2BUEA

Structure of aac(6')-ib in complex with ribostamycin and coenzyme a.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 179
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2bueA00
2QMLA 2OZUA 1IYKA 4MBUA 4KUBA 2PRBA 4E2AA 3EY5A 2AJ6A 4KOYA 3TFYA 4GS4A 2B4DA 5KTCA 3BJ7A 1KUVA 5C88A 1NE9A 1YK3A 1CM0A 3T9YA 4KOXA 1YVKA 4U5YA 4RI1A 3SHPA 1S5KA 3CXQA 3QB8A 4L89A 5J8CA 2OU2A 4IUSA 4NEXA 4AVAA 2REFA 4B5PB 3TOBA 2K5TA 4J3GA 4DNCA 2Z0ZA 2CNMA 2B3VA 4AVCA 4H89A 1YREA 5EC4A 1IIDA 4F0YA 3F5BA 2Q0YA 1QSRA 3S6GA 1VKCA 3F8KA 2HUZA 4UWIA 3OWCA 3V8IA 4QBJA 3QAHA 4XPDC 3JVNA 1B87A 3DNSA 4NXYA 4QVTA 2P6FA 4E0AA 4YFJA 5F47A 4NF1A 2A4NA 3EXNA 5F49A 4R87A 1IB1E 2NMTA 2GANA 4X5KA 3D2PA 3ZJ0A 2F5IA 3P2FA 4FD4A 4LUAA 1QSOA 4KOTA 4KVOE 4IF5A 3ZZIA 2OZGA 4H6ZA 3R95A 2Q4VA 3EFAA 4XNHC 4KORA 3MGDA 4CRYB 2Q7BA 1WWZA 2BEIA 2EUIA 4M85A 4QC6A 2KCWA 2I79A 4R57A 4KOUA 4II9A 4KOWA 4HNYB 4HNWB 1M1DA 2ATRA 1VHSA 1BO4A 4NSQA 3EC4A 4Y49B 1Z4EA 2I00A 1MK4A 1S3ZA 1TIQA 4OADA 2Q4YA 1LRZA 2GIVA 3NE7A 1R57A 4PSXA 1MJBA 4ORFA 4OAEA 1M44A 4M3SA 2PC1A 3JUWA 3R96A 3LODA 3W6XA 1QSTA 4KVXA 1PU9A 2Q44A 4MY0A 2J8RA 2B3UA 4KOSA 3RYOA 2FT0A 4YRHA 4JXQA 5GCNA 2P0WA 4EVYA 1QSMA 3GY9A 1XEBA 2HQYA 3FBUA 4JXRA 3W91A 4PK2A 1P0HA 4FD7A 2WPXA 4MJ8A 3KKWA 2D4PA 3FNCA 3CXPA 3FB3A 1XMTA 2P6GA 1IICA 3BLNA 4R3LA 2G3TA 2B5GB 2B58A 1KUYA 4UA3A 4JWPA 3SXNA 2P6EA 3S6FA 3PGPA 4YGOA 1WK4A 5J8FA 2B4DB 3P2HA 5C82A 4XPDB 4U9YA 2PR1A 1S7KA 2ARHA 1RO5A 3TO6A 5IX3A 2FIWA 2B4BA 1YVOA 1NSLA 1Y9KA 2VZZA 2X7BA 5HMNA 4LX9A 2J8NA 4KUAA 3K9UA 3SXOA 3DDDA 1SQHA 4AVBA 3R1KA 1I12A 1OZPA 1S7LA 2H5MA 5DWNA 1N71A 3VWEA 4AB7A 2ZW7A 4XNHB 2HV2A 4PK3A 2FIAA 5KTAA 4ZBGA 2ZW4A 4B5OA 2FSRA 1P4NA 4H6UA 1Q2YA 4HKFA 1B6BA 4PV6A 4MHDA 2Q04A 2FL4A 4R3KA 4JD6A 4CAWA 1S7NA 5HH1A 3FRMA 3FXTA 2J8MA 5H86A 3R9EA 1M4DA 3DSBA 3EO4A 2VBQA 1PUAA 1FY7A 1YR0A 1BOBA 2CY2A 1MJ9A 3IGRA 3TTHA 5JQ4A 3DR8A 4I49A 4KOVA 3I9SA 4B5PA 4QUSA 2ZW6A 3S6HA 3VWDA 2ZW5A 2BUEA 4AG7A 2VZYA 2R1IA 3S6KA 2EVNA 4NCZA 1J4JA 2REEA 2FE7A 1I21A 1XE4A 4CS0B 4U9ZA 4MI4A 4FD5A 4KVME 2BL1A 2JDDA 3F0AA 1KZFA 4R9MA 5I0CA 2G0BA 4XPLA 4XPKA 1Z9UA 2PQ8A 1M4GA 2C27A 4CAXA 5H84A 3CXSA 2JEVA 1U6MA 3H4QA 2QECA 2OZHA 2VXKA 1Q2CA 1YGHA 2BSWA 2FCKA 1ON0A 1UFHA 1GHEA 3W6SA 3BJ8A 1CJWA 4CRZB 3TO9A 1RXTA 2Z11A 3UY5A 1I1DA 2QIRA 4L8AA 1V0CA 1XF8A 2ZPAA 3IWGA 4K30A 4HNXB 3GYAA 4UBRA 5IB0A 4KZTA 3LD2A 4PSWA 3I3GA 1YX0A 4E8OA 2PSWA 2JDCA 4FD6A 5FVJA 1S7FA 2Z10A 1K4JA 5CNPA 4KLVA 1MJAA 1Z4RA 2PR8A 1YLEA 1M4IA 3FYNA 5F48A 1IYLA 2IL4A 3D8PA 5DWMA 2D4OA 2O28A 2JLMA 3C26A 4BMHA 2VQYA 2CNSA 2VI7A 2WPWA 5KTDA 3DR6A 3E0KA 4MY3A 3T90A 3TOAA 1NMTA 1S60A 4OLLA 2CNTA 5E96A 1KUXA 4QB9A 3TCVA 3PZJA 2R8VA 3GKRA 3D2MA 3TE4A 3G3SA 4JJXA 3TO7A 3N7ZA 5ISVA 1Y9WA 2OB0A 2ZXVA 5JPHA 2OH1A 4RS2A 1XIXA 1Y7RA 3WR7A 2G3AA 4AG9A 4UWJA 3G8WA 4KLWA 4F6AA 3R9GA 3FIXA 3PP9A 2PDOA 4Y49C 2AE6A 2GE3A 3TT2A 4ONUA 4JLYA 2DXQA 5EBVA 3B8GA 5IV0A 4CAVA 2FS5A 1Q2DA 2FXFA 2B5GA 1L0CA 2R7HA 1QSNA 3R9FA 2R98A 3D3SA 2RC4A 2VEZA 5F46A 2Y0MA
chains in the Genus database with same CATH superfamily
2QMLA 2OZUA 1IYKA 1ELLP 4MBUA 4A2ZA 4KUBA 2PRBA 3T8WA 4A39A 5AG5A 4E2AA 3EY5A 2AJ6A 4KOYA 3TFYA 4GS4A 2B4DA 5KTCA 3KGQA 4P4FA 1LANA 4K3NA 3BJ7A 5JGFA 1KUVA 5C88A 1NE9A 1YK3A 1CM0A 3T9YA 1JWQA 1BLLE 2YNCA 2Z3LA 3FX6A 4DUKA 4KOXA 4B6ZA 3H8FA 2O4HA 1YVKA 4U5YA 4LQGA 5G22A 4RI1A 3SHPA 3IJ3A 1S5KA 8CPAA 4UCNA 3L2NA 1HDQA 4M6GA 4RN7A 3CXQA 3QB8A 4L89A 5J8CA 2OU2A 2AFZA 2PJ9A 3KI9A 4IUSA 4OC0A 2CXAA 4NEXA 3S9MA 4AVAA 4MFKA 4OC2A 2REFA 4B5PB 1PCAA 1F2PA 1LAMA 1XMBA 2K5TA 2ZEDA 3TOBA 2PJ7A 4J3GA 4DNCA 2PVVA 2Z0ZA 5LYIA 1IGBA 2B3VA 2CNMA 4MFZA 5ELYA 1NSAA 2YNEA 4AVCA 4H89A 3SJGA 4Z65A 1YREA 5EC4A 1IIDA 4UFWA 3B3CA 4F0YA 5LRKA 3F5BA 3NH5A 2Q0YA 4H2KA 4G1PA 2PJ4A 4ONWA 1QSRA 3S6GA 1VKCA 2DPTA 2I3CA 4C7IA 5J1QA 2EK9A 3CPXA 3F8KA 2HUZA 4UWIA 4BINA 3OWCA 3V8IA 2V8GA 3CPAA 5A27A 4P10A 4R7MA 4QBJA 1ARMA 3QAHA 4XPDC 3B3VA 5LYDA 1CPXA 3JVNA 1B87A 3DNSA 1CPSA 2Y0MA 4NXYA 3HLPA 4QVTA 4A32A 3BXMA 2P6FA 4E0AA 4YFJA 4CYPA 5F47A 4NF1A 4P4DA 3H8GA 2A4NA 3EXNA 2PJCA 5F49A 4LQ6A 2BO9A 6CPAA 4R87A 1IB1E 3RBUA 4NGRA 4MCPA 2NMTA 2GANA 4X5KA 5AG7A 4CYOA 3D2PA 3ZJ0A 3CZXA 2F5IA 3P2FA 4Q38A 4FD4A 3H5ZA 4JYWA 4LUAA 1QSOA 4KOTA 4KVOE 4IF5A 4B13A 4OP4A 1LFWA 4PXBA 3ZZIA 3FF3A 1AYEA 3D67A 2JEWA 1CG2A 2OZGA 3IFEA 4IK2A 4H6ZA 4OIDA 4OC5A 4A31A 4DYOA 1TXRA 3R95A 2Q4VA 5JH9A 3EFAA 1CP6A 4UIAA 4XNHC 3KZWA 4IHMA 2HC9A 4KORA 2GLJA 2PRQA 3MGDA 1TKFA 4CRYB 5JM6A 2Q7BA 1Y0RA 4OC1A 4CYQA 4R6TA 1WWZA 2BEIA 4M6IA 2EUIA 4M85A 2PCUA 4QC6A 2KCWA 2I79A 4R57A 4KOUA 4II9A 4CGPA 4KOWA 4HNYB 4HNWB 3PB4X 1M1DA 4MCRA 2ATRA 3B35A 3PB6X 1VHSA 2Z3KA 1BO4A 4ZY0A 4W9YA 4NSQA 4NFRA 3EC4A 4Y49B 3NH4A 4CPAA 1Z4EA 2I00A 1ZG8A 1MK4A 4MMOA 1S3ZA 5LYLA 1TIQA 4OADA 1YSJA 2Q4YA 1LRZA 1LCPA 1PYTB 2GIVA 1R57A 3NE7A 4P45A 4PSXA 3DGVA 1MJBA 2PIZA 5HVGA 3KR5A 3FVLA 3KR4A 4ORFA 4OAEA 2YNDA 1M44A 4M3SA 2PC1A 3JUWA 3R96A 3PB8X 3LODA 4ZX9A 3RO0A 3W6XA 4B11A 1QSTA 4KVXA 3FEEA 3D7GA 1PU9A 1CBXA 2AFOA 2Q44A 4MY0A 3NFZA 5K8MA 2J8RA 2QYVA 2B3UA 4KOSA 1A2ZA 5D29A 3D7HA 1XBUA 3RYOA 2FT0A 4AXVA 4TNUA 1VHOA 2JBJA 1ZG9A 4CGNA 4YRHA 4MHYA 3SJXA 2ANPA 2JBKA 4JXQA 4UEEA 5AG6A 5GCNA 2PE3A 2F7VA 2P0WA 4B10A 4EVYA 5G1ZA 2OOTA 1QSMA 3GY9A 3KQXA 1XEBA 3PB9X 2EWBA 3KHZA 2HQYA 2PJ0A 4A38A 3FBUA 4JXRA 3W91A 2ZEMA 4KSAA 4PK2A 4WWVA 1P0HA 3FH4A 4FD7A 4C2YA 2WPXA 4MJ8A 3KKWA 2D4PA 3FNCA 3KL9A 5K8NA 3B7IA 4IAVA 5BWAB 1XFOA 1HEEA 3CXPA 4PXDA 4OIWA 3FB3A 4P4EA 1IY7A 1XMTA 1YW6A 4KSIA 2P6GA 2ZENA 3BHXA 1IICA 3BLNA 4WJBA 5G21A 3SI0A 7CPAA 4R3LA 2G3TA 4HPSA 1BPMA 2B5GB 2B58A 4FUUA 1KUYA 3B3TA 4UA3A 4JWPA 1QMUA 3HUVA 4A94A 3RAMA 3SXNA 3BI1A 4JZ0A 4B12A 2ZEEA 2P6EA 3S6FA 4NGNA 2HB6A 3PGPA 1WK4A 4YGOA 2AFSA 3SI1A 5J8FA 2POKA 3KQZA 2B4DB 5HVFA 3P2HA 5C82A 2AFUA 4XPDB 1X10A 4NGSA 4U9YA 4X3RA 1Z8TA 2PR1A 1S7KA 2ARHA 1RO5A 3TO6A 5IX3A 2FIWA 1TF8A 2B4BA 1DTDA 1YVOA 4MRIA 1NSLA 3FECA 3SJFA 5IB9A 2BOAA 1Y9KA 2VZZA 2X7BA 3LMSA 3S9LA 1Y7EA 5HMNA 1YQEA 2IJZA 3VARA 4LX9A 2QJ8A 4OC4A 2C6GA 1FT7A 4Q7AA 1IOFA 2GLFA 2J8NA 4KUAA 3K9UA 3SXOA 1XJOA 3B3SA 3DDDA 1SQHA 2FVGA 2ZOFA 4AVBA 3D68A 3R1KA 4ZI6A 1I12A 5HVHA 1OZPA 3TC8A 1S7LA 2PJ5A 2H5MA 5DWNA 1N71A 5AGEA 4EWTA 3VWEA 2AFMA 5THWA 4AB7A 1CX8A 1M4LA 2ZW7A 4F9VA 4XNHB 2HV2A 1Q7LA 4PK3A 2FIAA 3GB0A 4UEFA 3A9LA 5KTAA 1X12A 4FWUA 4R76A 1VGYA 2DEAA 4ZBGA 3WC5A 4NJRA 4UFVA 2ZW4A 4B5OA 2FSRA 1P4NA 4H6UA 1Q2YA 4HKFA 3D7DA 5AG4A 3IU1A 3WT4A 1B6BA 4PV6A 1LAPA 4P6YA 4MHDA 1HDUA 2XEFA 1XOVA 4NGQA 4GM5A 1AMPA 1Y0YA 2Q04A 1ZLHA 4CGMA 3ISXA 2FL4A 4R3KA 4JD6A 4CAWA 1ARLA 5I4MA 1ELMP 2AFXA 2XEIA 3ISZA 4ZYQA 1S7NA 1Z8LA 4EMEA 4UEZA 4P4BA 5HH1A 3FRMA 3FXTA 4C68A 1DE4C 4C2ZA 2J8MA 5EMIA 3H8EA 4MFPA 5H86A 2ZEGA 1M4DA 4KSFA 3R9EA 3S9NA 3DSBA 4NJQA 4P44A 3EO4A 1YLOA 4BD9A 3RZAA 1BPNA 2VBQA 3WC6A 3CDXA 1PUAA 1FY7A 1YR0A 2PJ3A 1BOBA 2CY2A 1MJ9A 5LRJA 3IGRA 2Q51A 3TTHA 2WZNA 5JQ4A 4RUHA 3DR8A 4I49A 4Q36A 4KOVA 3I9SA 4B5PA 4QUSA 2ZW6A 3S6HA 3VWDA 2EO8A 3PFEA 2NYQA 1RTQA 2ZW5A 1XRYA 2BUEA 4AG7A 2XEGA 2VZYA 1IOIA 2R1IA 3FEDA 4UFXA 3S6KA 5HXDA 3WC7A 2ZEHA 4NGTA 3CT9A 1TKJA 5D8NA 2EVNA 1Z5RA 3JRUA 4NCZA 1J4JA 2REEA 2EK8A 2PVWA 2FE7A 1I21A 1XE4A 4KS9A 4U9ZA 4MI4A 3WABA 4CS0B 4FD5A 4KVME 2BL1A 4MXUA 2JDDA 3F0AA 3KHXA 4FBEA 1KZFA 4R9MA 3D7FA 2DPSA 4A30A 5I0CA 2G0BA 2Q7SA 4XPLA 4XPKA 4A95A 2Z3OA 3LWUA 1Z9UA 1UWYA 2CTCA 3KASA 4UCMA 2PQ8A 1M4GA 2C27A 4CAXA 2ZEOA 5H84A 3CXSA 3TX8A 1ZLIA 3PRTA 2JEVA 4MHZA 4X2TA 1U6MA 3H4QA 4PQAA 4F9UA 2QECA 2OZHA 2VXKA 1Q2CA 1YGHA 3B2YA 3IWWA 3MN8A 2Q43A 5LRGA 4ZY1A 2BSWA 2FCKA 4ZY2A 1ON0A 1UFHA 2WYRA 1GHEA 3W6SA 1Z2LA 3VH9A 1CJWA 3BJ8A 4CRZB 4F8ZA 3TO9A 1R3NA 1RXTA 2QVPA 2Z11A 3IO1A 3UY5A 4CYNA 3QAYA 1CP7A 1I1DA 2GFQA 2GREA 3K9TA 4MCSA 3SI2A 2QIRA 4L8AA 1V0CA 3I1UA 3D4UA 1XF8A 2ZPAA 3D66A 2YGWA 3IWGA 4K30A 4YU9A 4HNXB 4UIBA 3GYAA 2V8VA 4UBRA 4NGPA 4PPZA 1R43A 3VATA 5IB0A 3NE8A 4KZTA 1JQGA 1YMEA 3LD2A 2V8HA 4PSWA 3I3GA 2AFWA 2GU2A 1YX0A 4E8OA 2PSWA 2JDCA 1TKHA 2C1CA 1GYTA 2PJ2A 4MFJA 2NSMA 4PXCA 3GLJA 4P4JA 4FD6A 1AUGA 1IU8A 1KWMA 2PJ6A 4MHPA 5FVJA 1TF9A 1S7FA 4UF4A 2Z10A 3IEHA 1K4JA 4CAFA 5CNPA 4NGMA 2RB7A 4KLVA 1VHEA 3PB7X 1MJAA 1Z4RA 4MCQA 5DS0A 2PR8A 5CBMA 1YLEA 1M4IA 2EBJA 2ODFA 2VL1A 2WUUA 1ZG7A 2V8DA 2YNCC 2ZEPA 3FYNA 4UCPA 5F48A 1IYLA 5F09A 3B3WA 2IL4A 3D8PA 2WSAA 3PBEA 4GXHA 5DWMA 3FJUA 4C7HA 2IMOA 3GIUA 2D4OA 2O28A 2JLMA 3C26A 3DLJA 5A28A 2Z3NA 2PIYA 4A37A 4BMHA 2CTBA 2VQYA 3PEIA 1VIXA 2CNSA 4B14A 2VI7A 2WPWA 4OKOA 4C2XA 3BI0A 5KTDA 3DR6A 2IQ6A 3E0KA 1YW4A 3FMCA 3K2KA 4MY3A 3RNZA 3T90A 4ZX8A 4MHNA 3TOAA 1NMTA 1S60A 4CGOA 5K8OA 2Q4ZA 2O53A 4OLLA 2CNTA 3IU2A 4MFLA 4O23A 3LACA 3IWEA 4R8FA 5E96A 3GUXA 3V7ZA 1KUXA 4QB9A 3SJEA 5G20A 3PZJA 3TCVA 2R8VA 5LYFA 2PJ8A 3GKRA 3D2MA 2ZELA 4MFQA 4CGLA 3TE4A 2Z3MA 4YWYA 3G3SA 4F0XA 3JTKA 4PXEA 1Z8WA 3NA6A 1F2OA 4BBHA 1H8LA 4JJXA 4OC3A 1OBRA 5K8PA 4FAIA 3TO7A 2CF4A 3N7ZA 2C6PA 5ISVA 3MRUA 1Y9WA 2OB0A 2RFHA 2ZXVA 5JPHA 4TWEA 2ZEFA 4M6HA 2OH1A 4OMEA 4DJLA 4RS2A 2G9DA 3N5FA 1Z8XA 1XIXA 1FNOA 1Y7RA 2J9AA 2Z3PA 3WR7A 4A33A 4CAEA 2G3AA 2F8HA 2PJBA 4UWJA 3G8WA 4AG9A 4ZGYB 2BCOA 3IC1A 4P4IA 4KLWA 4F6AA 3PFOA 1QQ9A 5CPAA 3R9GA 1BAVA 3FIXA 3PP9A 2PDOA 3NH8A 2AE6A 2GE3A 4Y49C 4ONUA 3TT2A 4JLYA 2V77A 1LOKA 2DXQA 5EBVA 3B8GA 5IV0A 4CAVA 2FS5A 4EFDA 1Q2DA 3PBBA 2PJ1A 1F57A 2OR4A 2FXFA 2B5GA 3IIBA 1L0CA 2ZOGA 2DF5A 2R7HA 1QSNA 3R9FA 2XEJA 2CIJA 2R98A 1EE3P 3D3SA 2RC4A 2VEZA 3QNVA 4X8IA 5F46A 2ABZA 3V38A 2C6CA 2PJAA 1ZO0A
chains in the Genus database with same CATH topology
2QMLA 2OZUA 1IYKA 4MBUA 4A2ZA 4KUBA 2PRBA 5AG5A 4E2AA 3EY5A 2AJ6A 4KOYA 3TFYA 4GS4A 2B4DA 5KTCA 3BJ7A 1KUVA 5C88A 1NE9A 1YK3A 1CM0A 3T9YA 2YNCA 2Z3LA 4KOXA 1YVKA 4U5YA 5G22A 4RI1A 3SHPA 1S5KA 4UCNA 3CXQA 3QB8A 4L89A 5J8CA 2OU2A 4IUSA 2CXAA 4NEXA 4AVAA 4MFKA 2REFA 4B5PB 3TOBA 2K5TA 4J3GA 4DNCA 2Z0ZA 2CNMA 2B3VA 4MFZA 2YNEA 4AVCA 4H89A 1YREA 5EC4A 1IIDA 4UFWA 4F0YA 3F5BA 2Q0YA 1QSRA 3S6GA 1VKCA 2DPTA 4C7IA 3F8KA 2HUZA 4UWIA 3OWCA 3V8IA 5A27A 4QBJA 3QAHA 4XPDC 3JVNA 1B87A 3DNSA 4NXYA 4QVTA 4A32A 2P6FA 4E0AA 4YFJA 4CYPA 5F47A 4NF1A 2A4NA 3EXNA 5F49A 4R87A 1IB1E 2NMTA 2GANA 4X5KA 5AG7A 4CYOA 3D2PA 3ZJ0A 2F5IA 3P2FA 4Q38A 4FD4A 3H5ZA 4LUAA 1QSOA 4KOTA 4KVOE 4IF5A 4B13A 3ZZIA 2OZGA 4H6ZA 4A31A 3R95A 2Q4VA 3EFAA 4XNHC 4KORA 3MGDA 4CRYB 2Q7BA 4CYQA 1WWZA 2BEIA 2EUIA 4M85A 4QC6A 2KCWA 2I79A 4R57A 4KOUA 4II9A 4CGPA 4KOWA 4HNYB 4HNWB 1M1DA 2ATRA 1VHSA 2Z3KA 1BO4A 4NSQA 3EC4A 4Y49B 1Z4EA 2I00A 1MK4A 1S3ZA 1TIQA 4OADA 2Q4YA 1LRZA 2GIVA 3NE7A 1R57A 4PSXA 1MJBA 4ORFA 4OAEA 2YNDA 1M44A 4M3SA 2PC1A 3JUWA 3R96A 3LODA 3W6XA 4B11A 1QSTA 4KVXA 1PU9A 2Q44A 4MY0A 2J8RA 2B3UA 4KOSA 3RYOA 2FT0A 4CGNA 4YRHA 4JXQA 5AG6A 5GCNA 2P0WA 4B10A 4EVYA 5G1ZA 1QSMA 3GY9A 1XEBA 2HQYA 3FBUA 4JXRA 3W91A 4KSAA 4PK2A 1P0HA 4FD7A 4C2YA 2WPXA 4MJ8A 3KKWA 2D4PA 3FNCA 5BWAB 3CXPA 3FB3A 1XMTA 2P6GA 1IICA 3BLNA 5G21A 4R3LA 2G3TA 2B5GB 2B58A 1KUYA 4UA3A 4JWPA 3SXNA 4B12A 2P6EA 3S6FA 3PGPA 4YGOA 1WK4A 5J8FA 2B4DB 3P2HA 5C82A 4XPDB 4U9YA 2PR1A 1S7KA 2ARHA 1RO5A 3TO6A 5IX3A 2FIWA 2B4BA 1YVOA 1NSLA 1Y9KA 2VZZA 2X7BA 5HMNA 4LX9A 2J8NA 4KUAA 3K9UA 3SXOA 3DDDA 1SQHA 4AVBA 3R1KA 1I12A 1OZPA 1S7LA 2H5MA 5DWNA 1N71A 5AGEA 3VWEA 4AB7A 2ZW7A 4XNHB 2HV2A 4PK3A 2FIAA 3A9LA 5KTAA 4ZBGA 4UFVA 2ZW4A 4B5OA 2FSRA 1P4NA 4H6UA 1Q2YA 4HKFA 5AG4A 3IU1A 1B6BA 4PV6A 4MHDA 2Q04A 4CGMA 2FL4A 4R3KA 4JD6A 4CAWA 1S7NA 5HH1A 3FRMA 3FXTA 4C68A 4C2ZA 2J8MA 4MFPA 5H86A 4KSFA 1M4DA 3R9EA 3DSBA 3EO4A 2VBQA 1PUAA 1FY7A 1YR0A 1BOBA 2CY2A 1MJ9A 3IGRA 3TTHA 5JQ4A 3DR8A 4I49A 4Q36A 4KOVA 3I9SA 4B5PA 4QUSA 2ZW6A 3S6HA 3VWDA 2ZW5A 2BUEA 4AG7A 2VZYA 2R1IA 3S6KA 4UFXA 2EVNA 4NCZA 1J4JA 2REEA 4KS9A 2FE7A 1I21A 1XE4A 4CS0B 4U9ZA 4MI4A 4FD5A 4KVME 2BL1A 2JDDA 3F0AA 1KZFA 4R9MA 4A30A 2DPSA 5I0CA 2G0BA 4XPLA 4XPKA 4A95A 2Z3OA 1Z9UA 4UCMA 2PQ8A 1M4GA 2C27A 4CAXA 5H84A 3CXSA 2JEVA 1U6MA 3H4QA 2QECA 2OZHA 2VXKA 1Q2CA 1YGHA 2BSWA 2FCKA 1ON0A 1UFHA 1GHEA 3W6SA 3BJ8A 1CJWA 4CRZB 3TO9A 1RXTA 2Z11A 3UY5A 4CYNA 1I1DA 2QIRA 4L8AA 1V0CA 1XF8A 2ZPAA 3IWGA 2YGWA 4K30A 4HNXB 3GYAA 4UBRA 5IB0A 4KZTA 3LD2A 4PSWA 3I3GA 1YX0A 4E8OA 2PSWA 2JDCA 4MFJA 4FD6A 5FVJA 1S7FA 2Z10A 4CAFA 1K4JA 5CNPA 4KLVA 1MJAA 1Z4RA 2PR8A 1YLEA 1M4IA 3FYNA 2WUUA 2YNCC 4UCPA 5F48A 1IYLA 2IL4A 3D8PA 2WSAA 5DWMA 4C7HA 2D4OA 2O28A 2JLMA 3C26A 5A28A 2Z3NA 4BMHA 2VQYA 2CNSA 4B14A 2VI7A 2WPWA 4C2XA 5KTDA 3DR6A 3E0KA 4MY3A 3T90A 3TOAA 1NMTA 1S60A 4CGOA 4OLLA 2CNTA 3IU2A 4MFLA 5E96A 3IWEA 1KUXA 4QB9A 3TCVA 5G20A 3PZJA 2R8VA 3GKRA 3D2MA 4MFQA 4CGLA 3TE4A 2Z3MA 3G3SA 4F0XA 3JTKA 4BBHA 4JJXA 3TO7A 3N7ZA 5ISVA 1Y9WA 2OB0A 2ZXVA 5JPHA 2OH1A 4RS2A 1XIXA 1Y7RA 2Z3PA 3WR7A 4A33A 4CAEA 2G3AA 4AG9A 4UWJA 4ZGYB 3G8WA 4KLWA 4F6AA 3R9GA 3FIXA 3PP9A 2PDOA 4Y49C 2AE6A 2GE3A 3TT2A 4ONUA 4JLYA 2DXQA 5EBVA 3B8GA 5IV0A 4CAVA 2FS5A 1Q2DA 2FXFA 2B5GA 1L0CA 2R7HA 1QSNA 3R9FA 2R98A 3D3SA 2RC4A 2VEZA 5F46A 2Y0MA 1ZO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QML A;  2OZU A;  1IYK A;  4MBU A;  4KUB A;  2PRB A;  4E2A A;  3EY5 A;  2AJ6 A;  4KOY A;  3TFY A;  4GS4 A;  2B4D A;  5KTC A;  3BJ7 A;  1KUV A;  5C88 A;  1NE9 A;  1YK3 A;  1CM0 A;  3T9Y A;  4KOX A;  1YVK A;  4U5Y A;  4RI1 A;  3SHP A;  1S5K A;  3CXQ A;  3QB8 A;  4L89 A;  5J8C A;  2OU2 A;  4IUS A;  4NEX A;  4AVA A;  2REF A;  4B5P B;  3TOB A;  2K5T A;  4J3G A;  4DNC A;  2Z0Z A;  2CNM A;  2B3V A;  4AVC A;  4H89 A;  1YRE A;  5EC4 A;  1IID A;  4F0Y A;  3F5B A;  2Q0Y A;  1QSR A;  3S6G A;  1VKC A;  3F8K A;  2HUZ A;  4UWI A;  3OWC A;  3V8I A;  4QBJ A;  3QAH A;  4XPD C;  3JVN A;  1B87 A;  3DNS A;  4NXY A;  4QVT A;  2P6F A;  4E0A A;  4YFJ A;  5F47 A;  4NF1 A;  2A4N A;  3EXN A;  5F49 A;  4R87 A;  1IB1 E;  2NMT A;  2GAN A;  4X5K A;  3D2P A;  3ZJ0 A;  2F5I A;  3P2F A;  4FD4 A;  4LUA A;  1QSO A;  4KOT A;  4KVO E;  4IF5 A;  3ZZI A;  2OZG A;  4H6Z A;  3R95 A;  2Q4V A;  3EFA A;  4XNH C;  4KOR A;  3MGD A;  4CRY B;  2Q7B A;  1WWZ A;  2BEI A;  2EUI A;  4M85 A;  4QC6 A;  2KCW A;  2I79 A;  4R57 A;  4KOU A;  4II9 A;  4KOW A;  4HNY B;  4HNW B;  1M1D A;  2ATR A;  1VHS A;  1BO4 A;  4NSQ A;  3EC4 A;  4Y49 B;  1Z4E A;  2I00 A;  1MK4 A;  1S3Z A;  1TIQ A;  4OAD A;  2Q4Y A;  1LRZ A;  2GIV A;  3NE7 A;  1R57 A;  4PSX A;  1MJB A;  4ORF A;  4OAE A;  1M44 A;  4M3S A;  2PC1 A;  3JUW A;  3R96 A;  3LOD A;  3W6X A;  1QST A;  4KVX A;  1PU9 A;  2Q44 A;  4MY0 A;  2J8R A;  2B3U A;  4KOS A;  3RYO A;  2FT0 A;  4YRH A;  4JXQ A;  5GCN A;  2P0W A;  4EVY A;  1QSM A;  3GY9 A;  1XEB A;  2HQY A;  3FBU A;  4JXR A;  3W91 A;  4PK2 A;  1P0H A;  4FD7 A;  2WPX A;  4MJ8 A;  3KKW A;  2D4P A;  3FNC A;  3CXP A;  3FB3 A;  1XMT A;  2P6G A;  1IIC A;  3BLN A;  4R3L A;  2G3T A;  2B5G B;  2B58 A;  1KUY A;  4UA3 A;  4JWP A;  3SXN A;  2P6E A;  3S6F A;  3PGP A;  4YGO A;  1WK4 A;  5J8F A;  2B4D B;  3P2H A;  5C82 A;  4XPD B;  4U9Y A;  2PR1 A;  1S7K A;  2ARH A;  1RO5 A;  3TO6 A;  5IX3 A;  2FIW A;  2B4B A;  1YVO A;  1NSL A;  1Y9K A;  2VZZ A;  2X7B A;  5HMN A;  4LX9 A;  2J8N A;  4KUA A;  3K9U A;  3SXO A;  3DDD A;  1SQH A;  4AVB A;  3R1K A;  1I12 A;  1OZP A;  1S7L A;  2H5M A;  5DWN A;  1N71 A;  3VWE A;  4AB7 A;  2ZW7 A;  4XNH B;  2HV2 A;  4PK3 A;  2FIA A;  5KTA A;  4ZBG A;  2ZW4 A;  4B5O A;  2FSR A;  1P4N A;  4H6U A;  1Q2Y A;  4HKF A;  1B6B A;  4PV6 A;  4MHD A;  2Q04 A;  2FL4 A;  4R3K A;  4JD6 A;  4CAW A;  1S7N A;  5HH1 A;  3FRM A;  3FXT A;  2J8M A;  5H86 A;  3R9E A;  1M4D A;  3DSB A;  3EO4 A;  2VBQ A;  1PUA A;  1FY7 A;  1YR0 A;  1BOB A;  2CY2 A;  1MJ9 A;  3IGR A;  3TTH A;  5JQ4 A;  3DR8 A;  4I49 A;  4KOV A;  3I9S A;  4B5P A;  4QUS A;  2ZW6 A;  3S6H A;  3VWD A;  2ZW5 A;  2BUE A;  4AG7 A;  2VZY A;  2R1I A;  3S6K A;  2EVN A;  4NCZ A;  1J4J A;  2REE A;  2FE7 A;  1I21 A;  1XE4 A;  4CS0 B;  4U9Z A;  4MI4 A;  4FD5 A;  4KVM E;  2BL1 A;  2JDD A;  3F0A A;  1KZF A;  4R9M A;  5I0C A;  2G0B A;  4XPL A;  4XPK A;  1Z9U A;  2PQ8 A;  1M4G A;  2C27 A;  4CAX A;  5H84 A;  3CXS A;  2JEV A;  1U6M A;  3H4Q A;  2QEC A;  2OZH A;  2VXK A;  1Q2C A;  1YGH A;  2BSW A;  2FCK A;  1ON0 A;  1UFH A;  1GHE A;  3W6S A;  3BJ8 A;  1CJW A;  4CRZ B;  3TO9 A;  1RXT A;  2Z11 A;  3UY5 A;  1I1D A;  2QIR A;  4L8A A;  1V0C A;  1XF8 A;  2ZPA A;  3IWG A;  4K30 A;  4HNX B;  3GYA A;  4UBR A;  5IB0 A;  4KZT A;  3LD2 A;  4PSW A;  3I3G A;  1YX0 A;  4E8O A;  2PSW A;  2JDC A;  4FD6 A;  5FVJ A;  1S7F A;  2Z10 A;  1K4J A;  5CNP A;  4KLV A;  1MJA A;  1Z4R A;  2PR8 A;  1YLE A;  1M4I A;  3FYN A;  5F48 A;  1IYL A;  2IL4 A;  3D8P A;  5DWM A;  2D4O A;  2O28 A;  2JLM A;  3C26 A;  4BMH A;  2VQY A;  2CNS A;  2VI7 A;  2WPW A;  5KTD A;  3DR6 A;  3E0K A;  4MY3 A;  3T90 A;  3TOA A;  1NMT A;  1S60 A;  4OLL A;  2CNT A;  5E96 A;  1KUX A;  4QB9 A;  3TCV A;  3PZJ A;  2R8V A;  3GKR A;  3D2M A;  3TE4 A;  3G3S A;  4JJX A;  3TO7 A;  3N7Z A;  5ISV A;  1Y9W A;  2OB0 A;  2ZXV A;  5JPH A;  2OH1 A;  4RS2 A;  1XIX A;  1Y7R A;  3WR7 A;  2G3A A;  4AG9 A;  4UWJ A;  3G8W A;  4KLW A;  4F6A A;  3R9G A;  3FIX A;  3PP9 A;  2PDO A;  4Y49 C;  2AE6 A;  2GE3 A;  3TT2 A;  4ONU A;  4JLY A;  2DXQ A;  5EBV A;  3B8G A;  5IV0 A;  4CAV A;  2FS5 A;  1Q2D A;  2FXF A;  2B5G A;  1L0C A;  2R7H A;  1QSN A;  3R9F A;  2R98 A;  3D3S A;  2RC4 A;  2VEZ A;  5F46 A;  2Y0M A; 
#chains in the Genus database with same CATH topology
 2QML A;  2OZU A;  1IYK A;  1ELL P;  4MBU A;  4A2Z A;  4KUB A;  2PRB A;  3T8W A;  4A39 A;  5AG5 A;  4E2A A;  3EY5 A;  2AJ6 A;  4KOY A;  3TFY A;  4GS4 A;  2B4D A;  5KTC A;  3KGQ A;  4P4F A;  1LAN A;  4K3N A;  3BJ7 A;  5JGF A;  1KUV A;  5C88 A;  1NE9 A;  1YK3 A;  1CM0 A;  3T9Y A;  1JWQ A;  1BLL E;  2YNC A;  2Z3L A;  3FX6 A;  4DUK A;  4KOX A;  4B6Z A;  3H8F A;  2O4H A;  1YVK A;  4U5Y A;  4LQG A;  5G22 A;  4RI1 A;  3SHP A;  3IJ3 A;  1S5K A;  8CPA A;  4UCN A;  3L2N A;  1HDQ A;  4M6G A;  4RN7 A;  3CXQ A;  3QB8 A;  4L89 A;  5J8C A;  2OU2 A;  2AFZ A;  2PJ9 A;  3KI9 A;  4IUS A;  4OC0 A;  2CXA A;  4NEX A;  3S9M A;  4AVA A;  4MFK A;  4OC2 A;  2REF A;  4B5P B;  1PCA A;  1F2P A;  1LAM A;  1XMB A;  2K5T A;  2ZED A;  3TOB A;  2PJ7 A;  4J3G A;  4DNC A;  2PVV A;  2Z0Z A;  5LYI A;  1IGB A;  2B3V A;  2CNM A;  4MFZ A;  5ELY A;  1NSA A;  2YNE A;  4AVC A;  4H89 A;  3SJG A;  4Z65 A;  1YRE A;  5EC4 A;  1IID A;  4UFW A;  3B3C A;  4F0Y A;  5LRK A;  3F5B A;  3NH5 A;  2Q0Y A;  4H2K A;  4G1P A;  2PJ4 A;  4ONW A;  1QSR A;  3S6G A;  1VKC A;  2DPT A;  2I3C A;  4C7I A;  5J1Q A;  2EK9 A;  3CPX A;  3F8K A;  2HUZ A;  4UWI A;  4BIN A;  3OWC A;  3V8I A;  2V8G A;  3CPA A;  5A27 A;  4P10 A;  4R7M A;  4QBJ A;  1ARM A;  3QAH A;  4XPD C;  3B3V A;  5LYD A;  1CPX A;  3JVN A;  1B87 A;  3DNS A;  1CPS A;  2Y0M A;  4NXY A;  3HLP A;  4QVT A;  4A32 A;  3BXM A;  2P6F A;  4E0A A;  4YFJ A;  4CYP A;  5F47 A;  4NF1 A;  4P4D A;  3H8G A;  2A4N A;  3EXN A;  2PJC A;  5F49 A;  4LQ6 A;  2BO9 A;  6CPA A;  4R87 A;  1IB1 E;  3RBU A;  4NGR A;  4MCP A;  2NMT A;  2GAN A;  4X5K A;  5AG7 A;  4CYO A;  3D2P A;  3ZJ0 A;  3CZX A;  2F5I A;  3P2F A;  4Q38 A;  4FD4 A;  3H5Z A;  4JYW A;  4LUA A;  1QSO A;  4KOT A;  4KVO E;  4IF5 A;  4B13 A;  4OP4 A;  1LFW A;  4PXB A;  3ZZI A;  3FF3 A;  1AYE A;  3D67 A;  2JEW A;  1CG2 A;  2OZG A;  3IFE A;  4IK2 A;  4H6Z A;  4OID A;  4OC5 A;  4A31 A;  4DYO A;  1TXR A;  3R95 A;  2Q4V A;  5JH9 A;  3EFA A;  1CP6 A;  4UIA A;  4XNH C;  3KZW A;  4IHM A;  2HC9 A;  4KOR A;  2GLJ A;  2PRQ A;  3MGD A;  1TKF A;  4CRY B;  5JM6 A;  2Q7B A;  1Y0R A;  4OC1 A;  4CYQ A;  4R6T A;  1WWZ A;  2BEI A;  4M6I A;  2EUI A;  4M85 A;  2PCU A;  4QC6 A;  2KCW A;  2I79 A;  4R57 A;  4KOU A;  4II9 A;  4CGP A;  4KOW A;  4HNY B;  4HNW B;  3PB4 X;  1M1D A;  4MCR A;  2ATR A;  3B35 A;  3PB6 X;  1VHS A;  2Z3K A;  1BO4 A;  4ZY0 A;  4W9Y A;  4NSQ A;  4NFR A;  3EC4 A;  4Y49 B;  3NH4 A;  4CPA A;  1Z4E A;  2I00 A;  1ZG8 A;  1MK4 A;  4MMO A;  1S3Z A;  5LYL A;  1TIQ A;  4OAD A;  1YSJ A;  2Q4Y A;  1LRZ A;  1LCP A;  1PYT B;  2GIV A;  1R57 A;  3NE7 A;  4P45 A;  4PSX A;  3DGV A;  1MJB A;  2PIZ A;  5HVG A;  3KR5 A;  3FVL A;  3KR4 A;  4ORF A;  4OAE A;  2YND A;  1M44 A;  4M3S A;  2PC1 A;  3JUW A;  3R96 A;  3PB8 X;  3LOD A;  4ZX9 A;  3RO0 A;  3W6X A;  4B11 A;  1QST A;  4KVX A;  3FEE A;  3D7G A;  1PU9 A;  1CBX A;  2AFO A;  2Q44 A;  4MY0 A;  3NFZ A;  5K8M A;  2J8R A;  2QYV A;  2B3U A;  4KOS A;  1A2Z A;  5D29 A;  3D7H A;  1XBU A;  3RYO A;  2FT0 A;  4AXV A;  4TNU A;  1VHO A;  2JBJ A;  1ZG9 A;  4CGN A;  4YRH A;  4MHY A;  3SJX A;  2ANP A;  2JBK A;  4JXQ A;  4UEE A;  5AG6 A;  5GCN A;  2PE3 A;  2F7V A;  2P0W A;  4B10 A;  4EVY A;  5G1Z A;  2OOT A;  1QSM A;  3GY9 A;  3KQX A;  1XEB A;  3PB9 X;  2EWB A;  3KHZ A;  2HQY A;  2PJ0 A;  4A38 A;  3FBU A;  4JXR A;  3W91 A;  2ZEM A;  4KSA A;  4PK2 A;  4WWV A;  1P0H A;  3FH4 A;  4FD7 A;  4C2Y A;  2WPX A;  4MJ8 A;  3KKW A;  2D4P A;  3FNC A;  3KL9 A;  5K8N A;  3B7I A;  4IAV A;  5BWA B;  1XFO A;  1HEE A;  3CXP A;  4PXD A;  4OIW A;  3FB3 A;  4P4E A;  1IY7 A;  1XMT A;  1YW6 A;  4KSI A;  2P6G A;  2ZEN A;  3BHX A;  1IIC A;  3BLN A;  4WJB A;  5G21 A;  3SI0 A;  7CPA A;  4R3L A;  2G3T A;  4HPS A;  1BPM A;  2B5G B;  2B58 A;  4FUU A;  1KUY A;  3B3T A;  4UA3 A;  4JWP A;  1QMU A;  3HUV A;  4A94 A;  3RAM A;  3SXN A;  3BI1 A;  4JZ0 A;  4B12 A;  2ZEE A;  2P6E A;  3S6F A;  4NGN A;  2HB6 A;  3PGP A;  1WK4 A;  4YGO A;  2AFS A;  3SI1 A;  5J8F A;  2POK A;  3KQZ A;  2B4D B;  5HVF A;  3P2H A;  5C82 A;  2AFU A;  4XPD B;  1X10 A;  4NGS A;  4U9Y A;  4X3R A;  1Z8T A;  2PR1 A;  1S7K A;  2ARH A;  1RO5 A;  3TO6 A;  5IX3 A;  2FIW A;  1TF8 A;  2B4B A;  1DTD A;  1YVO A;  4MRI A;  1NSL A;  3FEC A;  3SJF A;  5IB9 A;  2BOA A;  1Y9K A;  2VZZ A;  2X7B A;  3LMS A;  3S9L A;  1Y7E A;  5HMN A;  1YQE A;  2IJZ A;  3VAR A;  4LX9 A;  2QJ8 A;  4OC4 A;  2C6G A;  1FT7 A;  4Q7A A;  1IOF A;  2GLF A;  2J8N A;  4KUA A;  3K9U A;  3SXO A;  1XJO A;  3B3S A;  3DDD A;  1SQH A;  2FVG A;  2ZOF A;  4AVB A;  3D68 A;  3R1K A;  4ZI6 A;  1I12 A;  5HVH A;  1OZP A;  3TC8 A;  1S7L A;  2PJ5 A;  2H5M A;  5DWN A;  1N71 A;  5AGE A;  4EWT A;  3VWE A;  2AFM A;  5THW A;  4AB7 A;  1CX8 A;  1M4L A;  2ZW7 A;  4F9V A;  4XNH B;  2HV2 A;  1Q7L A;  4PK3 A;  2FIA A;  3GB0 A;  4UEF A;  3A9L A;  5KTA A;  1X12 A;  4FWU A;  4R76 A;  1VGY A;  2DEA A;  4ZBG A;  3WC5 A;  4NJR A;  4UFV A;  2ZW4 A;  4B5O A;  2FSR A;  1P4N A;  4H6U A;  1Q2Y A;  4HKF A;  3D7D A;  5AG4 A;  3IU1 A;  3WT4 A;  1B6B A;  4PV6 A;  1LAP A;  4P6Y A;  4MHD A;  1HDU A;  2XEF A;  1XOV A;  4NGQ A;  4GM5 A;  1AMP A;  1Y0Y A;  2Q04 A;  1ZLH A;  4CGM A;  3ISX A;  2FL4 A;  4R3K A;  4JD6 A;  4CAW A;  1ARL A;  5I4M A;  1ELM P;  2AFX A;  2XEI A;  3ISZ A;  4ZYQ A;  1S7N A;  1Z8L A;  4EME A;  4UEZ A;  4P4B A;  5HH1 A;  3FRM A;  3FXT A;  4C68 A;  1DE4 C;  4C2Z A;  2J8M A;  5EMI A;  3H8E A;  4MFP A;  5H86 A;  2ZEG A;  1M4D A;  4KSF A;  3R9E A;  3S9N A;  3DSB A;  4NJQ A;  4P44 A;  3EO4 A;  1YLO A;  4BD9 A;  3RZA A;  1BPN A;  2VBQ A;  3WC6 A;  3CDX A;  1PUA A;  1FY7 A;  1YR0 A;  2PJ3 A;  1BOB A;  2CY2 A;  1MJ9 A;  5LRJ A;  3IGR A;  2Q51 A;  3TTH A;  2WZN A;  5JQ4 A;  4RUH A;  3DR8 A;  4I49 A;  4Q36 A;  4KOV A;  3I9S A;  4B5P A;  4QUS A;  2ZW6 A;  3S6H A;  3VWD A;  2EO8 A;  3PFE A;  2NYQ A;  1RTQ A;  2ZW5 A;  1XRY A;  2BUE A;  4AG7 A;  2XEG A;  2VZY A;  1IOI A;  2R1I A;  3FED A;  4UFX A;  3S6K A;  5HXD A;  3WC7 A;  2ZEH A;  4NGT A;  3CT9 A;  1TKJ A;  5D8N A;  2EVN A;  1Z5R A;  3JRU A;  4NCZ A;  1J4J A;  2REE A;  2EK8 A;  2PVW A;  2FE7 A;  1I21 A;  1XE4 A;  4KS9 A;  4U9Z A;  4MI4 A;  3WAB A;  4CS0 B;  4FD5 A;  4KVM E;  2BL1 A;  4MXU A;  2JDD A;  3F0A A;  3KHX A;  4FBE A;  1KZF A;  4R9M A;  3D7F A;  2DPS A;  4A30 A;  5I0C A;  2G0B A;  2Q7S A;  4XPL A;  4XPK A;  4A95 A;  2Z3O A;  3LWU A;  1Z9U A;  1UWY A;  2CTC A;  3KAS A;  4UCM A;  2PQ8 A;  1M4G A;  2C27 A;  4CAX A;  2ZEO A;  5H84 A;  3CXS A;  3TX8 A;  1ZLI A;  3PRT A;  2JEV A;  4MHZ A;  4X2T A;  1U6M A;  3H4Q A;  4PQA A;  4F9U A;  2QEC A;  2OZH A;  2VXK A;  1Q2C A;  1YGH A;  3B2Y A;  3IWW A;  3MN8 A;  2Q43 A;  5LRG A;  4ZY1 A;  2BSW A;  2FCK A;  4ZY2 A;  1ON0 A;  1UFH A;  2WYR A;  1GHE A;  3W6S A;  1Z2L A;  3VH9 A;  1CJW A;  3BJ8 A;  4CRZ B;  4F8Z A;  3TO9 A;  1R3N A;  1RXT A;  2QVP A;  2Z11 A;  3IO1 A;  3UY5 A;  4CYN A;  3QAY A;  1CP7 A;  1I1D A;  2GFQ A;  2GRE A;  3K9T A;  4MCS A;  3SI2 A;  2QIR A;  4L8A A;  1V0C A;  3I1U A;  3D4U A;  1XF8 A;  2ZPA A;  3D66 A;  2YGW A;  3IWG A;  4K30 A;  4YU9 A;  4HNX B;  4UIB A;  3GYA A;  2V8V A;  4UBR A;  4NGP A;  4PPZ A;  1R43 A;  3VAT A;  5IB0 A;  3NE8 A;  4KZT A;  1JQG A;  1YME A;  3LD2 A;  2V8H A;  4PSW A;  3I3G A;  2AFW A;  2GU2 A;  1YX0 A;  4E8O A;  2PSW A;  2JDC A;  1TKH A;  2C1C A;  1GYT A;  2PJ2 A;  4MFJ A;  2NSM A;  4PXC A;  3GLJ A;  4P4J A;  4FD6 A;  1AUG A;  1IU8 A;  1KWM A;  2PJ6 A;  4MHP A;  5FVJ A;  1TF9 A;  1S7F A;  4UF4 A;  2Z10 A;  3IEH A;  1K4J A;  4CAF A;  5CNP A;  4NGM A;  2RB7 A;  4KLV A;  1VHE A;  3PB7 X;  1MJA A;  1Z4R A;  4MCQ A;  5DS0 A;  2PR8 A;  5CBM A;  1YLE A;  1M4I A;  2EBJ A;  2ODF A;  2VL1 A;  2WUU A;  1ZG7 A;  2V8D A;  2YNC C;  2ZEP A;  3FYN A;  4UCP A;  5F48 A;  1IYL A;  5F09 A;  3B3W A;  2IL4 A;  3D8P A;  2WSA A;  3PBE A;  4GXH A;  5DWM A;  3FJU A;  4C7H A;  2IMO A;  3GIU A;  2D4O A;  2O28 A;  2JLM A;  3C26 A;  3DLJ A;  5A28 A;  2Z3N A;  2PIY A;  4A37 A;  4BMH A;  2CTB A;  2VQY A;  3PEI A;  1VIX A;  2CNS A;  4B14 A;  2VI7 A;  2WPW A;  4OKO A;  4C2X A;  3BI0 A;  5KTD A;  3DR6 A;  2IQ6 A;  3E0K A;  1YW4 A;  3FMC A;  3K2K A;  4MY3 A;  3RNZ A;  3T90 A;  4ZX8 A;  4MHN A;  3TOA A;  1NMT A;  1S60 A;  4CGO A;  5K8O A;  2Q4Z A;  2O53 A;  4OLL A;  2CNT A;  3IU2 A;  4MFL A;  4O23 A;  3LAC A;  3IWE A;  4R8F A;  5E96 A;  3GUX A;  3V7Z A;  1KUX A;  4QB9 A;  3SJE A;  5G20 A;  3PZJ A;  3TCV A;  2R8V A;  5LYF A;  2PJ8 A;  3GKR A;  3D2M A;  2ZEL A;  4MFQ A;  4CGL A;  3TE4 A;  2Z3M A;  4YWY A;  3G3S A;  4F0X A;  3JTK A;  4PXE A;  1Z8W A;  3NA6 A;  1F2O A;  4BBH A;  1H8L A;  4JJX A;  4OC3 A;  1OBR A;  5K8P A;  4FAI A;  3TO7 A;  2CF4 A;  3N7Z A;  2C6P A;  5ISV A;  3MRU A;  1Y9W A;  2OB0 A;  2RFH A;  2ZXV A;  5JPH A;  4TWE A;  2ZEF A;  4M6H A;  2OH1 A;  4OME A;  4DJL A;  4RS2 A;  2G9D A;  3N5F A;  1Z8X A;  1XIX A;  1FNO A;  1Y7R A;  2J9A A;  2Z3P A;  3WR7 A;  4A33 A;  4CAE A;  2G3A A;  2F8H A;  2PJB A;  4UWJ A;  3G8W A;  4AG9 A;  4ZGY B;  2BCO A;  3IC1 A;  4P4I A;  4KLW A;  4F6A A;  3PFO A;  1QQ9 A;  5CPA A;  3R9G A;  1BAV A;  3FIX A;  3PP9 A;  2PDO A;  3NH8 A;  2AE6 A;  2GE3 A;  4Y49 C;  4ONU A;  3TT2 A;  4JLY A;  2V77 A;  1LOK A;  2DXQ A;  5EBV A;  3B8G A;  5IV0 A;  4CAV A;  2FS5 A;  4EFD A;  1Q2D A;  3PBB A;  2PJ1 A;  1F57 A;  2OR4 A;  2FXF A;  2B5G A;  3IIB A;  1L0C A;  2ZOG A;  2DF5 A;  2R7H A;  1QSN A;  3R9F A;  2XEJ A;  2CIJ A;  2R98 A;  1EE3 P;  3D3S A;  2RC4 A;  2VEZ A;  3QNV A;  4X8I A;  5F46 A;  2ABZ A;  3V38 A;  2C6C A;  2PJA A;  1ZO0 A; 
#chains in the Genus database with same CATH homology
 2QML A;  2OZU A;  1IYK A;  4MBU A;  4A2Z A;  4KUB A;  2PRB A;  5AG5 A;  4E2A A;  3EY5 A;  2AJ6 A;  4KOY A;  3TFY A;  4GS4 A;  2B4D A;  5KTC A;  3BJ7 A;  1KUV A;  5C88 A;  1NE9 A;  1YK3 A;  1CM0 A;  3T9Y A;  2YNC A;  2Z3L A;  4KOX A;  1YVK A;  4U5Y A;  5G22 A;  4RI1 A;  3SHP A;  1S5K A;  4UCN A;  3CXQ A;  3QB8 A;  4L89 A;  5J8C A;  2OU2 A;  4IUS A;  2CXA A;  4NEX A;  4AVA A;  4MFK A;  2REF A;  4B5P B;  3TOB A;  2K5T A;  4J3G A;  4DNC A;  2Z0Z A;  2CNM A;  2B3V A;  4MFZ A;  2YNE A;  4AVC A;  4H89 A;  1YRE A;  5EC4 A;  1IID A;  4UFW A;  4F0Y A;  3F5B A;  2Q0Y A;  1QSR A;  3S6G A;  1VKC A;  2DPT A;  4C7I A;  3F8K A;  2HUZ A;  4UWI A;  3OWC A;  3V8I A;  5A27 A;  4QBJ A;  3QAH A;  4XPD C;  3JVN A;  1B87 A;  3DNS A;  4NXY A;  4QVT A;  4A32 A;  2P6F A;  4E0A A;  4YFJ A;  4CYP A;  5F47 A;  4NF1 A;  2A4N A;  3EXN A;  5F49 A;  4R87 A;  1IB1 E;  2NMT A;  2GAN A;  4X5K A;  5AG7 A;  4CYO A;  3D2P A;  3ZJ0 A;  2F5I A;  3P2F A;  4Q38 A;  4FD4 A;  3H5Z A;  4LUA A;  1QSO A;  4KOT A;  4KVO E;  4IF5 A;  4B13 A;  3ZZI A;  2OZG A;  4H6Z A;  4A31 A;  3R95 A;  2Q4V A;  3EFA A;  4XNH C;  4KOR A;  3MGD A;  4CRY B;  2Q7B A;  4CYQ A;  1WWZ A;  2BEI A;  2EUI A;  4M85 A;  4QC6 A;  2KCW A;  2I79 A;  4R57 A;  4KOU A;  4II9 A;  4CGP A;  4KOW A;  4HNY B;  4HNW B;  1M1D A;  2ATR A;  1VHS A;  2Z3K A;  1BO4 A;  4NSQ A;  3EC4 A;  4Y49 B;  1Z4E A;  2I00 A;  1MK4 A;  1S3Z A;  1TIQ A;  4OAD A;  2Q4Y A;  1LRZ A;  2GIV A;  3NE7 A;  1R57 A;  4PSX A;  1MJB A;  4ORF A;  4OAE A;  2YND A;  1M44 A;  4M3S A;  2PC1 A;  3JUW A;  3R96 A;  3LOD A;  3W6X A;  4B11 A;  1QST A;  4KVX A;  1PU9 A;  2Q44 A;  4MY0 A;  2J8R A;  2B3U A;  4KOS A;  3RYO A;  2FT0 A;  4CGN A;  4YRH A;  4JXQ A;  5AG6 A;  5GCN A;  2P0W A;  4B10 A;  4EVY A;  5G1Z A;  1QSM A;  3GY9 A;  1XEB A;  2HQY A;  3FBU A;  4JXR A;  3W91 A;  4KSA A;  4PK2 A;  1P0H A;  4FD7 A;  4C2Y A;  2WPX A;  4MJ8 A;  3KKW A;  2D4P A;  3FNC A;  5BWA B;  3CXP A;  3FB3 A;  1XMT A;  2P6G A;  1IIC A;  3BLN A;  5G21 A;  4R3L A;  2G3T A;  2B5G B;  2B58 A;  1KUY A;  4UA3 A;  4JWP A;  3SXN A;  4B12 A;  2P6E A;  3S6F A;  3PGP A;  4YGO A;  1WK4 A;  5J8F A;  2B4D B;  3P2H A;  5C82 A;  4XPD B;  4U9Y A;  2PR1 A;  1S7K A;  2ARH A;  1RO5 A;  3TO6 A;  5IX3 A;  2FIW A;  2B4B A;  1YVO A;  1NSL A;  1Y9K A;  2VZZ A;  2X7B A;  5HMN A;  4LX9 A;  2J8N A;  4KUA A;  3K9U A;  3SXO A;  3DDD A;  1SQH A;  4AVB A;  3R1K A;  1I12 A;  1OZP A;  1S7L A;  2H5M A;  5DWN A;  1N71 A;  5AGE A;  3VWE A;  4AB7 A;  2ZW7 A;  4XNH B;  2HV2 A;  4PK3 A;  2FIA A;  3A9L A;  5KTA A;  4ZBG A;  4UFV A;  2ZW4 A;  4B5O A;  2FSR A;  1P4N A;  4H6U A;  1Q2Y A;  4HKF A;  5AG4 A;  3IU1 A;  1B6B A;  4PV6 A;  4MHD A;  2Q04 A;  4CGM A;  2FL4 A;  4R3K A;  4JD6 A;  4CAW A;  1S7N A;  5HH1 A;  3FRM A;  3FXT A;  4C68 A;  4C2Z A;  2J8M A;  4MFP A;  5H86 A;  4KSF A;  1M4D A;  3R9E A;  3DSB A;  3EO4 A;  2VBQ A;  1PUA A;  1FY7 A;  1YR0 A;  1BOB A;  2CY2 A;  1MJ9 A;  3IGR A;  3TTH A;  5JQ4 A;  3DR8 A;  4I49 A;  4Q36 A;  4KOV A;  3I9S A;  4B5P A;  4QUS A;  2ZW6 A;  3S6H A;  3VWD A;  2ZW5 A;  2BUE A;  4AG7 A;  2VZY A;  2R1I A;  3S6K A;  4UFX A;  2EVN A;  4NCZ A;  1J4J A;  2REE A;  4KS9 A;  2FE7 A;  1I21 A;  1XE4 A;  4CS0 B;  4U9Z A;  4MI4 A;  4FD5 A;  4KVM E;  2BL1 A;  2JDD A;  3F0A A;  1KZF A;  4R9M A;  4A30 A;  2DPS A;  5I0C A;  2G0B A;  4XPL A;  4XPK A;  4A95 A;  2Z3O A;  1Z9U A;  4UCM A;  2PQ8 A;  1M4G A;  2C27 A;  4CAX A;  5H84 A;  3CXS A;  2JEV A;  1U6M A;  3H4Q A;  2QEC A;  2OZH A;  2VXK A;  1Q2C A;  1YGH A;  2BSW A;  2FCK A;  1ON0 A;  1UFH A;  1GHE A;  3W6S A;  3BJ8 A;  1CJW A;  4CRZ B;  3TO9 A;  1RXT A;  2Z11 A;  3UY5 A;  4CYN A;  1I1D A;  2QIR A;  4L8A A;  1V0C A;  1XF8 A;  2ZPA A;  3IWG A;  2YGW A;  4K30 A;  4HNX B;  3GYA A;  4UBR A;  5IB0 A;  4KZT A;  3LD2 A;  4PSW A;  3I3G A;  1YX0 A;  4E8O A;  2PSW A;  2JDC A;  4MFJ A;  4FD6 A;  5FVJ A;  1S7F A;  2Z10 A;  4CAF A;  1K4J A;  5CNP A;  4KLV A;  1MJA A;  1Z4R A;  2PR8 A;  1YLE A;  1M4I A;  3FYN A;  2WUU A;  2YNC C;  4UCP A;  5F48 A;  1IYL A;  2IL4 A;  3D8P A;  2WSA A;  5DWM A;  4C7H A;  2D4O A;  2O28 A;  2JLM A;  3C26 A;  5A28 A;  2Z3N A;  4BMH A;  2VQY A;  2CNS A;  4B14 A;  2VI7 A;  2WPW A;  4C2X A;  5KTD A;  3DR6 A;  3E0K A;  4MY3 A;  3T90 A;  3TOA A;  1NMT A;  1S60 A;  4CGO A;  4OLL A;  2CNT A;  3IU2 A;  4MFL A;  5E96 A;  3IWE A;  1KUX A;  4QB9 A;  3TCV A;  5G20 A;  3PZJ A;  2R8V A;  3GKR A;  3D2M A;  4MFQ A;  4CGL A;  3TE4 A;  2Z3M A;  3G3S A;  4F0X A;  3JTK A;  4BBH A;  4JJX A;  3TO7 A;  3N7Z A;  5ISV A;  1Y9W A;  2OB0 A;  2ZXV A;  5JPH A;  2OH1 A;  4RS2 A;  1XIX A;  1Y7R A;  2Z3P A;  3WR7 A;  4A33 A;  4CAE A;  2G3A A;  4AG9 A;  4UWJ A;  4ZGY B;  3G8W A;  4KLW A;  4F6A A;  3R9G A;  3FIX A;  3PP9 A;  2PDO A;  4Y49 C;  2AE6 A;  2GE3 A;  3TT2 A;  4ONU A;  4JLY A;  2DXQ A;  5EBV A;  3B8G A;  5IV0 A;  4CAV A;  2FS5 A;  1Q2D A;  2FXF A;  2B5G A;  1L0C A;  2R7H A;  1QSN A;  3R9F A;  2R98 A;  3D3S A;  2RC4 A;  2VEZ A;  5F46 A;  2Y0M A;  1ZO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...