1Q2DA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue p53 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
161
structure length
161
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/structural protein
molecule keywords histone acetyltransferase GCN5
publication title Molecular basis for GCN5/PCAF histone acetyltransferase selectivity for histone and nonhistone substrates
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 46
structure length 161
sequence length 161
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2dA00
5JQ4A 2F5IA 3DDDA 1U6MA 1QSNA 4AVAA 4M85A 4NSQA 4ORFA 4CRYB 4XPLA 1XEBA 4DNCA 5FVJA 4KLWA 2PR8A 4HNXB 4B5PA 1IICA 3F0AA 4H6UA 2REFA 2WPXA 4KOUA 4MI4A 2JDDA 1CJWA 2A4NA 2VXKA 3F5BA 4AG7A 4YRHA 4FD6A 2WPWA 1YVOA 2CY2A 3TFYA 1NSLA 1L0CA 1MJBA 2B4DA 2PQ8A 4MY0A 2D4PA 3PGPA 2OB0A 1I12A 2FXFA 2FL4A 5F48A 2FIWA 1NE9A 2D4OA 2B4BA 3LODA 2R7HA 4OLLA 4PV6A 1S7NA 4HNYB 2J8MA 1S7KA 2ZW4A 4I49A 3WR7A 4KOTA 1GHEA 3VWDA 2I00A 2VZZA 2P6FA 3FYNA 1M4IA 1MJ9A 3OWCA 5DWNA 4HNWB 4CRZB 2JDCA 1QSTA 4CAWA 2ZW6A 4NEXA 4E0AA 3V8IA 2Z11A 1J4JA 5H84A 2P6GA 2VEZA 2AE6A 1N71A 2GE3A 3FIXA 2BL1A 2B5GB 2OH1A 4FD7A 2HUZA 3DR6A 4LUAA 1UFHA 1M4DA 4MJ8A 3GY9A 2Y0MA 4QVTA 3VWEA 3EY5A 3IGRA 4PSWA 4UWJA 1WK4A 3G8WA 1KUXA 3DR8A 3BJ7A 1OZPA 1IYLA 4KOSA 4NCZA 3FXTA 4KOYA 2Q4VA 3ZJ0A 3TTHA 4UA3A 5I0CA 2VQYA 4CAXA 1B87A 1SQHA 3H4QA 2HQYA 2NMTA 3EO4A 3D8PA 2B3VA 1QSMA 4K30A 1FY7A 1Y7RA 3EC4A 1YX0A 4XNHC 1KUVA 2K5TA 1QSOA 2OU2A 2VZYA 2QECA 4OAEA 4KUAA 4Y49C 4KUBA 4M3SA 3JUWA 2BEIA 1Y9KA 3S6KA 3FRMA 3KKWA 2QIRA 1P4NA 3BJ8A 1S60A 5GCNA 1M44A 2VBQA 4BMHA 4H6ZA 2FSRA 1BO4A 2ZW7A 4L89A 3D3SA 1Q2CA 3MGDA 4XPDB 1NMTA 2PR1A 5C88A 4J3GA 1VKCA 2Z10A 3EFAA 3W91A 1CM0A 4AVBA 4R87A 3G3SA 2B58A 4U5YA 4LX9A 4PK2A 3NE7A 2Z0ZA 1S7LA 5IX3A 4CS0B 4RI1A 2Q0YA 4X5KA 3P2FA 5IB0A 2B5GA 1YREA 3R1KA 2HV2A 2Q4YA 2KCWA 4IF5A 1YK3A 1ON0A 4H89A 1YR0A 2ZW5A 1QSRA 4XPDC 2ZPAA 3CXPA 3TE4A 3SXNA 4FD5A 3N7ZA 5F46A 4R9MA 1Z4EA 3TOAA 5KTDA 3D2PA 4NXYA 1Z4RA 2R1IA 3W6SA 2I79A 2FCKA 2G3TA 3P2HA 4U9YA 3DSBA 1YGHA 2CNTA 2J8NA 4XNHB 4II9A 1S5KA 3R9EA 4UWIA 3E0KA 2R98A 3TO7A 4Y49B 1P0HA 3TOBA 3S6GA 2R8VA 1YLEA 1TIQA 3CXQA 1XIXA 1IB1E 2CNSA 3I3GA 2OZGA 4JD6A 5E96A 1RXTA 3GKRA 1BOBA 1MK4A 3TO6A 2PRBA 2P0WA 3TCVA 4KOVA 4EVYA 1K4JA 2FIAA 1PU9A 3T90A 5J8FA 4JJXA 4HKFA 3R9FA 4OADA 1M1DA 4NF1A 3QAHA 4MHDA 2PSWA 2REEA 2QMLA 1M4GA 3TO9A 4YFJA 4B5OA 1XF8A 1XMTA 2BUEA 3R95A 3FB3A 4MY3A 2BSWA 1RO5A 4MBUA 1IYKA 4PSXA 5H86A 3F8KA 2H5MA 3IWGA 2G3AA 4GS4A 1Y9WA 2AJ6A 1S7FA 2ARHA 4IUSA 5F47A 3BLNA 1MJAA 3W6XA 3B8GA 2JLMA 2DXQA 3QB8A 5CNPA 2FT0A 4AVCA 2CNMA 3RYOA 1V0CA 2ATRA 3CXSA 5JPHA 1KUYA 4KOWA 4KVXA 4E8OA 3SHPA 1I1DA 3LD2A 2RC4A 5ISVA 4JXRA 2O28A 4ZBGA 2IL4A 3GYAA 4KLVA 4R57A 4UBRA 1I21A 4F0YA 3FBUA 4QB9A 1IIDA 2G0BA 4KVME 3D2MA 4U9ZA 4B5PB 2FS5A 2VI7A 4AG9A 2Q44A 5HMNA 4FD4A 2GANA 1Q2YA 3PP9A 4JLYA 1VHSA 4R3KA 2J8RA 1KZFA 4AB7A 2PC1A 2X7BA 1PUAA 2Q04A 3ZZIA 3T9YA 5KTCA 3S6HA 1XE4A 4E2AA 2B4DB 3FNCA 2OZHA 5DWMA 4F6AA 3DNSA 1LRZA 5HH1A 4CAVA 3TT2A 3R96A 1WWZA 4KOXA 4QBJA 4JXQA 2FE7A 2GIVA 3I9SA 3PZJA 5EBVA 5C82A 4ONUA 4KORA 4KVOE 3JVNA 3S6FA 5KTAA 1Q2DA 3EXNA 1B6BA 2Q7BA 4YGOA 1S3ZA 2JEVA 4XPKA 2P6EA 4L8AA 2OZUA 2B3UA 2C27A 2EVNA 2PDOA 4QUSA 1Z9UA 5EC4A 3R9GA 5IV0A 3UY5A 2EUIA 2ZXVA 5J8CA 4RS2A 5F49A 3C26A 4JWPA 1R57A 1YVKA 4PK3A 4QC6A 4R3LA 3SXOA 3K9UA 4KZTA
chains in the Genus database with same CATH superfamily
3KL9A 3VH9A 3D67A 2ZELA 5IB9A 2F5IA 5JQ4A 3DDDA 3FMCA 4HPSA 1U6MA 1QSNA 3IIBA 4AVAA 1Y0RA 4M85A 4NSQA 4ORFA 4CRYB 1IU8A 2WYRA 4XPLA 1LAMA 2PIYA 2AFZA 1XEBA 4UCNA 4DNCA 1QQ9A 5FVJA 5HXDA 5JGFA 3WABA 2ZOGA 3H8FA 5LYFA 4KLWA 6CPAA 2BCOA 2AFUA 4B14A 4PXDA 2PR8A 4HNXB 3SI2A 4DUKA 1XFOA 4B5PA 3JRUA 1IICA 2EK8A 5LYIA 1X10A 3F0AA 3CT9A 3FEDA 1FT7A 5AG5A 4A30A 4H6UA 4B13A 1PCAA 2REFA 2WPXA 4MCRA 5EMIA 2PCUA 4UCPA 4CGPA 4KOUA 4MI4A 3FVLA 2JDDA 1CJWA 2A4NA 4KSIA 5F09A 4ZY1A 2VXKA 3F5BA 3IFEA 4KS9A 4AG7A 3K2KA 4UIAA 4YRHA 4FD6A 4CYOA 2WPWA 1RTQA 3RBUA 2CTBA 4PQAA 1YVOA 2CY2A 3RO0A 3TFYA 4EMEA 4ZY2A 3D7GA 4A38A 1NSLA 5LRJA 4BINA 1L0CA 1MJBA 2B4DA 5A27A 1XJOA 5THWA 2PQ8A 1R43A 4MY0A 4PXBA 2D4PA 1VHOA 2PJ5A 5H84A 3B3WA 1R3NA 3PGPA 2OB0A 1I12A 2FXFA 4FBEA 2FL4A 4KSAA 1OBRA 2FIWA 5F48A 1NE9A 2AFWA 2D4OA 2B4BA 3LODA 2R7HA 4OLLA 4PV6A 3JTKA 4LQGA 1S7NA 4HNYB 3GB0A 4ZI6A 4Q38A 1F57A 2J8MA 4MMOA 1S7KA 3LWUA 2ZW4A 3H5ZA 4I49A 3HLPA 4KOTA 3WR7A 1XOVA 1GHEA 3VWDA 2WSAA 3VATA 4P4FA 3V38A 2I00A 4Z65A 2V77A 2VZZA 4YU9A 2P6FA 3FYNA 1M4IA 1MJ9A 3OWCA 5DWNA 2O4HA 4UEFA 2RFHA 1CP6A 3PB4X 1AUGA 4HNWB 3NH4A 1CPSA 4CRZB 4DYOA 2JDCA 3CZXA 1VIXA 2HC9A 1QSTA 4CAWA 2QYVA 1F2PA 2AFOA 2ZW6A 4NEXA 1Z5RA 4E0AA 3V8IA 2PIZA 4NGRA 2Z11A 1DTDA 2Z3KA 1LCPA 1J4JA 2Z3PA 3GUXA 4NJRA 2P6GA 2XEFA 4MFPA 4NGTA 4R8FA 4WJBA 5DS0A 3NH8A 2VEZA 2AE6A 2Z3OA 4LQ6A 2PJ4A 4CGLA 5CBMA 4B11A 1N71A 2GE3A 4MFJA 3FIXA 2BL1A 2B5GB 5JH9A 2OH1A 1ZLIA 1LFWA 1IOIA 5G21A 4MXUA 4B10A 1IOFA 1Z8LA 2HUZA 4FD7A 4C2ZA 2F8HA 3DR6A 2ZEDA 4LUAA 1UFHA 1M4DA 4P44A 4MJ8A 1XBUA 3GY9A 2Y0MA 4QVTA 3VWEA 3EY5A 3IGRA 4PSWA 4UWJA 1WK4A 3G8WA 4MRIA 1KUXA 2O53A 3DR8A 1OZPA 1BPMA 3BJ7A 3FX6A 4F0XA 1IYLA 2ZEPA 4KOSA 1XRYA 3NE8A 4NCZA 4OC2A 3FXTA 4C7HA 4KOYA 4MFKA 2Q4VA 3WT4A 1FNOA 3KHZA 5G20A 5LRKA 3ZJ0A 3TTHA 4UA3A 2V8DA 3IC1A 3BI1A 5D8NA 1HDUA 5I0CA 2Q7SA 4BBHA 3B3SA 2VQYA 2AFXA 2PJ1A 4CAXA 3B35A 1B87A 1SQHA 2ZEFA 3QAYA 3H4QA 4ONWA 3PFEA 2HQYA 2YNCC 3RNZA 4EFDA 2C6GA 2NMTA 3EO4A 1CX8A 3D8PA 2YGWA 2B3VA 1QSMA 1ELLP 4K30A 1FY7A 1GYTA 1Y7RA 3EC4A 2ZEOA 2DPTA 1YX0A 4XNHC 1KUVA 2K5TA 1QSOA 2OU2A 3FF3A 3T8WA 3SJXA 3PB9X 2VZYA 2QECA 2PVVA 4OAEA 4W9YA 4KUAA 3I1UA 3V7ZA 2ZENA 3A9LA 5LRGA 4Y49C 4KUBA 4M3SA 5AGEA 3JUWA 1Z8WA 2BEIA 4IHMA 2PJAA 1Y9KA 3BXMA 4B6ZA 5K8PA 1BPNA 3S6KA 4NGMA 3FRMA 3KKWA 1ELMP 8CPAA 3LACA 1YSJA 3D7DA 4UFWA 2QIRA 2Z3NA 4X2TA 1P4NA 2C6CA 3BJ8A 4CAEA 2V8GA 1S60A 5GCNA 4X3RA 1TF8A 2GREA 1CG2A 2EWBA 1CBXA 1M44A 2VBQA 4BMHA 4H6ZA 5AG4A 1PYTB 2FSRA 1BO4A 3BI0A 4JYWA 4CYPA 2ZW7A 4L89A 1IGBA 3FH4A 3D3SA 1Q2CA 2V8HA 4NGNA 5D29A 3MGDA 4AXVA 4Q36A 4XPDB 1NMTA 2PR1A 5ELYA 5C88A 2CIJA 4F8ZA 4J3GA 4UEEA 1VKCA 1ZG8A 2Z10A 2Q4ZA 5K8OA 2GU2A 4MFLA 3EFAA 1ZG7A 3W91A 1CM0A 4AVBA 4R87A 3DGVA 5CPAA 3WC6A 4MHYA 2CF4A 2PJBA 3G3SA 4A39A 4CYQA 2B58A 5HVHA 4U5YA 4LX9A 4PK2A 3PB8X 4OMEA 3NE7A 2Z0ZA 1S7LA 4MHZA 5IX3A 1ZLHA 3CPXA 4CS0B 4RN7A 5K8NA 1TF9A 3B3VA 4RI1A 2Q0YA 4X5KA 3P2FA 5IB0A 3IWWA 2EBJA 2B5GA 2YNCA 3NH5A 4JZ0A 3CDXA 1YREA 3MRUA 3R1KA 2HV2A 2Q4YA 1AYEA 2KCWA 4IF5A 1YK3A 5HVFA 1ON0A 2JBKA 4EWTA 2AFSA 4H89A 5I4MA 1YR0A 2ZW5A 3TC8A 4C68A 1JQGA 1QSRA 2IMOA 4KSFA 3LMSA 3PEIA 4MCPA 2ZPAA 3CXPA 4XPDC 3DLJA 4C7IA 2ODFA 2Q43A 1H8LA 3BHXA 3PFOA 2XEJA 3TE4A 4FAIA 3SXNA 4FD5A 2CTCA 3N7ZA 4X8IA 4DJLA 4R9MA 4R6TA 5F46A 1AMPA 1Z4EA 3TOAA 5KTDA 1Y0YA 3D2PA 4NXYA 3PBEA 1Z4RA 4K3NA 2R1IA 4OC1A 3W6SA 3KR5A 3PRTA 2I79A 2FCKA 3IEHA 4MFZA 2G9DA 2G3TA 3QNVA 4FWUA 3P2HA 3S9NA 4B12A 4U9YA 3DSBA 2DEAA 2GLFA 1YGHA 4NGPA 1Q7LA 4NGSA 3SI1A 1Z2LA 2CNTA 2J8NA 3SI0A 3KGQA 4P6YA 5G22A 1ARMA 4RUHA 3B2YA 4XNHB 4II9A 1S5KA 3MN8A 3R9EA 4CGMA 4UWIA 3E0KA 4UCMA 2ZEGA 2R98A 3TO7A 4MHNA 4NJQA 3KI9A 4Y49B 1P0HA 1Z8TA 3TOBA 5AG7A 4MCQA 2PJ7A 3S6GA 3N5FA 3SJEA 2R8VA 2ZEMA 5K8MA 4MHPA 4OP4A 1YLEA 1TIQA 3CXQA 5HVGA 1M4LA 4Q7AA 4ZX9A 1XIXA 2ABZA 2OR4A 1IB1E 2CNSA 3FEEA 3I3GA 2OZGA 1CPXA 4TNUA 4JD6A 5E96A 3HUVA 2JEWA 1QMUA 2PVWA 1RXTA 1YW4A 3GKRA 1LOKA 1BOBA 1MK4A 3NFZA 4OC0A 3TO6A 2NYQA 2PRBA 2P0WA 3TCVA 4KOVA 4EVYA 4GXHA 1K4JA 2DF5A 3KZWA 4M6HA 4P10A 2FIAA 2XEIA 4CGOA 2EK9A 1PU9A 3T90A 2GLJA 3H8EA 5J8FA 1ZO0A 4JJXA 4HKFA 3R9FA 4OADA 2PJ6A 2RB7A 3K9TA 3KQXA 1M1DA 2F7VA 1NSAA 1TXRA 4NF1A 2C1CA 4R76A 4NFRA 3QAHA 4IAVA 3B3CA 3CPAA 4M6GA 4MHDA 4UF4A 2PSWA 3GIUA 2REEA 3H8GA 3IU2A 1X12A 2EO8A 2QMLA 4P45A 1M4GA 3TO9A 2WUUA 4P4DA 3B7IA 4YFJA 5A28A 4B5OA 1XF8A 1XMTA 1TKFA 2FVGA 2BUEA 3R95A 3FB3A 4MY3A 4MFQA 4OIDA 2BSWA 4CYNA 1RO5A 4MBUA 2BOAA 1YMEA 1IYKA 4PSXA 1LANA 5H86A 2H5MA 3F8KA 3IWGA 4UEZA 2PJ8A 2G3AA 4GS4A 2JBJA 4M6IA 1Y9WA 2AJ6A 1S7FA 2ARHA 4IUSA 5F47A 1Y7EA 2ZEEA 3BLNA 1MJAA 3FJUA 1A2ZA 3D68A 2PJ3A 1TKHA 3W6XA 2DPSA 4NGQA 3B8GA 4A33A 2JLMA 2DXQA 2PJ0A 4PXEA 3QB8A 5CNPA 2FT0A 3PB6X 4KZTA 4AVCA 2ZEHA 4WWVA 5AG6A 4YWYA 2CNMA 2XEGA 4FUUA 3RYOA 1V0CA 4A95A 5IV0A 2ATRA 3CXSA 5JPHA 3SJFA 7CPAA 1KUYA 4KOWA 1YLOA 4KVXA 4E8OA 3SHPA 1I1DA 3LD2A 1EE3P 2RC4A 3D4UA 3ISXA 3WC7A 5J1QA 4ZYQA 4CGNA 3FECA 5LYDA 5ISVA 3S9MA 2NSMA 2O28A 4JXRA 2CXAA 4OC4A 1ZG9A 3PB7X 4ZBGA 2IL4A 3GYAA 4KLVA 4R57A 4UBRA 1XMBA 3B3TA 4CPAA 1DE4C 1I21A 3TX8A 4BD9A 4F0YA 3FBUA 4QB9A 2IJZA 1HEEA 2PJ2A 2Z3MA 1IIDA 2G0BA 4KVME 1KWMA 3D2MA 4U9ZA 4B5PB 2FS5A 2VI7A 4AG9A 3IJ3A 2Q44A 1BAVA 1BLLE 2WZNA 5HMNA 4FD4A 2C6PA 4OC5A 2GANA 1HDQA 1VHEA 1Q2YA 2V8VA 3PP9A 3KQZA 4A31A 4C2YA 4UFVA 2YNEA 4JLYA 4A94A 1VHSA 2HB6A 4R3KA 3RAMA 2J8RA 1KZFA 3IU1A 4AB7A 2PC1A 2X7BA 1PUAA 1YW6A 2Q04A 3IWEA 3T9YA 3ZZIA 5LYLA 3S9LA 4TWEA 3WC5A 5KTCA 3S6HA 5BWAB 2PJ9A 4UIBA 1XE4A 4OKOA 4ZX8A 1JWQA 4E2AA 1VGYA 2B4DB 1CP7A 4OIWA 2GFQA 2YNDA 2BO9A 3FNCA 4P4JA 3RZAA 4OC3A 2OZHA 2PJCA 5DWMA 2Q51A 4F6AA 2ANPA 3DNSA 4CAFA 1LRZA 5HH1A 1YQEA 3D66A 4CAVA 4MCSA 3TT2A 3R96A 5JM6A 1WWZA 4KOXA 4P4BA 4QBJA 4JXQA 2FE7A 2GIVA 3I9SA 3PZJA 5EBVA 5G1ZA 4ONUA 5C82A 1TKJA 4A32A 4KORA 1ARLA 4KVOE 4ZY0A 2AFMA 3L2NA 3D7HA 3KR4A 3JVNA 1F2OA 2OOTA 3SJGA 4P4EA 4F9UA 4A2ZA 2IQ6A 3S6FA 4GM5A 1Q2DA 3EXNA 5KTAA 1B6BA 4P4IA 2Q7BA 3VARA 1UWYA 4A37A 3NA6A 2POKA 4YGOA 2Z3LA 2PRQA 2I3CA 3D7FA 4G1PA 2ZOFA 1S3ZA 2JEVA 4R7MA 3PBBA 4XPKA 4H2KA 2P6EA 4L8AA 2OZUA 2B3UA 2C27A 2EVNA 2PDOA 3ISZA 1Z9UA 4QUSA 4UFXA 5EC4A 3R9GA 4F9VA 2J9AA 3UY5A 2EUIA 2ZXVA 5J8CA 4RS2A 1IY7A 3KHXA 5F49A 1LAPA 2PE3A 2VL1A 2QJ8A 3C26A 4JWPA 1R57A 1YVKA 4PK3A 4QC6A 4R3LA 4IK2A 4PPZA 4ZGYB 3SXOA 3KASA 1Z8XA 4PXCA 4O23A 3K9UA 2QVPA 3IO1A 3GLJA 4C2XA
chains in the Genus database with same CATH topology
5JQ4A 2F5IA 3DDDA 1U6MA 1QSNA 4AVAA 4M85A 4NSQA 4ORFA 4CRYB 4XPLA 1XEBA 4UCNA 4DNCA 5FVJA 4KLWA 4B14A 2PR8A 4HNXB 4B5PA 1IICA 3F0AA 5AG5A 4B13A 4A30A 4H6UA 2REFA 2WPXA 4UCPA 4CGPA 4KOUA 4MI4A 2JDDA 1CJWA 2A4NA 2VXKA 3F5BA 4KS9A 4AG7A 4YRHA 4CYOA 4FD6A 2WPWA 1YVOA 2CY2A 3TFYA 1NSLA 1L0CA 1MJBA 2B4DA 5A27A 2PQ8A 4MY0A 2D4PA 3PGPA 2OB0A 1I12A 2FXFA 2FL4A 4KSAA 5F48A 2FIWA 1NE9A 2D4OA 2B4BA 3LODA 2R7HA 4OLLA 4PV6A 3JTKA 1S7NA 4HNYB 4Q38A 2J8MA 1S7KA 2ZW4A 3H5ZA 4I49A 3WR7A 4KOTA 1GHEA 3VWDA 2WSAA 2I00A 2VZZA 2P6FA 3FYNA 1M4IA 1MJ9A 3OWCA 5DWNA 4HNWB 4CRZB 2JDCA 1QSTA 4CAWA 2ZW6A 4NEXA 4E0AA 3V8IA 2Z11A 2Z3KA 1J4JA 2Z3PA 5H84A 2P6GA 4MFPA 2VEZA 2AE6A 2Z3OA 4CGLA 4B11A 1N71A 2GE3A 4MFJA 3FIXA 2BL1A 2B5GB 2OH1A 5G21A 4B10A 4FD7A 4C2ZA 2HUZA 3DR6A 4LUAA 1UFHA 1M4DA 4MJ8A 3GY9A 2Y0MA 4QVTA 3VWEA 3EY5A 3IGRA 4PSWA 4UWJA 1WK4A 3G8WA 1KUXA 3DR8A 3BJ7A 1OZPA 4F0XA 1IYLA 4KOSA 4NCZA 3FXTA 4C7HA 4KOYA 4MFKA 2Q4VA 5G20A 3ZJ0A 3TTHA 4UA3A 5I0CA 4BBHA 2VQYA 4CAXA 1B87A 1SQHA 3H4QA 2HQYA 2YNCC 2NMTA 3EO4A 3D8PA 2YGWA 2B3VA 1QSMA 4K30A 1FY7A 1Y7RA 3EC4A 2DPTA 1YX0A 4XNHC 1KUVA 2K5TA 1QSOA 2OU2A 2VZYA 2QECA 4OAEA 4KUAA 3A9LA 4Y49C 4KUBA 4M3SA 5AGEA 3JUWA 2BEIA 1Y9KA 3S6KA 3FRMA 3KKWA 4UFWA 2QIRA 2Z3NA 1P4NA 3BJ8A 4CAEA 1S60A 5GCNA 5AG4A 1M44A 2VBQA 4BMHA 4H6ZA 2FSRA 1BO4A 4CYPA 2ZW7A 4L89A 3D3SA 1Q2CA 3MGDA 4Q36A 4XPDB 1NMTA 2PR1A 5C88A 4J3GA 1VKCA 2Z10A 4MFLA 3EFAA 3W91A 1CM0A 4AVBA 4R87A 3G3SA 4CYQA 2B58A 4U5YA 4LX9A 4PK2A 3NE7A 2Z0ZA 1S7LA 5IX3A 4CS0B 4RI1A 2Q0YA 4X5KA 3P2FA 5IB0A 2B5GA 2YNCA 1YREA 3R1KA 2HV2A 2Q4YA 2KCWA 4IF5A 1YK3A 1ON0A 4H89A 1YR0A 2ZW5A 4C68A 1QSRA 4KSFA 4XPDC 2ZPAA 3CXPA 4C7IA 3TE4A 3SXNA 4FD5A 3N7ZA 5F46A 4R9MA 1Z4EA 3TOAA 5KTDA 3D2PA 4NXYA 1Z4RA 2R1IA 3W6SA 2I79A 2FCKA 4MFZA 2G3TA 3P2HA 4B12A 4U9YA 3DSBA 1YGHA 2CNTA 2J8NA 5G22A 4XNHB 4II9A 1S5KA 3R9EA 4CGMA 4UWIA 3E0KA 4UCMA 2R98A 3TO7A 4Y49B 1P0HA 3TOBA 5AG7A 3S6GA 2R8VA 1YLEA 1TIQA 3CXQA 1XIXA 1IB1E 2CNSA 3I3GA 2OZGA 4JD6A 5E96A 1RXTA 3GKRA 1BOBA 1MK4A 3TO6A 2PRBA 2P0WA 3TCVA 4KOVA 4EVYA 1K4JA 2FIAA 4CGOA 1PU9A 3T90A 5J8FA 1ZO0A 4JJXA 4HKFA 3R9FA 4OADA 1M1DA 4NF1A 3QAHA 4MHDA 2PSWA 2REEA 3IU2A 2QMLA 1M4GA 3TO9A 2WUUA 4YFJA 5A28A 4B5OA 1XF8A 1XMTA 2BUEA 3R95A 3FB3A 4MY3A 4MFQA 2BSWA 4CYNA 1RO5A 4MBUA 1IYKA 4PSXA 5H86A 3F8KA 2H5MA 3IWGA 2G3AA 4GS4A 1Y9WA 2AJ6A 1S7FA 2ARHA 4IUSA 5F47A 3BLNA 1MJAA 3W6XA 2DPSA 3B8GA 4A33A 2JLMA 2DXQA 3QB8A 5CNPA 2FT0A 4AVCA 5AG6A 2CNMA 3RYOA 1V0CA 4A95A 2ATRA 3CXSA 5JPHA 1KUYA 4KOWA 4KVXA 4E8OA 3SHPA 1I1DA 3LD2A 2RC4A 4CGNA 5ISVA 4JXRA 2O28A 2CXAA 4ZBGA 2IL4A 3GYAA 4KLVA 4R57A 4UBRA 1I21A 4F0YA 3FBUA 4QB9A 2Z3MA 1IIDA 2G0BA 4KVME 3D2MA 4U9ZA 4B5PB 2FS5A 2VI7A 4AG9A 2Q44A 5HMNA 4FD4A 2GANA 1Q2YA 3PP9A 4A31A 4C2YA 4UFVA 2YNEA 4JLYA 1VHSA 4R3KA 2J8RA 1KZFA 3IU1A 4AB7A 2PC1A 2X7BA 1PUAA 2Q04A 3IWEA 3T9YA 3ZZIA 5KTCA 3S6HA 5BWAB 1XE4A 4E2AA 2B4DB 2YNDA 3FNCA 2OZHA 5DWMA 4F6AA 3DNSA 4CAFA 1LRZA 5HH1A 4CAVA 3TT2A 3R96A 1WWZA 4KOXA 4QBJA 4JXQA 2FE7A 2GIVA 3I9SA 3PZJA 5EBVA 5G1ZA 4ONUA 5C82A 4A32A 4KORA 4KVOE 3JVNA 4A2ZA 3S6FA 5KTAA 1Q2DA 3EXNA 1B6BA 2Q7BA 4YGOA 2Z3LA 1S3ZA 2JEVA 4XPKA 2P6EA 4L8AA 2OZUA 2B3UA 2C27A 2EVNA 2PDOA 4QUSA 1Z9UA 4UFXA 5EC4A 3R9GA 5IV0A 3UY5A 2EUIA 2ZXVA 5J8CA 4RS2A 5F49A 3C26A 4JWPA 1R57A 1YVKA 4PK3A 4QC6A 4R3LA 4ZGYB 3SXOA 3K9UA 4KZTA 4C2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JQ4 A;  2F5I A;  3DDD A;  1U6M A;  1QSN A;  4AVA A;  4M85 A;  4NSQ A;  4ORF A;  4CRY B;  4XPL A;  1XEB A;  4DNC A;  5FVJ A;  4KLW A;  2PR8 A;  4HNX B;  4B5P A;  1IIC A;  3F0A A;  4H6U A;  2REF A;  2WPX A;  4KOU A;  4MI4 A;  2JDD A;  1CJW A;  2A4N A;  2VXK A;  3F5B A;  4AG7 A;  4YRH A;  4FD6 A;  2WPW A;  1YVO A;  2CY2 A;  3TFY A;  1NSL A;  1L0C A;  1MJB A;  2B4D A;  2PQ8 A;  4MY0 A;  2D4P A;  3PGP A;  2OB0 A;  1I12 A;  2FXF A;  2FL4 A;  5F48 A;  2FIW A;  1NE9 A;  2D4O A;  2B4B A;  3LOD A;  2R7H A;  4OLL A;  4PV6 A;  1S7N A;  4HNY B;  2J8M A;  1S7K A;  2ZW4 A;  4I49 A;  3WR7 A;  4KOT A;  1GHE A;  3VWD A;  2I00 A;  2VZZ A;  2P6F A;  3FYN A;  1M4I A;  1MJ9 A;  3OWC A;  5DWN A;  4HNW B;  4CRZ B;  2JDC A;  1QST A;  4CAW A;  2ZW6 A;  4NEX A;  4E0A A;  3V8I A;  2Z11 A;  1J4J A;  5H84 A;  2P6G A;  2VEZ A;  2AE6 A;  1N71 A;  2GE3 A;  3FIX A;  2BL1 A;  2B5G B;  2OH1 A;  4FD7 A;  2HUZ A;  3DR6 A;  4LUA A;  1UFH A;  1M4D A;  4MJ8 A;  3GY9 A;  2Y0M A;  4QVT A;  3VWE A;  3EY5 A;  3IGR A;  4PSW A;  4UWJ A;  1WK4 A;  3G8W A;  1KUX A;  3DR8 A;  3BJ7 A;  1OZP A;  1IYL A;  4KOS A;  4NCZ A;  3FXT A;  4KOY A;  2Q4V A;  3ZJ0 A;  3TTH A;  4UA3 A;  5I0C A;  2VQY A;  4CAX A;  1B87 A;  1SQH A;  3H4Q A;  2HQY A;  2NMT A;  3EO4 A;  3D8P A;  2B3V A;  1QSM A;  4K30 A;  1FY7 A;  1Y7R A;  3EC4 A;  1YX0 A;  4XNH C;  1KUV A;  2K5T A;  1QSO A;  2OU2 A;  2VZY A;  2QEC A;  4OAE A;  4KUA A;  4Y49 C;  4KUB A;  4M3S A;  3JUW A;  2BEI A;  1Y9K A;  3S6K A;  3FRM A;  3KKW A;  2QIR A;  1P4N A;  3BJ8 A;  1S60 A;  5GCN A;  1M44 A;  2VBQ A;  4BMH A;  4H6Z A;  2FSR A;  1BO4 A;  2ZW7 A;  4L89 A;  3D3S A;  1Q2C A;  3MGD A;  4XPD B;  1NMT A;  2PR1 A;  5C88 A;  4J3G A;  1VKC A;  2Z10 A;  3EFA A;  3W91 A;  1CM0 A;  4AVB A;  4R87 A;  3G3S A;  2B58 A;  4U5Y A;  4LX9 A;  4PK2 A;  3NE7 A;  2Z0Z A;  1S7L A;  5IX3 A;  4CS0 B;  4RI1 A;  2Q0Y A;  4X5K A;  3P2F A;  5IB0 A;  2B5G A;  1YRE A;  3R1K A;  2HV2 A;  2Q4Y A;  2KCW A;  4IF5 A;  1YK3 A;  1ON0 A;  4H89 A;  1YR0 A;  2ZW5 A;  1QSR A;  4XPD C;  2ZPA A;  3CXP A;  3TE4 A;  3SXN A;  4FD5 A;  3N7Z A;  5F46 A;  4R9M A;  1Z4E A;  3TOA A;  5KTD A;  3D2P A;  4NXY A;  1Z4R A;  2R1I A;  3W6S A;  2I79 A;  2FCK A;  2G3T A;  3P2H A;  4U9Y A;  3DSB A;  1YGH A;  2CNT A;  2J8N A;  4XNH B;  4II9 A;  1S5K A;  3R9E A;  4UWI A;  3E0K A;  2R98 A;  3TO7 A;  4Y49 B;  1P0H A;  3TOB A;  3S6G A;  2R8V A;  1YLE A;  1TIQ A;  3CXQ A;  1XIX A;  1IB1 E;  2CNS A;  3I3G A;  2OZG A;  4JD6 A;  5E96 A;  1RXT A;  3GKR A;  1BOB A;  1MK4 A;  3TO6 A;  2PRB A;  2P0W A;  3TCV A;  4KOV A;  4EVY A;  1K4J A;  2FIA A;  1PU9 A;  3T90 A;  5J8F A;  4JJX A;  4HKF A;  3R9F A;  4OAD A;  1M1D A;  4NF1 A;  3QAH A;  4MHD A;  2PSW A;  2REE A;  2QML A;  1M4G A;  3TO9 A;  4YFJ A;  4B5O A;  1XF8 A;  1XMT A;  2BUE A;  3R95 A;  3FB3 A;  4MY3 A;  2BSW A;  1RO5 A;  4MBU A;  1IYK A;  4PSX A;  5H86 A;  3F8K A;  2H5M A;  3IWG A;  2G3A A;  4GS4 A;  1Y9W A;  2AJ6 A;  1S7F A;  2ARH A;  4IUS A;  5F47 A;  3BLN A;  1MJA A;  3W6X A;  3B8G A;  2JLM A;  2DXQ A;  3QB8 A;  5CNP A;  2FT0 A;  4AVC A;  2CNM A;  3RYO A;  1V0C A;  2ATR A;  3CXS A;  5JPH A;  1KUY A;  4KOW A;  4KVX A;  4E8O A;  3SHP A;  1I1D A;  3LD2 A;  2RC4 A;  5ISV A;  4JXR A;  2O28 A;  4ZBG A;  2IL4 A;  3GYA A;  4KLV A;  4R57 A;  4UBR A;  1I21 A;  4F0Y A;  3FBU A;  4QB9 A;  1IID A;  2G0B A;  4KVM E;  3D2M A;  4U9Z A;  4B5P B;  2FS5 A;  2VI7 A;  4AG9 A;  2Q44 A;  5HMN A;  4FD4 A;  2GAN A;  1Q2Y A;  3PP9 A;  4JLY A;  1VHS A;  4R3K A;  2J8R A;  1KZF A;  4AB7 A;  2PC1 A;  2X7B A;  1PUA A;  2Q04 A;  3ZZI A;  3T9Y A;  5KTC A;  3S6H A;  1XE4 A;  4E2A A;  2B4D B;  3FNC A;  2OZH A;  5DWM A;  4F6A A;  3DNS A;  1LRZ A;  5HH1 A;  4CAV A;  3TT2 A;  3R96 A;  1WWZ A;  4KOX A;  4QBJ A;  4JXQ A;  2FE7 A;  2GIV A;  3I9S A;  3PZJ A;  5EBV A;  5C82 A;  4ONU A;  4KOR A;  4KVO E;  3JVN A;  3S6F A;  5KTA A;  1Q2D A;  3EXN A;  1B6B A;  2Q7B A;  4YGO A;  1S3Z A;  2JEV A;  4XPK A;  2P6E A;  4L8A A;  2OZU A;  2B3U A;  2C27 A;  2EVN A;  2PDO A;  4QUS A;  1Z9U A;  5EC4 A;  3R9G A;  5IV0 A;  3UY5 A;  2EUI A;  2ZXV A;  5J8C A;  4RS2 A;  5F49 A;  3C26 A;  4JWP A;  1R57 A;  1YVK A;  4PK3 A;  4QC6 A;  4R3L A;  3SXO A;  3K9U A;  4KZT A; 
#chains in the Genus database with same CATH topology
 3KL9 A;  3VH9 A;  3D67 A;  2ZEL A;  5IB9 A;  2F5I A;  5JQ4 A;  3DDD A;  3FMC A;  4HPS A;  1U6M A;  1QSN A;  3IIB A;  4AVA A;  1Y0R A;  4M85 A;  4NSQ A;  4ORF A;  4CRY B;  1IU8 A;  2WYR A;  4XPL A;  1LAM A;  2PIY A;  2AFZ A;  1XEB A;  4UCN A;  4DNC A;  1QQ9 A;  5FVJ A;  5HXD A;  5JGF A;  3WAB A;  2ZOG A;  3H8F A;  5LYF A;  4KLW A;  6CPA A;  2BCO A;  2AFU A;  4B14 A;  4PXD A;  2PR8 A;  4HNX B;  3SI2 A;  4DUK A;  1XFO A;  4B5P A;  3JRU A;  1IIC A;  2EK8 A;  5LYI A;  1X10 A;  3F0A A;  3CT9 A;  3FED A;  1FT7 A;  5AG5 A;  4A30 A;  4H6U A;  4B13 A;  1PCA A;  2REF A;  2WPX A;  4MCR A;  5EMI A;  2PCU A;  4UCP A;  4CGP A;  4KOU A;  4MI4 A;  3FVL A;  2JDD A;  1CJW A;  2A4N A;  4KSI A;  5F09 A;  4ZY1 A;  2VXK A;  3F5B A;  3IFE A;  4KS9 A;  4AG7 A;  3K2K A;  4UIA A;  4YRH A;  4FD6 A;  4CYO A;  2WPW A;  1RTQ A;  3RBU A;  2CTB A;  4PQA A;  1YVO A;  2CY2 A;  3RO0 A;  3TFY A;  4EME A;  4ZY2 A;  3D7G A;  4A38 A;  1NSL A;  5LRJ A;  4BIN A;  1L0C A;  1MJB A;  2B4D A;  5A27 A;  1XJO A;  5THW A;  2PQ8 A;  1R43 A;  4MY0 A;  4PXB A;  2D4P A;  1VHO A;  2PJ5 A;  5H84 A;  3B3W A;  1R3N A;  3PGP A;  2OB0 A;  1I12 A;  2FXF A;  4FBE A;  2FL4 A;  4KSA A;  1OBR A;  2FIW A;  5F48 A;  1NE9 A;  2AFW A;  2D4O A;  2B4B A;  3LOD A;  2R7H A;  4OLL A;  4PV6 A;  3JTK A;  4LQG A;  1S7N A;  4HNY B;  3GB0 A;  4ZI6 A;  4Q38 A;  1F57 A;  2J8M A;  4MMO A;  1S7K A;  3LWU A;  2ZW4 A;  3H5Z A;  4I49 A;  3HLP A;  4KOT A;  3WR7 A;  1XOV A;  1GHE A;  3VWD A;  2WSA A;  3VAT A;  4P4F A;  3V38 A;  2I00 A;  4Z65 A;  2V77 A;  2VZZ A;  4YU9 A;  2P6F A;  3FYN A;  1M4I A;  1MJ9 A;  3OWC A;  5DWN A;  2O4H A;  4UEF A;  2RFH A;  1CP6 A;  3PB4 X;  1AUG A;  4HNW B;  3NH4 A;  1CPS A;  4CRZ B;  4DYO A;  2JDC A;  3CZX A;  1VIX A;  2HC9 A;  1QST A;  4CAW A;  2QYV A;  1F2P A;  2AFO A;  2ZW6 A;  4NEX A;  1Z5R A;  4E0A A;  3V8I A;  2PIZ A;  4NGR A;  2Z11 A;  1DTD A;  2Z3K A;  1LCP A;  1J4J A;  2Z3P A;  3GUX A;  4NJR A;  2P6G A;  2XEF A;  4MFP A;  4NGT A;  4R8F A;  4WJB A;  5DS0 A;  3NH8 A;  2VEZ A;  2AE6 A;  2Z3O A;  4LQ6 A;  2PJ4 A;  4CGL A;  5CBM A;  4B11 A;  1N71 A;  2GE3 A;  4MFJ A;  3FIX A;  2BL1 A;  2B5G B;  5JH9 A;  2OH1 A;  1ZLI A;  1LFW A;  1IOI A;  5G21 A;  4MXU A;  4B10 A;  1IOF A;  1Z8L A;  2HUZ A;  4FD7 A;  4C2Z A;  2F8H A;  3DR6 A;  2ZED A;  4LUA A;  1UFH A;  1M4D A;  4P44 A;  4MJ8 A;  1XBU A;  3GY9 A;  2Y0M A;  4QVT A;  3VWE A;  3EY5 A;  3IGR A;  4PSW A;  4UWJ A;  1WK4 A;  3G8W A;  4MRI A;  1KUX A;  2O53 A;  3DR8 A;  1OZP A;  1BPM A;  3BJ7 A;  3FX6 A;  4F0X A;  1IYL A;  2ZEP A;  4KOS A;  1XRY A;  3NE8 A;  4NCZ A;  4OC2 A;  3FXT A;  4C7H A;  4KOY A;  4MFK A;  2Q4V A;  3WT4 A;  1FNO A;  3KHZ A;  5G20 A;  5LRK A;  3ZJ0 A;  3TTH A;  4UA3 A;  2V8D A;  3IC1 A;  3BI1 A;  5D8N A;  1HDU A;  5I0C A;  2Q7S A;  4BBH A;  3B3S A;  2VQY A;  2AFX A;  2PJ1 A;  4CAX A;  3B35 A;  1B87 A;  1SQH A;  2ZEF A;  3QAY A;  3H4Q A;  4ONW A;  3PFE A;  2HQY A;  2YNC C;  3RNZ A;  4EFD A;  2C6G A;  2NMT A;  3EO4 A;  1CX8 A;  3D8P A;  2YGW A;  2B3V A;  1QSM A;  1ELL P;  4K30 A;  1FY7 A;  1GYT A;  1Y7R A;  3EC4 A;  2ZEO A;  2DPT A;  1YX0 A;  4XNH C;  1KUV A;  2K5T A;  1QSO A;  2OU2 A;  3FF3 A;  3T8W A;  3SJX A;  3PB9 X;  2VZY A;  2QEC A;  2PVV A;  4OAE A;  4W9Y A;  4KUA A;  3I1U A;  3V7Z A;  2ZEN A;  3A9L A;  5LRG A;  4Y49 C;  4KUB A;  4M3S A;  5AGE A;  3JUW A;  1Z8W A;  2BEI A;  4IHM A;  2PJA A;  1Y9K A;  3BXM A;  4B6Z A;  5K8P A;  1BPN A;  3S6K A;  4NGM A;  3FRM A;  3KKW A;  1ELM P;  8CPA A;  3LAC A;  1YSJ A;  3D7D A;  4UFW A;  2QIR A;  2Z3N A;  4X2T A;  1P4N A;  2C6C A;  3BJ8 A;  4CAE A;  2V8G A;  1S60 A;  5GCN A;  4X3R A;  1TF8 A;  2GRE A;  1CG2 A;  2EWB A;  1CBX A;  1M44 A;  2VBQ A;  4BMH A;  4H6Z A;  5AG4 A;  1PYT B;  2FSR A;  1BO4 A;  3BI0 A;  4JYW A;  4CYP A;  2ZW7 A;  4L89 A;  1IGB A;  3FH4 A;  3D3S A;  1Q2C A;  2V8H A;  4NGN A;  5D29 A;  3MGD A;  4AXV A;  4Q36 A;  4XPD B;  1NMT A;  2PR1 A;  5ELY A;  5C88 A;  2CIJ A;  4F8Z A;  4J3G A;  4UEE A;  1VKC A;  1ZG8 A;  2Z10 A;  2Q4Z A;  5K8O A;  2GU2 A;  4MFL A;  3EFA A;  1ZG7 A;  3W91 A;  1CM0 A;  4AVB A;  4R87 A;  3DGV A;  5CPA A;  3WC6 A;  4MHY A;  2CF4 A;  2PJB A;  3G3S A;  4A39 A;  4CYQ A;  2B58 A;  5HVH A;  4U5Y A;  4LX9 A;  4PK2 A;  3PB8 X;  4OME A;  3NE7 A;  2Z0Z A;  1S7L A;  4MHZ A;  5IX3 A;  1ZLH A;  3CPX A;  4CS0 B;  4RN7 A;  5K8N A;  1TF9 A;  3B3V A;  4RI1 A;  2Q0Y A;  4X5K A;  3P2F A;  5IB0 A;  3IWW A;  2EBJ A;  2B5G A;  2YNC A;  3NH5 A;  4JZ0 A;  3CDX A;  1YRE A;  3MRU A;  3R1K A;  2HV2 A;  2Q4Y A;  1AYE A;  2KCW A;  4IF5 A;  1YK3 A;  5HVF A;  1ON0 A;  2JBK A;  4EWT A;  2AFS A;  4H89 A;  5I4M A;  1YR0 A;  2ZW5 A;  3TC8 A;  4C68 A;  1JQG A;  1QSR A;  2IMO A;  4KSF A;  3LMS A;  3PEI A;  4MCP A;  2ZPA A;  3CXP A;  4XPD C;  3DLJ A;  4C7I A;  2ODF A;  2Q43 A;  1H8L A;  3BHX A;  3PFO A;  2XEJ A;  3TE4 A;  4FAI A;  3SXN A;  4FD5 A;  2CTC A;  3N7Z A;  4X8I A;  4DJL A;  4R9M A;  4R6T A;  5F46 A;  1AMP A;  1Z4E A;  3TOA A;  5KTD A;  1Y0Y A;  3D2P A;  4NXY A;  3PBE A;  1Z4R A;  4K3N A;  2R1I A;  4OC1 A;  3W6S A;  3KR5 A;  3PRT A;  2I79 A;  2FCK A;  3IEH A;  4MFZ A;  2G9D A;  2G3T A;  3QNV A;  4FWU A;  3P2H A;  3S9N A;  4B12 A;  4U9Y A;  3DSB A;  2DEA A;  2GLF A;  1YGH A;  4NGP A;  1Q7L A;  4NGS A;  3SI1 A;  1Z2L A;  2CNT A;  2J8N A;  3SI0 A;  3KGQ A;  4P6Y A;  5G22 A;  1ARM A;  4RUH A;  3B2Y A;  4XNH B;  4II9 A;  1S5K A;  3MN8 A;  3R9E A;  4CGM A;  4UWI A;  3E0K A;  4UCM A;  2ZEG A;  2R98 A;  3TO7 A;  4MHN A;  4NJQ A;  3KI9 A;  4Y49 B;  1P0H A;  1Z8T A;  3TOB A;  5AG7 A;  4MCQ A;  2PJ7 A;  3S6G A;  3N5F A;  3SJE A;  2R8V A;  2ZEM A;  5K8M A;  4MHP A;  4OP4 A;  1YLE A;  1TIQ A;  3CXQ A;  5HVG A;  1M4L A;  4Q7A A;  4ZX9 A;  1XIX A;  2ABZ A;  2OR4 A;  1IB1 E;  2CNS A;  3FEE A;  3I3G A;  2OZG A;  1CPX A;  4TNU A;  4JD6 A;  5E96 A;  3HUV A;  2JEW A;  1QMU A;  2PVW A;  1RXT A;  1YW4 A;  3GKR A;  1LOK A;  1BOB A;  1MK4 A;  3NFZ A;  4OC0 A;  3TO6 A;  2NYQ A;  2PRB A;  2P0W A;  3TCV A;  4KOV A;  4EVY A;  4GXH A;  1K4J A;  2DF5 A;  3KZW A;  4M6H A;  4P10 A;  2FIA A;  2XEI A;  4CGO A;  2EK9 A;  1PU9 A;  3T90 A;  2GLJ A;  3H8E A;  5J8F A;  1ZO0 A;  4JJX A;  4HKF A;  3R9F A;  4OAD A;  2PJ6 A;  2RB7 A;  3K9T A;  3KQX A;  1M1D A;  2F7V A;  1NSA A;  1TXR A;  4NF1 A;  2C1C A;  4R76 A;  4NFR A;  3QAH A;  4IAV A;  3B3C A;  3CPA A;  4M6G A;  4MHD A;  4UF4 A;  2PSW A;  3GIU A;  2REE A;  3H8G A;  3IU2 A;  1X12 A;  2EO8 A;  2QML A;  4P45 A;  1M4G A;  3TO9 A;  2WUU A;  4P4D A;  3B7I A;  4YFJ A;  5A28 A;  4B5O A;  1XF8 A;  1XMT A;  1TKF A;  2FVG A;  2BUE A;  3R95 A;  3FB3 A;  4MY3 A;  4MFQ A;  4OID A;  2BSW A;  4CYN A;  1RO5 A;  4MBU A;  2BOA A;  1YME A;  1IYK A;  4PSX A;  1LAN A;  5H86 A;  2H5M A;  3F8K A;  3IWG A;  4UEZ A;  2PJ8 A;  2G3A A;  4GS4 A;  2JBJ A;  4M6I A;  1Y9W A;  2AJ6 A;  1S7F A;  2ARH A;  4IUS A;  5F47 A;  1Y7E A;  2ZEE A;  3BLN A;  1MJA A;  3FJU A;  1A2Z A;  3D68 A;  2PJ3 A;  1TKH A;  3W6X A;  2DPS A;  4NGQ A;  3B8G A;  4A33 A;  2JLM A;  2DXQ A;  2PJ0 A;  4PXE A;  3QB8 A;  5CNP A;  2FT0 A;  3PB6 X;  4KZT A;  4AVC A;  2ZEH A;  4WWV A;  5AG6 A;  4YWY A;  2CNM A;  2XEG A;  4FUU A;  3RYO A;  1V0C A;  4A95 A;  5IV0 A;  2ATR A;  3CXS A;  5JPH A;  3SJF A;  7CPA A;  1KUY A;  4KOW A;  1YLO A;  4KVX A;  4E8O A;  3SHP A;  1I1D A;  3LD2 A;  1EE3 P;  2RC4 A;  3D4U A;  3ISX A;  3WC7 A;  5J1Q A;  4ZYQ A;  4CGN A;  3FEC A;  5LYD A;  5ISV A;  3S9M A;  2NSM A;  2O28 A;  4JXR A;  2CXA A;  4OC4 A;  1ZG9 A;  3PB7 X;  4ZBG A;  2IL4 A;  3GYA A;  4KLV A;  4R57 A;  4UBR A;  1XMB A;  3B3T A;  4CPA A;  1DE4 C;  1I21 A;  3TX8 A;  4BD9 A;  4F0Y A;  3FBU A;  4QB9 A;  2IJZ A;  1HEE A;  2PJ2 A;  2Z3M A;  1IID A;  2G0B A;  4KVM E;  1KWM A;  3D2M A;  4U9Z A;  4B5P B;  2FS5 A;  2VI7 A;  4AG9 A;  3IJ3 A;  2Q44 A;  1BAV A;  1BLL E;  2WZN A;  5HMN A;  4FD4 A;  2C6P A;  4OC5 A;  2GAN A;  1HDQ A;  1VHE A;  1Q2Y A;  2V8V A;  3PP9 A;  3KQZ A;  4A31 A;  4C2Y A;  4UFV A;  2YNE A;  4JLY A;  4A94 A;  1VHS A;  2HB6 A;  4R3K A;  3RAM A;  2J8R A;  1KZF A;  3IU1 A;  4AB7 A;  2PC1 A;  2X7B A;  1PUA A;  1YW6 A;  2Q04 A;  3IWE A;  3T9Y A;  3ZZI A;  5LYL A;  3S9L A;  4TWE A;  3WC5 A;  5KTC A;  3S6H A;  5BWA B;  2PJ9 A;  4UIB A;  1XE4 A;  4OKO A;  4ZX8 A;  1JWQ A;  4E2A A;  1VGY A;  2B4D B;  1CP7 A;  4OIW A;  2GFQ A;  2YND A;  2BO9 A;  3FNC A;  4P4J A;  3RZA A;  4OC3 A;  2OZH A;  2PJC A;  5DWM A;  2Q51 A;  4F6A A;  2ANP A;  3DNS A;  4CAF A;  1LRZ A;  5HH1 A;  1YQE A;  3D66 A;  4CAV A;  4MCS A;  3TT2 A;  3R96 A;  5JM6 A;  1WWZ A;  4KOX A;  4P4B A;  4QBJ A;  4JXQ A;  2FE7 A;  2GIV A;  3I9S A;  3PZJ A;  5EBV A;  5G1Z A;  4ONU A;  5C82 A;  1TKJ A;  4A32 A;  4KOR A;  1ARL A;  4KVO E;  4ZY0 A;  2AFM A;  3L2N A;  3D7H A;  3KR4 A;  3JVN A;  1F2O A;  2OOT A;  3SJG A;  4P4E A;  4F9U A;  4A2Z A;  2IQ6 A;  3S6F A;  4GM5 A;  1Q2D A;  3EXN A;  5KTA A;  1B6B A;  4P4I A;  2Q7B A;  3VAR A;  1UWY A;  4A37 A;  3NA6 A;  2POK A;  4YGO A;  2Z3L A;  2PRQ A;  2I3C A;  3D7F A;  4G1P A;  2ZOF A;  1S3Z A;  2JEV A;  4R7M A;  3PBB A;  4XPK A;  4H2K A;  2P6E A;  4L8A A;  2OZU A;  2B3U A;  2C27 A;  2EVN A;  2PDO A;  3ISZ A;  1Z9U A;  4QUS A;  4UFX A;  5EC4 A;  3R9G A;  4F9V A;  2J9A A;  3UY5 A;  2EUI A;  2ZXV A;  5J8C A;  4RS2 A;  1IY7 A;  3KHX A;  5F49 A;  1LAP A;  2PE3 A;  2VL1 A;  2QJ8 A;  3C26 A;  4JWP A;  1R57 A;  1YVK A;  4PK3 A;  4QC6 A;  4R3L A;  4IK2 A;  4PPZ A;  4ZGY B;  3SXO A;  3KAS A;  1Z8X A;  4PXC A;  4O23 A;  3K9U A;  2QVP A;  3IO1 A;  3GLJ A;  4C2X A; 
#chains in the Genus database with same CATH homology
 5JQ4 A;  2F5I A;  3DDD A;  1U6M A;  1QSN A;  4AVA A;  4M85 A;  4NSQ A;  4ORF A;  4CRY B;  4XPL A;  1XEB A;  4UCN A;  4DNC A;  5FVJ A;  4KLW A;  4B14 A;  2PR8 A;  4HNX B;  4B5P A;  1IIC A;  3F0A A;  5AG5 A;  4B13 A;  4A30 A;  4H6U A;  2REF A;  2WPX A;  4UCP A;  4CGP A;  4KOU A;  4MI4 A;  2JDD A;  1CJW A;  2A4N A;  2VXK A;  3F5B A;  4KS9 A;  4AG7 A;  4YRH A;  4CYO A;  4FD6 A;  2WPW A;  1YVO A;  2CY2 A;  3TFY A;  1NSL A;  1L0C A;  1MJB A;  2B4D A;  5A27 A;  2PQ8 A;  4MY0 A;  2D4P A;  3PGP A;  2OB0 A;  1I12 A;  2FXF A;  2FL4 A;  4KSA A;  5F48 A;  2FIW A;  1NE9 A;  2D4O A;  2B4B A;  3LOD A;  2R7H A;  4OLL A;  4PV6 A;  3JTK A;  1S7N A;  4HNY B;  4Q38 A;  2J8M A;  1S7K A;  2ZW4 A;  3H5Z A;  4I49 A;  3WR7 A;  4KOT A;  1GHE A;  3VWD A;  2WSA A;  2I00 A;  2VZZ A;  2P6F A;  3FYN A;  1M4I A;  1MJ9 A;  3OWC A;  5DWN A;  4HNW B;  4CRZ B;  2JDC A;  1QST A;  4CAW A;  2ZW6 A;  4NEX A;  4E0A A;  3V8I A;  2Z11 A;  2Z3K A;  1J4J A;  2Z3P A;  5H84 A;  2P6G A;  4MFP A;  2VEZ A;  2AE6 A;  2Z3O A;  4CGL A;  4B11 A;  1N71 A;  2GE3 A;  4MFJ A;  3FIX A;  2BL1 A;  2B5G B;  2OH1 A;  5G21 A;  4B10 A;  4FD7 A;  4C2Z A;  2HUZ A;  3DR6 A;  4LUA A;  1UFH A;  1M4D A;  4MJ8 A;  3GY9 A;  2Y0M A;  4QVT A;  3VWE A;  3EY5 A;  3IGR A;  4PSW A;  4UWJ A;  1WK4 A;  3G8W A;  1KUX A;  3DR8 A;  3BJ7 A;  1OZP A;  4F0X A;  1IYL A;  4KOS A;  4NCZ A;  3FXT A;  4C7H A;  4KOY A;  4MFK A;  2Q4V A;  5G20 A;  3ZJ0 A;  3TTH A;  4UA3 A;  5I0C A;  4BBH A;  2VQY A;  4CAX A;  1B87 A;  1SQH A;  3H4Q A;  2HQY A;  2YNC C;  2NMT A;  3EO4 A;  3D8P A;  2YGW A;  2B3V A;  1QSM A;  4K30 A;  1FY7 A;  1Y7R A;  3EC4 A;  2DPT A;  1YX0 A;  4XNH C;  1KUV A;  2K5T A;  1QSO A;  2OU2 A;  2VZY A;  2QEC A;  4OAE A;  4KUA A;  3A9L A;  4Y49 C;  4KUB A;  4M3S A;  5AGE A;  3JUW A;  2BEI A;  1Y9K A;  3S6K A;  3FRM A;  3KKW A;  4UFW A;  2QIR A;  2Z3N A;  1P4N A;  3BJ8 A;  4CAE A;  1S60 A;  5GCN A;  5AG4 A;  1M44 A;  2VBQ A;  4BMH A;  4H6Z A;  2FSR A;  1BO4 A;  4CYP A;  2ZW7 A;  4L89 A;  3D3S A;  1Q2C A;  3MGD A;  4Q36 A;  4XPD B;  1NMT A;  2PR1 A;  5C88 A;  4J3G A;  1VKC A;  2Z10 A;  4MFL A;  3EFA A;  3W91 A;  1CM0 A;  4AVB A;  4R87 A;  3G3S A;  4CYQ A;  2B58 A;  4U5Y A;  4LX9 A;  4PK2 A;  3NE7 A;  2Z0Z A;  1S7L A;  5IX3 A;  4CS0 B;  4RI1 A;  2Q0Y A;  4X5K A;  3P2F A;  5IB0 A;  2B5G A;  2YNC A;  1YRE A;  3R1K A;  2HV2 A;  2Q4Y A;  2KCW A;  4IF5 A;  1YK3 A;  1ON0 A;  4H89 A;  1YR0 A;  2ZW5 A;  4C68 A;  1QSR A;  4KSF A;  4XPD C;  2ZPA A;  3CXP A;  4C7I A;  3TE4 A;  3SXN A;  4FD5 A;  3N7Z A;  5F46 A;  4R9M A;  1Z4E A;  3TOA A;  5KTD A;  3D2P A;  4NXY A;  1Z4R A;  2R1I A;  3W6S A;  2I79 A;  2FCK A;  4MFZ A;  2G3T A;  3P2H A;  4B12 A;  4U9Y A;  3DSB A;  1YGH A;  2CNT A;  2J8N A;  5G22 A;  4XNH B;  4II9 A;  1S5K A;  3R9E A;  4CGM A;  4UWI A;  3E0K A;  4UCM A;  2R98 A;  3TO7 A;  4Y49 B;  1P0H A;  3TOB A;  5AG7 A;  3S6G A;  2R8V A;  1YLE A;  1TIQ A;  3CXQ A;  1XIX A;  1IB1 E;  2CNS A;  3I3G A;  2OZG A;  4JD6 A;  5E96 A;  1RXT A;  3GKR A;  1BOB A;  1MK4 A;  3TO6 A;  2PRB A;  2P0W A;  3TCV A;  4KOV A;  4EVY A;  1K4J A;  2FIA A;  4CGO A;  1PU9 A;  3T90 A;  5J8F A;  1ZO0 A;  4JJX A;  4HKF A;  3R9F A;  4OAD A;  1M1D A;  4NF1 A;  3QAH A;  4MHD A;  2PSW A;  2REE A;  3IU2 A;  2QML A;  1M4G A;  3TO9 A;  2WUU A;  4YFJ A;  5A28 A;  4B5O A;  1XF8 A;  1XMT A;  2BUE A;  3R95 A;  3FB3 A;  4MY3 A;  4MFQ A;  2BSW A;  4CYN A;  1RO5 A;  4MBU A;  1IYK A;  4PSX A;  5H86 A;  3F8K A;  2H5M A;  3IWG A;  2G3A A;  4GS4 A;  1Y9W A;  2AJ6 A;  1S7F A;  2ARH A;  4IUS A;  5F47 A;  3BLN A;  1MJA A;  3W6X A;  2DPS A;  3B8G A;  4A33 A;  2JLM A;  2DXQ A;  3QB8 A;  5CNP A;  2FT0 A;  4AVC A;  5AG6 A;  2CNM A;  3RYO A;  1V0C A;  4A95 A;  2ATR A;  3CXS A;  5JPH A;  1KUY A;  4KOW A;  4KVX A;  4E8O A;  3SHP A;  1I1D A;  3LD2 A;  2RC4 A;  4CGN A;  5ISV A;  4JXR A;  2O28 A;  2CXA A;  4ZBG A;  2IL4 A;  3GYA A;  4KLV A;  4R57 A;  4UBR A;  1I21 A;  4F0Y A;  3FBU A;  4QB9 A;  2Z3M A;  1IID A;  2G0B A;  4KVM E;  3D2M A;  4U9Z A;  4B5P B;  2FS5 A;  2VI7 A;  4AG9 A;  2Q44 A;  5HMN A;  4FD4 A;  2GAN A;  1Q2Y A;  3PP9 A;  4A31 A;  4C2Y A;  4UFV A;  2YNE A;  4JLY A;  1VHS A;  4R3K A;  2J8R A;  1KZF A;  3IU1 A;  4AB7 A;  2PC1 A;  2X7B A;  1PUA A;  2Q04 A;  3IWE A;  3T9Y A;  3ZZI A;  5KTC A;  3S6H A;  5BWA B;  1XE4 A;  4E2A A;  2B4D B;  2YND A;  3FNC A;  2OZH A;  5DWM A;  4F6A A;  3DNS A;  4CAF A;  1LRZ A;  5HH1 A;  4CAV A;  3TT2 A;  3R96 A;  1WWZ A;  4KOX A;  4QBJ A;  4JXQ A;  2FE7 A;  2GIV A;  3I9S A;  3PZJ A;  5EBV A;  5G1Z A;  4ONU A;  5C82 A;  4A32 A;  4KOR A;  4KVO E;  3JVN A;  4A2Z A;  3S6F A;  5KTA A;  1Q2D A;  3EXN A;  1B6B A;  2Q7B A;  4YGO A;  2Z3L A;  1S3Z A;  2JEV A;  4XPK A;  2P6E A;  4L8A A;  2OZU A;  2B3U A;  2C27 A;  2EVN A;  2PDO A;  4QUS A;  1Z9U A;  4UFX A;  5EC4 A;  3R9G A;  5IV0 A;  3UY5 A;  2EUI A;  2ZXV A;  5J8C A;  4RS2 A;  5F49 A;  3C26 A;  4JWP A;  1R57 A;  1YVK A;  4PK3 A;  4QC6 A;  4R3L A;  4ZGY B;  3SXO A;  3K9U A;  4KZT A;  4C2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...