2VQYA

Structure of aac(6')-ib in complex with parmomycin and acetylcoa.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
177
Chain Sequence
b'DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 53
structure length 177
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vqyA00
2C27A 5F49A 4RS2A 1S7FA 4LX9A 3OWCA 1Y9WA 4JWPA 4MI4A 4YRHA 5GCNA 4OAEA 1XMTA 3H4QA 3TTHA 4XPLA 3TFYA 2VBQA 2J8RA 3DR8A 4ORFA 1IB1E 4YGOA 3R9FA 2B58A 2Z11A 5HH1A 3ZJ0A 4XPKA 4J3GA 2B5GB 2FS5A 5KTCA 1IYKA 1YVKA 4QBJA 4XNHB 4KVXA 1I1DA 2VZZA 2R1IA 2H5MA 1BO4A 1M1DA 2JEVA 2JDDA 3FIXA 2REFA 2FIWA 5EBVA 2FE7A 1RO5A 2OU2A 3TO9A 4BMHA 2OH1A 2B4DB 5H86A 1MK4A 4H6ZA 4AG7A 4MJ8A 3DDDA 2K5TA 3BJ8A 3GKRA 3C26A 1L0CA 2ARHA 2X7BA 2Q4YA 3S6KA 4CAXA 4R87A 4R3KA 5H84A 2WPWA 4I49A 1YK3A 1RXTA 2ZXVA 3TOBA 5JQ4A 2Q7BA 1QSRA 1N71A 3F5BA 3ZZIA 3RYOA 4F6AA 1GHEA 4FD7A 1NSLA 2Z10A 1CJWA 2OZUA 3CXPA 2IL4A 4KUBA 1QSMA 3FRMA 2D4PA 3QAHA 2OZHA 1S7LA 2GIVA 2I00A 2Q0YA 4KUAA 1MJBA 4UWJA 1VHSA 4HKFA 4R57A 4PSXA 4KOUA 2G3AA 2QMLA 2B5GA 5F46A 4IF5A 1CM0A 3NE7A 3R95A 1I12A 4OADA 2ZW6A 1QSNA 1XE4A 5I0CA 3I9SA 2RC4A 1XIXA 5IV0A 3FXTA 3R9GA 4CS0B 2Q44A 3T9YA 5DWMA 4AVCA 1IIDA 1M44A 4QB9A 3W6XA 4XPDB 1Z4RA 4DNCA 2B4DA 2Z0ZA 3QB8A 2HQYA 2FXFA 2FT0A 1KUXA 1S7KA 1Z4EA 2R8VA 3EC4A 4EVYA 3GYAA 5HMNA 3JVNA 3D8PA 4QVTA 1QSOA 2WPXA 4FD5A 4IUSA 4KZTA 3MGDA 3S6FA 4B5PB 1FY7A 1IICA 2PC1A 2AJ6A 1S7NA 3SHPA 3EY5A 3P2FA 5EC4A 2GANA 3I3GA 2P6EA 2VZYA 3TCVA 5C82A 1M4GA 4FD6A 1QSTA 2ATRA 1YREA 3JUWA 1XEBA 3SXOA 4KOXA 4XNHC 4E2AA 1MJAA 2ZW7A 4QUSA 2PSWA 2VEZA 2R98A 3VWDA 2BSWA 4NXYA 3VWEA 1KUYA 4HNWB 3EO4A 4KOYA 1OZPA 5E96A 2PRBA 4KLVA 1U6MA 3S6HA 2CNSA 4KVME 1XF8A 3BJ7A 1S3ZA 4NCZA 3TO6A 3FB3A 3PZJA 3PGPA 5IB0A 1NE9A 2J8NA 1IYLA 4PK3A 3SXNA 5DWNA 2ZW5A 3K9UA 4QC6A 2OZGA 2R7HA 2BUEA 3E0KA 4CRZB 4H6UA 1YX0A 4GS4A 4KOWA 4CAVA 3D2MA 2JDCA 1YR0A 2Q4VA 1VKCA 4Y49B 4UA3A 1BOBA 1KUVA 1WK4A 3IWGA 3D2PA 5F48A 2AE6A 4JXQA 3G8WA 5KTAA 2CY2A 3KKWA 3TO7A 4B5PA 3T90A 4U9YA 2VI7A 5CNPA 2J8MA 3B8GA 3G3SA 3R96A 2O28A 2D4OA 4JJXA 1SQHA 4U9ZA 1PU9A 3PP9A 2P6FA 3D3SA 1R57A 4L89A 4X5KA 3FBUA 2B4BA 4MHDA 5C88A 1YVOA 3S6GA 2F5IA 4AG9A 2CNTA 3UY5A 2FIAA 3BLNA 3EXNA 4JD6A 4JLYA 3R9EA 2BEIA 2DXQA 2FSRA 2ZPAA 2PQ8A 5IX3A 1P4NA 3CXQA 4NSQA 2VXKA 4HNXB 2P0WA 1S60A 2PDOA 1WWZA 1B87A 5FVJA 2G0BA 4PV6A 4R3LA 3DR6A 4ZBGA 4KOVA 4MY3A 4AVBA 2QECA 4PSWA 4XPDC 4U5YA 1M4DA 3P2HA 4F0YA 4UBRA 2B3UA 3DNSA 5ISVA 3FYNA 3FNCA 1Z9UA 3DSBA 4KLWA 2JLMA 4ONUA 4KVOE 1B6BA 3LODA 1J4JA 2REEA 4KOSA 3W91A 4K30A 4M3SA 2KCWA 5J8FA 3CXSA 5JPHA 2Q04A 2ZW4A 4E0AA 3TT2A 1TIQA 1YLEA 4L8AA 2PR8A 3F0AA 4LUAA 3TOAA 4JXRA 4R9MA 3GY9A 4MY0A 3EFAA 2OB0A 2P6GA 4HNYB 3WR7A 4B5OA 1ON0A 1Y7RA 4M85A 4KOTA 3IGRA 4AB7A 2PR1A 4NF1A 1Y9KA 1KZFA 4UWIA 4PK2A 2HV2A 1PUAA 1M4IA 4OLLA 3LD2A 2GE3A 4NEXA 3V8IA 1NMTA 2EUIA 1K4JA 4H89A 3R1KA 2HUZA 1Q2DA 1V0CA 4KORA 5KTDA 2B3VA 5F47A 2Y0MA 2FCKA 4AVAA 2CNMA 2EVNA 3W6SA 2QIRA 1Q2YA 1MJ9A 1Q2CA 2NMTA 4YFJA 1P0HA 1S5KA 1YGHA 4MBUA 1I21A 4II9A 2FL4A 4CAWA 4Y49C 4CRYB 2A4NA 2BL1A 4RI1A 2VQYA 3F8KA 2I79A 5J8CA 4E8OA 1UFHA 3TE4A 1LRZA 4FD4A 3N7ZA 2G3TA
chains in the Genus database with same CATH superfamily
2C27A 3KZWA 5F49A 4RS2A 1S7FA 4LX9A 3KGQA 3OWCA 3FX6A 3ISXA 1YW4A 1AYEA 1Y9WA 3PBBA 4R8FA 1ELMP 1LOKA 1YSJA 4JWPA 4MI4A 4YRHA 5GCNA 4OAEA 4FUUA 2XEGA 2DPSA 3IC1A 1XMTA 4MFZA 5JGFA 3H4QA 4UEFA 2EK8A 2YNDA 3TTHA 4A2ZA 1M4LA 4OC2A 4UCNA 4XPLA 3TFYA 2VBQA 2J8RA 3DR8A 4ORFA 1IB1E 4YGOA 3R9FA 2B58A 2Z11A 5HH1A 2Z3MA 4XPKA 4J3GA 2B5GB 2FS5A 5AGEA 3DLJA 5LRGA 3ZJ0A 5KTCA 1IYKA 1YVKA 4QBJA 2XEFA 2PJ0A 3V38A 1HDQA 4XNHB 4IHMA 4KVXA 2JBKA 4NGTA 1I1DA 2GLJA 1CX8A 2VZZA 2DEAA 3IEHA 4LQGA 4Q7AA 2R1IA 2H5MA 3GUXA 4CGNA 1BO4A 1M1DA 2JEVA 2JDDA 3FIXA 4H2KA 2REFA 2FIWA 3K2KA 4ZY2A 4CPAA 5LYIA 5EBVA 4CGLA 5HVHA 2FE7A 1Y7EA 2JEWA 1RO5A 2OU2A 3TO9A 2PJ9A 1UWYA 2I3CA 4BMHA 2YNEA 3KI9A 4YU9A 1QQ9A 2OH1A 2B4DB 4OC0A 4WJBA 2YNCC 1MK4A 5H86A 3SJXA 4H6ZA 1ARLA 4AG7A 4A30A 3D7FA 4MJ8A 1XFOA 4P4JA 4ZX9A 1Y0YA 3QAYA 3DDDA 5HXDA 2AFUA 1CP6A 2DPTA 4P4IA 2K5TA 3BJ8A 3GKRA 3C26A 2Z3KA 4P10A 1L0CA 2ARHA 2X7BA 5K8NA 4BD9A 2Q4YA 3S6KA 4CAXA 4R87A 1ZG9A 4R3KA 3QNVA 4DUKA 1TKFA 2WPWA 5H84A 4I49A 5A28A 2IJZA 2AFMA 3CPAA 4CYQA 3GIUA 1YK3A 1RXTA 2ZXVA 4OC1A 3TOBA 1BPNA 1X12A 4PQAA 5JQ4A 2Q7BA 1QSRA 1N71A 2GFQA 3F5BA 3ZZIA 3RYOA 4F6AA 4ZY0A 1GHEA 4C68A 3PBEA 4MFKA 3BI0A 5F09A 4FD7A 1NSLA 3V7ZA 1ZG7A 4ZX8A 4WWVA 4P4DA 2Z10A 4F9UA 1CJWA 2OZUA 3CXPA 2CIJA 4OC4A 4C7IA 2XEJA 2ZOGA 4CYPA 5DS0A 5AG4A 3LACA 4MFPA 2IL4A 4KUBA 4OMEA 3S9MA 1QSMA 4F8ZA 3FRMA 2D4PA 3QAHA 5AG5A 2NSMA 1Z5RA 2OZHA 2ZELA 4A33A 3I1UA 3H8GA 1S7LA 2GIVA 2I00A 4B14A 3KHXA 4FAIA 3D4UA 4CAFA 2Q0YA 4ONWA 4KUAA 3IIBA 1MJBA 2XEIA 3BXMA 2PE3A 1F2OA 1TKHA 5LYFA 1VHOA 2PCUA 1VHSA 1OBRA 2ABZA 3NH5A 4NGMA 4UWJA 3MRUA 4HKFA 4R57A 4PSXA 4KOUA 1VGYA 2G3AA 2QMLA 2YNCA 2B5GA 5F46A 3JTKA 4IF5A 1QMUA 1CM0A 3NE7A 3R95A 1I12A 4TWEA 2AFZA 4OADA 4UIAA 1Y0RA 2ZW6A 4K3NA 2EBJA 1QSNA 1XE4A 5I0CA 1ZLIA 2J9AA 2RC4A 3I9SA 1ZLHA 1XIXA 5IV0A 3FXTA 3TC8A 3R9GA 4CS0B 2Q44A 4BINA 4EWTA 3T9YA 5DWMA 1YLOA 4PXBA 4AVCA 1Z8XA 4R6TA 1IIDA 4KSIA 4UCPA 1M44A 2V8HA 4QB9A 3W6XA 3IU1A 4XPDB 1Z4RA 4MCSA 4B13A 4DNCA 2B4DA 4F9VA 2Z0ZA 3QB8A 2HQYA 4ZI6A 2FXFA 2FT0A 1KUXA 1S7KA 3FJUA 2F7VA 4P45A 1Z4EA 2PIYA 1PCAA 2R8VA 2V8GA 4X3RA 4CYNA 3NFZA 1HEEA 5LRJA 1FT7A 3EC4A 2PJ7A 4R7MA 3GYAA 4EVYA 5HMNA 3JVNA 2IMOA 3GLJA 2EWBA 2WZNA 3D8PA 4UFVA 4A95A 4QVTA 1QSOA 2WPXA 4FD5A 1TF9A 1CPSA 3B3CA 3LMSA 4IUSA 3PB6X 3MGDA 4KZTA 3S6FA 4B5PB 4HPSA 1FY7A 4UEEA 2ODFA 5CBMA 1IICA 2CF4A 2Q7SA 2BCOA 2AJ6A 2PC1A 4BBHA 1S7NA 2IQ6A 2PJCA 1F57A 1LAPA 3D66A 4UEZA 3SI1A 1R43A 3IO1A 1KWMA 3KR4A 3K9TA 3EY5A 3SHPA 3D68A 3P2FA 5JH9A 5I4MA 4MCPA 5EC4A 4CAEA 2GANA 3I3GA 2P6EA 2VZYA 3TCVA 1XRYA 5C82A 1M4GA 4FD6A 3NE8A 2ZEMA 1QSTA 2ATRA 5D8NA 1ARMA 1YREA 3JUWA 1IGBA 4YWYA 1XEBA 2Z3LA 3KASA 1NSAA 2PJ8A 4KOXA 4MRIA 3SXOA 4A32A 4EMEA 4XNHC 2BOAA 2NYQA 4E2AA 1DTDA 1MJAA 2ZW7A 4QUSA 2PSWA 2VEZA 2R98A 3KHZA 2HC9A 3VWDA 4ZYQA 2BSWA 4NXYA 3RAMA 1LANA 3CDXA 1Z8TA 3VWEA 3CT9A 1KUYA 4GM5A 2PJ6A 5G20A 4C2ZA 4HNWB 3EO4A 4KOYA 1OZPA 3IJ3A 4MFLA 5E96A 2PRBA 4KLVA 4KS9A 1U6MA 3S6HA 2CNSA 3FEEA 4KVME 1XF8A 4OC5A 1ZO0A 5BWAB 3T8WA 1S3ZA 3BJ7A 4NCZA 3TO6A 3VH9A 1AUGA 3FB3A 3PZJA 3PGPA 1CG2A 3D67A 3H8EA 7CPAA 5IB0A 1NE9A 4UFXA 3A9LA 2J8NA 4RN7A 1IYLA 3IWEA 2PJBA 4FWUA 4PK3A 3SXNA 3PB9X 4P4BA 4Z65A 1XMBA 5D29A 4B10A 4B11A 5DWNA 3FMCA 1LAMA 4A37A 3B3TA 3SJGA 4MHZA 2CXAA 2PVVA 3L2NA 3FVLA 3CZXA 2ZW5A 4GXHA 3BHXA 2ZEHA 4PXDA 4G1PA 4W9YA 3K9UA 4QC6A 1YQEA 2OZGA 2R7HA 2BUEA 3E0KA 4NFRA 4CRZB 2JBJA 4FBEA 4H6UA 4OKOA 1YX0A 3B3SA 4GS4A 4KOWA 3H8FA 1X10A 4P4FA 4PXEA 4MCQA 4A31A 4CAVA 5ELYA 4CGMA 3D2MA 2JDCA 4B6ZA 2DF5A 2Z3NA 1YR0A 2Q4VA 1VKCA 4P44A 3FECA 4Y49B 4UA3A 1BOBA 2VL1A 1KUVA 5IB9A 2ZEFA 1WK4A 2CTBA 3D2PA 3IWGA 5F48A 2AE6A 4JXQA 4Q36A 3G8WA 3VATA 5KTAA 2CY2A 3KKWA 3TO7A 3B2YA 4NGQA 4O23A 3FEDA 3IU2A 4B5PA 1Z8WA 1R3NA 2O4HA 2VI7A 4U9YA 1CP7A 5CNPA 3T90A 5EMIA 2J8MA 3B8GA 3G3SA 2AFOA 4PPZA 5K8OA 3R96A 2O28A 2D4OA 4JJXA 1SQHA 2PJAA 4U9ZA 1PU9A 3PB7X 5LYDA 1ZG8A 3PP9A 2P6FA 2PRQA 1LCPA 1R57A 3D3SA 4L89A 4OIWA 2CTCA 4X5KA 3N5FA 3FBUA 2B4BA 4MHDA 5C88A 4A39A 1YVOA 4B12A 4A38A 3S6GA 2F5IA 4AG9A 2CNTA 2OOTA 1F2PA 3UY5A 2FIAA 3BLNA 1PYTB 4UCMA 3EXNA 4JD6A 2GU2A 4JLYA 3R9EA 2BEIA 2DXQA 1Z2LA 2FSRA 2PJ5A 2ZPAA 5G21A 2PQ8A 5IX3A 1P4NA 1RTQA 3KQXA 2ZEDA 4UFWA 3CXQA 2O53A 4NSQA 2VXKA 3NA6A 2FVGA 4HNXB 2P0WA 2C1CA 1S60A 2PDOA 4CYOA 1WWZA 3PEIA 5THWA 4UIBA 1B87A 1H8LA 3B7IA 5FVJA 2G0BA 4PV6A 1XBUA 4R3LA 3WC7A 3DR6A 4ZBGA 4KOVA 3SJEA 4MY3A 3ISZA 3RNZA 2F8HA 3VARA 2GLFA 4AVBA 3HUVA 1IY7A 2QECA 4PSWA 4KSFA 1BAVA 4U5YA 4XPDC 3RO0A 1M4DA 3P2HA 4F0YA 4UBRA 3NH8A 2Q43A 2B3UA 4OC3A 3DNSA 3FF3A 2ZEOA 4CGPA 5ISVA 2PJ2A 3FNCA 3FYNA 1Z9UA 3DSBA 2Z3OA 4NGPA 5HVFA 1ELLP 4KLWA 4LQ6A 3KR5A 3D7HA 4M6IA 4NJQA 1AMPA 3GB0A 4JZ0A 1CBXA 2C6GA 4NGRA 1JQGA 3D7GA 5LRKA 3PB8X 2JLMA 4ONUA 3PRTA 4KVOE 4OIDA 1LFWA 2ANPA 4MFJA 1B6BA 5G1ZA 5J1QA 4X8IA 3LODA 4MHNA 2ZEPA 1J4JA 2REEA 4KOSA 4ZY1A 2ZOFA 3SI0A 1TXRA 1XJOA 1YW6A 3W91A 4K30A 4EFDA 4DJLA 6CPAA 2AFWA 4M3SA 1DE4C 4NGNA 4RUHA 2KCWA 5J8FA 3CXSA 2RB7A 5JPHA 4C2XA 4CGOA 2Q04A 4NJRA 2ZW4A 3SI2A 4E0AA 4MMOA 3TT2A 3PFOA 4MHYA 1TIQA 5CPAA 4P4EA 1YLEA 4AXVA 1IOIA 4L8AA 3H5ZA 1FNOA 3NH4A 3TX8A 2QVPA 4C7HA 1Q7LA 3WT4A 2PR8A 3F0AA 4LUAA 4F0XA 1YMEA 2Z3PA 1IU8A 1TF8A 3TOAA 5HVGA 1BPMA 4JXRA 3RZAA 3BI1A 4DYOA 4X2TA 3B3WA 4R9MA 3GY9A 3DGVA 2EK9A 2Q4ZA 3KL9A 2RFHA 2C6PA 2PIZA 4MY0A 3EFAA 2OB0A 2P6GA 2C6CA 4HNYB 4MHPA 3WR7A 5JM6A 4P6YA 2V8DA 4IK2A 2GREA 2PJ1A 3MN8A 4B5OA 1ON0A 1Y7RA 2V8VA 3IFEA 4M85A 4NGSA 4KOTA 3IGRA 4Q38A 2PR1A 4AB7A 2EO8A 4NF1A 4ZGYB 3B3VA 1Y9KA 1KZFA 4UWIA 4PK2A 2WUUA 5AG6A 3JRUA 2HV2A 2PJ3A 1Z8LA 1PUAA 2YGWA 4MFQA 2QJ8A 3KQZA 3RBUA 1HDUA 3WC5A 1M4IA 2WSAA 1VHEA 2ZENA 3WC6A 4OLLA 4A94A 8CPAA 3LD2A 2GE3A 1VIXA 4KSAA 3PFEA 4NEXA 1CPXA 1NMTA 2EUIA 3V8IA 2PJ4A 1K4JA 5K8PA 2WYRA 1EE3P 4MCRA 3S9LA 4IAVA 4C2YA 4H89A 3R1KA 3IWWA 2HUZA 1Q2DA 2G9DA 4M6HA 3CPXA 3B35A 5LYLA 1V0CA 1BLLE 4KORA 5KTDA 2B3VA 2BO9A 3PB4X 1XOVA 2Y0MA 1TKJA 2FCKA 2QYVA 3LWUA 2CNMA 5F47A 3SJFA 4AVAA 4OP4A 2EVNA 3FH4A 4TNUA 3D7DA 2QIRA 4UF4A 3W6SA 1Q2YA 1MJ9A 1Q2CA 2NMTA 1JWQA 4YFJA 1P0HA 1S5KA 2PVWA 1YGHA 4MBUA 1I21A 4II9A 2POKA 2FL4A 2AFXA 4CAWA 4MXUA 4R76A 4Y49C 2A4NA 5G22A 2BL1A 4RI1A 2ZEGA 2VQYA 4CRYB 4JYWA 5K8MA 2V77A 3F8KA 2I79A 5J8CA 3WABA 4E8OA 4PXCA 4M6GA 2Q51A 3HLPA 1UFHA 5A27A 3S9NA 2AFSA 3TE4A 1LRZA 2OR4A 2ZEEA 1IOFA 4FD4A 2HB6A 3N7ZA 1A2ZA 1GYTA 2G3TA 5AG7A
chains in the Genus database with same CATH topology
2C27A 5F49A 4RS2A 1S7FA 4LX9A 3OWCA 1Y9WA 4JWPA 4MI4A 4YRHA 5GCNA 4OAEA 2DPSA 1XMTA 4MFZA 3H4QA 3TTHA 2YNDA 4A2ZA 4XPLA 4UCNA 3TFYA 2VBQA 2J8RA 3DR8A 4ORFA 1IB1E 4YGOA 3R9FA 2B58A 2Z11A 5HH1A 2Z3MA 4XPKA 4J3GA 2B5GB 2FS5A 5AGEA 3ZJ0A 5KTCA 1IYKA 1YVKA 4QBJA 4XNHB 4KVXA 1I1DA 2VZZA 2R1IA 2H5MA 4CGNA 1BO4A 1M1DA 2JEVA 2JDDA 3FIXA 2REFA 2FIWA 5EBVA 4CGLA 2FE7A 1RO5A 2OU2A 3TO9A 4BMHA 2YNEA 2OH1A 2B4DB 2YNCC 1MK4A 5H86A 4H6ZA 4AG7A 4A30A 4MJ8A 3DDDA 2DPTA 2K5TA 3BJ8A 3GKRA 3C26A 2Z3KA 1L0CA 2ARHA 2X7BA 2Q4YA 3S6KA 4CAXA 4R87A 4R3KA 5H84A 2WPWA 5A28A 4I49A 4CYQA 1YK3A 1RXTA 2ZXVA 3TOBA 5JQ4A 2Q7BA 1QSRA 1N71A 3F5BA 3ZZIA 3RYOA 4F6AA 1GHEA 4C68A 4MFKA 4FD7A 1NSLA 2Z10A 1CJWA 2OZUA 3CXPA 4C7IA 4CYPA 5AG4A 4MFPA 2IL4A 4KUBA 1QSMA 3FRMA 2D4PA 3QAHA 5AG5A 2OZHA 4A33A 1S7LA 2GIVA 2I00A 4B14A 4CAFA 2Q0YA 4KUAA 1MJBA 4UWJA 1VHSA 4HKFA 4R57A 4PSXA 4KOUA 2G3AA 2QMLA 2YNCA 2B5GA 5F46A 3JTKA 4IF5A 1CM0A 3NE7A 3R95A 1I12A 4OADA 2ZW6A 1QSNA 1XE4A 5I0CA 3I9SA 2RC4A 1XIXA 5IV0A 3FXTA 3R9GA 4CS0B 2Q44A 3T9YA 5DWMA 4AVCA 1IIDA 4UCPA 1M44A 4QB9A 3W6XA 3IU1A 4XPDB 1Z4RA 4B13A 4DNCA 2B4DA 2Z0ZA 3QB8A 2HQYA 2FXFA 2FT0A 1KUXA 1S7KA 1Z4EA 2R8VA 4CYNA 3EC4A 4EVYA 3GYAA 5HMNA 3JVNA 3D8PA 4UFVA 4QVTA 1QSOA 2WPXA 4FD5A 4IUSA 4KZTA 3MGDA 3S6FA 4B5PB 1FY7A 1IICA 2PC1A 2AJ6A 4BBHA 1S7NA 3SHPA 3EY5A 3P2FA 5EC4A 4CAEA 2GANA 3I3GA 2P6EA 2VZYA 3TCVA 5C82A 1M4GA 4FD6A 1QSTA 2ATRA 1YREA 3JUWA 1XEBA 2Z3LA 3SXOA 4KOXA 4A32A 4XNHC 4E2AA 1MJAA 2ZW7A 4QUSA 2PSWA 2VEZA 2R98A 3VWDA 2BSWA 4NXYA 3VWEA 1KUYA 5G20A 4C2ZA 4HNWB 3EO4A 4KOYA 1OZPA 4MFLA 5E96A 2PRBA 4KLVA 4KS9A 1U6MA 3S6HA 2CNSA 4KVME 1XF8A 1ZO0A 5BWAB 3BJ7A 1S3ZA 4NCZA 3TO6A 3FB3A 3PZJA 3PGPA 5IB0A 1NE9A 4UFXA 3A9LA 2J8NA 1IYLA 3IWEA 4PK3A 3SXNA 4B10A 4B11A 5DWNA 2CXAA 2ZW5A 3K9UA 4QC6A 3E0KA 2OZGA 2BUEA 2R7HA 4CRZB 4H6UA 1YX0A 4GS4A 4KOWA 4A31A 4CAVA 4CGMA 3D2MA 2JDCA 2Z3NA 1YR0A 2Q4VA 1VKCA 4Y49B 4UA3A 1BOBA 1KUVA 1WK4A 3IWGA 3D2PA 5F48A 2AE6A 4JXQA 4Q36A 3G8WA 5KTAA 2CY2A 3KKWA 3TO7A 3IU2A 4B5PA 3T90A 4U9YA 2VI7A 5CNPA 2J8MA 3B8GA 3G3SA 3R96A 2O28A 2D4OA 4JJXA 1SQHA 4U9ZA 4A95A 1PU9A 3PP9A 2P6FA 3D3SA 1R57A 4L89A 4X5KA 3FBUA 2B4BA 4MHDA 5C88A 1YVOA 4B12A 3S6GA 2F5IA 4AG9A 2CNTA 3UY5A 2FIAA 3BLNA 4UCMA 3EXNA 4JD6A 4JLYA 3R9EA 2BEIA 2DXQA 2FSRA 2ZPAA 5G21A 2PQ8A 5IX3A 1P4NA 4UFWA 3CXQA 4NSQA 2VXKA 4HNXB 2P0WA 1S60A 2PDOA 4CYOA 1WWZA 1B87A 5FVJA 2G0BA 4PV6A 4R3LA 3DR6A 4ZBGA 4KOVA 4MY3A 4AVBA 2QECA 4PSWA 4KSFA 4XPDC 4U5YA 1M4DA 3P2HA 4F0YA 4UBRA 2B3UA 3DNSA 4CGPA 5ISVA 3FYNA 3FNCA 1Z9UA 3DSBA 2Z3OA 4KLWA 2JLMA 4ONUA 4KVOE 4MFJA 1B6BA 5G1ZA 3LODA 1J4JA 2REEA 4KOSA 3W91A 4K30A 4M3SA 2KCWA 5J8FA 3CXSA 5JPHA 4C2XA 4CGOA 2Q04A 2ZW4A 4E0AA 3TT2A 1TIQA 1YLEA 4L8AA 3H5ZA 4C7HA 2PR8A 3F0AA 4LUAA 4F0XA 2Z3PA 3TOAA 4JXRA 4R9MA 3GY9A 4MY0A 3EFAA 2OB0A 2P6GA 4HNYB 3WR7A 4B5OA 1ON0A 1Y7RA 4M85A 4KOTA 3IGRA 4Q38A 2PR1A 4AB7A 4NF1A 4ZGYB 1Y9KA 1KZFA 4UWIA 4PK2A 2WUUA 5AG6A 2HV2A 2YGWA 1PUAA 4MFQA 1M4IA 2WSAA 4OLLA 3LD2A 2GE3A 4KSAA 4NEXA 3V8IA 1NMTA 2EUIA 1K4JA 4C2YA 4H89A 3R1KA 2HUZA 1Q2DA 1V0CA 4KORA 5KTDA 2B3VA 5F47A 2Y0MA 2FCKA 4AVAA 2CNMA 2EVNA 3W6SA 2QIRA 1Q2YA 1MJ9A 1Q2CA 2NMTA 4YFJA 1P0HA 1S5KA 1YGHA 4MBUA 1I21A 4II9A 2FL4A 4CAWA 4Y49C 5G22A 4CRYB 2A4NA 2BL1A 4RI1A 2VQYA 3F8KA 2I79A 5J8CA 4E8OA 1UFHA 5A27A 3TE4A 1LRZA 4FD4A 3N7ZA 2G3TA 5AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C27 A;  5F49 A;  4RS2 A;  1S7F A;  4LX9 A;  3OWC A;  1Y9W A;  4JWP A;  4MI4 A;  4YRH A;  5GCN A;  4OAE A;  1XMT A;  3H4Q A;  3TTH A;  4XPL A;  3TFY A;  2VBQ A;  2J8R A;  3DR8 A;  4ORF A;  1IB1 E;  4YGO A;  3R9F A;  2B58 A;  2Z11 A;  5HH1 A;  3ZJ0 A;  4XPK A;  4J3G A;  2B5G B;  2FS5 A;  5KTC A;  1IYK A;  1YVK A;  4QBJ A;  4XNH B;  4KVX A;  1I1D A;  2VZZ A;  2R1I A;  2H5M A;  1BO4 A;  1M1D A;  2JEV A;  2JDD A;  3FIX A;  2REF A;  2FIW A;  5EBV A;  2FE7 A;  1RO5 A;  2OU2 A;  3TO9 A;  4BMH A;  2OH1 A;  2B4D B;  5H86 A;  1MK4 A;  4H6Z A;  4AG7 A;  4MJ8 A;  3DDD A;  2K5T A;  3BJ8 A;  3GKR A;  3C26 A;  1L0C A;  2ARH A;  2X7B A;  2Q4Y A;  3S6K A;  4CAX A;  4R87 A;  4R3K A;  5H84 A;  2WPW A;  4I49 A;  1YK3 A;  1RXT A;  2ZXV A;  3TOB A;  5JQ4 A;  2Q7B A;  1QSR A;  1N71 A;  3F5B A;  3ZZI A;  3RYO A;  4F6A A;  1GHE A;  4FD7 A;  1NSL A;  2Z10 A;  1CJW A;  2OZU A;  3CXP A;  2IL4 A;  4KUB A;  1QSM A;  3FRM A;  2D4P A;  3QAH A;  2OZH A;  1S7L A;  2GIV A;  2I00 A;  2Q0Y A;  4KUA A;  1MJB A;  4UWJ A;  1VHS A;  4HKF A;  4R57 A;  4PSX A;  4KOU A;  2G3A A;  2QML A;  2B5G A;  5F46 A;  4IF5 A;  1CM0 A;  3NE7 A;  3R95 A;  1I12 A;  4OAD A;  2ZW6 A;  1QSN A;  1XE4 A;  5I0C A;  3I9S A;  2RC4 A;  1XIX A;  5IV0 A;  3FXT A;  3R9G A;  4CS0 B;  2Q44 A;  3T9Y A;  5DWM A;  4AVC A;  1IID A;  1M44 A;  4QB9 A;  3W6X A;  4XPD B;  1Z4R A;  4DNC A;  2B4D A;  2Z0Z A;  3QB8 A;  2HQY A;  2FXF A;  2FT0 A;  1KUX A;  1S7K A;  1Z4E A;  2R8V A;  3EC4 A;  4EVY A;  3GYA A;  5HMN A;  3JVN A;  3D8P A;  4QVT A;  1QSO A;  2WPX A;  4FD5 A;  4IUS A;  4KZT A;  3MGD A;  3S6F A;  4B5P B;  1FY7 A;  1IIC A;  2PC1 A;  2AJ6 A;  1S7N A;  3SHP A;  3EY5 A;  3P2F A;  5EC4 A;  2GAN A;  3I3G A;  2P6E A;  2VZY A;  3TCV A;  5C82 A;  1M4G A;  4FD6 A;  1QST A;  2ATR A;  1YRE A;  3JUW A;  1XEB A;  3SXO A;  4KOX A;  4XNH C;  4E2A A;  1MJA A;  2ZW7 A;  4QUS A;  2PSW A;  2VEZ A;  2R98 A;  3VWD A;  2BSW A;  4NXY A;  3VWE A;  1KUY A;  4HNW B;  3EO4 A;  4KOY A;  1OZP A;  5E96 A;  2PRB A;  4KLV A;  1U6M A;  3S6H A;  2CNS A;  4KVM E;  1XF8 A;  3BJ7 A;  1S3Z A;  4NCZ A;  3TO6 A;  3FB3 A;  3PZJ A;  3PGP A;  5IB0 A;  1NE9 A;  2J8N A;  1IYL A;  4PK3 A;  3SXN A;  5DWN A;  2ZW5 A;  3K9U A;  4QC6 A;  2OZG A;  2R7H A;  2BUE A;  3E0K A;  4CRZ B;  4H6U A;  1YX0 A;  4GS4 A;  4KOW A;  4CAV A;  3D2M A;  2JDC A;  1YR0 A;  2Q4V A;  1VKC A;  4Y49 B;  4UA3 A;  1BOB A;  1KUV A;  1WK4 A;  3IWG A;  3D2P A;  5F48 A;  2AE6 A;  4JXQ A;  3G8W A;  5KTA A;  2CY2 A;  3KKW A;  3TO7 A;  4B5P A;  3T90 A;  4U9Y A;  2VI7 A;  5CNP A;  2J8M A;  3B8G A;  3G3S A;  3R96 A;  2O28 A;  2D4O A;  4JJX A;  1SQH A;  4U9Z A;  1PU9 A;  3PP9 A;  2P6F A;  3D3S A;  1R57 A;  4L89 A;  4X5K A;  3FBU A;  2B4B A;  4MHD A;  5C88 A;  1YVO A;  3S6G A;  2F5I A;  4AG9 A;  2CNT A;  3UY5 A;  2FIA A;  3BLN A;  3EXN A;  4JD6 A;  4JLY A;  3R9E A;  2BEI A;  2DXQ A;  2FSR A;  2ZPA A;  2PQ8 A;  5IX3 A;  1P4N A;  3CXQ A;  4NSQ A;  2VXK A;  4HNX B;  2P0W A;  1S60 A;  2PDO A;  1WWZ A;  1B87 A;  5FVJ A;  2G0B A;  4PV6 A;  4R3L A;  3DR6 A;  4ZBG A;  4KOV A;  4MY3 A;  4AVB A;  2QEC A;  4PSW A;  4XPD C;  4U5Y A;  1M4D A;  3P2H A;  4F0Y A;  4UBR A;  2B3U A;  3DNS A;  5ISV A;  3FYN A;  3FNC A;  1Z9U A;  3DSB A;  4KLW A;  2JLM A;  4ONU A;  4KVO E;  1B6B A;  3LOD A;  1J4J A;  2REE A;  4KOS A;  3W91 A;  4K30 A;  4M3S A;  2KCW A;  5J8F A;  3CXS A;  5JPH A;  2Q04 A;  2ZW4 A;  4E0A A;  3TT2 A;  1TIQ A;  1YLE A;  4L8A A;  2PR8 A;  3F0A A;  4LUA A;  3TOA A;  4JXR A;  4R9M A;  3GY9 A;  4MY0 A;  3EFA A;  2OB0 A;  2P6G A;  4HNY B;  3WR7 A;  4B5O A;  1ON0 A;  1Y7R A;  4M85 A;  4KOT A;  3IGR A;  4AB7 A;  2PR1 A;  4NF1 A;  1Y9K A;  1KZF A;  4UWI A;  4PK2 A;  2HV2 A;  1PUA A;  1M4I A;  4OLL A;  3LD2 A;  2GE3 A;  4NEX A;  3V8I A;  1NMT A;  2EUI A;  1K4J A;  4H89 A;  3R1K A;  2HUZ A;  1Q2D A;  1V0C A;  4KOR A;  5KTD A;  2B3V A;  5F47 A;  2Y0M A;  2FCK A;  4AVA A;  2CNM A;  2EVN A;  3W6S A;  2QIR A;  1Q2Y A;  1MJ9 A;  1Q2C A;  2NMT A;  4YFJ A;  1P0H A;  1S5K A;  1YGH A;  4MBU A;  1I21 A;  4II9 A;  2FL4 A;  4CAW A;  4Y49 C;  4CRY B;  2A4N A;  2BL1 A;  4RI1 A;  2VQY A;  3F8K A;  2I79 A;  5J8C A;  4E8O A;  1UFH A;  3TE4 A;  1LRZ A;  4FD4 A;  3N7Z A;  2G3T A; 
#chains in the Genus database with same CATH topology
 2C27 A;  3KZW A;  5F49 A;  4RS2 A;  1S7F A;  4LX9 A;  3KGQ A;  3OWC A;  3FX6 A;  3ISX A;  1YW4 A;  1AYE A;  1Y9W A;  3PBB A;  4R8F A;  1ELM P;  1LOK A;  1YSJ A;  4JWP A;  4MI4 A;  4YRH A;  5GCN A;  4OAE A;  4FUU A;  2XEG A;  2DPS A;  3IC1 A;  1XMT A;  4MFZ A;  5JGF A;  3H4Q A;  4UEF A;  2EK8 A;  2YND A;  3TTH A;  4A2Z A;  1M4L A;  4OC2 A;  4UCN A;  4XPL A;  3TFY A;  2VBQ A;  2J8R A;  3DR8 A;  4ORF A;  1IB1 E;  4YGO A;  3R9F A;  2B58 A;  2Z11 A;  5HH1 A;  2Z3M A;  4XPK A;  4J3G A;  2B5G B;  2FS5 A;  5AGE A;  3DLJ A;  5LRG A;  3ZJ0 A;  5KTC A;  1IYK A;  1YVK A;  4QBJ A;  2XEF A;  2PJ0 A;  3V38 A;  1HDQ A;  4XNH B;  4IHM A;  4KVX A;  2JBK A;  4NGT A;  1I1D A;  2GLJ A;  1CX8 A;  2VZZ A;  2DEA A;  3IEH A;  4LQG A;  4Q7A A;  2R1I A;  2H5M A;  3GUX A;  4CGN A;  1BO4 A;  1M1D A;  2JEV A;  2JDD A;  3FIX A;  4H2K A;  2REF A;  2FIW A;  3K2K A;  4ZY2 A;  4CPA A;  5LYI A;  5EBV A;  4CGL A;  5HVH A;  2FE7 A;  1Y7E A;  2JEW A;  1RO5 A;  2OU2 A;  3TO9 A;  2PJ9 A;  1UWY A;  2I3C A;  4BMH A;  2YNE A;  3KI9 A;  4YU9 A;  1QQ9 A;  2OH1 A;  2B4D B;  4OC0 A;  4WJB A;  2YNC C;  1MK4 A;  5H86 A;  3SJX A;  4H6Z A;  1ARL A;  4AG7 A;  4A30 A;  3D7F A;  4MJ8 A;  1XFO A;  4P4J A;  4ZX9 A;  1Y0Y A;  3QAY A;  3DDD A;  5HXD A;  2AFU A;  1CP6 A;  2DPT A;  4P4I A;  2K5T A;  3BJ8 A;  3GKR A;  3C26 A;  2Z3K A;  4P10 A;  1L0C A;  2ARH A;  2X7B A;  5K8N A;  4BD9 A;  2Q4Y A;  3S6K A;  4CAX A;  4R87 A;  1ZG9 A;  4R3K A;  3QNV A;  4DUK A;  1TKF A;  2WPW A;  5H84 A;  4I49 A;  5A28 A;  2IJZ A;  2AFM A;  3CPA A;  4CYQ A;  3GIU A;  1YK3 A;  1RXT A;  2ZXV A;  4OC1 A;  3TOB A;  1BPN A;  1X12 A;  4PQA A;  5JQ4 A;  2Q7B A;  1QSR A;  1N71 A;  2GFQ A;  3F5B A;  3ZZI A;  3RYO A;  4F6A A;  4ZY0 A;  1GHE A;  4C68 A;  3PBE A;  4MFK A;  3BI0 A;  5F09 A;  4FD7 A;  1NSL A;  3V7Z A;  1ZG7 A;  4ZX8 A;  4WWV A;  4P4D A;  2Z10 A;  4F9U A;  1CJW A;  2OZU A;  3CXP A;  2CIJ A;  4OC4 A;  4C7I A;  2XEJ A;  2ZOG A;  4CYP A;  5DS0 A;  5AG4 A;  3LAC A;  4MFP A;  2IL4 A;  4KUB A;  4OME A;  3S9M A;  1QSM A;  4F8Z A;  3FRM A;  2D4P A;  3QAH A;  5AG5 A;  2NSM A;  1Z5R A;  2OZH A;  2ZEL A;  4A33 A;  3I1U A;  3H8G A;  1S7L A;  2GIV A;  2I00 A;  4B14 A;  3KHX A;  4FAI A;  3D4U A;  4CAF A;  2Q0Y A;  4ONW A;  4KUA A;  3IIB A;  1MJB A;  2XEI A;  3BXM A;  2PE3 A;  1F2O A;  1TKH A;  5LYF A;  1VHO A;  2PCU A;  1VHS A;  1OBR A;  2ABZ A;  3NH5 A;  4NGM A;  4UWJ A;  3MRU A;  4HKF A;  4R57 A;  4PSX A;  4KOU A;  1VGY A;  2G3A A;  2QML A;  2YNC A;  2B5G A;  5F46 A;  3JTK A;  4IF5 A;  1QMU A;  1CM0 A;  3NE7 A;  3R95 A;  1I12 A;  4TWE A;  2AFZ A;  4OAD A;  4UIA A;  1Y0R A;  2ZW6 A;  4K3N A;  2EBJ A;  1QSN A;  1XE4 A;  5I0C A;  1ZLI A;  2J9A A;  2RC4 A;  3I9S A;  1ZLH A;  1XIX A;  5IV0 A;  3FXT A;  3TC8 A;  3R9G A;  4CS0 B;  2Q44 A;  4BIN A;  4EWT A;  3T9Y A;  5DWM A;  1YLO A;  4PXB A;  4AVC A;  1Z8X A;  4R6T A;  1IID A;  4KSI A;  4UCP A;  1M44 A;  2V8H A;  4QB9 A;  3W6X A;  3IU1 A;  4XPD B;  1Z4R A;  4MCS A;  4B13 A;  4DNC A;  2B4D A;  4F9V A;  2Z0Z A;  3QB8 A;  2HQY A;  4ZI6 A;  2FXF A;  2FT0 A;  1KUX A;  1S7K A;  3FJU A;  2F7V A;  4P45 A;  1Z4E A;  2PIY A;  1PCA A;  2R8V A;  2V8G A;  4X3R A;  4CYN A;  3NFZ A;  1HEE A;  5LRJ A;  1FT7 A;  3EC4 A;  2PJ7 A;  4R7M A;  3GYA A;  4EVY A;  5HMN A;  3JVN A;  2IMO A;  3GLJ A;  2EWB A;  2WZN A;  3D8P A;  4UFV A;  4A95 A;  4QVT A;  1QSO A;  2WPX A;  4FD5 A;  1TF9 A;  1CPS A;  3B3C A;  3LMS A;  4IUS A;  3PB6 X;  3MGD A;  4KZT A;  3S6F A;  4B5P B;  4HPS A;  1FY7 A;  4UEE A;  2ODF A;  5CBM A;  1IIC A;  2CF4 A;  2Q7S A;  2BCO A;  2AJ6 A;  2PC1 A;  4BBH A;  1S7N A;  2IQ6 A;  2PJC A;  1F57 A;  1LAP A;  3D66 A;  4UEZ A;  3SI1 A;  1R43 A;  3IO1 A;  1KWM A;  3KR4 A;  3K9T A;  3EY5 A;  3SHP A;  3D68 A;  3P2F A;  5JH9 A;  5I4M A;  4MCP A;  5EC4 A;  4CAE A;  2GAN A;  3I3G A;  2P6E A;  2VZY A;  3TCV A;  1XRY A;  5C82 A;  1M4G A;  4FD6 A;  3NE8 A;  2ZEM A;  1QST A;  2ATR A;  5D8N A;  1ARM A;  1YRE A;  3JUW A;  1IGB A;  4YWY A;  1XEB A;  2Z3L A;  3KAS A;  1NSA A;  2PJ8 A;  4KOX A;  4MRI A;  3SXO A;  4A32 A;  4EME A;  4XNH C;  2BOA A;  2NYQ A;  4E2A A;  1DTD A;  1MJA A;  2ZW7 A;  4QUS A;  2PSW A;  2VEZ A;  2R98 A;  3KHZ A;  2HC9 A;  3VWD A;  4ZYQ A;  2BSW A;  4NXY A;  3RAM A;  1LAN A;  3CDX A;  1Z8T A;  3VWE A;  3CT9 A;  1KUY A;  4GM5 A;  2PJ6 A;  5G20 A;  4C2Z A;  4HNW B;  3EO4 A;  4KOY A;  1OZP A;  3IJ3 A;  4MFL A;  5E96 A;  2PRB A;  4KLV A;  4KS9 A;  1U6M A;  3S6H A;  2CNS A;  3FEE A;  4KVM E;  1XF8 A;  4OC5 A;  1ZO0 A;  5BWA B;  3T8W A;  1S3Z A;  3BJ7 A;  4NCZ A;  3TO6 A;  3VH9 A;  1AUG A;  3FB3 A;  3PZJ A;  3PGP A;  1CG2 A;  3D67 A;  3H8E A;  7CPA A;  5IB0 A;  1NE9 A;  4UFX A;  3A9L A;  2J8N A;  4RN7 A;  1IYL A;  3IWE A;  2PJB A;  4FWU A;  4PK3 A;  3SXN A;  3PB9 X;  4P4B A;  4Z65 A;  1XMB A;  5D29 A;  4B10 A;  4B11 A;  5DWN A;  3FMC A;  1LAM A;  4A37 A;  3B3T A;  3SJG A;  4MHZ A;  2CXA A;  2PVV A;  3L2N A;  3FVL A;  3CZX A;  2ZW5 A;  4GXH A;  3BHX A;  2ZEH A;  4PXD A;  4G1P A;  4W9Y A;  3K9U A;  4QC6 A;  1YQE A;  2OZG A;  2R7H A;  2BUE A;  3E0K A;  4NFR A;  4CRZ B;  2JBJ A;  4FBE A;  4H6U A;  4OKO A;  1YX0 A;  3B3S A;  4GS4 A;  4KOW A;  3H8F A;  1X10 A;  4P4F A;  4PXE A;  4MCQ A;  4A31 A;  4CAV A;  5ELY A;  4CGM A;  3D2M A;  2JDC A;  4B6Z A;  2DF5 A;  2Z3N A;  1YR0 A;  2Q4V A;  1VKC A;  4P44 A;  3FEC A;  4Y49 B;  4UA3 A;  1BOB A;  2VL1 A;  1KUV A;  5IB9 A;  2ZEF A;  1WK4 A;  2CTB A;  3D2P A;  3IWG A;  5F48 A;  2AE6 A;  4JXQ A;  4Q36 A;  3G8W A;  3VAT A;  5KTA A;  2CY2 A;  3KKW A;  3TO7 A;  3B2Y A;  4NGQ A;  4O23 A;  3FED A;  3IU2 A;  4B5P A;  1Z8W A;  1R3N A;  2O4H A;  2VI7 A;  4U9Y A;  1CP7 A;  5CNP A;  3T90 A;  5EMI A;  2J8M A;  3B8G A;  3G3S A;  2AFO A;  4PPZ A;  5K8O A;  3R96 A;  2O28 A;  2D4O A;  4JJX A;  1SQH A;  2PJA A;  4U9Z A;  1PU9 A;  3PB7 X;  5LYD A;  1ZG8 A;  3PP9 A;  2P6F A;  2PRQ A;  1LCP A;  1R57 A;  3D3S A;  4L89 A;  4OIW A;  2CTC A;  4X5K A;  3N5F A;  3FBU A;  2B4B A;  4MHD A;  5C88 A;  4A39 A;  1YVO A;  4B12 A;  4A38 A;  3S6G A;  2F5I A;  4AG9 A;  2CNT A;  2OOT A;  1F2P A;  3UY5 A;  2FIA A;  3BLN A;  1PYT B;  4UCM A;  3EXN A;  4JD6 A;  2GU2 A;  4JLY A;  3R9E A;  2BEI A;  2DXQ A;  1Z2L A;  2FSR A;  2PJ5 A;  2ZPA A;  5G21 A;  2PQ8 A;  5IX3 A;  1P4N A;  1RTQ A;  3KQX A;  2ZED A;  4UFW A;  3CXQ A;  2O53 A;  4NSQ A;  2VXK A;  3NA6 A;  2FVG A;  4HNX B;  2P0W A;  2C1C A;  1S60 A;  2PDO A;  4CYO A;  1WWZ A;  3PEI A;  5THW A;  4UIB A;  1B87 A;  1H8L A;  3B7I A;  5FVJ A;  2G0B A;  4PV6 A;  1XBU A;  4R3L A;  3WC7 A;  3DR6 A;  4ZBG A;  4KOV A;  3SJE A;  4MY3 A;  3ISZ A;  3RNZ A;  2F8H A;  3VAR A;  2GLF A;  4AVB A;  3HUV A;  1IY7 A;  2QEC A;  4PSW A;  4KSF A;  1BAV A;  4U5Y A;  4XPD C;  3RO0 A;  1M4D A;  3P2H A;  4F0Y A;  4UBR A;  3NH8 A;  2Q43 A;  2B3U A;  4OC3 A;  3DNS A;  3FF3 A;  2ZEO A;  4CGP A;  5ISV A;  2PJ2 A;  3FNC A;  3FYN A;  1Z9U A;  3DSB A;  2Z3O A;  4NGP A;  5HVF A;  1ELL P;  4KLW A;  4LQ6 A;  3KR5 A;  3D7H A;  4M6I A;  4NJQ A;  1AMP A;  3GB0 A;  4JZ0 A;  1CBX A;  2C6G A;  4NGR A;  1JQG A;  3D7G A;  5LRK A;  3PB8 X;  2JLM A;  4ONU A;  3PRT A;  4KVO E;  4OID A;  1LFW A;  2ANP A;  4MFJ A;  1B6B A;  5G1Z A;  5J1Q A;  4X8I A;  3LOD A;  4MHN A;  2ZEP A;  1J4J A;  2REE A;  4KOS A;  4ZY1 A;  2ZOF A;  3SI0 A;  1TXR A;  1XJO A;  1YW6 A;  3W91 A;  4K30 A;  4EFD A;  4DJL A;  6CPA A;  2AFW A;  4M3S A;  1DE4 C;  4NGN A;  4RUH A;  2KCW A;  5J8F A;  3CXS A;  2RB7 A;  5JPH A;  4C2X A;  4CGO A;  2Q04 A;  4NJR A;  2ZW4 A;  3SI2 A;  4E0A A;  4MMO A;  3TT2 A;  3PFO A;  4MHY A;  1TIQ A;  5CPA A;  4P4E A;  1YLE A;  4AXV A;  1IOI A;  4L8A A;  3H5Z A;  1FNO A;  3NH4 A;  3TX8 A;  2QVP A;  4C7H A;  1Q7L A;  3WT4 A;  2PR8 A;  3F0A A;  4LUA A;  4F0X A;  1YME A;  2Z3P A;  1IU8 A;  1TF8 A;  3TOA A;  5HVG A;  1BPM A;  4JXR A;  3RZA A;  3BI1 A;  4DYO A;  4X2T A;  3B3W A;  4R9M A;  3GY9 A;  3DGV A;  2EK9 A;  2Q4Z A;  3KL9 A;  2RFH A;  2C6P A;  2PIZ A;  4MY0 A;  3EFA A;  2OB0 A;  2P6G A;  2C6C A;  4HNY B;  4MHP A;  3WR7 A;  5JM6 A;  4P6Y A;  2V8D A;  4IK2 A;  2GRE A;  2PJ1 A;  3MN8 A;  4B5O A;  1ON0 A;  1Y7R A;  2V8V A;  3IFE A;  4M85 A;  4NGS A;  4KOT A;  3IGR A;  4Q38 A;  2PR1 A;  4AB7 A;  2EO8 A;  4NF1 A;  4ZGY B;  3B3V A;  1Y9K A;  1KZF A;  4UWI A;  4PK2 A;  2WUU A;  5AG6 A;  3JRU A;  2HV2 A;  2PJ3 A;  1Z8L A;  1PUA A;  2YGW A;  4MFQ A;  2QJ8 A;  3KQZ A;  3RBU A;  1HDU A;  3WC5 A;  1M4I A;  2WSA A;  1VHE A;  2ZEN A;  3WC6 A;  4OLL A;  4A94 A;  8CPA A;  3LD2 A;  2GE3 A;  1VIX A;  4KSA A;  3PFE A;  4NEX A;  1CPX A;  1NMT A;  2EUI A;  3V8I A;  2PJ4 A;  1K4J A;  5K8P A;  2WYR A;  1EE3 P;  4MCR A;  3S9L A;  4IAV A;  4C2Y A;  4H89 A;  3R1K A;  3IWW A;  2HUZ A;  1Q2D A;  2G9D A;  4M6H A;  3CPX A;  3B35 A;  5LYL A;  1V0C A;  1BLL E;  4KOR A;  5KTD A;  2B3V A;  2BO9 A;  3PB4 X;  1XOV A;  2Y0M A;  1TKJ A;  2FCK A;  2QYV A;  3LWU A;  2CNM A;  5F47 A;  3SJF A;  4AVA A;  4OP4 A;  2EVN A;  3FH4 A;  4TNU A;  3D7D A;  2QIR A;  4UF4 A;  3W6S A;  1Q2Y A;  1MJ9 A;  1Q2C A;  2NMT A;  1JWQ A;  4YFJ A;  1P0H A;  1S5K A;  2PVW A;  1YGH A;  4MBU A;  1I21 A;  4II9 A;  2POK A;  2FL4 A;  2AFX A;  4CAW A;  4MXU A;  4R76 A;  4Y49 C;  2A4N A;  5G22 A;  2BL1 A;  4RI1 A;  2ZEG A;  2VQY A;  4CRY B;  4JYW A;  5K8M A;  2V77 A;  3F8K A;  2I79 A;  5J8C A;  3WAB A;  4E8O A;  4PXC A;  4M6G A;  2Q51 A;  3HLP A;  1UFH A;  5A27 A;  3S9N A;  2AFS A;  3TE4 A;  1LRZ A;  2OR4 A;  2ZEE A;  1IOF A;  4FD4 A;  2HB6 A;  3N7Z A;  1A2Z A;  1GYT A;  2G3T A;  5AG7 A; 
#chains in the Genus database with same CATH homology
 2C27 A;  5F49 A;  4RS2 A;  1S7F A;  4LX9 A;  3OWC A;  1Y9W A;  4JWP A;  4MI4 A;  4YRH A;  5GCN A;  4OAE A;  2DPS A;  1XMT A;  4MFZ A;  3H4Q A;  3TTH A;  2YND A;  4A2Z A;  4XPL A;  4UCN A;  3TFY A;  2VBQ A;  2J8R A;  3DR8 A;  4ORF A;  1IB1 E;  4YGO A;  3R9F A;  2B58 A;  2Z11 A;  5HH1 A;  2Z3M A;  4XPK A;  4J3G A;  2B5G B;  2FS5 A;  5AGE A;  3ZJ0 A;  5KTC A;  1IYK A;  1YVK A;  4QBJ A;  4XNH B;  4KVX A;  1I1D A;  2VZZ A;  2R1I A;  2H5M A;  4CGN A;  1BO4 A;  1M1D A;  2JEV A;  2JDD A;  3FIX A;  2REF A;  2FIW A;  5EBV A;  4CGL A;  2FE7 A;  1RO5 A;  2OU2 A;  3TO9 A;  4BMH A;  2YNE A;  2OH1 A;  2B4D B;  2YNC C;  1MK4 A;  5H86 A;  4H6Z A;  4AG7 A;  4A30 A;  4MJ8 A;  3DDD A;  2DPT A;  2K5T A;  3BJ8 A;  3GKR A;  3C26 A;  2Z3K A;  1L0C A;  2ARH A;  2X7B A;  2Q4Y A;  3S6K A;  4CAX A;  4R87 A;  4R3K A;  5H84 A;  2WPW A;  5A28 A;  4I49 A;  4CYQ A;  1YK3 A;  1RXT A;  2ZXV A;  3TOB A;  5JQ4 A;  2Q7B A;  1QSR A;  1N71 A;  3F5B A;  3ZZI A;  3RYO A;  4F6A A;  1GHE A;  4C68 A;  4MFK A;  4FD7 A;  1NSL A;  2Z10 A;  1CJW A;  2OZU A;  3CXP A;  4C7I A;  4CYP A;  5AG4 A;  4MFP A;  2IL4 A;  4KUB A;  1QSM A;  3FRM A;  2D4P A;  3QAH A;  5AG5 A;  2OZH A;  4A33 A;  1S7L A;  2GIV A;  2I00 A;  4B14 A;  4CAF A;  2Q0Y A;  4KUA A;  1MJB A;  4UWJ A;  1VHS A;  4HKF A;  4R57 A;  4PSX A;  4KOU A;  2G3A A;  2QML A;  2YNC A;  2B5G A;  5F46 A;  3JTK A;  4IF5 A;  1CM0 A;  3NE7 A;  3R95 A;  1I12 A;  4OAD A;  2ZW6 A;  1QSN A;  1XE4 A;  5I0C A;  3I9S A;  2RC4 A;  1XIX A;  5IV0 A;  3FXT A;  3R9G A;  4CS0 B;  2Q44 A;  3T9Y A;  5DWM A;  4AVC A;  1IID A;  4UCP A;  1M44 A;  4QB9 A;  3W6X A;  3IU1 A;  4XPD B;  1Z4R A;  4B13 A;  4DNC A;  2B4D A;  2Z0Z A;  3QB8 A;  2HQY A;  2FXF A;  2FT0 A;  1KUX A;  1S7K A;  1Z4E A;  2R8V A;  4CYN A;  3EC4 A;  4EVY A;  3GYA A;  5HMN A;  3JVN A;  3D8P A;  4UFV A;  4QVT A;  1QSO A;  2WPX A;  4FD5 A;  4IUS A;  4KZT A;  3MGD A;  3S6F A;  4B5P B;  1FY7 A;  1IIC A;  2PC1 A;  2AJ6 A;  4BBH A;  1S7N A;  3SHP A;  3EY5 A;  3P2F A;  5EC4 A;  4CAE A;  2GAN A;  3I3G A;  2P6E A;  2VZY A;  3TCV A;  5C82 A;  1M4G A;  4FD6 A;  1QST A;  2ATR A;  1YRE A;  3JUW A;  1XEB A;  2Z3L A;  3SXO A;  4KOX A;  4A32 A;  4XNH C;  4E2A A;  1MJA A;  2ZW7 A;  4QUS A;  2PSW A;  2VEZ A;  2R98 A;  3VWD A;  2BSW A;  4NXY A;  3VWE A;  1KUY A;  5G20 A;  4C2Z A;  4HNW B;  3EO4 A;  4KOY A;  1OZP A;  4MFL A;  5E96 A;  2PRB A;  4KLV A;  4KS9 A;  1U6M A;  3S6H A;  2CNS A;  4KVM E;  1XF8 A;  1ZO0 A;  5BWA B;  3BJ7 A;  1S3Z A;  4NCZ A;  3TO6 A;  3FB3 A;  3PZJ A;  3PGP A;  5IB0 A;  1NE9 A;  4UFX A;  3A9L A;  2J8N A;  1IYL A;  3IWE A;  4PK3 A;  3SXN A;  4B10 A;  4B11 A;  5DWN A;  2CXA A;  2ZW5 A;  3K9U A;  4QC6 A;  3E0K A;  2OZG A;  2BUE A;  2R7H A;  4CRZ B;  4H6U A;  1YX0 A;  4GS4 A;  4KOW A;  4A31 A;  4CAV A;  4CGM A;  3D2M A;  2JDC A;  2Z3N A;  1YR0 A;  2Q4V A;  1VKC A;  4Y49 B;  4UA3 A;  1BOB A;  1KUV A;  1WK4 A;  3IWG A;  3D2P A;  5F48 A;  2AE6 A;  4JXQ A;  4Q36 A;  3G8W A;  5KTA A;  2CY2 A;  3KKW A;  3TO7 A;  3IU2 A;  4B5P A;  3T90 A;  4U9Y A;  2VI7 A;  5CNP A;  2J8M A;  3B8G A;  3G3S A;  3R96 A;  2O28 A;  2D4O A;  4JJX A;  1SQH A;  4U9Z A;  4A95 A;  1PU9 A;  3PP9 A;  2P6F A;  3D3S A;  1R57 A;  4L89 A;  4X5K A;  3FBU A;  2B4B A;  4MHD A;  5C88 A;  1YVO A;  4B12 A;  3S6G A;  2F5I A;  4AG9 A;  2CNT A;  3UY5 A;  2FIA A;  3BLN A;  4UCM A;  3EXN A;  4JD6 A;  4JLY A;  3R9E A;  2BEI A;  2DXQ A;  2FSR A;  2ZPA A;  5G21 A;  2PQ8 A;  5IX3 A;  1P4N A;  4UFW A;  3CXQ A;  4NSQ A;  2VXK A;  4HNX B;  2P0W A;  1S60 A;  2PDO A;  4CYO A;  1WWZ A;  1B87 A;  5FVJ A;  2G0B A;  4PV6 A;  4R3L A;  3DR6 A;  4ZBG A;  4KOV A;  4MY3 A;  4AVB A;  2QEC A;  4PSW A;  4KSF A;  4XPD C;  4U5Y A;  1M4D A;  3P2H A;  4F0Y A;  4UBR A;  2B3U A;  3DNS A;  4CGP A;  5ISV A;  3FYN A;  3FNC A;  1Z9U A;  3DSB A;  2Z3O A;  4KLW A;  2JLM A;  4ONU A;  4KVO E;  4MFJ A;  1B6B A;  5G1Z A;  3LOD A;  1J4J A;  2REE A;  4KOS A;  3W91 A;  4K30 A;  4M3S A;  2KCW A;  5J8F A;  3CXS A;  5JPH A;  4C2X A;  4CGO A;  2Q04 A;  2ZW4 A;  4E0A A;  3TT2 A;  1TIQ A;  1YLE A;  4L8A A;  3H5Z A;  4C7H A;  2PR8 A;  3F0A A;  4LUA A;  4F0X A;  2Z3P A;  3TOA A;  4JXR A;  4R9M A;  3GY9 A;  4MY0 A;  3EFA A;  2OB0 A;  2P6G A;  4HNY B;  3WR7 A;  4B5O A;  1ON0 A;  1Y7R A;  4M85 A;  4KOT A;  3IGR A;  4Q38 A;  2PR1 A;  4AB7 A;  4NF1 A;  4ZGY B;  1Y9K A;  1KZF A;  4UWI A;  4PK2 A;  2WUU A;  5AG6 A;  2HV2 A;  2YGW A;  1PUA A;  4MFQ A;  1M4I A;  2WSA A;  4OLL A;  3LD2 A;  2GE3 A;  4KSA A;  4NEX A;  3V8I A;  1NMT A;  2EUI A;  1K4J A;  4C2Y A;  4H89 A;  3R1K A;  2HUZ A;  1Q2D A;  1V0C A;  4KOR A;  5KTD A;  2B3V A;  5F47 A;  2Y0M A;  2FCK A;  4AVA A;  2CNM A;  2EVN A;  3W6S A;  2QIR A;  1Q2Y A;  1MJ9 A;  1Q2C A;  2NMT A;  4YFJ A;  1P0H A;  1S5K A;  1YGH A;  4MBU A;  1I21 A;  4II9 A;  2FL4 A;  4CAW A;  4Y49 C;  5G22 A;  4CRY B;  2A4N A;  2BL1 A;  4RI1 A;  2VQY A;  3F8K A;  2I79 A;  5J8C A;  4E8O A;  1UFH A;  5A27 A;  3TE4 A;  1LRZ A;  4FD4 A;  3N7Z A;  2G3T A;  5AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...