2VQYA

Structure of aac(6')-ib in complex with parmomycin and acetylcoa.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
177
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 177
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vqyA00
3H4QA 2Q44A 3S6HA 5FVJA 1OZPA 4KZTA 3D8PA 4MI4A 4E8OA 4CAVA 3EO4A 1IICA 4KOWA 2C27A 2F5IA 3ZZIA 2RC4A 2P0WA 2OZUA 1Q2YA 4YRHA 1P4NA 2EVNA 2IL4A 3S6GA 2PR8A 4Y49C 2REFA 3IGRA 1YREA 4HNYB 2B5GA 3JVNA 4RS2A 2OU2A 4U9ZA 2NMTA 2REEA 5DWMA 4MBUA 1Q2DA 1WWZA 3BLNA 4HKFA 3TE4A 2H5MA 1U6MA 2GANA 4NF1A 4X5KA 1ON0A 2ARHA 2R98A 4XNHB 4KVOE 2PC1A 3N7ZA 4OADA 4XPLA 4MHDA 4F6AA 2J8RA 3S6KA 2FXFA 4KORA 4M3SA 4ORFA 3T9YA 4CS0B 1KUYA 1YK3A 3EXNA 3EY5A 4K30A 1QSTA 2HUZA 2PRBA 3ZJ0A 3G8WA 2D4PA 3TT2A 5H86A 2CY2A 1MJ9A 1P0HA 3C26A 5KTAA 4QVTA 1NE9A 5C82A 3I9SA 3CXQA 2KCWA 5F48A 3F8KA 1S7LA 2CNTA 4BMHA 5JPHA 4HNXB 3WR7A 2VQYA 2P6GA 2VXKA 3D2PA 3R1KA 4QB9A 4CRYB 5CNPA 3UY5A 2VI7A 2X7BA 4L8AA 1KZFA 4KOXA 2PQ8A 2A4NA 2B5GB 2B3VA 3DSBA 5IV0A 3FNCA 1MJBA 3E0KA 3B8GA 4KOUA 4LX9A 2QIRA 1SQHA 5H84A 3VWDA 2JDCA 3R95A 2GIVA 2CNMA 2K5TA 2WPWA 3PP9A 1KUXA 1I21A 1YGHA 4KVXA 4PK2A 2Z10A 4ZBGA 4AVBA 2Q04A 4FD4A 4AVAA 1WK4A 4PV6A 3FB3A 1B87A 4JWPA 3DDDA 2ZW7A 2Q0YA 3EC4A 1S7NA 1IIDA 4HNWB 4R57A 2D4OA 4II9A 3GYAA 4UA3A 2Q7BA 3EFAA 3G3SA 1FY7A 4LUAA 1M4DA 1XE4A 1Z4EA 4U5YA 5GCNA 4KUBA 2ATRA 2FL4A 4MJ8A 3RYOA 3FRMA 4JJXA 3R9FA 3QB8A 3TOBA 4R3KA 5HMNA 4CAWA 2R1IA 5KTDA 2FS5A 5F49A 1M4GA 4JXQA 2Z11A 2BSWA 4PSXA 5IB0A 3FIXA 4NCZA 4AVCA 2J8MA 4GS4A 3MGDA 1QSMA 4I49A 3F0AA 3IWGA 2FE7A 4DNCA 3R9EA 5HH1A 4PSWA 4OLLA 4U9YA 2DXQA 3PZJA 2PSWA 2OB0A 1RXTA 1S7KA 4H89A 3LD2A 4FD6A 3S6FA 4CAXA 4NEXA 2ZW4A 3DR8A 4MY0A 4EVYA 3D2MA 1QSOA 2BL1A 2PDOA 4E0AA 1BOBA 4CRZB 5J8FA 4YFJA 2EUIA 1NMTA 1KUVA 1VHSA 5DWNA 1IB1E 1NSLA 5EC4A 3P2FA 4B5OA 2VZYA 4J3GA 2VZZA 4JLYA 4IUSA 4XPDB 3TTHA 4RI1A 5IX3A 2FSRA 4B5PA 1BO4A 1S7FA 1Y9WA 3DNSA 2VBQA 3SHPA 3V8IA 2QECA 2ZW6A 5F46A 4AG9A 3T90A 4H6ZA 2B3UA 1Z9UA 5C88A 3SXOA 1I12A 4KUAA 4XPKA 2O28A 1LRZA 1PU9A 4E2AA 3GY9A 3TO7A 3KKWA 1MJAA 4FD5A 4JD6A 2GE3A 1VKCA 2ZW5A 1TIQA 4KVME 2AJ6A 5F47A 2AE6A 4R9MA 1CM0A 4Y49B 2BUEA 2I79A 2PR1A 4KOSA 1S60A 2B4BA 3F5BA 4M85A 1CJWA 2FIWA 1YX0A 2ZPAA 3GKRA 2R8VA 3R96A 1L0CA 3W6XA 1N71A 4R87A 3W91A 4ONUA 1IYLA 1QSRA 1XIXA 2P6FA 4B5PB 2G3AA 3R9GA 2FIAA 1IYKA 3JUWA 4KLVA 1S3ZA 5KTCA 3LODA 4PK3A 2HV2A 5J8CA 4NSQA 2G0BA 4KOYA 3K9UA 2Q4VA 1I1DA 3FYNA 2OZHA 3VWEA 1M44A 1J4JA 5E96A 1B6BA 1MK4A 2B4DA 5I0CA 4JXRA 4KLWA 4MY3A 3TO6A 3FBUA 2CNSA 2HQYA 3I3GA 2G3TA 4R3LA 2Z0ZA 1PUAA 1R57A 2WPXA 1YLEA 2VEZA 4KOVA 1Z4RA 3BJ8A 3FXTA 2B58A 1XEBA 1RO5A 2JLMA 1YVKA 2J8NA 2Y0MA 1K4JA 1Y9KA 1YR0A 4IF5A 3CXPA 3DR6A 3CXSA 4XNHC 1YVOA 3W6SA 4QBJA 3TFYA 1Q2CA 3TCVA 1GHEA 4KOTA 4AB7A 2QMLA 1QSNA 1XF8A 2FCKA 2ZXVA 2FT0A 4L89A 2JEVA 1S5KA 1M4IA 2OZGA 3TO9A 4QC6A 4F0YA 3SXNA 2I00A 2R7HA 5JQ4A 4QUSA 4OAEA 2BEIA 2P6EA 4YGOA 3NE7A 1V0CA 2B4DB 3BJ7A 4AG7A 5ISVA 4FD7A 1XMTA 4NXYA 4UWIA 1M1DA 3QAHA 2OH1A 3P2HA 4H6UA 4UBRA 4XPDC 1Y7RA 1UFHA 2Q4YA 3PGPA 3D3SA 4UWJA 2JDDA 3TOAA 5EBVA 3OWCA
chains in the Genus database with same CATH superfamily
2PCUA 3H4QA 3ISXA 4BBHA 3S9MA 3IU2A 2Q44A 3S6HA 4UCPA 3WABA 4EWTA 4CAFA 3HLPA 5FVJA 4MFJA 5CBMA 1OZPA 4ZX8A 1TF9A 3SJFA 2V77A 2JBKA 4KZTA 1DTDA 3D8PA 4MI4A 2WUUA 1FT7A 2PJ5A 4CAVA 4E8OA 2QVPA 3EO4A 3S9LA 1IICA 1XMBA 4KOWA 4MFZA 3B3WA 4CYOA 2C27A 2F5IA 3IO1A 4FWUA 3ZZIA 2RC4A 2P0WA 3CPXA 3IEHA 2YGWA 4P6YA 2C6GA 2F7VA 4C2ZA 3BHXA 4B10A 2ZEOA 2ANPA 2OZUA 1Q2YA 1Z8TA 1QMUA 4JZ0A 4YRHA 2AFZA 2Z3NA 2DPSA 1P4NA 2EVNA 2IL4A 3S6GA 2PR8A 3NA6A 4P4BA 3K9TA 2EK9A 4Y49C 2REFA 3IGRA 1YREA 4HNYB 3B3SA 2B5GA 3JVNA 2YNCC 2PJ3A 2O53A 4RS2A 3LMSA 3FX6A 2ZEHA 3BI1A 3NE8A 2OU2A 3PEIA 4U9ZA 4A31A 2NMTA 2REEA 3B2YA 5DWMA 3GLJA 5LYDA 2EO8A 4MBUA 4A37A 1Q2DA 1WWZA 4CYPA 3BLNA 4HKFA 3TE4A 4OC0A 3VARA 5A27A 1YMEA 2H5MA 4NGMA 1U6MA 2PE3A 2GANA 4NF1A 4X5KA 1ON0A 2ARHA 4A39A 2R98A 7CPAA 1ELLP 3PBBA 4XNHB 4ZYQA 5K8MA 2AFUA 4KVOE 4PXDA 2PC1A 3N7ZA 4OADA 2CTBA 4XPLA 1Y0YA 1Z8WA 4MHDA 2J8RA 2AFWA 4F6AA 4C2XA 3S6KA 4FAIA 4UEZA 4A94A 2FXFA 4KORA 4M3SA 4ORFA 3T9YA 4CS0B 1KUYA 1YK3A 3EXNA 3EY5A 4NJRA 4P4IA 4B13A 2POKA 4K30A 4ZI6A 3B3CA 1QSTA 3H8EA 3KHXA 2GLJA 2HUZA 2PRBA 3ZJ0A 2J9AA 3G8WA 1NSAA 2D4PA 2JBJA 1QQ9A 3TT2A 2DEAA 4P10A 3IWEA 3WC6A 5H86A 2CY2A 1MJ9A 1P0HA 2YNCA 3C26A 4OMEA 4OC4A 4QVTA 1NE9A 5AG7A 5C82A 2PJAA 3I9SA 2V8GA 3CXQA 4MXUA 3S9NA 2KCWA 2V8HA 4MRIA 4P4DA 4P4EA 1ZG7A 5G21A 4A2ZA 2V8DA 5F48A 4EMEA 3F8KA 2ZOFA 1S7LA 2CNTA 3RAMA 1EE3P 3IC1A 4BMHA 5JPHA 4HNXB 3WR7A 4B12A 2VQYA 2P6GA 2VXKA 3D2PA 2YNEA 3R1KA 4QB9A 4CRYB 1ARMA 2PVVA 4W9YA 5CNPA 5A28A 3UY5A 2VI7A 2Z3MA 2X7BA 1ZG9A 4L8AA 1AYEA 1KZFA 2CIJA 4KOXA 2PQ8A 2A4NA 3CT9A 2B5GB 2B3VA 3DSBA 3IWWA 3KI9A 3PB6X 1F57A 4NGTA 4UFWA 3NH5A 2QYVA 3TC8A 3D7HA 4DYOA 5IV0A 3FNCA 1MJBA 4FBEA 2Q7SA 4Z65A 3E0KA 3QNVA 4IK2A 3B8GA 4KOUA 4X3RA 2G9DA 4LX9A 5JH9A 1CP6A 3D7FA 1TKJA 4FUUA 2QIRA 4MCPA 4Q7AA 5JM6A 4NJQA 3D4UA 1SQHA 5H84A 4PQAA 3VWDA 3H5ZA 2JDCA 3R95A 1JWQA 2GIVA 1IU8A 2CNMA 1IOFA 3NH4A 4OIDA 3PFOA 5HVGA 4IAVA 4MCRA 2K5TA 2WPWA 2GREA 3D68A 3PP9A 1IGBA 4MFQA 1I21A 1KUXA 1YGHA 4C2YA 4KVXA 4Q36A 1XRYA 1HEEA 1ELMP 4PK2A 2AFXA 2Z10A 4NGRA 3RZAA 4UFXA 2FVGA 4ZBGA 4AVBA 2Q04A 3HUVA 2Z3LA 4TWEA 4FD4A 2I3CA 1WK4A 4G1PA 4ONWA 4OC2A 4PV6A 4AVAA 2HB6A 4DUKA 2EWBA 4CYQA 1LCPA 3FB3A 1B87A 1CBXA 4CGPA 4JWPA 3DDDA 2ZW7A 2Q0YA 3FMCA 4M6GA 3H8GA 3EC4A 1S7NA 5AGEA 2BCOA 1IIDA 4HNWB 1PYTB 4M6IA 3BI0A 4PXEA 4R57A 2D4OA 2WSAA 4II9A 3GYAA 4UA3A 2Q7BA 3EFAA 4MFKA 2C6PA 3G3SA 5K8OA 1FY7A 3KZWA 3VH9A 5AG4A 4LUAA 1M4DA 1XE4A 1Z4EA 4BD9A 1CPSA 4CGLA 4U5YA 4NGQA 5GCNA 4TNUA 4F8ZA 2ZENA 2IMOA 5G20A 4BINA 4KUBA 2ATRA 1GYTA 2FL4A 4MJ8A 3RYOA 5D29A 2ZEDA 3FRMA 4WWVA 2YNDA 4JJXA 3R9FA 3RO0A 3IFEA 5G1ZA 2EK8A 3QB8A 3GUXA 3TOBA 4R3KA 4OP4A 5HMNA 4CAWA 1AMPA 2R1IA 3FEDA 5KTDA 3KR4A 1BPNA 3PBEA 5KTAA 1A2ZA 2FS5A 5F49A 1M4GA 4JXQA 1TKFA 2Q4ZA 2Z11A 2BSWA 3SI0A 3OWCA 4PSXA 5IB0A 3FIXA 4NCZA 4P44A 4AVCA 2J8MA 4GS4A 3MGDA 4OIWA 1QSMA 4I49A 2CXAA 3F0AA 3IWGA 2PJ2A 1ZLHA 2FE7A 4DNCA 3R9EA 5HH1A 4PSWA 4OLLA 4U9YA 3WC7A 2DXQA 2NYQA 3PZJA 2PSWA 3DLJA 1XJOA 2Z3OA 2ABZA 2OB0A 1RXTA 1S7KA 2ZEPA 3PB4X 2RFHA 5LRJA 4H89A 1YW4A 3LD2A 3JTKA 4FD6A 4OC5A 3S6FA 4OC3A 2VL1A 2ZEEA 4OKOA 3RNZA 4CAXA 4NEXA 3IIBA 2C1CA 2ZW4A 4DJLA 3DR8A 5IB9A 2PJ9A 4NGPA 4MHPA 4MY0A 4EVYA 3D2MA 1QSOA 1Z8LA 2PVWA 3B3TA 2PRQA 1DE4C 2BL1A 2PJ8A 2PDOA 4X2TA 4C7HA 4E0AA 3MN8A 1ZLIA 2GFQA 5AG5A 1BOBA 1ZG8A 4CRZB 5J8FA 3ISZA 3TX8A 1TKHA 4YFJA 1Z5RA 2EUIA 4UEEA 3SI1A 5LRGA 5AG6A 1NMTA 2RB7A 2AFMA 1KUVA 2PJ4A 4P45A 5HXDA 1VHSA 5DWNA 1IB1E 1VIXA 1NSLA 3FF3A 5EC4A 1ZO0A 3PB9X 2GLFA 3P2FA 2VZYA 5ELYA 2QJ8A 4J3GA 4UCNA 4B5OA 2VZZA 1H8LA 4JLYA 3PRTA 5CPAA 4IUSA 4XPDB 5D8NA 4RI1A 3TTHA 3PB8X 4ZY0A 3KGQA 5IX3A 2FSRA 4B5PA 1BO4A 4R7MA 2IQ6A 1S7FA 1Y9WA 4C7IA 1Y0RA 3DNSA 5HVFA 5F09A 3RBUA 2VBQA 3SHPA 4CYNA 1LAMA 3V8IA 2QECA 2ZW6A 4F0XA 5F46A 4RN7A 2GU2A 1CG2A 3H8FA 4LQ6A 3V38A 4A32A 4AG9A 3T90A 4H6ZA 2B3UA 4UEFA 4HPSA 1Z9UA 1VHEA 5C88A 2C6CA 3SXOA 1I12A 4KUAA 4XPKA 5THWA 2O28A 2ZOGA 2JEWA 1LRZA 4A33A 1PU9A 4E2AA 3GY9A 3FH4A 3KHZA 3TO7A 3KKWA 1LFWA 1MJAA 4MMOA 4FD5A 3CDXA 3N5FA 2O4HA 4JD6A 4F9UA 5JGFA 2GE3A 5LRKA 1Y7EA 4P4FA 4YWYA 1VKCA 1JQGA 1TIQA 1VGYA 2ZW5A 2IJZA 4KVME 1X12A 1IY7A 2AJ6A 5F47A 4RUHA 3D7GA 2AE6A 3KL9A 2BO9A 4M6HA 4R9MA 1CM0A 8CPAA 4Y49B 1R3NA 3D7DA 1TXRA 2BUEA 3D67A 1IOIA 4MFLA 2I79A 2PR1A 3CZXA 1UWYA 4KOSA 1S60A 2B4BA 4H2KA 3F5BA 4B11A 4M85A 1CJWA 3GIUA 2ZEMA 3CPAA 2FIWA 1YX0A 3GB0A 2AFSA 4MCSA 4Q38A 2PIYA 4UIBA 3FECA 3PFEA 4KS9A 4C68A 3NFZA 3KR5A 2ZPAA 3GKRA 5J1QA 2DF5A 3K2KA 1TF8A 4CAEA 2R8VA 4O23A 3R96A 2PJ1A 1L0CA 2PJBA 2XEJA 3V7ZA 3FEEA 3W6XA 1N71A 4R87A 3W91A 4MHNA 4ONUA 1IYLA 2EBJA 3B7IA 3KQZA 1QSRA 2OR4A 1XIXA 2P6FA 3FVLA 4B5PB 4MCQA 4R6TA 2G3AA 2ZELA 3R9GA 2FIAA 5I4MA 2PJ6A 1IYKA 3JUWA 4KLVA 1F2PA 1S3ZA 4NGSA 2BOAA 3LODA 5KTCA 4PK3A 2HV2A 1F2OA 4KSAA 5J8CA 3KASA 4NSQA 4IHMA 2G0BA 3D66A 4KOYA 2XEIA 4CGNA 3K9UA 4A95A 6CPAA 2Q4VA 1FNOA 3WC5A 4OC1A 1I1DA 1BLLE 4LQGA 5DS0A 2Z3KA 3FYNA 3DGVA 4NGNA 1Z2LA 3SJEA 2OZHA 4K3NA 4P4JA 3VWEA 1M44A 1J4JA 5E96A 1B6BA 1MK4A 2B4DA 5I0CA 3NH8A 4JXRA 5LYLA 4KLWA 4A38A 4EFDA 3QAYA 4ZX9A 3JRUA 4MY3A 3TO6A 3FBUA 2CNSA 2HQYA 3I3GA 2Z3PA 2G3TA 2Q43A 2V8VA 4R3LA 2Z0ZA 4R8FA 1PUAA 1R57A 3SJXA 2WPXA 1YLEA 2VEZA 2HC9A 4KOVA 1R43A 1Z4RA 3BXMA 4ZY1A 3BJ8A 3FXTA 2B58A 1XEBA 1RO5A 4B14A 2JLMA 1YVKA 2AFOA 1CP7A 3KQXA 2J8NA 3PB7X 4X8IA 3LACA 2Y0MA 5LYIA 2OOTA 4CGMA 1YQEA 4MHZA 1Z8XA 4UFVA 1XFOA 1K4JA 1Y9KA 1YR0A 3IJ3A 4IF5A 5EMIA 3CXPA 1CPXA 3DR6A 2PJ7A 2CF4A 1VHOA 1LANA 3CXSA 4ZGYB 4XNHC 1HDUA 1YVOA 4PPZA 3W6SA 4QBJA 3TFYA 5K8NA 1Q2CA 3TCVA 1GHEA 4KOTA 4MHYA 2ZEFA 3L2NA 1BPMA 5LYFA 4AB7A 1YW6A 2QMLA 1QSNA 1CX8A 4PXBA 1XF8A 2FCKA 2ZXVA 4AXVA 4MFPA 2FT0A 2XEFA 1XOVA 5BWAB 4L89A 2JEVA 1S5KA 2ZEGA 1KWMA 4B6ZA 4NFRA 3SI2A 1OBRA 1YSJA 1M4IA 2OZGA 3TO9A 2XEGA 3LWUA 3FJUA 3IU1A 3I1UA 4QC6A 4F0YA 3SXNA 4A30A 2I00A 4KSIA 2PJCA 4YU9A 3SJGA 1Q7LA 4F9VA 2R7HA 5JQ4A 4QUSA 4OAEA 2BEIA 1BAVA 1X10A 2F8HA 4PXCA 1PCAA 1LAPA 2P6EA 3MRUA 4YGOA 4ZY2A 1V0CA 3NE7A 2B4DB 3BJ7A 4CPAA 4AG7A 5ISVA 4FD7A 1ARLA 1XMTA 1YLOA 4UF4A 4JYWA 4GM5A 2WYRA 5K8PA 2Q51A 3A9LA 4NXYA 4UIAA 4UWIA 5G22A 4GXHA 3WT4A 1M1DA 3QAHA 2OH1A 4CGOA 3P2HA 1HDQA 2ODFA 3T8WA 4H6UA 3VATA 1AUGA 1XBUA 1LOKA 1M4LA 3B35A 4UBRA 2CTCA 4XPDC 4UCMA 1Y7RA 1UFHA 2PIZA 4WJBA 2Q4YA 2WZNA 4KSFA 1RTQA 2PJ0A 3B3VA 2NSMA 3PGPA 3D3SA 4R76A 4UWJA 5HVHA 2JDDA 3TOAA 5EBVA 2DPTA
chains in the Genus database with same CATH topology
3H4QA 4BBHA 3IU2A 2Q44A 3S6HA 4UCPA 4CAFA 5FVJA 4MFJA 1OZPA 4KZTA 3D8PA 4MI4A 2WUUA 4E8OA 4CAVA 3EO4A 1IICA 4KOWA 4MFZA 4CYOA 2C27A 2F5IA 3ZZIA 2RC4A 2P0WA 2YGWA 4C2ZA 4B10A 2OZUA 1Q2YA 4YRHA 2Z3NA 2DPSA 1P4NA 2EVNA 2IL4A 3S6GA 2PR8A 4Y49C 2REFA 3IGRA 1YREA 4HNYB 2B5GA 3JVNA 2YNCC 4RS2A 2OU2A 4U9ZA 4A31A 2NMTA 2REEA 5DWMA 4MBUA 1Q2DA 1WWZA 4CYPA 3BLNA 4HKFA 3TE4A 5A27A 2H5MA 1U6MA 2GANA 4NF1A 4X5KA 1ON0A 2ARHA 2R98A 4XNHB 4KVOE 2PC1A 3N7ZA 4OADA 4XPLA 4MHDA 4F6AA 2J8RA 4C2XA 3S6KA 2FXFA 4KORA 4M3SA 4ORFA 3T9YA 4CS0B 1KUYA 1YK3A 3EXNA 3EY5A 2DPTA 4B13A 4K30A 1QSTA 2HUZA 2PRBA 3ZJ0A 3G8WA 2D4PA 3TT2A 3IWEA 5H86A 2CY2A 1MJ9A 1P0HA 2YNCA 3C26A 4QVTA 5KTAA 5AG7A 1NE9A 5C82A 3I9SA 3CXQA 2KCWA 4A2ZA 5G21A 5F48A 3F8KA 1S7LA 2CNTA 4BMHA 5JPHA 4HNXB 3WR7A 4B12A 2VQYA 2P6GA 2VXKA 3D2PA 2YNEA 3R1KA 4QB9A 4CRYB 5CNPA 5A28A 3UY5A 2VI7A 2Z3MA 2X7BA 4L8AA 1KZFA 4KOXA 2PQ8A 2A4NA 4UFWA 2B5GB 2B3VA 3DSBA 5IV0A 3FNCA 1MJBA 3E0KA 3B8GA 4KOUA 4LX9A 2QIRA 1SQHA 5H84A 3VWDA 3H5ZA 2JDCA 3R95A 2GIVA 2CNMA 2K5TA 2WPWA 3PP9A 4MFQA 1KUXA 1I21A 1YGHA 4C2YA 4KVXA 4Q36A 4PK2A 2Z10A 4UFXA 4ZBGA 4AVBA 2Q04A 2Z3LA 4FD4A 4AVAA 1WK4A 4PV6A 4CYQA 3FB3A 1B87A 4CGPA 4JWPA 3DDDA 2ZW7A 2Q0YA 3EC4A 1S7NA 5AGEA 1IIDA 4HNWB 4R57A 2D4OA 2WSAA 4II9A 3GYAA 4UA3A 2Q7BA 3EFAA 4MFKA 3G3SA 1FY7A 5AG4A 4LUAA 1M4DA 1XE4A 1Z4EA 4CGLA 4U5YA 5GCNA 5G20A 4KUBA 2ATRA 2FL4A 4MJ8A 3RYOA 3FRMA 2YNDA 4JJXA 3R9FA 5G1ZA 3QB8A 3TOBA 4R3KA 5HMNA 4CAWA 2R1IA 5KTDA 2FS5A 5F49A 1M4GA 4JXQA 2Z11A 2BSWA 4PSXA 5IB0A 3FIXA 4NCZA 4AVCA 2J8MA 4GS4A 3MGDA 1QSMA 4I49A 2CXAA 3F0AA 3IWGA 2FE7A 4DNCA 3R9EA 5HH1A 4PSWA 4OLLA 4U9YA 2DXQA 3PZJA 2PSWA 2Z3OA 2OB0A 1RXTA 1S7KA 4H89A 3LD2A 3JTKA 4FD6A 3S6FA 4CAXA 4NEXA 2ZW4A 3DR8A 4MY0A 4EVYA 3D2MA 1QSOA 2BL1A 2PDOA 4C7HA 4E0AA 5AG5A 1BOBA 4CRZB 5J8FA 4YFJA 2EUIA 5AG6A 1NMTA 1KUVA 1VHSA 5DWNA 1IB1E 1NSLA 5EC4A 1ZO0A 3P2FA 4B5OA 2VZYA 4J3GA 4UCNA 2VZZA 4JLYA 4IUSA 4XPDB 3TTHA 4RI1A 5IX3A 2FSRA 4B5PA 1BO4A 4C7IA 1S7FA 1Y9WA 3DNSA 2VBQA 3SHPA 4CYNA 3V8IA 2QECA 2ZW6A 4F0XA 5F46A 4A32A 4AG9A 3T90A 4H6ZA 2B3UA 1Z9UA 5C88A 3SXOA 1I12A 4KUAA 4XPKA 2O28A 1LRZA 4A33A 1PU9A 4E2AA 3GY9A 3TO7A 3KKWA 1MJAA 4FD5A 4JD6A 2GE3A 1VKCA 2ZW5A 1TIQA 4KVME 2AJ6A 5F47A 2AE6A 4R9MA 1CM0A 4Y49B 2BUEA 4MFLA 2I79A 2PR1A 4KOSA 1S60A 2B4BA 3F5BA 4B11A 4M85A 1CJWA 2FIWA 1YX0A 4Q38A 4KS9A 4C68A 2ZPAA 3GKRA 4CAEA 2R8VA 3R96A 1L0CA 3W6XA 1N71A 4R87A 3W91A 4ONUA 1IYLA 1QSRA 1XIXA 2P6FA 4B5PB 2G3AA 3R9GA 2FIAA 1IYKA 3JUWA 4KLVA 1S3ZA 5KTCA 3LODA 4PK3A 2HV2A 4KSAA 5J8CA 4NSQA 2G0BA 4KOYA 4CGNA 3K9UA 4A95A 2Q4VA 1I1DA 2Z3KA 3FYNA 2OZHA 3VWEA 1M44A 1J4JA 5E96A 1B6BA 1MK4A 2B4DA 5I0CA 4JXRA 4KLWA 4MY3A 3TO6A 3FBUA 2CNSA 2HQYA 3I3GA 2Z3PA 2G3TA 4R3LA 2Z0ZA 1PUAA 1R57A 2WPXA 1YLEA 2VEZA 4KOVA 1Z4RA 3BJ8A 3FXTA 2B58A 1XEBA 1RO5A 4B14A 2JLMA 1YVKA 2J8NA 4CGMA 2Y0MA 4UFVA 1K4JA 1Y9KA 1YR0A 4IF5A 3CXPA 3DR6A 3CXSA 4ZGYB 4XNHC 1YVOA 3W6SA 4QBJA 3TFYA 1Q2CA 3TCVA 1GHEA 4KOTA 4AB7A 2QMLA 1QSNA 1XF8A 2FCKA 2ZXVA 4MFPA 2FT0A 5BWAB 4L89A 2JEVA 1S5KA 1M4IA 2OZGA 3TO9A 3IU1A 4QC6A 4F0YA 3SXNA 4A30A 2I00A 2R7HA 5JQ4A 4QUSA 4OAEA 2BEIA 2P6EA 4YGOA 3NE7A 1V0CA 2B4DB 3BJ7A 4AG7A 5ISVA 4FD7A 1XMTA 3A9LA 4NXYA 5G22A 4UWIA 1M1DA 3QAHA 2OH1A 4CGOA 3P2HA 4H6UA 4UBRA 4XPDC 4UCMA 1Y7RA 1UFHA 2Q4YA 4KSFA 3PGPA 3D3SA 4UWJA 2JDDA 3TOAA 5EBVA 3OWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4Q A;  2Q44 A;  3S6H A;  5FVJ A;  1OZP A;  4KZT A;  3D8P A;  4MI4 A;  4E8O A;  4CAV A;  3EO4 A;  1IIC A;  4KOW A;  2C27 A;  2F5I A;  3ZZI A;  2RC4 A;  2P0W A;  2OZU A;  1Q2Y A;  4YRH A;  1P4N A;  2EVN A;  2IL4 A;  3S6G A;  2PR8 A;  4Y49 C;  2REF A;  3IGR A;  1YRE A;  4HNY B;  2B5G A;  3JVN A;  4RS2 A;  2OU2 A;  4U9Z A;  2NMT A;  2REE A;  5DWM A;  4MBU A;  1Q2D A;  1WWZ A;  3BLN A;  4HKF A;  3TE4 A;  2H5M A;  1U6M A;  2GAN A;  4NF1 A;  4X5K A;  1ON0 A;  2ARH A;  2R98 A;  4XNH B;  4KVO E;  2PC1 A;  3N7Z A;  4OAD A;  4XPL A;  4MHD A;  4F6A A;  2J8R A;  3S6K A;  2FXF A;  4KOR A;  4M3S A;  4ORF A;  3T9Y A;  4CS0 B;  1KUY A;  1YK3 A;  3EXN A;  3EY5 A;  4K30 A;  1QST A;  2HUZ A;  2PRB A;  3ZJ0 A;  3G8W A;  2D4P A;  3TT2 A;  5H86 A;  2CY2 A;  1MJ9 A;  1P0H A;  3C26 A;  5KTA A;  4QVT A;  1NE9 A;  5C82 A;  3I9S A;  3CXQ A;  2KCW A;  5F48 A;  3F8K A;  1S7L A;  2CNT A;  4BMH A;  5JPH A;  4HNX B;  3WR7 A;  2VQY A;  2P6G A;  2VXK A;  3D2P A;  3R1K A;  4QB9 A;  4CRY B;  5CNP A;  3UY5 A;  2VI7 A;  2X7B A;  4L8A A;  1KZF A;  4KOX A;  2PQ8 A;  2A4N A;  2B5G B;  2B3V A;  3DSB A;  5IV0 A;  3FNC A;  1MJB A;  3E0K A;  3B8G A;  4KOU A;  4LX9 A;  2QIR A;  1SQH A;  5H84 A;  3VWD A;  2JDC A;  3R95 A;  2GIV A;  2CNM A;  2K5T A;  2WPW A;  3PP9 A;  1KUX A;  1I21 A;  1YGH A;  4KVX A;  4PK2 A;  2Z10 A;  4ZBG A;  4AVB A;  2Q04 A;  4FD4 A;  4AVA A;  1WK4 A;  4PV6 A;  3FB3 A;  1B87 A;  4JWP A;  3DDD A;  2ZW7 A;  2Q0Y A;  3EC4 A;  1S7N A;  1IID A;  4HNW B;  4R57 A;  2D4O A;  4II9 A;  3GYA A;  4UA3 A;  2Q7B A;  3EFA A;  3G3S A;  1FY7 A;  4LUA A;  1M4D A;  1XE4 A;  1Z4E A;  4U5Y A;  5GCN A;  4KUB A;  2ATR A;  2FL4 A;  4MJ8 A;  3RYO A;  3FRM A;  4JJX A;  3R9F A;  3QB8 A;  3TOB A;  4R3K A;  5HMN A;  4CAW A;  2R1I A;  5KTD A;  2FS5 A;  5F49 A;  1M4G A;  4JXQ A;  2Z11 A;  2BSW A;  4PSX A;  5IB0 A;  3FIX A;  4NCZ A;  4AVC A;  2J8M A;  4GS4 A;  3MGD A;  1QSM A;  4I49 A;  3F0A A;  3IWG A;  2FE7 A;  4DNC A;  3R9E A;  5HH1 A;  4PSW A;  4OLL A;  4U9Y A;  2DXQ A;  3PZJ A;  2PSW A;  2OB0 A;  1RXT A;  1S7K A;  4H89 A;  3LD2 A;  4FD6 A;  3S6F A;  4CAX A;  4NEX A;  2ZW4 A;  3DR8 A;  4MY0 A;  4EVY A;  3D2M A;  1QSO A;  2BL1 A;  2PDO A;  4E0A A;  1BOB A;  4CRZ B;  5J8F A;  4YFJ A;  2EUI A;  1NMT A;  1KUV A;  1VHS A;  5DWN A;  1IB1 E;  1NSL A;  5EC4 A;  3P2F A;  4B5O A;  2VZY A;  4J3G A;  2VZZ A;  4JLY A;  4IUS A;  4XPD B;  3TTH A;  4RI1 A;  5IX3 A;  2FSR A;  4B5P A;  1BO4 A;  1S7F A;  1Y9W A;  3DNS A;  2VBQ A;  3SHP A;  3V8I A;  2QEC A;  2ZW6 A;  5F46 A;  4AG9 A;  3T90 A;  4H6Z A;  2B3U A;  1Z9U A;  5C88 A;  3SXO A;  1I12 A;  4KUA A;  4XPK A;  2O28 A;  1LRZ A;  1PU9 A;  4E2A A;  3GY9 A;  3TO7 A;  3KKW A;  1MJA A;  4FD5 A;  4JD6 A;  2GE3 A;  1VKC A;  2ZW5 A;  1TIQ A;  4KVM E;  2AJ6 A;  5F47 A;  2AE6 A;  4R9M A;  1CM0 A;  4Y49 B;  2BUE A;  2I79 A;  2PR1 A;  4KOS A;  1S60 A;  2B4B A;  3F5B A;  4M85 A;  1CJW A;  2FIW A;  1YX0 A;  2ZPA A;  3GKR A;  2R8V A;  3R96 A;  1L0C A;  3W6X A;  1N71 A;  4R87 A;  3W91 A;  4ONU A;  1IYL A;  1QSR A;  1XIX A;  2P6F A;  4B5P B;  2G3A A;  3R9G A;  2FIA A;  1IYK A;  3JUW A;  4KLV A;  1S3Z A;  5KTC A;  3LOD A;  4PK3 A;  2HV2 A;  5J8C A;  4NSQ A;  2G0B A;  4KOY A;  3K9U A;  2Q4V A;  1I1D A;  3FYN A;  2OZH A;  3VWE A;  1M44 A;  1J4J A;  5E96 A;  1B6B A;  1MK4 A;  2B4D A;  5I0C A;  4JXR A;  4KLW A;  4MY3 A;  3TO6 A;  3FBU A;  2CNS A;  2HQY A;  3I3G A;  2G3T A;  4R3L A;  2Z0Z A;  1PUA A;  1R57 A;  2WPX A;  1YLE A;  2VEZ A;  4KOV A;  1Z4R A;  3BJ8 A;  3FXT A;  2B58 A;  1XEB A;  1RO5 A;  2JLM A;  1YVK A;  2J8N A;  2Y0M A;  1K4J A;  1Y9K A;  1YR0 A;  4IF5 A;  3CXP A;  3DR6 A;  3CXS A;  4XNH C;  1YVO A;  3W6S A;  4QBJ A;  3TFY A;  1Q2C A;  3TCV A;  1GHE A;  4KOT A;  4AB7 A;  2QML A;  1QSN A;  1XF8 A;  2FCK A;  2ZXV A;  2FT0 A;  4L89 A;  2JEV A;  1S5K A;  1M4I A;  2OZG A;  3TO9 A;  4QC6 A;  4F0Y A;  3SXN A;  2I00 A;  2R7H A;  5JQ4 A;  4QUS A;  4OAE A;  2BEI A;  2P6E A;  4YGO A;  3NE7 A;  1V0C A;  2B4D B;  3BJ7 A;  4AG7 A;  5ISV A;  4FD7 A;  1XMT A;  4NXY A;  4UWI A;  1M1D A;  3QAH A;  2OH1 A;  3P2H A;  4H6U A;  4UBR A;  4XPD C;  1Y7R A;  1UFH A;  2Q4Y A;  3PGP A;  3D3S A;  4UWJ A;  2JDD A;  3TOA A;  5EBV A;  3OWC A; 
#chains in the Genus database with same CATH topology
 2PCU A;  3H4Q A;  3ISX A;  4BBH A;  3S9M A;  3IU2 A;  2Q44 A;  3S6H A;  4UCP A;  3WAB A;  4EWT A;  4CAF A;  3HLP A;  5FVJ A;  4MFJ A;  5CBM A;  1OZP A;  4ZX8 A;  1TF9 A;  3SJF A;  2V77 A;  2JBK A;  4KZT A;  1DTD A;  3D8P A;  4MI4 A;  2WUU A;  1FT7 A;  2PJ5 A;  4CAV A;  4E8O A;  2QVP A;  3EO4 A;  3S9L A;  1IIC A;  1XMB A;  4KOW A;  4MFZ A;  3B3W A;  4CYO A;  2C27 A;  2F5I A;  3IO1 A;  4FWU A;  3ZZI A;  2RC4 A;  2P0W A;  3CPX A;  3IEH A;  2YGW A;  4P6Y A;  2C6G A;  2F7V A;  4C2Z A;  3BHX A;  4B10 A;  2ZEO A;  2ANP A;  2OZU A;  1Q2Y A;  1Z8T A;  1QMU A;  4JZ0 A;  4YRH A;  2AFZ A;  2Z3N A;  2DPS A;  1P4N A;  2EVN A;  2IL4 A;  3S6G A;  2PR8 A;  3NA6 A;  4P4B A;  3K9T A;  2EK9 A;  4Y49 C;  2REF A;  3IGR A;  1YRE A;  4HNY B;  3B3S A;  2B5G A;  3JVN A;  2YNC C;  2PJ3 A;  2O53 A;  4RS2 A;  3LMS A;  3FX6 A;  2ZEH A;  3BI1 A;  3NE8 A;  2OU2 A;  3PEI A;  4U9Z A;  4A31 A;  2NMT A;  2REE A;  3B2Y A;  5DWM A;  3GLJ A;  5LYD A;  2EO8 A;  4MBU A;  4A37 A;  1Q2D A;  1WWZ A;  4CYP A;  3BLN A;  4HKF A;  3TE4 A;  4OC0 A;  3VAR A;  5A27 A;  1YME A;  2H5M A;  4NGM A;  1U6M A;  2PE3 A;  2GAN A;  4NF1 A;  4X5K A;  1ON0 A;  2ARH A;  4A39 A;  2R98 A;  7CPA A;  1ELL P;  3PBB A;  4XNH B;  4ZYQ A;  5K8M A;  2AFU A;  4KVO E;  4PXD A;  2PC1 A;  3N7Z A;  4OAD A;  2CTB A;  4XPL A;  1Y0Y A;  1Z8W A;  4MHD A;  2J8R A;  2AFW A;  4F6A A;  4C2X A;  3S6K A;  4FAI A;  4UEZ A;  4A94 A;  2FXF A;  4KOR A;  4M3S A;  4ORF A;  3T9Y A;  4CS0 B;  1KUY A;  1YK3 A;  3EXN A;  3EY5 A;  4NJR A;  4P4I A;  4B13 A;  2POK A;  4K30 A;  4ZI6 A;  3B3C A;  1QST A;  3H8E A;  3KHX A;  2GLJ A;  2HUZ A;  2PRB A;  3ZJ0 A;  2J9A A;  3G8W A;  1NSA A;  2D4P A;  2JBJ A;  1QQ9 A;  3TT2 A;  2DEA A;  4P10 A;  3IWE A;  3WC6 A;  5H86 A;  2CY2 A;  1MJ9 A;  1P0H A;  2YNC A;  3C26 A;  4OME A;  4OC4 A;  4QVT A;  1NE9 A;  5AG7 A;  5C82 A;  2PJA A;  3I9S A;  2V8G A;  3CXQ A;  4MXU A;  3S9N A;  2KCW A;  2V8H A;  4MRI A;  4P4D A;  4P4E A;  1ZG7 A;  5G21 A;  4A2Z A;  2V8D A;  5F48 A;  4EME A;  3F8K A;  2ZOF A;  1S7L A;  2CNT A;  3RAM A;  1EE3 P;  3IC1 A;  4BMH A;  5JPH A;  4HNX B;  3WR7 A;  4B12 A;  2VQY A;  2P6G A;  2VXK A;  3D2P A;  2YNE A;  3R1K A;  4QB9 A;  4CRY B;  1ARM A;  2PVV A;  4W9Y A;  5CNP A;  5A28 A;  3UY5 A;  2VI7 A;  2Z3M A;  2X7B A;  1ZG9 A;  4L8A A;  1AYE A;  1KZF A;  2CIJ A;  4KOX A;  2PQ8 A;  2A4N A;  3CT9 A;  2B5G B;  2B3V A;  3DSB A;  3IWW A;  3KI9 A;  3PB6 X;  1F57 A;  4NGT A;  4UFW A;  3NH5 A;  2QYV A;  3TC8 A;  3D7H A;  4DYO A;  5IV0 A;  3FNC A;  1MJB A;  4FBE A;  2Q7S A;  4Z65 A;  3E0K A;  3QNV A;  4IK2 A;  3B8G A;  4KOU A;  4X3R A;  2G9D A;  4LX9 A;  5JH9 A;  1CP6 A;  3D7F A;  1TKJ A;  4FUU A;  2QIR A;  4MCP A;  4Q7A A;  5JM6 A;  4NJQ A;  3D4U A;  1SQH A;  5H84 A;  4PQA A;  3VWD A;  3H5Z A;  2JDC A;  3R95 A;  1JWQ A;  2GIV A;  1IU8 A;  2CNM A;  1IOF A;  3NH4 A;  4OID A;  3PFO A;  5HVG A;  4IAV A;  4MCR A;  2K5T A;  2WPW A;  2GRE A;  3D68 A;  3PP9 A;  1IGB A;  4MFQ A;  1I21 A;  1KUX A;  1YGH A;  4C2Y A;  4KVX A;  4Q36 A;  1XRY A;  1HEE A;  1ELM P;  4PK2 A;  2AFX A;  2Z10 A;  4NGR A;  3RZA A;  4UFX A;  2FVG A;  4ZBG A;  4AVB A;  2Q04 A;  3HUV A;  2Z3L A;  4TWE A;  4FD4 A;  2I3C A;  1WK4 A;  4G1P A;  4ONW A;  4OC2 A;  4PV6 A;  4AVA A;  2HB6 A;  4DUK A;  2EWB A;  4CYQ A;  1LCP A;  3FB3 A;  1B87 A;  1CBX A;  4CGP A;  4JWP A;  3DDD A;  2ZW7 A;  2Q0Y A;  3FMC A;  4M6G A;  3H8G A;  3EC4 A;  1S7N A;  5AGE A;  2BCO A;  1IID A;  4HNW B;  1PYT B;  4M6I A;  3BI0 A;  4PXE A;  4R57 A;  2D4O A;  2WSA A;  4II9 A;  3GYA A;  4UA3 A;  2Q7B A;  3EFA A;  4MFK A;  2C6P A;  3G3S A;  5K8O A;  1FY7 A;  3KZW A;  3VH9 A;  5AG4 A;  4LUA A;  1M4D A;  1XE4 A;  1Z4E A;  4BD9 A;  1CPS A;  4CGL A;  4U5Y A;  4NGQ A;  5GCN A;  4TNU A;  4F8Z A;  2ZEN A;  2IMO A;  5G20 A;  4BIN A;  4KUB A;  2ATR A;  1GYT A;  2FL4 A;  4MJ8 A;  3RYO A;  5D29 A;  2ZED A;  3FRM A;  4WWV A;  2YND A;  4JJX A;  3R9F A;  3RO0 A;  3IFE A;  5G1Z A;  2EK8 A;  3QB8 A;  3GUX A;  3TOB A;  4R3K A;  4OP4 A;  5HMN A;  4CAW A;  1AMP A;  2R1I A;  3FED A;  5KTD A;  3KR4 A;  1BPN A;  3PBE A;  5KTA A;  1A2Z A;  2FS5 A;  5F49 A;  1M4G A;  4JXQ A;  1TKF A;  2Q4Z A;  2Z11 A;  2BSW A;  3SI0 A;  3OWC A;  4PSX A;  5IB0 A;  3FIX A;  4NCZ A;  4P44 A;  4AVC A;  2J8M A;  4GS4 A;  3MGD A;  4OIW A;  1QSM A;  4I49 A;  2CXA A;  3F0A A;  3IWG A;  2PJ2 A;  1ZLH A;  2FE7 A;  4DNC A;  3R9E A;  5HH1 A;  4PSW A;  4OLL A;  4U9Y A;  3WC7 A;  2DXQ A;  2NYQ A;  3PZJ A;  2PSW A;  3DLJ A;  1XJO A;  2Z3O A;  2ABZ A;  2OB0 A;  1RXT A;  1S7K A;  2ZEP A;  3PB4 X;  2RFH A;  5LRJ A;  4H89 A;  1YW4 A;  3LD2 A;  3JTK A;  4FD6 A;  4OC5 A;  3S6F A;  4OC3 A;  2VL1 A;  2ZEE A;  4OKO A;  3RNZ A;  4CAX A;  4NEX A;  3IIB A;  2C1C A;  2ZW4 A;  4DJL A;  3DR8 A;  5IB9 A;  2PJ9 A;  4NGP A;  4MHP A;  4MY0 A;  4EVY A;  3D2M A;  1QSO A;  1Z8L A;  2PVW A;  3B3T A;  2PRQ A;  1DE4 C;  2BL1 A;  2PJ8 A;  2PDO A;  4X2T A;  4C7H A;  4E0A A;  3MN8 A;  1ZLI A;  2GFQ A;  5AG5 A;  1BOB A;  1ZG8 A;  4CRZ B;  5J8F A;  3ISZ A;  3TX8 A;  1TKH A;  4YFJ A;  1Z5R A;  2EUI A;  4UEE A;  3SI1 A;  5LRG A;  5AG6 A;  1NMT A;  2RB7 A;  2AFM A;  1KUV A;  2PJ4 A;  4P45 A;  5HXD A;  1VHS A;  5DWN A;  1IB1 E;  1VIX A;  1NSL A;  3FF3 A;  5EC4 A;  1ZO0 A;  3PB9 X;  2GLF A;  3P2F A;  2VZY A;  5ELY A;  2QJ8 A;  4J3G A;  4UCN A;  4B5O A;  2VZZ A;  1H8L A;  4JLY A;  3PRT A;  5CPA A;  4IUS A;  4XPD B;  5D8N A;  4RI1 A;  3TTH A;  3PB8 X;  4ZY0 A;  3KGQ A;  5IX3 A;  2FSR A;  4B5P A;  1BO4 A;  4R7M A;  2IQ6 A;  1S7F A;  1Y9W A;  4C7I A;  1Y0R A;  3DNS A;  5HVF A;  5F09 A;  3RBU A;  2VBQ A;  3SHP A;  4CYN A;  1LAM A;  3V8I A;  2QEC A;  2ZW6 A;  4F0X A;  5F46 A;  4RN7 A;  2GU2 A;  1CG2 A;  3H8F A;  4LQ6 A;  3V38 A;  4A32 A;  4AG9 A;  3T90 A;  4H6Z A;  2B3U A;  4UEF A;  4HPS A;  1Z9U A;  1VHE A;  5C88 A;  2C6C A;  3SXO A;  1I12 A;  4KUA A;  4XPK A;  5THW A;  2O28 A;  2ZOG A;  2JEW A;  1LRZ A;  4A33 A;  1PU9 A;  4E2A A;  3GY9 A;  3FH4 A;  3KHZ A;  3TO7 A;  3KKW A;  1LFW A;  1MJA A;  4MMO A;  4FD5 A;  3CDX A;  3N5F A;  2O4H A;  4JD6 A;  4F9U A;  5JGF A;  2GE3 A;  5LRK A;  1Y7E A;  4P4F A;  4YWY A;  1VKC A;  1JQG A;  1TIQ A;  1VGY A;  2ZW5 A;  2IJZ A;  4KVM E;  1X12 A;  1IY7 A;  2AJ6 A;  5F47 A;  4RUH A;  3D7G A;  2AE6 A;  3KL9 A;  2BO9 A;  4M6H A;  4R9M A;  1CM0 A;  8CPA A;  4Y49 B;  1R3N A;  3D7D A;  1TXR A;  2BUE A;  3D67 A;  1IOI A;  4MFL A;  2I79 A;  2PR1 A;  3CZX A;  1UWY A;  4KOS A;  1S60 A;  2B4B A;  4H2K A;  3F5B A;  4B11 A;  4M85 A;  1CJW A;  3GIU A;  2ZEM A;  3CPA A;  2FIW A;  1YX0 A;  3GB0 A;  2AFS A;  4MCS A;  4Q38 A;  2PIY A;  4UIB A;  3FEC A;  3PFE A;  4KS9 A;  4C68 A;  3NFZ A;  3KR5 A;  2ZPA A;  3GKR A;  5J1Q A;  2DF5 A;  3K2K A;  1TF8 A;  4CAE A;  2R8V A;  4O23 A;  3R96 A;  2PJ1 A;  1L0C A;  2PJB A;  2XEJ A;  3V7Z A;  3FEE A;  3W6X A;  1N71 A;  4R87 A;  3W91 A;  4MHN A;  4ONU A;  1IYL A;  2EBJ A;  3B7I A;  3KQZ A;  1QSR A;  2OR4 A;  1XIX A;  2P6F A;  3FVL A;  4B5P B;  4MCQ A;  4R6T A;  2G3A A;  2ZEL A;  3R9G A;  2FIA A;  5I4M A;  2PJ6 A;  1IYK A;  3JUW A;  4KLV A;  1F2P A;  1S3Z A;  4NGS A;  2BOA A;  3LOD A;  5KTC A;  4PK3 A;  2HV2 A;  1F2O A;  4KSA A;  5J8C A;  3KAS A;  4NSQ A;  4IHM A;  2G0B A;  3D66 A;  4KOY A;  2XEI A;  4CGN A;  3K9U A;  4A95 A;  6CPA A;  2Q4V A;  1FNO A;  3WC5 A;  4OC1 A;  1I1D A;  1BLL E;  4LQG A;  5DS0 A;  2Z3K A;  3FYN A;  3DGV A;  4NGN A;  1Z2L A;  3SJE A;  2OZH A;  4K3N A;  4P4J A;  3VWE A;  1M44 A;  1J4J A;  5E96 A;  1B6B A;  1MK4 A;  2B4D A;  5I0C A;  3NH8 A;  4JXR A;  5LYL A;  4KLW A;  4A38 A;  4EFD A;  3QAY A;  4ZX9 A;  3JRU A;  4MY3 A;  3TO6 A;  3FBU A;  2CNS A;  2HQY A;  3I3G A;  2Z3P A;  2G3T A;  2Q43 A;  2V8V A;  4R3L A;  2Z0Z A;  4R8F A;  1PUA A;  1R57 A;  3SJX A;  2WPX A;  1YLE A;  2VEZ A;  2HC9 A;  4KOV A;  1R43 A;  1Z4R A;  3BXM A;  4ZY1 A;  3BJ8 A;  3FXT A;  2B58 A;  1XEB A;  1RO5 A;  4B14 A;  2JLM A;  1YVK A;  2AFO A;  1CP7 A;  3KQX A;  2J8N A;  3PB7 X;  4X8I A;  3LAC A;  2Y0M A;  5LYI A;  2OOT A;  4CGM A;  1YQE A;  4MHZ A;  1Z8X A;  4UFV A;  1XFO A;  1K4J A;  1Y9K A;  1YR0 A;  3IJ3 A;  4IF5 A;  5EMI A;  3CXP A;  1CPX A;  3DR6 A;  2PJ7 A;  2CF4 A;  1VHO A;  1LAN A;  3CXS A;  4ZGY B;  4XNH C;  1HDU A;  1YVO A;  4PPZ A;  3W6S A;  4QBJ A;  3TFY A;  5K8N A;  1Q2C A;  3TCV A;  1GHE A;  4KOT A;  4MHY A;  2ZEF A;  3L2N A;  1BPM A;  5LYF A;  4AB7 A;  1YW6 A;  2QML A;  1QSN A;  1CX8 A;  4PXB A;  1XF8 A;  2FCK A;  2ZXV A;  4AXV A;  4MFP A;  2FT0 A;  2XEF A;  1XOV A;  5BWA B;  4L89 A;  2JEV A;  1S5K A;  2ZEG A;  1KWM A;  4B6Z A;  4NFR A;  3SI2 A;  1OBR A;  1YSJ A;  1M4I A;  2OZG A;  3TO9 A;  2XEG A;  3LWU A;  3FJU A;  3IU1 A;  3I1U A;  4QC6 A;  4F0Y A;  3SXN A;  4A30 A;  2I00 A;  4KSI A;  2PJC A;  4YU9 A;  3SJG A;  1Q7L A;  4F9V A;  2R7H A;  5JQ4 A;  4QUS A;  4OAE A;  2BEI A;  1BAV A;  1X10 A;  2F8H A;  4PXC A;  1PCA A;  1LAP A;  2P6E A;  3MRU A;  4YGO A;  4ZY2 A;  1V0C A;  3NE7 A;  2B4D B;  3BJ7 A;  4CPA A;  4AG7 A;  5ISV A;  4FD7 A;  1ARL A;  1XMT A;  1YLO A;  4UF4 A;  4JYW A;  4GM5 A;  2WYR A;  5K8P A;  2Q51 A;  3A9L A;  4NXY A;  4UIA A;  4UWI A;  5G22 A;  4GXH A;  3WT4 A;  1M1D A;  3QAH A;  2OH1 A;  4CGO A;  3P2H A;  1HDQ A;  2ODF A;  3T8W A;  4H6U A;  3VAT A;  1AUG A;  1XBU A;  1LOK A;  1M4L A;  3B35 A;  4UBR A;  2CTC A;  4XPD C;  4UCM A;  1Y7R A;  1UFH A;  2PIZ A;  4WJB A;  2Q4Y A;  2WZN A;  4KSF A;  1RTQ A;  2PJ0 A;  3B3V A;  2NSM A;  3PGP A;  3D3S A;  4R76 A;  4UWJ A;  5HVH A;  2JDD A;  3TOA A;  5EBV A;  2DPT A; 
#chains in the Genus database with same CATH homology
 3H4Q A;  4BBH A;  3IU2 A;  2Q44 A;  3S6H A;  4UCP A;  4CAF A;  5FVJ A;  4MFJ A;  1OZP A;  4KZT A;  3D8P A;  4MI4 A;  2WUU A;  4E8O A;  4CAV A;  3EO4 A;  1IIC A;  4KOW A;  4MFZ A;  4CYO A;  2C27 A;  2F5I A;  3ZZI A;  2RC4 A;  2P0W A;  2YGW A;  4C2Z A;  4B10 A;  2OZU A;  1Q2Y A;  4YRH A;  2Z3N A;  2DPS A;  1P4N A;  2EVN A;  2IL4 A;  3S6G A;  2PR8 A;  4Y49 C;  2REF A;  3IGR A;  1YRE A;  4HNY B;  2B5G A;  3JVN A;  2YNC C;  4RS2 A;  2OU2 A;  4U9Z A;  4A31 A;  2NMT A;  2REE A;  5DWM A;  4MBU A;  1Q2D A;  1WWZ A;  4CYP A;  3BLN A;  4HKF A;  3TE4 A;  5A27 A;  2H5M A;  1U6M A;  2GAN A;  4NF1 A;  4X5K A;  1ON0 A;  2ARH A;  2R98 A;  4XNH B;  4KVO E;  2PC1 A;  3N7Z A;  4OAD A;  4XPL A;  4MHD A;  4F6A A;  2J8R A;  4C2X A;  3S6K A;  2FXF A;  4KOR A;  4M3S A;  4ORF A;  3T9Y A;  4CS0 B;  1KUY A;  1YK3 A;  3EXN A;  3EY5 A;  2DPT A;  4B13 A;  4K30 A;  1QST A;  2HUZ A;  2PRB A;  3ZJ0 A;  3G8W A;  2D4P A;  3TT2 A;  3IWE A;  5H86 A;  2CY2 A;  1MJ9 A;  1P0H A;  2YNC A;  3C26 A;  4QVT A;  5KTA A;  5AG7 A;  1NE9 A;  5C82 A;  3I9S A;  3CXQ A;  2KCW A;  4A2Z A;  5G21 A;  5F48 A;  3F8K A;  1S7L A;  2CNT A;  4BMH A;  5JPH A;  4HNX B;  3WR7 A;  4B12 A;  2VQY A;  2P6G A;  2VXK A;  3D2P A;  2YNE A;  3R1K A;  4QB9 A;  4CRY B;  5CNP A;  5A28 A;  3UY5 A;  2VI7 A;  2Z3M A;  2X7B A;  4L8A A;  1KZF A;  4KOX A;  2PQ8 A;  2A4N A;  4UFW A;  2B5G B;  2B3V A;  3DSB A;  5IV0 A;  3FNC A;  1MJB A;  3E0K A;  3B8G A;  4KOU A;  4LX9 A;  2QIR A;  1SQH A;  5H84 A;  3VWD A;  3H5Z A;  2JDC A;  3R95 A;  2GIV A;  2CNM A;  2K5T A;  2WPW A;  3PP9 A;  4MFQ A;  1KUX A;  1I21 A;  1YGH A;  4C2Y A;  4KVX A;  4Q36 A;  4PK2 A;  2Z10 A;  4UFX A;  4ZBG A;  4AVB A;  2Q04 A;  2Z3L A;  4FD4 A;  4AVA A;  1WK4 A;  4PV6 A;  4CYQ A;  3FB3 A;  1B87 A;  4CGP A;  4JWP A;  3DDD A;  2ZW7 A;  2Q0Y A;  3EC4 A;  1S7N A;  5AGE A;  1IID A;  4HNW B;  4R57 A;  2D4O A;  2WSA A;  4II9 A;  3GYA A;  4UA3 A;  2Q7B A;  3EFA A;  4MFK A;  3G3S A;  1FY7 A;  5AG4 A;  4LUA A;  1M4D A;  1XE4 A;  1Z4E A;  4CGL A;  4U5Y A;  5GCN A;  5G20 A;  4KUB A;  2ATR A;  2FL4 A;  4MJ8 A;  3RYO A;  3FRM A;  2YND A;  4JJX A;  3R9F A;  5G1Z A;  3QB8 A;  3TOB A;  4R3K A;  5HMN A;  4CAW A;  2R1I A;  5KTD A;  2FS5 A;  5F49 A;  1M4G A;  4JXQ A;  2Z11 A;  2BSW A;  4PSX A;  5IB0 A;  3FIX A;  4NCZ A;  4AVC A;  2J8M A;  4GS4 A;  3MGD A;  1QSM A;  4I49 A;  2CXA A;  3F0A A;  3IWG A;  2FE7 A;  4DNC A;  3R9E A;  5HH1 A;  4PSW A;  4OLL A;  4U9Y A;  2DXQ A;  3PZJ A;  2PSW A;  2Z3O A;  2OB0 A;  1RXT A;  1S7K A;  4H89 A;  3LD2 A;  3JTK A;  4FD6 A;  3S6F A;  4CAX A;  4NEX A;  2ZW4 A;  3DR8 A;  4MY0 A;  4EVY A;  3D2M A;  1QSO A;  2BL1 A;  2PDO A;  4C7H A;  4E0A A;  5AG5 A;  1BOB A;  4CRZ B;  5J8F A;  4YFJ A;  2EUI A;  5AG6 A;  1NMT A;  1KUV A;  1VHS A;  5DWN A;  1IB1 E;  1NSL A;  5EC4 A;  1ZO0 A;  3P2F A;  4B5O A;  2VZY A;  4J3G A;  4UCN A;  2VZZ A;  4JLY A;  4IUS A;  4XPD B;  3TTH A;  4RI1 A;  5IX3 A;  2FSR A;  4B5P A;  1BO4 A;  4C7I A;  1S7F A;  1Y9W A;  3DNS A;  2VBQ A;  3SHP A;  4CYN A;  3V8I A;  2QEC A;  2ZW6 A;  4F0X A;  5F46 A;  4A32 A;  4AG9 A;  3T90 A;  4H6Z A;  2B3U A;  1Z9U A;  5C88 A;  3SXO A;  1I12 A;  4KUA A;  4XPK A;  2O28 A;  1LRZ A;  4A33 A;  1PU9 A;  4E2A A;  3GY9 A;  3TO7 A;  3KKW A;  1MJA A;  4FD5 A;  4JD6 A;  2GE3 A;  1VKC A;  2ZW5 A;  1TIQ A;  4KVM E;  2AJ6 A;  5F47 A;  2AE6 A;  4R9M A;  1CM0 A;  4Y49 B;  2BUE A;  4MFL A;  2I79 A;  2PR1 A;  4KOS A;  1S60 A;  2B4B A;  3F5B A;  4B11 A;  4M85 A;  1CJW A;  2FIW A;  1YX0 A;  4Q38 A;  4KS9 A;  4C68 A;  2ZPA A;  3GKR A;  4CAE A;  2R8V A;  3R96 A;  1L0C A;  3W6X A;  1N71 A;  4R87 A;  3W91 A;  4ONU A;  1IYL A;  1QSR A;  1XIX A;  2P6F A;  4B5P B;  2G3A A;  3R9G A;  2FIA A;  1IYK A;  3JUW A;  4KLV A;  1S3Z A;  5KTC A;  3LOD A;  4PK3 A;  2HV2 A;  4KSA A;  5J8C A;  4NSQ A;  2G0B A;  4KOY A;  4CGN A;  3K9U A;  4A95 A;  2Q4V A;  1I1D A;  2Z3K A;  3FYN A;  2OZH A;  3VWE A;  1M44 A;  1J4J A;  5E96 A;  1B6B A;  1MK4 A;  2B4D A;  5I0C A;  4JXR A;  4KLW A;  4MY3 A;  3TO6 A;  3FBU A;  2CNS A;  2HQY A;  3I3G A;  2Z3P A;  2G3T A;  4R3L A;  2Z0Z A;  1PUA A;  1R57 A;  2WPX A;  1YLE A;  2VEZ A;  4KOV A;  1Z4R A;  3BJ8 A;  3FXT A;  2B58 A;  1XEB A;  1RO5 A;  4B14 A;  2JLM A;  1YVK A;  2J8N A;  4CGM A;  2Y0M A;  4UFV A;  1K4J A;  1Y9K A;  1YR0 A;  4IF5 A;  3CXP A;  3DR6 A;  3CXS A;  4ZGY B;  4XNH C;  1YVO A;  3W6S A;  4QBJ A;  3TFY A;  1Q2C A;  3TCV A;  1GHE A;  4KOT A;  4AB7 A;  2QML A;  1QSN A;  1XF8 A;  2FCK A;  2ZXV A;  4MFP A;  2FT0 A;  5BWA B;  4L89 A;  2JEV A;  1S5K A;  1M4I A;  2OZG A;  3TO9 A;  3IU1 A;  4QC6 A;  4F0Y A;  3SXN A;  4A30 A;  2I00 A;  2R7H A;  5JQ4 A;  4QUS A;  4OAE A;  2BEI A;  2P6E A;  4YGO A;  3NE7 A;  1V0C A;  2B4D B;  3BJ7 A;  4AG7 A;  5ISV A;  4FD7 A;  1XMT A;  3A9L A;  4NXY A;  5G22 A;  4UWI A;  1M1D A;  3QAH A;  2OH1 A;  4CGO A;  3P2H A;  4H6U A;  4UBR A;  4XPD C;  4UCM A;  1Y7R A;  1UFH A;  2Q4Y A;  4KSF A;  3PGP A;  3D3S A;  4UWJ A;  2JDD A;  3TOA A;  5EBV A;  3OWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...