1M4IA

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and kanamycin a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
181
structure length
181
Chain Sequence
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside 2'-N-acetyltransferase
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 52
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m4iA00
4U9YA 3I9SA 2PR8A 5J8FA 4XPKA 1QSRA 3W91A 3BJ8A 4XPLA 1XEBA 2J8NA 3EY5A 2KCWA 1WWZA 4R87A 3S6FA 3ZZIA 4H6UA 4UA3A 2GIVA 2BSWA 2Q7BA 3MGDA 2R8VA 1MJBA 4UBRA 1MJ9A 5HH1A 1RXTA 3RYOA 2FIWA 5F46A 2B3UA 4M3SA 4AB7A 3R9GA 3H4QA 3D3SA 4KVME 4R3LA 1VHSA 3UY5A 5JPHA 4RS2A 1TIQA 2B5GA 3FIXA 3F5BA 2HV2A 1QSOA 1YGHA 3PZJA 3T90A 4BMHA 2CNTA 2G3TA 1Z4EA 2JEVA 1M4IA 2X7BA 1S7LA 3G3SA 4AVCA 5H84A 3R9EA 4II9A 1Y7RA 2OZGA 4KVOE 4M85A 1XIXA 3TO9A 2Q04A 2B4DB 1XE4A 4U5YA 2J8MA 1IYKA 3FXTA 2VQYA 3FB3A 4L8AA 4FD7A 4QC6A 4NSQA 3EFAA 3DDDA 2I00A 2FIAA 2ZW6A 2WPXA 1PUAA 1LRZA 2FE7A 4OLLA 3BLNA 1M4DA 1KUYA 4YRHA 1SQHA 4MJ8A 4AG7A 1UFHA 5JQ4A 5KTCA 1V0CA 2B4DA 5KTAA 4MY3A 2G3AA 4QVTA 4XNHB 3R95A 3E0KA 2CY2A 2O28A 4GS4A 2ZW7A 2PR1A 3GY9A 2BUEA 3JUWA 5C88A 3TE4A 4QBJA 2OZHA 5ISVA 1IIDA 4E8OA 3F0AA 2B58A 4PK3A 1YR0A 3EO4A 3W6SA 1N71A 2BL1A 1QSTA 3BJ7A 2H5MA 4IUSA 4MY0A 3WR7A 4YGOA 2PC1A 3PP9A 2AE6A 4HKFA 1NE9A 2FS5A 4XPDC 1B6BA 3KKWA 4CAVA 4AVBA 2P6FA 1QSMA 1MJAA 2BEIA 3TO6A 1PU9A 4H6ZA 4RI1A 4HNWB 3S6HA 3VWEA 4JJXA 3EC4A 2B5GB 5F48A 5DWMA 2Z10A 4B5PB 5F49A 1P0HA 2Q0YA 1CJWA 1YREA 2P6EA 3OWCA 2R98A 1KZFA 4CAXA 4LUAA 1IICA 2D4PA 3LD2A 1NSLA 4K30A 1YK3A 1Z9UA 4NXYA 4EVYA 1S7FA 2PSWA 1I12A 4LX9A 2OB0A 3TTHA 4F6AA 4MHDA 4L89A 2AJ6A 1YVOA 2F5IA 4MBUA 2PQ8A 2CNMA 2ZPAA 4B5PA 2FL4A 2FCKA 3LODA 4QB9A 4R57A 4FD5A 2DXQA 2Z0ZA 5C82A 1XF8A 2QECA 3VWDA 2Q4VA 2EUIA 1IB1E 4KLWA 4KOYA 5GCNA 4JXQA 2OZUA 2P6GA 2VZYA 4JXRA 2FT0A 2B4BA 1VKCA 4AVAA 3I3GA 4HNXB 3S6GA 2REEA 3QB8A 2A4NA 2Q44A 1Y9WA 1GHEA 4E2AA 4UWIA 4JD6A 3R96A 2VXKA 3FYNA 2IL4A 5EC4A 2JLMA 3DR8A 4OADA 3D2PA 4F0YA 3C26A 4CAWA 1YVKA 4UWJA 4CS0B 2OH1A 1S7KA 2HQYA 3G8WA 5FVJA 4HNYB 2CNSA 4NF1A 3PGPA 1M1DA 2ARHA 4KOSA 3K9UA 1I1DA 4KVXA 2ATRA 5IV0A 3SXNA 3IWGA 3S6KA 4KOTA 4E0AA 3T9YA 1K4JA 2ZW4A 4JLYA 4XPDB 3DSBA 2NMTA 3W6XA 3B8GA 3FNCA 1MK4A 2WPWA 4KOUA 2FXFA 4ONUA 2P0WA 2PRBA 1KUVA 2C27A 2GE3A 3TOAA 3F8KA 2OU2A 5DWNA 3FRMA 3SXOA 2R7HA 3TT2A 4PSXA 4PSWA 5IB0A 2B3VA 3IGRA 3V8IA 4KUBA 1R57A 4IF5A 1ON0A 3TOBA 4AG9A 5I0CA 2Q4YA 1S60A 1BO4A 3DNSA 2ZXVA 3JVNA 4B5OA 1YX0A 2EVNA 3TFYA 2I79A 2VBQA 1L0CA 3SHPA 4R3KA 1I21A 3R1KA 1RO5A 3DR6A 4NEXA 2G0BA 2K5TA 1CM0A 4FD4A 4X5KA 1FY7A 4KLVA 4J3GA 3GYAA 2J8RA 2Y0MA 1U6MA 3D2MA 4MI4A 5HMNA 2GANA 3D8PA 2VEZA 1BOBA 3TO7A 4U9ZA 4FD6A 3GKRA 2QMLA 4CRZB 4YFJA 4H89A 4KZTA 5KTDA 1S3ZA 3CXSA 2ZW5A 1Q2YA 1S5KA 4KUAA 1B87A 1KUXA 1QSNA 1Z4RA 4QUSA 4KORA 2VZZA 3P2FA 4NCZA 4Y49B 2FSRA 2JDCA 5CNPA 1YLEA 3QAHA 3CXQA 3N7ZA 4JWPA 4CRYB 1OZPA 2R1IA 5E96A 1Y9KA 1M4GA 4I49A 4PV6A 4KOVA 4Y49C 1WK4A 1M44A 4ZBGA 3FBUA 4ORFA 4PK2A 2QIRA 1Q2DA 4OAEA 3R9FA 4KOWA 2HUZA 4KOXA 3P2HA 4DNCA 3CXPA 2PDOA 4XNHC 2Z11A 2JDDA 3EXNA 1IYLA 1XMTA 1Q2CA 2RC4A 4R9MA 5J8CA 3NE7A 5F47A 1NMTA 5EBVA 5IX3A 1P4NA 2REFA 3TCVA 2VI7A 5H86A 1S7NA 1J4JA 3ZJ0A 2D4OA
chains in the Genus database with same CATH superfamily
4OC2A 4U9YA 1YW4A 2AFUA 4MFLA 5A28A 1ZG9A 4P4EA 3I9SA 1TF9A 2PR8A 2PJ3A 5J8FA 4XPKA 1QSRA 2POKA 2AFWA 4OC1A 4BD9A 5LYFA 3W91A 3BJ8A 4XPLA 1XEBA 3B7IA 4ZX8A 2OR4A 4P10A 5F09A 2J8NA 3EY5A 2KCWA 4UFWA 4YU9A 3DGVA 1WWZA 3H8FA 4R87A 3S6FA 2DPTA 3KHZA 3ZZIA 4H6UA 4UA3A 2GIVA 1RTQA 1ZG7A 2ZEPA 2BSWA 1Z8XA 1CPXA 3PB8X 2Q7BA 3MGDA 1PYTB 4MMOA 2V8GA 3SJGA 2R8VA 4A39A 1MJBA 4UBRA 4C68A 1MJ9A 4A33A 3B35A 5G1ZA 3BXMA 4ZX9A 5HH1A 1RXTA 2BOAA 2VL1A 4Z65A 1LAPA 1YLOA 3RYOA 2FIWA 5F46A 2B3UA 4LQGA 1HDUA 4M3SA 4AB7A 3PFOA 4M6GA 3PFEA 3R9GA 4PXDA 3H4QA 3D3SA 4K3NA 2ZOGA 2IMOA 4KVME 1VHOA 4A37A 4AXVA 3N5FA 1A2ZA 3IU2A 2V8VA 4R3LA 1XJOA 1VHSA 4UIAA 3UY5A 5JPHA 2JEWA 5BWAB 4C2ZA 4RS2A 4UCMA 4B11A 1IU8A 3PB7X 4BBHA 1TIQA 2B5GA 3FIXA 3F5BA 2HV2A 1QSOA 1YGHA 3D7DA 3PZJA 3T90A 2HB6A 4BMHA 2CNTA 2HC9A 2G3TA 5G21A 3KI9A 1Z4EA 4P4DA 2JEVA 1M4IA 3KR4A 1LANA 1S7LA 1F2PA 1YQEA 2X7BA 2YGWA 3DLJA 3G3SA 4OIWA 4P4JA 3D66A 5H84A 4AVCA 3FEDA 3R9EA 4ZGYB 4II9A 2ZEOA 1Y7RA 2OZGA 2Q7SA 4KVOE 4OC4A 2ABZA 4M85A 2XEFA 5HXDA 4OP4A 1XIXA 2QVPA 3TO9A 3KQXA 2Q04A 5HVGA 2B4DB 3FX6A 3S9LA 1XE4A 2WSAA 3QNVA 4MCSA 4MHNA 4U5YA 5K8PA 3D68A 2GLJA 2J8MA 4GXHA 1EE3P 1IYKA 3FXTA 2VQYA 3FB3A 4L8AA 3FH4A 3IWWA 4FD7A 4QC6A 4NSQA 3EFAA 3H8GA 3DDDA 2I00A 4NGTA 1X10A 2FIAA 2ZW6A 2WPXA 1XBUA 2WUUA 3H5ZA 1PUAA 1LRZA 2ANPA 3T8WA 2PJ1A 4IHMA 2Z3PA 3PEIA 5G20A 2FE7A 4UEZA 4IK2A 4OLLA 4EFDA 3BLNA 1M4DA 3CZXA 2WZNA 1KUYA 2I3CA 1SQHA 4MJ8A 4YRHA 1OBRA 1UFHA 4AG7A 1GYTA 2ZOFA 4ZYQA 5JQ4A 5KTCA 1V0CA 2B4DA 5KTAA 1LCPA 2Z3LA 4MY3A 2G3AA 1LAMA 4QVTA 4F0XA 5A27A 5J1QA 4XNHB 3R95A 4MXUA 3E0KA 2CY2A 4EMEA 2O28A 1Z5RA 2BO9A 4KSAA 4MFQA 4A94A 4GS4A 3SJFA 2Q4ZA 2ZW7A 3B3CA 2PR1A 4MRIA 3RO0A 3GY9A 2BUEA 3JUWA 5C88A 3TE4A 4QBJA 4B14A 2OZHA 5ISVA 1IIDA 4E8OA 3F0AA 2B58A 4R7MA 4KSIA 4A95A 4C2YA 5I4MA 1UWYA 5AG5A 4PK3A 1YR0A 2PJ8A 1LOKA 4A31A 5AGEA 3EO4A 2GREA 3D7GA 2AFOA 3W6SA 3KZWA 4CGMA 4F9VA 1CBXA 1N71A 2PJ2A 3GIUA 1BAVA 3BI1A 2BL1A 1QSTA 3BJ7A 2H5MA 4B6ZA 4IUSA 3PBBA 4MY0A 3MN8A 3WR7A 3HUVA 4YGOA 2PC1A 1QQ9A 2AFXA 2XEIA 4OIDA 3PP9A 2AE6A 4HKFA 1Z8WA 1NE9A 2FS5A 4XPDC 1JQGA 1B6BA 3VH9A 5CBMA 3IJ3A 4R8FA 3KKWA 4CAVA 5AG7A 4PXEA 4P4IA 4AVBA 2P6FA 3IWEA 4OC5A 4CGLA 1QSMA 5LRKA 1MJAA 2BEIA 2C1CA 3FF3A 3TO6A 2QYVA 4BINA 4CAFA 3LWUA 1PU9A 4H6ZA 5D29A 3V7ZA 5HVHA 4RI1A 4HNWB 3S6HA 2YNCC 3VWEA 4JJXA 2Q43A 2B5GB 3EC4A 4NJRA 4PXBA 5F48A 4ZI6A 5DWMA 2Z10A 4B5PB 1ZLIA 5F49A 1P0HA 2Q0YA 1CJWA 1YREA 2P6EA 3OWCA 2R98A 3RNZA 1ELMP 3SJEA 4OC3A 1KZFA 4C2XA 3GB0A 4RN7A 5D8NA 2NYQA 4CAXA 4Q38A 4LUAA 1IICA 2ODFA 4M6IA 2D4PA 3LD2A 4UFXA 1NSLA 3D7FA 2EK9A 4K30A 3WC5A 2YNCA 1YK3A 1QMUA 1Z9UA 4NXYA 4X3RA 4A30A 4EVYA 1S7FA 2ZEEA 2PSWA 4C7HA 1I12A 6CPAA 4LX9A 1M4LA 5LYIA 2OB0A 2V8DA 4NGQA 5IB9A 3TTHA 1BPMA 2CF4A 4F6AA 4CPAA 2WYRA 4MCRA 3SI2A 2IQ6A 4C7IA 4GM5A 5LRJA 4CGOA 4MHDA 2NSMA 4L89A 3SJXA 2AJ6A 1YVOA 5AG4A 2F5IA 4MBUA 2PQ8A 4H2KA 1CG2A 2C6GA 3B3SA 2CNMA 2ZPAA 4B5PA 2GU2A 2FL4A 3VATA 2FCKA 4B10A 4WJBA 3KASA 3LODA 4QB9A 4R57A 4FD5A 2DXQA 2Z0ZA 5C82A 3NFZA 1XF8A 4ZY0A 1Q7LA 4OKOA 2QECA 4X8IA 2Q4VA 2EUIA 3VWDA 3IC1A 1IB1E 4KLWA 4KOYA 5GCNA 4MFZA 4JXQA 1XFOA 2OZUA 2P6GA 2PIYA 2VZYA 3I1UA 4JXRA 4RUHA 2FT0A 3FECA 4TNUA 2B4BA 1FT7A 4NFRA 1VKCA 3L2NA 3B3WA 3CPXA 4KS9A 4UFVA 4B12A 4AVAA 4CGNA 3I3GA 4M6HA 4HNXB 5CPAA 4KSFA 4IAVA 3S6GA 3SI0A 3FEEA 2REEA 3QB8A 2A4NA 1CPSA 2Q44A 1Y9WA 3S9NA 1GHEA 1ZLHA 4E2AA 1BPNA 4UWIA 4B13A 4JD6A 3R96A 5K8NA 2EBJA 2VXKA 3FYNA 1CP7A 2IL4A 5EC4A 2ZEDA 1Y0YA 3BI0A 2Z3KA 2JLMA 1ARLA 1XOVA 3DR8A 2AFMA 1TXRA 5LYLA 3H8EA 3KL9A 4OADA 3FMCA 4DJLA 4FBEA 3D2PA 4F0YA 2F7VA 3B3VA 4FUUA 2GLFA 3C26A 1Z8TA 4CAWA 1YVKA 5JH9A 4NGMA 2AFZA 4UWJA 1VHEA 4UF4A 3V38A 1ZG8A 2OH1A 4CS0B 4P4FA 1Z8LA 1IOIA 1KWMA 2JBKA 1S7KA 3B2YA 4G1PA 2HQYA 3G8WA 5FVJA 4HNYB 2CNSA 2CIJA 2PVVA 1AUGA 4NF1A 4MCPA 3NH5A 3NH8A 3PGPA 1M1DA 2ARHA 2XEJA 4F8ZA 4KOSA 3D67A 3K9UA 4JYWA 1I1DA 4MHYA 1YW6A 4KVXA 1AYEA 2ATRA 2C6PA 2G9DA 2PJ6A 3SXNA 3IWGA 3RZAA 3S6KA 1AMPA 4KOTA 3KQZA 4E0AA 3T9YA 1K4JA 2ZEFA 2ZW4A 4JLYA 4XPDB 1Y0RA 3DSBA 2NMTA 3PB6X 3W6XA 2PVWA 5DS0A 3B8GA 2PJ7A 3ISXA 1TF8A 1DE4C 5G22A 3IU1A 2AFSA 3FNCA 2DPSA 3JRUA 1JWQA 2PJ5A 2BCOA 2DEAA 3CT9A 4YWYA 1MK4A 5LYDA 1H8LA 5AG6A 1TKHA 3SI1A 2WPWA 4NJQA 3IFEA 4KOUA 1TKJA 2FXFA 4ONUA 2P0WA 2QJ8A 4CAEA 3PB4X 3IIBA 1R3NA 4FAIA 7CPAA 2PRBA 4R76A 4PQAA 1Y7EA 3KHXA 3D7HA 1KUVA 2C27A 2PCUA 2GE3A 3WABA 2F8HA 3MRUA 5THWA 3TOAA 3F8KA 3A9LA 2OU2A 2PE3A 5DWNA 5ELYA 3WC7A 3FRMA 3PB9X 4P45A 2R7HA 4UEFA 2OOTA 3SXOA 4CYOA 3TT2A 1YMEA 2ZEMA 3LMSA 4UIBA 4CYQA 4PSXA 4PSWA 3RBUA 4P6YA 1TKFA 3B3TA 1YSJA 5IB0A 2B3VA 1NSAA 4DUKA 4ZY1A 2PIZA 5IV0A 2CTCA 2V77A 3FVLA 3NA6A 3HLPA 4MCQA 3IGRA 4WWVA 3ISZA 3V8IA 4KUBA 1R57A 3RAMA 3PRTA 4PPZA 3CDXA 2J9AA 4IF5A 1IOFA 2RFHA 1ON0A 4A2ZA 4UEEA 3S9MA 4MFKA 3TOBA 1IGBA 1ZO0A 4AG9A 5I0CA 2C6CA 2Q4YA 2O4HA 1S60A 1BO4A 2CTBA 2FVGA 2JBJA 2ZXVA 2PJ0A 1YX0A 3DNSA 3JVNA 4ONWA 4R6TA 4B5OA 1VGYA 5JGFA 5JM6A 2EVNA 3QAYA 3TFYA 4DYOA 2I79A 2VBQA 3NE8A 1XMBA 4LQ6A 2Z3OA 1L0CA 3SHPA 4NGPA 3KGQA 4R3KA 4P44A 1I21A 3R1KA 4A32A 1RO5A 3DR6A 4NEXA 4EWTA 1FNOA 3WC6A 2PJBA 4NGSA 2G0BA 2K5TA 1CM0A 4FD4A 4X5KA 1FY7A 2ZENA 4KLVA 4F9UA 3FJUA 4J3GA 2PJ4A 5EMIA 3GYAA 2J8RA 2Y0MA 3K2KA 8CPAA 1U6MA 1CX8A 3D2MA 4MI4A 2PRQA 1X12A 4CGPA 5HMNA 2GANA 4HPSA 3D8PA 2VEZA 4UCPA 1LFWA 2ZEGA 1BOBA 3TO7A 2EK8A 3GLJA 1XRYA 4U9ZA 2YNEA 4FD6A 2O53A 3GKRA 2QMLA 4CRZB 2CXAA 2Z3NA 4YFJA 4H89A 5K8MA 4KZTA 1F57A 5KTDA 3CPAA 1HDQA 4MHPA 4NGNA 3GUXA 4ZY2A 1S3ZA 4A38A 3CXSA 3IO1A 2ZW5A 3TX8A 4Q7AA 1Q2YA 1S5KA 4FWUA 2EWBA 5K8OA 4UCNA 4KUAA 3NH4A 4OMEA 4JZ0A 1B87A 2EO8A 3BHXA 4X2TA 1KUXA 1QSNA 1Z4RA 4QUSA 4KORA 4NGRA 4P4BA 2ZELA 2VZZA 3P2FA 4NCZA 4Y49B 4W9YA 2FSRA 2JDCA 4CYNA 5CNPA 1YLEA 3QAHA 2IJZA 3CXQA 3N7ZA 4JWPA 4CRYB 1OZPA 2R1IA 5E96A 3KR5A 2DF5A 1Y9KA 3D4UA 2PJ9A 4MHZA 1M4GA 4I49A 4O23A 4PV6A 4KOVA 2YNDA 3K9TA 4Y49C 1WK4A 1M44A 2PJAA 2RB7A 5LRGA 1PCAA 4ZBGA 4OC0A 3FBUA 4ORFA 4PK2A 1HEEA 2QIRA 1ELLP 1Q2DA 4Q36A 3IEHA 4TWEA 4OAEA 1Z2LA 4KOWA 4MFPA 3R9FA 2HUZA 4KOXA 2ZEHA 3P2HA 2V8HA 1VIXA 3CXPA 3WT4A 4DNCA 2PDOA 4XNHC 2Z11A 3PBEA 2JDDA 3EXNA 1BLLE 1IYLA 1R43A 1F2OA 2Q51A 2XEGA 1XMTA 2Z3MA 1Q2CA 2RC4A 3LACA 4R9MA 5J8CA 5HVFA 4MFJA 2PJCA 3NE7A 4PXCA 5F47A 1IY7A 1NMTA 5EBVA 1DTDA 1CP6A 3JTKA 3VARA 1P4NA 1ARMA 5IX3A 2REFA 3TC8A 2VI7A 5H86A 3TCVA 4CYPA 1S7NA 1J4JA 3ZJ0A 2D4OA 2GFQA
chains in the Genus database with same CATH topology
4U9YA 4MFLA 5A28A 3I9SA 2PR8A 5J8FA 4XPKA 1QSRA 3W91A 3BJ8A 4XPLA 1XEBA 2J8NA 3EY5A 2KCWA 4UFWA 1WWZA 4R87A 3S6FA 2DPTA 3ZZIA 4H6UA 4UA3A 2GIVA 2BSWA 2Q7BA 3MGDA 2R8VA 1MJBA 4UBRA 4C68A 1MJ9A 4A33A 5HH1A 5G1ZA 1RXTA 3RYOA 2FIWA 5F46A 2B3UA 4M3SA 4AB7A 3R9GA 3H4QA 3D3SA 4KVME 3IU2A 4R3LA 1VHSA 3UY5A 5JPHA 4C2ZA 4RS2A 4UCMA 4B11A 4BBHA 1TIQA 2B5GA 3FIXA 3F5BA 2HV2A 1QSOA 1YGHA 3PZJA 3T90A 4BMHA 2CNTA 5G21A 2G3TA 1Z4EA 2JEVA 1M4IA 2X7BA 1S7LA 5BWAB 2YGWA 3G3SA 4AVCA 5H84A 3R9EA 4ZGYB 4II9A 1Y7RA 2OZGA 4KVOE 4M85A 1XIXA 3TO9A 2Q04A 2B4DB 1XE4A 2WSAA 4U5YA 2J8MA 1IYKA 3FXTA 2VQYA 3FB3A 4L8AA 4FD7A 4QC6A 4NSQA 3EFAA 3DDDA 2I00A 2FIAA 2ZW6A 2WPXA 2WUUA 3H5ZA 1PUAA 1LRZA 2Z3PA 5G20A 2FE7A 4OLLA 3BLNA 1M4DA 1KUYA 4YRHA 1SQHA 4MJ8A 4AG7A 1UFHA 5JQ4A 5KTCA 1V0CA 2B4DA 5KTAA 2Z3LA 4MY3A 2G3AA 4QVTA 4F0XA 5A27A 4XNHB 3R95A 3E0KA 2CY2A 2O28A 4KSAA 4MFQA 4GS4A 2ZW7A 2PR1A 3GY9A 2BUEA 3JUWA 5C88A 3TE4A 4QBJA 4B14A 2OZHA 5ISVA 1IIDA 4E8OA 3F0AA 2B58A 4A95A 4C2YA 5AG5A 4PK3A 1YR0A 4A31A 5AGEA 3EO4A 3W6SA 4CGMA 1N71A 2BL1A 1QSTA 3BJ7A 2H5MA 4IUSA 4MY0A 3WR7A 4YGOA 2PC1A 3PP9A 2AE6A 4HKFA 1NE9A 2FS5A 4XPDC 1B6BA 3KKWA 4CAVA 5AG7A 4AVBA 2P6FA 3IWEA 4CGLA 1QSMA 1MJAA 2BEIA 3TO6A 4CAFA 1PU9A 4H6ZA 4RI1A 4HNWB 3S6HA 2YNCC 3VWEA 4JJXA 3EC4A 2B5GB 5F48A 5DWMA 2Z10A 4B5PB 5F49A 1P0HA 2Q0YA 1CJWA 1YREA 2P6EA 3OWCA 2R98A 1KZFA 4C2XA 4CAXA 4Q38A 4LUAA 1IICA 2D4PA 3LD2A 4UFXA 1NSLA 4K30A 2YNCA 1YK3A 1Z9UA 4NXYA 4EVYA 4A30A 1S7FA 2PSWA 4C7HA 1I12A 4LX9A 2OB0A 3TTHA 4F6AA 4C7IA 4CGOA 4MHDA 4L89A 2AJ6A 1YVOA 5AG4A 2F5IA 4MBUA 2PQ8A 2CNMA 2ZPAA 4B5PA 2FL4A 2FCKA 4B10A 3LODA 4QB9A 4R57A 4FD5A 2DXQA 2Z0ZA 5C82A 1XF8A 2QECA 3VWDA 2Q4VA 2EUIA 1IB1E 4KLWA 4KOYA 5GCNA 4MFZA 4JXQA 2OZUA 2P6GA 2VZYA 4JXRA 2FT0A 2B4BA 1VKCA 4UFVA 4B12A 4KS9A 4AVAA 4CGNA 3I3GA 4HNXB 4KSFA 3S6GA 2REEA 3QB8A 2A4NA 2Q44A 1Y9WA 1GHEA 4E2AA 4UWIA 4B13A 4JD6A 3R96A 2VXKA 3FYNA 2IL4A 5EC4A 2Z3KA 2JLMA 3DR8A 4OADA 3D2PA 4F0YA 3C26A 4CAWA 1YVKA 4UWJA 4CS0B 2OH1A 1S7KA 2HQYA 3G8WA 5FVJA 4HNYB 2CNSA 4NF1A 3PGPA 1M1DA 2ARHA 4KOSA 3K9UA 1I1DA 4KVXA 2ATRA 5IV0A 3SXNA 3IWGA 3S6KA 4KOTA 4E0AA 3T9YA 1K4JA 2ZW4A 4JLYA 4XPDB 3DSBA 2NMTA 3W6XA 3B8GA 5G22A 3IU1A 3FNCA 2DPSA 1MK4A 5AG6A 2WPWA 4KOUA 2FXFA 4ONUA 2P0WA 4CAEA 2PRBA 1KUVA 2C27A 2GE3A 3TOAA 3F8KA 3A9LA 2OU2A 5DWNA 3FRMA 3SXOA 4CYOA 2R7HA 3TT2A 4CYQA 4PSXA 4PSWA 5IB0A 2B3VA 3IGRA 3V8IA 4KUBA 1R57A 4A2ZA 4IF5A 1ON0A 4MFKA 3TOBA 4AG9A 1ZO0A 5I0CA 2Q4YA 1S60A 1BO4A 3DNSA 2ZXVA 3JVNA 4B5OA 1YX0A 2EVNA 3TFYA 2I79A 2VBQA 2Z3OA 1L0CA 3SHPA 4R3KA 1I21A 3R1KA 4A32A 1RO5A 3DR6A 4NEXA 2G0BA 2K5TA 1CM0A 4FD4A 4X5KA 1FY7A 4KLVA 4J3GA 3GYAA 2J8RA 2Y0MA 1U6MA 3D2MA 4MI4A 4CGPA 5HMNA 2GANA 3D8PA 2VEZA 4UCPA 1BOBA 3TO7A 4U9ZA 2YNEA 4FD6A 3GKRA 2QMLA 4CRZB 2CXAA 2Z3NA 4YFJA 4H89A 4KZTA 5KTDA 1S3ZA 3CXSA 2ZW5A 1Q2YA 1S5KA 4UCNA 4KUAA 1B87A 1KUXA 1QSNA 1Z4RA 4QUSA 4KORA 2VZZA 3P2FA 4NCZA 4Y49B 2FSRA 2JDCA 4CYNA 5CNPA 1YLEA 3QAHA 3CXQA 3N7ZA 4JWPA 4CRYB 1OZPA 2R1IA 5E96A 1Y9KA 1M4GA 4I49A 4PV6A 4KOVA 2YNDA 4Y49C 1WK4A 1M44A 4ZBGA 3FBUA 4ORFA 4PK2A 2QIRA 1Q2DA 4Q36A 4OAEA 3R9FA 4KOWA 4MFPA 2HUZA 4KOXA 3P2HA 4DNCA 3CXPA 2PDOA 4XNHC 2Z11A 2JDDA 3EXNA 1IYLA 2Z3MA 1XMTA 1Q2CA 2RC4A 4R9MA 5J8CA 4MFJA 3NE7A 5F47A 1NMTA 5EBVA 3JTKA 5IX3A 1P4NA 2REFA 3TCVA 2VI7A 5H86A 4CYPA 1S7NA 1J4JA 3ZJ0A 2D4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Y A;  3I9S A;  2PR8 A;  5J8F A;  4XPK A;  1QSR A;  3W91 A;  3BJ8 A;  4XPL A;  1XEB A;  2J8N A;  3EY5 A;  2KCW A;  1WWZ A;  4R87 A;  3S6F A;  3ZZI A;  4H6U A;  4UA3 A;  2GIV A;  2BSW A;  2Q7B A;  3MGD A;  2R8V A;  1MJB A;  4UBR A;  1MJ9 A;  5HH1 A;  1RXT A;  3RYO A;  2FIW A;  5F46 A;  2B3U A;  4M3S A;  4AB7 A;  3R9G A;  3H4Q A;  3D3S A;  4KVM E;  4R3L A;  1VHS A;  3UY5 A;  5JPH A;  4RS2 A;  1TIQ A;  2B5G A;  3FIX A;  3F5B A;  2HV2 A;  1QSO A;  1YGH A;  3PZJ A;  3T90 A;  4BMH A;  2CNT A;  2G3T A;  1Z4E A;  2JEV A;  1M4I A;  2X7B A;  1S7L A;  3G3S A;  4AVC A;  5H84 A;  3R9E A;  4II9 A;  1Y7R A;  2OZG A;  4KVO E;  4M85 A;  1XIX A;  3TO9 A;  2Q04 A;  2B4D B;  1XE4 A;  4U5Y A;  2J8M A;  1IYK A;  3FXT A;  2VQY A;  3FB3 A;  4L8A A;  4FD7 A;  4QC6 A;  4NSQ A;  3EFA A;  3DDD A;  2I00 A;  2FIA A;  2ZW6 A;  2WPX A;  1PUA A;  1LRZ A;  2FE7 A;  4OLL A;  3BLN A;  1M4D A;  1KUY A;  4YRH A;  1SQH A;  4MJ8 A;  4AG7 A;  1UFH A;  5JQ4 A;  5KTC A;  1V0C A;  2B4D A;  5KTA A;  4MY3 A;  2G3A A;  4QVT A;  4XNH B;  3R95 A;  3E0K A;  2CY2 A;  2O28 A;  4GS4 A;  2ZW7 A;  2PR1 A;  3GY9 A;  2BUE A;  3JUW A;  5C88 A;  3TE4 A;  4QBJ A;  2OZH A;  5ISV A;  1IID A;  4E8O A;  3F0A A;  2B58 A;  4PK3 A;  1YR0 A;  3EO4 A;  3W6S A;  1N71 A;  2BL1 A;  1QST A;  3BJ7 A;  2H5M A;  4IUS A;  4MY0 A;  3WR7 A;  4YGO A;  2PC1 A;  3PP9 A;  2AE6 A;  4HKF A;  1NE9 A;  2FS5 A;  4XPD C;  1B6B A;  3KKW A;  4CAV A;  4AVB A;  2P6F A;  1QSM A;  1MJA A;  2BEI A;  3TO6 A;  1PU9 A;  4H6Z A;  4RI1 A;  4HNW B;  3S6H A;  3VWE A;  4JJX A;  3EC4 A;  2B5G B;  5F48 A;  5DWM A;  2Z10 A;  4B5P B;  5F49 A;  1P0H A;  2Q0Y A;  1CJW A;  1YRE A;  2P6E A;  3OWC A;  2R98 A;  1KZF A;  4CAX A;  4LUA A;  1IIC A;  2D4P A;  3LD2 A;  1NSL A;  4K30 A;  1YK3 A;  1Z9U A;  4NXY A;  4EVY A;  1S7F A;  2PSW A;  1I12 A;  4LX9 A;  2OB0 A;  3TTH A;  4F6A A;  4MHD A;  4L89 A;  2AJ6 A;  1YVO A;  2F5I A;  4MBU A;  2PQ8 A;  2CNM A;  2ZPA A;  4B5P A;  2FL4 A;  2FCK A;  3LOD A;  4QB9 A;  4R57 A;  4FD5 A;  2DXQ A;  2Z0Z A;  5C82 A;  1XF8 A;  2QEC A;  3VWD A;  2Q4V A;  2EUI A;  1IB1 E;  4KLW A;  4KOY A;  5GCN A;  4JXQ A;  2OZU A;  2P6G A;  2VZY A;  4JXR A;  2FT0 A;  2B4B A;  1VKC A;  4AVA A;  3I3G A;  4HNX B;  3S6G A;  2REE A;  3QB8 A;  2A4N A;  2Q44 A;  1Y9W A;  1GHE A;  4E2A A;  4UWI A;  4JD6 A;  3R96 A;  2VXK A;  3FYN A;  2IL4 A;  5EC4 A;  2JLM A;  3DR8 A;  4OAD A;  3D2P A;  4F0Y A;  3C26 A;  4CAW A;  1YVK A;  4UWJ A;  4CS0 B;  2OH1 A;  1S7K A;  2HQY A;  3G8W A;  5FVJ A;  4HNY B;  2CNS A;  4NF1 A;  3PGP A;  1M1D A;  2ARH A;  4KOS A;  3K9U A;  1I1D A;  4KVX A;  2ATR A;  5IV0 A;  3SXN A;  3IWG A;  3S6K A;  4KOT A;  4E0A A;  3T9Y A;  1K4J A;  2ZW4 A;  4JLY A;  4XPD B;  3DSB A;  2NMT A;  3W6X A;  3B8G A;  3FNC A;  1MK4 A;  2WPW A;  4KOU A;  2FXF A;  4ONU A;  2P0W A;  2PRB A;  1KUV A;  2C27 A;  2GE3 A;  3TOA A;  3F8K A;  2OU2 A;  5DWN A;  3FRM A;  3SXO A;  2R7H A;  3TT2 A;  4PSX A;  4PSW A;  5IB0 A;  2B3V A;  3IGR A;  3V8I A;  4KUB A;  1R57 A;  4IF5 A;  1ON0 A;  3TOB A;  4AG9 A;  5I0C A;  2Q4Y A;  1S60 A;  1BO4 A;  3DNS A;  2ZXV A;  3JVN A;  4B5O A;  1YX0 A;  2EVN A;  3TFY A;  2I79 A;  2VBQ A;  1L0C A;  3SHP A;  4R3K A;  1I21 A;  3R1K A;  1RO5 A;  3DR6 A;  4NEX A;  2G0B A;  2K5T A;  1CM0 A;  4FD4 A;  4X5K A;  1FY7 A;  4KLV A;  4J3G A;  3GYA A;  2J8R A;  2Y0M A;  1U6M A;  3D2M A;  4MI4 A;  5HMN A;  2GAN A;  3D8P A;  2VEZ A;  1BOB A;  3TO7 A;  4U9Z A;  4FD6 A;  3GKR A;  2QML A;  4CRZ B;  4YFJ A;  4H89 A;  4KZT A;  5KTD A;  1S3Z A;  3CXS A;  2ZW5 A;  1Q2Y A;  1S5K A;  4KUA A;  1B87 A;  1KUX A;  1QSN A;  1Z4R A;  4QUS A;  4KOR A;  2VZZ A;  3P2F A;  4NCZ A;  4Y49 B;  2FSR A;  2JDC A;  5CNP A;  1YLE A;  3QAH A;  3CXQ A;  3N7Z A;  4JWP A;  4CRY B;  1OZP A;  2R1I A;  5E96 A;  1Y9K A;  1M4G A;  4I49 A;  4PV6 A;  4KOV A;  4Y49 C;  1WK4 A;  1M44 A;  4ZBG A;  3FBU A;  4ORF A;  4PK2 A;  2QIR A;  1Q2D A;  4OAE A;  3R9F A;  4KOW A;  2HUZ A;  4KOX A;  3P2H A;  4DNC A;  3CXP A;  2PDO A;  4XNH C;  2Z11 A;  2JDD A;  3EXN A;  1IYL A;  1XMT A;  1Q2C A;  2RC4 A;  4R9M A;  5J8C A;  3NE7 A;  5F47 A;  1NMT A;  5EBV A;  5IX3 A;  1P4N A;  2REF A;  3TCV A;  2VI7 A;  5H86 A;  1S7N A;  1J4J A;  3ZJ0 A;  2D4O A; 
#chains in the Genus database with same CATH topology
 4OC2 A;  4U9Y A;  1YW4 A;  2AFU A;  4MFL A;  5A28 A;  1ZG9 A;  4P4E A;  3I9S A;  1TF9 A;  2PR8 A;  2PJ3 A;  5J8F A;  4XPK A;  1QSR A;  2POK A;  2AFW A;  4OC1 A;  4BD9 A;  5LYF A;  3W91 A;  3BJ8 A;  4XPL A;  1XEB A;  3B7I A;  4ZX8 A;  2OR4 A;  4P10 A;  5F09 A;  2J8N A;  3EY5 A;  2KCW A;  4UFW A;  4YU9 A;  3DGV A;  1WWZ A;  3H8F A;  4R87 A;  3S6F A;  2DPT A;  3KHZ A;  3ZZI A;  4H6U A;  4UA3 A;  2GIV A;  1RTQ A;  1ZG7 A;  2ZEP A;  2BSW A;  1Z8X A;  1CPX A;  3PB8 X;  2Q7B A;  3MGD A;  1PYT B;  4MMO A;  2V8G A;  3SJG A;  2R8V A;  4A39 A;  1MJB A;  4UBR A;  4C68 A;  1MJ9 A;  4A33 A;  3B35 A;  5G1Z A;  3BXM A;  4ZX9 A;  5HH1 A;  1RXT A;  2BOA A;  2VL1 A;  4Z65 A;  1LAP A;  1YLO A;  3RYO A;  2FIW A;  5F46 A;  2B3U A;  4LQG A;  1HDU A;  4M3S A;  4AB7 A;  3PFO A;  4M6G A;  3PFE A;  3R9G A;  4PXD A;  3H4Q A;  3D3S A;  4K3N A;  2ZOG A;  2IMO A;  4KVM E;  1VHO A;  4A37 A;  4AXV A;  3N5F A;  1A2Z A;  3IU2 A;  2V8V A;  4R3L A;  1XJO A;  1VHS A;  4UIA A;  3UY5 A;  5JPH A;  2JEW A;  5BWA B;  4C2Z A;  4RS2 A;  4UCM A;  4B11 A;  1IU8 A;  3PB7 X;  4BBH A;  1TIQ A;  2B5G A;  3FIX A;  3F5B A;  2HV2 A;  1QSO A;  1YGH A;  3D7D A;  3PZJ A;  3T90 A;  2HB6 A;  4BMH A;  2CNT A;  2HC9 A;  2G3T A;  5G21 A;  3KI9 A;  1Z4E A;  4P4D A;  2JEV A;  1M4I A;  3KR4 A;  1LAN A;  1S7L A;  1F2P A;  1YQE A;  2X7B A;  2YGW A;  3DLJ A;  3G3S A;  4OIW A;  4P4J A;  3D66 A;  5H84 A;  4AVC A;  3FED A;  3R9E A;  4ZGY B;  4II9 A;  2ZEO A;  1Y7R A;  2OZG A;  2Q7S A;  4KVO E;  4OC4 A;  2ABZ A;  4M85 A;  2XEF A;  5HXD A;  4OP4 A;  1XIX A;  2QVP A;  3TO9 A;  3KQX A;  2Q04 A;  5HVG A;  2B4D B;  3FX6 A;  3S9L A;  1XE4 A;  2WSA A;  3QNV A;  4MCS A;  4MHN A;  4U5Y A;  5K8P A;  3D68 A;  2GLJ A;  2J8M A;  4GXH A;  1EE3 P;  1IYK A;  3FXT A;  2VQY A;  3FB3 A;  4L8A A;  3FH4 A;  3IWW A;  4FD7 A;  4QC6 A;  4NSQ A;  3EFA A;  3H8G A;  3DDD A;  2I00 A;  4NGT A;  1X10 A;  2FIA A;  2ZW6 A;  2WPX A;  1XBU A;  2WUU A;  3H5Z A;  1PUA A;  1LRZ A;  2ANP A;  3T8W A;  2PJ1 A;  4IHM A;  2Z3P A;  3PEI A;  5G20 A;  2FE7 A;  4UEZ A;  4IK2 A;  4OLL A;  4EFD A;  3BLN A;  1M4D A;  3CZX A;  2WZN A;  1KUY A;  2I3C A;  1SQH A;  4MJ8 A;  4YRH A;  1OBR A;  1UFH A;  4AG7 A;  1GYT A;  2ZOF A;  4ZYQ A;  5JQ4 A;  5KTC A;  1V0C A;  2B4D A;  5KTA A;  1LCP A;  2Z3L A;  4MY3 A;  2G3A A;  1LAM A;  4QVT A;  4F0X A;  5A27 A;  5J1Q A;  4XNH B;  3R95 A;  4MXU A;  3E0K A;  2CY2 A;  4EME A;  2O28 A;  1Z5R A;  2BO9 A;  4KSA A;  4MFQ A;  4A94 A;  4GS4 A;  3SJF A;  2Q4Z A;  2ZW7 A;  3B3C A;  2PR1 A;  4MRI A;  3RO0 A;  3GY9 A;  2BUE A;  3JUW A;  5C88 A;  3TE4 A;  4QBJ A;  4B14 A;  2OZH A;  5ISV A;  1IID A;  4E8O A;  3F0A A;  2B58 A;  4R7M A;  4KSI A;  4A95 A;  4C2Y A;  5I4M A;  1UWY A;  5AG5 A;  4PK3 A;  1YR0 A;  2PJ8 A;  1LOK A;  4A31 A;  5AGE A;  3EO4 A;  2GRE A;  3D7G A;  2AFO A;  3W6S A;  3KZW A;  4CGM A;  4F9V A;  1CBX A;  1N71 A;  2PJ2 A;  3GIU A;  1BAV A;  3BI1 A;  2BL1 A;  1QST A;  3BJ7 A;  2H5M A;  4B6Z A;  4IUS A;  3PBB A;  4MY0 A;  3MN8 A;  3WR7 A;  3HUV A;  4YGO A;  2PC1 A;  1QQ9 A;  2AFX A;  2XEI A;  4OID A;  3PP9 A;  2AE6 A;  4HKF A;  1Z8W A;  1NE9 A;  2FS5 A;  4XPD C;  1JQG A;  1B6B A;  3VH9 A;  5CBM A;  3IJ3 A;  4R8F A;  3KKW A;  4CAV A;  5AG7 A;  4PXE A;  4P4I A;  4AVB A;  2P6F A;  3IWE A;  4OC5 A;  4CGL A;  1QSM A;  5LRK A;  1MJA A;  2BEI A;  2C1C A;  3FF3 A;  3TO6 A;  2QYV A;  4BIN A;  4CAF A;  3LWU A;  1PU9 A;  4H6Z A;  5D29 A;  3V7Z A;  5HVH A;  4RI1 A;  4HNW B;  3S6H A;  2YNC C;  3VWE A;  4JJX A;  2Q43 A;  2B5G B;  3EC4 A;  4NJR A;  4PXB A;  5F48 A;  4ZI6 A;  5DWM A;  2Z10 A;  4B5P B;  1ZLI A;  5F49 A;  1P0H A;  2Q0Y A;  1CJW A;  1YRE A;  2P6E A;  3OWC A;  2R98 A;  3RNZ A;  1ELM P;  3SJE A;  4OC3 A;  1KZF A;  4C2X A;  3GB0 A;  4RN7 A;  5D8N A;  2NYQ A;  4CAX A;  4Q38 A;  4LUA A;  1IIC A;  2ODF A;  4M6I A;  2D4P A;  3LD2 A;  4UFX A;  1NSL A;  3D7F A;  2EK9 A;  4K30 A;  3WC5 A;  2YNC A;  1YK3 A;  1QMU A;  1Z9U A;  4NXY A;  4X3R A;  4A30 A;  4EVY A;  1S7F A;  2ZEE A;  2PSW A;  4C7H A;  1I12 A;  6CPA A;  4LX9 A;  1M4L A;  5LYI A;  2OB0 A;  2V8D A;  4NGQ A;  5IB9 A;  3TTH A;  1BPM A;  2CF4 A;  4F6A A;  4CPA A;  2WYR A;  4MCR A;  3SI2 A;  2IQ6 A;  4C7I A;  4GM5 A;  5LRJ A;  4CGO A;  4MHD A;  2NSM A;  4L89 A;  3SJX A;  2AJ6 A;  1YVO A;  5AG4 A;  2F5I A;  4MBU A;  2PQ8 A;  4H2K A;  1CG2 A;  2C6G A;  3B3S A;  2CNM A;  2ZPA A;  4B5P A;  2GU2 A;  2FL4 A;  3VAT A;  2FCK A;  4B10 A;  4WJB A;  3KAS A;  3LOD A;  4QB9 A;  4R57 A;  4FD5 A;  2DXQ A;  2Z0Z A;  5C82 A;  3NFZ A;  1XF8 A;  4ZY0 A;  1Q7L A;  4OKO A;  2QEC A;  4X8I A;  2Q4V A;  2EUI A;  3VWD A;  3IC1 A;  1IB1 E;  4KLW A;  4KOY A;  5GCN A;  4MFZ A;  4JXQ A;  1XFO A;  2OZU A;  2P6G A;  2PIY A;  2VZY A;  3I1U A;  4JXR A;  4RUH A;  2FT0 A;  3FEC A;  4TNU A;  2B4B A;  1FT7 A;  4NFR A;  1VKC A;  3L2N A;  3B3W A;  3CPX A;  4KS9 A;  4UFV A;  4B12 A;  4AVA A;  4CGN A;  3I3G A;  4M6H A;  4HNX B;  5CPA A;  4KSF A;  4IAV A;  3S6G A;  3SI0 A;  3FEE A;  2REE A;  3QB8 A;  2A4N A;  1CPS A;  2Q44 A;  1Y9W A;  3S9N A;  1GHE A;  1ZLH A;  4E2A A;  1BPN A;  4UWI A;  4B13 A;  4JD6 A;  3R96 A;  5K8N A;  2EBJ A;  2VXK A;  3FYN A;  1CP7 A;  2IL4 A;  5EC4 A;  2ZED A;  1Y0Y A;  3BI0 A;  2Z3K A;  2JLM A;  1ARL A;  1XOV A;  3DR8 A;  2AFM A;  1TXR A;  5LYL A;  3H8E A;  3KL9 A;  4OAD A;  3FMC A;  4DJL A;  4FBE A;  3D2P A;  4F0Y A;  2F7V A;  3B3V A;  4FUU A;  2GLF A;  3C26 A;  1Z8T A;  4CAW A;  1YVK A;  5JH9 A;  4NGM A;  2AFZ A;  4UWJ A;  1VHE A;  4UF4 A;  3V38 A;  1ZG8 A;  2OH1 A;  4CS0 B;  4P4F A;  1Z8L A;  1IOI A;  1KWM A;  2JBK A;  1S7K A;  3B2Y A;  4G1P A;  2HQY A;  3G8W A;  5FVJ A;  4HNY B;  2CNS A;  2CIJ A;  2PVV A;  1AUG A;  4NF1 A;  4MCP A;  3NH5 A;  3NH8 A;  3PGP A;  1M1D A;  2ARH A;  2XEJ A;  4F8Z A;  4KOS A;  3D67 A;  3K9U A;  4JYW A;  1I1D A;  4MHY A;  1YW6 A;  4KVX A;  1AYE A;  2ATR A;  2C6P A;  2G9D A;  2PJ6 A;  3SXN A;  3IWG A;  3RZA A;  3S6K A;  1AMP A;  4KOT A;  3KQZ A;  4E0A A;  3T9Y A;  1K4J A;  2ZEF A;  2ZW4 A;  4JLY A;  4XPD B;  1Y0R A;  3DSB A;  2NMT A;  3PB6 X;  3W6X A;  2PVW A;  5DS0 A;  3B8G A;  2PJ7 A;  3ISX A;  1TF8 A;  1DE4 C;  5G22 A;  3IU1 A;  2AFS A;  3FNC A;  2DPS A;  3JRU A;  1JWQ A;  2PJ5 A;  2BCO A;  2DEA A;  3CT9 A;  4YWY A;  1MK4 A;  5LYD A;  1H8L A;  5AG6 A;  1TKH A;  3SI1 A;  2WPW A;  4NJQ A;  3IFE A;  4KOU A;  1TKJ A;  2FXF A;  4ONU A;  2P0W A;  2QJ8 A;  4CAE A;  3PB4 X;  3IIB A;  1R3N A;  4FAI A;  7CPA A;  2PRB A;  4R76 A;  4PQA A;  1Y7E A;  3KHX A;  3D7H A;  1KUV A;  2C27 A;  2PCU A;  2GE3 A;  3WAB A;  2F8H A;  3MRU A;  5THW A;  3TOA A;  3F8K A;  3A9L A;  2OU2 A;  2PE3 A;  5DWN A;  5ELY A;  3WC7 A;  3FRM A;  3PB9 X;  4P45 A;  2R7H A;  4UEF A;  2OOT A;  3SXO A;  4CYO A;  3TT2 A;  1YME A;  2ZEM A;  3LMS A;  4UIB A;  4CYQ A;  4PSX A;  4PSW A;  3RBU A;  4P6Y A;  1TKF A;  3B3T A;  1YSJ A;  5IB0 A;  2B3V A;  1NSA A;  4DUK A;  4ZY1 A;  2PIZ A;  5IV0 A;  2CTC A;  2V77 A;  3FVL A;  3NA6 A;  3HLP A;  4MCQ A;  3IGR A;  4WWV A;  3ISZ A;  3V8I A;  4KUB A;  1R57 A;  3RAM A;  3PRT A;  4PPZ A;  3CDX A;  2J9A A;  4IF5 A;  1IOF A;  2RFH A;  1ON0 A;  4A2Z A;  4UEE A;  3S9M A;  4MFK A;  3TOB A;  1IGB A;  1ZO0 A;  4AG9 A;  5I0C A;  2C6C A;  2Q4Y A;  2O4H A;  1S60 A;  1BO4 A;  2CTB A;  2FVG A;  2JBJ A;  2ZXV A;  2PJ0 A;  1YX0 A;  3DNS A;  3JVN A;  4ONW A;  4R6T A;  4B5O A;  1VGY A;  5JGF A;  5JM6 A;  2EVN A;  3QAY A;  3TFY A;  4DYO A;  2I79 A;  2VBQ A;  3NE8 A;  1XMB A;  4LQ6 A;  2Z3O A;  1L0C A;  3SHP A;  4NGP A;  3KGQ A;  4R3K A;  4P44 A;  1I21 A;  3R1K A;  4A32 A;  1RO5 A;  3DR6 A;  4NEX A;  4EWT A;  1FNO A;  3WC6 A;  2PJB A;  4NGS A;  2G0B A;  2K5T A;  1CM0 A;  4FD4 A;  4X5K A;  1FY7 A;  2ZEN A;  4KLV A;  4F9U A;  3FJU A;  4J3G A;  2PJ4 A;  5EMI A;  3GYA A;  2J8R A;  2Y0M A;  3K2K A;  8CPA A;  1U6M A;  1CX8 A;  3D2M A;  4MI4 A;  2PRQ A;  1X12 A;  4CGP A;  5HMN A;  2GAN A;  4HPS A;  3D8P A;  2VEZ A;  4UCP A;  1LFW A;  2ZEG A;  1BOB A;  3TO7 A;  2EK8 A;  3GLJ A;  1XRY A;  4U9Z A;  2YNE A;  4FD6 A;  2O53 A;  3GKR A;  2QML A;  4CRZ B;  2CXA A;  2Z3N A;  4YFJ A;  4H89 A;  5K8M A;  4KZT A;  1F57 A;  5KTD A;  3CPA A;  1HDQ A;  4MHP A;  4NGN A;  3GUX A;  4ZY2 A;  1S3Z A;  4A38 A;  3CXS A;  3IO1 A;  2ZW5 A;  3TX8 A;  4Q7A A;  1Q2Y A;  1S5K A;  4FWU A;  2EWB A;  5K8O A;  4UCN A;  4KUA A;  3NH4 A;  4OME A;  4JZ0 A;  1B87 A;  2EO8 A;  3BHX A;  4X2T A;  1KUX A;  1QSN A;  1Z4R A;  4QUS A;  4KOR A;  4NGR A;  4P4B A;  2ZEL A;  2VZZ A;  3P2F A;  4NCZ A;  4Y49 B;  4W9Y A;  2FSR A;  2JDC A;  4CYN A;  5CNP A;  1YLE A;  3QAH A;  2IJZ A;  3CXQ A;  3N7Z A;  4JWP A;  4CRY B;  1OZP A;  2R1I A;  5E96 A;  3KR5 A;  2DF5 A;  1Y9K A;  3D4U A;  2PJ9 A;  4MHZ A;  1M4G A;  4I49 A;  4O23 A;  4PV6 A;  4KOV A;  2YND A;  3K9T A;  4Y49 C;  1WK4 A;  1M44 A;  2PJA A;  2RB7 A;  5LRG A;  1PCA A;  4ZBG A;  4OC0 A;  3FBU A;  4ORF A;  4PK2 A;  1HEE A;  2QIR A;  1ELL P;  1Q2D A;  4Q36 A;  3IEH A;  4TWE A;  4OAE A;  1Z2L A;  4KOW A;  4MFP A;  3R9F A;  2HUZ A;  4KOX A;  2ZEH A;  3P2H A;  2V8H A;  1VIX A;  3CXP A;  3WT4 A;  4DNC A;  2PDO A;  4XNH C;  2Z11 A;  3PBE A;  2JDD A;  3EXN A;  1BLL E;  1IYL A;  1R43 A;  1F2O A;  2Q51 A;  2XEG A;  1XMT A;  2Z3M A;  1Q2C A;  2RC4 A;  3LAC A;  4R9M A;  5J8C A;  5HVF A;  4MFJ A;  2PJC A;  3NE7 A;  4PXC A;  5F47 A;  1IY7 A;  1NMT A;  5EBV A;  1DTD A;  1CP6 A;  3JTK A;  3VAR A;  1P4N A;  1ARM A;  5IX3 A;  2REF A;  3TC8 A;  2VI7 A;  5H86 A;  3TCV A;  4CYP A;  1S7N A;  1J4J A;  3ZJ0 A;  2D4O A;  2GFQ A; 
#chains in the Genus database with same CATH homology
 4U9Y A;  4MFL A;  5A28 A;  3I9S A;  2PR8 A;  5J8F A;  4XPK A;  1QSR A;  3W91 A;  3BJ8 A;  4XPL A;  1XEB A;  2J8N A;  3EY5 A;  2KCW A;  4UFW A;  1WWZ A;  4R87 A;  3S6F A;  2DPT A;  3ZZI A;  4H6U A;  4UA3 A;  2GIV A;  2BSW A;  2Q7B A;  3MGD A;  2R8V A;  1MJB A;  4UBR A;  4C68 A;  1MJ9 A;  4A33 A;  5HH1 A;  5G1Z A;  1RXT A;  3RYO A;  2FIW A;  5F46 A;  2B3U A;  4M3S A;  4AB7 A;  3R9G A;  3H4Q A;  3D3S A;  4KVM E;  3IU2 A;  4R3L A;  1VHS A;  3UY5 A;  5JPH A;  4C2Z A;  4RS2 A;  4UCM A;  4B11 A;  4BBH A;  1TIQ A;  2B5G A;  3FIX A;  3F5B A;  2HV2 A;  1QSO A;  1YGH A;  3PZJ A;  3T90 A;  4BMH A;  2CNT A;  5G21 A;  2G3T A;  1Z4E A;  2JEV A;  1M4I A;  2X7B A;  1S7L A;  5BWA B;  2YGW A;  3G3S A;  4AVC A;  5H84 A;  3R9E A;  4ZGY B;  4II9 A;  1Y7R A;  2OZG A;  4KVO E;  4M85 A;  1XIX A;  3TO9 A;  2Q04 A;  2B4D B;  1XE4 A;  2WSA A;  4U5Y A;  2J8M A;  1IYK A;  3FXT A;  2VQY A;  3FB3 A;  4L8A A;  4FD7 A;  4QC6 A;  4NSQ A;  3EFA A;  3DDD A;  2I00 A;  2FIA A;  2ZW6 A;  2WPX A;  2WUU A;  3H5Z A;  1PUA A;  1LRZ A;  2Z3P A;  5G20 A;  2FE7 A;  4OLL A;  3BLN A;  1M4D A;  1KUY A;  4YRH A;  1SQH A;  4MJ8 A;  4AG7 A;  1UFH A;  5JQ4 A;  5KTC A;  1V0C A;  2B4D A;  5KTA A;  2Z3L A;  4MY3 A;  2G3A A;  4QVT A;  4F0X A;  5A27 A;  4XNH B;  3R95 A;  3E0K A;  2CY2 A;  2O28 A;  4KSA A;  4MFQ A;  4GS4 A;  2ZW7 A;  2PR1 A;  3GY9 A;  2BUE A;  3JUW A;  5C88 A;  3TE4 A;  4QBJ A;  4B14 A;  2OZH A;  5ISV A;  1IID A;  4E8O A;  3F0A A;  2B58 A;  4A95 A;  4C2Y A;  5AG5 A;  4PK3 A;  1YR0 A;  4A31 A;  5AGE A;  3EO4 A;  3W6S A;  4CGM A;  1N71 A;  2BL1 A;  1QST A;  3BJ7 A;  2H5M A;  4IUS A;  4MY0 A;  3WR7 A;  4YGO A;  2PC1 A;  3PP9 A;  2AE6 A;  4HKF A;  1NE9 A;  2FS5 A;  4XPD C;  1B6B A;  3KKW A;  4CAV A;  5AG7 A;  4AVB A;  2P6F A;  3IWE A;  4CGL A;  1QSM A;  1MJA A;  2BEI A;  3TO6 A;  4CAF A;  1PU9 A;  4H6Z A;  4RI1 A;  4HNW B;  3S6H A;  2YNC C;  3VWE A;  4JJX A;  3EC4 A;  2B5G B;  5F48 A;  5DWM A;  2Z10 A;  4B5P B;  5F49 A;  1P0H A;  2Q0Y A;  1CJW A;  1YRE A;  2P6E A;  3OWC A;  2R98 A;  1KZF A;  4C2X A;  4CAX A;  4Q38 A;  4LUA A;  1IIC A;  2D4P A;  3LD2 A;  4UFX A;  1NSL A;  4K30 A;  2YNC A;  1YK3 A;  1Z9U A;  4NXY A;  4EVY A;  4A30 A;  1S7F A;  2PSW A;  4C7H A;  1I12 A;  4LX9 A;  2OB0 A;  3TTH A;  4F6A A;  4C7I A;  4CGO A;  4MHD A;  4L89 A;  2AJ6 A;  1YVO A;  5AG4 A;  2F5I A;  4MBU A;  2PQ8 A;  2CNM A;  2ZPA A;  4B5P A;  2FL4 A;  2FCK A;  4B10 A;  3LOD A;  4QB9 A;  4R57 A;  4FD5 A;  2DXQ A;  2Z0Z A;  5C82 A;  1XF8 A;  2QEC A;  3VWD A;  2Q4V A;  2EUI A;  1IB1 E;  4KLW A;  4KOY A;  5GCN A;  4MFZ A;  4JXQ A;  2OZU A;  2P6G A;  2VZY A;  4JXR A;  2FT0 A;  2B4B A;  1VKC A;  4UFV A;  4B12 A;  4KS9 A;  4AVA A;  4CGN A;  3I3G A;  4HNX B;  4KSF A;  3S6G A;  2REE A;  3QB8 A;  2A4N A;  2Q44 A;  1Y9W A;  1GHE A;  4E2A A;  4UWI A;  4B13 A;  4JD6 A;  3R96 A;  2VXK A;  3FYN A;  2IL4 A;  5EC4 A;  2Z3K A;  2JLM A;  3DR8 A;  4OAD A;  3D2P A;  4F0Y A;  3C26 A;  4CAW A;  1YVK A;  4UWJ A;  4CS0 B;  2OH1 A;  1S7K A;  2HQY A;  3G8W A;  5FVJ A;  4HNY B;  2CNS A;  4NF1 A;  3PGP A;  1M1D A;  2ARH A;  4KOS A;  3K9U A;  1I1D A;  4KVX A;  2ATR A;  5IV0 A;  3SXN A;  3IWG A;  3S6K A;  4KOT A;  4E0A A;  3T9Y A;  1K4J A;  2ZW4 A;  4JLY A;  4XPD B;  3DSB A;  2NMT A;  3W6X A;  3B8G A;  5G22 A;  3IU1 A;  3FNC A;  2DPS A;  1MK4 A;  5AG6 A;  2WPW A;  4KOU A;  2FXF A;  4ONU A;  2P0W A;  4CAE A;  2PRB A;  1KUV A;  2C27 A;  2GE3 A;  3TOA A;  3F8K A;  3A9L A;  2OU2 A;  5DWN A;  3FRM A;  3SXO A;  4CYO A;  2R7H A;  3TT2 A;  4CYQ A;  4PSX A;  4PSW A;  5IB0 A;  2B3V A;  3IGR A;  3V8I A;  4KUB A;  1R57 A;  4A2Z A;  4IF5 A;  1ON0 A;  4MFK A;  3TOB A;  4AG9 A;  1ZO0 A;  5I0C A;  2Q4Y A;  1S60 A;  1BO4 A;  3DNS A;  2ZXV A;  3JVN A;  4B5O A;  1YX0 A;  2EVN A;  3TFY A;  2I79 A;  2VBQ A;  2Z3O A;  1L0C A;  3SHP A;  4R3K A;  1I21 A;  3R1K A;  4A32 A;  1RO5 A;  3DR6 A;  4NEX A;  2G0B A;  2K5T A;  1CM0 A;  4FD4 A;  4X5K A;  1FY7 A;  4KLV A;  4J3G A;  3GYA A;  2J8R A;  2Y0M A;  1U6M A;  3D2M A;  4MI4 A;  4CGP A;  5HMN A;  2GAN A;  3D8P A;  2VEZ A;  4UCP A;  1BOB A;  3TO7 A;  4U9Z A;  2YNE A;  4FD6 A;  3GKR A;  2QML A;  4CRZ B;  2CXA A;  2Z3N A;  4YFJ A;  4H89 A;  4KZT A;  5KTD A;  1S3Z A;  3CXS A;  2ZW5 A;  1Q2Y A;  1S5K A;  4UCN A;  4KUA A;  1B87 A;  1KUX A;  1QSN A;  1Z4R A;  4QUS A;  4KOR A;  2VZZ A;  3P2F A;  4NCZ A;  4Y49 B;  2FSR A;  2JDC A;  4CYN A;  5CNP A;  1YLE A;  3QAH A;  3CXQ A;  3N7Z A;  4JWP A;  4CRY B;  1OZP A;  2R1I A;  5E96 A;  1Y9K A;  1M4G A;  4I49 A;  4PV6 A;  4KOV A;  2YND A;  4Y49 C;  1WK4 A;  1M44 A;  4ZBG A;  3FBU A;  4ORF A;  4PK2 A;  2QIR A;  1Q2D A;  4Q36 A;  4OAE A;  3R9F A;  4KOW A;  4MFP A;  2HUZ A;  4KOX A;  3P2H A;  4DNC A;  3CXP A;  2PDO A;  4XNH C;  2Z11 A;  2JDD A;  3EXN A;  1IYL A;  2Z3M A;  1XMT A;  1Q2C A;  2RC4 A;  4R9M A;  5J8C A;  4MFJ A;  3NE7 A;  5F47 A;  1NMT A;  5EBV A;  3JTK A;  5IX3 A;  1P4N A;  2REF A;  3TCV A;  2VI7 A;  5H86 A;  4CYP A;  1S7N A;  1J4J A;  3ZJ0 A;  2D4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...