2VQYA

Structure of aac(6')-ib in complex with parmomycin and acetylcoa.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
177
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 53
structure length 177
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vqyA00
2CNMA 2QIRA 3R1KA 2Z11A 1Y9KA 2FSRA 4HKFA 1QSMA 4NXYA 2EUIA 2ZW7A 3W91A 2ATRA 2VXKA 4H6ZA 3PGPA 3JUWA 1QSNA 1B87A 3TOAA 4OAEA 3ZJ0A 2A4NA 3IGRA 2PR8A 3R9EA 4E8OA 4JLYA 3R9GA 1M4IA 3BJ8A 2HQYA 3FRMA 1VHSA 3T90A 3TOBA 3PP9A 4YRHA 3OWCA 1KZFA 2FXFA 4LX9A 2Q04A 2OB0A 2R98A 4RI1A 2WPWA 2FL4A 1S3ZA 3TFYA 4UWJA 4JXRA 4IUSA 4L89A 4KVXA 1MJ9A 4E0AA 1U6MA 1Z9UA 3T9YA 1I1DA 3E0KA 3TT2A 5EC4A 3QAHA 4RS2A 2J8MA 4MBUA 1TIQA 4KOYA 1XE4A 3CXPA 4Y49B 1QSOA 1S7NA 1RO5A 5C88A 4PSWA 3S6FA 4HNWB 2JLMA 1CM0A 2OZUA 3W6XA 3FBUA 4FD6A 2P0WA 2K5TA 4CAWA 4R3LA 4CAXA 4XPDB 2REEA 5J8FA 1K4JA 3FNCA 1N71A 2FIWA 2OZHA 2Q4YA 2Q44A 4KOTA 4Y49C 1NE9A 4AVCA 1Z4RA 3LD2A 2BL1A 2HUZA 3TE4A 2D4PA 4XNHB 4R57A 2QMLA 5CNPA 2VEZA 2JDDA 4AB7A 5H84A 3GKRA 4UBRA 3VWDA 2AE6A 4OADA 2B4BA 5IX3A 4KLVA 3BJ7A 3I9SA 2G3TA 2B5GB 4M85A 4IF5A 3SXOA 3UY5A 1SQHA 1Q2YA 3DNSA 1Y9WA 3D2MA 2I79A 1LRZA 4MHDA 4YGOA 1FY7A 3BLNA 1S7KA 2BSWA 1XIXA 2OU2A 2CY2A 2VQYA 3IWGA 4KOXA 4AG7A 3S6GA 4CS0B 4ORFA 1IICA 5I0CA 2REFA 2R8VA 3K9UA 1S7FA 3DR8A 3TCVA 5HMNA 4QBJA 3EY5A 5ISVA 2HV2A 3RYOA 4ZBGA 3FXTA 4QB9A 2BUEA 3R95A 2ZW5A 3FYNA 2BEIA 2ZXVA 2DXQA 4NCZA 1PU9A 2ARHA 3B8GA 2FS5A 2GIVA 2P6EA 1L0CA 4KUBA 1I12A 4CRZB 3D3SA 4KVME 1KUYA 2CNTA 5JPHA 3JVNA 1OZPA 2B58A 2PQ8A 4PK3A 4AVBA 4M3SA 2P6FA 2D4OA 2WPXA 1KUVA 4XPKA 5IV0A 4LUAA 4HNYB 3I3GA 2QECA 2PR1A 4KVOE 2FE7A 5KTCA 5F49A 2AJ6A 1M4GA 4MJ8A 3D2PA 3C26A 2PC1A 3QB8A 1YR0A 4JXQA 1S7LA 5KTDA 1PUAA 4PSXA 3TTHA 4L8AA 4QC6A 2OZGA 3PZJA 4U9YA 3SXNA 2B3UA 4QVTA 4B5PA 4J3GA 4F0YA 1VKCA 1YX0A 1V0CA 5IB0A 3TO9A 2B4DA 4KOSA 2Q4VA 4R87A 3DDDA 1WWZA 1M44A 1P4NA 5EBVA 3EFAA 3F5BA 3LODA 4XPDC 2C27A 1YK3A 3P2FA 5F46A 2Q0YA 2ZW4A 3D8PA 2B3VA 2EVNA 2Y0MA 1J4JA 2O28A 1P0HA 3SHPA 2J8RA 2ZW6A 4R9MA 3TO7A 1GHEA 3DR6A 4FD5A 1QSRA 1XF8A 4CRYB 3S6HA 1MJAA 4XNHC 2GE3A 4I49A 3W6SA 4K30A 1IB1E 1R57A 3F8KA 2GANA 2R7HA 1UFHA 4UA3A 1XEBA 2G0BA 5GCNA 3V8IA 4YFJA 1CJWA 4MY3A 4JWPA 4H6UA 1XMTA 1YLEA 4KOWA 4PV6A 3FB3A 2OH1A 4QUSA 4GS4A 5FVJA 1S60A 1BO4A 1WK4A 3P2HA 5J8CA 4MY0A 3NE7A 3H4QA 1IIDA 3KKWA 2F5IA 5KTAA 1IYLA 4U9ZA 4II9A 1Q2CA 4MI4A 4ONUA 2PSWA 4NEXA 4AG9A 2R1IA 2PDOA 4KUAA 4UWIA 2VBQA 3G3SA 2FCKA 3R96A 2JEVA 4PK2A 2ZPAA 4KZTA 2FIAA 1Q2DA 2J8NA 3MGDA 2X7BA 1BOBA 4B5OA 4FD7A 2IL4A 5DWMA 3VWEA 4NSQA 5F47A 1YGHA 5JQ4A 4X5KA 2Z0ZA 3F0AA 3G8WA 4NF1A 4U5YA 1MK4A 4CAVA 1YREA 5C82A 1Y7RA 3CXQA 5HH1A 1QSTA 1ON0A 2CNSA 3S6KA 3EXNA 1M4DA 1MJBA 5F48A 1YVOA 3CXSA 4JD6A 3DSBA 3EC4A 4KOVA 2NMTA 2VZYA 1M1DA 4F6AA 1KUXA 3R9FA 4JJXA 1NMTA 1IYKA 4H89A 3FIXA 4E2AA 2B5GA 2P6GA 2Z10A 3TO6A 2VI7A 4BMHA 2VZZA 4HNXB 5DWNA 5E96A 1RXTA 2JDCA 4KLWA 1YVKA 4OLLA 4XPLA 3ZZIA 1NSLA 4FD4A 2RC4A 3GYAA 4EVYA 2PRBA 1B6BA 3EO4A 3GY9A 4DNCA 4B5PB 3N7ZA 2Q7BA 2G3AA 1Z4EA 3WR7A 1I21A 2B4DB 2KCWA 2H5MA 5H86A 4KORA 4AVAA 4R3KA 2FT0A 1S5KA 4KOUA 2I00A
chains in the Genus database with same CATH superfamily
2CNMA 1Z8TA 2YNEA 2QIRA 4RN7A 2PIZA 2F7VA 1CPXA 4X3RA 3R1KA 2Z11A 3TX8A 2XEFA 1Y9KA 2FSRA 4HKFA 1QSMA 2ODFA 3FECA 4NXYA 2EUIA 2PE3A 2C6GA 2ZW7A 4A2ZA 4BBHA 3W91A 5EMIA 3V38A 2ATRA 2V8GA 2VXKA 4H6ZA 3PGPA 4P4BA 2BO9A 1YSJA 3FEDA 3JUWA 3SJGA 4MMOA 1H8LA 1QSNA 4YU9A 3KQZA 7CPAA 1IOFA 2PIYA 1B87A 1GYTA 3B3TA 4OAEA 3TOAA 4UEZA 2EWBA 3ZJ0A 2A4NA 4UIBA 3IGRA 1Z8WA 2PR8A 1AYEA 4ZY2A 3R9EA 4C2XA 4E8OA 4A33A 3JRUA 4JLYA 3R9GA 1M4IA 2XEGA 1A2ZA 4TNUA 2DPSA 3BJ8A 3PBEA 2HQYA 3FRMA 2ZOGA 2EBJA 3KHZA 4PXBA 1VHSA 3B35A 4B13A 4OC4A 4IAVA 3T90A 3TOBA 3B3WA 3PP9A 4YRHA 4MRIA 3OWCA 1KZFA 2FXFA 4LX9A 2Q04A 2OB0A 2R98A 4RI1A 2WPWA 2FL4A 1S3ZA 2PJ1A 3SI2A 3TFYA 4UWJA 4JXRA 4WWVA 4BINA 1R43A 3D7GA 2ZEOA 3PFEA 4IUSA 3CDXA 4L89A 4KVXA 3IJ3A 1MJ9A 4E0AA 1U6MA 4ZY1A 1Z9UA 2QYVA 3PRTA 4M6IA 3T9YA 1I1DA 1IY7A 3E0KA 3TT2A 5EC4A 4GXHA 3QAHA 3QNVA 1QMUA 2AFMA 3D66A 4Q36A 1HDUA 4RS2A 3WT4A 3CPAA 4F9VA 2J8MA 2GLFA 4MBUA 3BHXA 1TIQA 2CXAA 4KOYA 4UFVA 2JEWA 3HUVA 1XE4A 1DTDA 3CXPA 4Y49B 1QSOA 1S7NA 1RO5A 4A37A 3SJEA 4NGTA 5C88A 2PRQA 4PSWA 1NSAA 3S6FA 5DS0A 2PJ6A 1LFWA 2EO8A 2PJBA 4HNWB 5AGEA 2JLMA 4F9UA 2Q4ZA 1CM0A 2ZEFA 2OZUA 2ZEMA 4LQGA 3FBUA 3W6XA 5HVHA 1YQEA 1XOVA 3PB9X 3PBBA 2Z3NA 3NH8A 4FD6A 2P0WA 2K5TA 1XMBA 1ZLHA 4CAWA 4C2ZA 3A9LA 2ZEPA 4F0XA 5JH9A 4R3LA 4CAXA 3ISXA 4EWTA 3IU1A 5HVFA 1AMPA 4XPDB 3FF3A 2REEA 4KSFA 3KHXA 2Z3KA 1JQGA 4MFPA 5J1QA 5J8FA 1X12A 5AG7A 1K4JA 4KS9A 1F57A 3FNCA 1N71A 2FIWA 2OZHA 2Q4YA 2Q44A 3DGVA 1BLLE 4JZ0A 1Z5RA 4FBEA 1BPNA 4KOTA 1NE9A 4Y49C 1XFOA 4AVCA 4MCQA 4CPAA 4YWYA 4R8FA 1Q7LA 1Z4RA 3LD2A 3ISZA 4MFKA 2BL1A 1LCPA 3LWUA 2ZOFA 4P4DA 4A32A 2HUZA 4RUHA 2FVGA 3TE4A 4FAIA 2D4PA 4XNHB 1EE3P 2ANPA 3IEHA 2NSMA 3GIUA 4R57A 3MRUA 2QMLA 5LYIA 5CNPA 5JM6A 4P6YA 2Q7SA 2VEZA 1FNOA 2AFXA 1CPSA 1CBXA 3B3CA 4ZX8A 2JDDA 2POKA 2C1CA 4AB7A 5H84A 2IJZA 3GKRA 1VIXA 1AUGA 1YLOA 4UBRA 2RB7A 3PB6X 3VWDA 2WYRA 2AE6A 1YW4A 4CYNA 5IB9A 4DJLA 4OADA 2B4BA 5IX3A 4KLVA 4P45A 2YNCC 2CF4A 4H2KA 4MHPA 1LAPA 1IOIA 3RNZA 3BJ7A 3S9MA 3I9SA 2G3TA 4OIWA 4OMEA 2B5GB 4M85A 4IF5A 5G1ZA 5LRJA 4C2YA 3SXOA 2CTBA 3UY5A 1SQHA 1Q2YA 1R3NA 3BI0A 2ZEDA 2ZEEA 3DNSA 1TXRA 3NH4A 1Y9WA 3D2MA 1TKHA 5CPAA 2PJ5A 1BAVA 1F2PA 1LRZA 2I79A 3H8FA 4MHDA 4NGQA 4NGSA 3D4UA 3KZWA 4OIDA 4UFXA 4YGOA 3WABA 2J9AA 2O4HA 4A95A 1FY7A 3BLNA 1S7KA 2BSWA 3WC7A 3D7HA 1XIXA 2OU2A 3N5FA 4NGRA 2CY2A 1ELLP 2VQYA 4P10A 3IWGA 4KOXA 2PJ2A 3I1UA 4AG7A 4IK2A 6CPAA 3S6GA 1ZG9A 3FVLA 2V8DA 4CS0B 4ORFA 3KI9A 4ZGYB 1IICA 5I0CA 2REFA 2R8VA 3MN8A 2PJ4A 3K9UA 1S7FA 1HDQA 3DR8A 3BI1A 3TCVA 4MHYA 5HMNA 4QBJA 3EY5A 3T8WA 3GB0A 4DUKA 5ISVA 2HV2A 5AG6A 3RAMA 3S9LA 3RYOA 2Q43A 2RFHA 4ZBGA 5LRKA 1ZO0A 3K2KA 3PB4X 3SJFA 3FXTA 4QB9A 4F8ZA 2BUEA 2AFZA 1Y0RA 3R95A 1OBRA 2ZW5A 3FYNA 2BEIA 2ZXVA 4AXVA 2DXQA 4NCZA 1PU9A 4KSAA 2CTCA 2ARHA 4W9YA 3IU2A 5LYFA 3B8GA 2FS5A 5ELYA 2O53A 4OP4A 1PYTB 4MFZA 4NGMA 3IWWA 2GIVA 2P6EA 3H8GA 1L0CA 4KUBA 1I12A 4CAFA 4CRZB 3D3SA 4KVME 4JYWA 2PCUA 1KUYA 5C82A 4CAEA 4B11A 5D8NA 2Z3PA 3FEEA 2CNTA 2YNDA 3TC8A 2QVPA 5JPHA 1F2OA 3JVNA 1OZPA 2B58A 2PQ8A 4PK3A 4AVBA 4M3SA 2P6FA 2D4OA 2ZEGA 2WPXA 2YGWA 1KUVA 4XPKA 5IV0A 2YNCA 4LUAA 4HNYB 3I3GA 5HVGA 2QECA 2PR1A 4KVOE 3RBUA 2FE7A 5KTCA 5F49A 2AJ6A 1M4GA 2PJ7A 4X2TA 3IO1A 4MJ8A 3D2PA 5F09A 3C26A 2PC1A 3QB8A 1YR0A 4JXQA 5THWA 1S7LA 1CG2A 2ZENA 2OOTA 5KTDA 1PUAA 4PSXA 4UEEA 2Z3LA 3TTHA 4L8AA 4QC6A 3KGQA 2OZGA 3PZJA 2HC9A 4G1PA 4U9YA 3SXNA 2B3UA 3NH5A 2DEAA 4QVTA 4B5PA 4J3GA 4OKOA 3D7DA 3V7ZA 1VKCA 3KR5A 4F0YA 5K8NA 2IQ6A 5LRGA 1YX0A 1RTQA 1M4LA 2C6PA 4CGNA 1V0CA 2PVWA 2BOAA 5IB0A 3TO9A 2B4DA 4KOSA 5HXDA 2Q4VA 2PJCA 4R87A 3DDDA 4PQAA 1WWZA 4LQ6A 1M44A 1P4NA 1Z8LA 3CT9A 8CPAA 5G20A 5EBVA 3EFAA 3F5BA 3LODA 1BPMA 1XJOA 4XPDC 4O23A 4CYQA 2C27A 1LOKA 1YK3A 1LANA 3P2FA 4UIAA 2Q0YA 5F46A 2ZW4A 4CYOA 2V8VA 3D8PA 4B14A 2B3VA 4PXCA 1CP6A 3QAYA 2EVNA 2Y0MA 2PVVA 1J4JA 1ZG8A 1ZG7A 2G9DA 2O28A 4K3NA 1P0HA 4ZX9A 3SHPA 1VGYA 3WC6A 2CIJA 2J8RA 1ARLA 2ZW6A 3B2YA 4R9MA 3TO7A 3VARA 1GHEA 3DR6A 1TKJA 1ZLIA 5D29A 4FD5A 2GU2A 4P44A 4B12A 3S9NA 4OC2A 2Z3MA 4CYPA 1QSRA 1XF8A 4BD9A 4CRYB 3S6HA 1MJAA 3BXMA 1Z8XA 2ZEHA 4NFRA 3B3SA 4XNHC 3KQXA 3CZXA 5G21A 4FWUA 2GE3A 4I49A 4A39A 4A94A 3W6SA 4K30A 1IB1E 1R57A 3F8KA 2GANA 1IGBA 2R7HA 4C68A 1UFHA 2IMOA 3HLPA 3JTKA 5LYLA 2F8HA 1UWYA 2C6CA 4UA3A 1XEBA 2G0BA 5GCNA 3V8IA 4YFJA 4Z65A 1CJWA 1YW6A 3D68A 3NA6A 4MY3A 3KASA 2DF5A 1VHOA 1TKFA 1YMEA 4KSIA 3H8EA 4JWPA 1FT7A 4MXUA 3IWEA 4H6UA 4ONWA 1XMTA 1YLEA 4KOWA 4PV6A 4R76A 4TWEA 2PJ0A 4B10A 3FB3A 2PJ9A 2OH1A 4CGOA 4QUSA 2AFSA 4GS4A 4P4JA 2XEJA 4P4IA 5FVJA 5LYDA 1X10A 1S60A 1BO4A 2AFOA 4PXDA 1WK4A 3SI1A 4NGNA 3SI0A 2HB6A 4WJBA 3P2HA 5J8CA 4MY0A 3NE7A 3DLJA 3H4QA 1IIDA 4X8IA 3KKWA 2F5IA 5KTAA 1IYLA 2OR4A 4KOUA 3L2NA 4U9ZA 1Q2CA 4MI4A 4ONUA 4II9A 2PSWA 3LACA 4MFQA 4NEXA 1LAMA 3PFOA 4Q38A 4AG9A 4OC0A 2R1IA 2PDOA 3LMSA 4MHZA 4KUAA 4FUUA 4UWIA 2VBQA 3H5ZA 3G3SA 2PJ3A 2FCKA 3RZAA 4EFDA 4UFWA 3NE8A 3R96A 4P4EA 1VHEA 2JEVA 4PK2A 4MCSA 1ARMA 3IIBA 2ZPAA 4R6TA 4IHMA 4KZTA 4C7HA 5A27A 4UCNA 2FIAA 2VL1A 2WZNA 4OC1A 3IC1A 1ELMP 1Q2DA 2J8NA 4MCPA 4OC3A 2EK9A 3MGDA 2X7BA 5K8MA 5K8PA 2GFQA 1BOBA 1TF9A 2PJ8A 1KWMA 4FD7A 4B5OA 3CPXA 2WSAA 2IL4A 5DWMA 4A30A 3VWEA 1Z2LA 4NSQA 2DPTA 1YGHA 5F47A 4CGMA 3D7FA 5JQ4A 4X5KA 4M6HA 4A38A 1Y0YA 2Z0ZA 3F0AA 3G8WA 2JBJA 4NF1A 3WC5A 4A31A 4U5YA 4NJRA 2XEIA 4NGPA 3GLJA 1MK4A 3D67A 4CAVA 1YREA 1JWQA 1Y7RA 2AFWA 3NFZA 4B6ZA 1IU8A 4MFLA 4NJQA 3CXQA 5HH1A 1XRYA 4ZYQA 5G22A 2Q51A 1QSTA 2ZELA 1HEEA 1ON0A 2BCOA 2CNSA 3SJXA 3S6KA 1CX8A 2WUUA 3EXNA 1M4DA 4PPZA 1MJBA 5F48A 1YVOA 3CXSA 4M6GA 3RO0A 4JD6A 3DSBA 5JGFA 3EC4A 4KOVA 5CBMA 4DYOA 4GM5A 5K8OA 2NMTA 2VZYA 1M1DA 4F6AA 1KUXA 3R9FA 4JJXA 1NMTA 1IYKA 4H89A 3FIXA 2NYQA 3KR4A 2PJAA 4E2AA 2B5GA 3FJUA 2P6GA 2Z10A 4ZY0A 3TO6A 4HPSA 2VI7A 4BMHA 1PCAA 2VZZA 3FH4A 3KL9A 4HNXB 4R7MA 5DWNA 5E96A 1RXTA 4UEFA 2JDCA 2ABZA 4KLWA 5BWAB 1YVKA 4OLLA 4PXEA 3K9TA 4XPLA 3ZZIA 3VH9A 1NSLA 2I3CA 4FD4A 2RC4A 4P4FA 3GYAA 4UF4A 4EVYA 2PRBA 2Z3OA 4ZI6A 1QQ9A 1XBUA 2AFUA 1B6BA 4UCMA 3EO4A 2QJ8A 1DE4C 3GY9A 2GREA 4B5PB 4DNCA 5AG4A 3N7ZA 4Q7AA 2Q7BA 2EK8A 2G3AA 4CGPA 3PB8X 5I4MA 3B3VA 1Z4EA 1TF8A 1CP7A 3B7IA 2V8HA 5AG5A 4CGLA 3GUXA 5A28A 3WR7A 4C7IA 1I21A 2GLJA 2B4DB 2KCWA 3FMCA 2H5MA 2V77A 4UCPA 4OC5A 5H86A 4EMEA 4KORA 3IFEA 4MFJA 1Y7EA 4AVAA 4R3KA 4MHNA 2FT0A 2JBKA 4MCRA 3PEIA 1S5KA 3VATA 3FX6A 3PB7X 2I00A
chains in the Genus database with same CATH topology
2CNMA 2YNEA 2QIRA 3R1KA 2Z11A 1Y9KA 2FSRA 4HKFA 1QSMA 4NXYA 4A2ZA 2EUIA 2ZW7A 4BBHA 3W91A 2ATRA 2VXKA 4H6ZA 3PGPA 3JUWA 1QSNA 1B87A 3TOAA 4OAEA 3ZJ0A 2A4NA 3IGRA 2PR8A 4C2XA 3R9EA 4E8OA 4A33A 4JLYA 3R9GA 1M4IA 2DPSA 3BJ8A 2HQYA 3FRMA 1VHSA 4B13A 3T90A 3TOBA 3PP9A 4YRHA 3OWCA 1KZFA 2FXFA 4LX9A 2Q04A 2OB0A 2R98A 4RI1A 2WPWA 2FL4A 1S3ZA 3TFYA 4UWJA 4JXRA 4IUSA 4L89A 4KVXA 1MJ9A 4E0AA 1U6MA 1Z9UA 3T9YA 1I1DA 3E0KA 3TT2A 5EC4A 3QAHA 4Q36A 4RS2A 2J8MA 4MBUA 1TIQA 2CXAA 4KOYA 4UFVA 1XE4A 3CXPA 4Y49B 1QSOA 1S7NA 1RO5A 5C88A 4PSWA 3S6FA 4HNWB 5AGEA 2JLMA 1CM0A 2OZUA 3W6XA 3FBUA 2Z3NA 4FD6A 2P0WA 2K5TA 4CAWA 4C2ZA 3A9LA 4F0XA 4R3LA 4CAXA 3IU1A 4XPDB 2REEA 4KSFA 2Z3KA 4MFPA 5J8FA 5AG7A 1K4JA 4KS9A 3FNCA 1N71A 2FIWA 2OZHA 2Q4YA 2Q44A 4KOTA 4Y49C 1NE9A 4AVCA 1Z4RA 3LD2A 4MFKA 2BL1A 4A32A 2HUZA 3TE4A 2D4PA 4XNHB 4R57A 2QMLA 5CNPA 2VEZA 2JDDA 4AB7A 5H84A 3GKRA 4UBRA 3VWDA 2AE6A 4CYNA 4OADA 2B4BA 5IX3A 4KLVA 2YNCC 3BJ7A 3I9SA 2G3TA 2B5GB 4M85A 4IF5A 5G1ZA 4C2YA 3SXOA 3UY5A 1SQHA 1Q2YA 3DNSA 1Y9WA 3D2MA 2I79A 1LRZA 4MHDA 4UFXA 4YGOA 4A95A 1FY7A 3BLNA 1S7KA 2BSWA 1XIXA 2OU2A 2CY2A 2VQYA 3IWGA 4KOXA 4AG7A 3S6GA 4CS0B 4ORFA 4ZGYB 1IICA 5I0CA 2REFA 2R8VA 3K9UA 1S7FA 3DR8A 3TCVA 5HMNA 4QBJA 3EY5A 5ISVA 2HV2A 5AG6A 3RYOA 4ZBGA 1ZO0A 3FXTA 4QB9A 2BUEA 3R95A 2ZW5A 3FYNA 2BEIA 2ZXVA 2DXQA 4NCZA 1PU9A 4KSAA 2ARHA 3IU2A 3B8GA 2FS5A 4MFZA 2GIVA 2P6EA 1L0CA 4KUBA 1I12A 4CAFA 4CRZB 3D3SA 4KVME 1KUYA 4CAEA 4B11A 2Z3PA 2CNTA 2YNDA 5JPHA 3JVNA 1OZPA 2B58A 2PQ8A 4PK3A 4AVBA 4M3SA 2P6FA 2D4OA 2WPXA 2YGWA 1KUVA 4XPKA 5IV0A 2YNCA 4LUAA 4HNYB 3I3GA 2QECA 2PR1A 4KVOE 2FE7A 5KTCA 5F49A 2AJ6A 1M4GA 4MJ8A 3D2PA 3C26A 2PC1A 3QB8A 1YR0A 4JXQA 1S7LA 5KTDA 1PUAA 4PSXA 2Z3LA 3TTHA 4L8AA 4QC6A 2OZGA 3PZJA 4U9YA 3SXNA 2B3UA 4QVTA 4B5PA 4J3GA 4F0YA 1VKCA 1YX0A 4CGNA 1V0CA 5IB0A 3TO9A 2B4DA 4KOSA 2Q4VA 4R87A 3DDDA 1WWZA 1M44A 1P4NA 5G20A 5EBVA 3EFAA 3F5BA 3LODA 4XPDC 4CYQA 2C27A 1YK3A 3P2FA 5F46A 2Q0YA 2ZW4A 4CYOA 3D8PA 4B14A 2B3VA 2EVNA 2Y0MA 1J4JA 2O28A 1P0HA 3SHPA 2J8RA 2ZW6A 4R9MA 3TO7A 1GHEA 3DR6A 4FD5A 4B12A 2Z3MA 4CYPA 1QSRA 1XF8A 4CRYB 3S6HA 1MJAA 4XNHC 5G21A 2GE3A 4I49A 3W6SA 4K30A 1IB1E 1R57A 3F8KA 2GANA 2R7HA 4C68A 1UFHA 3JTKA 4UA3A 1XEBA 2G0BA 5GCNA 3V8IA 4YFJA 1CJWA 4MY3A 4JWPA 3IWEA 4H6UA 1XMTA 1YLEA 4KOWA 4PV6A 4B10A 3FB3A 2OH1A 4CGOA 4QUSA 4GS4A 5FVJA 1S60A 1BO4A 1WK4A 3P2HA 5J8CA 4MY0A 3NE7A 3H4QA 1IIDA 3KKWA 2F5IA 5KTAA 1IYLA 4U9ZA 4II9A 1Q2CA 4MI4A 4ONUA 2PSWA 4MFQA 4NEXA 4Q38A 4AG9A 2R1IA 2PDOA 4KUAA 4UWIA 2VBQA 3H5ZA 3G3SA 2FCKA 4UFWA 3R96A 2JEVA 4PK2A 2ZPAA 4KZTA 4C7HA 5A27A 4UCNA 2FIAA 1Q2DA 2J8NA 3MGDA 2X7BA 1BOBA 4B5OA 4FD7A 2WSAA 2IL4A 5DWMA 4A30A 3VWEA 4NSQA 2DPTA 1YGHA 5F47A 4CGMA 5JQ4A 4X5KA 2Z0ZA 3F0AA 3G8WA 4NF1A 4A31A 4U5YA 1MK4A 4CAVA 1YREA 5C82A 1Y7RA 4MFLA 3CXQA 5HH1A 5G22A 1QSTA 1ON0A 2CNSA 3S6KA 2WUUA 3EXNA 1M4DA 1MJBA 5F48A 1YVOA 3CXSA 4JD6A 3DSBA 3EC4A 4KOVA 2NMTA 2VZYA 1M1DA 4F6AA 1KUXA 3R9FA 4JJXA 1NMTA 1IYKA 4H89A 3FIXA 4E2AA 2B5GA 2P6GA 2Z10A 3TO6A 2VI7A 4BMHA 2VZZA 4HNXB 5DWNA 5E96A 1RXTA 2JDCA 4KLWA 5BWAB 1YVKA 4OLLA 4XPLA 3ZZIA 1NSLA 4FD4A 2RC4A 3GYAA 4EVYA 2PRBA 2Z3OA 1B6BA 4UCMA 3EO4A 3GY9A 4DNCA 4B5PB 5AG4A 3N7ZA 2Q7BA 4CGPA 2G3AA 1Z4EA 5A28A 4CGLA 5AG5A 3WR7A 4C7IA 1I21A 2B4DB 2KCWA 2H5MA 4UCPA 5H86A 4KORA 4MFJA 4AVAA 4R3KA 2FT0A 1S5KA 4KOUA 2I00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNM A;  2QIR A;  3R1K A;  2Z11 A;  1Y9K A;  2FSR A;  4HKF A;  1QSM A;  4NXY A;  2EUI A;  2ZW7 A;  3W91 A;  2ATR A;  2VXK A;  4H6Z A;  3PGP A;  3JUW A;  1QSN A;  1B87 A;  3TOA A;  4OAE A;  3ZJ0 A;  2A4N A;  3IGR A;  2PR8 A;  3R9E A;  4E8O A;  4JLY A;  3R9G A;  1M4I A;  3BJ8 A;  2HQY A;  3FRM A;  1VHS A;  3T90 A;  3TOB A;  3PP9 A;  4YRH A;  3OWC A;  1KZF A;  2FXF A;  4LX9 A;  2Q04 A;  2OB0 A;  2R98 A;  4RI1 A;  2WPW A;  2FL4 A;  1S3Z A;  3TFY A;  4UWJ A;  4JXR A;  4IUS A;  4L89 A;  4KVX A;  1MJ9 A;  4E0A A;  1U6M A;  1Z9U A;  3T9Y A;  1I1D A;  3E0K A;  3TT2 A;  5EC4 A;  3QAH A;  4RS2 A;  2J8M A;  4MBU A;  1TIQ A;  4KOY A;  1XE4 A;  3CXP A;  4Y49 B;  1QSO A;  1S7N A;  1RO5 A;  5C88 A;  4PSW A;  3S6F A;  4HNW B;  2JLM A;  1CM0 A;  2OZU A;  3W6X A;  3FBU A;  4FD6 A;  2P0W A;  2K5T A;  4CAW A;  4R3L A;  4CAX A;  4XPD B;  2REE A;  5J8F A;  1K4J A;  3FNC A;  1N71 A;  2FIW A;  2OZH A;  2Q4Y A;  2Q44 A;  4KOT A;  4Y49 C;  1NE9 A;  4AVC A;  1Z4R A;  3LD2 A;  2BL1 A;  2HUZ A;  3TE4 A;  2D4P A;  4XNH B;  4R57 A;  2QML A;  5CNP A;  2VEZ A;  2JDD A;  4AB7 A;  5H84 A;  3GKR A;  4UBR A;  3VWD A;  2AE6 A;  4OAD A;  2B4B A;  5IX3 A;  4KLV A;  3BJ7 A;  3I9S A;  2G3T A;  2B5G B;  4M85 A;  4IF5 A;  3SXO A;  3UY5 A;  1SQH A;  1Q2Y A;  3DNS A;  1Y9W A;  3D2M A;  2I79 A;  1LRZ A;  4MHD A;  4YGO A;  1FY7 A;  3BLN A;  1S7K A;  2BSW A;  1XIX A;  2OU2 A;  2CY2 A;  2VQY A;  3IWG A;  4KOX A;  4AG7 A;  3S6G A;  4CS0 B;  4ORF A;  1IIC A;  5I0C A;  2REF A;  2R8V A;  3K9U A;  1S7F A;  3DR8 A;  3TCV A;  5HMN A;  4QBJ A;  3EY5 A;  5ISV A;  2HV2 A;  3RYO A;  4ZBG A;  3FXT A;  4QB9 A;  2BUE A;  3R95 A;  2ZW5 A;  3FYN A;  2BEI A;  2ZXV A;  2DXQ A;  4NCZ A;  1PU9 A;  2ARH A;  3B8G A;  2FS5 A;  2GIV A;  2P6E A;  1L0C A;  4KUB A;  1I12 A;  4CRZ B;  3D3S A;  4KVM E;  1KUY A;  2CNT A;  5JPH A;  3JVN A;  1OZP A;  2B58 A;  2PQ8 A;  4PK3 A;  4AVB A;  4M3S A;  2P6F A;  2D4O A;  2WPX A;  1KUV A;  4XPK A;  5IV0 A;  4LUA A;  4HNY B;  3I3G A;  2QEC A;  2PR1 A;  4KVO E;  2FE7 A;  5KTC A;  5F49 A;  2AJ6 A;  1M4G A;  4MJ8 A;  3D2P A;  3C26 A;  2PC1 A;  3QB8 A;  1YR0 A;  4JXQ A;  1S7L A;  5KTD A;  1PUA A;  4PSX A;  3TTH A;  4L8A A;  4QC6 A;  2OZG A;  3PZJ A;  4U9Y A;  3SXN A;  2B3U A;  4QVT A;  4B5P A;  4J3G A;  4F0Y A;  1VKC A;  1YX0 A;  1V0C A;  5IB0 A;  3TO9 A;  2B4D A;  4KOS A;  2Q4V A;  4R87 A;  3DDD A;  1WWZ A;  1M44 A;  1P4N A;  5EBV A;  3EFA A;  3F5B A;  3LOD A;  4XPD C;  2C27 A;  1YK3 A;  3P2F A;  5F46 A;  2Q0Y A;  2ZW4 A;  3D8P A;  2B3V A;  2EVN A;  2Y0M A;  1J4J A;  2O28 A;  1P0H A;  3SHP A;  2J8R A;  2ZW6 A;  4R9M A;  3TO7 A;  1GHE A;  3DR6 A;  4FD5 A;  1QSR A;  1XF8 A;  4CRY B;  3S6H A;  1MJA A;  4XNH C;  2GE3 A;  4I49 A;  3W6S A;  4K30 A;  1IB1 E;  1R57 A;  3F8K A;  2GAN A;  2R7H A;  1UFH A;  4UA3 A;  1XEB A;  2G0B A;  5GCN A;  3V8I A;  4YFJ A;  1CJW A;  4MY3 A;  4JWP A;  4H6U A;  1XMT A;  1YLE A;  4KOW A;  4PV6 A;  3FB3 A;  2OH1 A;  4QUS A;  4GS4 A;  5FVJ A;  1S60 A;  1BO4 A;  1WK4 A;  3P2H A;  5J8C A;  4MY0 A;  3NE7 A;  3H4Q A;  1IID A;  3KKW A;  2F5I A;  5KTA A;  1IYL A;  4U9Z A;  4II9 A;  1Q2C A;  4MI4 A;  4ONU A;  2PSW A;  4NEX A;  4AG9 A;  2R1I A;  2PDO A;  4KUA A;  4UWI A;  2VBQ A;  3G3S A;  2FCK A;  3R96 A;  2JEV A;  4PK2 A;  2ZPA A;  4KZT A;  2FIA A;  1Q2D A;  2J8N A;  3MGD A;  2X7B A;  1BOB A;  4B5O A;  4FD7 A;  2IL4 A;  5DWM A;  3VWE A;  4NSQ A;  5F47 A;  1YGH A;  5JQ4 A;  4X5K A;  2Z0Z A;  3F0A A;  3G8W A;  4NF1 A;  4U5Y A;  1MK4 A;  4CAV A;  1YRE A;  5C82 A;  1Y7R A;  3CXQ A;  5HH1 A;  1QST A;  1ON0 A;  2CNS A;  3S6K A;  3EXN A;  1M4D A;  1MJB A;  5F48 A;  1YVO A;  3CXS A;  4JD6 A;  3DSB A;  3EC4 A;  4KOV A;  2NMT A;  2VZY A;  1M1D A;  4F6A A;  1KUX A;  3R9F A;  4JJX A;  1NMT A;  1IYK A;  4H89 A;  3FIX A;  4E2A A;  2B5G A;  2P6G A;  2Z10 A;  3TO6 A;  2VI7 A;  4BMH A;  2VZZ A;  4HNX B;  5DWN A;  5E96 A;  1RXT A;  2JDC A;  4KLW A;  1YVK A;  4OLL A;  4XPL A;  3ZZI A;  1NSL A;  4FD4 A;  2RC4 A;  3GYA A;  4EVY A;  2PRB A;  1B6B A;  3EO4 A;  3GY9 A;  4DNC A;  4B5P B;  3N7Z A;  2Q7B A;  2G3A A;  1Z4E A;  3WR7 A;  1I21 A;  2B4D B;  2KCW A;  2H5M A;  5H86 A;  4KOR A;  4AVA A;  4R3K A;  2FT0 A;  1S5K A;  4KOU A;  2I00 A; 
#chains in the Genus database with same CATH topology
 2CNM A;  1Z8T A;  2YNE A;  2QIR A;  4RN7 A;  2PIZ A;  2F7V A;  1CPX A;  4X3R A;  3R1K A;  2Z11 A;  3TX8 A;  2XEF A;  1Y9K A;  2FSR A;  4HKF A;  1QSM A;  2ODF A;  3FEC A;  4NXY A;  2EUI A;  2PE3 A;  2C6G A;  2ZW7 A;  4A2Z A;  4BBH A;  3W91 A;  5EMI A;  3V38 A;  2ATR A;  2V8G A;  2VXK A;  4H6Z A;  3PGP A;  4P4B A;  2BO9 A;  1YSJ A;  3FED A;  3JUW A;  3SJG A;  4MMO A;  1H8L A;  1QSN A;  4YU9 A;  3KQZ A;  7CPA A;  1IOF A;  2PIY A;  1B87 A;  1GYT A;  3B3T A;  4OAE A;  3TOA A;  4UEZ A;  2EWB A;  3ZJ0 A;  2A4N A;  4UIB A;  3IGR A;  1Z8W A;  2PR8 A;  1AYE A;  4ZY2 A;  3R9E A;  4C2X A;  4E8O A;  4A33 A;  3JRU A;  4JLY A;  3R9G A;  1M4I A;  2XEG A;  1A2Z A;  4TNU A;  2DPS A;  3BJ8 A;  3PBE A;  2HQY A;  3FRM A;  2ZOG A;  2EBJ A;  3KHZ A;  4PXB A;  1VHS A;  3B35 A;  4B13 A;  4OC4 A;  4IAV A;  3T90 A;  3TOB A;  3B3W A;  3PP9 A;  4YRH A;  4MRI A;  3OWC A;  1KZF A;  2FXF A;  4LX9 A;  2Q04 A;  2OB0 A;  2R98 A;  4RI1 A;  2WPW A;  2FL4 A;  1S3Z A;  2PJ1 A;  3SI2 A;  3TFY A;  4UWJ A;  4JXR A;  4WWV A;  4BIN A;  1R43 A;  3D7G A;  2ZEO A;  3PFE A;  4IUS A;  3CDX A;  4L89 A;  4KVX A;  3IJ3 A;  1MJ9 A;  4E0A A;  1U6M A;  4ZY1 A;  1Z9U A;  2QYV A;  3PRT A;  4M6I A;  3T9Y A;  1I1D A;  1IY7 A;  3E0K A;  3TT2 A;  5EC4 A;  4GXH A;  3QAH A;  3QNV A;  1QMU A;  2AFM A;  3D66 A;  4Q36 A;  1HDU A;  4RS2 A;  3WT4 A;  3CPA A;  4F9V A;  2J8M A;  2GLF A;  4MBU A;  3BHX A;  1TIQ A;  2CXA A;  4KOY A;  4UFV A;  2JEW A;  3HUV A;  1XE4 A;  1DTD A;  3CXP A;  4Y49 B;  1QSO A;  1S7N A;  1RO5 A;  4A37 A;  3SJE A;  4NGT A;  5C88 A;  2PRQ A;  4PSW A;  1NSA A;  3S6F A;  5DS0 A;  2PJ6 A;  1LFW A;  2EO8 A;  2PJB A;  4HNW B;  5AGE A;  2JLM A;  4F9U A;  2Q4Z A;  1CM0 A;  2ZEF A;  2OZU A;  2ZEM A;  4LQG A;  3FBU A;  3W6X A;  5HVH A;  1YQE A;  1XOV A;  3PB9 X;  3PBB A;  2Z3N A;  3NH8 A;  4FD6 A;  2P0W A;  2K5T A;  1XMB A;  1ZLH A;  4CAW A;  4C2Z A;  3A9L A;  2ZEP A;  4F0X A;  5JH9 A;  4R3L A;  4CAX A;  3ISX A;  4EWT A;  3IU1 A;  5HVF A;  1AMP A;  4XPD B;  3FF3 A;  2REE A;  4KSF A;  3KHX A;  2Z3K A;  1JQG A;  4MFP A;  5J1Q A;  5J8F A;  1X12 A;  5AG7 A;  1K4J A;  4KS9 A;  1F57 A;  3FNC A;  1N71 A;  2FIW A;  2OZH A;  2Q4Y A;  2Q44 A;  3DGV A;  1BLL E;  4JZ0 A;  1Z5R A;  4FBE A;  1BPN A;  4KOT A;  1NE9 A;  4Y49 C;  1XFO A;  4AVC A;  4MCQ A;  4CPA A;  4YWY A;  4R8F A;  1Q7L A;  1Z4R A;  3LD2 A;  3ISZ A;  4MFK A;  2BL1 A;  1LCP A;  3LWU A;  2ZOF A;  4P4D A;  4A32 A;  2HUZ A;  4RUH A;  2FVG A;  3TE4 A;  4FAI A;  2D4P A;  4XNH B;  1EE3 P;  2ANP A;  3IEH A;  2NSM A;  3GIU A;  4R57 A;  3MRU A;  2QML A;  5LYI A;  5CNP A;  5JM6 A;  4P6Y A;  2Q7S A;  2VEZ A;  1FNO A;  2AFX A;  1CPS A;  1CBX A;  3B3C A;  4ZX8 A;  2JDD A;  2POK A;  2C1C A;  4AB7 A;  5H84 A;  2IJZ A;  3GKR A;  1VIX A;  1AUG A;  1YLO A;  4UBR A;  2RB7 A;  3PB6 X;  3VWD A;  2WYR A;  2AE6 A;  1YW4 A;  4CYN A;  5IB9 A;  4DJL A;  4OAD A;  2B4B A;  5IX3 A;  4KLV A;  4P45 A;  2YNC C;  2CF4 A;  4H2K A;  4MHP A;  1LAP A;  1IOI A;  3RNZ A;  3BJ7 A;  3S9M A;  3I9S A;  2G3T A;  4OIW A;  4OME A;  2B5G B;  4M85 A;  4IF5 A;  5G1Z A;  5LRJ A;  4C2Y A;  3SXO A;  2CTB A;  3UY5 A;  1SQH A;  1Q2Y A;  1R3N A;  3BI0 A;  2ZED A;  2ZEE A;  3DNS A;  1TXR A;  3NH4 A;  1Y9W A;  3D2M A;  1TKH A;  5CPA A;  2PJ5 A;  1BAV A;  1F2P A;  1LRZ A;  2I79 A;  3H8F A;  4MHD A;  4NGQ A;  4NGS A;  3D4U A;  3KZW A;  4OID A;  4UFX A;  4YGO A;  3WAB A;  2J9A A;  2O4H A;  4A95 A;  1FY7 A;  3BLN A;  1S7K A;  2BSW A;  3WC7 A;  3D7H A;  1XIX A;  2OU2 A;  3N5F A;  4NGR A;  2CY2 A;  1ELL P;  2VQY A;  4P10 A;  3IWG A;  4KOX A;  2PJ2 A;  3I1U A;  4AG7 A;  4IK2 A;  6CPA A;  3S6G A;  1ZG9 A;  3FVL A;  2V8D A;  4CS0 B;  4ORF A;  3KI9 A;  4ZGY B;  1IIC A;  5I0C A;  2REF A;  2R8V A;  3MN8 A;  2PJ4 A;  3K9U A;  1S7F A;  1HDQ A;  3DR8 A;  3BI1 A;  3TCV A;  4MHY A;  5HMN A;  4QBJ A;  3EY5 A;  3T8W A;  3GB0 A;  4DUK A;  5ISV A;  2HV2 A;  5AG6 A;  3RAM A;  3S9L A;  3RYO A;  2Q43 A;  2RFH A;  4ZBG A;  5LRK A;  1ZO0 A;  3K2K A;  3PB4 X;  3SJF A;  3FXT A;  4QB9 A;  4F8Z A;  2BUE A;  2AFZ A;  1Y0R A;  3R95 A;  1OBR A;  2ZW5 A;  3FYN A;  2BEI A;  2ZXV A;  4AXV A;  2DXQ A;  4NCZ A;  1PU9 A;  4KSA A;  2CTC A;  2ARH A;  4W9Y A;  3IU2 A;  5LYF A;  3B8G A;  2FS5 A;  5ELY A;  2O53 A;  4OP4 A;  1PYT B;  4MFZ A;  4NGM A;  3IWW A;  2GIV A;  2P6E A;  3H8G A;  1L0C A;  4KUB A;  1I12 A;  4CAF A;  4CRZ B;  3D3S A;  4KVM E;  4JYW A;  2PCU A;  1KUY A;  5C82 A;  4CAE A;  4B11 A;  5D8N A;  2Z3P A;  3FEE A;  2CNT A;  2YND A;  3TC8 A;  2QVP A;  5JPH A;  1F2O A;  3JVN A;  1OZP A;  2B58 A;  2PQ8 A;  4PK3 A;  4AVB A;  4M3S A;  2P6F A;  2D4O A;  2ZEG A;  2WPX A;  2YGW A;  1KUV A;  4XPK A;  5IV0 A;  2YNC A;  4LUA A;  4HNY B;  3I3G A;  5HVG A;  2QEC A;  2PR1 A;  4KVO E;  3RBU A;  2FE7 A;  5KTC A;  5F49 A;  2AJ6 A;  1M4G A;  2PJ7 A;  4X2T A;  3IO1 A;  4MJ8 A;  3D2P A;  5F09 A;  3C26 A;  2PC1 A;  3QB8 A;  1YR0 A;  4JXQ A;  5THW A;  1S7L A;  1CG2 A;  2ZEN A;  2OOT A;  5KTD A;  1PUA A;  4PSX A;  4UEE A;  2Z3L A;  3TTH A;  4L8A A;  4QC6 A;  3KGQ A;  2OZG A;  3PZJ A;  2HC9 A;  4G1P A;  4U9Y A;  3SXN A;  2B3U A;  3NH5 A;  2DEA A;  4QVT A;  4B5P A;  4J3G A;  4OKO A;  3D7D A;  3V7Z A;  1VKC A;  3KR5 A;  4F0Y A;  5K8N A;  2IQ6 A;  5LRG A;  1YX0 A;  1RTQ A;  1M4L A;  2C6P A;  4CGN A;  1V0C A;  2PVW A;  2BOA A;  5IB0 A;  3TO9 A;  2B4D A;  4KOS A;  5HXD A;  2Q4V A;  2PJC A;  4R87 A;  3DDD A;  4PQA A;  1WWZ A;  4LQ6 A;  1M44 A;  1P4N A;  1Z8L A;  3CT9 A;  8CPA A;  5G20 A;  5EBV A;  3EFA A;  3F5B A;  3LOD A;  1BPM A;  1XJO A;  4XPD C;  4O23 A;  4CYQ A;  2C27 A;  1LOK A;  1YK3 A;  1LAN A;  3P2F A;  4UIA A;  2Q0Y A;  5F46 A;  2ZW4 A;  4CYO A;  2V8V A;  3D8P A;  4B14 A;  2B3V A;  4PXC A;  1CP6 A;  3QAY A;  2EVN A;  2Y0M A;  2PVV A;  1J4J A;  1ZG8 A;  1ZG7 A;  2G9D A;  2O28 A;  4K3N A;  1P0H A;  4ZX9 A;  3SHP A;  1VGY A;  3WC6 A;  2CIJ A;  2J8R A;  1ARL A;  2ZW6 A;  3B2Y A;  4R9M A;  3TO7 A;  3VAR A;  1GHE A;  3DR6 A;  1TKJ A;  1ZLI A;  5D29 A;  4FD5 A;  2GU2 A;  4P44 A;  4B12 A;  3S9N A;  4OC2 A;  2Z3M A;  4CYP A;  1QSR A;  1XF8 A;  4BD9 A;  4CRY B;  3S6H A;  1MJA A;  3BXM A;  1Z8X A;  2ZEH A;  4NFR A;  3B3S A;  4XNH C;  3KQX A;  3CZX A;  5G21 A;  4FWU A;  2GE3 A;  4I49 A;  4A39 A;  4A94 A;  3W6S A;  4K30 A;  1IB1 E;  1R57 A;  3F8K A;  2GAN A;  1IGB A;  2R7H A;  4C68 A;  1UFH A;  2IMO A;  3HLP A;  3JTK A;  5LYL A;  2F8H A;  1UWY A;  2C6C A;  4UA3 A;  1XEB A;  2G0B A;  5GCN A;  3V8I A;  4YFJ A;  4Z65 A;  1CJW A;  1YW6 A;  3D68 A;  3NA6 A;  4MY3 A;  3KAS A;  2DF5 A;  1VHO A;  1TKF A;  1YME A;  4KSI A;  3H8E A;  4JWP A;  1FT7 A;  4MXU A;  3IWE A;  4H6U A;  4ONW A;  1XMT A;  1YLE A;  4KOW A;  4PV6 A;  4R76 A;  4TWE A;  2PJ0 A;  4B10 A;  3FB3 A;  2PJ9 A;  2OH1 A;  4CGO A;  4QUS A;  2AFS A;  4GS4 A;  4P4J A;  2XEJ A;  4P4I A;  5FVJ A;  5LYD A;  1X10 A;  1S60 A;  1BO4 A;  2AFO A;  4PXD A;  1WK4 A;  3SI1 A;  4NGN A;  3SI0 A;  2HB6 A;  4WJB A;  3P2H A;  5J8C A;  4MY0 A;  3NE7 A;  3DLJ A;  3H4Q A;  1IID A;  4X8I A;  3KKW A;  2F5I A;  5KTA A;  1IYL A;  2OR4 A;  4KOU A;  3L2N A;  4U9Z A;  1Q2C A;  4MI4 A;  4ONU A;  4II9 A;  2PSW A;  3LAC A;  4MFQ A;  4NEX A;  1LAM A;  3PFO A;  4Q38 A;  4AG9 A;  4OC0 A;  2R1I A;  2PDO A;  3LMS A;  4MHZ A;  4KUA A;  4FUU A;  4UWI A;  2VBQ A;  3H5Z A;  3G3S A;  2PJ3 A;  2FCK A;  3RZA A;  4EFD A;  4UFW A;  3NE8 A;  3R96 A;  4P4E A;  1VHE A;  2JEV A;  4PK2 A;  4MCS A;  1ARM A;  3IIB A;  2ZPA A;  4R6T A;  4IHM A;  4KZT A;  4C7H A;  5A27 A;  4UCN A;  2FIA A;  2VL1 A;  2WZN A;  4OC1 A;  3IC1 A;  1ELM P;  1Q2D A;  2J8N A;  4MCP A;  4OC3 A;  2EK9 A;  3MGD A;  2X7B A;  5K8M A;  5K8P A;  2GFQ A;  1BOB A;  1TF9 A;  2PJ8 A;  1KWM A;  4FD7 A;  4B5O A;  3CPX A;  2WSA A;  2IL4 A;  5DWM A;  4A30 A;  3VWE A;  1Z2L A;  4NSQ A;  2DPT A;  1YGH A;  5F47 A;  4CGM A;  3D7F A;  5JQ4 A;  4X5K A;  4M6H A;  4A38 A;  1Y0Y A;  2Z0Z A;  3F0A A;  3G8W A;  2JBJ A;  4NF1 A;  3WC5 A;  4A31 A;  4U5Y A;  4NJR A;  2XEI A;  4NGP A;  3GLJ A;  1MK4 A;  3D67 A;  4CAV A;  1YRE A;  1JWQ A;  1Y7R A;  2AFW A;  3NFZ A;  4B6Z A;  1IU8 A;  4MFL A;  4NJQ A;  3CXQ A;  5HH1 A;  1XRY A;  4ZYQ A;  5G22 A;  2Q51 A;  1QST A;  2ZEL A;  1HEE A;  1ON0 A;  2BCO A;  2CNS A;  3SJX A;  3S6K A;  1CX8 A;  2WUU A;  3EXN A;  1M4D A;  4PPZ A;  1MJB A;  5F48 A;  1YVO A;  3CXS A;  4M6G A;  3RO0 A;  4JD6 A;  3DSB A;  5JGF A;  3EC4 A;  4KOV A;  5CBM A;  4DYO A;  4GM5 A;  5K8O A;  2NMT A;  2VZY A;  1M1D A;  4F6A A;  1KUX A;  3R9F A;  4JJX A;  1NMT A;  1IYK A;  4H89 A;  3FIX A;  2NYQ A;  3KR4 A;  2PJA A;  4E2A A;  2B5G A;  3FJU A;  2P6G A;  2Z10 A;  4ZY0 A;  3TO6 A;  4HPS A;  2VI7 A;  4BMH A;  1PCA A;  2VZZ A;  3FH4 A;  3KL9 A;  4HNX B;  4R7M A;  5DWN A;  5E96 A;  1RXT A;  4UEF A;  2JDC A;  2ABZ A;  4KLW A;  5BWA B;  1YVK A;  4OLL A;  4PXE A;  3K9T A;  4XPL A;  3ZZI A;  3VH9 A;  1NSL A;  2I3C A;  4FD4 A;  2RC4 A;  4P4F A;  3GYA A;  4UF4 A;  4EVY A;  2PRB A;  2Z3O A;  4ZI6 A;  1QQ9 A;  1XBU A;  2AFU A;  1B6B A;  4UCM A;  3EO4 A;  2QJ8 A;  1DE4 C;  3GY9 A;  2GRE A;  4B5P B;  4DNC A;  5AG4 A;  3N7Z A;  4Q7A A;  2Q7B A;  2EK8 A;  2G3A A;  4CGP A;  3PB8 X;  5I4M A;  3B3V A;  1Z4E A;  1TF8 A;  1CP7 A;  3B7I A;  2V8H A;  5AG5 A;  4CGL A;  3GUX A;  5A28 A;  3WR7 A;  4C7I A;  1I21 A;  2GLJ A;  2B4D B;  2KCW A;  3FMC A;  2H5M A;  2V77 A;  4UCP A;  4OC5 A;  5H86 A;  4EME A;  4KOR A;  3IFE A;  4MFJ A;  1Y7E A;  4AVA A;  4R3K A;  4MHN A;  2FT0 A;  2JBK A;  4MCR A;  3PEI A;  1S5K A;  3VAT A;  3FX6 A;  3PB7 X;  2I00 A; 
#chains in the Genus database with same CATH homology
 2CNM A;  2YNE A;  2QIR A;  3R1K A;  2Z11 A;  1Y9K A;  2FSR A;  4HKF A;  1QSM A;  4NXY A;  4A2Z A;  2EUI A;  2ZW7 A;  4BBH A;  3W91 A;  2ATR A;  2VXK A;  4H6Z A;  3PGP A;  3JUW A;  1QSN A;  1B87 A;  3TOA A;  4OAE A;  3ZJ0 A;  2A4N A;  3IGR A;  2PR8 A;  4C2X A;  3R9E A;  4E8O A;  4A33 A;  4JLY A;  3R9G A;  1M4I A;  2DPS A;  3BJ8 A;  2HQY A;  3FRM A;  1VHS A;  4B13 A;  3T90 A;  3TOB A;  3PP9 A;  4YRH A;  3OWC A;  1KZF A;  2FXF A;  4LX9 A;  2Q04 A;  2OB0 A;  2R98 A;  4RI1 A;  2WPW A;  2FL4 A;  1S3Z A;  3TFY A;  4UWJ A;  4JXR A;  4IUS A;  4L89 A;  4KVX A;  1MJ9 A;  4E0A A;  1U6M A;  1Z9U A;  3T9Y A;  1I1D A;  3E0K A;  3TT2 A;  5EC4 A;  3QAH A;  4Q36 A;  4RS2 A;  2J8M A;  4MBU A;  1TIQ A;  2CXA A;  4KOY A;  4UFV A;  1XE4 A;  3CXP A;  4Y49 B;  1QSO A;  1S7N A;  1RO5 A;  5C88 A;  4PSW A;  3S6F A;  4HNW B;  5AGE A;  2JLM A;  1CM0 A;  2OZU A;  3W6X A;  3FBU A;  2Z3N A;  4FD6 A;  2P0W A;  2K5T A;  4CAW A;  4C2Z A;  3A9L A;  4F0X A;  4R3L A;  4CAX A;  3IU1 A;  4XPD B;  2REE A;  4KSF A;  2Z3K A;  4MFP A;  5J8F A;  5AG7 A;  1K4J A;  4KS9 A;  3FNC A;  1N71 A;  2FIW A;  2OZH A;  2Q4Y A;  2Q44 A;  4KOT A;  4Y49 C;  1NE9 A;  4AVC A;  1Z4R A;  3LD2 A;  4MFK A;  2BL1 A;  4A32 A;  2HUZ A;  3TE4 A;  2D4P A;  4XNH B;  4R57 A;  2QML A;  5CNP A;  2VEZ A;  2JDD A;  4AB7 A;  5H84 A;  3GKR A;  4UBR A;  3VWD A;  2AE6 A;  4CYN A;  4OAD A;  2B4B A;  5IX3 A;  4KLV A;  2YNC C;  3BJ7 A;  3I9S A;  2G3T A;  2B5G B;  4M85 A;  4IF5 A;  5G1Z A;  4C2Y A;  3SXO A;  3UY5 A;  1SQH A;  1Q2Y A;  3DNS A;  1Y9W A;  3D2M A;  2I79 A;  1LRZ A;  4MHD A;  4UFX A;  4YGO A;  4A95 A;  1FY7 A;  3BLN A;  1S7K A;  2BSW A;  1XIX A;  2OU2 A;  2CY2 A;  2VQY A;  3IWG A;  4KOX A;  4AG7 A;  3S6G A;  4CS0 B;  4ORF A;  4ZGY B;  1IIC A;  5I0C A;  2REF A;  2R8V A;  3K9U A;  1S7F A;  3DR8 A;  3TCV A;  5HMN A;  4QBJ A;  3EY5 A;  5ISV A;  2HV2 A;  5AG6 A;  3RYO A;  4ZBG A;  1ZO0 A;  3FXT A;  4QB9 A;  2BUE A;  3R95 A;  2ZW5 A;  3FYN A;  2BEI A;  2ZXV A;  2DXQ A;  4NCZ A;  1PU9 A;  4KSA A;  2ARH A;  3IU2 A;  3B8G A;  2FS5 A;  4MFZ A;  2GIV A;  2P6E A;  1L0C A;  4KUB A;  1I12 A;  4CAF A;  4CRZ B;  3D3S A;  4KVM E;  1KUY A;  4CAE A;  4B11 A;  2Z3P A;  2CNT A;  2YND A;  5JPH A;  3JVN A;  1OZP A;  2B58 A;  2PQ8 A;  4PK3 A;  4AVB A;  4M3S A;  2P6F A;  2D4O A;  2WPX A;  2YGW A;  1KUV A;  4XPK A;  5IV0 A;  2YNC A;  4LUA A;  4HNY B;  3I3G A;  2QEC A;  2PR1 A;  4KVO E;  2FE7 A;  5KTC A;  5F49 A;  2AJ6 A;  1M4G A;  4MJ8 A;  3D2P A;  3C26 A;  2PC1 A;  3QB8 A;  1YR0 A;  4JXQ A;  1S7L A;  5KTD A;  1PUA A;  4PSX A;  2Z3L A;  3TTH A;  4L8A A;  4QC6 A;  2OZG A;  3PZJ A;  4U9Y A;  3SXN A;  2B3U A;  4QVT A;  4B5P A;  4J3G A;  4F0Y A;  1VKC A;  1YX0 A;  4CGN A;  1V0C A;  5IB0 A;  3TO9 A;  2B4D A;  4KOS A;  2Q4V A;  4R87 A;  3DDD A;  1WWZ A;  1M44 A;  1P4N A;  5G20 A;  5EBV A;  3EFA A;  3F5B A;  3LOD A;  4XPD C;  4CYQ A;  2C27 A;  1YK3 A;  3P2F A;  5F46 A;  2Q0Y A;  2ZW4 A;  4CYO A;  3D8P A;  4B14 A;  2B3V A;  2EVN A;  2Y0M A;  1J4J A;  2O28 A;  1P0H A;  3SHP A;  2J8R A;  2ZW6 A;  4R9M A;  3TO7 A;  1GHE A;  3DR6 A;  4FD5 A;  4B12 A;  2Z3M A;  4CYP A;  1QSR A;  1XF8 A;  4CRY B;  3S6H A;  1MJA A;  4XNH C;  5G21 A;  2GE3 A;  4I49 A;  3W6S A;  4K30 A;  1IB1 E;  1R57 A;  3F8K A;  2GAN A;  2R7H A;  4C68 A;  1UFH A;  3JTK A;  4UA3 A;  1XEB A;  2G0B A;  5GCN A;  3V8I A;  4YFJ A;  1CJW A;  4MY3 A;  4JWP A;  3IWE A;  4H6U A;  1XMT A;  1YLE A;  4KOW A;  4PV6 A;  4B10 A;  3FB3 A;  2OH1 A;  4CGO A;  4QUS A;  4GS4 A;  5FVJ A;  1S60 A;  1BO4 A;  1WK4 A;  3P2H A;  5J8C A;  4MY0 A;  3NE7 A;  3H4Q A;  1IID A;  3KKW A;  2F5I A;  5KTA A;  1IYL A;  4U9Z A;  4II9 A;  1Q2C A;  4MI4 A;  4ONU A;  2PSW A;  4MFQ A;  4NEX A;  4Q38 A;  4AG9 A;  2R1I A;  2PDO A;  4KUA A;  4UWI A;  2VBQ A;  3H5Z A;  3G3S A;  2FCK A;  4UFW A;  3R96 A;  2JEV A;  4PK2 A;  2ZPA A;  4KZT A;  4C7H A;  5A27 A;  4UCN A;  2FIA A;  1Q2D A;  2J8N A;  3MGD A;  2X7B A;  1BOB A;  4B5O A;  4FD7 A;  2WSA A;  2IL4 A;  5DWM A;  4A30 A;  3VWE A;  4NSQ A;  2DPT A;  1YGH A;  5F47 A;  4CGM A;  5JQ4 A;  4X5K A;  2Z0Z A;  3F0A A;  3G8W A;  4NF1 A;  4A31 A;  4U5Y A;  1MK4 A;  4CAV A;  1YRE A;  5C82 A;  1Y7R A;  4MFL A;  3CXQ A;  5HH1 A;  5G22 A;  1QST A;  1ON0 A;  2CNS A;  3S6K A;  2WUU A;  3EXN A;  1M4D A;  1MJB A;  5F48 A;  1YVO A;  3CXS A;  4JD6 A;  3DSB A;  3EC4 A;  4KOV A;  2NMT A;  2VZY A;  1M1D A;  4F6A A;  1KUX A;  3R9F A;  4JJX A;  1NMT A;  1IYK A;  4H89 A;  3FIX A;  4E2A A;  2B5G A;  2P6G A;  2Z10 A;  3TO6 A;  2VI7 A;  4BMH A;  2VZZ A;  4HNX B;  5DWN A;  5E96 A;  1RXT A;  2JDC A;  4KLW A;  5BWA B;  1YVK A;  4OLL A;  4XPL A;  3ZZI A;  1NSL A;  4FD4 A;  2RC4 A;  3GYA A;  4EVY A;  2PRB A;  2Z3O A;  1B6B A;  4UCM A;  3EO4 A;  3GY9 A;  4DNC A;  4B5P B;  5AG4 A;  3N7Z A;  2Q7B A;  4CGP A;  2G3A A;  1Z4E A;  5A28 A;  4CGL A;  5AG5 A;  3WR7 A;  4C7I A;  1I21 A;  2B4D B;  2KCW A;  2H5M A;  4UCP A;  5H86 A;  4KOR A;  4MFJ A;  4AVA A;  4R3K A;  2FT0 A;  1S5K A;  4KOU A;  2I00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...