1M44A

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-apo structure
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
177
structure length
177
Chain Sequence
VHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside 2'-N-acetyltransferase
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 47
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m44A00
2FS5A 4KZTA 4E0AA 2ZXVA 4R3KA 4IF5A 2Q7BA 4HNYB 2OH1A 2JDDA 4KORA 4K30A 4L8AA 2Z11A 4YRHA 3GY9A 4R3LA 2FE7A 3IWGA 3TCVA 2BSWA 3RYOA 1LRZA 1KUVA 4U9YA 1S7KA 4MI4A 3N7ZA 4XPDB 2ZW7A 5DWMA 3S6FA 2P6GA 3S6HA 2BL1A 3IGRA 2Q4VA 2FSRA 1QSMA 5F47A 4KOTA 3ZZIA 4GS4A 2OU2A 4B5PA 2B5GB 1P4NA 3TT2A 4QB9A 1XE4A 1M1DA 1Y9KA 2PC1A 4JD6A 4JXRA 4AG9A 4LUAA 4H6UA 1S7FA 4M85A 4OADA 4MJ8A 2FIAA 2G3TA 3EFAA 1YX0A 3NE7A 2FXFA 3T90A 4PK3A 2ZW5A 4HNXB 4ZBGA 1RXTA 2HV2A 4FD6A 2IL4A 4QC6A 4HNWB 4KOSA 4PK2A 3SHPA 3SXOA 5FVJA 4XNHB 1VHSA 1YREA 1XMTA 3JVNA 5H84A 1WWZA 1S7LA 4H6ZA 1KZFA 4BMHA 4JXQA 4XPLA 2B58A 1WK4A 1UFHA 4KVME 2CNTA 1V0CA 2OZHA 4KOVA 1CJWA 4OLLA 4PV6A 1BO4A 4PSWA 1ON0A 1Z9UA 2BUEA 4M3SA 4XPKA 4AB7A 1GHEA 2PR8A 2KCWA 2PR1A 3TOBA 4OAEA 1MJBA 1NSLA 4ORFA 4YGOA 3FYNA 1M4IA 5F46A 1R57A 3D8PA 4II9A 2B4DA 3OWCA 1M4DA 1Y7RA 1YGHA 3TO6A 4KLVA 1OZPA 4F6AA 4NSQA 2FIWA 2ATRA 2B3UA 2WPWA 2CY2A 3C26A 3TO7A 1Z4RA 4UWJA 1MJAA 1MJ9A 5H86A 3BJ7A 3BJ8A 1QSRA 5J8CA 2VZZA 2GE3A 4FD5A 3F0AA 3I9SA 4KUAA 3R1KA 5DWNA 4F0YA 4MY0A 1K4JA 5JQ4A 3QAHA 2B3VA 2FCKA 2Q04A 2QECA 2P0WA 5KTDA 2F5IA 2P6EA 2Q4YA 5KTCA 4KUBA 1QSTA 3EO4A 2GANA 3D2PA 3R9FA 2D4PA 3CXQA 3D3SA 2WPXA 3PZJA 4PSXA 3UY5A 4JLYA 2GIVA 3G8WA 4U9ZA 1Q2CA 2C27A 4EVYA 3G3SA 2HQYA 4Y49B 1QSOA 2R1IA 1SQHA 5GCNA 4FD7A 5HH1A 2Q44A 3CXSA 3GYAA 4YFJA 1U6MA 4AVBA 3B8GA 4R57A 2OZGA 5IV0A 4NXYA 4KVOE 3R95A 1B6BA 4AVAA 5F48A 4AVCA 4CRYB 5E96A 2G0BA 3TO9A 1J4JA 4R9MA 2CNSA 2FT0A 3BLNA 1RO5A 2VBQA 4LX9A 5EBVA 1YK3A 2R8VA 2I00A 2EUIA 5C82A 3FXTA 4KOUA 2R7HA 2A4NA 1IIDA 5C88A 1KUYA 4J3GA 2PQ8A 1NE9A 4H89A 1YVKA 3WR7A 3EY5A 1QSNA 1YR0A 2H5MA 1KUXA 4E2AA 2REFA 1XF8A 3LD2A 4AG7A 3LODA 3VWEA 1TIQA 5EC4A 1S3ZA 4JJXA 2QMLA 2J8RA 1P0HA 3DSBA 3VWDA 2B5GA 2VXKA 1M44A 2G3AA 2X7BA 4B5PB 3P2FA 2OB0A 3FIXA 3TE4A 5I0CA 5CNPA 2FL4A 1I1DA 3PP9A 2K5TA 1YLEA 1XEBA 1CM0A 4UA3A 4NEXA 4XPDC 4CAXA 2QIRA 1S5KA 1Y9WA 1Q2YA 3FNCA 2JDCA 2BEIA 4KVXA 3TTHA 4MBUA 5IB0A 4X5KA 2J8MA 2HUZA 5JPHA 3T9YA 3DDDA 2Z0ZA 3ZJ0A 4KLWA 4HKFA 3R96A 2B4BA 2O28A 4FD4A 3FBUA 2JEVA 3I3GA 2VI7A 3MGDA 3H4QA 5IX3A 3FRMA 4NCZA 3TOAA 2VQYA 4KOYA 2J8NA 4RS2A 2NMTA 1S7NA 2ZW4A 4KOXA 4CRZB 2AE6A 3JUWA 4CAWA 1S60A 4XNHC 4MY3A 2D4OA 3TFYA 2OZUA 2I79A 2B4DB 4QUSA 1XIXA 3S6GA 1FY7A 3DR8A 4MHDA 3SXNA 3DR6A 4NF1A 1IYLA 4U5YA 5F49A 1Z4EA 3W6SA 1I12A 2Z10A 2CNMA 4CS0B 3KKWA 3F5BA 2R98A 4IUSA 2ARHA 1BOBA 2DXQA 1PUAA 1PU9A 4CAVA 2ZW6A 3P2HA 4DNCA 3R9GA 4KOWA 3S6KA 5KTAA 2PSWA 1IICA 1Q2DA 2VZYA 1L0CA 1MK4A 2ZPAA 4ONUA 2VEZA 2EVNA 2PRBA 3W6XA 3PGPA 5ISVA 2Y0MA 3FB3A 4E8OA 3CXPA 3DNSA 3EXNA 4JWPA 1VKCA 4UWIA 2AJ6A 1N71A 4QBJA 3E0KA 3W91A 1IYKA 5J8FA 1YVOA 4B5OA 3R9EA 2Q0YA 1IB1E 2RC4A 3F8KA 5HMNA 3QB8A 4RI1A 1B87A 3EC4A 2P6FA 4L89A 1I21A 2JLMA 3GKRA 4I49A 4UBRA 3D2MA 2REEA 1M4GA 4Y49C 3V8IA 3K9UA 2PDOA 4R87A 4QVTA 1NMTA
chains in the Genus database with same CATH superfamily
2FS5A 4KZTA 4E0AA 5K8OA 2ZXVA 4GXHA 4R3KA 4F9VA 1CP6A 4IF5A 2Q7BA 2F7VA 3PBEA 2OH1A 1Y7EA 4HNYB 5CPAA 4OC0A 2CXAA 2JDDA 1FT7A 4KORA 4K30A 4L8AA 2ZELA 2Z11A 4YRHA 3GY9A 4R3LA 1CPSA 2FE7A 4MFZA 2G9DA 3IWGA 3HUVA 5DS0A 3TCVA 2BSWA 3D68A 5AG5A 3RYOA 1LRZA 1KUVA 4U9YA 4MCRA 4MFPA 1S7KA 1ELLP 4KS9A 4OKOA 4MI4A 3N7ZA 2PJ3A 2V8HA 2ABZA 1DE4C 2ZW7A 4XPDB 5DWMA 2P6GA 3S6FA 4BBHA 3PB4X 2BL1A 1NSAA 3IGRA 4MMOA 3S6HA 1X12A 1YLOA 2Q4VA 2FSRA 1BLLE 1QSMA 5LYFA 4MCSA 4P4FA 3QAYA 5F47A 4KOTA 1ZLHA 4HPSA 4M6HA 4FUUA 3KASA 4GS4A 3ZZIA 2OU2A 2RFHA 3TX8A 5J1QA 4RUHA 4B14A 4B5PA 4C68A 2B5GB 1P4NA 3TT2A 1CPXA 2I3CA 4GM5A 2PIZA 4QB9A 4F0XA 1XE4A 2IQ6A 3KR5A 4CYOA 1M1DA 1Y9KA 2PC1A 4JD6A 2PJ5A 4JXRA 3IEHA 4AG9A 3H8EA 4BINA 4Z65A 2C1CA 4LUAA 4H6UA 1S7FA 4M85A 4OADA 5G20A 3D7FA 3H8GA 2FIAA 2G3TA 4MJ8A 3EFAA 1YX0A 2Z3KA 2FXFA 3NE7A 1Q7LA 3T90A 4A2ZA 4PK3A 2ZW5A 4OC3A 5CBMA 4C7HA 4HNXB 4ZBGA 1RXTA 3KL9A 2HV2A 3CDXA 4FD6A 1OBRA 3SI0A 3FECA 5K8NA 2IL4A 4QC6A 4HNWB 4ZY1A 1AYEA 4KOSA 4H2KA 5LRKA 3B3SA 4PK2A 2C6PA 2PJ2A 3NFZA 3SHPA 1IU8A 4UCPA 3SXOA 5G1ZA 4YU9A 3B3CA 5FVJA 2Z3PA 4XNHB 4Q38A 3SI1A 1VHSA 1YREA 1XMTA 3JVNA 5H84A 1WWZA 3RBUA 5K8MA 1VHOA 1S7LA 2WYRA 3L2NA 2WZNA 4H6ZA 4MFQA 4UFWA 1KZFA 4BMHA 4JXQA 5JGFA 4XPLA 2B58A 2AFSA 1WK4A 1UFHA 3KZWA 4CGPA 4UFVA 4KVME 3D66A 2Z3LA 3WABA 2CNTA 1V0CA 2OZHA 4IHMA 4KOVA 3MN8A 1CJWA 4OLLA 3RZAA 3VARA 3D67A 2PE3A 4P6YA 4MHYA 2DF5A 1LOKA 4KSFA 1BO4A 4PV6A 1TXRA 1YMEA 4G1PA 1ON0A 4PSWA 1Z9UA 2BUEA 4M3SA 4XPKA 4AB7A 5LRGA 4ONWA 1GHEA 2ZEDA 2PR8A 4UEZA 2KCWA 2PR1A 3T8WA 4A32A 3TOBA 4OAEA 1MJBA 3B3VA 1RTQA 1QQ9A 1IY7A 4ORFA 1NSLA 4YGOA 3FYNA 5IB9A 1M4IA 3A9LA 5F46A 4R7MA 3SJXA 1R3NA 4OIDA 1R57A 3D8PA 4A33A 4II9A 2C6GA 2B4DA 1YQEA 3OWCA 4A38A 1M4DA 1LFWA 2ZEHA 1Y7RA 1YGHA 3TO6A 4B10A 4C7IA 1Y0YA 4PXCA 2ZOGA 4KLVA 4JZ0A 5THWA 1Z5RA 1OZPA 3V38A 2Q4ZA 3FJUA 3S9MA 3MRUA 4F6AA 4NSQA 4UCMA 2PJ7A 2EK8A 2FIWA 2ATRA 2B3UA 2PJ0A 2WPWA 3I1UA 2CY2A 3BI1A 4RN7A 3KI9A 4OMEA 4A95A 1EE3P 4ZYQA 3C26A 2ODFA 3TO7A 4OC4A 1Z4RA 1QMUA 1MJAA 2CIJA 3B3WA 1MJ9A 4UWJA 5H86A 3GUXA 3KR4A 3LMSA 3BJ7A 3BJ8A 5A28A 5AG7A 4TNUA 1ARLA 1QSRA 1VIXA 4AXVA 5J8CA 1CP7A 2VZZA 3DGVA 4MCQA 3PFOA 2GE3A 4A39A 4FD5A 3F0AA 3I9SA 4KUAA 3R1KA 3CPXA 4LQGA 5DWNA 4F0YA 3FX6A 3IC1A 4MY0A 1K4JA 2OR4A 3VH9A 5JQ4A 3QAHA 2B3VA 2FCKA 2Q04A 2QECA 4JYWA 2P0WA 3QNVA 5KTDA 4UIBA 2F5IA 2P6EA 2Q4YA 4A30A 1XFOA 4F9UA 3S9LA 1KWMA 5KTCA 1XOVA 4UF4A 3WT4A 3SJEA 4KUBA 1QSTA 5LYDA 3LWUA 3SJFA 3EO4A 4A94A 2GANA 3D2PA 3R9FA 2Z3NA 2D4PA 3CXQA 3D3SA 2YNDA 1ZLIA 2WPXA 3PZJA 4MHZA 4PSXA 3UY5A 4B13A 4JLYA 2GIVA 3D7GA 3G8WA 3IU1A 4U9ZA 1Q2CA 2C27A 3BXMA 4EVYA 2BO9A 3G3SA 2HQYA 4CYNA 4Y49B 1QSOA 2R1IA 2Q7SA 3KQXA 4ZY2A 1SQHA 5GCNA 4R76A 5BWAB 3NH5A 3FEEA 4FD7A 2GLFA 4NJRA 2Q44A 3CXSA 3GYAA 5HH1A 4BD9A 1HDUA 3PB6X 3KGQA 3IIBA 4YFJA 4PXEA 1TKHA 2ZENA 1U6MA 4AVBA 1TKFA 4UFXA 3B8GA 4K3NA 4R57A 2OZGA 5F09A 2V8GA 5IV0A 1FNOA 4NXYA 3CT9A 3H5ZA 4KVOE 4MFJA 1B6BA 2XEIA 2PVWA 3R95A 4AVAA 4CAEA 1ELMP 8CPAA 5F48A 4AVCA 4CRYB 5E96A 2G0BA 3TO9A 2YNEA 2AFWA 1IOFA 3WC7A 1J4JA 1YW6A 5HVFA 2QYVA 4R9MA 4B6ZA 4P4IA 2CNSA 2FT0A 3IFEA 4F8ZA 4A31A 2DPSA 4MRIA 2F8HA 4FBEA 3BLNA 1RO5A 4KSIA 3FVLA 2VBQA 4NGRA 4LX9A 5EBVA 1YK3A 5G22A 2JBKA 1TF8A 2R8VA 1YW4A 2I00A 3GIUA 7CPAA 5AGEA 2EUIA 5C82A 1Z8XA 2BCOA 2ZEEA 4FWUA 3IWWA 2O4HA 3FEDA 3FXTA 3GLJA 3D7DA 4ZGYB 2FVGA 2NYQA 2R7HA 4KOUA 4P4BA 3RAMA 2A4NA 3ISXA 2ANPA 4P10A 3RNZA 1IIDA 4CAFA 5C88A 1KUYA 4OP4A 4J3GA 2PQ8A 5A27A 4P4DA 1NE9A 1XMBA 4H89A 1YVKA 3PB8X 2PJ4A 4M6GA 3WR7A 3EY5A 1QSNA 2XEJA 6CPAA 2XEGA 1YR0A 4ZY0A 2H5MA 1KUXA 3WC6A 4E2AA 2REFA 3DLJA 1XF8A 3LD2A 4AG7A 2EO8A 1ARMA 4CGNA 3LODA 3VWEA 1TIQA 4UIAA 1Z2LA 5EC4A 3V7ZA 4UEEA 5HVGA 4CYQA 2GU2A 5HXDA 4O23A 1S3ZA 4JJXA 2QMLA 2J8RA 1LANA 2PCUA 1P0HA 3RO0A 2IJZA 4OC1A 3DSBA 3VWDA 1JQGA 2B5GA 2HB6A 1ZG8A 4P4EA 2VXKA 1IGBA 1HEEA 2Q43A 1M44A 2G3AA 2X7BA 2C6CA 3LACA 3ISZA 4B5PB 4C2XA 4NGSA 5K8PA 3IO1A 3P2FA 2OB0A 4PPZA 3FIXA 4DYOA 1PYTB 4ZX8A 2PRQA 4R8FA 3TE4A 2AFZA 1X10A 5I0CA 3JTKA 3PB7X 5CNPA 2WUUA 2FL4A 2ZEMA 1I1DA 5I4MA 3PP9A 2K5TA 3SJGA 2EWBA 4X3RA 5LRJA 1YLEA 4MCPA 1LCPA 1XEBA 1CM0A 4UA3A 4X2TA 4R6TA 3NA6A 2RB7A 4NEXA 4XPDC 4CAXA 2QIRA 4NGMA 1S5KA 1Y9WA 1Q2YA 3IWEA 1VHEA 3FNCA 1BPNA 2JDCA 1H8LA 2BEIA 4KVXA 3BHXA 3GB0A 2DEAA 4MHNA 2ZEFA 4MBUA 3TTHA 2NSMA 2DPTA 4EWTA 5IB0A 4X5KA 2J8MA 2HUZA 2POKA 4DUKA 5JPHA 3T9YA 2Z3OA 4OC5A 3DDDA 2Z0ZA 3KHZA 4PXDA 3ZJ0A 3PB9X 4NGPA 3JRUA 1XRYA 1ZO0A 3VATA 2PJBA 4KLWA 1IOIA 2IMOA 2V8VA 4DJLA 4HKFA 2GFQA 3S9NA 3R96A 1TKJA 4W9YA 2B4BA 2CTBA 4IAVA 2O28A 4FD4A 1XJOA 4NJQA 3FBUA 2VL1A 2JEVA 3I3GA 3D4UA 2VI7A 2YGWA 3H4QA 3MGDA 3FRMA 3CPAA 2ZEGA 4NCZA 5IX3A 3TOAA 2VQYA 4KOYA 2J8NA 4RS2A 2PJ9A 5JH9A 4PXBA 2NMTA 1S7NA 2ZW4A 3B7IA 4KOXA 4B11A 4CRZB 4MXUA 3KHXA 2AE6A 2QVPA 1CX8A 3JUWA 4CAWA 4OIWA 1S60A 4XNHC 1LAPA 1XBUA 4MY3A 2D4OA 3TFYA 1AMPA 2OZUA 2I79A 4Q7AA 4NFRA 2B4DB 2PJCA 4QUSA 1XIXA 3S6GA 4X8IA 2QJ8A 1TF9A 1FY7A 3DR8A 4MHDA 3SXNA 2YNCA 2AFXA 4CPAA 1LAMA 2XEFA 2O53A 3DR6A 4NF1A 1A2ZA 1IYLA 2Q51A 4U5YA 5F49A 1Z4EA 4P45A 3W6SA 1I12A 3FF3A 2Z10A 2JBJA 4C2YA 2PJ8A 2CNMA 4CS0B 3KKWA 4FAIA 4CYPA 4A37A 2Z3MA 2JEWA 2ZEOA 3F5BA 2R98A 4IUSA 1CG2A 2ARHA 1BOBA 4EMEA 2DXQA 1PUAA 1PU9A 3B2YA 4CAVA 1UWYA 2ZW6A 3P2HA 4DNCA 3IU2A 3PEIA 3N5FA 2AFOA 3BI0A 3R9GA 4TWEA 4KOWA 3S6KA 5KTAA 1R43A 4MFKA 2PSWA 2PJ1A 1IICA 5EMIA 1Y0RA 1Q2DA 2VZYA 3CZXA 2PJ6A 1L0CA 1MK4A 2ZPAA 4Q36A 1JWQA 4B12A 4ONUA 1VGYA 1YSJA 4NGTA 3TC8A 4PQAA 3KQZA 4ZI6A 4LQ6A 5LYIA 1ZG7A 2VEZA 2EVNA 5LYLA 3H8FA 2PRBA 2YNCC 4P4JA 1M4LA 3B3TA 4MFLA 3PGPA 3FH4A 3W6XA 3D7HA 4MHPA 2AFMA 2BOAA 2WSAA 5ISVA 2Y0MA 3FB3A 4E8OA 3CXPA 2V8DA 2GREA 3DNSA 3EXNA 1F57A 1ZG9A 4WJBA 3NH8A 2EBJA 4JWPA 4NGQA 1VKCA 5JM6A 4UWIA 1BPMA 4C2ZA 4UEFA 2AJ6A 1N71A 2J9AA 3IJ3A 3SI2A 1F2PA 3PRTA 3E0KA 4CGLA 4QBJA 1PCAA 3W91A 1F2OA 1IYKA 2OOTA 5HVHA 5J8FA 5ELYA 5G21A 1CBXA 3FMCA 3NE8A 1YVOA 4P44A 2GLJA 4B5OA 2CTCA 3WC5A 1Z8WA 3R9EA 2Q0YA 1IB1E 2EK9A 2RC4A 1GYTA 3F8KA 2PVVA 1HDQA 3HLPA 1Z8LA 5HMNA 2PIYA 5D29A 3QB8A 4CGMA 4OC2A 4EFDA 4RI1A 1B87A 2AFUA 1Z8TA 3EC4A 2P6FA 4L89A 4M6IA 1AUGA 4UCNA 2CF4A 3PFEA 5AG6A 1BAVA 1I21A 2HC9A 2JLMA 3GKRA 4I49A 5D8NA 4NGNA 4IK2A 3NH4A 2ZEPA 4YWYA 4CGOA 4UBRA 5AG4A 2PJAA 2V77A 3D2MA 4ZX9A 2REEA 1DTDA 1M4GA 3K2KA 4Y49C 3B35A 4WWVA 3V8IA 3K9UA 3PBBA 2PDOA 3K9TA 4R87A 4QVTA 4KSAA 1NMTA 2ZOFA
chains in the Genus database with same CATH topology
2FS5A 4KZTA 4E0AA 2ZXVA 4R3KA 4IF5A 2Q7BA 4HNYB 2OH1A 2CXAA 2JDDA 4KORA 4K30A 4L8AA 2Z11A 4YRHA 3GY9A 4R3LA 2FE7A 4MFZA 3IWGA 3TCVA 2BSWA 5AG5A 3RYOA 1LRZA 1KUVA 4U9YA 4MFPA 1S7KA 4KS9A 4MI4A 3N7ZA 4XPDB 2ZW7A 5DWMA 3S6FA 4BBHA 2P6GA 3S6HA 2BL1A 3IGRA 2Q4VA 2FSRA 1QSMA 5F47A 4KOTA 3ZZIA 4GS4A 2OU2A 4B14A 4B5PA 4C68A 2B5GB 1P4NA 3TT2A 4QB9A 4F0XA 1XE4A 4CYOA 1M1DA 1Y9KA 2PC1A 4JD6A 4JXRA 4AG9A 4LUAA 4H6UA 1S7FA 4M85A 4OADA 5G20A 4MJ8A 2FIAA 2G3TA 3EFAA 1YX0A 2Z3KA 2FXFA 3NE7A 3T90A 4A2ZA 4PK3A 2ZW5A 4C7HA 4HNXB 4ZBGA 1RXTA 2HV2A 4FD6A 2IL4A 4QC6A 4HNWB 4KOSA 4PK2A 3SHPA 4UCPA 3SXOA 5G1ZA 5FVJA 2Z3PA 4XNHB 4Q38A 1VHSA 1YREA 1XMTA 3JVNA 5H84A 1WWZA 1S7LA 4H6ZA 4MFQA 4UFWA 1KZFA 4BMHA 4JXQA 4XPLA 2B58A 1WK4A 1UFHA 4CGPA 4UFVA 4KVME 2Z3LA 2CNTA 1V0CA 2OZHA 4KOVA 1CJWA 4OLLA 4PV6A 4KSFA 1BO4A 4PSWA 1ON0A 1Z9UA 2BUEA 4M3SA 4XPKA 4AB7A 1GHEA 2PR8A 2KCWA 2PR1A 4A32A 3TOBA 4OAEA 1MJBA 1NSLA 4ORFA 4YGOA 3FYNA 1M4IA 3A9LA 5F46A 1R57A 3D8PA 4A33A 4II9A 2B4DA 3OWCA 1M4DA 1Y7RA 1YGHA 3TO6A 4B10A 4C7IA 4KLVA 1OZPA 4F6AA 4NSQA 4UCMA 2FIWA 2ATRA 2B3UA 2WPWA 2CY2A 4A95A 3C26A 3TO7A 1Z4RA 4UWJA 1MJAA 1MJ9A 5H86A 3BJ7A 3BJ8A 5A28A 5AG7A 1QSRA 5J8CA 2VZZA 2GE3A 4FD5A 3F0AA 3I9SA 4KUAA 3R1KA 5DWNA 4F0YA 4MY0A 1K4JA 5JQ4A 3QAHA 2B3VA 2FCKA 2Q04A 2QECA 2P0WA 5KTDA 2F5IA 2P6EA 2Q4YA 4A30A 5KTCA 4KUBA 1QSTA 3EO4A 2GANA 3D2PA 3R9FA 2Z3NA 2D4PA 3CXQA 3D3SA 2YNDA 2WPXA 3PZJA 4PSXA 3UY5A 4B13A 4JLYA 2GIVA 3IU1A 3G8WA 4U9ZA 1Q2CA 2C27A 4EVYA 3G3SA 2HQYA 4CYNA 4Y49B 1QSOA 2R1IA 1SQHA 5GCNA 5BWAB 4FD7A 5HH1A 2Q44A 3CXSA 3GYAA 4YFJA 1U6MA 4AVBA 4UFXA 3B8GA 4R57A 2OZGA 5IV0A 4NXYA 3H5ZA 4KVOE 4MFJA 1B6BA 3R95A 4AVAA 4CAEA 5F48A 4AVCA 4CRYB 5E96A 2G0BA 3TO9A 2YNEA 1J4JA 4R9MA 2CNSA 2FT0A 4A31A 2DPSA 3BLNA 1RO5A 2VBQA 4LX9A 5EBVA 1YK3A 5G22A 2R8VA 2I00A 5AGEA 2EUIA 5C82A 3FXTA 4ZGYB 4KOUA 2R7HA 2A4NA 4CAFA 1IIDA 5C88A 1KUYA 4J3GA 2PQ8A 5A27A 1NE9A 4H89A 1YVKA 3WR7A 3EY5A 1QSNA 1YR0A 2H5MA 1KUXA 4E2AA 2REFA 1XF8A 3LD2A 4AG7A 4CGNA 3LODA 3VWEA 1TIQA 5EC4A 4CYQA 1S3ZA 4JJXA 2QMLA 2J8RA 1P0HA 3DSBA 3VWDA 2B5GA 2VXKA 1M44A 2G3AA 2X7BA 4C2XA 4B5PB 3P2FA 2OB0A 3FIXA 3TE4A 5I0CA 3JTKA 5CNPA 2WUUA 2FL4A 1I1DA 3PP9A 2K5TA 1YLEA 1XEBA 1CM0A 4UA3A 4NEXA 4XPDC 4CAXA 2QIRA 1S5KA 1Y9WA 1Q2YA 3IWEA 3FNCA 2JDCA 2BEIA 4KVXA 3TTHA 4MBUA 5IB0A 2DPTA 4X5KA 2J8MA 2HUZA 5JPHA 3T9YA 2Z3OA 3DDDA 2Z0ZA 3ZJ0A 1ZO0A 4KLWA 4HKFA 3R96A 2B4BA 2O28A 4FD4A 3FBUA 2JEVA 3I3GA 2VI7A 2YGWA 3H4QA 3MGDA 3FRMA 4NCZA 5IX3A 3TOAA 2VQYA 4KOYA 2J8NA 4RS2A 2NMTA 1S7NA 2ZW4A 4KOXA 4B11A 4CRZB 2AE6A 3JUWA 4CAWA 1S60A 4XNHC 4MY3A 2D4OA 3TFYA 2OZUA 2I79A 2B4DB 4QUSA 1XIXA 3S6GA 1FY7A 3DR8A 4MHDA 3SXNA 2YNCA 3DR6A 4NF1A 1IYLA 4U5YA 5F49A 1Z4EA 3W6SA 1I12A 2Z10A 4C2YA 2CNMA 4CS0B 3KKWA 4CYPA 2Z3MA 3F5BA 2R98A 4IUSA 2ARHA 1BOBA 2DXQA 1PUAA 1PU9A 4CAVA 2ZW6A 3P2HA 4DNCA 3IU2A 3R9GA 4KOWA 3S6KA 5KTAA 4MFKA 2PSWA 1IICA 1Q2DA 2VZYA 1L0CA 1MK4A 2ZPAA 4Q36A 4B12A 4ONUA 2VEZA 2EVNA 2PRBA 2YNCC 3W6XA 4MFLA 3PGPA 2WSAA 5ISVA 2Y0MA 3FB3A 4E8OA 3CXPA 3DNSA 3EXNA 4JWPA 1VKCA 4UWIA 4C2ZA 2AJ6A 1N71A 4CGLA 4QBJA 3E0KA 3W91A 1IYKA 5J8FA 5G21A 1YVOA 4B5OA 3R9EA 2Q0YA 1IB1E 2RC4A 3F8KA 5HMNA 3QB8A 4CGMA 4RI1A 1B87A 3EC4A 2P6FA 4L89A 4UCNA 5AG6A 1I21A 2JLMA 3GKRA 4I49A 4CGOA 4UBRA 5AG4A 3D2MA 2REEA 1M4GA 4Y49C 3V8IA 3K9UA 2PDOA 4R87A 4QVTA 4KSAA 1NMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  4KZT A;  4E0A A;  2ZXV A;  4R3K A;  4IF5 A;  2Q7B A;  4HNY B;  2OH1 A;  2JDD A;  4KOR A;  4K30 A;  4L8A A;  2Z11 A;  4YRH A;  3GY9 A;  4R3L A;  2FE7 A;  3IWG A;  3TCV A;  2BSW A;  3RYO A;  1LRZ A;  1KUV A;  4U9Y A;  1S7K A;  4MI4 A;  3N7Z A;  4XPD B;  2ZW7 A;  5DWM A;  3S6F A;  2P6G A;  3S6H A;  2BL1 A;  3IGR A;  2Q4V A;  2FSR A;  1QSM A;  5F47 A;  4KOT A;  3ZZI A;  4GS4 A;  2OU2 A;  4B5P A;  2B5G B;  1P4N A;  3TT2 A;  4QB9 A;  1XE4 A;  1M1D A;  1Y9K A;  2PC1 A;  4JD6 A;  4JXR A;  4AG9 A;  4LUA A;  4H6U A;  1S7F A;  4M85 A;  4OAD A;  4MJ8 A;  2FIA A;  2G3T A;  3EFA A;  1YX0 A;  3NE7 A;  2FXF A;  3T90 A;  4PK3 A;  2ZW5 A;  4HNX B;  4ZBG A;  1RXT A;  2HV2 A;  4FD6 A;  2IL4 A;  4QC6 A;  4HNW B;  4KOS A;  4PK2 A;  3SHP A;  3SXO A;  5FVJ A;  4XNH B;  1VHS A;  1YRE A;  1XMT A;  3JVN A;  5H84 A;  1WWZ A;  1S7L A;  4H6Z A;  1KZF A;  4BMH A;  4JXQ A;  4XPL A;  2B58 A;  1WK4 A;  1UFH A;  4KVM E;  2CNT A;  1V0C A;  2OZH A;  4KOV A;  1CJW A;  4OLL A;  4PV6 A;  1BO4 A;  4PSW A;  1ON0 A;  1Z9U A;  2BUE A;  4M3S A;  4XPK A;  4AB7 A;  1GHE A;  2PR8 A;  2KCW A;  2PR1 A;  3TOB A;  4OAE A;  1MJB A;  1NSL A;  4ORF A;  4YGO A;  3FYN A;  1M4I A;  5F46 A;  1R57 A;  3D8P A;  4II9 A;  2B4D A;  3OWC A;  1M4D A;  1Y7R A;  1YGH A;  3TO6 A;  4KLV A;  1OZP A;  4F6A A;  4NSQ A;  2FIW A;  2ATR A;  2B3U A;  2WPW A;  2CY2 A;  3C26 A;  3TO7 A;  1Z4R A;  4UWJ A;  1MJA A;  1MJ9 A;  5H86 A;  3BJ7 A;  3BJ8 A;  1QSR A;  5J8C A;  2VZZ A;  2GE3 A;  4FD5 A;  3F0A A;  3I9S A;  4KUA A;  3R1K A;  5DWN A;  4F0Y A;  4MY0 A;  1K4J A;  5JQ4 A;  3QAH A;  2B3V A;  2FCK A;  2Q04 A;  2QEC A;  2P0W A;  5KTD A;  2F5I A;  2P6E A;  2Q4Y A;  5KTC A;  4KUB A;  1QST A;  3EO4 A;  2GAN A;  3D2P A;  3R9F A;  2D4P A;  3CXQ A;  3D3S A;  2WPX A;  3PZJ A;  4PSX A;  3UY5 A;  4JLY A;  2GIV A;  3G8W A;  4U9Z A;  1Q2C A;  2C27 A;  4EVY A;  3G3S A;  2HQY A;  4Y49 B;  1QSO A;  2R1I A;  1SQH A;  5GCN A;  4FD7 A;  5HH1 A;  2Q44 A;  3CXS A;  3GYA A;  4YFJ A;  1U6M A;  4AVB A;  3B8G A;  4R57 A;  2OZG A;  5IV0 A;  4NXY A;  4KVO E;  3R95 A;  1B6B A;  4AVA A;  5F48 A;  4AVC A;  4CRY B;  5E96 A;  2G0B A;  3TO9 A;  1J4J A;  4R9M A;  2CNS A;  2FT0 A;  3BLN A;  1RO5 A;  2VBQ A;  4LX9 A;  5EBV A;  1YK3 A;  2R8V A;  2I00 A;  2EUI A;  5C82 A;  3FXT A;  4KOU A;  2R7H A;  2A4N A;  1IID A;  5C88 A;  1KUY A;  4J3G A;  2PQ8 A;  1NE9 A;  4H89 A;  1YVK A;  3WR7 A;  3EY5 A;  1QSN A;  1YR0 A;  2H5M A;  1KUX A;  4E2A A;  2REF A;  1XF8 A;  3LD2 A;  4AG7 A;  3LOD A;  3VWE A;  1TIQ A;  5EC4 A;  1S3Z A;  4JJX A;  2QML A;  2J8R A;  1P0H A;  3DSB A;  3VWD A;  2B5G A;  2VXK A;  1M44 A;  2G3A A;  2X7B A;  4B5P B;  3P2F A;  2OB0 A;  3FIX A;  3TE4 A;  5I0C A;  5CNP A;  2FL4 A;  1I1D A;  3PP9 A;  2K5T A;  1YLE A;  1XEB A;  1CM0 A;  4UA3 A;  4NEX A;  4XPD C;  4CAX A;  2QIR A;  1S5K A;  1Y9W A;  1Q2Y A;  3FNC A;  2JDC A;  2BEI A;  4KVX A;  3TTH A;  4MBU A;  5IB0 A;  4X5K A;  2J8M A;  2HUZ A;  5JPH A;  3T9Y A;  3DDD A;  2Z0Z A;  3ZJ0 A;  4KLW A;  4HKF A;  3R96 A;  2B4B A;  2O28 A;  4FD4 A;  3FBU A;  2JEV A;  3I3G A;  2VI7 A;  3MGD A;  3H4Q A;  5IX3 A;  3FRM A;  4NCZ A;  3TOA A;  2VQY A;  4KOY A;  2J8N A;  4RS2 A;  2NMT A;  1S7N A;  2ZW4 A;  4KOX A;  4CRZ B;  2AE6 A;  3JUW A;  4CAW A;  1S60 A;  4XNH C;  4MY3 A;  2D4O A;  3TFY A;  2OZU A;  2I79 A;  2B4D B;  4QUS A;  1XIX A;  3S6G A;  1FY7 A;  3DR8 A;  4MHD A;  3SXN A;  3DR6 A;  4NF1 A;  1IYL A;  4U5Y A;  5F49 A;  1Z4E A;  3W6S A;  1I12 A;  2Z10 A;  2CNM A;  4CS0 B;  3KKW A;  3F5B A;  2R98 A;  4IUS A;  2ARH A;  1BOB A;  2DXQ A;  1PUA A;  1PU9 A;  4CAV A;  2ZW6 A;  3P2H A;  4DNC A;  3R9G A;  4KOW A;  3S6K A;  5KTA A;  2PSW A;  1IIC A;  1Q2D A;  2VZY A;  1L0C A;  1MK4 A;  2ZPA A;  4ONU A;  2VEZ A;  2EVN A;  2PRB A;  3W6X A;  3PGP A;  5ISV A;  2Y0M A;  3FB3 A;  4E8O A;  3CXP A;  3DNS A;  3EXN A;  4JWP A;  1VKC A;  4UWI A;  2AJ6 A;  1N71 A;  4QBJ A;  3E0K A;  3W91 A;  1IYK A;  5J8F A;  1YVO A;  4B5O A;  3R9E A;  2Q0Y A;  1IB1 E;  2RC4 A;  3F8K A;  5HMN A;  3QB8 A;  4RI1 A;  1B87 A;  3EC4 A;  2P6F A;  4L89 A;  1I21 A;  2JLM A;  3GKR A;  4I49 A;  4UBR A;  3D2M A;  2REE A;  1M4G A;  4Y49 C;  3V8I A;  3K9U A;  2PDO A;  4R87 A;  4QVT A;  1NMT A; 
#chains in the Genus database with same CATH topology
 2FS5 A;  4KZT A;  4E0A A;  5K8O A;  2ZXV A;  4GXH A;  4R3K A;  4F9V A;  1CP6 A;  4IF5 A;  2Q7B A;  2F7V A;  3PBE A;  2OH1 A;  1Y7E A;  4HNY B;  5CPA A;  4OC0 A;  2CXA A;  2JDD A;  1FT7 A;  4KOR A;  4K30 A;  4L8A A;  2ZEL A;  2Z11 A;  4YRH A;  3GY9 A;  4R3L A;  1CPS A;  2FE7 A;  4MFZ A;  2G9D A;  3IWG A;  3HUV A;  5DS0 A;  3TCV A;  2BSW A;  3D68 A;  5AG5 A;  3RYO A;  1LRZ A;  1KUV A;  4U9Y A;  4MCR A;  4MFP A;  1S7K A;  1ELL P;  4KS9 A;  4OKO A;  4MI4 A;  3N7Z A;  2PJ3 A;  2V8H A;  2ABZ A;  1DE4 C;  2ZW7 A;  4XPD B;  5DWM A;  2P6G A;  3S6F A;  4BBH A;  3PB4 X;  2BL1 A;  1NSA A;  3IGR A;  4MMO A;  3S6H A;  1X12 A;  1YLO A;  2Q4V A;  2FSR A;  1BLL E;  1QSM A;  5LYF A;  4MCS A;  4P4F A;  3QAY A;  5F47 A;  4KOT A;  1ZLH A;  4HPS A;  4M6H A;  4FUU A;  3KAS A;  4GS4 A;  3ZZI A;  2OU2 A;  2RFH A;  3TX8 A;  5J1Q A;  4RUH A;  4B14 A;  4B5P A;  4C68 A;  2B5G B;  1P4N A;  3TT2 A;  1CPX A;  2I3C A;  4GM5 A;  2PIZ A;  4QB9 A;  4F0X A;  1XE4 A;  2IQ6 A;  3KR5 A;  4CYO A;  1M1D A;  1Y9K A;  2PC1 A;  4JD6 A;  2PJ5 A;  4JXR A;  3IEH A;  4AG9 A;  3H8E A;  4BIN A;  4Z65 A;  2C1C A;  4LUA A;  4H6U A;  1S7F A;  4M85 A;  4OAD A;  5G20 A;  3D7F A;  3H8G A;  2FIA A;  2G3T A;  4MJ8 A;  3EFA A;  1YX0 A;  2Z3K A;  2FXF A;  3NE7 A;  1Q7L A;  3T90 A;  4A2Z A;  4PK3 A;  2ZW5 A;  4OC3 A;  5CBM A;  4C7H A;  4HNX B;  4ZBG A;  1RXT A;  3KL9 A;  2HV2 A;  3CDX A;  4FD6 A;  1OBR A;  3SI0 A;  3FEC A;  5K8N A;  2IL4 A;  4QC6 A;  4HNW B;  4ZY1 A;  1AYE A;  4KOS A;  4H2K A;  5LRK A;  3B3S A;  4PK2 A;  2C6P A;  2PJ2 A;  3NFZ A;  3SHP A;  1IU8 A;  4UCP A;  3SXO A;  5G1Z A;  4YU9 A;  3B3C A;  5FVJ A;  2Z3P A;  4XNH B;  4Q38 A;  3SI1 A;  1VHS A;  1YRE A;  1XMT A;  3JVN A;  5H84 A;  1WWZ A;  3RBU A;  5K8M A;  1VHO A;  1S7L A;  2WYR A;  3L2N A;  2WZN A;  4H6Z A;  4MFQ A;  4UFW A;  1KZF A;  4BMH A;  4JXQ A;  5JGF A;  4XPL A;  2B58 A;  2AFS A;  1WK4 A;  1UFH A;  3KZW A;  4CGP A;  4UFV A;  4KVM E;  3D66 A;  2Z3L A;  3WAB A;  2CNT A;  1V0C A;  2OZH A;  4IHM A;  4KOV A;  3MN8 A;  1CJW A;  4OLL A;  3RZA A;  3VAR A;  3D67 A;  2PE3 A;  4P6Y A;  4MHY A;  2DF5 A;  1LOK A;  4KSF A;  1BO4 A;  4PV6 A;  1TXR A;  1YME A;  4G1P A;  1ON0 A;  4PSW A;  1Z9U A;  2BUE A;  4M3S A;  4XPK A;  4AB7 A;  5LRG A;  4ONW A;  1GHE A;  2ZED A;  2PR8 A;  4UEZ A;  2KCW A;  2PR1 A;  3T8W A;  4A32 A;  3TOB A;  4OAE A;  1MJB A;  3B3V A;  1RTQ A;  1QQ9 A;  1IY7 A;  4ORF A;  1NSL A;  4YGO A;  3FYN A;  5IB9 A;  1M4I A;  3A9L A;  5F46 A;  4R7M A;  3SJX A;  1R3N A;  4OID A;  1R57 A;  3D8P A;  4A33 A;  4II9 A;  2C6G A;  2B4D A;  1YQE A;  3OWC A;  4A38 A;  1M4D A;  1LFW A;  2ZEH A;  1Y7R A;  1YGH A;  3TO6 A;  4B10 A;  4C7I A;  1Y0Y A;  4PXC A;  2ZOG A;  4KLV A;  4JZ0 A;  5THW A;  1Z5R A;  1OZP A;  3V38 A;  2Q4Z A;  3FJU A;  3S9M A;  3MRU A;  4F6A A;  4NSQ A;  4UCM A;  2PJ7 A;  2EK8 A;  2FIW A;  2ATR A;  2B3U A;  2PJ0 A;  2WPW A;  3I1U A;  2CY2 A;  3BI1 A;  4RN7 A;  3KI9 A;  4OME A;  4A95 A;  1EE3 P;  4ZYQ A;  3C26 A;  2ODF A;  3TO7 A;  4OC4 A;  1Z4R A;  1QMU A;  1MJA A;  2CIJ A;  3B3W A;  1MJ9 A;  4UWJ A;  5H86 A;  3GUX A;  3KR4 A;  3LMS A;  3BJ7 A;  3BJ8 A;  5A28 A;  5AG7 A;  4TNU A;  1ARL A;  1QSR A;  1VIX A;  4AXV A;  5J8C A;  1CP7 A;  2VZZ A;  3DGV A;  4MCQ A;  3PFO A;  2GE3 A;  4A39 A;  4FD5 A;  3F0A A;  3I9S A;  4KUA A;  3R1K A;  3CPX A;  4LQG A;  5DWN A;  4F0Y A;  3FX6 A;  3IC1 A;  4MY0 A;  1K4J A;  2OR4 A;  3VH9 A;  5JQ4 A;  3QAH A;  2B3V A;  2FCK A;  2Q04 A;  2QEC A;  4JYW A;  2P0W A;  3QNV A;  5KTD A;  4UIB A;  2F5I A;  2P6E A;  2Q4Y A;  4A30 A;  1XFO A;  4F9U A;  3S9L A;  1KWM A;  5KTC A;  1XOV A;  4UF4 A;  3WT4 A;  3SJE A;  4KUB A;  1QST A;  5LYD A;  3LWU A;  3SJF A;  3EO4 A;  4A94 A;  2GAN A;  3D2P A;  3R9F A;  2Z3N A;  2D4P A;  3CXQ A;  3D3S A;  2YND A;  1ZLI A;  2WPX A;  3PZJ A;  4MHZ A;  4PSX A;  3UY5 A;  4B13 A;  4JLY A;  2GIV A;  3D7G A;  3G8W A;  3IU1 A;  4U9Z A;  1Q2C A;  2C27 A;  3BXM A;  4EVY A;  2BO9 A;  3G3S A;  2HQY A;  4CYN A;  4Y49 B;  1QSO A;  2R1I A;  2Q7S A;  3KQX A;  4ZY2 A;  1SQH A;  5GCN A;  4R76 A;  5BWA B;  3NH5 A;  3FEE A;  4FD7 A;  2GLF A;  4NJR A;  2Q44 A;  3CXS A;  3GYA A;  5HH1 A;  4BD9 A;  1HDU A;  3PB6 X;  3KGQ A;  3IIB A;  4YFJ A;  4PXE A;  1TKH A;  2ZEN A;  1U6M A;  4AVB A;  1TKF A;  4UFX A;  3B8G A;  4K3N A;  4R57 A;  2OZG A;  5F09 A;  2V8G A;  5IV0 A;  1FNO A;  4NXY A;  3CT9 A;  3H5Z A;  4KVO E;  4MFJ A;  1B6B A;  2XEI A;  2PVW A;  3R95 A;  4AVA A;  4CAE A;  1ELM P;  8CPA A;  5F48 A;  4AVC A;  4CRY B;  5E96 A;  2G0B A;  3TO9 A;  2YNE A;  2AFW A;  1IOF A;  3WC7 A;  1J4J A;  1YW6 A;  5HVF A;  2QYV A;  4R9M A;  4B6Z A;  4P4I A;  2CNS A;  2FT0 A;  3IFE A;  4F8Z A;  4A31 A;  2DPS A;  4MRI A;  2F8H A;  4FBE A;  3BLN A;  1RO5 A;  4KSI A;  3FVL A;  2VBQ A;  4NGR A;  4LX9 A;  5EBV A;  1YK3 A;  5G22 A;  2JBK A;  1TF8 A;  2R8V A;  1YW4 A;  2I00 A;  3GIU A;  7CPA A;  5AGE A;  2EUI A;  5C82 A;  1Z8X A;  2BCO A;  2ZEE A;  4FWU A;  3IWW A;  2O4H A;  3FED A;  3FXT A;  3GLJ A;  3D7D A;  4ZGY B;  2FVG A;  2NYQ A;  2R7H A;  4KOU A;  4P4B A;  3RAM A;  2A4N A;  3ISX A;  2ANP A;  4P10 A;  3RNZ A;  1IID A;  4CAF A;  5C88 A;  1KUY A;  4OP4 A;  4J3G A;  2PQ8 A;  5A27 A;  4P4D A;  1NE9 A;  1XMB A;  4H89 A;  1YVK A;  3PB8 X;  2PJ4 A;  4M6G A;  3WR7 A;  3EY5 A;  1QSN A;  2XEJ A;  6CPA A;  2XEG A;  1YR0 A;  4ZY0 A;  2H5M A;  1KUX A;  3WC6 A;  4E2A A;  2REF A;  3DLJ A;  1XF8 A;  3LD2 A;  4AG7 A;  2EO8 A;  1ARM A;  4CGN A;  3LOD A;  3VWE A;  1TIQ A;  4UIA A;  1Z2L A;  5EC4 A;  3V7Z A;  4UEE A;  5HVG A;  4CYQ A;  2GU2 A;  5HXD A;  4O23 A;  1S3Z A;  4JJX A;  2QML A;  2J8R A;  1LAN A;  2PCU A;  1P0H A;  3RO0 A;  2IJZ A;  4OC1 A;  3DSB A;  3VWD A;  1JQG A;  2B5G A;  2HB6 A;  1ZG8 A;  4P4E A;  2VXK A;  1IGB A;  1HEE A;  2Q43 A;  1M44 A;  2G3A A;  2X7B A;  2C6C A;  3LAC A;  3ISZ A;  4B5P B;  4C2X A;  4NGS A;  5K8P A;  3IO1 A;  3P2F A;  2OB0 A;  4PPZ A;  3FIX A;  4DYO A;  1PYT B;  4ZX8 A;  2PRQ A;  4R8F A;  3TE4 A;  2AFZ A;  1X10 A;  5I0C A;  3JTK A;  3PB7 X;  5CNP A;  2WUU A;  2FL4 A;  2ZEM A;  1I1D A;  5I4M A;  3PP9 A;  2K5T A;  3SJG A;  2EWB A;  4X3R A;  5LRJ A;  1YLE A;  4MCP A;  1LCP A;  1XEB A;  1CM0 A;  4UA3 A;  4X2T A;  4R6T A;  3NA6 A;  2RB7 A;  4NEX A;  4XPD C;  4CAX A;  2QIR A;  4NGM A;  1S5K A;  1Y9W A;  1Q2Y A;  3IWE A;  1VHE A;  3FNC A;  1BPN A;  2JDC A;  1H8L A;  2BEI A;  4KVX A;  3BHX A;  3GB0 A;  2DEA A;  4MHN A;  2ZEF A;  4MBU A;  3TTH A;  2NSM A;  2DPT A;  4EWT A;  5IB0 A;  4X5K A;  2J8M A;  2HUZ A;  2POK A;  4DUK A;  5JPH A;  3T9Y A;  2Z3O A;  4OC5 A;  3DDD A;  2Z0Z A;  3KHZ A;  4PXD A;  3ZJ0 A;  3PB9 X;  4NGP A;  3JRU A;  1XRY A;  1ZO0 A;  3VAT A;  2PJB A;  4KLW A;  1IOI A;  2IMO A;  2V8V A;  4DJL A;  4HKF A;  2GFQ A;  3S9N A;  3R96 A;  1TKJ A;  4W9Y A;  2B4B A;  2CTB A;  4IAV A;  2O28 A;  4FD4 A;  1XJO A;  4NJQ A;  3FBU A;  2VL1 A;  2JEV A;  3I3G A;  3D4U A;  2VI7 A;  2YGW A;  3H4Q A;  3MGD A;  3FRM A;  3CPA A;  2ZEG A;  4NCZ A;  5IX3 A;  3TOA A;  2VQY A;  4KOY A;  2J8N A;  4RS2 A;  2PJ9 A;  5JH9 A;  4PXB A;  2NMT A;  1S7N A;  2ZW4 A;  3B7I A;  4KOX A;  4B11 A;  4CRZ B;  4MXU A;  3KHX A;  2AE6 A;  2QVP A;  1CX8 A;  3JUW A;  4CAW A;  4OIW A;  1S60 A;  4XNH C;  1LAP A;  1XBU A;  4MY3 A;  2D4O A;  3TFY A;  1AMP A;  2OZU A;  2I79 A;  4Q7A A;  4NFR A;  2B4D B;  2PJC A;  4QUS A;  1XIX A;  3S6G A;  4X8I A;  2QJ8 A;  1TF9 A;  1FY7 A;  3DR8 A;  4MHD A;  3SXN A;  2YNC A;  2AFX A;  4CPA A;  1LAM A;  2XEF A;  2O53 A;  3DR6 A;  4NF1 A;  1A2Z A;  1IYL A;  2Q51 A;  4U5Y A;  5F49 A;  1Z4E A;  4P45 A;  3W6S A;  1I12 A;  3FF3 A;  2Z10 A;  2JBJ A;  4C2Y A;  2PJ8 A;  2CNM A;  4CS0 B;  3KKW A;  4FAI A;  4CYP A;  4A37 A;  2Z3M A;  2JEW A;  2ZEO A;  3F5B A;  2R98 A;  4IUS A;  1CG2 A;  2ARH A;  1BOB A;  4EME A;  2DXQ A;  1PUA A;  1PU9 A;  3B2Y A;  4CAV A;  1UWY A;  2ZW6 A;  3P2H A;  4DNC A;  3IU2 A;  3PEI A;  3N5F A;  2AFO A;  3BI0 A;  3R9G A;  4TWE A;  4KOW A;  3S6K A;  5KTA A;  1R43 A;  4MFK A;  2PSW A;  2PJ1 A;  1IIC A;  5EMI A;  1Y0R A;  1Q2D A;  2VZY A;  3CZX A;  2PJ6 A;  1L0C A;  1MK4 A;  2ZPA A;  4Q36 A;  1JWQ A;  4B12 A;  4ONU A;  1VGY A;  1YSJ A;  4NGT A;  3TC8 A;  4PQA A;  3KQZ A;  4ZI6 A;  4LQ6 A;  5LYI A;  1ZG7 A;  2VEZ A;  2EVN A;  5LYL A;  3H8F A;  2PRB A;  2YNC C;  4P4J A;  1M4L A;  3B3T A;  4MFL A;  3PGP A;  3FH4 A;  3W6X A;  3D7H A;  4MHP A;  2AFM A;  2BOA A;  2WSA A;  5ISV A;  2Y0M A;  3FB3 A;  4E8O A;  3CXP A;  2V8D A;  2GRE A;  3DNS A;  3EXN A;  1F57 A;  1ZG9 A;  4WJB A;  3NH8 A;  2EBJ A;  4JWP A;  4NGQ A;  1VKC A;  5JM6 A;  4UWI A;  1BPM A;  4C2Z A;  4UEF A;  2AJ6 A;  1N71 A;  2J9A A;  3IJ3 A;  3SI2 A;  1F2P A;  3PRT A;  3E0K A;  4CGL A;  4QBJ A;  1PCA A;  3W91 A;  1F2O A;  1IYK A;  2OOT A;  5HVH A;  5J8F A;  5ELY A;  5G21 A;  1CBX A;  3FMC A;  3NE8 A;  1YVO A;  4P44 A;  2GLJ A;  4B5O A;  2CTC A;  3WC5 A;  1Z8W A;  3R9E A;  2Q0Y A;  1IB1 E;  2EK9 A;  2RC4 A;  1GYT A;  3F8K A;  2PVV A;  1HDQ A;  3HLP A;  1Z8L A;  5HMN A;  2PIY A;  5D29 A;  3QB8 A;  4CGM A;  4OC2 A;  4EFD A;  4RI1 A;  1B87 A;  2AFU A;  1Z8T A;  3EC4 A;  2P6F A;  4L89 A;  4M6I A;  1AUG A;  4UCN A;  2CF4 A;  3PFE A;  5AG6 A;  1BAV A;  1I21 A;  2HC9 A;  2JLM A;  3GKR A;  4I49 A;  5D8N A;  4NGN A;  4IK2 A;  3NH4 A;  2ZEP A;  4YWY A;  4CGO A;  4UBR A;  5AG4 A;  2PJA A;  2V77 A;  3D2M A;  4ZX9 A;  2REE A;  1DTD A;  1M4G A;  3K2K A;  4Y49 C;  3B35 A;  4WWV A;  3V8I A;  3K9U A;  3PBB A;  2PDO A;  3K9T A;  4R87 A;  4QVT A;  4KSA A;  1NMT A;  2ZOF A; 
#chains in the Genus database with same CATH homology
 2FS5 A;  4KZT A;  4E0A A;  2ZXV A;  4R3K A;  4IF5 A;  2Q7B A;  4HNY B;  2OH1 A;  2CXA A;  2JDD A;  4KOR A;  4K30 A;  4L8A A;  2Z11 A;  4YRH A;  3GY9 A;  4R3L A;  2FE7 A;  4MFZ A;  3IWG A;  3TCV A;  2BSW A;  5AG5 A;  3RYO A;  1LRZ A;  1KUV A;  4U9Y A;  4MFP A;  1S7K A;  4KS9 A;  4MI4 A;  3N7Z A;  4XPD B;  2ZW7 A;  5DWM A;  3S6F A;  4BBH A;  2P6G A;  3S6H A;  2BL1 A;  3IGR A;  2Q4V A;  2FSR A;  1QSM A;  5F47 A;  4KOT A;  3ZZI A;  4GS4 A;  2OU2 A;  4B14 A;  4B5P A;  4C68 A;  2B5G B;  1P4N A;  3TT2 A;  4QB9 A;  4F0X A;  1XE4 A;  4CYO A;  1M1D A;  1Y9K A;  2PC1 A;  4JD6 A;  4JXR A;  4AG9 A;  4LUA A;  4H6U A;  1S7F A;  4M85 A;  4OAD A;  5G20 A;  4MJ8 A;  2FIA A;  2G3T A;  3EFA A;  1YX0 A;  2Z3K A;  2FXF A;  3NE7 A;  3T90 A;  4A2Z A;  4PK3 A;  2ZW5 A;  4C7H A;  4HNX B;  4ZBG A;  1RXT A;  2HV2 A;  4FD6 A;  2IL4 A;  4QC6 A;  4HNW B;  4KOS A;  4PK2 A;  3SHP A;  4UCP A;  3SXO A;  5G1Z A;  5FVJ A;  2Z3P A;  4XNH B;  4Q38 A;  1VHS A;  1YRE A;  1XMT A;  3JVN A;  5H84 A;  1WWZ A;  1S7L A;  4H6Z A;  4MFQ A;  4UFW A;  1KZF A;  4BMH A;  4JXQ A;  4XPL A;  2B58 A;  1WK4 A;  1UFH A;  4CGP A;  4UFV A;  4KVM E;  2Z3L A;  2CNT A;  1V0C A;  2OZH A;  4KOV A;  1CJW A;  4OLL A;  4PV6 A;  4KSF A;  1BO4 A;  4PSW A;  1ON0 A;  1Z9U A;  2BUE A;  4M3S A;  4XPK A;  4AB7 A;  1GHE A;  2PR8 A;  2KCW A;  2PR1 A;  4A32 A;  3TOB A;  4OAE A;  1MJB A;  1NSL A;  4ORF A;  4YGO A;  3FYN A;  1M4I A;  3A9L A;  5F46 A;  1R57 A;  3D8P A;  4A33 A;  4II9 A;  2B4D A;  3OWC A;  1M4D A;  1Y7R A;  1YGH A;  3TO6 A;  4B10 A;  4C7I A;  4KLV A;  1OZP A;  4F6A A;  4NSQ A;  4UCM A;  2FIW A;  2ATR A;  2B3U A;  2WPW A;  2CY2 A;  4A95 A;  3C26 A;  3TO7 A;  1Z4R A;  4UWJ A;  1MJA A;  1MJ9 A;  5H86 A;  3BJ7 A;  3BJ8 A;  5A28 A;  5AG7 A;  1QSR A;  5J8C A;  2VZZ A;  2GE3 A;  4FD5 A;  3F0A A;  3I9S A;  4KUA A;  3R1K A;  5DWN A;  4F0Y A;  4MY0 A;  1K4J A;  5JQ4 A;  3QAH A;  2B3V A;  2FCK A;  2Q04 A;  2QEC A;  2P0W A;  5KTD A;  2F5I A;  2P6E A;  2Q4Y A;  4A30 A;  5KTC A;  4KUB A;  1QST A;  3EO4 A;  2GAN A;  3D2P A;  3R9F A;  2Z3N A;  2D4P A;  3CXQ A;  3D3S A;  2YND A;  2WPX A;  3PZJ A;  4PSX A;  3UY5 A;  4B13 A;  4JLY A;  2GIV A;  3IU1 A;  3G8W A;  4U9Z A;  1Q2C A;  2C27 A;  4EVY A;  3G3S A;  2HQY A;  4CYN A;  4Y49 B;  1QSO A;  2R1I A;  1SQH A;  5GCN A;  5BWA B;  4FD7 A;  5HH1 A;  2Q44 A;  3CXS A;  3GYA A;  4YFJ A;  1U6M A;  4AVB A;  4UFX A;  3B8G A;  4R57 A;  2OZG A;  5IV0 A;  4NXY A;  3H5Z A;  4KVO E;  4MFJ A;  1B6B A;  3R95 A;  4AVA A;  4CAE A;  5F48 A;  4AVC A;  4CRY B;  5E96 A;  2G0B A;  3TO9 A;  2YNE A;  1J4J A;  4R9M A;  2CNS A;  2FT0 A;  4A31 A;  2DPS A;  3BLN A;  1RO5 A;  2VBQ A;  4LX9 A;  5EBV A;  1YK3 A;  5G22 A;  2R8V A;  2I00 A;  5AGE A;  2EUI A;  5C82 A;  3FXT A;  4ZGY B;  4KOU A;  2R7H A;  2A4N A;  4CAF A;  1IID A;  5C88 A;  1KUY A;  4J3G A;  2PQ8 A;  5A27 A;  1NE9 A;  4H89 A;  1YVK A;  3WR7 A;  3EY5 A;  1QSN A;  1YR0 A;  2H5M A;  1KUX A;  4E2A A;  2REF A;  1XF8 A;  3LD2 A;  4AG7 A;  4CGN A;  3LOD A;  3VWE A;  1TIQ A;  5EC4 A;  4CYQ A;  1S3Z A;  4JJX A;  2QML A;  2J8R A;  1P0H A;  3DSB A;  3VWD A;  2B5G A;  2VXK A;  1M44 A;  2G3A A;  2X7B A;  4C2X A;  4B5P B;  3P2F A;  2OB0 A;  3FIX A;  3TE4 A;  5I0C A;  3JTK A;  5CNP A;  2WUU A;  2FL4 A;  1I1D A;  3PP9 A;  2K5T A;  1YLE A;  1XEB A;  1CM0 A;  4UA3 A;  4NEX A;  4XPD C;  4CAX A;  2QIR A;  1S5K A;  1Y9W A;  1Q2Y A;  3IWE A;  3FNC A;  2JDC A;  2BEI A;  4KVX A;  3TTH A;  4MBU A;  5IB0 A;  2DPT A;  4X5K A;  2J8M A;  2HUZ A;  5JPH A;  3T9Y A;  2Z3O A;  3DDD A;  2Z0Z A;  3ZJ0 A;  1ZO0 A;  4KLW A;  4HKF A;  3R96 A;  2B4B A;  2O28 A;  4FD4 A;  3FBU A;  2JEV A;  3I3G A;  2VI7 A;  2YGW A;  3H4Q A;  3MGD A;  3FRM A;  4NCZ A;  5IX3 A;  3TOA A;  2VQY A;  4KOY A;  2J8N A;  4RS2 A;  2NMT A;  1S7N A;  2ZW4 A;  4KOX A;  4B11 A;  4CRZ B;  2AE6 A;  3JUW A;  4CAW A;  1S60 A;  4XNH C;  4MY3 A;  2D4O A;  3TFY A;  2OZU A;  2I79 A;  2B4D B;  4QUS A;  1XIX A;  3S6G A;  1FY7 A;  3DR8 A;  4MHD A;  3SXN A;  2YNC A;  3DR6 A;  4NF1 A;  1IYL A;  4U5Y A;  5F49 A;  1Z4E A;  3W6S A;  1I12 A;  2Z10 A;  4C2Y A;  2CNM A;  4CS0 B;  3KKW A;  4CYP A;  2Z3M A;  3F5B A;  2R98 A;  4IUS A;  2ARH A;  1BOB A;  2DXQ A;  1PUA A;  1PU9 A;  4CAV A;  2ZW6 A;  3P2H A;  4DNC A;  3IU2 A;  3R9G A;  4KOW A;  3S6K A;  5KTA A;  4MFK A;  2PSW A;  1IIC A;  1Q2D A;  2VZY A;  1L0C A;  1MK4 A;  2ZPA A;  4Q36 A;  4B12 A;  4ONU A;  2VEZ A;  2EVN A;  2PRB A;  2YNC C;  3W6X A;  4MFL A;  3PGP A;  2WSA A;  5ISV A;  2Y0M A;  3FB3 A;  4E8O A;  3CXP A;  3DNS A;  3EXN A;  4JWP A;  1VKC A;  4UWI A;  4C2Z A;  2AJ6 A;  1N71 A;  4CGL A;  4QBJ A;  3E0K A;  3W91 A;  1IYK A;  5J8F A;  5G21 A;  1YVO A;  4B5O A;  3R9E A;  2Q0Y A;  1IB1 E;  2RC4 A;  3F8K A;  5HMN A;  3QB8 A;  4CGM A;  4RI1 A;  1B87 A;  3EC4 A;  2P6F A;  4L89 A;  4UCN A;  5AG6 A;  1I21 A;  2JLM A;  3GKR A;  4I49 A;  4CGO A;  4UBR A;  5AG4 A;  3D2M A;  2REE A;  1M4G A;  4Y49 C;  3V8I A;  3K9U A;  2PDO A;  4R87 A;  4QVT A;  4KSA A;  1NMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...