWDA 2OB0A 2FS5A 4B5PB 1NMTA 2BEIA 4AG9A 1S7LA 2RC4A 2QECA 2BUEA 2CNMA 2Q0YA 3ZJ0A 5HH1A 4ORFA 3FXTA 5I0CA 1S60A 3GYAA 4FD5A 1K4JA 2HUZA 2ATRA 5IB0A 1YR0A 2R7HA 4RS2A 3F0AA 3WR7A 2ZXVA 3RYOA 1N71A 1QSOA 1Y7RA 5IX3A 5J8CA 3N7ZA 3DR6A 2WPWA 2VI7A 4H6ZA 2QIRA 2HQYA 1U6MA 2Q04A 4NCZA 4CAWA 2JDCA 3H4QA 1S7FA 3R9GA 5J8FA 3UY5A 3SXNA 1YVOA 4F6AA 2PR1A 3CXPA 1VHSA 4KVME 4B5OA 4QVTA 4CS0B 4KVOE 2P6FA 3D2MA 1Z4RA 3FYNA 4JXRA 3TCVA 4UBRA 3GY9A 3LD2A 4PK3A 3DDDA 1YLEA 2OZUA 1Q2CA 2BSWA 3S6FA 1I21A 3EY5A 2PRBA 1NSLA 1R57A 4F0YA 3GKRA 4AG7A 4PV6A 3T9YA 5DWMA 4NSQA 1KUXA 3S6KA 1GHEA 4UWJA 1Y9KA 5FVJA 3D2PA 2BL1A 4NXYA 4YGOA 3R96A 2REFA 3EC4A 2Q7BA 2B3UA 1P4NA 4JJXA 4JWPA 3P2FA 4J3GA 4U9ZA 3W6XA 1M4IA 2PDOA 1P0HA 4ZBGA 4KLWA 1MJ9A 4R9MA 2B4DB 4XPDC 2J8MA 4X5KA 3SXOA 4M3SA 1IB1E 4KVXA 2FSRA 4DNCA 2B5GB 3W6SA 3DSBA 5CNPA 2PQ8A 2G3TA 3BJ8A 4KUAA 4M85A 4KOYA 3V8IA 2B4DA 2Z11A 5F49A 1B6BA 2VZZA 5ISVA 1M44A 2VEZA 1IIDA 1YVKA 2HV2A 2REEA 1M1DA 3D3SA 2Z0ZA 4FD6A 1B87A 2F5IA 1VKCA 1YX0A 1L0CA 3R1KA 4OAEA 1S5KA 1QSMA 2Q44A 5EBVA 4KOUA 1V0CA 1KUYA 3C26A 3K9UA 5DWNA 2C27A 4L8AA 3MGDA 4XPLA 1NE9A 4KLVA 1OZPA 3TO9A 2A4NA 4L89A 2ARHA 2WPXA 2K5TA 4FD7A 4OLLA 2JEVA 3F8KA 3TFYA 5KTAA 1Q2YA 5GCNA 5E96A 2I00A 2FL4A 1CJWA 1J4JA 2IL4A 1Z4EA 5C88A 1S3ZA 3F5BA 2PSWA 2X7BA 3TO7A 3TO6A 1YK3A 5HMNA 4KOSA 4Y49B 5F47A 1BOBA 1RXTA 4HNWB 4H89A 4E0AA 2GANA 4HKFA 1PU9A 4MY3A 1M4DA 4XNHB 1QSRA 1XE4A 1MJAA 2B58A 3QB8A 3PZJA 2AJ6A 4UA3A 3DNSA 2GE3A 2B3VA 1I12A 1TIQA 4R3KA 5H84A 2OU2A 3EO4A 4IF5A 4JD6A 2CY2A 1IYLA 1YGHA 4KZTA 1XIXA 3I9SA 3R9EA 2J8NA 3I3GA 3QAHA 4KOXA 1XEBA 2J8RA 2AE6A
chains in the Genus database with same CATH superfamily
1CPXA 2P0WA 2PJ0A 4KOVA 4CPAA 2FIWA 4RI1A 3D66A 3KL9A 3P2HA 4MHNA 1KWMA 1PUAA 2OZHA 4QUSA 1YREA 4M6GA 4TWEA 2Z3KA 3B2YA 3D68A 5LRJA 3B3SA 4KUBA 4DJLA 1MJBA 3HLPA 3BLNA 2YNCC 1DTDA 4NGNA 4OC0A 3S6GA 3B3VA 5DS0A 4MMOA 3LACA 4B10A 4R6TA 1SQHA 2Z3PA 2PJ9A 3TTHA 2FIAA 2Q4YA 1YW6A 3K9TA 2KCWA 3KQZA 2FCKA 2OZGA 1WWZA 4C2ZA 1ZG7A 3KKWA 3FVLA 4UCMA 4A30A 1IU8A 3CPXA 4MI4A 4B11A 3B3TA 3GIUA 3GLJA 2D4OA 3IJ3A 4MBUA 2G0BA 2G3AA 2XEGA 3B3CA 4C7HA 5LRKA 5JH9A 4XPKA 2JDDA 1WK4A 4R3LA 3B8GA 3TOBA 1S7KA 2V8VA 4YFJA 1Z8LA 2CTCA 3IU1A 3TT2A 5HVGA 3EFAA 2Q4ZA 3G8WA 2AFOA 1XOVA 4KOTA 1RO5A 4E8OA 2ZW6A 2PJ3A 2P6EA 3H5ZA 3PP9A 4FD4A 4ZY1A 3SJXA 4HNXB 4JXQA 2CNSA 3G3SA 3H8EA 4P10A 4U9YA 4YRHA 3LODA 3PEIA 4CRZB 3JUWA 1LANA 2I79A 2ZELA 3T90A 1JWQA 3PB8X 4LX9A 3VWEA 3N5FA 4MHDA 3KQXA 2V8GA 1QSTA 5EC4A 3QNVA 3NFZA 4MFKA 4QB9A 4KSAA 4AVCA 4EFDA 2GLJA 1ZG9A 1S7NA 4UFXA 4A95A 1CBXA 4PXEA 1TKJA 3TOAA 1TKHA 1QSNA 2HC9A 2XEIA 3D7DA 1YMEA 4XPDB 1QMUA 3CPAA 4KOWA 1XF8A 2J9AA 3CDXA 1BO4A 3FNCA 4H6UA 2VL1A 3VARA 4AVBA 1MK4A 2Q4VA 3B35A 3ZZIA 5HXDA 2R1IA 4P4IA 4MFLA 3PB7X 2FT0A 2JBJA 4UWIA 5G1ZA 2ZPAA 3SHPA 4H2KA 4GM5A 4NGTA 4MFJA 5ELYA 2PC1A 2PRQA 4QC6A 3E0KA 3QAYA 2P6GA 3NH5A 4GS4A 1LRZA 4P4BA 4CRYB 4I49A 4YWYA 4R8FA 2PVWA 2PVVA 3D7FA 4ZYQA 3OWCA 3CXSA 3BXMA 2EUIA 1LFWA 4PPZA 4K30A 2EO8A 4NJRA 4OC1A 3IWWA 4Q36A 4XNHC 3SJEA 2B5GA 2BOAA 2FVGA 3S6HA 1AYEA 3LMSA 3IWEA 4UF4A 5JGFA 3MN8A 3H8GA 4QBJA 2PJ7A 3PFEA 3KHXA 4PSXA 2Z10A 3TC8A 3B7IA 4OMEA 4OC3A 2V8DA 4ZX8A 4F0XA 2C6GA 3D7GA 2ZEDA 3JVNA 5KTDA 5IB9A 3K2KA 4F9UA 2ZW4A 3WT4A 2PR8A 1Y9WA 1YSJA 2VZYA 4IHMA 3DR8A 1R3NA 2VQYA 2WYRA 1UFHA 4MRIA 4RN7A 2ZEPA 2OH1A 3FIXA 4A38A 4ZY0A 4BD9A 2AFMA 2R8VA 4HPSA 4K3NA 3TX8A 5BWAB 5IV0A 3PBBA 2ZW5A 3IGRA 4ZI6A 4AVAA 1ELLP 1LCPA 2B4BA 3FRMA 2CTBA 4PXCA 3PGPA 4BMHA 4MCRA 4HNYB 4NF1A 4OIWA 4UIAA 5AG7A 2YNDA 1AMPA 3PB4X 2V77A 1XMTA 3BJ7A 3FBUA 4IUSA 4OC5A 3NE7A 4R87A 4UFVA 4B5PA 4FAIA 2EK9A 3LWUA 2C1CA 2VXKA 2D4PA 5KTCA 4WWVA 4E2AA 4B14A 1VIXA 2NSMA 4PSWA 2PCUA 1I1DA 4G1PA 5H86A 4NEXA 3R95A 4JLYA 3FX6A 3CXQA 3FJUA 3W91A 4CAVA 1OBRA 2QMLA 2Z3NA 4KSIA 4A94A 1CX8A 4CGPA 2C6PA 4FWUA 2FXFA 3TE4A 1XRYA 2GIVA 4U5YA 2VBQA 3D8PA 1YW4A 1FY7A 4CAXA 1Q2DA 2ZEMA 1VHEA 2FE7A 5JPHA 1IICA 2ANPA 2ZENA 2RFHA 5F46A 5F48A 2ZW7A 3FB3A 3IU2A 2H5MA 1IY7A 1ON0A 3S9LA 2NMTA 2DXQA 3EXNA 5I4MA 4II9A 4MY0A 2O28A 4KORA 5CPAA 3D4UA 1NSAA 4LUAA 4A31A 3FECA 1KUVA 1PCAA 3KR4A 1KZFA 4OC2A 3RNZA 3WC5A 2EBJA 1PYTB 3PRTA 4MJ8A 3WABA 4UEZA 4C7IA 2PJ2A 1IGBA 4ONUA 2F8HA 4MCQA 5C82A 4F9VA 3IC1A 2Y0MA 4NJQA 2OOTA 3SJGA 1CM0A 1M4GA 2DF5A 1IYKA 4UCPA 5JQ4A 4Y49C 2CNTA 1DE4C 2EWBA 3D7HA 2JLMA 4PXDA 4CAFA 1Z9UA 3R9FA 4FBEA 1F2OA 2YNEA 4AB7A 4OADA 3NH4A 5LYFA 3S9NA 2EVNA 3IWGA 5THWA 3V38A 4R57A 4B6ZA 2R98A 1EE3P 4NGQA 4PK2A 3VWDA 2OB0A 2FS5A 1BLLE 4NGSA 1ARMA 4B5PB 4JYWA 1NMTA 4M6IA 2BEIA 2AFZA 4CAEA 4LQGA 2AFWA 3VH9A 4AG9A 4BINA 2G9DA 2Z3OA 4CGNA 3FEEA 3IEHA 2IQ6A 1S7LA 2RC4A 3FF3A 4OC4A 2QECA 3HUVA 5D29A 2BUEA 2CNMA 4OKOA 1XMBA 2Q0YA 1AUGA 3ZJ0A 4B12A 5AG5A 5HH1A 4MCSA 4ORFA 2QJ8A 3FXTA 5I0CA 4M6HA 3SI1A 1S60A 3NH8A 3GYAA 3KZWA 4FD5A 1K4JA 1LAMA 2HUZA 2ATRA 5IB0A 1YR0A 2QYVA 2R7HA 2PJAA 4RS2A 3F0AA 1CG2A 3WR7A 4YU9A 2ZEOA 1Y7EA 2ZXVA 3VATA 1YLOA 1N71A 3RYOA 1QSOA 1Y7RA 2AFSA 2Q7SA 4MHPA 2Z3MA 5IX3A 5J8CA 3DLJA 3DR6A 3N7ZA 2WPWA 4EVYA 1HDUA 2VI7A 2JBKA 4H6ZA 2QIRA 2HQYA 3RO0A 3RZAA 1U6MA 3ISZA 2PJ8A 3H8FA 3S9MA 2Q04A 4NCZA 4CAWA 2JDCA 3H4QA 4AXVA 1S7FA 2RB7A 4CGMA 3GB0A 4A33A 4A39A 2QVPA 2BO9A 2ZEFA 4W9YA 3R9GA 8CPAA 2CIJA 3PB9X 5J8FA 3UY5A 4OP4A 3SXNA 2O53A 4PXBA 2V8HA 1YVOA 4F6AA 2PR1A 2ZEEA 3CXPA 1VHSA 4KVME 3CZXA 4PQAA 3NA6A 3GUXA 4B5OA 2DEAA 4QVTA 4CS0B 4KVOE 2P6FA 3WC7A 3D2MA 1X10A 4F8ZA 1VHOA 1Z4RA 2GREA 2Q51A 3FYNA 4MFQA 4JXRA 4R7MA 3T8WA 4UBRA 3TCVA 4CYQA 4P45A 3GY9A 3LD2A 4LQ6A 4UCNA 1Z8WA 4NGPA 4PK3A 1Y0YA 3DDDA 3MRUA 2GU2A 2PJBA 3PB6X 2GFQA 1YLEA 4ONWA 5F09A 1IOIA 2OZUA 2ZEGA 1Q2CA 2BSWA 3S6FA 1I21A 3EY5A 2PRBA 1NSLA 2GLFA 1R57A 2WUUA 4A2ZA 3GKRA 4F0YA 5A28A 4KSFA 4BBHA 2XEFA 4X3RA 5JM6A 1X12A 4AG7A 4PV6A 3RAMA 4MHZA 4DYOA 3T9YA 5DWMA 4NSQA 1KUXA 3KASA 3S6KA 1GHEA 3JRUA 4Q7AA 4MFZA 4OIDA 1Y9KA 4UWJA 1JQGA 5FVJA 3L2NA 4ZY2A 2ABZA 3D2PA 2BL1A 1LOKA 2O4HA 4NXYA 2PIYA 4YGOA 2REFA 3R96A 2ZEHA 3WC6A 4A37A 3EC4A 4RUHA 1TXRA 2Q7BA 2B3UA 3IIBA 1P4NA 4JJXA 4JWPA 2NYQA 3P2FA 4J3GA 4UIBA 4MHYA 4U9ZA 3W6XA 1M4IA 4UEFA 1Y0RA 2PDOA 1P0HA 1VGYA 2I3CA 4ZBGA 1BPMA 2Z3LA 4KLWA 1MJ9A 4KS9A 4R9MA 2DPTA 4NGRA 1TF8A 2B4DB 3IFEA 4XPDC 5K8MA 2J8MA 5D8NA 2DPSA 4X5KA 3SI0A 3SXOA 4M3SA 3CT9A 1IB1E 4KVXA 2FSRA 3B3WA 4DNCA 2B5GB 3W6SA 3DSBA 4TNUA 5CNPA 1ZLIA 2F7VA 2G3TA 2PQ8A 3BJ8A 3KR5A 4KOYA 2YGWA 4KUAA 2B4DA 4M85A 3V8IA 4B13A 5K8PA 2Z11A 5LYIA 5G21A 1R43A 4WJBA 5F49A 4UFWA 1XJOA 1BAVA 1B6BA 5G22A 2IJZA 2VZZA 5ISVA 1M44A 2VEZA 1IIDA 1ARLA 1YVKA 3FEDA 2CXAA 2HV2A 3A9LA 3KI9A 2REEA 1M1DA 3D3SA 2Z0ZA 4FD6A 2OR4A 4NGMA 1B87A 5K8OA 3RBUA 4C68A 2F5IA 1VKCA 4EMEA 4X2TA 2ZOFA 1YX0A 1Z2LA 1L0CA 4FUUA 3R1KA 4MCPA 4OAEA 1S5KA 1ZO0A 1QSMA 2Q44A 2ZOGA 3DGVA 2PJCA 5EBVA 4KOUA 1V0CA 1FNOA 1KUYA 2BCOA 3JTKA 1TKFA 1F2PA 3C26A 1HEEA 3K9UA 4UEEA 4Q38A 5DWNA 3V7ZA 2C27A 2WZNA 3MGDA 4L8AA 3NE8A 3FMCA 4XPLA 1H8LA 2PJ1A 4P4FA 2EK8A 1NE9A 4KLVA 1OZPA 3TO9A 1UWYA 2A4NA 2IMOA 2PJ5A 3BHXA 2AFXA 4L89A 4R76A 4MFPA 1GYTA 2YNCA 3KHZA 2ARHA 2WPXA 3ISXA 5EMIA 2K5TA 4FD7A 2JEWA 2JEVA 3F8KA 4OLLA 1HDQA 5AG6A 3KGQA 4C2XA 5LYDA 4O23A 5AG4A 3TFYA 4P6YA 1LAPA 5KTAA 1ZG8A 1BPNA 4GXHA 2AFUA 1Q2YA 4CGOA 1QQ9A 5GCNA 4EWTA 5E96A 2I00A 4Z65A 1F57A 5HVHA 1IOFA 2C6CA 2FL4A 3IO1A 1CJWA 1CP6A 1Z8XA 1Z8TA 1J4JA 1CP7A 2IL4A 4DUKA 1Z4EA 3PBEA 5C88A 1S3ZA 2POKA 2CF4A 2PSWA 2X7BA 1XBUA 3F5BA 1YK3A 3TO7A 3TO6A 4KOSA 5HMNA 4Y49B 2PE3A 5F47A 1BOBA 1CPSA 1RXTA 4HNWB 4NFRA 5LRGA 4P4DA 4H89A 3BI0A 4E0AA 2PIZA 2GANA 4HKFA 4JZ0A 4P4EA 1PU9A 3BI1A 1M4DA 4MY3A 4XNHB 1QSRA 3D67A 4X8IA 1XE4A 1MJAA 2B58A 3QB8A 3PZJA 2AJ6A 4UA3A 5G20A 3DNSA 1XFOA 1Q7LA 2GE3A 2B3VA 1I12A 1YQEA 1TIQA 3PFOA 4R3KA 4C2YA 5LYLA 1ZLHA 1M4LA 5A27A 5K8NA 5H84A 2ODFA 2OU2A 1Z5RA 4P44A 3SI2A 3SJFA 6CPAA 4CGLA 1ELMP 3EO4A 4IF5A 4IAVA 1A2ZA 4JD6A 2CY2A 1IYLA 3FH4A 1YGHA 5J1QA 4KZTA 4MXUA 2Q43A 2HB6A 1XIXA 4IK2A 4CYPA 7CPAA 3I9SA 5AGEA 3R9EA 5CBMA 2J8NA 2WSAA 3I3GA 1TF9A 4ZX9A 4ZGYB 2PJ6A 3QAHA 4KOXA 3I1UA 4A32A 1RTQA 2PJ4A 1XEBA 4CYOA 2XEJA 5HVFA 4CYNA 2J8RA 4P4JA 2AE6A 1FT7A
chains in the Genus database with same CATH topology
2P0WA 4KOVA 2FIWA 4RI1A 3P2HA 1PUAA 2OZHA 4QUSA 1YREA 2Z3KA 4KUBA 1MJBA 3BLNA 2YNCC 3S6GA 4B10A 1SQHA 2Z3PA 3TTHA 2FIAA 2Q4YA 2KCWA 2FCKA 2OZGA 1WWZA 4C2ZA 3KKWA 4UCMA 4A30A 4EVYA 4B11A 4MI4A 2D4OA 4MBUA 2G0BA 2G3AA 4C7HA 4XPKA 2JDDA 1WK4A 4R3LA 3B8GA 3TOBA 1S7KA 4YFJA 3IU1A 3TT2A 3EFAA 3G8WA 4E8OA 4KOTA 1RO5A 2ZW6A 2P6EA 3H5ZA 3PP9A 4FD4A 4HNXB 4JXQA 2CNSA 3G3SA 4U9YA 4YRHA 3LODA 4CRZB 3JUWA 3T90A 2I79A 4LX9A 3VWEA 4MHDA 1QSTA 5EC4A 4MFKA 4QB9A 4AVCA 4KSAA 1S7NA 4UFXA 4A95A 3TOAA 1QSNA 4XPDB 4KOWA 1XF8A 3FNCA 4H6UA 1BO4A 4AVBA 1MK4A 2Q4VA 3ZZIA 2R1IA 4MFLA 2FT0A 4UWIA 5G1ZA 2ZPAA 3SHPA 4MFJA 2PC1A 4QC6A 3E0KA 4GS4A 2P6GA 4CRYB 1LRZA 4I49A 3OWCA 3CXSA 2EUIA 4K30A 4Q36A 4XNHC 2B5GA 3S6HA 3IWEA 4QBJA 4PSXA 2Z10A 4F0XA 3JVNA 5KTDA 2ZW4A 2PR8A 1Y9WA 2VZYA 3DR8A 2VQYA 1UFHA 2OH1A 3FIXA 2R8VA 5IV0A 5BWAB 2ZW5A 3IGRA 4AVAA 2B4BA 3FRMA 4BMHA 3PGPA 4HNYB 4NF1A 5AG7A 2YNDA 4IUSA 3BJ7A 1XMTA 3FBUA 4R87A 3NE7A 4B5PA 4UFVA 2VXKA 2D4PA 5KTCA 4E2AA 4B14A 4PSWA 1I1DA 5H86A 4NEXA 3R95A 4JLYA 3CXQA 3W91A 4CAVA 2QMLA 2Z3NA 4CGPA 2FXFA 3TE4A 2GIVA 4U5YA 2VBQA 3D8PA 1FY7A 4CAXA 1Q2DA 5JPHA 2FE7A 1IICA 5F46A 5F48A 3FB3A 2ZW7A 3IU2A 2H5MA 1ON0A 2NMTA 2DXQA 3EXNA 4II9A 4MY0A 2O28A 4KORA 4LUAA 4A31A 1KUVA 1KZFA 4MJ8A 4C7IA 4ONUA 5C82A 2Y0MA 1CM0A 1M4GA 1IYKA 4UCPA 5JQ4A 4Y49C 2CNTA 2JLMA 4CAFA 1Z9UA 3R9FA 2YNEA 4AB7A 4OADA 2EVNA 3IWGA 4R57A 2R98A 4PK2A 3VWDA 2OB0A 2FS5A 4B5PB 1NMTA 2BEIA 4CAEA 4AG9A 4CGNA 2Z3OA 1S7LA 2RC4A 2QECA 2BUEA 2CNMA 2Q0YA 3ZJ0A 4B12A 5AG5A 5HH1A 4ORFA 3FXTA 5I0CA 1S60A 3GYAA 4FD5A 1K4JA 2HUZA 2ATRA 5IB0A 1YR0A 2R7HA 4RS2A 3F0AA 3WR7A 2ZXVA 3RYOA 1N71A 1QSOA 1Y7RA 2Z3MA 5IX3A 5J8CA 3N7ZA 3DR6A 2WPWA 2VI7A 4H6ZA 2QIRA 2HQYA 1U6MA 2Q04A 4NCZA 4CAWA 2JDCA 3H4QA 1S7FA 4CGMA 4A33A 3R9GA 5J8FA 3UY5A 3SXNA 1YVOA 4F6AA 2PR1A 3CXPA 1VHSA 4KVME 4B5OA 4QVTA 4CS0B 4KVOE 2P6FA 3D2MA 1Z4RA 3FYNA 4MFQA 4JXRA 3TCVA 4UBRA 4CYQA 3GY9A 3LD2A 4UCNA 4PK3A 3DDDA 1YLEA 2OZUA 1Q2CA 2BSWA 3S6FA 1I21A 3EY5A 2PRBA 1NSLA 4A2ZA 1R57A 2WUUA 4F0YA 3GKRA 5A28A 4KSFA 4BBHA 4AG7A 4PV6A 3T9YA 5DWMA 4NSQA 1KUXA 3S6KA 1GHEA 4MFZA 4UWJA 1Y9KA 5FVJA 3D2PA 2BL1A 4NXYA 4YGOA 3R96A 2REFA 3EC4A 2Q7BA 2B3UA 1P4NA 4JJXA 4JWPA 3P2FA 4J3GA 4U9ZA 3W6XA 1M4IA 2PDOA 1P0HA 4ZBGA 4KLWA 2Z3LA 1MJ9A 4KS9A 4R9MA 2DPTA 2B4DB 4XPDC 2J8MA 2DPSA 4X5KA 3SXOA 4M3SA 1IB1E 4KVXA 2FSRA 4DNCA 2B5GB 3W6SA 3DSBA 5CNPA 2PQ8A 2G3TA 3BJ8A 4KUAA 4M85A 4KOYA 2YGWA 3V8IA 2B4DA 4B13A 2Z11A 5G21A 5F49A 4UFWA 1B6BA 5G22A 2VZZA 5ISVA 1M44A 2VEZA 1IIDA 1YVKA 2CXAA 2HV2A 3A9LA 2REEA 1M1DA 3D3SA 2Z0ZA 4FD6A 1B87A 4C68A 2F5IA 1VKCA 1YX0A 1L0CA 3R1KA 4OAEA 1S5KA 1ZO0A 1QSMA 2Q44A 5EBVA 4KOUA 1V0CA 1KUYA 3JTKA 3C26A 3K9UA 4Q38A 5DWNA 2C27A 4L8AA 3MGDA 4XPLA 1NE9A 4KLVA 1OZPA 3TO9A 2A4NA 4L89A 4MFPA 2YNCA 2ARHA 2WPXA 2K5TA 4FD7A 4OLLA 2JEVA 3F8KA 5AG6A 4C2XA 5AG4A 3TFYA 5KTAA 1Q2YA 4CGOA 5GCNA 5E96A 2I00A 2FL4A 1CJWA 1J4JA 2IL4A 1Z4EA 5C88A 1S3ZA 3F5BA 2PSWA 2X7BA 3TO7A 3TO6A 1YK3A 5HMNA 4KOSA 4Y49B 5F47A 1BOBA 1RXTA 4HNWB 4H89A 4E0AA 2GANA 4HKFA 1PU9A 4MY3A 1M4DA 4XNHB 1QSRA 1XE4A 1MJAA 2B58A 3QB8A 3PZJA 2AJ6A 4UA3A 5G20A 3DNSA 2GE3A 2B3VA 1I12A 1TIQA 4R3KA 4C2YA 5A27A 5H84A 2OU2A 4CGLA 3EO4A 4IF5A 4JD6A 2CY2A 1IYLA 1YGHA 4KZTA 1XIXA 4CYPA 3I9SA 5AGEA 3R9EA 2J8NA 2WSAA 3I3GA 4ZGYB 3QAHA 4KOXA 4A32A 1XEBA 4CYOA 4CYNA 2J8RA 2AE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0W A;  4KOV A;  2FIW A;  4RI1 A;  3P2H A;  1PUA A;  2OZH A;  4QUS A;  1YRE A;  4KUB A;  1MJB A;  3BLN A;  3S6G A;  1SQH A;  3TTH A;  2FIA A;  2Q4Y A;  2KCW A;  2FCK A;  2OZG A;  1WWZ A;  3KKW A;  4EVY A;  4MI4 A;  2D4O A;  4MBU A;  2G0B A;  2G3A A;  4XPK A;  2JDD A;  1WK4 A;  4R3L A;  3B8G A;  3TOB A;  1S7K A;  4YFJ A;  3TT2 A;  3EFA A;  3G8W A;  4E8O A;  4KOT A;  1RO5 A;  2ZW6 A;  2P6E A;  3PP9 A;  4FD4 A;  4HNX B;  4JXQ A;  2CNS A;  3G3S A;  4U9Y A;  4YRH A;  3LOD A;  4CRZ B;  3JUW A;  3T90 A;  2I79 A;  4LX9 A;  3VWE A;  4MHD A;  1QST A;  5EC4 A;  4QB9 A;  4AVC A;  1S7N A;  3TOA A;  1QSN A;  4XPD B;  4KOW A;  1XF8 A;  3FNC A;  4H6U A;  1BO4 A;  4AVB A;  1MK4 A;  2Q4V A;  3ZZI A;  2R1I A;  2FT0 A;  4UWI A;  2ZPA A;  3SHP A;  2PC1 A;  4QC6 A;  3E0K A;  4GS4 A;  2P6G A;  4CRY B;  1LRZ A;  4I49 A;  3OWC A;  3CXS A;  2EUI A;  4K30 A;  4XNH C;  2B5G A;  3S6H A;  4QBJ A;  4PSX A;  2Z10 A;  3JVN A;  5KTD A;  2ZW4 A;  2PR8 A;  1Y9W A;  2VZY A;  3DR8 A;  2VQY A;  1UFH A;  2OH1 A;  3FIX A;  2R8V A;  5IV0 A;  2ZW5 A;  3IGR A;  4AVA A;  2B4B A;  3FRM A;  4BMH A;  3PGP A;  4HNY B;  4NF1 A;  4IUS A;  3BJ7 A;  1XMT A;  3FBU A;  4R87 A;  3NE7 A;  4B5P A;  2VXK A;  2D4P A;  5KTC A;  4E2A A;  4PSW A;  1I1D A;  5H86 A;  4NEX A;  3R95 A;  4JLY A;  3CXQ A;  3W91 A;  4CAV A;  2QML A;  2FXF A;  3TE4 A;  4U5Y A;  2GIV A;  2VBQ A;  3D8P A;  1FY7 A;  4CAX A;  1Q2D A;  5JPH A;  2FE7 A;  1IIC A;  5F46 A;  5F48 A;  3FB3 A;  2ZW7 A;  2H5M A;  1ON0 A;  2NMT A;  2DXQ A;  3EXN A;  4II9 A;  4MY0 A;  2O28 A;  4KOR A;  4LUA A;  1KUV A;  1KZF A;  4MJ8 A;  4ONU A;  5C82 A;  2Y0M A;  1CM0 A;  1M4G A;  1IYK A;  5JQ4 A;  4Y49 C;  2CNT A;  2JLM A;  1Z9U A;  3R9F A;  4AB7 A;  4OAD A;  2EVN A;  3IWG A;  4R57 A;  2R98 A;  4PK2 A;  3VWD A;  2OB0 A;  2FS5 A;  4B5P B;  1NMT A;  2BEI A;  4AG9 A;  1S7L A;  2RC4 A;  2QEC A;  2BUE A;  2CNM A;  2Q0Y A;  3ZJ0 A;  5HH1 A;  4ORF A;  3FXT A;  5I0C A;  1S60 A;  3GYA A;  4FD5 A;  1K4J A;  2HUZ A;  2ATR A;  5IB0 A;  1YR0 A;  2R7H A;  4RS2 A;  3F0A A;  3WR7 A;  2ZXV A;  3RYO A;  1N71 A;  1QSO A;  1Y7R A;  5IX3 A;  5J8C A;  3N7Z A;  3DR6 A;  2WPW A;  2VI7 A;  4H6Z A;  2QIR A;  2HQY A;  1U6M A;  2Q04 A;  4NCZ A;  4CAW A;  2JDC A;  3H4Q A;  1S7F A;  3R9G A;  5J8F A;  3UY5 A;  3SXN A;  1YVO A;  4F6A A;  2PR1 A;  3CXP A;  1VHS A;  4KVM E;  4B5O A;  4QVT A;  4CS0 B;  4KVO E;  2P6F A;  3D2M A;  1Z4R A;  3FYN A;  4JXR A;  3TCV A;  4UBR A;  3GY9 A;  3LD2 A;  4PK3 A;  3DDD A;  1YLE A;  2OZU A;  1Q2C A;  2BSW A;  3S6F A;  1I21 A;  3EY5 A;  2PRB A;  1NSL A;  1R57 A;  4F0Y A;  3GKR A;  4AG7 A;  4PV6 A;  3T9Y A;  5DWM A;  4NSQ A;  1KUX A;  3S6K A;  1GHE A;  4UWJ A;  1Y9K A;  5FVJ A;  3D2P A;  2BL1 A;  4NXY A;  4YGO A;  3R96 A;  2REF A;  3EC4 A;  2Q7B A;  2B3U A;  1P4N A;  4JJX A;  4JWP A;  3P2F A;  4J3G A;  4U9Z A;  3W6X A;  1M4I A;  2PDO A;  1P0H A;  4ZBG A;  4KLW A;  1MJ9 A;  4R9M A;  2B4D B;  4XPD C;  2J8M A;  4X5K A;  3SXO A;  4M3S A;  1IB1 E;  4KVX A;  2FSR A;  4DNC A;  2B5G B;  3W6S A;  3DSB A;  5CNP A;  2PQ8 A;  2G3T A;  3BJ8 A;  4KUA A;  4M85 A;  4KOY A;  3V8I A;  2B4D A;  2Z11 A;  5F49 A;  1B6B A;  2VZZ A;  5ISV A;  1M44 A;  2VEZ A;  1IID A;  1YVK A;  2HV2 A;  2REE A;  1M1D A;  3D3S A;  2Z0Z A;  4FD6 A;  1B87 A;  2F5I A;  1VKC A;  1YX0 A;  1L0C A;  3R1K A;  4OAE A;  1S5K A;  1QSM A;  2Q44 A;  5EBV A;  4KOU A;  1V0C A;  1KUY A;  3C26 A;  3K9U A;  5DWN A;  2C27 A;  4L8A A;  3MGD A;  4XPL A;  1NE9 A;  4KLV A;  1OZP A;  3TO9 A;  2A4N A;  4L89 A;  2ARH A;  2WPX A;  2K5T A;  4FD7 A;  4OLL A;  2JEV A;  3F8K A;  3TFY A;  5KTA A;  1Q2Y A;  5GCN A;  5E96 A;  2I00 A;  2FL4 A;  1CJW A;  1J4J A;  2IL4 A;  1Z4E A;  5C88 A;  1S3Z A;  3F5B A;  2PSW A;  2X7B A;  3TO7 A;  3TO6 A;  1YK3 A;  5HMN A;  4KOS A;  4Y49 B;  5F47 A;  1BOB A;  1RXT A;  4HNW B;  4H89 A;  4E0A A;  2GAN A;  4HKF A;  1PU9 A;  4MY3 A;  1M4D A;  4XNH B;  1QSR A;  1XE4 A;  1MJA A;  2B58 A;  3QB8 A;  3PZJ A;  2AJ6 A;  4UA3 A;  3DNS A;  2GE3 A;  2B3V A;  1I12 A;  1TIQ A;  4R3K A;  5H84 A;  2OU2 A;  3EO4 A;  4IF5 A;  4JD6 A;  2CY2 A;  1IYL A;  1YGH A;  4KZT A;  1XIX A;  3I9S A;  3R9E A;  2J8N A;  3I3G A;  3QAH A;  4KOX A;  1XEB A;  2J8R A;  2AE6 A; 
#chains in the Genus database with same CATH topology
 1CPX A;  2P0W A;  2PJ0 A;  4KOV A;  4CPA A;  2FIW A;  4RI1 A;  3D66 A;  3KL9 A;  3P2H A;  4MHN A;  1KWM A;  1PUA A;  2OZH A;  4QUS A;  1YRE A;  4M6G A;  4TWE A;  2Z3K A;  3B2Y A;  3D68 A;  5LRJ A;  3B3S A;  4KUB A;  4DJL A;  1MJB A;  3HLP A;  3BLN A;  2YNC C;  1DTD A;  4NGN A;  4OC0 A;  3S6G A;  3B3V A;  5DS0 A;  4MMO A;  3LAC A;  4B10 A;  4R6T A;  1SQH A;  2Z3P A;  2PJ9 A;  3TTH A;  2FIA A;  2Q4Y A;  1YW6 A;  3K9T A;  2KCW A;  3KQZ A;  2FCK A;  2OZG A;  1WWZ A;  4C2Z A;  1ZG7 A;  3KKW A;  3FVL A;  4UCM A;  4A30 A;  1IU8 A;  3CPX A;  4MI4 A;  4B11 A;  3B3T A;  3GIU A;  3GLJ A;  2D4O A;  3IJ3 A;  4MBU A;  2G0B A;  2G3A A;  2XEG A;  3B3C A;  4C7H A;  5LRK A;  5JH9 A;  4XPK A;  2JDD A;  1WK4 A;  4R3L A;  3B8G A;  3TOB A;  1S7K A;  2V8V A;  4YFJ A;  1Z8L A;  2CTC A;  3IU1 A;  3TT2 A;  5HVG A;  3EFA A;  2Q4Z A;  3G8W A;  2AFO A;  1XOV A;  4KOT A;  1RO5 A;  4E8O A;  2ZW6 A;  2PJ3 A;  2P6E A;  3H5Z A;  3PP9 A;  4FD4 A;  4ZY1 A;  3SJX A;  4HNX B;  4JXQ A;  2CNS A;  3G3S A;  3H8E A;  4P10 A;  4U9Y A;  4YRH A;  3LOD A;  3PEI A;  4CRZ B;  3JUW A;  1LAN A;  2I79 A;  2ZEL A;  3T90 A;  1JWQ A;  3PB8 X;  4LX9 A;  3VWE A;  3N5F A;  4MHD A;  3KQX A;  2V8G A;  1QST A;  5EC4 A;  3QNV A;  3NFZ A;  4MFK A;  4QB9 A;  4KSA A;  4AVC A;  4EFD A;  2GLJ A;  1ZG9 A;  1S7N A;  4UFX A;  4A95 A;  1CBX A;  4PXE A;  1TKJ A;  3TOA A;  1TKH A;  1QSN A;  2HC9 A;  2XEI A;  3D7D A;  1YME A;  4XPD B;  1QMU A;  3CPA A;  4KOW A;  1XF8 A;  2J9A A;  3CDX A;  1BO4 A;  3FNC A;  4H6U A;  2VL1 A;  3VAR A;  4AVB A;  1MK4 A;  2Q4V A;  3B35 A;  3ZZI A;  5HXD A;  2R1I A;  4P4I A;  4MFL A;  3PB7 X;  2FT0 A;  2JBJ A;  4UWI A;  5G1Z A;  2ZPA A;  3SHP A;  4H2K A;  4GM5 A;  4NGT A;  4MFJ A;  5ELY A;  2PC1 A;  2PRQ A;  4QC6 A;  3E0K A;  3QAY A;  2P6G A;  3NH5 A;  4GS4 A;  1LRZ A;  4P4B A;  4CRY B;  4I49 A;  4YWY A;  4R8F A;  2PVW A;  2PVV A;  3D7F A;  4ZYQ A;  3OWC A;  3CXS A;  3BXM A;  2EUI A;  1LFW A;  4PPZ A;  4K30 A;  2EO8 A;  4NJR A;  4OC1 A;  3IWW A;  4Q36 A;  4XNH C;  3SJE A;  2B5G A;  2BOA A;  2FVG A;  3S6H A;  1AYE A;  3LMS A;  3IWE A;  4UF4 A;  5JGF A;  3MN8 A;  3H8G A;  4QBJ A;  2PJ7 A;  3PFE A;  3KHX A;  4PSX A;  2Z10 A;  3TC8 A;  3B7I A;  4OME A;  4OC3 A;  2V8D A;  4ZX8 A;  4F0X A;  2C6G A;  3D7G A;  2ZED A;  3JVN A;  5KTD A;  5IB9 A;  3K2K A;  4F9U A;  2ZW4 A;  3WT4 A;  2PR8 A;  1Y9W A;  1YSJ A;  2VZY A;  4IHM A;  3DR8 A;  1R3N A;  2VQY A;  2WYR A;  1UFH A;  4MRI A;  4RN7 A;  2ZEP A;  2OH1 A;  3FIX A;  4A38 A;  4ZY0 A;  4BD9 A;  2AFM A;  2R8V A;  4HPS A;  4K3N A;  3TX8 A;  5BWA B;  5IV0 A;  3PBB A;  2ZW5 A;  3IGR A;  4ZI6 A;  4AVA A;  1ELL P;  1LCP A;  2B4B A;  3FRM A;  2CTB A;  4PXC A;  3PGP A;  4BMH A;  4MCR A;  4HNY B;  4NF1 A;  4OIW A;  4UIA A;  5AG7 A;  2YND A;  1AMP A;  3PB4 X;  2V77 A;  1XMT A;  3BJ7 A;  3FBU A;  4IUS A;  4OC5 A;  3NE7 A;  4R87 A;  4UFV A;  4B5P A;  4FAI A;  2EK9 A;  3LWU A;  2C1C A;  2VXK A;  2D4P A;  5KTC A;  4WWV A;  4E2A A;  4B14 A;  1VIX A;  2NSM A;  4PSW A;  2PCU A;  1I1D A;  4G1P A;  5H86 A;  4NEX A;  3R95 A;  4JLY A;  3FX6 A;  3CXQ A;  3FJU A;  3W91 A;  4CAV A;  1OBR A;  2QML A;  2Z3N A;  4KSI A;  4A94 A;  1CX8 A;  4CGP A;  2C6P A;  4FWU A;  2FXF A;  3TE4 A;  1XRY A;  2GIV A;  4U5Y A;  2VBQ A;  3D8P A;  1YW4 A;  1FY7 A;  4CAX A;  1Q2D A;  2ZEM A;  1VHE A;  2FE7 A;  5JPH A;  1IIC A;  2ANP A;  2ZEN A;  2RFH A;  5F46 A;  5F48 A;  2ZW7 A;  3FB3 A;  3IU2 A;  2H5M A;  1IY7 A;  1ON0 A;  3S9L A;  2NMT A;  2DXQ A;  3EXN A;  5I4M A;  4II9 A;  4MY0 A;  2O28 A;  4KOR A;  5CPA A;  3D4U A;  1NSA A;  4LUA A;  4A31 A;  3FEC A;  1KUV A;  1PCA A;  3KR4 A;  1KZF A;  4OC2 A;  3RNZ A;  3WC5 A;  2EBJ A;  1PYT B;  3PRT A;  4MJ8 A;  3WAB A;  4UEZ A;  4C7I A;  2PJ2 A;  1IGB A;  4ONU A;  2F8H A;  4MCQ A;  5C82 A;  4F9V A;  3IC1 A;  2Y0M A;  4NJQ A;  2OOT A;  3SJG A;  1CM0 A;  1M4G A;  2DF5 A;  1IYK A;  4UCP A;  5JQ4 A;  4Y49 C;  2CNT A;  1DE4 C;  2EWB A;  3D7H A;  2JLM A;  4PXD A;  4CAF A;  1Z9U A;  3R9F A;  4FBE A;  1F2O A;  2YNE A;  4AB7 A;  4OAD A;  3NH4 A;  5LYF A;  3S9N A;  2EVN A;  3IWG A;  5THW A;  3V38 A;  4R57 A;  4B6Z A;  2R98 A;  1EE3 P;  4NGQ A;  4PK2 A;  3VWD A;  2OB0 A;  2FS5 A;  1BLL E;  4NGS A;  1ARM A;  4B5P B;  4JYW A;  1NMT A;  4M6I A;  2BEI A;  2AFZ A;  4CAE A;  4LQG A;  2AFW A;  3VH9 A;  4AG9 A;  4BIN A;  2G9D A;  2Z3O A;  4CGN A;  3FEE A;  3IEH A;  2IQ6 A;  1S7L A;  2RC4 A;  3FF3 A;  4OC4 A;  2QEC A;  3HUV A;  5D29 A;  2BUE A;  2CNM A;  4OKO A;  1XMB A;  2Q0Y A;  1AUG A;  3ZJ0 A;  4B12 A;  5AG5 A;  5HH1 A;  4MCS A;  4ORF A;  2QJ8 A;  3FXT A;  5I0C A;  4M6H A;  3SI1 A;  1S60 A;  3NH8 A;  3GYA A;  3KZW A;  4FD5 A;  1K4J A;  1LAM A;  2HUZ A;  2ATR A;  5IB0 A;  1YR0 A;  2QYV A;  2R7H A;  2PJA A;  4RS2 A;  3F0A A;  1CG2 A;  3WR7 A;  4YU9 A;  2ZEO A;  1Y7E A;  2ZXV A;  3VAT A;  1YLO A;  1N71 A;  3RYO A;  1QSO A;  1Y7R A;  2AFS A;  2Q7S A;  4MHP A;  2Z3M A;  5IX3 A;  5J8C A;  3DLJ A;  3DR6 A;  3N7Z A;  2WPW A;  4EVY A;  1HDU A;  2VI7 A;  2JBK A;  4H6Z A;  2QIR A;  2HQY A;  3RO0 A;  3RZA A;  1U6M A;  3ISZ A;  2PJ8 A;  3H8F A;  3S9M A;  2Q04 A;  4NCZ A;  4CAW A;  2JDC A;  3H4Q A;  4AXV A;  1S7F A;  2RB7 A;  4CGM A;  3GB0 A;  4A33 A;  4A39 A;  2QVP A;  2BO9 A;  2ZEF A;  4W9Y A;  3R9G A;  8CPA A;  2CIJ A;  3PB9 X;  5J8F A;  3UY5 A;  4OP4 A;  3SXN A;  2O53 A;  4PXB A;  2V8H A;  1YVO A;  4F6A A;  2PR1 A;  2ZEE A;  3CXP A;  1VHS A;  4KVM E;  3CZX A;  4PQA A;  3NA6 A;  3GUX A;  4B5O A;  2DEA A;  4QVT A;  4CS0 B;  4KVO E;  2P6F A;  3WC7 A;  3D2M A;  1X10 A;  4F8Z A;  1VHO A;  1Z4R A;  2GRE A;  2Q51 A;  3FYN A;  4MFQ A;  4JXR A;  4R7M A;  3T8W A;  4UBR A;  3TCV A;  4CYQ A;  4P45 A;  3GY9 A;  3LD2 A;  4LQ6 A;  4UCN A;  1Z8W A;  4NGP A;  4PK3 A;  1Y0Y A;  3DDD A;  3MRU A;  2GU2 A;  2PJB A;  3PB6 X;  2GFQ A;  1YLE A;  4ONW A;  5F09 A;  1IOI A;  2OZU A;  2ZEG A;  1Q2C A;  2BSW A;  3S6F A;  1I21 A;  3EY5 A;  2PRB A;  1NSL A;  2GLF A;  1R57 A;  2WUU A;  4A2Z A;  3GKR A;  4F0Y A;  5A28 A;  4KSF A;  4BBH A;  2XEF A;  4X3R A;  5JM6 A;  1X12 A;  4AG7 A;  4PV6 A;  3RAM A;  4MHZ A;  4DYO A;  3T9Y A;  5DWM A;  4NSQ A;  1KUX A;  3KAS A;  3S6K A;  1GHE A;  3JRU A;  4Q7A A;  4MFZ A;  4OID A;  1Y9K A;  4UWJ A;  1JQG A;  5FVJ A;  3L2N A;  4ZY2 A;  2ABZ A;  3D2P A;  2BL1 A;  1LOK A;  2O4H A;  4NXY A;  2PIY A;  4YGO A;  2REF A;  3R96 A;  2ZEH A;  3WC6 A;  4A37 A;  3EC4 A;  4RUH A;  1TXR A;  2Q7B A;  2B3U A;  3IIB A;  1P4N A;  4JJX A;  4JWP A;  2NYQ A;  3P2F A;  4J3G A;  4UIB A;  4MHY A;  4U9Z A;  3W6X A;  1M4I A;  4UEF A;  1Y0R A;  2PDO A;  1P0H A;  1VGY A;  2I3C A;  4ZBG A;  1BPM A;  2Z3L A;  4KLW A;  1MJ9 A;  4KS9 A;  4R9M A;  2DPT A;  4NGR A;  1TF8 A;  2B4D B;  3IFE A;  4XPD C;  5K8M A;  2J8M A;  5D8N A;  2DPS A;  4X5K A;  3SI0 A;  3SXO A;  4M3S A;  3CT9 A;  1IB1 E;  4KVX A;  2FSR A;  3B3W A;  4DNC A;  2B5G B;  3W6S A;  3DSB A;  4TNU A;  5CNP A;  1ZLI A;  2F7V A;  2G3T A;  2PQ8 A;  3BJ8 A;  3KR5 A;  4KOY A;  2YGW A;  4KUA A;  2B4D A;  4M85 A;  3V8I A;  4B13 A;  5K8P A;  2Z11 A;  5LYI A;  5G21 A;  1R43 A;  4WJB A;  5F49 A;  4UFW A;  1XJO A;  1BAV A;  1B6B A;  5G22 A;  2IJZ A;  2VZZ A;  5ISV A;  1M44 A;  2VEZ A;  1IID A;  1ARL A;  1YVK A;  3FED A;  2CXA A;  2HV2 A;  3A9L A;  3KI9 A;  2REE A;  1M1D A;  3D3S A;  2Z0Z A;  4FD6 A;  2OR4 A;  4NGM A;  1B87 A;  5K8O A;  3RBU A;  4C68 A;  2F5I A;  1VKC A;  4EME A;  4X2T A;  2ZOF A;  1YX0 A;  1Z2L A;  1L0C A;  4FUU A;  3R1K A;  4MCP A;  4OAE A;  1S5K A;  1ZO0 A;  1QSM A;  2Q44 A;  2ZOG A;  3DGV A;  2PJC A;  5EBV A;  4KOU A;  1V0C A;  1FNO A;  1KUY A;  2BCO A;  3JTK A;  1TKF A;  1F2P A;  3C26 A;  1HEE A;  3K9U A;  4UEE A;  4Q38 A;  5DWN A;  3V7Z A;  2C27 A;  2WZN A;  3MGD A;  4L8A A;  3NE8 A;  3FMC A;  4XPL A;  1H8L A;  2PJ1 A;  4P4F A;  2EK8 A;  1NE9 A;  4KLV A;  1OZP A;  3TO9 A;  1UWY A;  2A4N A;  2IMO A;  2PJ5 A;  3BHX A;  2AFX A;  4L89 A;  4R76 A;  4MFP A;  1GYT A;  2YNC A;  3KHZ A;  2ARH A;  2WPX A;  3ISX A;  5EMI A;  2K5T A;  4FD7 A;  2JEW A;  2JEV A;  3F8K A;  4OLL A;  1HDQ A;  5AG6 A;  3KGQ A;  4C2X A;  5LYD A;  4O23 A;  5AG4 A;  3TFY A;  4P6Y A;  1LAP A;  5KTA A;  1ZG8 A;  1BPN A;  4GXH A;  2AFU A;  1Q2Y A;  4CGO A;  1QQ9 A;  5GCN A;  4EWT A;  5E96 A;  2I00 A;  4Z65 A;  1F57 A;  5HVH A;  1IOF A;  2C6C A;  2FL4 A;  3IO1 A;  1CJW A;  1CP6 A;  1Z8X A;  1Z8T A;  1J4J A;  1CP7 A;  2IL4 A;  4DUK A;  1Z4E A;  3PBE A;  5C88 A;  1S3Z A;  2POK A;  2CF4 A;  2PSW A;  2X7B A;  1XBU A;  3F5B A;  1YK3 A;  3TO7 A;  3TO6 A;  4KOS A;  5HMN A;  4Y49 B;  2PE3 A;  5F47 A;  1BOB A;  1CPS A;  1RXT A;  4HNW B;  4NFR A;  5LRG A;  4P4D A;  4H89 A;  3BI0 A;  4E0A A;  2PIZ A;  2GAN A;  4HKF A;  4JZ0 A;  4P4E A;  1PU9 A;  3BI1 A;  1M4D A;  4MY3 A;  4XNH B;  1QSR A;  3D67 A;  4X8I A;  1XE4 A;  1MJA A;  2B58 A;  3QB8 A;  3PZJ A;  2AJ6 A;  4UA3 A;  5G20 A;  3DNS A;  1XFO A;  1Q7L A;  2GE3 A;  2B3V A;  1I12 A;  1YQE A;  1TIQ A;  3PFO A;  4R3K A;  4C2Y A;  5LYL A;  1ZLH A;  1M4L A;  5A27 A;  5K8N A;  5H84 A;  2ODF A;  2OU2 A;  1Z5R A;  4P44 A;  3SI2 A;  3SJF A;  6CPA A;  4CGL A;  1ELM P;  3EO4 A;  4IF5 A;  4IAV A;  1A2Z A;  4JD6 A;  2CY2 A;  1IYL A;  3FH4 A;  1YGH A;  5J1Q A;  4KZT A;  4MXU A;  2Q43 A;  2HB6 A;  1XIX A;  4IK2 A;  4CYP A;  7CPA A;  3I9S A;  5AGE A;  3R9E A;  5CBM A;  2J8N A;  2WSA A;  3I3G A;  1TF9 A;  4ZX9 A;  4ZGY B;  2PJ6 A;  3QAH A;  4KOX A;  3I1U A;  4A32 A;  1RTQ A;  2PJ4 A;  1XEB A;  4CYO A;  2XEJ A;  5HVF A;  4CYN A;  2J8R A;  4P4J A;  2AE6 A;  1FT7 A; 
#chains in the Genus database with same CATH homology
 2P0W A;  4KOV A;  2FIW A;  4RI1 A;  3P2H A;  1PUA A;  2OZH A;  4QUS A;  1YRE A;  2Z3K A;  4KUB A;  1MJB A;  3BLN A;  2YNC C;  3S6G A;  4B10 A;  1SQH A;  2Z3P A;  3TTH A;  2FIA A;  2Q4Y A;  2KCW A;  2FCK A;  2OZG A;  1WWZ A;  4C2Z A;  3KKW A;  4UCM A;  4A30 A;  4EVY A;  4B11 A;  4MI4 A;  2D4O A;  4MBU A;  2G0B A;  2G3A A;  4C7H A;  4XPK A;  2JDD A;  1WK4 A;  4R3L A;  3B8G A;  3TOB A;  1S7K A;  4YFJ A;  3IU1 A;  3TT2 A;  3EFA A;  3G8W A;  4E8O A;  4KOT A;  1RO5 A;  2ZW6 A;  2P6E A;  3H5Z A;  3PP9 A;  4FD4 A;  4HNX B;  4JXQ A;  2CNS A;  3G3S A;  4U9Y A;  4YRH A;  3LOD A;  4CRZ B;  3JUW A;  3T90 A;  2I79 A;  4LX9 A;  3VWE A;  4MHD A;  1QST A;  5EC4 A;  4MFK A;  4QB9 A;  4AVC A;  4KSA A;  1S7N A;  4UFX A;  4A95 A;  3TOA A;  1QSN A;  4XPD B;  4KOW A;  1XF8 A;  3FNC A;  4H6U A;  1BO4 A;  4AVB A;  1MK4 A;  2Q4V A;  3ZZI A;  2R1I A;  4MFL A;  2FT0 A;  4UWI A;  5G1Z A;  2ZPA A;  3SHP A;  4MFJ A;  2PC1 A;  4QC6 A;  3E0K A;  4GS4 A;  2P6G A;  4CRY B;  1LRZ A;  4I49 A;  3OWC A;  3CXS A;  2EUI A;  4K30 A;  4Q36 A;  4XNH C;  2B5G A;  3S6H A;  3IWE A;  4QBJ A;  4PSX A;  2Z10 A;  4F0X A;  3JVN A;  5KTD A;  2ZW4 A;  2PR8 A;  1Y9W A;  2VZY A;  3DR8 A;  2VQY A;  1UFH A;  2OH1 A;  3FIX A;  2R8V A;  5IV0 A;  5BWA B;  2ZW5 A;  3IGR A;  4AVA A;  2B4B A;  3FRM A;  4BMH A;  3PGP A;  4HNY B;  4NF1 A;  5AG7 A;  2YND A;  4IUS A;  3BJ7 A;  1XMT A;  3FBU A;  4R87 A;  3NE7 A;  4B5P A;  4UFV A;  2VXK A;  2D4P A;  5KTC A;  4E2A A;  4B14 A;  4PSW A;  1I1D A;  5H86 A;  4NEX A;  3R95 A;  4JLY A;  3CXQ A;  3W91 A;  4CAV A;  2QML A;  2Z3N A;  4CGP A;  2FXF A;  3TE4 A;  2GIV A;  4U5Y A;  2VBQ A;  3D8P A;  1FY7 A;  4CAX A;  1Q2D A;  5JPH A;  2FE7 A;  1IIC A;  5F46 A;  5F48 A;  3FB3 A;  2ZW7 A;  3IU2 A;  2H5M A;  1ON0 A;  2NMT A;  2DXQ A;  3EXN A;  4II9 A;  4MY0 A;  2O28 A;  4KOR A;  4LUA A;  4A31 A;  1KUV A;  1KZF A;  4MJ8 A;  4C7I A;  4ONU A;  5C82 A;  2Y0M A;  1CM0 A;  1M4G A;  1IYK A;  4UCP A;  5JQ4 A;  4Y49 C;  2CNT A;  2JLM A;  4CAF A;  1Z9U A;  3R9F A;  2YNE A;  4AB7 A;  4OAD A;  2EVN A;  3IWG A;  4R57 A;  2R98 A;  4PK2 A;  3VWD A;  2OB0 A;  2FS5 A;  4B5P B;  1NMT A;  2BEI A;  4CAE A;  4AG9 A;  4CGN A;  2Z3O A;  1S7L A;  2RC4 A;  2QEC A;  2BUE A;  2CNM A;  2Q0Y A;  3ZJ0 A;  4B12 A;  5AG5 A;  5HH1 A;  4ORF A;  3FXT A;  5I0C A;  1S60 A;  3GYA A;  4FD5 A;  1K4J A;  2HUZ A;  2ATR A;  5IB0 A;  1YR0 A;  2R7H A;  4RS2 A;  3F0A A;  3WR7 A;  2ZXV A;  3RYO A;  1N71 A;  1QSO A;  1Y7R A;  2Z3M A;  5IX3 A;  5J8C A;  3N7Z A;  3DR6 A;  2WPW A;  2VI7 A;  4H6Z A;  2QIR A;  2HQY A;  1U6M A;  2Q04 A;  4NCZ A;  4CAW A;  2JDC A;  3H4Q A;  1S7F A;  4CGM A;  4A33 A;  3R9G A;  5J8F A;  3UY5 A;  3SXN A;  1YVO A;  4F6A A;  2PR1 A;  3CXP A;  1VHS A;  4KVM E;  4B5O A;  4QVT A;  4CS0 B;  4KVO E;  2P6F A;  3D2M A;  1Z4R A;  3FYN A;  4MFQ A;  4JXR A;  3TCV A;  4UBR A;  4CYQ A;  3GY9 A;  3LD2 A;  4UCN A;  4PK3 A;  3DDD A;  1YLE A;  2OZU A;  1Q2C A;  2BSW A;  3S6F A;  1I21 A;  3EY5 A;  2PRB A;  1NSL A;  4A2Z A;  1R57 A;  2WUU A;  4F0Y A;  3GKR A;  5A28 A;  4KSF A;  4BBH A;  4AG7 A;  4PV6 A;  3T9Y A;  5DWM A;  4NSQ A;  1KUX A;  3S6K A;  1GHE A;  4MFZ A;  4UWJ A;  1Y9K A;  5FVJ A;  3D2P A;  2BL1 A;  4NXY A;  4YGO A;  3R96 A;  2REF A;  3EC4 A;  2Q7B A;  2B3U A;  1P4N A;  4JJX A;  4JWP A;  3P2F A;  4J3G A;  4U9Z A;  3W6X A;  1M4I A;  2PDO A;  1P0H A;  4ZBG A;  4KLW A;  2Z3L A;  1MJ9 A;  4KS9 A;  4R9M A;  2DPT A;  2B4D B;  4XPD C;  2J8M A;  2DPS A;  4X5K A;  3SXO A;  4M3S A;  1IB1 E;  4KVX A;  2FSR A;  4DNC A;  2B5G B;  3W6S A;  3DSB A;  5CNP A;  2PQ8 A;  2G3T A;  3BJ8 A;  4KUA A;  4M85 A;  4KOY A;  2YGW A;  3V8I A;  2B4D A;  4B13 A;  2Z11 A;  5G21 A;  5F49 A;  4UFW A;  1B6B A;  5G22 A;  2VZZ A;  5ISV A;  1M44 A;  2VEZ A;  1IID A;  1YVK A;  2CXA A;  2HV2 A;  3A9L A;  2REE A;  1M1D A;  3D3S A;  2Z0Z A;  4FD6 A;  1B87 A;  4C68 A;  2F5I A;  1VKC A;  1YX0 A;  1L0C A;  3R1K A;  4OAE A;  1S5K A;  1ZO0 A;  1QSM A;  2Q44 A;  5EBV A;  4KOU A;  1V0C A;  1KUY A;  3JTK A;  3C26 A;  3K9U A;  4Q38 A;  5DWN A;  2C27 A;  4L8A A;  3MGD A;  4XPL A;  1NE9 A;  4KLV A;  1OZP A;  3TO9 A;  2A4N A;  4L89 A;  4MFP A;  2YNC A;  2ARH A;  2WPX A;  2K5T A;  4FD7 A;  4OLL A;  2JEV A;  3F8K A;  5AG6 A;  4C2X A;  5AG4 A;  3TFY A;  5KTA A;  1Q2Y A;  4CGO A;  5GCN A;  5E96 A;  2I00 A;  2FL4 A;  1CJW A;  1J4J A;  2IL4 A;  1Z4E A;  5C88 A;  1S3Z A;  3F5B A;  2PSW A;  2X7B A;  3TO7 A;  3TO6 A;  1YK3 A;  5HMN A;  4KOS A;  4Y49 B;  5F47 A;  1BOB A;  1RXT A;  4HNW B;  4H89 A;  4E0A A;  2GAN A;  4HKF A;  1PU9 A;  4MY3 A;  1M4D A;  4XNH B;  1QSR A;  1XE4 A;  1MJA A;  2B58 A;  3QB8 A;  3PZJ A;  2AJ6 A;  4UA3 A;  5G20 A;  3DNS A;  2GE3 A;  2B3V A;  1I12 A;  1TIQ A;  4R3K A;  4C2Y A;  5A27 A;  5H84 A;  2OU2 A;  4CGL A;  3EO4 A;  4IF5 A;  4JD6 A;  2CY2 A;  1IYL A;  1YGH A;  4KZT A;  1XIX A;  4CYP A;  3I9S A;  5AGE A;  3R9E A;  2J8N A;  2WSA A;  3I3G A;  4ZGY B;  3QAH A;  4KOX A;  4A32 A;  1XEB A;  4CYO A;  4CYN A;  2J8R A;  2AE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...