2BUEA

Structure of aac(6')-ib in complex with ribostamycin and coenzyme a.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 54
structure length 179
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2bueA00
5F47A 2Q44A 3BJ8A 5F48A 3EXNA 1S7FA 1WWZA 4B5PA 4OAEA 5DWNA 3EO4A 1ON0A 2PR8A 4MY3A 3ZZIA 4AVBA 5DWMA 2R7HA 3FBUA 1B6BA 4KLWA 4KOXA 1XMTA 4UWIA 1M4DA 1Z4RA 5FVJA 4NSQA 3E0KA 4QVTA 3KKWA 4XNHC 2B4DA 3W6XA 1KUXA 4KORA 3JUWA 4CS0B 3UY5A 4JD6A 3PZJA 3T9YA 3T90A 3TTHA 2AE6A 5EC4A 2BUEA 3DR6A 1I1DA 2G3AA 4LX9A 1VHSA 3FIXA 1IB1E 1SQHA 3R95A 4KLVA 2Z0ZA 3R9FA 1NMTA 2ZW6A 1R57A 3R9GA 1BOBA 3D8PA 5ISVA 1MJAA 4KVME 1Q2DA 3D2PA 2GE3A 3S6GA 2A4NA 4FD5A 1QSNA 1N71A 2K5TA 1NE9A 2FSRA 2NMTA 5J8CA 3OWCA 4U9ZA 5GCNA 3IWGA 5HMNA 4PK3A 2O28A 4X5KA 1M4GA 4JJXA 4JXRA 3NE7A 3SHPA 5I0CA 2VI7A 4KOWA 2DXQA 4HNWB 5IV0A 3TCVA 2OZHA 2ATRA 2HQYA 1S60A 2VEZA 3S6HA 4Y49C 4U5YA 1S7KA 1S5KA 1QSTA 3TO7A 4KZTA 2I79A 1KUVA 2ZW5A 3TOBA 4NCZA 1QSMA 1YLEA 2Q04A 1MK4A 4MHDA 4JWPA 1YGHA 2D4OA 4K30A 4AVAA 4KVXA 2P6EA 2BEIA 2ARHA 4I49A 2B5GA 2WPWA 4II9A 1P0HA 4CRYB 3TT2A 1IYLA 1Z4EA 4B5PB 4GS4A 2VBQA 4QUSA 2KCWA 3H4QA 1BO4A 1YK3A 4NF1A 4QB9A 1WK4A 3GYAA 4FD4A 5H84A 4YRHA 4KVOE 5F49A 4FD7A 2B4DB 2Y0MA 2JEVA 1QSOA 3P2HA 4XPDC 4CRZB 3BJ7A 2VXKA 3QB8A 2REEA 3PGPA 2EVNA 3TOAA 2ZPAA 5KTDA 2BSWA 2JLMA 1GHEA 1XEBA 2Q4VA 3S6KA 1VKCA 4XNHB 3SXNA 2FXFA 1RXTA 4MJ8A 4E0AA 4AB7A 2B4BA 2VZYA 1CJWA 1S7NA 1Y9WA 5F46A 1YX0A 1Y9KA 2F5IA 4XPKA 1PUAA 4RS2A 1YREA 4M3SA 3B8GA 3EC4A 4FD6A 1S3ZA 4MBUA 2X7BA 1YVKA 4H6ZA 1M1DA 3F0AA 4L89A 2FT0A 4IF5A 1CM0A 1YR0A 1M44A 3TO9A 4CAVA 2Z11A 3IGRA 2AJ6A 4R3KA 4CAWA 2CNMA 2OZUA 3DSBA 4KOTA 3DDDA 3FB3A 3I9SA 2PSWA 3EY5A 3RYOA 2P6GA 4NEXA 3D3SA 2OU2A 4E2AA 2G0BA 2CNSA 4M85A 3C26A 2EUIA 2OZGA 4KUAA 1I21A 2J8RA 1IYKA 4IUSA 1KUYA 2Z10A 2WPXA 4BMHA 4UWJA 4PSWA 2PC1A 2R98A 2R1IA 2OB0A 1Y7RA 3D2MA 1V0CA 4KOYA 1RO5A 4HNYB 4OLLA 4YGOA 4F0YA 5JQ4A 2JDCA 1I12A 4PK2A 4CAXA 2RC4A 3VWEA 1Z9UA 3GY9A 2HV2A 1MJ9A 2PR1A 2B3UA 2FIWA 2H5MA 2B5GB 4R3LA 3FYNA 5C88A 4Y49B 1OZPA 4H6UA 2Q0YA 2C27A 2PQ8A 2VZZA 4HNXB 2CNTA 3EFAA 1IICA 2GIVA 5J8FA 4AVCA 4PSXA 1Q2CA 4R87A 3N7ZA 2QMLA 1XIXA 4U9YA 2B3VA 3PP9A 1PU9A 3R96A 1TIQA 5E96A 2Q7BA 4R9MA 2Q4YA 4KUBA 2PDOA 3G8WA 1MJBA 3FXTA 2ZW4A 4MI4A 1J4JA 2FIAA 4OADA 2QIRA 4QC6A 2REFA 1Q2YA 4KOSA 4JXQA 2I00A 4HKFA 1KZFA 2VQYA 4KOVA 3BLNA 3R1KA 1XE4A 4UBRA 4XPDB 5HH1A 3R9EA 1IIDA 1LRZA 4YFJA 1FY7A 3F8KA 4F6AA 3QAHA 3CXPA 3DR8A 2BL1A 4J3GA 4E8OA 4UA3A 4JLYA 1UFHA 1YVOA 4B5OA 2J8MA 4ZBGA 4KOUA 3F5BA 3I3GA 2B58A 3CXQA 4PV6A 5H86A 5C82A 4R57A 5CNPA 3JVNA 2PRBA 4LUAA 4ORFA 4EVYA 2JDDA 2HUZA 3V8IA 1K4JA 2J8NA 1NSLA 2D4PA 3FRMA 3VWDA 3CXSA 4XPLA 1XF8A 2GANA 3W6SA 2CY2A 1P4NA 3LD2A 2OH1A 4H89A 2FL4A 2ZW7A 2FS5A 4RI1A 1B87A 5IB0A 3ZJ0A 1M4IA 4MY0A 5EBVA 2R8VA 2FCKA 2G3TA 5IX3A 1QSRA 1S7LA 4L8AA 4QBJA 1L0CA 3GKRA 2QECA 3LODA 3TFYA 2FE7A 5KTAA 4DNCA 4ONUA 4AG9A 3P2FA 3TO6A 3S6FA 5KTCA 3W91A 3DNSA 4AG7A 4NXYA 2P6FA 2P0WA 3SXOA 1U6MA 3G3SA 2ZXVA 5JPHA 3TE4A 3FNCA 2IL4A 3WR7A 3K9UA 3MGDA
chains in the Genus database with same CATH superfamily
1NSAA 2V8VA 3HLPA 5F47A 1Z8LA 5K8MA 1R43A 4BINA 2Q44A 3BJ8A 5F48A 3EXNA 1S7FA 1WWZA 2Q51A 3KI9A 4B5PA 4P6YA 5K8OA 4OAEA 5DWNA 3EO4A 1ON0A 4CGOA 2PR8A 4MY3A 3ZZIA 4AVBA 5DWMA 4A38A 4UFWA 2R7HA 3FBUA 1B6BA 4KLWA 1ZG9A 4KOXA 1XMTA 3B3SA 1BLLE 2Z3MA 4EWTA 5CBMA 2PJAA 1ELMP 4UWIA 3VH9A 1M4DA 1Z4RA 2BOAA 4MHNA 5FVJA 4B6ZA 4NSQA 2PIZA 2EK9A 3E0KA 4QVTA 3KKWA 4MXUA 4XNHC 2B4DA 4M6IA 2PJ3A 4UCNA 2ZEOA 4ZYQA 4CYPA 2ABZA 3W6XA 3PRTA 1KUXA 4KORA 1Z5RA 2YGWA 4UCPA 3BI1A 3JUWA 2EWBA 4PXBA 5HVHA 4CS0B 3LACA 4NJQA 3H5ZA 2EBJA 5CPAA 2WZNA 3UY5A 4JD6A 3PZJA 3T9YA 2ZEEA 4K3NA 3T90A 3KHXA 3TTHA 4LQGA 4OC1A 2AE6A 5EC4A 2BUEA 4UFVA 3DR6A 4YWYA 2EO8A 1I1DA 3KQXA 2G3AA 2C1CA 4R6TA 4LX9A 1VHSA 1ZG8A 4H2KA 3FIXA 1IB1E 2C6GA 1SQHA 3R95A 4KLVA 4KSAA 5LYIA 2Z0ZA 1AYEA 3R9FA 4A33A 5LYLA 1NMTA 3KR5A 4ZX8A 2ZW6A 4MCPA 1Z8TA 1CPXA 4NGMA 6CPAA 1R57A 3R9GA 1BOBA 3D8PA 2ZOFA 5ISVA 3VARA 4UIBA 1MJAA 1YMEA 4KVME 4A32A 4B10A 4F0XA 1Q2DA 3D2PA 2GE3A 3GB0A 2G9DA 3D7GA 4MMOA 4Q7AA 2A4NA 3S6GA 3SJEA 1R3NA 4EFDA 4FD5A 1HEEA 3B7IA 1OBRA 1QSNA 3SI1A 1N71A 2K5TA 5AGEA 2WSAA 4C7IA 1NE9A 2FSRA 2NMTA 5J8CA 3OWCA 3D68A 1CG2A 4U9ZA 4GXHA 5BWAB 2AFSA 1VIXA 2XEIA 1F57A 3LMSA 2ANPA 4P4IA 5GCNA 3IWGA 5HMNA 4PK3A 1BPMA 2O28A 4X5KA 1M4GA 3WT4A 4JJXA 4P45A 3FMCA 1XOVA 3GLJA 4JXRA 1JWQA 1LFWA 4GM5A 3NE7A 5JGFA 2ZEHA 3SHPA 5K8NA 5I0CA 4F9UA 2VI7A 4KOWA 2ZENA 2DXQA 4P4DA 4HNWB 5IV0A 3TCVA 2OZHA 4NGQA 2ATRA 2HQYA 1S60A 3IFEA 3SI0A 2ZEMA 1CP7A 3BHXA 1LAPA 3KASA 2VEZA 3IIBA 3S6HA 4Y49C 4U5YA 1VHEA 1S7KA 1S5KA 1XMBA 1QSTA 1KWMA 4KZTA 4MRIA 2I79A 3TO7A 3VATA 4CYNA 1X12A 1KUVA 2PJ1A 2PJ4A 1VGYA 2ZW5A 3TOBA 1BAVA 1QSMA 3FH4A 4NCZA 1YLEA 2Q04A 1MK4A 1TXRA 2F7VA 4JZ0A 3FF3A 4NGRA 4MHDA 1PCAA 4JWPA 3HUVA 3MRUA 1X10A 3CDXA 1LCPA 1YGHA 2D4OA 4K30A 3FVLA 1QQ9A 4AVAA 4KVXA 4OP4A 2P6EA 2BEIA 2ZOGA 2ARHA 2O53A 5LRJA 5G22A 4A94A 3PB8X 4ZGYB 4I49A 2B5GA 2WPWA 3JRUA 3DLJA 4C68A 4CAEA 4M6HA 4FUUA 4II9A 1H8LA 4A39A 1P0HA 4F9VA 4MFZA 3TC8A 4CRYB 3PB9X 4MCSA 2RB7A 3B3VA 1IYLA 1Z4EA 3TT2A 4B5PB 4GS4A 2QJ8A 2VBQA 4G1PA 4PXDA 4QUSA 3S9LA 2KCWA 1YW6A 3PB6X 3H4QA 2PJ5A 1BO4A 2BCOA 1YK3A 3RBUA 4NF1A 4QB9A 3H8EA 4DUKA 4OC2A 3SJGA 3A9LA 1WK4A 3GYAA 4A30A 1TKJA 3NH4A 1ARMA 1VHOA 2PJ7A 4FD4A 5H84A 2PVVA 4YRHA 2ZEFA 5G21A 4KVOE 5F49A 1DE4C 3BXMA 5AG6A 5G20A 1ELLP 3N5FA 3S9MA 2ZELA 4FD7A 2B4DB 3CT9A 4BD9A 4MHYA 5A27A 2Y0MA 2JEVA 3RZAA 3WC6A 4CGNA 5HXDA 5EMIA 1QSOA 3B35A 3P2HA 4LQ6A 4NGTA 4XPDC 4CRZB 4TWEA 1F2OA 3BJ7A 2VXKA 3QB8A 4B14A 1CPSA 3BI0A 2REEA 3PGPA 1LANA 3PFOA 2EVNA 3NFZA 2V8DA 2ZPAA 3TOAA 3TX8A 2ZEGA 4ZY1A 5KTDA 3RO0A 3SJFA 2ODFA 3DGVA 4HPSA 2BSWA 4PPZA 2JLMA 1GHEA 2PJ9A 1XEBA 2Q4VA 1Z8WA 2XEJA 3IEHA 1PYTB 3MN8A 3S6KA 1VKCA 4XNHB 3SXNA 1IU8A 2FXFA 1RXTA 4MJ8A 4E0AA 3PEIA 2B4BA 1LOKA 2VZYA 1CJWA 3FX6A 4AB7A 2HB6A 3IU2A 3PFEA 1S7NA 4ZY2A 1Y9WA 2ZEPA 2V8HA 2DPTA 2WUUA 2OOTA 5F46A 1M4LA 2AFOA 1YX0A 1FT7A 5A28A 4CGPA 1Y9KA 4C2XA 2F5IA 4XPKA 1PUAA 4IHMA 2PE3A 4M6GA 4RS2A 1YREA 4M3SA 7CPAA 2NYQA 3B8GA 3EC4A 4FD6A 1S3ZA 4MBUA 2X7BA 3FECA 4KS9A 4OMEA 1TKHA 1YVKA 3QNVA 2AFUA 1AMPA 2J9AA 4H6ZA 4CYQA 1M1DA 3F0AA 4L89A 2FT0A 4IF5A 1CM0A 1YR0A 1M44A 3TO9A 4X2TA 3FJUA 4CAVA 3LWUA 1IOFA 3SJXA 4X8IA 3D7HA 2Z11A 2HC9A 4B12A 3IGRA 2AJ6A 2Z3OA 4R3KA 3WC7A 4CAWA 2CNMA 2AFWA 1F2PA 2OZUA 3DSBA 3KGQA 4KOTA 3DDDA 3FB3A 4Z65A 2PIYA 3I9SA 4KSFA 1YQEA 2PSWA 3EY5A 3RYOA 2P6GA 2Z3LA 5JH9A 1IY7A 1ZLHA 2O4HA 2XEGA 4NEXA 4Q38A 3RAMA 3D3SA 2OU2A 4E2AA 2G0BA 4KSIA 2CNSA 4M85A 1XFOA 1TF8A 3C26A 2EUIA 2JBKA 1DTDA 2OZGA 1I21A 4KUAA 4R7MA 2J8RA 4A37A 1GYTA 1IYKA 2EK8A 4F8ZA 4IUSA 5JM6A 1KUYA 2Z10A 4RN7A 2WPXA 2JEWA 4BMHA 4UWJA 4PSWA 4PXCA 2PC1A 2PVWA 2R98A 3B3TA 2CTCA 1IGBA 4MHPA 5I4MA 3KL9A 5F09A 2R1IA 2WYRA 2OB0A 1Y7RA 3D2MA 5HVGA 2I3CA 3CZXA 3SI2A 3T8WA 5LRKA 1V0CA 2QYVA 4DYOA 2FVGA 4KOYA 4R8FA 1RO5A 2DPSA 4HNYB 4OKOA 4OLLA 1CP6A 1XBUA 2JBJA 2GU2A 4YGOA 4RUHA 1Y0RA 4F0YA 2YNDA 5JQ4A 1LAMA 2JDCA 4MFJA 3PB4X 4P44A 1I12A 2Q43A 3KHZA 1TF9A 4MFQA 2RC4A 4PK2A 3VWEA 4CAXA 1Z9UA 3GY9A 2HV2A 3WC5A 2POKA 1MJ9A 3L2NA 2PR1A 2AFMA 8CPAA 2B3UA 2FIWA 2H5MA 2QVPA 3K9TA 4MFKA 3B2YA 2B5GB 3IWEA 3KQZA 3FYNA 3NH8A 4R3LA 5D29A 4C2ZA 5HVFA 1UWYA 3NA6A 5C88A 2CTBA 4Y49B 2IQ6A 1FNOA 2GLFA 1OZPA 4H6UA 2CF4A 2Q0YA 3V7ZA 2C27A 2PQ8A 4YU9A 2VZZA 4P10A 4HNXB 1JQGA 1Q7LA 1ARLA 2PRQA 2CNTA 2IJZA 3IU1A 3KR4A 4UEZA 3D7DA 2AFXA 3EFAA 1IICA 2GIVA 5J8FA 5ELYA 4AVCA 1YLOA 2CIJA 4PSXA 1Q2CA 3PB7X 4PXEA 4R87A 2PCUA 3N7ZA 4PQAA 4C7HA 4MFPA 4OC4A 2QMLA 1XIXA 3D66A 4U9YA 1Y0YA 2B3VA 3PP9A 1PU9A 4DJLA 4W9YA 4UEEA 3R96A 4MFLA 3IC1A 4A95A 1TIQA 5E96A 2Q7BA 4R9MA 4IK2A 2Q4YA 2PJ6A 5G1ZA 4MCQA 4OIDA 2GFQA 4X3RA 4KUBA 2PDOA 3G8WA 3PBBA 3B3WA 4P4BA 1MJBA 1XJOA 3FXTA 2ZW4A 4MI4A 2PJBA 3IJ3A 4NJRA 1J4JA 1HDQA 2FIAA 2VL1A 4OADA 5LYFA 2QIRA 1AUGA 4QC6A 2RFHA 1YW4A 2REFA 2PJCA 4R76A 2F8HA 1TKFA 2Q4ZA 3S9NA 1Q2YA 4CPAA 1RTQA 4P4EA 2DEAA 4P4FA 4KOSA 1Y7EA 2I00A 4JXQA 4TNUA 4HKFA 1Z2LA 1KZFA 2VQYA 4CGLA 4A31A 4FBEA 4B11A 4KOVA 4NFRA 1XRYA 3BLNA 3V38A 4NGSA 3R1KA 1XE4A 4UBRA 1CX8A 4XPDB 2NSMA 5HH1A 3R9EA 1IIDA 1LRZA 3D7FA 2V8GA 4YFJA 4OIWA 3NE8A 1CBXA 1FY7A 3F8KA 3K2KA 4F6AA 3QAHA 1IOIA 2AFZA 3CPAA 3CXPA 4CGMA 4UF4A 3DR8A 2BL1A 4J3GA 5LRGA 4UIAA 4E8OA 4UA3A 4JLYA 4NGPA 1UFHA 1YVOA 4FAIA 4B5OA 5AG4A 2J8MA 2YNEA 2C6CA 4ZBGA 2CXAA 2GREA 2IMOA 3I1UA 1Z8XA 3F5BA 3I3GA 2B58A 3CXQA 4KOUA 4PV6A 5H86A 5C82A 4R57A 1ZG7A 5CNPA 4ONWA 3JVNA 4FWUA 1ZLIA 2PRBA 2Z3KA 4B13A 4LUAA 4UFXA 4A2ZA 4ORFA 4EVYA 2JDDA 2YNCC 2HUZA 3V8IA 4AXVA 1K4JA 2XEFA 2J8NA 1NSLA 5THWA 2D4PA 3ISXA 3FRMA 4UCMA 3VWDA 3CXSA 3KZWA 4XPLA 5AG7A 1XF8A 4IAVA 4BBHA 4ZY0A 2GANA 3FEEA 3W6SA 1HDUA 2CY2A 2V77A 1P4NA 4OC5A 2PJ2A 3LD2A 4OC0A 3PBEA 2OH1A 4H89A 2FL4A 2ZW7A 2FS5A 2PJ0A 4RI1A 3RNZA 1B87A 4ZX9A 5IB0A 4WWVA 3ZJ0A 1M4IA 3QAYA 2PJ8A 1ZO0A 4JYWA 4MY0A 5EBVA 2R8VA 3IWWA 2FCKA 2YNCA 2Z3PA 2G3TA 2C6PA 4ZI6A 5IX3A 5LYDA 1QSRA 1S7LA 3IO1A 3NH5A 3FEDA 4OC3A 4L8AA 3WABA 4C2YA 4QBJA 1L0CA 2BO9A 1QMUA 3GKRA 2QECA 2ZEDA 4UEFA 3LODA 3CPXA 3TFYA 2FE7A 5KTAA 3H8GA 4MCRA 5D8NA 4DNCA 4O23A 3D4UA 4ONUA 3GIUA 4AG9A 4CYOA 1A2ZA 4CAFA 3P2FA 2OR4A 3TO6A 4NGNA 4MHZA 5K8PA 5AG5A 3S6FA 5KTCA 3W91A 1YSJA 3DNSA 3JTKA 4AG7A 2DF5A 2P6FA 2P0WA 4NXYA 1EE3P 3B3CA 3SXOA 2Q7SA 4Q36A 1U6MA 3D67A 3G3SA 4P4JA 2ZXVA 5JPHA 2GLJA 5DS0A 5IB9A 3TE4A 1BPNA 5J1QA 2Z3NA 3H8FA 3ISZA 4WJBA 3FNCA 3GUXA 2IL4A 3WR7A 3K9UA 3MGDA 4EMEA
chains in the Genus database with same CATH topology
5F47A 2Q44A 3BJ8A 5F48A 3EXNA 1S7FA 1WWZA 4B5PA 4OAEA 5DWNA 3EO4A 1ON0A 4CGOA 2PR8A 4MY3A 3ZZIA 4AVBA 5DWMA 4UFWA 2R7HA 3FBUA 1B6BA 4KLWA 4KOXA 1XMTA 2Z3MA 4UWIA 1M4DA 1Z4RA 5FVJA 4NSQA 3E0KA 4QVTA 3KKWA 4XNHC 2B4DA 4UCNA 4CYPA 3W6XA 1KUXA 4KORA 2YGWA 4UCPA 3JUWA 4CS0B 3H5ZA 3UY5A 4JD6A 3PZJA 3T9YA 3T90A 3TTHA 2AE6A 5EC4A 2BUEA 4UFVA 3DR6A 1I1DA 2G3AA 4LX9A 1VHSA 3FIXA 1IB1E 1SQHA 3R95A 4KLVA 4KSAA 2Z0ZA 3R9FA 4A33A 1NMTA 2ZW6A 1R57A 3R9GA 1BOBA 3D8PA 5ISVA 1MJAA 4KVME 4A32A 4B10A 4F0XA 1Q2DA 3D2PA 2GE3A 3S6GA 2A4NA 4FD5A 1QSNA 1N71A 2K5TA 5AGEA 2WSAA 4C7IA 1NE9A 2FSRA 2NMTA 5J8CA 3OWCA 4U9ZA 5BWAB 5GCNA 3IWGA 5HMNA 4PK3A 2O28A 4X5KA 1M4GA 4JJXA 4JXRA 3NE7A 3SHPA 5I0CA 2VI7A 4KOWA 2DXQA 4HNWB 5IV0A 3TCVA 2OZHA 2ATRA 2HQYA 1S60A 2VEZA 3S6HA 4Y49C 4U5YA 1S7KA 1S5KA 1QSTA 3TO7A 4KZTA 2I79A 4CYNA 1KUVA 2ZW5A 3TOBA 4NCZA 1QSMA 1YLEA 2Q04A 1MK4A 4MHDA 4JWPA 1YGHA 2D4OA 4K30A 4AVAA 4KVXA 2P6EA 2BEIA 2ARHA 5G22A 4ZGYB 4I49A 2B5GA 2WPWA 4C68A 4CAEA 4II9A 1P0HA 4MFZA 4CRYB 3TT2A 1IYLA 1Z4EA 4B5PB 4GS4A 2VBQA 4QUSA 2KCWA 3H4QA 1BO4A 1YK3A 4NF1A 4QB9A 3A9LA 1WK4A 3GYAA 4A30A 4FD4A 5H84A 4YRHA 5G21A 4KVOE 5F49A 5AG6A 5G20A 4FD7A 2B4DB 5A27A 2Y0MA 2JEVA 4CGNA 1QSOA 3P2HA 4XPDC 4CRZB 3BJ7A 2VXKA 3QB8A 4B14A 2REEA 3PGPA 2EVNA 3TOAA 2ZPAA 5KTDA 2BSWA 2JLMA 1GHEA 1XEBA 2Q4VA 3S6KA 1VKCA 4XNHB 3SXNA 2FXFA 1RXTA 4MJ8A 4E0AA 4AB7A 2B4BA 2VZYA 1CJWA 3IU2A 1S7NA 1Y9WA 2DPTA 2WUUA 5F46A 1YX0A 5A28A 4CGPA 1Y9KA 4C2XA 2F5IA 4XPKA 1PUAA 4RS2A 1YREA 4M3SA 3B8GA 3EC4A 4FD6A 1S3ZA 4MBUA 2X7BA 4KS9A 1YVKA 4H6ZA 4CYQA 1M1DA 3F0AA 4L89A 2FT0A 4IF5A 1CM0A 1YR0A 1M44A 3TO9A 4CAVA 2Z11A 4B12A 3IGRA 2AJ6A 2Z3OA 4R3KA 4CAWA 2CNMA 2OZUA 3DSBA 4KOTA 3DDDA 3FB3A 3I9SA 4KSFA 2PSWA 3EY5A 3RYOA 2P6GA 2Z3LA 4NEXA 4Q38A 3D3SA 2OU2A 4E2AA 2G0BA 2CNSA 4M85A 3C26A 2EUIA 2OZGA 1I21A 4KUAA 2J8RA 1IYKA 4IUSA 1KUYA 2Z10A 2WPXA 4BMHA 4UWJA 4PSWA 2PC1A 2R98A 2R1IA 2OB0A 1Y7RA 3D2MA 1V0CA 4KOYA 1RO5A 2DPSA 4HNYB 4OLLA 4YGOA 4F0YA 2YNDA 5JQ4A 2JDCA 4MFJA 1I12A 4PK2A 4MFQA 4CAXA 2RC4A 3VWEA 1Z9UA 3GY9A 2HV2A 1MJ9A 2PR1A 2B3UA 2FIWA 2H5MA 4MFKA 2B5GB 3IWEA 4R3LA 3FYNA 4C2ZA 5C88A 4Y49B 1OZPA 4H6UA 2Q0YA 2C27A 2PQ8A 2VZZA 4HNXB 2CNTA 3IU1A 3EFAA 1IICA 2GIVA 5J8FA 4AVCA 4PSXA 1Q2CA 4R87A 3N7ZA 4C7HA 4MFPA 2QMLA 1XIXA 4U9YA 2B3VA 3PP9A 1PU9A 3R96A 4MFLA 4A95A 1TIQA 5E96A 2Q7BA 4R9MA 2Q4YA 5G1ZA 4KUBA 2PDOA 3G8WA 1MJBA 3FXTA 2ZW4A 4MI4A 1J4JA 2FIAA 4OADA 2QIRA 4QC6A 2REFA 1Q2YA 4KOSA 4JXQA 2I00A 4HKFA 1KZFA 2VQYA 4CGLA 4A31A 4B11A 4KOVA 3BLNA 3R1KA 1XE4A 4UBRA 4XPDB 5HH1A 3R9EA 1IIDA 1LRZA 4YFJA 1FY7A 3F8KA 4F6AA 3QAHA 4CGMA 3CXPA 3DR8A 2BL1A 4J3GA 4E8OA 4UA3A 4JLYA 1UFHA 1YVOA 4B5OA 5AG4A 2J8MA 2YNEA 4ZBGA 2CXAA 4KOUA 3F5BA 3I3GA 2B58A 3CXQA 4PV6A 5H86A 5C82A 4R57A 5CNPA 3JVNA 2PRBA 2Z3KA 4B13A 4LUAA 4UFXA 4A2ZA 4ORFA 4EVYA 2JDDA 2YNCC 2HUZA 3V8IA 1K4JA 2J8NA 1NSLA 2D4PA 3FRMA 4UCMA 3VWDA 3CXSA 4XPLA 5AG7A 1XF8A 4BBHA 2GANA 3W6SA 2CY2A 1P4NA 3LD2A 2OH1A 4H89A 2FL4A 2ZW7A 2FS5A 4RI1A 1B87A 5IB0A 3ZJ0A 1M4IA 1ZO0A 4MY0A 5EBVA 2R8VA 2FCKA 2YNCA 2Z3PA 2G3TA 5IX3A 1QSRA 1S7LA 4L8AA 4C2YA 4QBJA 1L0CA 3GKRA 2QECA 3LODA 3TFYA 2FE7A 5KTAA 4DNCA 4ONUA 4AG9A 4CYOA 4CAFA 3P2FA 3TO6A 5AG5A 3S6FA 5KTCA 3W91A 3DNSA 3JTKA 4AG7A 4NXYA 2P6FA 2P0WA 3SXOA 4Q36A 1U6MA 3G3SA 2ZXVA 5JPHA 3TE4A 2Z3NA 3FNCA 2IL4A 3WR7A 3K9UA 3MGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F47 A;  2Q44 A;  3BJ8 A;  5F48 A;  3EXN A;  1S7F A;  1WWZ A;  4B5P A;  4OAE A;  5DWN A;  3EO4 A;  1ON0 A;  2PR8 A;  4MY3 A;  3ZZI A;  4AVB A;  5DWM A;  2R7H A;  3FBU A;  1B6B A;  4KLW A;  4KOX A;  1XMT A;  4UWI A;  1M4D A;  1Z4R A;  5FVJ A;  4NSQ A;  3E0K A;  4QVT A;  3KKW A;  4XNH C;  2B4D A;  3W6X A;  1KUX A;  4KOR A;  3JUW A;  4CS0 B;  3UY5 A;  4JD6 A;  3PZJ A;  3T9Y A;  3T90 A;  3TTH A;  2AE6 A;  5EC4 A;  2BUE A;  3DR6 A;  1I1D A;  2G3A A;  4LX9 A;  1VHS A;  3FIX A;  1IB1 E;  1SQH A;  3R95 A;  4KLV A;  2Z0Z A;  3R9F A;  1NMT A;  2ZW6 A;  1R57 A;  3R9G A;  1BOB A;  3D8P A;  5ISV A;  1MJA A;  4KVM E;  1Q2D A;  3D2P A;  2GE3 A;  3S6G A;  2A4N A;  4FD5 A;  1QSN A;  1N71 A;  2K5T A;  1NE9 A;  2FSR A;  2NMT A;  5J8C A;  3OWC A;  4U9Z A;  5GCN A;  3IWG A;  5HMN A;  4PK3 A;  2O28 A;  4X5K A;  1M4G A;  4JJX A;  4JXR A;  3NE7 A;  3SHP A;  5I0C A;  2VI7 A;  4KOW A;  2DXQ A;  4HNW B;  5IV0 A;  3TCV A;  2OZH A;  2ATR A;  2HQY A;  1S60 A;  2VEZ A;  3S6H A;  4Y49 C;  4U5Y A;  1S7K A;  1S5K A;  1QST A;  3TO7 A;  4KZT A;  2I79 A;  1KUV A;  2ZW5 A;  3TOB A;  4NCZ A;  1QSM A;  1YLE A;  2Q04 A;  1MK4 A;  4MHD A;  4JWP A;  1YGH A;  2D4O A;  4K30 A;  4AVA A;  4KVX A;  2P6E A;  2BEI A;  2ARH A;  4I49 A;  2B5G A;  2WPW A;  4II9 A;  1P0H A;  4CRY B;  3TT2 A;  1IYL A;  1Z4E A;  4B5P B;  4GS4 A;  2VBQ A;  4QUS A;  2KCW A;  3H4Q A;  1BO4 A;  1YK3 A;  4NF1 A;  4QB9 A;  1WK4 A;  3GYA A;  4FD4 A;  5H84 A;  4YRH A;  4KVO E;  5F49 A;  4FD7 A;  2B4D B;  2Y0M A;  2JEV A;  1QSO A;  3P2H A;  4XPD C;  4CRZ B;  3BJ7 A;  2VXK A;  3QB8 A;  2REE A;  3PGP A;  2EVN A;  3TOA A;  2ZPA A;  5KTD A;  2BSW A;  2JLM A;  1GHE A;  1XEB A;  2Q4V A;  3S6K A;  1VKC A;  4XNH B;  3SXN A;  2FXF A;  1RXT A;  4MJ8 A;  4E0A A;  4AB7 A;  2B4B A;  2VZY A;  1CJW A;  1S7N A;  1Y9W A;  5F46 A;  1YX0 A;  1Y9K A;  2F5I A;  4XPK A;  1PUA A;  4RS2 A;  1YRE A;  4M3S A;  3B8G A;  3EC4 A;  4FD6 A;  1S3Z A;  4MBU A;  2X7B A;  1YVK A;  4H6Z A;  1M1D A;  3F0A A;  4L89 A;  2FT0 A;  4IF5 A;  1CM0 A;  1YR0 A;  1M44 A;  3TO9 A;  4CAV A;  2Z11 A;  3IGR A;  2AJ6 A;  4R3K A;  4CAW A;  2CNM A;  2OZU A;  3DSB A;  4KOT A;  3DDD A;  3FB3 A;  3I9S A;  2PSW A;  3EY5 A;  3RYO A;  2P6G A;  4NEX A;  3D3S A;  2OU2 A;  4E2A A;  2G0B A;  2CNS A;  4M85 A;  3C26 A;  2EUI A;  2OZG A;  4KUA A;  1I21 A;  2J8R A;  1IYK A;  4IUS A;  1KUY A;  2Z10 A;  2WPX A;  4BMH A;  4UWJ A;  4PSW A;  2PC1 A;  2R98 A;  2R1I A;  2OB0 A;  1Y7R A;  3D2M A;  1V0C A;  4KOY A;  1RO5 A;  4HNY B;  4OLL A;  4YGO A;  4F0Y A;  5JQ4 A;  2JDC A;  1I12 A;  4PK2 A;  4CAX A;  2RC4 A;  3VWE A;  1Z9U A;  3GY9 A;  2HV2 A;  1MJ9 A;  2PR1 A;  2B3U A;  2FIW A;  2H5M A;  2B5G B;  4R3L A;  3FYN A;  5C88 A;  4Y49 B;  1OZP A;  4H6U A;  2Q0Y A;  2C27 A;  2PQ8 A;  2VZZ A;  4HNX B;  2CNT A;  3EFA A;  1IIC A;  2GIV A;  5J8F A;  4AVC A;  4PSX A;  1Q2C A;  4R87 A;  3N7Z A;  2QML A;  1XIX A;  4U9Y A;  2B3V A;  3PP9 A;  1PU9 A;  3R96 A;  1TIQ A;  5E96 A;  2Q7B A;  4R9M A;  2Q4Y A;  4KUB A;  2PDO A;  3G8W A;  1MJB A;  3FXT A;  2ZW4 A;  4MI4 A;  1J4J A;  2FIA A;  4OAD A;  2QIR A;  4QC6 A;  2REF A;  1Q2Y A;  4KOS A;  4JXQ A;  2I00 A;  4HKF A;  1KZF A;  2VQY A;  4KOV A;  3BLN A;  3R1K A;  1XE4 A;  4UBR A;  4XPD B;  5HH1 A;  3R9E A;  1IID A;  1LRZ A;  4YFJ A;  1FY7 A;  3F8K A;  4F6A A;  3QAH A;  3CXP A;  3DR8 A;  2BL1 A;  4J3G A;  4E8O A;  4UA3 A;  4JLY A;  1UFH A;  1YVO A;  4B5O A;  2J8M A;  4ZBG A;  4KOU A;  3F5B A;  3I3G A;  2B58 A;  3CXQ A;  4PV6 A;  5H86 A;  5C82 A;  4R57 A;  5CNP A;  3JVN A;  2PRB A;  4LUA A;  4ORF A;  4EVY A;  2JDD A;  2HUZ A;  3V8I A;  1K4J A;  2J8N A;  1NSL A;  2D4P A;  3FRM A;  3VWD A;  3CXS A;  4XPL A;  1XF8 A;  2GAN A;  3W6S A;  2CY2 A;  1P4N A;  3LD2 A;  2OH1 A;  4H89 A;  2FL4 A;  2ZW7 A;  2FS5 A;  4RI1 A;  1B87 A;  5IB0 A;  3ZJ0 A;  1M4I A;  4MY0 A;  5EBV A;  2R8V A;  2FCK A;  2G3T A;  5IX3 A;  1QSR A;  1S7L A;  4L8A A;  4QBJ A;  1L0C A;  3GKR A;  2QEC A;  3LOD A;  3TFY A;  2FE7 A;  5KTA A;  4DNC A;  4ONU A;  4AG9 A;  3P2F A;  3TO6 A;  3S6F A;  5KTC A;  3W91 A;  3DNS A;  4AG7 A;  4NXY A;  2P6F A;  2P0W A;  3SXO A;  1U6M A;  3G3S A;  2ZXV A;  5JPH A;  3TE4 A;  3FNC A;  2IL4 A;  3WR7 A;  3K9U A;  3MGD A; 
#chains in the Genus database with same CATH topology
 1NSA A;  2V8V A;  3HLP A;  5F47 A;  1Z8L A;  5K8M A;  1R43 A;  4BIN A;  2Q44 A;  3BJ8 A;  5F48 A;  3EXN A;  1S7F A;  1WWZ A;  2Q51 A;  3KI9 A;  4B5P A;  4P6Y A;  5K8O A;  4OAE A;  5DWN A;  3EO4 A;  1ON0 A;  4CGO A;  2PR8 A;  4MY3 A;  3ZZI A;  4AVB A;  5DWM A;  4A38 A;  4UFW A;  2R7H A;  3FBU A;  1B6B A;  4KLW A;  1ZG9 A;  4KOX A;  1XMT A;  3B3S A;  1BLL E;  2Z3M A;  4EWT A;  5CBM A;  2PJA A;  1ELM P;  4UWI A;  3VH9 A;  1M4D A;  1Z4R A;  2BOA A;  4MHN A;  5FVJ A;  4B6Z A;  4NSQ A;  2PIZ A;  2EK9 A;  3E0K A;  4QVT A;  3KKW A;  4MXU A;  4XNH C;  2B4D A;  4M6I A;  2PJ3 A;  4UCN A;  2ZEO A;  4ZYQ A;  4CYP A;  2ABZ A;  3W6X A;  3PRT A;  1KUX A;  4KOR A;  1Z5R A;  2YGW A;  4UCP A;  3BI1 A;  3JUW A;  2EWB A;  4PXB A;  5HVH A;  4CS0 B;  3LAC A;  4NJQ A;  3H5Z A;  2EBJ A;  5CPA A;  2WZN A;  3UY5 A;  4JD6 A;  3PZJ A;  3T9Y A;  2ZEE A;  4K3N A;  3T90 A;  3KHX A;  3TTH A;  4LQG A;  4OC1 A;  2AE6 A;  5EC4 A;  2BUE A;  4UFV A;  3DR6 A;  4YWY A;  2EO8 A;  1I1D A;  3KQX A;  2G3A A;  2C1C A;  4R6T A;  4LX9 A;  1VHS A;  1ZG8 A;  4H2K A;  3FIX A;  1IB1 E;  2C6G A;  1SQH A;  3R95 A;  4KLV A;  4KSA A;  5LYI A;  2Z0Z A;  1AYE A;  3R9F A;  4A33 A;  5LYL A;  1NMT A;  3KR5 A;  4ZX8 A;  2ZW6 A;  4MCP A;  1Z8T A;  1CPX A;  4NGM A;  6CPA A;  1R57 A;  3R9G A;  1BOB A;  3D8P A;  2ZOF A;  5ISV A;  3VAR A;  4UIB A;  1MJA A;  1YME A;  4KVM E;  4A32 A;  4B10 A;  4F0X A;  1Q2D A;  3D2P A;  2GE3 A;  3GB0 A;  2G9D A;  3D7G A;  4MMO A;  4Q7A A;  2A4N A;  3S6G A;  3SJE A;  1R3N A;  4EFD A;  4FD5 A;  1HEE A;  3B7I A;  1OBR A;  1QSN A;  3SI1 A;  1N71 A;  2K5T A;  5AGE A;  2WSA A;  4C7I A;  1NE9 A;  2FSR A;  2NMT A;  5J8C A;  3OWC A;  3D68 A;  1CG2 A;  4U9Z A;  4GXH A;  5BWA B;  2AFS A;  1VIX A;  2XEI A;  1F57 A;  3LMS A;  2ANP A;  4P4I A;  5GCN A;  3IWG A;  5HMN A;  4PK3 A;  1BPM A;  2O28 A;  4X5K A;  1M4G A;  3WT4 A;  4JJX A;  4P45 A;  3FMC A;  1XOV A;  3GLJ A;  4JXR A;  1JWQ A;  1LFW A;  4GM5 A;  3NE7 A;  5JGF A;  2ZEH A;  3SHP A;  5K8N A;  5I0C A;  4F9U A;  2VI7 A;  4KOW A;  2ZEN A;  2DXQ A;  4P4D A;  4HNW B;  5IV0 A;  3TCV A;  2OZH A;  4NGQ A;  2ATR A;  2HQY A;  1S60 A;  3IFE A;  3SI0 A;  2ZEM A;  1CP7 A;  3BHX A;  1LAP A;  3KAS A;  2VEZ A;  3IIB A;  3S6H A;  4Y49 C;  4U5Y A;  1VHE A;  1S7K A;  1S5K A;  1XMB A;  1QST A;  1KWM A;  4KZT A;  4MRI A;  2I79 A;  3TO7 A;  3VAT A;  4CYN A;  1X12 A;  1KUV A;  2PJ1 A;  2PJ4 A;  1VGY A;  2ZW5 A;  3TOB A;  1BAV A;  1QSM A;  3FH4 A;  4NCZ A;  1YLE A;  2Q04 A;  1MK4 A;  1TXR A;  2F7V A;  4JZ0 A;  3FF3 A;  4NGR A;  4MHD A;  1PCA A;  4JWP A;  3HUV A;  3MRU A;  1X10 A;  3CDX A;  1LCP A;  1YGH A;  2D4O A;  4K30 A;  3FVL A;  1QQ9 A;  4AVA A;  4KVX A;  4OP4 A;  2P6E A;  2BEI A;  2ZOG A;  2ARH A;  2O53 A;  5LRJ A;  5G22 A;  4A94 A;  3PB8 X;  4ZGY B;  4I49 A;  2B5G A;  2WPW A;  3JRU A;  3DLJ A;  4C68 A;  4CAE A;  4M6H A;  4FUU A;  4II9 A;  1H8L A;  4A39 A;  1P0H A;  4F9V A;  4MFZ A;  3TC8 A;  4CRY B;  3PB9 X;  4MCS A;  2RB7 A;  3B3V A;  1IYL A;  1Z4E A;  3TT2 A;  4B5P B;  4GS4 A;  2QJ8 A;  2VBQ A;  4G1P A;  4PXD A;  4QUS A;  3S9L A;  2KCW A;  1YW6 A;  3PB6 X;  3H4Q A;  2PJ5 A;  1BO4 A;  2BCO A;  1YK3 A;  3RBU A;  4NF1 A;  4QB9 A;  3H8E A;  4DUK A;  4OC2 A;  3SJG A;  3A9L A;  1WK4 A;  3GYA A;  4A30 A;  1TKJ A;  3NH4 A;  1ARM A;  1VHO A;  2PJ7 A;  4FD4 A;  5H84 A;  2PVV A;  4YRH A;  2ZEF A;  5G21 A;  4KVO E;  5F49 A;  1DE4 C;  3BXM A;  5AG6 A;  5G20 A;  1ELL P;  3N5F A;  3S9M A;  2ZEL A;  4FD7 A;  2B4D B;  3CT9 A;  4BD9 A;  4MHY A;  5A27 A;  2Y0M A;  2JEV A;  3RZA A;  3WC6 A;  4CGN A;  5HXD A;  5EMI A;  1QSO A;  3B35 A;  3P2H A;  4LQ6 A;  4NGT A;  4XPD C;  4CRZ B;  4TWE A;  1F2O A;  3BJ7 A;  2VXK A;  3QB8 A;  4B14 A;  1CPS A;  3BI0 A;  2REE A;  3PGP A;  1LAN A;  3PFO A;  2EVN A;  3NFZ A;  2V8D A;  2ZPA A;  3TOA A;  3TX8 A;  2ZEG A;  4ZY1 A;  5KTD A;  3RO0 A;  3SJF A;  2ODF A;  3DGV A;  4HPS A;  2BSW A;  4PPZ A;  2JLM A;  1GHE A;  2PJ9 A;  1XEB A;  2Q4V A;  1Z8W A;  2XEJ A;  3IEH A;  1PYT B;  3MN8 A;  3S6K A;  1VKC A;  4XNH B;  3SXN A;  1IU8 A;  2FXF A;  1RXT A;  4MJ8 A;  4E0A A;  3PEI A;  2B4B A;  1LOK A;  2VZY A;  1CJW A;  3FX6 A;  4AB7 A;  2HB6 A;  3IU2 A;  3PFE A;  1S7N A;  4ZY2 A;  1Y9W A;  2ZEP A;  2V8H A;  2DPT A;  2WUU A;  2OOT A;  5F46 A;  1M4L A;  2AFO A;  1YX0 A;  1FT7 A;  5A28 A;  4CGP A;  1Y9K A;  4C2X A;  2F5I A;  4XPK A;  1PUA A;  4IHM A;  2PE3 A;  4M6G A;  4RS2 A;  1YRE A;  4M3S A;  7CPA A;  2NYQ A;  3B8G A;  3EC4 A;  4FD6 A;  1S3Z A;  4MBU A;  2X7B A;  3FEC A;  4KS9 A;  4OME A;  1TKH A;  1YVK A;  3QNV A;  2AFU A;  1AMP A;  2J9A A;  4H6Z A;  4CYQ A;  1M1D A;  3F0A A;  4L89 A;  2FT0 A;  4IF5 A;  1CM0 A;  1YR0 A;  1M44 A;  3TO9 A;  4X2T A;  3FJU A;  4CAV A;  3LWU A;  1IOF A;  3SJX A;  4X8I A;  3D7H A;  2Z11 A;  2HC9 A;  4B12 A;  3IGR A;  2AJ6 A;  2Z3O A;  4R3K A;  3WC7 A;  4CAW A;  2CNM A;  2AFW A;  1F2P A;  2OZU A;  3DSB A;  3KGQ A;  4KOT A;  3DDD A;  3FB3 A;  4Z65 A;  2PIY A;  3I9S A;  4KSF A;  1YQE A;  2PSW A;  3EY5 A;  3RYO A;  2P6G A;  2Z3L A;  5JH9 A;  1IY7 A;  1ZLH A;  2O4H A;  2XEG A;  4NEX A;  4Q38 A;  3RAM A;  3D3S A;  2OU2 A;  4E2A A;  2G0B A;  4KSI A;  2CNS A;  4M85 A;  1XFO A;  1TF8 A;  3C26 A;  2EUI A;  2JBK A;  1DTD A;  2OZG A;  1I21 A;  4KUA A;  4R7M A;  2J8R A;  4A37 A;  1GYT A;  1IYK A;  2EK8 A;  4F8Z A;  4IUS A;  5JM6 A;  1KUY A;  2Z10 A;  4RN7 A;  2WPX A;  2JEW A;  4BMH A;  4UWJ A;  4PSW A;  4PXC A;  2PC1 A;  2PVW A;  2R98 A;  3B3T A;  2CTC A;  1IGB A;  4MHP A;  5I4M A;  3KL9 A;  5F09 A;  2R1I A;  2WYR A;  2OB0 A;  1Y7R A;  3D2M A;  5HVG A;  2I3C A;  3CZX A;  3SI2 A;  3T8W A;  5LRK A;  1V0C A;  2QYV A;  4DYO A;  2FVG A;  4KOY A;  4R8F A;  1RO5 A;  2DPS A;  4HNY B;  4OKO A;  4OLL A;  1CP6 A;  1XBU A;  2JBJ A;  2GU2 A;  4YGO A;  4RUH A;  1Y0R A;  4F0Y A;  2YND A;  5JQ4 A;  1LAM A;  2JDC A;  4MFJ A;  3PB4 X;  4P44 A;  1I12 A;  2Q43 A;  3KHZ A;  1TF9 A;  4MFQ A;  2RC4 A;  4PK2 A;  3VWE A;  4CAX A;  1Z9U A;  3GY9 A;  2HV2 A;  3WC5 A;  2POK A;  1MJ9 A;  3L2N A;  2PR1 A;  2AFM A;  8CPA A;  2B3U A;  2FIW A;  2H5M A;  2QVP A;  3K9T A;  4MFK A;  3B2Y A;  2B5G B;  3IWE A;  3KQZ A;  3FYN A;  3NH8 A;  4R3L A;  5D29 A;  4C2Z A;  5HVF A;  1UWY A;  3NA6 A;  5C88 A;  2CTB A;  4Y49 B;  2IQ6 A;  1FNO A;  2GLF A;  1OZP A;  4H6U A;  2CF4 A;  2Q0Y A;  3V7Z A;  2C27 A;  2PQ8 A;  4YU9 A;  2VZZ A;  4P10 A;  4HNX B;  1JQG A;  1Q7L A;  1ARL A;  2PRQ A;  2CNT A;  2IJZ A;  3IU1 A;  3KR4 A;  4UEZ A;  3D7D A;  2AFX A;  3EFA A;  1IIC A;  2GIV A;  5J8F A;  5ELY A;  4AVC A;  1YLO A;  2CIJ A;  4PSX A;  1Q2C A;  3PB7 X;  4PXE A;  4R87 A;  2PCU A;  3N7Z A;  4PQA A;  4C7H A;  4MFP A;  4OC4 A;  2QML A;  1XIX A;  3D66 A;  4U9Y A;  1Y0Y A;  2B3V A;  3PP9 A;  1PU9 A;  4DJL A;  4W9Y A;  4UEE A;  3R96 A;  4MFL A;  3IC1 A;  4A95 A;  1TIQ A;  5E96 A;  2Q7B A;  4R9M A;  4IK2 A;  2Q4Y A;  2PJ6 A;  5G1Z A;  4MCQ A;  4OID A;  2GFQ A;  4X3R A;  4KUB A;  2PDO A;  3G8W A;  3PBB A;  3B3W A;  4P4B A;  1MJB A;  1XJO A;  3FXT A;  2ZW4 A;  4MI4 A;  2PJB A;  3IJ3 A;  4NJR A;  1J4J A;  1HDQ A;  2FIA A;  2VL1 A;  4OAD A;  5LYF A;  2QIR A;  1AUG A;  4QC6 A;  2RFH A;  1YW4 A;  2REF A;  2PJC A;  4R76 A;  2F8H A;  1TKF A;  2Q4Z A;  3S9N A;  1Q2Y A;  4CPA A;  1RTQ A;  4P4E A;  2DEA A;  4P4F A;  4KOS A;  1Y7E A;  2I00 A;  4JXQ A;  4TNU A;  4HKF A;  1Z2L A;  1KZF A;  2VQY A;  4CGL A;  4A31 A;  4FBE A;  4B11 A;  4KOV A;  4NFR A;  1XRY A;  3BLN A;  3V38 A;  4NGS A;  3R1K A;  1XE4 A;  4UBR A;  1CX8 A;  4XPD B;  2NSM A;  5HH1 A;  3R9E A;  1IID A;  1LRZ A;  3D7F A;  2V8G A;  4YFJ A;  4OIW A;  3NE8 A;  1CBX A;  1FY7 A;  3F8K A;  3K2K A;  4F6A A;  3QAH A;  1IOI A;  2AFZ A;  3CPA A;  3CXP A;  4CGM A;  4UF4 A;  3DR8 A;  2BL1 A;  4J3G A;  5LRG A;  4UIA A;  4E8O A;  4UA3 A;  4JLY A;  4NGP A;  1UFH A;  1YVO A;  4FAI A;  4B5O A;  5AG4 A;  2J8M A;  2YNE A;  2C6C A;  4ZBG A;  2CXA A;  2GRE A;  2IMO A;  3I1U A;  1Z8X A;  3F5B A;  3I3G A;  2B58 A;  3CXQ A;  4KOU A;  4PV6 A;  5H86 A;  5C82 A;  4R57 A;  1ZG7 A;  5CNP A;  4ONW A;  3JVN A;  4FWU A;  1ZLI A;  2PRB A;  2Z3K A;  4B13 A;  4LUA A;  4UFX A;  4A2Z A;  4ORF A;  4EVY A;  2JDD A;  2YNC C;  2HUZ A;  3V8I A;  4AXV A;  1K4J A;  2XEF A;  2J8N A;  1NSL A;  5THW A;  2D4P A;  3ISX A;  3FRM A;  4UCM A;  3VWD A;  3CXS A;  3KZW A;  4XPL A;  5AG7 A;  1XF8 A;  4IAV A;  4BBH A;  4ZY0 A;  2GAN A;  3FEE A;  3W6S A;  1HDU A;  2CY2 A;  2V77 A;  1P4N A;  4OC5 A;  2PJ2 A;  3LD2 A;  4OC0 A;  3PBE A;  2OH1 A;  4H89 A;  2FL4 A;  2ZW7 A;  2FS5 A;  2PJ0 A;  4RI1 A;  3RNZ A;  1B87 A;  4ZX9 A;  5IB0 A;  4WWV A;  3ZJ0 A;  1M4I A;  3QAY A;  2PJ8 A;  1ZO0 A;  4JYW A;  4MY0 A;  5EBV A;  2R8V A;  3IWW A;  2FCK A;  2YNC A;  2Z3P A;  2G3T A;  2C6P A;  4ZI6 A;  5IX3 A;  5LYD A;  1QSR A;  1S7L A;  3IO1 A;  3NH5 A;  3FED A;  4OC3 A;  4L8A A;  3WAB A;  4C2Y A;  4QBJ A;  1L0C A;  2BO9 A;  1QMU A;  3GKR A;  2QEC A;  2ZED A;  4UEF A;  3LOD A;  3CPX A;  3TFY A;  2FE7 A;  5KTA A;  3H8G A;  4MCR A;  5D8N A;  4DNC A;  4O23 A;  3D4U A;  4ONU A;  3GIU A;  4AG9 A;  4CYO A;  1A2Z A;  4CAF A;  3P2F A;  2OR4 A;  3TO6 A;  4NGN A;  4MHZ A;  5K8P A;  5AG5 A;  3S6F A;  5KTC A;  3W91 A;  1YSJ A;  3DNS A;  3JTK A;  4AG7 A;  2DF5 A;  2P6F A;  2P0W A;  4NXY A;  1EE3 P;  3B3C A;  3SXO A;  2Q7S A;  4Q36 A;  1U6M A;  3D67 A;  3G3S A;  4P4J A;  2ZXV A;  5JPH A;  2GLJ A;  5DS0 A;  5IB9 A;  3TE4 A;  1BPN A;  5J1Q A;  2Z3N A;  3H8F A;  3ISZ A;  4WJB A;  3FNC A;  3GUX A;  2IL4 A;  3WR7 A;  3K9U A;  3MGD A;  4EME A; 
#chains in the Genus database with same CATH homology
 5F47 A;  2Q44 A;  3BJ8 A;  5F48 A;  3EXN A;  1S7F A;  1WWZ A;  4B5P A;  4OAE A;  5DWN A;  3EO4 A;  1ON0 A;  4CGO A;  2PR8 A;  4MY3 A;  3ZZI A;  4AVB A;  5DWM A;  4UFW A;  2R7H A;  3FBU A;  1B6B A;  4KLW A;  4KOX A;  1XMT A;  2Z3M A;  4UWI A;  1M4D A;  1Z4R A;  5FVJ A;  4NSQ A;  3E0K A;  4QVT A;  3KKW A;  4XNH C;  2B4D A;  4UCN A;  4CYP A;  3W6X A;  1KUX A;  4KOR A;  2YGW A;  4UCP A;  3JUW A;  4CS0 B;  3H5Z A;  3UY5 A;  4JD6 A;  3PZJ A;  3T9Y A;  3T90 A;  3TTH A;  2AE6 A;  5EC4 A;  2BUE A;  4UFV A;  3DR6 A;  1I1D A;  2G3A A;  4LX9 A;  1VHS A;  3FIX A;  1IB1 E;  1SQH A;  3R95 A;  4KLV A;  4KSA A;  2Z0Z A;  3R9F A;  4A33 A;  1NMT A;  2ZW6 A;  1R57 A;  3R9G A;  1BOB A;  3D8P A;  5ISV A;  1MJA A;  4KVM E;  4A32 A;  4B10 A;  4F0X A;  1Q2D A;  3D2P A;  2GE3 A;  3S6G A;  2A4N A;  4FD5 A;  1QSN A;  1N71 A;  2K5T A;  5AGE A;  2WSA A;  4C7I A;  1NE9 A;  2FSR A;  2NMT A;  5J8C A;  3OWC A;  4U9Z A;  5BWA B;  5GCN A;  3IWG A;  5HMN A;  4PK3 A;  2O28 A;  4X5K A;  1M4G A;  4JJX A;  4JXR A;  3NE7 A;  3SHP A;  5I0C A;  2VI7 A;  4KOW A;  2DXQ A;  4HNW B;  5IV0 A;  3TCV A;  2OZH A;  2ATR A;  2HQY A;  1S60 A;  2VEZ A;  3S6H A;  4Y49 C;  4U5Y A;  1S7K A;  1S5K A;  1QST A;  3TO7 A;  4KZT A;  2I79 A;  4CYN A;  1KUV A;  2ZW5 A;  3TOB A;  4NCZ A;  1QSM A;  1YLE A;  2Q04 A;  1MK4 A;  4MHD A;  4JWP A;  1YGH A;  2D4O A;  4K30 A;  4AVA A;  4KVX A;  2P6E A;  2BEI A;  2ARH A;  5G22 A;  4ZGY B;  4I49 A;  2B5G A;  2WPW A;  4C68 A;  4CAE A;  4II9 A;  1P0H A;  4MFZ A;  4CRY B;  3TT2 A;  1IYL A;  1Z4E A;  4B5P B;  4GS4 A;  2VBQ A;  4QUS A;  2KCW A;  3H4Q A;  1BO4 A;  1YK3 A;  4NF1 A;  4QB9 A;  3A9L A;  1WK4 A;  3GYA A;  4A30 A;  4FD4 A;  5H84 A;  4YRH A;  5G21 A;  4KVO E;  5F49 A;  5AG6 A;  5G20 A;  4FD7 A;  2B4D B;  5A27 A;  2Y0M A;  2JEV A;  4CGN A;  1QSO A;  3P2H A;  4XPD C;  4CRZ B;  3BJ7 A;  2VXK A;  3QB8 A;  4B14 A;  2REE A;  3PGP A;  2EVN A;  3TOA A;  2ZPA A;  5KTD A;  2BSW A;  2JLM A;  1GHE A;  1XEB A;  2Q4V A;  3S6K A;  1VKC A;  4XNH B;  3SXN A;  2FXF A;  1RXT A;  4MJ8 A;  4E0A A;  4AB7 A;  2B4B A;  2VZY A;  1CJW A;  3IU2 A;  1S7N A;  1Y9W A;  2DPT A;  2WUU A;  5F46 A;  1YX0 A;  5A28 A;  4CGP A;  1Y9K A;  4C2X A;  2F5I A;  4XPK A;  1PUA A;  4RS2 A;  1YRE A;  4M3S A;  3B8G A;  3EC4 A;  4FD6 A;  1S3Z A;  4MBU A;  2X7B A;  4KS9 A;  1YVK A;  4H6Z A;  4CYQ A;  1M1D A;  3F0A A;  4L89 A;  2FT0 A;  4IF5 A;  1CM0 A;  1YR0 A;  1M44 A;  3TO9 A;  4CAV A;  2Z11 A;  4B12 A;  3IGR A;  2AJ6 A;  2Z3O A;  4R3K A;  4CAW A;  2CNM A;  2OZU A;  3DSB A;  4KOT A;  3DDD A;  3FB3 A;  3I9S A;  4KSF A;  2PSW A;  3EY5 A;  3RYO A;  2P6G A;  2Z3L A;  4NEX A;  4Q38 A;  3D3S A;  2OU2 A;  4E2A A;  2G0B A;  2CNS A;  4M85 A;  3C26 A;  2EUI A;  2OZG A;  1I21 A;  4KUA A;  2J8R A;  1IYK A;  4IUS A;  1KUY A;  2Z10 A;  2WPX A;  4BMH A;  4UWJ A;  4PSW A;  2PC1 A;  2R98 A;  2R1I A;  2OB0 A;  1Y7R A;  3D2M A;  1V0C A;  4KOY A;  1RO5 A;  2DPS A;  4HNY B;  4OLL A;  4YGO A;  4F0Y A;  2YND A;  5JQ4 A;  2JDC A;  4MFJ A;  1I12 A;  4PK2 A;  4MFQ A;  4CAX A;  2RC4 A;  3VWE A;  1Z9U A;  3GY9 A;  2HV2 A;  1MJ9 A;  2PR1 A;  2B3U A;  2FIW A;  2H5M A;  4MFK A;  2B5G B;  3IWE A;  4R3L A;  3FYN A;  4C2Z A;  5C88 A;  4Y49 B;  1OZP A;  4H6U A;  2Q0Y A;  2C27 A;  2PQ8 A;  2VZZ A;  4HNX B;  2CNT A;  3IU1 A;  3EFA A;  1IIC A;  2GIV A;  5J8F A;  4AVC A;  4PSX A;  1Q2C A;  4R87 A;  3N7Z A;  4C7H A;  4MFP A;  2QML A;  1XIX A;  4U9Y A;  2B3V A;  3PP9 A;  1PU9 A;  3R96 A;  4MFL A;  4A95 A;  1TIQ A;  5E96 A;  2Q7B A;  4R9M A;  2Q4Y A;  5G1Z A;  4KUB A;  2PDO A;  3G8W A;  1MJB A;  3FXT A;  2ZW4 A;  4MI4 A;  1J4J A;  2FIA A;  4OAD A;  2QIR A;  4QC6 A;  2REF A;  1Q2Y A;  4KOS A;  4JXQ A;  2I00 A;  4HKF A;  1KZF A;  2VQY A;  4CGL A;  4A31 A;  4B11 A;  4KOV A;  3BLN A;  3R1K A;  1XE4 A;  4UBR A;  4XPD B;  5HH1 A;  3R9E A;  1IID A;  1LRZ A;  4YFJ A;  1FY7 A;  3F8K A;  4F6A A;  3QAH A;  4CGM A;  3CXP A;  3DR8 A;  2BL1 A;  4J3G A;  4E8O A;  4UA3 A;  4JLY A;  1UFH A;  1YVO A;  4B5O A;  5AG4 A;  2J8M A;  2YNE A;  4ZBG A;  2CXA A;  4KOU A;  3F5B A;  3I3G A;  2B58 A;  3CXQ A;  4PV6 A;  5H86 A;  5C82 A;  4R57 A;  5CNP A;  3JVN A;  2PRB A;  2Z3K A;  4B13 A;  4LUA A;  4UFX A;  4A2Z A;  4ORF A;  4EVY A;  2JDD A;  2YNC C;  2HUZ A;  3V8I A;  1K4J A;  2J8N A;  1NSL A;  2D4P A;  3FRM A;  4UCM A;  3VWD A;  3CXS A;  4XPL A;  5AG7 A;  1XF8 A;  4BBH A;  2GAN A;  3W6S A;  2CY2 A;  1P4N A;  3LD2 A;  2OH1 A;  4H89 A;  2FL4 A;  2ZW7 A;  2FS5 A;  4RI1 A;  1B87 A;  5IB0 A;  3ZJ0 A;  1M4I A;  1ZO0 A;  4MY0 A;  5EBV A;  2R8V A;  2FCK A;  2YNC A;  2Z3P A;  2G3T A;  5IX3 A;  1QSR A;  1S7L A;  4L8A A;  4C2Y A;  4QBJ A;  1L0C A;  3GKR A;  2QEC A;  3LOD A;  3TFY A;  2FE7 A;  5KTA A;  4DNC A;  4ONU A;  4AG9 A;  4CYO A;  4CAF A;  3P2F A;  3TO6 A;  5AG5 A;  3S6F A;  5KTC A;  3W91 A;  3DNS A;  3JTK A;  4AG7 A;  4NXY A;  2P6F A;  2P0W A;  3SXO A;  4Q36 A;  1U6M A;  3G3S A;  2ZXV A;  5JPH A;  3TE4 A;  2Z3N A;  3FNC A;  2IL4 A;  3WR7 A;  3K9U A;  3MGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...