1Q2DA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue p53 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
161
structure length
161
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords histone acetyltransferase GCN5
publication title Molecular basis for GCN5/PCAF histone acetyltransferase selectivity for histone and nonhistone substrates
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
total genus 46
structure length 161
sequence length 161
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2dA00
3BJ7A 5J8FA 4MHDA 4R9MA 1L0CA 1S3ZA 4H6ZA 2B4DB 3R1KA 3R95A 3G3SA 1WWZA 3PGPA 3TO9A 1QSMA 1B87A 3GY9A 3T9YA 4FD7A 3UY5A 5JPHA 2JDCA 2REEA 5CNPA 1RO5A 1YVOA 4YGOA 3EY5A 3FIXA 1XF8A 1VKCA 2OZHA 3RYOA 3BLNA 4LX9A 2AE6A 2OB0A 4E0AA 3TFYA 5F46A 4NXYA 1RXTA 2JLMA 1M1DA 2PRBA 3T90A 4NEXA 2VQYA 2ZW4A 3IWGA 2X7BA 2Z0ZA 4KOWA 3GYAA 4JLYA 3F8KA 5IV0A 2OZUA 4RS2A 2VXKA 3K9UA 4YRHA 3E0KA 1PU9A 4XNHC 3V8IA 4NF1A 1M4DA 2B5GA 5DWMA 3W6XA 1U6MA 1MJ9A 2HQYA 4R3LA 3TE4A 1M4GA 2PC1A 2PR8A 2Q0YA 2EVNA 3PZJA 2B3UA 1CM0A 1Y9KA 1S7LA 2ARHA 5KTDA 5HMNA 3FBUA 3DSBA 1NE9A 2JDDA 4JWPA 4YFJA 4CAVA 1KUVA 2FXFA 4J3GA 3FB3A 2FSRA 4MJ8A 3SXOA 4B5PA 2R8VA 2P6FA 4AB7A 4R3KA 1S60A 3EFAA 2GIVA 2FE7A 3R9EA 3P2FA 3G8WA 2FCKA 1IICA 2D4PA 2Q7BA 4F6AA 5C82A 2VEZA 2RC4A 4XPKA 1MJAA 2R1IA 1P4NA 2Q4YA 3F5BA 3CXPA 1IIDA 3D3SA 2R7HA 4R87A 2BEIA 4EVYA 2O28A 2EUIA 2VI7A 4CAWA 1I1DA 2VZZA 3DNSA 3LODA 4HNXB 2ZPAA 4KOVA 2J8NA 4L8AA 4KUAA 3ZJ0A 1R57A 4KOYA 3FNCA 3JVNA 1XE4A 3DDDA 4X5KA 2QMLA 4PK2A 4XNHB 2B4BA 2P6EA 2Q04A 5JQ4A 5FVJA 4KORA 3FRMA 4OAEA 2J8RA 3EC4A 4UWJA 3R9FA 3I9SA 4ONUA 1Q2DA 5EBVA 5J8CA 4QVTA 1YK3A 3P2HA 4KVXA 4AG7A 4KOUA 3QB8A 2G3TA 2WPXA 1GHEA 2OZGA 4R57A 3D8PA 5H86A 2I79A 3R96A 2VBQA 1S7KA 2R98A 1I12A 3W91A 2HV2A 3S6KA 5DWNA 3MGDA 4LUAA 4KLVA 3R9GA 2B5GB 1IB1E 4HNYB 4DNCA 2K5TA 2G0BA 4M3SA 4MI4A 4XPDC 4AVBA 1J4JA 1K4JA 4AVCA 1Z4EA 4UA3A 3CXQA 4KVME 3TO6A 1Y9WA 4JJXA 4FD6A 1Q2YA 1XMTA 1YR0A 1KZFA 3EXNA 4ZBGA 2Z10A 1PUAA 1Q2CA 2I00A 4FD5A 4CRZB 3PP9A 3N7ZA 5F49A 2WPWA 2AJ6A 3EO4A 2H5MA 4B5PB 5IB0A 2C27A 4U9YA 1UFHA 3F0AA 3BJ8A 2F5IA 2KCWA 1YLEA 2ZW7A 4U9ZA 1I21A 3TOBA 2ATRA 2A4NA 2CNMA 2QECA 4KOXA 3C26A 4NCZA 2FIAA 4OLLA 1QSRA 3NE7A 1QSTA 4GS4A 1YREA 1IYLA 1M4IA 5E96A 2B58A 4HKFA 4MBUA 5HH1A 1B6BA 1S5KA 1KUYA 2GE3A 2PR1A 2P6GA 2PDOA 4IUSA 3TCVA 4KOTA 1OZPA 4M85A 5C88A 4H6UA 4XPLA 4OADA 3ZZIA 1NSLA 4KVOE 3TO7A 4PK3A 1QSNA 1YX0A 2FL4A 3S6GA 4UWIA 3OWCA 2FT0A 2B4DA 2REFA 4ORFA 4RI1A 5IX3A 4BMHA 1VHSA 4PV6A 4F0YA 1LRZA 1BO4A 4QBJA 2OH1A 4XPDB 4E8OA 2ZXVA 4CS0B 3IGRA 4IF5A 5H84A 5GCNA 2BUEA 4Y49C 3I3GA 4KLWA 4B5OA 2PSWA 4E2AA 4HNWB 3VWDA 5EC4A 1Z4RA 3CXSA 1NMTA 1KUXA 3D2PA 4KUBA 4AG9A 4NSQA 3FXTA 2ZW6A 2ZW5A 2JEVA 2G3AA 4JXRA 3JUWA 3FYNA 1Y7RA 3QAHA 2FS5A 3D2MA 4U5YA 3SHPA 5KTCA 5F48A 4FD4A 1S7NA 1IYKA 3SXNA 3WR7A 4AVAA 3S6FA 1QSOA 4PSWA 4K30A 2CNSA 4H89A 2BSWA 1CJWA 1Z9UA 4MY0A 3TTHA 2HUZA 1WK4A 1MK4A 4MY3A 4JD6A 4QC6A 3DR8A 2IL4A 3DR6A 1V0CA 2Q44A 4QB9A 1YGHA 4PSXA 5KTAA 2NMTA 3W6SA 5ISVA 3VWEA 2B3VA 1FY7A 2CNTA 1XEBA 4KOSA 1ON0A 4JXQA 1P0HA 1S7FA 4KZTA 4CRYB 4CAXA 1MJBA 2J8MA 2BL1A 2GANA 1BOBA 4I49A 3LD2A 4L89A 2FIWA 2Y0MA 3KKWA 3S6HA 1SQHA 5I0CA 1TIQA 3B8GA 1YVKA 2QIRA 2PQ8A 4UBRA 1N71A 4II9A 2DXQA 4QUSA 1XIXA 4Y49B 2OU2A 3TOAA 2P0WA 2CY2A 2Q4VA 2Z11A 5F47A 1M44A 3GKRA 3TT2A 2VZYA 2D4OA 3H4QA
chains in the Genus database with same CATH superfamily
3V7ZA 2PJ7A 3BJ7A 5J8FA 1F2PA 4ZX9A 3SJXA 1AMPA 3A9LA 4A95A 1Z8WA 4MHDA 3BXMA 3PB9X 2AFMA 1L0CA 2CF4A 2QVPA 1S3ZA 4H6ZA 4R9MA 5K8MA 2B4DB 3R1KA 5HVHA 5J1QA 3R95A 3HUVA 3VH9A 1YW6A 3G3SA 5DS0A 3FECA 1WWZA 3PGPA 3TO9A 4CGMA 1QSMA 4M6HA 1B87A 3GY9A 3T9YA 4FD7A 3PFEA 3UY5A 5JPHA 2JDCA 3FX6A 2CXAA 2REEA 3PB4X 2DPTA 4MHNA 2XEGA 1IU8A 1RO5A 1YVOA 2CTBA 5CNPA 4YGOA 4OC1A 5LYIA 1BPMA 3EY5A 4Z65A 5F09A 3KL9A 4CGOA 2JEWA 3FIXA 3SI0A 1XF8A 1VKCA 3FJUA 1KWMA 4MRIA 2OZHA 3RYOA 1QMUA 2V8HA 2PJBA 2Z3MA 2PJ4A 3BLNA 1XRYA 2AE6A 2OB0A 3GUXA 4LX9A 4R8FA 4E0AA 3TFYA 5F46A 3KHXA 1RXTA 2EWBA 3MN8A 4NXYA 4EMEA 5CPAA 2JLMA 1M1DA 2PRBA 3D4UA 4C2XA 1VHEA 4K3NA 2Z3NA 3T90A 3CPAA 4YU9A 4FBEA 1ARLA 4NEXA 3MRUA 3FMCA 4OC5A 3JRUA 2VQYA 2ZW4A 3IWGA 2X7BA 2Z0ZA 5A27A 1F57A 4KOWA 3GYAA 1IOFA 4JLYA 2PCUA 3F8KA 1CBXA 1YMEA 2ZELA 4MFJA 5IV0A 2DEAA 4P45A 2OZUA 2ZEGA 4RS2A 4OIWA 5AG6A 2VXKA 1Z8LA 1CG2A 1LCPA 1XFOA 3K9UA 3E0KA 4YRHA 1PU9A 4XNHC 3V8IA 3B3TA 3IU2A 1M4DA 2B5GA 4NF1A 5DWMA 1U6MA 3W6XA 1MJ9A 4F0XA 2HQYA 2IMOA 4R3LA 3TE4A 2JBJA 1LAPA 1M4GA 2PC1A 2PR8A 3D66A 3RBUA 3I1UA 4F9UA 4GXHA 2C6CA 2Q0YA 1DTDA 2O4HA 2EVNA 3PZJA 2B3UA 5HVGA 1CM0A 3GIUA 1Y9KA 2ZOGA 3S9MA 1S7LA 2C6PA 4A31A 2I3CA 2HC9A 2QYVA 2ARHA 3S9NA 3NH5A 5KTDA 1TF9A 5HMNA 4A33A 2BO9A 3IFEA 2XEIA 3RZAA 3FBUA 4LQGA 2PVVA 3DSBA 1NE9A 1YW4A 1TKHA 2V8DA 5IB9A 5LYLA 1LANA 2JDDA 4JWPA 4YFJA 4CAVA 2IJZA 4C7HA 4DJLA 3SI1A 1KUVA 1ELMP 2FXFA 5BWAB 4J3GA 3B3VA 1NSAA 3FB3A 2FSRA 4NGMA 5AG5A 5LYFA 4MJ8A 4M6GA 1AUGA 3SJEA 3FEEA 3NE8A 3SXOA 4B5PA 4Q38A 2R8VA 3IEHA 2P6FA 4AB7A 2PJ0A 3B3WA 4ZY1A 4PXCA 4R3KA 4OC4A 2OR4A 1S60A 4Q7AA 2ZEDA 3EFAA 1PCAA 1ZG9A 3IWWA 4UEFA 2GIVA 4W9YA 4ZYQA 3WABA 2FE7A 3R9EA 2AFOA 4MXUA 3P2FA 4A32A 3G8WA 4AXVA 2Q4ZA 1X12A 2FCKA 1IICA 2D4PA 2Q7BA 4F6AA 2Q43A 4ZGYB 5C82A 2VEZA 5LRJA 3KASA 2RC4A 4XPKA 1MJAA 4ZY0A 3H8EA 4UIBA 2R1IA 1P4NA 4O23A 2Q4YA 3F5BA 3CXPA 1IIDA 2ZOFA 2WZNA 4X3RA 1IGBA 4CYNA 4ZY2A 2NYQA 2RB7A 4OC0A 4P4FA 4UFXA 3D3SA 3IU1A 2R7HA 4ZX8A 4HPSA 4R87A 3FH4A 2BEIA 3GLJA 4X2TA 4EVYA 2QJ8A 2YNEA 4A39A 3KGQA 3KQXA 2O28A 2EUIA 2VI7A 1R43A 1Y0YA 7CPAA 2WUUA 4CAWA 2J9AA 2Z3LA 3CPXA 1I1DA 2VZZA 3DNSA 3LODA 4C7IA 1FT7A 3B2YA 2ZEOA 3PEIA 4HNXB 2ZPAA 4KOVA 4NFRA 4MMOA 4PPZA 2J8NA 4L8AA 3BHXA 4KUAA 3ZJ0A 1R57A 4KOYA 4CAEA 3FNCA 8CPAA 3JVNA 3QNVA 4P44A 5LYDA 3FVLA 1XE4A 3DDDA 4F8ZA 2YNCA 3PB8X 4X5KA 1BAVA 1CPXA 4B6ZA 3BI1A 2QMLA 3WC5A 4PK2A 5THWA 4XNHB 2B4BA 2P6EA 2Q04A 5JQ4A 1RTQA 5FVJA 1Y7EA 4KORA 4NJRA 3FRMA 3SI2A 3B3SA 2PJ3A 4KSFA 1ZLIA 4RUHA 4OAEA 2J8RA 3CDXA 3EC4A 4UWJA 3R9FA 3I9SA 4R76A 4ONUA 1UWYA 1Q2DA 4OC3A 5EBVA 5J8CA 4MFZA 4P4EA 4QVTA 3IIBA 4FAIA 4DYOA 1YK3A 2POKA 3VARA 4LQ6A 3HLPA 3P2HA 2PJ1A 2GFQA 4KVXA 2C6GA 4RN7A 4AG7A 3NFZA 4KOUA 3QB8A 3LACA 1AYEA 2G3TA 2AFZA 4KS9A 2WPXA 1GHEA 2OZGA 4P4IA 4R57A 5AG7A 3D8PA 5H86A 2I79A 1ZG8A 1CP7A 3R96A 4KSAA 2VBQA 1S7KA 2R98A 1I12A 3W91A 2HV2A 5G22A 4TWEA 3DGVA 2YNCC 4M6IA 3S6KA 5DWNA 1F2OA 3MGDA 4LUAA 3PBBA 4KLVA 1TF8A 3R9GA 2B5GB 4A94A 4MCSA 5ELYA 3WC7A 1IB1E 5LRKA 4FUUA 3S9LA 2WYRA 2GLJA 2EO8A 4HNYB 4DNCA 2K5TA 2G0BA 2Q51A 3NH4A 4M3SA 4MI4A 1CPSA 4XPDC 1ZLHA 4AVBA 3WT4A 4WWVA 1ELLP 1J4JA 1K4JA 4AVCA 1HDQA 1Z4EA 2AFXA 1VGYA 4UA3A 3CXQA 4KVME 3TO6A 1Y9WA 4JJXA 4CYPA 3L2NA 1DE4C 4FD6A 4UEEA 2F7VA 1HEEA 1Q2YA 4P4DA 4OIDA 4H2KA 1XMTA 1ZO0A 2ZEEA 4PXDA 1YR0A 1KZFA 3EXNA 2EBJA 3NA6A 4ZBGA 2Z10A 1PUAA 5JGFA 4ONWA 1Q2CA 2I00A 2IQ6A 5I4MA 5A28A 4FD5A 3N5FA 3PP9A 3D7DA 4CRZB 3N7ZA 5F49A 4B11A 4MFPA 2WPWA 1FNOA 2AJ6A 3EO4A 2VL1A 4UCNA 4UIAA 3RO0A 2H5MA 3IO1A 4B5PB 1XMBA 5IB0A 2C27A 4U9YA 1UFHA 3F0AA 1A2ZA 3BJ8A 2F5IA 3RNZA 4G1PA 4TNUA 5AG4A 1LFWA 2KCWA 1YLEA 5HXDA 2ZW7A 4GM5A 4P4BA 1Z8TA 4U9ZA 4KSIA 5AGEA 1I21A 3TOBA 4BD9A 2CTCA 3FEDA 3TC8A 2ATRA 2A4NA 2AFSA 2CNMA 2QECA 3B7IA 4KOXA 5EMIA 3C26A 5K8OA 4NCZA 4CYQA 2FIAA 2ZEHA 3IWEA 4OLLA 1QSRA 1QSTA 3NE7A 4GS4A 2RFHA 5HVFA 1YREA 4PQAA 1IYLA 1M4IA 2PJCA 5E96A 4B13A 1TKFA 2B58A 4HKFA 3D7FA 4MBUA 5HH1A 1XJOA 3D68A 2PJ6A 1YSJA 1B6BA 3SJFA 1S5KA 1KUYA 2PRQA 1XBUA 2GE3A 2PR1A 2ZEPA 2P6GA 2PDOA 3CZXA 4IUSA 1CX8A 3TCVA 4KOTA 4Q36A 4OC2A 1BPNA 1OZPA 4WJBA 2Z3OA 1GYTA 3JTKA 4M85A 5C88A 4UFWA 2ABZA 3KR4A 2XEJA 4A37A 2BOAA 2O53A 4H6UA 1IY7A 4XPLA 2HB6A 2V77A 4NGRA 4OADA 3FF3A 1NSLA 3WC6A 4KVOE 4OKOA 3ZZIA 3TO7A 4PK3A 1QSNA 1YX0A 1CP6A 2FL4A 3S6GA 4ZI6A 1R3NA 4IK2A 3OWCA 4UWIA 1QQ9A 4NGQA 4UFVA 5D8NA 3VATA 4P10A 2FT0A 3KHZA 4EFDA 1Z2LA 4P6YA 2B4DA 4X8IA 2REFA 1TXRA 4ORFA 4RI1A 5IX3A 3D67A 4CYOA 4BMHA 4NJQA 3K2KA 1VHSA 3NH8A 4PV6A 4B10A 4F0YA 1LRZA 4JZ0A 1BO4A 2V8GA 2Q7SA 2DPSA 2BCOA 2AFWA 2ODFA 2OH1A 4MHYA 4XPDB 3LMSA 2ZXVA 4YWYA 4E8OA 4CS0B 3IGRA 4IF5A 5H84A 4CGPA 5JH9A 5GCNA 2BUEA 4Y49C 3QAYA 1Z5RA 3IC1A 3I3GA 4IAVA 2ZEFA 4C2ZA 2DF5A 3B35A 4CPAA 4KLWA 3KZWA 2PIYA 3B3CA 4JYWA 1VHOA 4B5OA 2PSWA 2PIZA 4E2AA 4HNWB 3VWDA 5K8PA 5EC4A 5G20A 1Z4RA 1LAMA 2Z3KA 2PJ5A 3CXSA 3PB6X 1NMTA 1KUXA 3D2PA 3PBEA 4KUBA 4AG9A 4NSQA 3FXTA 4MFQA 1TKJA 1JWQA 2ZW6A 2ZW5A 2XEFA 2JEVA 1EE3P 2F8HA 2G3AA 4JXRA 2YNDA 1IOIA 2GREA 3FYNA 2C1CA 3JUWA 3KQZA 1Y7RA 4UCMA 2OOTA 3QAHA 2PJ8A 3CT9A 2FS5A 3D2MA 4U5YA 3SHPA 4B12A 5KTCA 2FVGA 5F48A 4FD4A 1S7NA 2PJAA 1IYKA 2GLFA 3SXNA 4CGLA 1YLOA 1HDUA 6CPAA 4EWTA 2Z3PA 3WR7A 4PXEA 3RAMA 3S6FA 1JQGA 4AVAA 1BLLE 1QSOA 5G1ZA 3GB0A 4PSWA 5G21A 3H8FA 2PJ2A 3H5ZA 4FWUA 4K30A 4MHZA 3LWUA 2CNSA 4H89A 2BSWA 1CJWA 1Z9UA 3ISXA 4MY0A 2GU2A 2ZENA 3TTHA 2HUZA 3SJGA 1WK4A 2V8VA 1MK4A 2AFUA 4MY3A 4JD6A 3KI9A 4QC6A 4UF4A 4A2ZA 5K8NA 2ANPA 4CAFA 5JM6A 3DR8A 2IL4A 3DR6A 1V0CA 2PE3A 2Q44A 4UEZA 4QB9A 1YGHA 3DLJA 4PSXA 4OMEA 4NGPA 5KTAA 4MCQA 2NMTA 3W6SA 2ZEMA 5ISVA 3VWEA 1Y0RA 4IHMA 2B3VA 1FY7A 1LOKA 2CNTA 1XEBA 4KOSA 1ON0A 2EK8A 3KR5A 4JXQA 1YQEA 1P0HA 1H8LA 2CIJA 4NGSA 3PFOA 1S7FA 4KZTA 4CRYB 5D29A 4CAXA 4NGTA 1M4LA 1MJBA 2EK9A 2J8MA 2BL1A 3T8WA 2GANA 1BOBA 3D7GA 3LD2A 4I49A 4L89A 4MFKA 4MHPA 4PXBA 4F9VA 4MCPA 2FIWA 3BI0A 2Y0MA 1Q7LA 4B14A 4CGNA 1PYTB 5CBMA 2YGWA 1X10A 2NSMA 3KKWA 4MCRA 3S6HA 1SQHA 4R7MA 5I0CA 1TIQA 4C68A 4OP4A 1XOVA 1YVKA 3B8GA 1VIXA 2PQ8A 2QIRA 2WSAA 3IJ3A 4NGNA 4P4JA 4UBRA 4UCPA 3ISZA 1N71A 1ZG7A 3PB7X 4A38A 4II9A 3V38A 2JBKA 1ARMA 2DXQA 4QUSA 1OBRA 3K9TA 1XIXA 4Y49B 2OU2A 1Z8XA 3H8GA 3D7HA 4R6TA 4BBHA 3TOAA 2P0WA 3PRTA 2PJ9A 2CY2A 4BINA 2Q4VA 2Z11A 5F47A 4A30A 4MFLA 4DUKA 1M44A 2G9DA 2PVWA 3GKRA 3TT2A 2VZYA 2D4OA 5LRGA 3H4QA 3TX8A 4C2YA 4QBJA
chains in the Genus database with same CATH topology
3BJ7A 5J8FA 3A9LA 4A95A 4MHDA 4R9MA 1L0CA 1S3ZA 4H6ZA 2B4DB 3R1KA 3R95A 3G3SA 1WWZA 3PGPA 3TO9A 4CGMA 1QSMA 1B87A 3GY9A 3T9YA 4FD7A 3UY5A 5JPHA 2JDCA 2CXAA 2REEA 2DPTA 5CNPA 1RO5A 1YVOA 4YGOA 3EY5A 4CGOA 3FIXA 1XF8A 1VKCA 2OZHA 3RYOA 2Z3MA 3BLNA 4LX9A 2AE6A 2OB0A 4E0AA 3TFYA 5F46A 4NXYA 1RXTA 2JLMA 1M1DA 2PRBA 4C2XA 2Z3NA 3T90A 4NEXA 2VQYA 2ZW4A 3IWGA 2X7BA 2Z0ZA 5A27A 4KOWA 3GYAA 4JLYA 3F8KA 4MFJA 5IV0A 2OZUA 4RS2A 5AG6A 2VXKA 3K9UA 4YRHA 3E0KA 1PU9A 4XNHC 3V8IA 3IU2A 1M4DA 2B5GA 4NF1A 5DWMA 1U6MA 3W6XA 1MJ9A 4F0XA 2HQYA 4R3LA 3TE4A 1M4GA 2PC1A 2PR8A 2Q0YA 2EVNA 3PZJA 2B3UA 1CM0A 1Y9KA 4A31A 1S7LA 2ARHA 5KTDA 5HMNA 4A33A 3FBUA 3DSBA 1NE9A 2JDDA 4JWPA 4YFJA 4CAVA 4C7HA 1KUVA 2FXFA 5BWAB 4J3GA 3FB3A 2FSRA 5AG5A 4MJ8A 3SXOA 4B5PA 4Q38A 2R8VA 2P6FA 4AB7A 4R3KA 1S60A 3EFAA 2GIVA 2FE7A 3R9EA 3P2FA 4A32A 3G8WA 2FCKA 1IICA 2D4PA 2Q7BA 4F6AA 4ZGYB 5C82A 2VEZA 2RC4A 4XPKA 1MJAA 2R1IA 1P4NA 2Q4YA 3F5BA 3CXPA 1IIDA 4CYNA 4UFXA 3D3SA 3IU1A 2R7HA 4R87A 2BEIA 4EVYA 2YNEA 2O28A 2EUIA 2VI7A 2WUUA 4CAWA 2Z3LA 1I1DA 2VZZA 3DNSA 3LODA 4C7IA 4HNXB 2ZPAA 4KOVA 2J8NA 4L8AA 4KUAA 3ZJ0A 1R57A 4KOYA 4CAEA 3FNCA 3JVNA 1XE4A 3DDDA 2YNCA 4X5KA 2QMLA 4PK2A 4XNHB 2B4BA 2P6EA 2Q04A 5JQ4A 5FVJA 4KORA 3FRMA 4KSFA 4OAEA 2J8RA 3EC4A 4UWJA 3R9FA 3I9SA 4ONUA 1Q2DA 5EBVA 5J8CA 4MFZA 4QVTA 1YK3A 3P2HA 4KVXA 4AG7A 4KOUA 3QB8A 2G3TA 4KS9A 2WPXA 1GHEA 2OZGA 4R57A 5AG7A 3D8PA 5H86A 2I79A 3R96A 4KSAA 2VBQA 1S7KA 2R98A 1I12A 3W91A 2HV2A 5G22A 3S6KA 2YNCC 5DWNA 3MGDA 4LUAA 4KLVA 3R9GA 2B5GB 1IB1E 4HNYB 4DNCA 2K5TA 2G0BA 4M3SA 4MI4A 4XPDC 4AVBA 1J4JA 1K4JA 4AVCA 1Z4EA 4UA3A 3CXQA 4KVME 3TO6A 1Y9WA 4JJXA 4CYPA 4FD6A 1Q2YA 1XMTA 1ZO0A 1YR0A 1KZFA 3EXNA 4ZBGA 2Z10A 1PUAA 1Q2CA 2I00A 5A28A 4FD5A 4CRZB 3PP9A 3N7ZA 5F49A 4B11A 4MFPA 2WPWA 2AJ6A 3EO4A 4UCNA 2H5MA 4B5PB 5IB0A 2C27A 4U9YA 1UFHA 3F0AA 3BJ8A 2F5IA 5AG4A 2KCWA 1YLEA 2ZW7A 4U9ZA 5AGEA 1I21A 3TOBA 2ATRA 2A4NA 2CNMA 2QECA 4KOXA 3C26A 4NCZA 4CYQA 2FIAA 3IWEA 4OLLA 1QSRA 3NE7A 1QSTA 4GS4A 1YREA 1IYLA 1M4IA 5E96A 4B13A 2B58A 4HKFA 4MBUA 5HH1A 1B6BA 1S5KA 1KUYA 2GE3A 2PR1A 2P6GA 2PDOA 4IUSA 3TCVA 4KOTA 4Q36A 1OZPA 2Z3OA 3JTKA 4M85A 5C88A 4UFWA 4H6UA 4XPLA 4OADA 3ZZIA 1NSLA 4KVOE 3TO7A 4PK3A 1QSNA 1YX0A 2FL4A 3S6GA 4UWIA 3OWCA 4UFVA 2FT0A 2B4DA 2REFA 4ORFA 4RI1A 5IX3A 4CYOA 4BMHA 1VHSA 4PV6A 4B10A 4F0YA 1LRZA 1BO4A 2DPSA 4QBJA 2OH1A 4XPDB 4E8OA 2ZXVA 4CS0B 3IGRA 4IF5A 5H84A 4CGPA 5GCNA 2BUEA 4Y49C 3I3GA 4C2ZA 4KLWA 4B5OA 2PSWA 4E2AA 4HNWB 3VWDA 5EC4A 5G20A 1Z4RA 2Z3KA 3CXSA 1NMTA 1KUXA 3D2PA 4KUBA 4AG9A 4NSQA 3FXTA 4MFQA 2ZW6A 2ZW5A 2JEVA 2G3AA 4JXRA 2YNDA 3FYNA 3JUWA 4UCMA 1Y7RA 3QAHA 2FS5A 3D2MA 4U5YA 3SHPA 4B12A 5KTCA 5F48A 4FD4A 1S7NA 1IYKA 3SXNA 4CGLA 2Z3PA 3WR7A 4AVAA 3S6FA 1QSOA 5G1ZA 4PSWA 5G21A 3H5ZA 4K30A 2CNSA 4H89A 2BSWA 1CJWA 1Z9UA 4MY0A 3TTHA 2HUZA 1WK4A 1MK4A 4MY3A 4JD6A 4QC6A 4A2ZA 4CAFA 3DR8A 2IL4A 3DR6A 1V0CA 2Q44A 4QB9A 1YGHA 4PSXA 5KTAA 2NMTA 3W6SA 5ISVA 3VWEA 2B3VA 1FY7A 2CNTA 1XEBA 4KOSA 1ON0A 4JXQA 1P0HA 1S7FA 4KZTA 4CRYB 4CAXA 1MJBA 2J8MA 2BL1A 2GANA 1BOBA 4I49A 3LD2A 4L89A 4MFKA 2FIWA 4B14A 2Y0MA 4CGNA 2YGWA 3KKWA 3S6HA 1SQHA 5I0CA 1TIQA 4C68A 3B8GA 1YVKA 2QIRA 2PQ8A 2WSAA 4UBRA 4UCPA 1N71A 4II9A 2DXQA 4QUSA 1XIXA 4Y49B 2OU2A 4BBHA 3TOAA 2P0WA 2CY2A 2Q4VA 2Z11A 5F47A 4A30A 4MFLA 1M44A 3GKRA 3TT2A 2VZYA 2D4OA 3H4QA 4C2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJ7 A;  5J8F A;  4MHD A;  4R9M A;  1L0C A;  1S3Z A;  4H6Z A;  2B4D B;  3R1K A;  3R95 A;  3G3S A;  1WWZ A;  3PGP A;  3TO9 A;  1QSM A;  1B87 A;  3GY9 A;  3T9Y A;  4FD7 A;  3UY5 A;  5JPH A;  2JDC A;  2REE A;  5CNP A;  1RO5 A;  1YVO A;  4YGO A;  3EY5 A;  3FIX A;  1XF8 A;  1VKC A;  2OZH A;  3RYO A;  3BLN A;  4LX9 A;  2AE6 A;  2OB0 A;  4E0A A;  3TFY A;  5F46 A;  4NXY A;  1RXT A;  2JLM A;  1M1D A;  2PRB A;  3T90 A;  4NEX A;  2VQY A;  2ZW4 A;  3IWG A;  2X7B A;  2Z0Z A;  4KOW A;  3GYA A;  4JLY A;  3F8K A;  5IV0 A;  2OZU A;  4RS2 A;  2VXK A;  3K9U A;  4YRH A;  3E0K A;  1PU9 A;  4XNH C;  3V8I A;  4NF1 A;  1M4D A;  2B5G A;  5DWM A;  3W6X A;  1U6M A;  1MJ9 A;  2HQY A;  4R3L A;  3TE4 A;  1M4G A;  2PC1 A;  2PR8 A;  2Q0Y A;  2EVN A;  3PZJ A;  2B3U A;  1CM0 A;  1Y9K A;  1S7L A;  2ARH A;  5KTD A;  5HMN A;  3FBU A;  3DSB A;  1NE9 A;  2JDD A;  4JWP A;  4YFJ A;  4CAV A;  1KUV A;  2FXF A;  4J3G A;  3FB3 A;  2FSR A;  4MJ8 A;  3SXO A;  4B5P A;  2R8V A;  2P6F A;  4AB7 A;  4R3K A;  1S60 A;  3EFA A;  2GIV A;  2FE7 A;  3R9E A;  3P2F A;  3G8W A;  2FCK A;  1IIC A;  2D4P A;  2Q7B A;  4F6A A;  5C82 A;  2VEZ A;  2RC4 A;  4XPK A;  1MJA A;  2R1I A;  1P4N A;  2Q4Y A;  3F5B A;  3CXP A;  1IID A;  3D3S A;  2R7H A;  4R87 A;  2BEI A;  4EVY A;  2O28 A;  2EUI A;  2VI7 A;  4CAW A;  1I1D A;  2VZZ A;  3DNS A;  3LOD A;  4HNX B;  2ZPA A;  4KOV A;  2J8N A;  4L8A A;  4KUA A;  3ZJ0 A;  1R57 A;  4KOY A;  3FNC A;  3JVN A;  1XE4 A;  3DDD A;  4X5K A;  2QML A;  4PK2 A;  4XNH B;  2B4B A;  2P6E A;  2Q04 A;  5JQ4 A;  5FVJ A;  4KOR A;  3FRM A;  4OAE A;  2J8R A;  3EC4 A;  4UWJ A;  3R9F A;  3I9S A;  4ONU A;  1Q2D A;  5EBV A;  5J8C A;  4QVT A;  1YK3 A;  3P2H A;  4KVX A;  4AG7 A;  4KOU A;  3QB8 A;  2G3T A;  2WPX A;  1GHE A;  2OZG A;  4R57 A;  3D8P A;  5H86 A;  2I79 A;  3R96 A;  2VBQ A;  1S7K A;  2R98 A;  1I12 A;  3W91 A;  2HV2 A;  3S6K A;  5DWN A;  3MGD A;  4LUA A;  4KLV A;  3R9G A;  2B5G B;  1IB1 E;  4HNY B;  4DNC A;  2K5T A;  2G0B A;  4M3S A;  4MI4 A;  4XPD C;  4AVB A;  1J4J A;  1K4J A;  4AVC A;  1Z4E A;  4UA3 A;  3CXQ A;  4KVM E;  3TO6 A;  1Y9W A;  4JJX A;  4FD6 A;  1Q2Y A;  1XMT A;  1YR0 A;  1KZF A;  3EXN A;  4ZBG A;  2Z10 A;  1PUA A;  1Q2C A;  2I00 A;  4FD5 A;  4CRZ B;  3PP9 A;  3N7Z A;  5F49 A;  2WPW A;  2AJ6 A;  3EO4 A;  2H5M A;  4B5P B;  5IB0 A;  2C27 A;  4U9Y A;  1UFH A;  3F0A A;  3BJ8 A;  2F5I A;  2KCW A;  1YLE A;  2ZW7 A;  4U9Z A;  1I21 A;  3TOB A;  2ATR A;  2A4N A;  2CNM A;  2QEC A;  4KOX A;  3C26 A;  4NCZ A;  2FIA A;  4OLL A;  1QSR A;  3NE7 A;  1QST A;  4GS4 A;  1YRE A;  1IYL A;  1M4I A;  5E96 A;  2B58 A;  4HKF A;  4MBU A;  5HH1 A;  1B6B A;  1S5K A;  1KUY A;  2GE3 A;  2PR1 A;  2P6G A;  2PDO A;  4IUS A;  3TCV A;  4KOT A;  1OZP A;  4M85 A;  5C88 A;  4H6U A;  4XPL A;  4OAD A;  3ZZI A;  1NSL A;  4KVO E;  3TO7 A;  4PK3 A;  1QSN A;  1YX0 A;  2FL4 A;  3S6G A;  4UWI A;  3OWC A;  2FT0 A;  2B4D A;  2REF A;  4ORF A;  4RI1 A;  5IX3 A;  4BMH A;  1VHS A;  4PV6 A;  4F0Y A;  1LRZ A;  1BO4 A;  4QBJ A;  2OH1 A;  4XPD B;  4E8O A;  2ZXV A;  4CS0 B;  3IGR A;  4IF5 A;  5H84 A;  5GCN A;  2BUE A;  4Y49 C;  3I3G A;  4KLW A;  4B5O A;  2PSW A;  4E2A A;  4HNW B;  3VWD A;  5EC4 A;  1Z4R A;  3CXS A;  1NMT A;  1KUX A;  3D2P A;  4KUB A;  4AG9 A;  4NSQ A;  3FXT A;  2ZW6 A;  2ZW5 A;  2JEV A;  2G3A A;  4JXR A;  3JUW A;  3FYN A;  1Y7R A;  3QAH A;  2FS5 A;  3D2M A;  4U5Y A;  3SHP A;  5KTC A;  5F48 A;  4FD4 A;  1S7N A;  1IYK A;  3SXN A;  3WR7 A;  4AVA A;  3S6F A;  1QSO A;  4PSW A;  4K30 A;  2CNS A;  4H89 A;  2BSW A;  1CJW A;  1Z9U A;  4MY0 A;  3TTH A;  2HUZ A;  1WK4 A;  1MK4 A;  4MY3 A;  4JD6 A;  4QC6 A;  3DR8 A;  2IL4 A;  3DR6 A;  1V0C A;  2Q44 A;  4QB9 A;  1YGH A;  4PSX A;  5KTA A;  2NMT A;  3W6S A;  5ISV A;  3VWE A;  2B3V A;  1FY7 A;  2CNT A;  1XEB A;  4KOS A;  1ON0 A;  4JXQ A;  1P0H A;  1S7F A;  4KZT A;  4CRY B;  4CAX A;  1MJB A;  2J8M A;  2BL1 A;  2GAN A;  1BOB A;  4I49 A;  3LD2 A;  4L89 A;  2FIW A;  2Y0M A;  3KKW A;  3S6H A;  1SQH A;  5I0C A;  1TIQ A;  3B8G A;  1YVK A;  2QIR A;  2PQ8 A;  4UBR A;  1N71 A;  4II9 A;  2DXQ A;  4QUS A;  1XIX A;  4Y49 B;  2OU2 A;  3TOA A;  2P0W A;  2CY2 A;  2Q4V A;  2Z11 A;  5F47 A;  1M44 A;  3GKR A;  3TT2 A;  2VZY A;  2D4O A;  3H4Q A; 
#chains in the Genus database with same CATH topology
 3V7Z A;  2PJ7 A;  3BJ7 A;  5J8F A;  1F2P A;  4ZX9 A;  3SJX A;  1AMP A;  3A9L A;  4A95 A;  1Z8W A;  4MHD A;  3BXM A;  3PB9 X;  2AFM A;  1L0C A;  2CF4 A;  2QVP A;  1S3Z A;  4H6Z A;  4R9M A;  5K8M A;  2B4D B;  3R1K A;  5HVH A;  5J1Q A;  3R95 A;  3HUV A;  3VH9 A;  1YW6 A;  3G3S A;  5DS0 A;  3FEC A;  1WWZ A;  3PGP A;  3TO9 A;  4CGM A;  1QSM A;  4M6H A;  1B87 A;  3GY9 A;  3T9Y A;  4FD7 A;  3PFE A;  3UY5 A;  5JPH A;  2JDC A;  3FX6 A;  2CXA A;  2REE A;  3PB4 X;  2DPT A;  4MHN A;  2XEG A;  1IU8 A;  1RO5 A;  1YVO A;  2CTB A;  5CNP A;  4YGO A;  4OC1 A;  5LYI A;  1BPM A;  3EY5 A;  4Z65 A;  5F09 A;  3KL9 A;  4CGO A;  2JEW A;  3FIX A;  3SI0 A;  1XF8 A;  1VKC A;  3FJU A;  1KWM A;  4MRI A;  2OZH A;  3RYO A;  1QMU A;  2V8H A;  2PJB A;  2Z3M A;  2PJ4 A;  3BLN A;  1XRY A;  2AE6 A;  2OB0 A;  3GUX A;  4LX9 A;  4R8F A;  4E0A A;  3TFY A;  5F46 A;  3KHX A;  1RXT A;  2EWB A;  3MN8 A;  4NXY A;  4EME A;  5CPA A;  2JLM A;  1M1D A;  2PRB A;  3D4U A;  4C2X A;  1VHE A;  4K3N A;  2Z3N A;  3T90 A;  3CPA A;  4YU9 A;  4FBE A;  1ARL A;  4NEX A;  3MRU A;  3FMC A;  4OC5 A;  3JRU A;  2VQY A;  2ZW4 A;  3IWG A;  2X7B A;  2Z0Z A;  5A27 A;  1F57 A;  4KOW A;  3GYA A;  1IOF A;  4JLY A;  2PCU A;  3F8K A;  1CBX A;  1YME A;  2ZEL A;  4MFJ A;  5IV0 A;  2DEA A;  4P45 A;  2OZU A;  2ZEG A;  4RS2 A;  4OIW A;  5AG6 A;  2VXK A;  1Z8L A;  1CG2 A;  1LCP A;  1XFO A;  3K9U A;  3E0K A;  4YRH A;  1PU9 A;  4XNH C;  3V8I A;  3B3T A;  3IU2 A;  1M4D A;  2B5G A;  4NF1 A;  5DWM A;  1U6M A;  3W6X A;  1MJ9 A;  4F0X A;  2HQY A;  2IMO A;  4R3L A;  3TE4 A;  2JBJ A;  1LAP A;  1M4G A;  2PC1 A;  2PR8 A;  3D66 A;  3RBU A;  3I1U A;  4F9U A;  4GXH A;  2C6C A;  2Q0Y A;  1DTD A;  2O4H A;  2EVN A;  3PZJ A;  2B3U A;  5HVG A;  1CM0 A;  3GIU A;  1Y9K A;  2ZOG A;  3S9M A;  1S7L A;  2C6P A;  4A31 A;  2I3C A;  2HC9 A;  2QYV A;  2ARH A;  3S9N A;  3NH5 A;  5KTD A;  1TF9 A;  5HMN A;  4A33 A;  2BO9 A;  3IFE A;  2XEI A;  3RZA A;  3FBU A;  4LQG A;  2PVV A;  3DSB A;  1NE9 A;  1YW4 A;  1TKH A;  2V8D A;  5IB9 A;  5LYL A;  1LAN A;  2JDD A;  4JWP A;  4YFJ A;  4CAV A;  2IJZ A;  4C7H A;  4DJL A;  3SI1 A;  1KUV A;  1ELM P;  2FXF A;  5BWA B;  4J3G A;  3B3V A;  1NSA A;  3FB3 A;  2FSR A;  4NGM A;  5AG5 A;  5LYF A;  4MJ8 A;  4M6G A;  1AUG A;  3SJE A;  3FEE A;  3NE8 A;  3SXO A;  4B5P A;  4Q38 A;  2R8V A;  3IEH A;  2P6F A;  4AB7 A;  2PJ0 A;  3B3W A;  4ZY1 A;  4PXC A;  4R3K A;  4OC4 A;  2OR4 A;  1S60 A;  4Q7A A;  2ZED A;  3EFA A;  1PCA A;  1ZG9 A;  3IWW A;  4UEF A;  2GIV A;  4W9Y A;  4ZYQ A;  3WAB A;  2FE7 A;  3R9E A;  2AFO A;  4MXU A;  3P2F A;  4A32 A;  3G8W A;  4AXV A;  2Q4Z A;  1X12 A;  2FCK A;  1IIC A;  2D4P A;  2Q7B A;  4F6A A;  2Q43 A;  4ZGY B;  5C82 A;  2VEZ A;  5LRJ A;  3KAS A;  2RC4 A;  4XPK A;  1MJA A;  4ZY0 A;  3H8E A;  4UIB A;  2R1I A;  1P4N A;  4O23 A;  2Q4Y A;  3F5B A;  3CXP A;  1IID A;  2ZOF A;  2WZN A;  4X3R A;  1IGB A;  4CYN A;  4ZY2 A;  2NYQ A;  2RB7 A;  4OC0 A;  4P4F A;  4UFX A;  3D3S A;  3IU1 A;  2R7H A;  4ZX8 A;  4HPS A;  4R87 A;  3FH4 A;  2BEI A;  3GLJ A;  4X2T A;  4EVY A;  2QJ8 A;  2YNE A;  4A39 A;  3KGQ A;  3KQX A;  2O28 A;  2EUI A;  2VI7 A;  1R43 A;  1Y0Y A;  7CPA A;  2WUU A;  4CAW A;  2J9A A;  2Z3L A;  3CPX A;  1I1D A;  2VZZ A;  3DNS A;  3LOD A;  4C7I A;  1FT7 A;  3B2Y A;  2ZEO A;  3PEI A;  4HNX B;  2ZPA A;  4KOV A;  4NFR A;  4MMO A;  4PPZ A;  2J8N A;  4L8A A;  3BHX A;  4KUA A;  3ZJ0 A;  1R57 A;  4KOY A;  4CAE A;  3FNC A;  8CPA A;  3JVN A;  3QNV A;  4P44 A;  5LYD A;  3FVL A;  1XE4 A;  3DDD A;  4F8Z A;  2YNC A;  3PB8 X;  4X5K A;  1BAV A;  1CPX A;  4B6Z A;  3BI1 A;  2QML A;  3WC5 A;  4PK2 A;  5THW A;  4XNH B;  2B4B A;  2P6E A;  2Q04 A;  5JQ4 A;  1RTQ A;  5FVJ A;  1Y7E A;  4KOR A;  4NJR A;  3FRM A;  3SI2 A;  3B3S A;  2PJ3 A;  4KSF A;  1ZLI A;  4RUH A;  4OAE A;  2J8R A;  3CDX A;  3EC4 A;  4UWJ A;  3R9F A;  3I9S A;  4R76 A;  4ONU A;  1UWY A;  1Q2D A;  4OC3 A;  5EBV A;  5J8C A;  4MFZ A;  4P4E A;  4QVT A;  3IIB A;  4FAI A;  4DYO A;  1YK3 A;  2POK A;  3VAR A;  4LQ6 A;  3HLP A;  3P2H A;  2PJ1 A;  2GFQ A;  4KVX A;  2C6G A;  4RN7 A;  4AG7 A;  3NFZ A;  4KOU A;  3QB8 A;  3LAC A;  1AYE A;  2G3T A;  2AFZ A;  4KS9 A;  2WPX A;  1GHE A;  2OZG A;  4P4I A;  4R57 A;  5AG7 A;  3D8P A;  5H86 A;  2I79 A;  1ZG8 A;  1CP7 A;  3R96 A;  4KSA A;  2VBQ A;  1S7K A;  2R98 A;  1I12 A;  3W91 A;  2HV2 A;  5G22 A;  4TWE A;  3DGV A;  2YNC C;  4M6I A;  3S6K A;  5DWN A;  1F2O A;  3MGD A;  4LUA A;  3PBB A;  4KLV A;  1TF8 A;  3R9G A;  2B5G B;  4A94 A;  4MCS A;  5ELY A;  3WC7 A;  1IB1 E;  5LRK A;  4FUU A;  3S9L A;  2WYR A;  2GLJ A;  2EO8 A;  4HNY B;  4DNC A;  2K5T A;  2G0B A;  2Q51 A;  3NH4 A;  4M3S A;  4MI4 A;  1CPS A;  4XPD C;  1ZLH A;  4AVB A;  3WT4 A;  4WWV A;  1ELL P;  1J4J A;  1K4J A;  4AVC A;  1HDQ A;  1Z4E A;  2AFX A;  1VGY A;  4UA3 A;  3CXQ A;  4KVM E;  3TO6 A;  1Y9W A;  4JJX A;  4CYP A;  3L2N A;  1DE4 C;  4FD6 A;  4UEE A;  2F7V A;  1HEE A;  1Q2Y A;  4P4D A;  4OID A;  4H2K A;  1XMT A;  1ZO0 A;  2ZEE A;  4PXD A;  1YR0 A;  1KZF A;  3EXN A;  2EBJ A;  3NA6 A;  4ZBG A;  2Z10 A;  1PUA A;  5JGF A;  4ONW A;  1Q2C A;  2I00 A;  2IQ6 A;  5I4M A;  5A28 A;  4FD5 A;  3N5F A;  3PP9 A;  3D7D A;  4CRZ B;  3N7Z A;  5F49 A;  4B11 A;  4MFP A;  2WPW A;  1FNO A;  2AJ6 A;  3EO4 A;  2VL1 A;  4UCN A;  4UIA A;  3RO0 A;  2H5M A;  3IO1 A;  4B5P B;  1XMB A;  5IB0 A;  2C27 A;  4U9Y A;  1UFH A;  3F0A A;  1A2Z A;  3BJ8 A;  2F5I A;  3RNZ A;  4G1P A;  4TNU A;  5AG4 A;  1LFW A;  2KCW A;  1YLE A;  5HXD A;  2ZW7 A;  4GM5 A;  4P4B A;  1Z8T A;  4U9Z A;  4KSI A;  5AGE A;  1I21 A;  3TOB A;  4BD9 A;  2CTC A;  3FED A;  3TC8 A;  2ATR A;  2A4N A;  2AFS A;  2CNM A;  2QEC A;  3B7I A;  4KOX A;  5EMI A;  3C26 A;  5K8O A;  4NCZ A;  4CYQ A;  2FIA A;  2ZEH A;  3IWE A;  4OLL A;  1QSR A;  1QST A;  3NE7 A;  4GS4 A;  2RFH A;  5HVF A;  1YRE A;  4PQA A;  1IYL A;  1M4I A;  2PJC A;  5E96 A;  4B13 A;  1TKF A;  2B58 A;  4HKF A;  3D7F A;  4MBU A;  5HH1 A;  1XJO A;  3D68 A;  2PJ6 A;  1YSJ A;  1B6B A;  3SJF A;  1S5K A;  1KUY A;  2PRQ A;  1XBU A;  2GE3 A;  2PR1 A;  2ZEP A;  2P6G A;  2PDO A;  3CZX A;  4IUS A;  1CX8 A;  3TCV A;  4KOT A;  4Q36 A;  4OC2 A;  1BPN A;  1OZP A;  4WJB A;  2Z3O A;  1GYT A;  3JTK A;  4M85 A;  5C88 A;  4UFW A;  2ABZ A;  3KR4 A;  2XEJ A;  4A37 A;  2BOA A;  2O53 A;  4H6U A;  1IY7 A;  4XPL A;  2HB6 A;  2V77 A;  4NGR A;  4OAD A;  3FF3 A;  1NSL A;  3WC6 A;  4KVO E;  4OKO A;  3ZZI A;  3TO7 A;  4PK3 A;  1QSN A;  1YX0 A;  1CP6 A;  2FL4 A;  3S6G A;  4ZI6 A;  1R3N A;  4IK2 A;  3OWC A;  4UWI A;  1QQ9 A;  4NGQ A;  4UFV A;  5D8N A;  3VAT A;  4P10 A;  2FT0 A;  3KHZ A;  4EFD A;  1Z2L A;  4P6Y A;  2B4D A;  4X8I A;  2REF A;  1TXR A;  4ORF A;  4RI1 A;  5IX3 A;  3D67 A;  4CYO A;  4BMH A;  4NJQ A;  3K2K A;  1VHS A;  3NH8 A;  4PV6 A;  4B10 A;  4F0Y A;  1LRZ A;  4JZ0 A;  1BO4 A;  2V8G A;  2Q7S A;  2DPS A;  2BCO A;  2AFW A;  2ODF A;  2OH1 A;  4MHY A;  4XPD B;  3LMS A;  2ZXV A;  4YWY A;  4E8O A;  4CS0 B;  3IGR A;  4IF5 A;  5H84 A;  4CGP A;  5JH9 A;  5GCN A;  2BUE A;  4Y49 C;  3QAY A;  1Z5R A;  3IC1 A;  3I3G A;  4IAV A;  2ZEF A;  4C2Z A;  2DF5 A;  3B35 A;  4CPA A;  4KLW A;  3KZW A;  2PIY A;  3B3C A;  4JYW A;  1VHO A;  4B5O A;  2PSW A;  2PIZ A;  4E2A A;  4HNW B;  3VWD A;  5K8P A;  5EC4 A;  5G20 A;  1Z4R A;  1LAM A;  2Z3K A;  2PJ5 A;  3CXS A;  3PB6 X;  1NMT A;  1KUX A;  3D2P A;  3PBE A;  4KUB A;  4AG9 A;  4NSQ A;  3FXT A;  4MFQ A;  1TKJ A;  1JWQ A;  2ZW6 A;  2ZW5 A;  2XEF A;  2JEV A;  1EE3 P;  2F8H A;  2G3A A;  4JXR A;  2YND A;  1IOI A;  2GRE A;  3FYN A;  2C1C A;  3JUW A;  3KQZ A;  1Y7R A;  4UCM A;  2OOT A;  3QAH A;  2PJ8 A;  3CT9 A;  2FS5 A;  3D2M A;  4U5Y A;  3SHP A;  4B12 A;  5KTC A;  2FVG A;  5F48 A;  4FD4 A;  1S7N A;  2PJA A;  1IYK A;  2GLF A;  3SXN A;  4CGL A;  1YLO A;  1HDU A;  6CPA A;  4EWT A;  2Z3P A;  3WR7 A;  4PXE A;  3RAM A;  3S6F A;  1JQG A;  4AVA A;  1BLL E;  1QSO A;  5G1Z A;  3GB0 A;  4PSW A;  5G21 A;  3H8F A;  2PJ2 A;  3H5Z A;  4FWU A;  4K30 A;  4MHZ A;  3LWU A;  2CNS A;  4H89 A;  2BSW A;  1CJW A;  1Z9U A;  3ISX A;  4MY0 A;  2GU2 A;  2ZEN A;  3TTH A;  2HUZ A;  3SJG A;  1WK4 A;  2V8V A;  1MK4 A;  2AFU A;  4MY3 A;  4JD6 A;  3KI9 A;  4QC6 A;  4UF4 A;  4A2Z A;  5K8N A;  2ANP A;  4CAF A;  5JM6 A;  3DR8 A;  2IL4 A;  3DR6 A;  1V0C A;  2PE3 A;  2Q44 A;  4UEZ A;  4QB9 A;  1YGH A;  3DLJ A;  4PSX A;  4OME A;  4NGP A;  5KTA A;  4MCQ A;  2NMT A;  3W6S A;  2ZEM A;  5ISV A;  3VWE A;  1Y0R A;  4IHM A;  2B3V A;  1FY7 A;  1LOK A;  2CNT A;  1XEB A;  4KOS A;  1ON0 A;  2EK8 A;  3KR5 A;  4JXQ A;  1YQE A;  1P0H A;  1H8L A;  2CIJ A;  4NGS A;  3PFO A;  1S7F A;  4KZT A;  4CRY B;  5D29 A;  4CAX A;  4NGT A;  1M4L A;  1MJB A;  2EK9 A;  2J8M A;  2BL1 A;  3T8W A;  2GAN A;  1BOB A;  3D7G A;  3LD2 A;  4I49 A;  4L89 A;  4MFK A;  4MHP A;  4PXB A;  4F9V A;  4MCP A;  2FIW A;  3BI0 A;  2Y0M A;  1Q7L A;  4B14 A;  4CGN A;  1PYT B;  5CBM A;  2YGW A;  1X10 A;  2NSM A;  3KKW A;  4MCR A;  3S6H A;  1SQH A;  4R7M A;  5I0C A;  1TIQ A;  4C68 A;  4OP4 A;  1XOV A;  1YVK A;  3B8G A;  1VIX A;  2PQ8 A;  2QIR A;  2WSA A;  3IJ3 A;  4NGN A;  4P4J A;  4UBR A;  4UCP A;  3ISZ A;  1N71 A;  1ZG7 A;  3PB7 X;  4A38 A;  4II9 A;  3V38 A;  2JBK A;  1ARM A;  2DXQ A;  4QUS A;  1OBR A;  3K9T A;  1XIX A;  4Y49 B;  2OU2 A;  1Z8X A;  3H8G A;  3D7H A;  4R6T A;  4BBH A;  3TOA A;  2P0W A;  3PRT A;  2PJ9 A;  2CY2 A;  4BIN A;  2Q4V A;  2Z11 A;  5F47 A;  4A30 A;  4MFL A;  4DUK A;  1M44 A;  2G9D A;  2PVW A;  3GKR A;  3TT2 A;  2VZY A;  2D4O A;  5LRG A;  3H4Q A;  3TX8 A;  4C2Y A;  4QBJ A; 
#chains in the Genus database with same CATH homology
 3BJ7 A;  5J8F A;  3A9L A;  4A95 A;  4MHD A;  4R9M A;  1L0C A;  1S3Z A;  4H6Z A;  2B4D B;  3R1K A;  3R95 A;  3G3S A;  1WWZ A;  3PGP A;  3TO9 A;  4CGM A;  1QSM A;  1B87 A;  3GY9 A;  3T9Y A;  4FD7 A;  3UY5 A;  5JPH A;  2JDC A;  2CXA A;  2REE A;  2DPT A;  5CNP A;  1RO5 A;  1YVO A;  4YGO A;  3EY5 A;  4CGO A;  3FIX A;  1XF8 A;  1VKC A;  2OZH A;  3RYO A;  2Z3M A;  3BLN A;  4LX9 A;  2AE6 A;  2OB0 A;  4E0A A;  3TFY A;  5F46 A;  4NXY A;  1RXT A;  2JLM A;  1M1D A;  2PRB A;  4C2X A;  2Z3N A;  3T90 A;  4NEX A;  2VQY A;  2ZW4 A;  3IWG A;  2X7B A;  2Z0Z A;  5A27 A;  4KOW A;  3GYA A;  4JLY A;  3F8K A;  4MFJ A;  5IV0 A;  2OZU A;  4RS2 A;  5AG6 A;  2VXK A;  3K9U A;  4YRH A;  3E0K A;  1PU9 A;  4XNH C;  3V8I A;  3IU2 A;  1M4D A;  2B5G A;  4NF1 A;  5DWM A;  1U6M A;  3W6X A;  1MJ9 A;  4F0X A;  2HQY A;  4R3L A;  3TE4 A;  1M4G A;  2PC1 A;  2PR8 A;  2Q0Y A;  2EVN A;  3PZJ A;  2B3U A;  1CM0 A;  1Y9K A;  4A31 A;  1S7L A;  2ARH A;  5KTD A;  5HMN A;  4A33 A;  3FBU A;  3DSB A;  1NE9 A;  2JDD A;  4JWP A;  4YFJ A;  4CAV A;  4C7H A;  1KUV A;  2FXF A;  5BWA B;  4J3G A;  3FB3 A;  2FSR A;  5AG5 A;  4MJ8 A;  3SXO A;  4B5P A;  4Q38 A;  2R8V A;  2P6F A;  4AB7 A;  4R3K A;  1S60 A;  3EFA A;  2GIV A;  2FE7 A;  3R9E A;  3P2F A;  4A32 A;  3G8W A;  2FCK A;  1IIC A;  2D4P A;  2Q7B A;  4F6A A;  4ZGY B;  5C82 A;  2VEZ A;  2RC4 A;  4XPK A;  1MJA A;  2R1I A;  1P4N A;  2Q4Y A;  3F5B A;  3CXP A;  1IID A;  4CYN A;  4UFX A;  3D3S A;  3IU1 A;  2R7H A;  4R87 A;  2BEI A;  4EVY A;  2YNE A;  2O28 A;  2EUI A;  2VI7 A;  2WUU A;  4CAW A;  2Z3L A;  1I1D A;  2VZZ A;  3DNS A;  3LOD A;  4C7I A;  4HNX B;  2ZPA A;  4KOV A;  2J8N A;  4L8A A;  4KUA A;  3ZJ0 A;  1R57 A;  4KOY A;  4CAE A;  3FNC A;  3JVN A;  1XE4 A;  3DDD A;  2YNC A;  4X5K A;  2QML A;  4PK2 A;  4XNH B;  2B4B A;  2P6E A;  2Q04 A;  5JQ4 A;  5FVJ A;  4KOR A;  3FRM A;  4KSF A;  4OAE A;  2J8R A;  3EC4 A;  4UWJ A;  3R9F A;  3I9S A;  4ONU A;  1Q2D A;  5EBV A;  5J8C A;  4MFZ A;  4QVT A;  1YK3 A;  3P2H A;  4KVX A;  4AG7 A;  4KOU A;  3QB8 A;  2G3T A;  4KS9 A;  2WPX A;  1GHE A;  2OZG A;  4R57 A;  5AG7 A;  3D8P A;  5H86 A;  2I79 A;  3R96 A;  4KSA A;  2VBQ A;  1S7K A;  2R98 A;  1I12 A;  3W91 A;  2HV2 A;  5G22 A;  3S6K A;  2YNC C;  5DWN A;  3MGD A;  4LUA A;  4KLV A;  3R9G A;  2B5G B;  1IB1 E;  4HNY B;  4DNC A;  2K5T A;  2G0B A;  4M3S A;  4MI4 A;  4XPD C;  4AVB A;  1J4J A;  1K4J A;  4AVC A;  1Z4E A;  4UA3 A;  3CXQ A;  4KVM E;  3TO6 A;  1Y9W A;  4JJX A;  4CYP A;  4FD6 A;  1Q2Y A;  1XMT A;  1ZO0 A;  1YR0 A;  1KZF A;  3EXN A;  4ZBG A;  2Z10 A;  1PUA A;  1Q2C A;  2I00 A;  5A28 A;  4FD5 A;  4CRZ B;  3PP9 A;  3N7Z A;  5F49 A;  4B11 A;  4MFP A;  2WPW A;  2AJ6 A;  3EO4 A;  4UCN A;  2H5M A;  4B5P B;  5IB0 A;  2C27 A;  4U9Y A;  1UFH A;  3F0A A;  3BJ8 A;  2F5I A;  5AG4 A;  2KCW A;  1YLE A;  2ZW7 A;  4U9Z A;  5AGE A;  1I21 A;  3TOB A;  2ATR A;  2A4N A;  2CNM A;  2QEC A;  4KOX A;  3C26 A;  4NCZ A;  4CYQ A;  2FIA A;  3IWE A;  4OLL A;  1QSR A;  3NE7 A;  1QST A;  4GS4 A;  1YRE A;  1IYL A;  1M4I A;  5E96 A;  4B13 A;  2B58 A;  4HKF A;  4MBU A;  5HH1 A;  1B6B A;  1S5K A;  1KUY A;  2GE3 A;  2PR1 A;  2P6G A;  2PDO A;  4IUS A;  3TCV A;  4KOT A;  4Q36 A;  1OZP A;  2Z3O A;  3JTK A;  4M85 A;  5C88 A;  4UFW A;  4H6U A;  4XPL A;  4OAD A;  3ZZI A;  1NSL A;  4KVO E;  3TO7 A;  4PK3 A;  1QSN A;  1YX0 A;  2FL4 A;  3S6G A;  4UWI A;  3OWC A;  4UFV A;  2FT0 A;  2B4D A;  2REF A;  4ORF A;  4RI1 A;  5IX3 A;  4CYO A;  4BMH A;  1VHS A;  4PV6 A;  4B10 A;  4F0Y A;  1LRZ A;  1BO4 A;  2DPS A;  4QBJ A;  2OH1 A;  4XPD B;  4E8O A;  2ZXV A;  4CS0 B;  3IGR A;  4IF5 A;  5H84 A;  4CGP A;  5GCN A;  2BUE A;  4Y49 C;  3I3G A;  4C2Z A;  4KLW A;  4B5O A;  2PSW A;  4E2A A;  4HNW B;  3VWD A;  5EC4 A;  5G20 A;  1Z4R A;  2Z3K A;  3CXS A;  1NMT A;  1KUX A;  3D2P A;  4KUB A;  4AG9 A;  4NSQ A;  3FXT A;  4MFQ A;  2ZW6 A;  2ZW5 A;  2JEV A;  2G3A A;  4JXR A;  2YND A;  3FYN A;  3JUW A;  4UCM A;  1Y7R A;  3QAH A;  2FS5 A;  3D2M A;  4U5Y A;  3SHP A;  4B12 A;  5KTC A;  5F48 A;  4FD4 A;  1S7N A;  1IYK A;  3SXN A;  4CGL A;  2Z3P A;  3WR7 A;  4AVA A;  3S6F A;  1QSO A;  5G1Z A;  4PSW A;  5G21 A;  3H5Z A;  4K30 A;  2CNS A;  4H89 A;  2BSW A;  1CJW A;  1Z9U A;  4MY0 A;  3TTH A;  2HUZ A;  1WK4 A;  1MK4 A;  4MY3 A;  4JD6 A;  4QC6 A;  4A2Z A;  4CAF A;  3DR8 A;  2IL4 A;  3DR6 A;  1V0C A;  2Q44 A;  4QB9 A;  1YGH A;  4PSX A;  5KTA A;  2NMT A;  3W6S A;  5ISV A;  3VWE A;  2B3V A;  1FY7 A;  2CNT A;  1XEB A;  4KOS A;  1ON0 A;  4JXQ A;  1P0H A;  1S7F A;  4KZT A;  4CRY B;  4CAX A;  1MJB A;  2J8M A;  2BL1 A;  2GAN A;  1BOB A;  4I49 A;  3LD2 A;  4L89 A;  4MFK A;  2FIW A;  4B14 A;  2Y0M A;  4CGN A;  2YGW A;  3KKW A;  3S6H A;  1SQH A;  5I0C A;  1TIQ A;  4C68 A;  3B8G A;  1YVK A;  2QIR A;  2PQ8 A;  2WSA A;  4UBR A;  4UCP A;  1N71 A;  4II9 A;  2DXQ A;  4QUS A;  1XIX A;  4Y49 B;  2OU2 A;  4BBH A;  3TOA A;  2P0W A;  2CY2 A;  2Q4V A;  2Z11 A;  5F47 A;  4A30 A;  4MFL A;  1M44 A;  3GKR A;  3TT2 A;  2VZY A;  2D4O A;  3H4Q A;  4C2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...