1M44A

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-apo structure
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
177
structure length
177
Chain Sequence
VHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 2'-N-acetyltransferase
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 47
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m44A00
3SXNA 3I9SA 2CNTA 2O28A 3DR6A 3NE7A 1I1DA 4KVOE 2Q04A 1UFHA 4AG9A 3R9GA 2WPWA 3PP9A 4HNYB 4NF1A 1LRZA 1YX0A 2ZW7A 4AG7A 2B58A 1IYKA 2B5GB 3D2PA 1J4JA 4ONUA 2OU2A 2Q4YA 3BJ7A 3FB3A 1CM0A 1Q2DA 2JLMA 4KZTA 4L8AA 2JDCA 5C82A 1YVOA 3RYOA 3TTHA 5DWNA 3VWEA 3KKWA 3P2HA 5ISVA 1Y9WA 3N7ZA 4H6UA 4MJ8A 2B4DA 3DSBA 2ZPAA 4ZBGA 2OZHA 4HNWB 2FS5A 4Y49C 1S7FA 3FNCA 5F47A 4MY3A 2F5IA 4YGOA 1KUVA 3EO4A 4PV6A 3UY5A 3R1KA 3FRMA 2A4NA 3TO7A 1QSNA 1YR0A 3QAHA 1TIQA 4QBJA 2P6GA 5E96A 3IWGA 2ZXVA 3MGDA 4KOUA 1YGHA 2PC1A 4LUAA 3K9UA 2BSWA 3P2FA 2Q0YA 3TOAA 2AE6A 4JXRA 3EXNA 3R9FA 3QB8A 3EC4A 4PK2A 4JXQA 3SXOA 3D2MA 2VI7A 1Q2CA 4FD4A 4R87A 1CJWA 1IB1E 3TT2A 1V0CA 5F48A 2R8VA 2B4DB 1NE9A 4X5KA 1K4JA 5IB0A 1S7LA 2FE7A 4KLVA 4JD6A 1YREA 4MBUA 2P6FA 4MY0A 2J8MA 3G8WA 5KTAA 4U9ZA 3F5BA 3DR8A 3LODA 2FXFA 3TO6A 2FCKA 4KLWA 4F0YA 3C26A 3IGRA 3TE4A 2CNMA 2H5MA 5H84A 2FL4A 2Q44A 4CAXA 2ARHA 1QSMA 2PR8A 4KOYA 1KUXA 2FSRA 1Z4RA 4E2AA 3EFAA 1VKCA 5DWMA 4L89A 2I00A 2REEA 2GIVA 1XIXA 2QIRA 1IIDA 2FIWA 4RI1A 5J8CA 1XEBA 3G3SA 4PSWA 1IICA 4F6AA 4KUAA 2BEIA 1S3ZA 4ORFA 2PSWA 1Z9UA 3LD2A 3ZJ0A 1QSTA 3D3SA 4NCZA 4JWPA 1KZFA 4XPDB 2IL4A 4NXYA 4R57A 1I21A 1XMTA 4UWIA 1S7NA 2PDOA 1RO5A 1QSOA 4YFJA 1WK4A 2HUZA 3GKRA 3B8GA 2D4OA 2DXQA 1GHEA 2BL1A 3CXPA 2QECA 3WR7A 4XNHB 3CXQA 4R3KA 4XNHC 1I12A 1MJBA 2CY2A 2J8RA 4H89A 3VWDA 1PU9A 4FD7A 4AVAA 3FIXA 2Z11A 2OB0A 1MJ9A 4XPLA 4FD6A 2R98A 3D8PA 2ATRA 5JPHA 4CRZB 3SHPA 5KTCA 1P0HA 4AB7A 5J8FA 1Y7RA 3TO9A 4E0AA 3FYNA 2VXKA 3CXSA 3S6GA 1KUYA 2J8NA 2VEZA 2Q4VA 4HNXB 1S7KA 4CS0B 4CRYB 5F49A 2C27A 2VZZA 4UA3A 1YLEA 4OLLA 2VQYA 2HQYA 2ZW6A 4KOVA 4YRHA 4KORA 2G0BA 1MJAA 4QB9A 3BJ8A 1BOBA 1MK4A 4AVBA 3BLNA 4LX9A 3R9EA 3W6SA 2B3UA 5C88A 1ON0A 3TFYA 2K5TA 1Y9KA 2VZYA 5HH1A 4IUSA 1M1DA 5HMNA 4KOTA 2Z10A 2JEVA 2PRBA 4QUSA 4HKFA 3ZZIA 4R9MA 2GANA 2X7BA 3DNSA 2OZGA 1L0CA 1BO4A 3JUWA 2R7HA 1M4DA 2B4BA 4QVTA 2Z0ZA 1WWZA 4E8OA 4MHDA 1B87A 3E0KA 4RS2A 2OH1A 1P4NA 2OZUA 3OWCA 4J3GA 2R1IA 2VBQA 3R96A 4UBRA 4II9A 4OAEA 4KVXA 3W91A 2REFA 3F0AA 4PSXA 5EC4A 1Q2YA 3H4QA 4B5PA 4UWJA 4XPDC 4NSQA 2ZW5A 2P6EA 1B6BA 4R3LA 2FIAA 3DDDA 3GY9A 1M44A 1YK3A 1S5KA 1IYLA 3S6KA 2HV2A 1U6MA 1OZPA 5CNPA 3PZJA 1SQHA 1XF8A 2WPXA 3FXTA 2RC4A 4Y49B 3W6XA 1YVKA 5GCNA 1RXTA 2JDDA 1M4GA 3JVNA 2G3TA 4IF5A 1N71A 3R95A 4JJXA 2AJ6A 2B3VA 3T9YA 4XPKA 4KVME 5EBVA 1S60A 1PUAA 3TOBA 5F46A 1VHSA 5H86A 1NMTA 1R57A 4AVCA 2B5GA 5KTDA 4KUBA 2I79A 3PGPA 3GYAA 3F8KA 4B5PB 4MI4A 4EVYA 4U9YA 1FY7A 2GE3A 2CNSA 4JLYA 5IX3A 2PQ8A 4DNCA 4KOWA 4B5OA 2Q7BA 4NEXA 2PR1A 2BUEA 4FD5A 3I3GA 1NSLA 3EY5A 4QC6A 2FT0A 4KOXA 4M85A 4OADA 2KCWA 4CAWA 2QMLA 1QSRA 1XE4A 3TCVA 4BMHA 2D4PA 1Z4EA 3S6HA 5JQ4A 4CAVA 4K30A 4U5YA 4H6ZA 4PK3A 2Y0MA 2P0WA 4I49A 5I0CA 4KOSA 5FVJA 1M4IA 2EVNA 3FBUA 3V8IA 2ZW4A 3S6FA 4M3SA 3T90A 4GS4A 2G3AA 2NMTA 2EUIA 5IV0A
chains in the Genus database with same CATH superfamily
4Q38A 3SXNA 3SJFA 3I9SA 2CNTA 2O28A 2PJBA 3DR6A 3PB6X 4A2ZA 4JZ0A 3NE7A 4EFDA 1I1DA 4KVOE 1YW4A 2F7VA 2PIYA 2OOTA 1BPMA 5ELYA 2Q04A 1UFHA 4AG9A 3R9GA 2WPWA 3PP9A 4MFZA 5A27A 3BI0A 2J9AA 3IU1A 4HNYB 2QJ8A 3B35A 4RN7A 3KHZA 4NF1A 3WABA 1LRZA 1YX0A 1YMEA 2XEGA 3BHXA 3KL9A 2ZW7A 4AG7A 4CAEA 2B58A 1IYKA 2B5GB 3D2PA 1J4JA 4K3NA 3TX8A 4CGOA 4ONUA 2I3CA 2OU2A 4OP4A 2Q4YA 3PB8X 2QVPA 3BJ7A 3FB3A 1CM0A 1Q2DA 3IJ3A 3HUVA 2JLMA 4KZTA 3IEHA 2O4HA 4L8AA 2JEWA 2JDCA 5C82A 2F8HA 1YVOA 3FEDA 3SJEA 3RYOA 3TTHA 3VATA 1HDUA 5DWNA 4F8ZA 4ZX9A 4R8FA 2DPTA 3V7ZA 4P6YA 3FEEA 3VWEA 3KKWA 3SI2A 3P2HA 5ISVA 3VH9A 1PYTB 1Y9WA 1R43A 3N7ZA 5LRKA 1KWMA 4H6UA 4MJ8A 2B4DA 3DSBA 1OBRA 4UCPA 4TNUA 3LMSA 2YNCA 2ZEEA 3NE8A 4B11A 4JYWA 2ZPAA 4ZBGA 4A39A 2OZHA 4NFRA 4HNWB 4F9VA 2FS5A 4UFWA 4DYOA 3CT9A 4Y49C 1S7FA 3FNCA 4MXUA 5F47A 2V77A 2QYVA 4MY3A 2F5IA 4GXHA 4YGOA 1KUVA 3EO4A 5THWA 4PV6A 1ZG9A 3IU2A 3RO0A 4UFVA 1IGBA 3IWEA 3UY5A 2V8VA 4ZX8A 3R1KA 3FRMA 3SI1A 4FUUA 2A4NA 3TO7A 1QSNA 1YR0A 4KSFA 1F2PA 1TIQA 3QAHA 3QAYA 3SI0A 5F09A 4QBJA 3SJXA 1ZO0A 2P6GA 5E96A 1ELMP 2ZEGA 3IWGA 2ZXVA 5G1ZA 4B12A 4ZY1A 3MGDA 4KOUA 4FBEA 2EBJA 1YGHA 3MRUA 2PC1A 2NSMA 4LUAA 3K9UA 4MFKA 3WC7A 2BSWA 2EWBA 2Z3OA 3P2FA 2Q0YA 1GYTA 2AFSA 1Y0YA 3TOAA 1IOFA 4A37A 3WC6A 2AE6A 4JXRA 3EXNA 5LYDA 1QQ9A 5HVFA 3R9FA 3QB8A 3EC4A 5JM6A 1DTDA 4MCSA 3NFZA 4JXQA 4PK2A 4NGTA 3D2MA 3SXOA 4TWEA 2VI7A 1Q2CA 4FD4A 4R87A 1CJWA 1IB1E 4UF4A 3CZXA 2Z3LA 3TT2A 3V38A 3BI1A 2C6PA 4P10A 2GLJA 3KGQA 4CYQA 1V0CA 5F48A 1XBUA 2R8VA 1YLOA 4DUKA 3I1UA 5LYLA 2CIJA 2B4DB 2PJCA 4R6TA 3DLJA 1NE9A 4X5KA 2PE3A 2GU2A 1K4JA 2YNCC 3D7HA 5IB0A 4UEEA 4WJBA 1S7LA 3FJUA 3D7DA 1CX8A 2AFMA 4B14A 2FE7A 3A9LA 2Q43A 4A94A 2CTCA 3GLJA 4KLVA 4JD6A 1XMBA 1YREA 4MBUA 1LAMA 4YWYA 2P6FA 4MY0A 6CPAA 4OKOA 2J8MA 3FF3A 3G8WA 5KTAA 4U9ZA 1JQGA 4A31A 3NH8A 3F5BA 4LQGA 4G1PA 3DR8A 3LODA 2FXFA 3TO6A 2FCKA 1Z8TA 4KLWA 4NGPA 1TKFA 4F0YA 3H8GA 2ZEFA 2AFXA 3C26A 3IGRA 2O53A 5AGEA 5D8NA 1VIXA 2CNMA 2H5MA 1Z8XA 4P4FA 5H84A 3TE4A 1ZLHA 2FL4A 3KASA 4KSIA 1X12A 2Q44A 2VL1A 2ANPA 2WUUA 2ARHA 4H2KA 1QSMA 2CXAA 2PCUA 2ZENA 3NH5A 2PR8A 3B3WA 1XRYA 2C6GA 4KOYA 2GLFA 3KQZA 4R7MA 5CPAA 1KUXA 3FX6A 1RTQA 2FSRA 3WT4A 1Z4RA 5LRGA 4UFXA 2YNDA 1Y7EA 3EFAA 4PXDA 1VKCA 3GIUA 1BLLE 4E2AA 3KQXA 5DWMA 4MHZA 3KI9A 4L89A 2I00A 2EK9A 2REEA 2GIVA 1XIXA 4Q36A 4P45A 2QIRA 1IIDA 1F2OA 2DF5A 3BXMA 2FIWA 4RI1A 5J8CA 1XEBA 3G3SA 4PSWA 1IICA 4F6AA 3FECA 2OR4A 4KUAA 2BEIA 1S3ZA 3MN8A 4ORFA 4FAIA 2PSWA 1LCPA 1TF9A 4C7HA 4ZYQA 1A2ZA 4IHMA 1Z9UA 3LD2A 3ZJ0A 1QSTA 3KR5A 2PJ5A 5AG4A 3D3SA 4LQ6A 1VHEA 4NCZA 4JWPA 1KZFA 3H8EA 2BCOA 5K8MA 4XPDB 2IL4A 2AFWA 2CF4A 1XOVA 5J1QA 1YSJA 2IQ6A 3IFEA 4NXYA 4R57A 2DEAA 1I21A 2WYRA 4HPSA 1XMTA 4UWIA 4CGMA 3CPXA 1S7NA 1Y0RA 2PDOA 1RO5A 3DGVA 5AG5A 3LACA 1QSOA 3H8FA 5CBMA 2Q7SA 1WK4A 3IC1A 4YFJA 2ZEOA 2HUZA 2PJ2A 3GKRA 4MFLA 3B8GA 4OC3A 2D4OA 2ZOFA 3PBEA 2PJ6A 4BINA 2DXQA 1GHEA 2AFUA 2BL1A 3CXPA 2QECA 3HLPA 3PFOA 3WR7A 4EMEA 2YGWA 4XNHB 3CXQA 3B3TA 4R3KA 4XNHC 3WC5A 1I12A 1TKHA 5HVHA 4NGRA 3IWWA 1MJBA 2CY2A 2J8RA 4H89A 4P4BA 3VWDA 1PU9A 4FD7A 4AVAA 2HC9A 3FIXA 2Z11A 2OB0A 1MJ9A 2Z3MA 4Z65A 4IK2A 4NGMA 2PJ4A 4F9UA 2RFHA 4B13A 5A28A 1JWQA 4XPLA 4FD6A 2R98A 1LFWA 1AUGA 3D8PA 1X10A 1DE4C 5IB9A 1LOKA 2ATRA 2CTBA 4CRZB 5JPHA 2NYQA 4OMEA 4MRIA 2EK8A 3SHPA 4X8IA 5KTCA 5G21A 4KS9A 3SJGA 1P0HA 2BOAA 7CPAA 5HXDA 4AXVA 4AB7A 5J8FA 5D29A 1Y7RA 3TO9A 4E0AA 1VGYA 1R3NA 2VXKA 3CXSA 3FYNA 3T8WA 4BBHA 4MHYA 3S6GA 4DJLA 5K8PA 1KUYA 2J8NA 4MFJA 3RZAA 2PJ0A 2VEZA 3RNZA 2Q4VA 1CBXA 4HNXB 2YNEA 1S7KA 4CS0B 4CRYB 5F49A 4A30A 2C27A 2VZZA 1AYEA 4UA3A 1YLEA 4OLLA 2ZEHA 4BD9A 1EE3P 2VQYA 2HQYA 4CYPA 2ZW6A 4KOVA 4YRHA 3RBUA 4KORA 2G0BA 1MJAA 1ZG8A 3CDXA 4QB9A 3BJ8A 4WWVA 1BOBA 1MK4A 2PVVA 4AVBA 4CGNA 4ZGYB 3BLNA 4OC1A 1Z8LA 4LX9A 1HDQA 2XEIA 4C2YA 2RB7A 4RUHA 3D7GA 4KSAA 3R9EA 3W6SA 2GFQA 2B3UA 3GUXA 5C88A 4A33A 1ON0A 4MHPA 2PRQA 4A38A 3TFYA 3K9TA 1FT7A 1TKJA 4MFQA 2AFOA 2K5TA 5LRJA 1Y9KA 2V8DA 2VZYA 3D4UA 3PB7X 3D68A 4IUSA 1M1DA 5HH1A 1TF8A 2XEJA 5HMNA 1ARMA 2PJ7A 4KOTA 2Z10A 2BO9A 2JBKA 4MCQA 2PJ9A 4P4EA 2JEVA 1CP6A 1VHOA 2PRBA 4HKFA 4QUSA 2PIZA 3H5ZA 3ZZIA 4R9MA 2GANA 3B3VA 3PB9X 4MMOA 4GM5A 4OC5A 1XJOA 1LAPA 2X7BA 2ZEMA 3DNSA 2OZGA 3N5FA 3PRTA 4OIWA 1L0CA 1BO4A 4A32A 1ZLIA 3KHXA 4PQAA 4ZY2A 4C7IA 2ZEDA 3JUWA 5AG7A 1BAVA 4UCNA 2R7HA 1YW6A 1M4DA 2B4BA 4QVTA 2Z0ZA 4YU9A 5K8OA 2Z3NA 1WWZA 2PJ1A 3PBBA 2ABZA 4CGLA 4FWUA 3VARA 4E8OA 4MHDA 2V8GA 4PXEA 1B87A 1CPXA 3PEIA 4B6ZA 3E0KA 4RS2A 2OH1A 4MFPA 2WSAA 4X3RA 1P4NA 2OZUA 1IY7A 3OWCA 2R1IA 2VBQA 4J3GA 3R96A 4UBRA 4II9A 2EO8A 4KVXA 1CPSA 2REFA 4OAEA 3W91A 5JH9A 1AMPA 3F0AA 2Q4ZA 4PSXA 3JTKA 1Q7LA 5EC4A 2JBJA 4MHNA 1Q2YA 3PFEA 3H4QA 4B5PA 2IMOA 4UWJA 4PXCA 4XPDC 1H8LA 4NSQA 2Q51A 2ZW5A 3B7IA 1IU8A 3D66A 2P6EA 1B6BA 4R3LA 5I4MA 2FIAA 3DDDA 3GY9A 1M44A 1YK3A 2ZELA 4P4DA 1S5KA 4NJQA 4P44A 3ISXA 3ISZA 1IYLA 3KR4A 3S6KA 2HB6A 4CPAA 4PPZA 2HV2A 1QMUA 2AFZA 4CAXA 1U6MA 1ZG7A 1CP7A 1OZPA 5CNPA 2FVGA 4OIDA 5G20A 5BWAB 3PZJA 1SQHA 1XF8A 3FMCA 3B3SA 2WPXA 4OC2A 5JGFA 3QNVA 4NGNA 5K8NA 3GB0A 1LANA 3IO1A 3FXTA 3PB4X 4NJRA 2PVWA 2RC4A 1HEEA 4Y49B 3W6XA 1YVKA 4ZI6A 5GCNA 1RXTA 1ARLA 4MCRA 5LYFA 2PJ8A 2JDDA 2Z3KA 4OC4A 1M4GA 2Z3PA 3L2NA 3JVNA 4UEZA 4C68A 2G3TA 2ODFA 4IF5A 4B10A 1N71A 4UEFA 2G9DA 2ZOGA 3IIBA 3R95A 2PJ3A 5LYIA 3D7FA 4JJXA 2AJ6A 2B3VA 1UWYA 3NA6A 3T9YA 5HVGA 3K2KA 4M6HA 1Z2LA 1BPNA 2V8HA 4M6GA 4C2XA 4XPKA 4KVME 1CG2A 5EBVA 5AG6A 1S60A 1PUAA 3TOBA 3S9NA 5F46A 1VHSA 5H86A 4A95A 4W9YA 4ZY0A 3FVLA 1NMTA 1R57A 1Z8WA 4CYNA 4UCMA 4AVCA 1F57A 2B5GA 5KTDA 1PCAA 4IAVA 2I79A 3PGPA 4KUBA 3FH4A 3GYAA 3RAMA 3F8KA 5EMIA 2POKA 1IOIA 3D67A 1FNOA 4B5PB 1YQEA 4MI4A 4P4JA 1ELLP 1XFOA 4EVYA 4U9YA 1FY7A 2GE3A 4UIAA 2CNSA 2GREA 4JLYA 5IX3A 2PQ8A 4F0XA 3S9LA 2IJZA 4OC0A 4PXBA 2XEFA 4CYOA 4DNCA 4KOWA 4B5OA 2ZEPA 2Q7BA 3JRUA 4NEXA 2PR1A 4Q7AA 4EWTA 2BUEA 4FD5A 3I3GA 1NSLA 4CAFA 1TXRA 3EY5A 4QC6A 2FT0A 4KOXA 4M85A 8CPAA 3NH4A 4P4IA 3B2YA 4OADA 4ONWA 3S9MA 2KCWA 1Z5RA 4MCPA 2WZNA 4CAWA 1M4LA 5DS0A 2QMLA 1QSRA 1XE4A 3TCVA 4BMHA 2D4PA 1Z4EA 3S6HA 5JQ4A 4CAVA 4K30A 4U5YA 4H6ZA 4PK3A 2Y0MA 3B3CA 2C6CA 4C2ZA 2P0WA 4NGSA 3LWUA 4CGPA 4I49A 5I0CA 4KOSA 4NGQA 5G22A 4O23A 2C1CA 5FVJA 1M4IA 4X2TA 2EVNA 2PJAA 3FBUA 4UIBA 3KZWA 3V8IA 2ZW4A 3S6FA 4M3SA 3T90A 3TC8A 4R76A 3CPAA 1NSAA 4GS4A 2G3AA 2NMTA 4M6IA 2EUIA 2DPSA 5IV0A
chains in the Genus database with same CATH topology
4Q38A 3SXNA 3I9SA 2CNTA 2O28A 3DR6A 4A2ZA 3NE7A 1I1DA 4KVOE 2Q04A 1UFHA 4AG9A 3R9GA 2WPWA 3PP9A 4MFZA 5A27A 4HNYB 3IU1A 4NF1A 1LRZA 1YX0A 4CAEA 2ZW7A 4AG7A 2B58A 1IYKA 2B5GB 3D2PA 1J4JA 4CGOA 4ONUA 2OU2A 2Q4YA 3BJ7A 3FB3A 1CM0A 1Q2DA 2JLMA 4KZTA 4L8AA 2JDCA 5C82A 1YVOA 3RYOA 3TTHA 5DWNA 2DPTA 3VWEA 3KKWA 3P2HA 5ISVA 1Y9WA 3N7ZA 4H6UA 4MJ8A 2B4DA 3DSBA 4UCPA 2YNCA 4B11A 2ZPAA 4ZBGA 2OZHA 4HNWB 2FS5A 4UFWA 4Y49C 1S7FA 3FNCA 5F47A 4MY3A 2F5IA 4YGOA 1KUVA 3EO4A 4PV6A 3IU2A 4UFVA 3IWEA 3UY5A 3R1KA 3FRMA 2A4NA 3TO7A 1QSNA 1YR0A 4KSFA 3QAHA 1TIQA 4QBJA 1ZO0A 2P6GA 5E96A 3IWGA 2ZXVA 5G1ZA 4B12A 3MGDA 4KOUA 1YGHA 2PC1A 4LUAA 3K9UA 4MFKA 2BSWA 2Z3OA 3P2FA 2Q0YA 3TOAA 2AE6A 4JXRA 3EXNA 3R9FA 3QB8A 3EC4A 4PK2A 4JXQA 3SXOA 3D2MA 2VI7A 1Q2CA 4FD4A 4R87A 1CJWA 1IB1E 2Z3LA 3TT2A 4CYQA 1V0CA 5F48A 2R8VA 2B4DB 1NE9A 4X5KA 1K4JA 2YNCC 5IB0A 1S7LA 4B14A 2FE7A 3A9LA 4KLVA 4JD6A 1YREA 4MBUA 2P6FA 4MY0A 2J8MA 3G8WA 5KTAA 4U9ZA 4A31A 3F5BA 3DR8A 3LODA 2FXFA 3TO6A 2FCKA 4KLWA 4F0YA 3C26A 3IGRA 5AGEA 3TE4A 2CNMA 2H5MA 5H84A 2FL4A 2Q44A 4CAXA 2WUUA 2ARHA 1QSMA 2CXAA 2PR8A 4KOYA 1KUXA 2FSRA 1Z4RA 4UFXA 2YNDA 4E2AA 3EFAA 1VKCA 5DWMA 4L89A 2I00A 2REEA 2GIVA 1XIXA 4Q36A 2QIRA 1IIDA 2FIWA 4RI1A 5J8CA 1XEBA 3G3SA 4PSWA 1IICA 4F6AA 4KUAA 2BEIA 1S3ZA 4ORFA 2PSWA 4C7HA 1Z9UA 3LD2A 3ZJ0A 1QSTA 5AG4A 3D3SA 4NCZA 4JWPA 1KZFA 4XPDB 2IL4A 4NXYA 4R57A 1I21A 1XMTA 4UWIA 4CGMA 1S7NA 2PDOA 5AG5A 1RO5A 1QSOA 4YFJA 1WK4A 2HUZA 3GKRA 4MFLA 3B8GA 2D4OA 2DXQA 1GHEA 2BL1A 3CXPA 2QECA 3WR7A 2YGWA 4XNHB 3CXQA 4R3KA 4XNHC 1I12A 1MJBA 2CY2A 2J8RA 4H89A 3VWDA 1PU9A 4FD7A 4AVAA 3FIXA 2Z11A 2OB0A 1MJ9A 2Z3MA 4B13A 5A28A 4XPLA 4FD6A 2R98A 3D8PA 2ATRA 5JPHA 4CRZB 3SHPA 5KTCA 5G21A 4KS9A 1P0HA 4AB7A 5J8FA 1Y7RA 3TO9A 4E0AA 3FYNA 2VXKA 3CXSA 4BBHA 3S6GA 1KUYA 2J8NA 4MFJA 2VEZA 2Q4VA 4HNXB 2YNEA 1S7KA 4CS0B 4CRYB 5F49A 4A30A 2C27A 2VZZA 4UA3A 1YLEA 4OLLA 2VQYA 2HQYA 4CYPA 2ZW6A 4KOVA 4YRHA 4KORA 2G0BA 1MJAA 4QB9A 3BJ8A 1BOBA 1MK4A 4AVBA 4CGNA 4ZGYB 3BLNA 4LX9A 4C2YA 4KSAA 3R9EA 3W6SA 2B3UA 5C88A 4A33A 1ON0A 3TFYA 4MFQA 2K5TA 1Y9KA 2VZYA 5HH1A 4IUSA 1M1DA 5HMNA 4KOTA 2Z10A 2JEVA 2PRBA 4QUSA 4HKFA 3H5ZA 3ZZIA 4R9MA 2GANA 2X7BA 3DNSA 2OZGA 1L0CA 1BO4A 4A32A 4C7IA 3JUWA 5AG7A 4UCNA 2R7HA 1M4DA 2B4BA 4QVTA 2Z0ZA 2Z3NA 1WWZA 4CGLA 4E8OA 4MHDA 1B87A 3E0KA 4RS2A 2OH1A 4MFPA 2WSAA 1P4NA 2OZUA 3OWCA 4J3GA 2R1IA 2VBQA 3R96A 4UBRA 4II9A 4OAEA 4KVXA 3W91A 2REFA 3F0AA 4PSXA 3JTKA 5EC4A 1Q2YA 3H4QA 4B5PA 4UWJA 4XPDC 4NSQA 2ZW5A 2P6EA 1B6BA 4R3LA 2FIAA 3DDDA 3GY9A 1M44A 1YK3A 1S5KA 1IYLA 3S6KA 2HV2A 1U6MA 1OZPA 5CNPA 5G20A 5BWAB 3PZJA 1SQHA 1XF8A 2WPXA 3FXTA 2RC4A 4Y49B 3W6XA 1YVKA 5GCNA 1RXTA 2JDDA 2Z3KA 1M4GA 2Z3PA 3JVNA 4C68A 2G3TA 4IF5A 4B10A 1N71A 3R95A 4JJXA 2AJ6A 2B3VA 3T9YA 4C2XA 4XPKA 4KVME 5EBVA 5AG6A 1S60A 1PUAA 3TOBA 5F46A 1VHSA 5H86A 4A95A 1NMTA 1R57A 4CYNA 4UCMA 4AVCA 2B5GA 5KTDA 4KUBA 2I79A 3PGPA 3GYAA 3F8KA 4B5PB 4MI4A 4EVYA 4U9YA 1FY7A 2GE3A 2CNSA 4JLYA 5IX3A 2PQ8A 4F0XA 4CYOA 4DNCA 4KOWA 4B5OA 2Q7BA 4NEXA 2PR1A 2BUEA 4FD5A 3I3GA 1NSLA 4CAFA 3EY5A 4QC6A 2FT0A 4KOXA 4M85A 4OADA 2KCWA 4CAWA 2QMLA 1QSRA 1XE4A 3TCVA 4BMHA 2D4PA 1Z4EA 3S6HA 5JQ4A 4CAVA 4K30A 4U5YA 4H6ZA 4PK3A 2Y0MA 4C2ZA 2P0WA 4CGPA 4I49A 5I0CA 4KOSA 5G22A 5FVJA 1M4IA 2EVNA 3FBUA 3V8IA 2ZW4A 3S6FA 4M3SA 3T90A 4GS4A 2G3AA 2NMTA 2EUIA 2DPSA 5IV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXN A;  3I9S A;  2CNT A;  2O28 A;  3DR6 A;  3NE7 A;  1I1D A;  4KVO E;  2Q04 A;  1UFH A;  4AG9 A;  3R9G A;  2WPW A;  3PP9 A;  4HNY B;  4NF1 A;  1LRZ A;  1YX0 A;  2ZW7 A;  4AG7 A;  2B58 A;  1IYK A;  2B5G B;  3D2P A;  1J4J A;  4ONU A;  2OU2 A;  2Q4Y A;  3BJ7 A;  3FB3 A;  1CM0 A;  1Q2D A;  2JLM A;  4KZT A;  4L8A A;  2JDC A;  5C82 A;  1YVO A;  3RYO A;  3TTH A;  5DWN A;  3VWE A;  3KKW A;  3P2H A;  5ISV A;  1Y9W A;  3N7Z A;  4H6U A;  4MJ8 A;  2B4D A;  3DSB A;  2ZPA A;  4ZBG A;  2OZH A;  4HNW B;  2FS5 A;  4Y49 C;  1S7F A;  3FNC A;  5F47 A;  4MY3 A;  2F5I A;  4YGO A;  1KUV A;  3EO4 A;  4PV6 A;  3UY5 A;  3R1K A;  3FRM A;  2A4N A;  3TO7 A;  1QSN A;  1YR0 A;  3QAH A;  1TIQ A;  4QBJ A;  2P6G A;  5E96 A;  3IWG A;  2ZXV A;  3MGD A;  4KOU A;  1YGH A;  2PC1 A;  4LUA A;  3K9U A;  2BSW A;  3P2F A;  2Q0Y A;  3TOA A;  2AE6 A;  4JXR A;  3EXN A;  3R9F A;  3QB8 A;  3EC4 A;  4PK2 A;  4JXQ A;  3SXO A;  3D2M A;  2VI7 A;  1Q2C A;  4FD4 A;  4R87 A;  1CJW A;  1IB1 E;  3TT2 A;  1V0C A;  5F48 A;  2R8V A;  2B4D B;  1NE9 A;  4X5K A;  1K4J A;  5IB0 A;  1S7L A;  2FE7 A;  4KLV A;  4JD6 A;  1YRE A;  4MBU A;  2P6F A;  4MY0 A;  2J8M A;  3G8W A;  5KTA A;  4U9Z A;  3F5B A;  3DR8 A;  3LOD A;  2FXF A;  3TO6 A;  2FCK A;  4KLW A;  4F0Y A;  3C26 A;  3IGR A;  3TE4 A;  2CNM A;  2H5M A;  5H84 A;  2FL4 A;  2Q44 A;  4CAX A;  2ARH A;  1QSM A;  2PR8 A;  4KOY A;  1KUX A;  2FSR A;  1Z4R A;  4E2A A;  3EFA A;  1VKC A;  5DWM A;  4L89 A;  2I00 A;  2REE A;  2GIV A;  1XIX A;  2QIR A;  1IID A;  2FIW A;  4RI1 A;  5J8C A;  1XEB A;  3G3S A;  4PSW A;  1IIC A;  4F6A A;  4KUA A;  2BEI A;  1S3Z A;  4ORF A;  2PSW A;  1Z9U A;  3LD2 A;  3ZJ0 A;  1QST A;  3D3S A;  4NCZ A;  4JWP A;  1KZF A;  4XPD B;  2IL4 A;  4NXY A;  4R57 A;  1I21 A;  1XMT A;  4UWI A;  1S7N A;  2PDO A;  1RO5 A;  1QSO A;  4YFJ A;  1WK4 A;  2HUZ A;  3GKR A;  3B8G A;  2D4O A;  2DXQ A;  1GHE A;  2BL1 A;  3CXP A;  2QEC A;  3WR7 A;  4XNH B;  3CXQ A;  4R3K A;  4XNH C;  1I12 A;  1MJB A;  2CY2 A;  2J8R A;  4H89 A;  3VWD A;  1PU9 A;  4FD7 A;  4AVA A;  3FIX A;  2Z11 A;  2OB0 A;  1MJ9 A;  4XPL A;  4FD6 A;  2R98 A;  3D8P A;  2ATR A;  5JPH A;  4CRZ B;  3SHP A;  5KTC A;  1P0H A;  4AB7 A;  5J8F A;  1Y7R A;  3TO9 A;  4E0A A;  3FYN A;  2VXK A;  3CXS A;  3S6G A;  1KUY A;  2J8N A;  2VEZ A;  2Q4V A;  4HNX B;  1S7K A;  4CS0 B;  4CRY B;  5F49 A;  2C27 A;  2VZZ A;  4UA3 A;  1YLE A;  4OLL A;  2VQY A;  2HQY A;  2ZW6 A;  4KOV A;  4YRH A;  4KOR A;  2G0B A;  1MJA A;  4QB9 A;  3BJ8 A;  1BOB A;  1MK4 A;  4AVB A;  3BLN A;  4LX9 A;  3R9E A;  3W6S A;  2B3U A;  5C88 A;  1ON0 A;  3TFY A;  2K5T A;  1Y9K A;  2VZY A;  5HH1 A;  4IUS A;  1M1D A;  5HMN A;  4KOT A;  2Z10 A;  2JEV A;  2PRB A;  4QUS A;  4HKF A;  3ZZI A;  4R9M A;  2GAN A;  2X7B A;  3DNS A;  2OZG A;  1L0C A;  1BO4 A;  3JUW A;  2R7H A;  1M4D A;  2B4B A;  4QVT A;  2Z0Z A;  1WWZ A;  4E8O A;  4MHD A;  1B87 A;  3E0K A;  4RS2 A;  2OH1 A;  1P4N A;  2OZU A;  3OWC A;  4J3G A;  2R1I A;  2VBQ A;  3R96 A;  4UBR A;  4II9 A;  4OAE A;  4KVX A;  3W91 A;  2REF A;  3F0A A;  4PSX A;  5EC4 A;  1Q2Y A;  3H4Q A;  4B5P A;  4UWJ A;  4XPD C;  4NSQ A;  2ZW5 A;  2P6E A;  1B6B A;  4R3L A;  2FIA A;  3DDD A;  3GY9 A;  1M44 A;  1YK3 A;  1S5K A;  1IYL A;  3S6K A;  2HV2 A;  1U6M A;  1OZP A;  5CNP A;  3PZJ A;  1SQH A;  1XF8 A;  2WPX A;  3FXT A;  2RC4 A;  4Y49 B;  3W6X A;  1YVK A;  5GCN A;  1RXT A;  2JDD A;  1M4G A;  3JVN A;  2G3T A;  4IF5 A;  1N71 A;  3R95 A;  4JJX A;  2AJ6 A;  2B3V A;  3T9Y A;  4XPK A;  4KVM E;  5EBV A;  1S60 A;  1PUA A;  3TOB A;  5F46 A;  1VHS A;  5H86 A;  1NMT A;  1R57 A;  4AVC A;  2B5G A;  5KTD A;  4KUB A;  2I79 A;  3PGP A;  3GYA A;  3F8K A;  4B5P B;  4MI4 A;  4EVY A;  4U9Y A;  1FY7 A;  2GE3 A;  2CNS A;  4JLY A;  5IX3 A;  2PQ8 A;  4DNC A;  4KOW A;  4B5O A;  2Q7B A;  4NEX A;  2PR1 A;  2BUE A;  4FD5 A;  3I3G A;  1NSL A;  3EY5 A;  4QC6 A;  2FT0 A;  4KOX A;  4M85 A;  4OAD A;  2KCW A;  4CAW A;  2QML A;  1QSR A;  1XE4 A;  3TCV A;  4BMH A;  2D4P A;  1Z4E A;  3S6H A;  5JQ4 A;  4CAV A;  4K30 A;  4U5Y A;  4H6Z A;  4PK3 A;  2Y0M A;  2P0W A;  4I49 A;  5I0C A;  4KOS A;  5FVJ A;  1M4I A;  2EVN A;  3FBU A;  3V8I A;  2ZW4 A;  3S6F A;  4M3S A;  3T90 A;  4GS4 A;  2G3A A;  2NMT A;  2EUI A;  5IV0 A; 
#chains in the Genus database with same CATH topology
 4Q38 A;  3SXN A;  3SJF A;  3I9S A;  2CNT A;  2O28 A;  2PJB A;  3DR6 A;  3PB6 X;  4A2Z A;  4JZ0 A;  3NE7 A;  4EFD A;  1I1D A;  4KVO E;  1YW4 A;  2F7V A;  2PIY A;  2OOT A;  1BPM A;  5ELY A;  2Q04 A;  1UFH A;  4AG9 A;  3R9G A;  2WPW A;  3PP9 A;  4MFZ A;  5A27 A;  3BI0 A;  2J9A A;  3IU1 A;  4HNY B;  2QJ8 A;  3B35 A;  4RN7 A;  3KHZ A;  4NF1 A;  3WAB A;  1LRZ A;  1YX0 A;  1YME A;  2XEG A;  3BHX A;  3KL9 A;  2ZW7 A;  4AG7 A;  4CAE A;  2B58 A;  1IYK A;  2B5G B;  3D2P A;  1J4J A;  4K3N A;  3TX8 A;  4CGO A;  4ONU A;  2I3C A;  2OU2 A;  4OP4 A;  2Q4Y A;  3PB8 X;  2QVP A;  3BJ7 A;  3FB3 A;  1CM0 A;  1Q2D A;  3IJ3 A;  3HUV A;  2JLM A;  4KZT A;  3IEH A;  2O4H A;  4L8A A;  2JEW A;  2JDC A;  5C82 A;  2F8H A;  1YVO A;  3FED A;  3SJE A;  3RYO A;  3TTH A;  3VAT A;  1HDU A;  5DWN A;  4F8Z A;  4ZX9 A;  4R8F A;  2DPT A;  3V7Z A;  4P6Y A;  3FEE A;  3VWE A;  3KKW A;  3SI2 A;  3P2H A;  5ISV A;  3VH9 A;  1PYT B;  1Y9W A;  1R43 A;  3N7Z A;  5LRK A;  1KWM A;  4H6U A;  4MJ8 A;  2B4D A;  3DSB A;  1OBR A;  4UCP A;  4TNU A;  3LMS A;  2YNC A;  2ZEE A;  3NE8 A;  4B11 A;  4JYW A;  2ZPA A;  4ZBG A;  4A39 A;  2OZH A;  4NFR A;  4HNW B;  4F9V A;  2FS5 A;  4UFW A;  4DYO A;  3CT9 A;  4Y49 C;  1S7F A;  3FNC A;  4MXU A;  5F47 A;  2V77 A;  2QYV A;  4MY3 A;  2F5I A;  4GXH A;  4YGO A;  1KUV A;  3EO4 A;  5THW A;  4PV6 A;  1ZG9 A;  3IU2 A;  3RO0 A;  4UFV A;  1IGB A;  3IWE A;  3UY5 A;  2V8V A;  4ZX8 A;  3R1K A;  3FRM A;  3SI1 A;  4FUU A;  2A4N A;  3TO7 A;  1QSN A;  1YR0 A;  4KSF A;  1F2P A;  1TIQ A;  3QAH A;  3QAY A;  3SI0 A;  5F09 A;  4QBJ A;  3SJX A;  1ZO0 A;  2P6G A;  5E96 A;  1ELM P;  2ZEG A;  3IWG A;  2ZXV A;  5G1Z A;  4B12 A;  4ZY1 A;  3MGD A;  4KOU A;  4FBE A;  2EBJ A;  1YGH A;  3MRU A;  2PC1 A;  2NSM A;  4LUA A;  3K9U A;  4MFK A;  3WC7 A;  2BSW A;  2EWB A;  2Z3O A;  3P2F A;  2Q0Y A;  1GYT A;  2AFS A;  1Y0Y A;  3TOA A;  1IOF A;  4A37 A;  3WC6 A;  2AE6 A;  4JXR A;  3EXN A;  5LYD A;  1QQ9 A;  5HVF A;  3R9F A;  3QB8 A;  3EC4 A;  5JM6 A;  1DTD A;  4MCS A;  3NFZ A;  4JXQ A;  4PK2 A;  4NGT A;  3D2M A;  3SXO A;  4TWE A;  2VI7 A;  1Q2C A;  4FD4 A;  4R87 A;  1CJW A;  1IB1 E;  4UF4 A;  3CZX A;  2Z3L A;  3TT2 A;  3V38 A;  3BI1 A;  2C6P A;  4P10 A;  2GLJ A;  3KGQ A;  4CYQ A;  1V0C A;  5F48 A;  1XBU A;  2R8V A;  1YLO A;  4DUK A;  3I1U A;  5LYL A;  2CIJ A;  2B4D B;  2PJC A;  4R6T A;  3DLJ A;  1NE9 A;  4X5K A;  2PE3 A;  2GU2 A;  1K4J A;  2YNC C;  3D7H A;  5IB0 A;  4UEE A;  4WJB A;  1S7L A;  3FJU A;  3D7D A;  1CX8 A;  2AFM A;  4B14 A;  2FE7 A;  3A9L A;  2Q43 A;  4A94 A;  2CTC A;  3GLJ A;  4KLV A;  4JD6 A;  1XMB A;  1YRE A;  4MBU A;  1LAM A;  4YWY A;  2P6F A;  4MY0 A;  6CPA A;  4OKO A;  2J8M A;  3FF3 A;  3G8W A;  5KTA A;  4U9Z A;  1JQG A;  4A31 A;  3NH8 A;  3F5B A;  4LQG A;  4G1P A;  3DR8 A;  3LOD A;  2FXF A;  3TO6 A;  2FCK A;  1Z8T A;  4KLW A;  4NGP A;  1TKF A;  4F0Y A;  3H8G A;  2ZEF A;  2AFX A;  3C26 A;  3IGR A;  2O53 A;  5AGE A;  5D8N A;  1VIX A;  2CNM A;  2H5M A;  1Z8X A;  4P4F A;  5H84 A;  3TE4 A;  1ZLH A;  2FL4 A;  3KAS A;  4KSI A;  1X12 A;  2Q44 A;  2VL1 A;  2ANP A;  2WUU A;  2ARH A;  4H2K A;  1QSM A;  2CXA A;  2PCU A;  2ZEN A;  3NH5 A;  2PR8 A;  3B3W A;  1XRY A;  2C6G A;  4KOY A;  2GLF A;  3KQZ A;  4R7M A;  5CPA A;  1KUX A;  3FX6 A;  1RTQ A;  2FSR A;  3WT4 A;  1Z4R A;  5LRG A;  4UFX A;  2YND A;  1Y7E A;  3EFA A;  4PXD A;  1VKC A;  3GIU A;  1BLL E;  4E2A A;  3KQX A;  5DWM A;  4MHZ A;  3KI9 A;  4L89 A;  2I00 A;  2EK9 A;  2REE A;  2GIV A;  1XIX A;  4Q36 A;  4P45 A;  2QIR A;  1IID A;  1F2O A;  2DF5 A;  3BXM A;  2FIW A;  4RI1 A;  5J8C A;  1XEB A;  3G3S A;  4PSW A;  1IIC A;  4F6A A;  3FEC A;  2OR4 A;  4KUA A;  2BEI A;  1S3Z A;  3MN8 A;  4ORF A;  4FAI A;  2PSW A;  1LCP A;  1TF9 A;  4C7H A;  4ZYQ A;  1A2Z A;  4IHM A;  1Z9U A;  3LD2 A;  3ZJ0 A;  1QST A;  3KR5 A;  2PJ5 A;  5AG4 A;  3D3S A;  4LQ6 A;  1VHE A;  4NCZ A;  4JWP A;  1KZF A;  3H8E A;  2BCO A;  5K8M A;  4XPD B;  2IL4 A;  2AFW A;  2CF4 A;  1XOV A;  5J1Q A;  1YSJ A;  2IQ6 A;  3IFE A;  4NXY A;  4R57 A;  2DEA A;  1I21 A;  2WYR A;  4HPS A;  1XMT A;  4UWI A;  4CGM A;  3CPX A;  1S7N A;  1Y0R A;  2PDO A;  1RO5 A;  3DGV A;  5AG5 A;  3LAC A;  1QSO A;  3H8F A;  5CBM A;  2Q7S A;  1WK4 A;  3IC1 A;  4YFJ A;  2ZEO A;  2HUZ A;  2PJ2 A;  3GKR A;  4MFL A;  3B8G A;  4OC3 A;  2D4O A;  2ZOF A;  3PBE A;  2PJ6 A;  4BIN A;  2DXQ A;  1GHE A;  2AFU A;  2BL1 A;  3CXP A;  2QEC A;  3HLP A;  3PFO A;  3WR7 A;  4EME A;  2YGW A;  4XNH B;  3CXQ A;  3B3T A;  4R3K A;  4XNH C;  3WC5 A;  1I12 A;  1TKH A;  5HVH A;  4NGR A;  3IWW A;  1MJB A;  2CY2 A;  2J8R A;  4H89 A;  4P4B A;  3VWD A;  1PU9 A;  4FD7 A;  4AVA A;  2HC9 A;  3FIX A;  2Z11 A;  2OB0 A;  1MJ9 A;  2Z3M A;  4Z65 A;  4IK2 A;  4NGM A;  2PJ4 A;  4F9U A;  2RFH A;  4B13 A;  5A28 A;  1JWQ A;  4XPL A;  4FD6 A;  2R98 A;  1LFW A;  1AUG A;  3D8P A;  1X10 A;  1DE4 C;  5IB9 A;  1LOK A;  2ATR A;  2CTB A;  4CRZ B;  5JPH A;  2NYQ A;  4OME A;  4MRI A;  2EK8 A;  3SHP A;  4X8I A;  5KTC A;  5G21 A;  4KS9 A;  3SJG A;  1P0H A;  2BOA A;  7CPA A;  5HXD A;  4AXV A;  4AB7 A;  5J8F A;  5D29 A;  1Y7R A;  3TO9 A;  4E0A A;  1VGY A;  1R3N A;  2VXK A;  3CXS A;  3FYN A;  3T8W A;  4BBH A;  4MHY A;  3S6G A;  4DJL A;  5K8P A;  1KUY A;  2J8N A;  4MFJ A;  3RZA A;  2PJ0 A;  2VEZ A;  3RNZ A;  2Q4V A;  1CBX A;  4HNX B;  2YNE A;  1S7K A;  4CS0 B;  4CRY B;  5F49 A;  4A30 A;  2C27 A;  2VZZ A;  1AYE A;  4UA3 A;  1YLE A;  4OLL A;  2ZEH A;  4BD9 A;  1EE3 P;  2VQY A;  2HQY A;  4CYP A;  2ZW6 A;  4KOV A;  4YRH A;  3RBU A;  4KOR A;  2G0B A;  1MJA A;  1ZG8 A;  3CDX A;  4QB9 A;  3BJ8 A;  4WWV A;  1BOB A;  1MK4 A;  2PVV A;  4AVB A;  4CGN A;  4ZGY B;  3BLN A;  4OC1 A;  1Z8L A;  4LX9 A;  1HDQ A;  2XEI A;  4C2Y A;  2RB7 A;  4RUH A;  3D7G A;  4KSA A;  3R9E A;  3W6S A;  2GFQ A;  2B3U A;  3GUX A;  5C88 A;  4A33 A;  1ON0 A;  4MHP A;  2PRQ A;  4A38 A;  3TFY A;  3K9T A;  1FT7 A;  1TKJ A;  4MFQ A;  2AFO A;  2K5T A;  5LRJ A;  1Y9K A;  2V8D A;  2VZY A;  3D4U A;  3PB7 X;  3D68 A;  4IUS A;  1M1D A;  5HH1 A;  1TF8 A;  2XEJ A;  5HMN A;  1ARM A;  2PJ7 A;  4KOT A;  2Z10 A;  2BO9 A;  2JBK A;  4MCQ A;  2PJ9 A;  4P4E A;  2JEV A;  1CP6 A;  1VHO A;  2PRB A;  4HKF A;  4QUS A;  2PIZ A;  3H5Z A;  3ZZI A;  4R9M A;  2GAN A;  3B3V A;  3PB9 X;  4MMO A;  4GM5 A;  4OC5 A;  1XJO A;  1LAP A;  2X7B A;  2ZEM A;  3DNS A;  2OZG A;  3N5F A;  3PRT A;  4OIW A;  1L0C A;  1BO4 A;  4A32 A;  1ZLI A;  3KHX A;  4PQA A;  4ZY2 A;  4C7I A;  2ZED A;  3JUW A;  5AG7 A;  1BAV A;  4UCN A;  2R7H A;  1YW6 A;  1M4D A;  2B4B A;  4QVT A;  2Z0Z A;  4YU9 A;  5K8O A;  2Z3N A;  1WWZ A;  2PJ1 A;  3PBB A;  2ABZ A;  4CGL A;  4FWU A;  3VAR A;  4E8O A;  4MHD A;  2V8G A;  4PXE A;  1B87 A;  1CPX A;  3PEI A;  4B6Z A;  3E0K A;  4RS2 A;  2OH1 A;  4MFP A;  2WSA A;  4X3R A;  1P4N A;  2OZU A;  1IY7 A;  3OWC A;  2R1I A;  2VBQ A;  4J3G A;  3R96 A;  4UBR A;  4II9 A;  2EO8 A;  4KVX A;  1CPS A;  2REF A;  4OAE A;  3W91 A;  5JH9 A;  1AMP A;  3F0A A;  2Q4Z A;  4PSX A;  3JTK A;  1Q7L A;  5EC4 A;  2JBJ A;  4MHN A;  1Q2Y A;  3PFE A;  3H4Q A;  4B5P A;  2IMO A;  4UWJ A;  4PXC A;  4XPD C;  1H8L A;  4NSQ A;  2Q51 A;  2ZW5 A;  3B7I A;  1IU8 A;  3D66 A;  2P6E A;  1B6B A;  4R3L A;  5I4M A;  2FIA A;  3DDD A;  3GY9 A;  1M44 A;  1YK3 A;  2ZEL A;  4P4D A;  1S5K A;  4NJQ A;  4P44 A;  3ISX A;  3ISZ A;  1IYL A;  3KR4 A;  3S6K A;  2HB6 A;  4CPA A;  4PPZ A;  2HV2 A;  1QMU A;  2AFZ A;  4CAX A;  1U6M A;  1ZG7 A;  1CP7 A;  1OZP A;  5CNP A;  2FVG A;  4OID A;  5G20 A;  5BWA B;  3PZJ A;  1SQH A;  1XF8 A;  3FMC A;  3B3S A;  2WPX A;  4OC2 A;  5JGF A;  3QNV A;  4NGN A;  5K8N A;  3GB0 A;  1LAN A;  3IO1 A;  3FXT A;  3PB4 X;  4NJR A;  2PVW A;  2RC4 A;  1HEE A;  4Y49 B;  3W6X A;  1YVK A;  4ZI6 A;  5GCN A;  1RXT A;  1ARL A;  4MCR A;  5LYF A;  2PJ8 A;  2JDD A;  2Z3K A;  4OC4 A;  1M4G A;  2Z3P A;  3L2N A;  3JVN A;  4UEZ A;  4C68 A;  2G3T A;  2ODF A;  4IF5 A;  4B10 A;  1N71 A;  4UEF A;  2G9D A;  2ZOG A;  3IIB A;  3R95 A;  2PJ3 A;  5LYI A;  3D7F A;  4JJX A;  2AJ6 A;  2B3V A;  1UWY A;  3NA6 A;  3T9Y A;  5HVG A;  3K2K A;  4M6H A;  1Z2L A;  1BPN A;  2V8H A;  4M6G A;  4C2X A;  4XPK A;  4KVM E;  1CG2 A;  5EBV A;  5AG6 A;  1S60 A;  1PUA A;  3TOB A;  3S9N A;  5F46 A;  1VHS A;  5H86 A;  4A95 A;  4W9Y A;  4ZY0 A;  3FVL A;  1NMT A;  1R57 A;  1Z8W A;  4CYN A;  4UCM A;  4AVC A;  1F57 A;  2B5G A;  5KTD A;  1PCA A;  4IAV A;  2I79 A;  3PGP A;  4KUB A;  3FH4 A;  3GYA A;  3RAM A;  3F8K A;  5EMI A;  2POK A;  1IOI A;  3D67 A;  1FNO A;  4B5P B;  1YQE A;  4MI4 A;  4P4J A;  1ELL P;  1XFO A;  4EVY A;  4U9Y A;  1FY7 A;  2GE3 A;  4UIA A;  2CNS A;  2GRE A;  4JLY A;  5IX3 A;  2PQ8 A;  4F0X A;  3S9L A;  2IJZ A;  4OC0 A;  4PXB A;  2XEF A;  4CYO A;  4DNC A;  4KOW A;  4B5O A;  2ZEP A;  2Q7B A;  3JRU A;  4NEX A;  2PR1 A;  4Q7A A;  4EWT A;  2BUE A;  4FD5 A;  3I3G A;  1NSL A;  4CAF A;  1TXR A;  3EY5 A;  4QC6 A;  2FT0 A;  4KOX A;  4M85 A;  8CPA A;  3NH4 A;  4P4I A;  3B2Y A;  4OAD A;  4ONW A;  3S9M A;  2KCW A;  1Z5R A;  4MCP A;  2WZN A;  4CAW A;  1M4L A;  5DS0 A;  2QML A;  1QSR A;  1XE4 A;  3TCV A;  4BMH A;  2D4P A;  1Z4E A;  3S6H A;  5JQ4 A;  4CAV A;  4K30 A;  4U5Y A;  4H6Z A;  4PK3 A;  2Y0M A;  3B3C A;  2C6C A;  4C2Z A;  2P0W A;  4NGS A;  3LWU A;  4CGP A;  4I49 A;  5I0C A;  4KOS A;  4NGQ A;  5G22 A;  4O23 A;  2C1C A;  5FVJ A;  1M4I A;  4X2T A;  2EVN A;  2PJA A;  3FBU A;  4UIB A;  3KZW A;  3V8I A;  2ZW4 A;  3S6F A;  4M3S A;  3T90 A;  3TC8 A;  4R76 A;  3CPA A;  1NSA A;  4GS4 A;  2G3A A;  2NMT A;  4M6I A;  2EUI A;  2DPS A;  5IV0 A; 
#chains in the Genus database with same CATH homology
 4Q38 A;  3SXN A;  3I9S A;  2CNT A;  2O28 A;  3DR6 A;  4A2Z A;  3NE7 A;  1I1D A;  4KVO E;  2Q04 A;  1UFH A;  4AG9 A;  3R9G A;  2WPW A;  3PP9 A;  4MFZ A;  5A27 A;  4HNY B;  3IU1 A;  4NF1 A;  1LRZ A;  1YX0 A;  4CAE A;  2ZW7 A;  4AG7 A;  2B58 A;  1IYK A;  2B5G B;  3D2P A;  1J4J A;  4CGO A;  4ONU A;  2OU2 A;  2Q4Y A;  3BJ7 A;  3FB3 A;  1CM0 A;  1Q2D A;  2JLM A;  4KZT A;  4L8A A;  2JDC A;  5C82 A;  1YVO A;  3RYO A;  3TTH A;  5DWN A;  2DPT A;  3VWE A;  3KKW A;  3P2H A;  5ISV A;  1Y9W A;  3N7Z A;  4H6U A;  4MJ8 A;  2B4D A;  3DSB A;  4UCP A;  2YNC A;  4B11 A;  2ZPA A;  4ZBG A;  2OZH A;  4HNW B;  2FS5 A;  4UFW A;  4Y49 C;  1S7F A;  3FNC A;  5F47 A;  4MY3 A;  2F5I A;  4YGO A;  1KUV A;  3EO4 A;  4PV6 A;  3IU2 A;  4UFV A;  3IWE A;  3UY5 A;  3R1K A;  3FRM A;  2A4N A;  3TO7 A;  1QSN A;  1YR0 A;  4KSF A;  3QAH A;  1TIQ A;  4QBJ A;  1ZO0 A;  2P6G A;  5E96 A;  3IWG A;  2ZXV A;  5G1Z A;  4B12 A;  3MGD A;  4KOU A;  1YGH A;  2PC1 A;  4LUA A;  3K9U A;  4MFK A;  2BSW A;  2Z3O A;  3P2F A;  2Q0Y A;  3TOA A;  2AE6 A;  4JXR A;  3EXN A;  3R9F A;  3QB8 A;  3EC4 A;  4PK2 A;  4JXQ A;  3SXO A;  3D2M A;  2VI7 A;  1Q2C A;  4FD4 A;  4R87 A;  1CJW A;  1IB1 E;  2Z3L A;  3TT2 A;  4CYQ A;  1V0C A;  5F48 A;  2R8V A;  2B4D B;  1NE9 A;  4X5K A;  1K4J A;  2YNC C;  5IB0 A;  1S7L A;  4B14 A;  2FE7 A;  3A9L A;  4KLV A;  4JD6 A;  1YRE A;  4MBU A;  2P6F A;  4MY0 A;  2J8M A;  3G8W A;  5KTA A;  4U9Z A;  4A31 A;  3F5B A;  3DR8 A;  3LOD A;  2FXF A;  3TO6 A;  2FCK A;  4KLW A;  4F0Y A;  3C26 A;  3IGR A;  5AGE A;  3TE4 A;  2CNM A;  2H5M A;  5H84 A;  2FL4 A;  2Q44 A;  4CAX A;  2WUU A;  2ARH A;  1QSM A;  2CXA A;  2PR8 A;  4KOY A;  1KUX A;  2FSR A;  1Z4R A;  4UFX A;  2YND A;  4E2A A;  3EFA A;  1VKC A;  5DWM A;  4L89 A;  2I00 A;  2REE A;  2GIV A;  1XIX A;  4Q36 A;  2QIR A;  1IID A;  2FIW A;  4RI1 A;  5J8C A;  1XEB A;  3G3S A;  4PSW A;  1IIC A;  4F6A A;  4KUA A;  2BEI A;  1S3Z A;  4ORF A;  2PSW A;  4C7H A;  1Z9U A;  3LD2 A;  3ZJ0 A;  1QST A;  5AG4 A;  3D3S A;  4NCZ A;  4JWP A;  1KZF A;  4XPD B;  2IL4 A;  4NXY A;  4R57 A;  1I21 A;  1XMT A;  4UWI A;  4CGM A;  1S7N A;  2PDO A;  5AG5 A;  1RO5 A;  1QSO A;  4YFJ A;  1WK4 A;  2HUZ A;  3GKR A;  4MFL A;  3B8G A;  2D4O A;  2DXQ A;  1GHE A;  2BL1 A;  3CXP A;  2QEC A;  3WR7 A;  2YGW A;  4XNH B;  3CXQ A;  4R3K A;  4XNH C;  1I12 A;  1MJB A;  2CY2 A;  2J8R A;  4H89 A;  3VWD A;  1PU9 A;  4FD7 A;  4AVA A;  3FIX A;  2Z11 A;  2OB0 A;  1MJ9 A;  2Z3M A;  4B13 A;  5A28 A;  4XPL A;  4FD6 A;  2R98 A;  3D8P A;  2ATR A;  5JPH A;  4CRZ B;  3SHP A;  5KTC A;  5G21 A;  4KS9 A;  1P0H A;  4AB7 A;  5J8F A;  1Y7R A;  3TO9 A;  4E0A A;  3FYN A;  2VXK A;  3CXS A;  4BBH A;  3S6G A;  1KUY A;  2J8N A;  4MFJ A;  2VEZ A;  2Q4V A;  4HNX B;  2YNE A;  1S7K A;  4CS0 B;  4CRY B;  5F49 A;  4A30 A;  2C27 A;  2VZZ A;  4UA3 A;  1YLE A;  4OLL A;  2VQY A;  2HQY A;  4CYP A;  2ZW6 A;  4KOV A;  4YRH A;  4KOR A;  2G0B A;  1MJA A;  4QB9 A;  3BJ8 A;  1BOB A;  1MK4 A;  4AVB A;  4CGN A;  4ZGY B;  3BLN A;  4LX9 A;  4C2Y A;  4KSA A;  3R9E A;  3W6S A;  2B3U A;  5C88 A;  4A33 A;  1ON0 A;  3TFY A;  4MFQ A;  2K5T A;  1Y9K A;  2VZY A;  5HH1 A;  4IUS A;  1M1D A;  5HMN A;  4KOT A;  2Z10 A;  2JEV A;  2PRB A;  4QUS A;  4HKF A;  3H5Z A;  3ZZI A;  4R9M A;  2GAN A;  2X7B A;  3DNS A;  2OZG A;  1L0C A;  1BO4 A;  4A32 A;  4C7I A;  3JUW A;  5AG7 A;  4UCN A;  2R7H A;  1M4D A;  2B4B A;  4QVT A;  2Z0Z A;  2Z3N A;  1WWZ A;  4CGL A;  4E8O A;  4MHD A;  1B87 A;  3E0K A;  4RS2 A;  2OH1 A;  4MFP A;  2WSA A;  1P4N A;  2OZU A;  3OWC A;  4J3G A;  2R1I A;  2VBQ A;  3R96 A;  4UBR A;  4II9 A;  4OAE A;  4KVX A;  3W91 A;  2REF A;  3F0A A;  4PSX A;  3JTK A;  5EC4 A;  1Q2Y A;  3H4Q A;  4B5P A;  4UWJ A;  4XPD C;  4NSQ A;  2ZW5 A;  2P6E A;  1B6B A;  4R3L A;  2FIA A;  3DDD A;  3GY9 A;  1M44 A;  1YK3 A;  1S5K A;  1IYL A;  3S6K A;  2HV2 A;  1U6M A;  1OZP A;  5CNP A;  5G20 A;  5BWA B;  3PZJ A;  1SQH A;  1XF8 A;  2WPX A;  3FXT A;  2RC4 A;  4Y49 B;  3W6X A;  1YVK A;  5GCN A;  1RXT A;  2JDD A;  2Z3K A;  1M4G A;  2Z3P A;  3JVN A;  4C68 A;  2G3T A;  4IF5 A;  4B10 A;  1N71 A;  3R95 A;  4JJX A;  2AJ6 A;  2B3V A;  3T9Y A;  4C2X A;  4XPK A;  4KVM E;  5EBV A;  5AG6 A;  1S60 A;  1PUA A;  3TOB A;  5F46 A;  1VHS A;  5H86 A;  4A95 A;  1NMT A;  1R57 A;  4CYN A;  4UCM A;  4AVC A;  2B5G A;  5KTD A;  4KUB A;  2I79 A;  3PGP A;  3GYA A;  3F8K A;  4B5P B;  4MI4 A;  4EVY A;  4U9Y A;  1FY7 A;  2GE3 A;  2CNS A;  4JLY A;  5IX3 A;  2PQ8 A;  4F0X A;  4CYO A;  4DNC A;  4KOW A;  4B5O A;  2Q7B A;  4NEX A;  2PR1 A;  2BUE A;  4FD5 A;  3I3G A;  1NSL A;  4CAF A;  3EY5 A;  4QC6 A;  2FT0 A;  4KOX A;  4M85 A;  4OAD A;  2KCW A;  4CAW A;  2QML A;  1QSR A;  1XE4 A;  3TCV A;  4BMH A;  2D4P A;  1Z4E A;  3S6H A;  5JQ4 A;  4CAV A;  4K30 A;  4U5Y A;  4H6Z A;  4PK3 A;  2Y0M A;  4C2Z A;  2P0W A;  4CGP A;  4I49 A;  5I0C A;  4KOS A;  5G22 A;  5FVJ A;  1M4I A;  2EVN A;  3FBU A;  3V8I A;  2ZW4 A;  3S6F A;  4M3S A;  3T90 A;  4GS4 A;  2G3A A;  2NMT A;  2EUI A;  2DPS A;  5IV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...