2JDDA

Glyphosate n-acetyltransferase bound to acetyl coa and 3-phosphoglycerate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
b'IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title The molecular basis of glyphosate resistance by an optimized microbial acetyltransferase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Transferase
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jddA00
4QC6A 2R7HA 1GHEA 2EUIA 4F0YA 4MBUA 3S6KA 1LRZA 3DR8A 1KUXA 1KUYA 3DNSA 4XNHB 3FNCA 3P2HA 1Z4RA 2ZXVA 4MJ8A 2AJ6A 4YGOA 2FE7A 3C26A 5J8CA 2JEVA 2FL4A 3VWDA 3FRMA 3R95A 4E2AA 4KVXA 2D4PA 2G3TA 2JLMA 4KOXA 4DNCA 1S7LA 3FIXA 2ZW7A 4B5OA 1NMTA 2DXQA 2J8NA 3FYNA 3EY5A 3GY9A 3SXOA 4MHDA 2VEZA 3RYOA 2O28A 3G3SA 4UA3A 2Q7BA 1IYKA 2GANA 3TT2A 4H89A 3S6FA 1NE9A 3GKRA 1QSOA 4NSQA 4H6ZA 1M4GA 5F48A 3DDDA 1J4JA 2P6EA 4HNWB 3QB8A 3R96A 3E0KA 4IUSA 2VQYA 1Q2YA 2F5IA 2Z0ZA 4KOYA 4CRZB 1YR0A 3BJ8A 4JXQA 3LODA 4AVCA 3QAHA 2J8RA 4KOUA 2Q04A 2P6FA 4NXYA 3TE4A 4PV6A 2HV2A 3CXQA 1QSNA 1IICA 4KUAA 1I1DA 4UWIA 2CY2A 1IIDA 3PGPA 3PP9A 1UFHA 4XPKA 4PSWA 3D2MA 2BEIA 4B5PB 4OAEA 1MJAA 1QSMA 3FBUA 3BJ7A 1WWZA 3DR6A 1RO5A 2NMTA 4JLYA 4PK3A 3IWGA 2B4DB 3W6XA 3W91A 4OADA 2JDCA 1MJ9A 1Y9KA 5JQ4A 1R57A 1M1DA 3D2PA 5J8FA 4CAXA 4NF1A 3IGRA 2A4NA 2X7BA 1YREA 1P0HA 2OZGA 2R1IA 4K30A 4CRYB 1SQHA 2KCWA 4E0AA 3N7ZA 3TO7A 3GYAA 3EO4A 4RI1A 1Y7RA 4KLVA 2C27A 4U9YA 5HH1A 4ZBGA 1PU9A 2PDOA 4JD6A 1U6MA 4FD7A 3CXPA 2B5GB 2R8VA 4H6UA 1S3ZA 4KOVA 2B4DA 2H5MA 4OLLA 2ZW6A 2IL4A 2EVNA 3TO9A 4AVAA 1YVKA 2B4BA 5JPHA 4R57A 4HKFA 3SXNA 5E96A 4LX9A 1CJWA 4QUSA 1B87A 4JJXA 3TOAA 3BLNA 4MY3A 3PZJA 2PR1A 3R9EA 3JUWA 5F46A 5GCNA 2J8MA 5C88A 1MK4A 4YRHA 4KOWA 4XPLA 2PC1A 4ONUA 2QECA 3TTHA 1YVOA 2FIAA 1S7KA 5H86A 5I0CA 2B5GA 5F47A 3F8KA 3EFAA 3R1KA 2ZW5A 2WPWA 2REEA 2OB0A 2I00A 5DWMA 4AG7A 4AG9A 4R3LA 5KTCA 2ATRA 5ISVA 2BL1A 4CS0B 3JVNA 1Q2DA 4L89A 3W6SA 2BUEA 1M4DA 4RS2A 2Z10A 1S5KA 4FD6A 4CAWA 2VZYA 2Q4YA 2VBQA 3KKWA 4EVYA 1BO4A 2GIVA 2Z11A 4UWJA 4NCZA 5HMNA 1XMTA 3F0AA 2REFA 1TIQA 5EBVA 3R9GA 1I21A 1NSLA 2OZUA 4QBJA 4X5KA 4M3SA 5IX3A 3CXSA 3S6HA 2P0WA 4QVTA 5IB0A 2WPXA 2VZZA 4KUBA 5KTAA 3R9FA 4M85A 5F49A 4AVBA 3SHPA 4CAVA 5IV0A 2P6GA 1M44A 2OZHA 4B5PA 3MGDA 1YGHA 4Y49C 1P4NA 4PSXA 3UY5A 4IF5A 2G3AA 3F5BA 1FY7A 3DSBA 1S60A 2PSWA 2PRBA 3G8WA 4XPDB 4MY0A 4KZTA 1L0CA 2RC4A 3EC4A 3TOBA 2BSWA 2Q44A 1WK4A 2VI7A 3FXTA 1KUVA 3NE7A 5KTDA 5H84A 1CM0A 2PQ8A 1XIXA 4R9MA 4R87A 3TFYA 1IB1E 1Z9UA 4FD4A 3ZZIA 2HUZA 3T9YA 3ZJ0A 1MJBA 4PK2A 2G0BA 4KVOE 2CNMA 1KZFA 2Q4VA 1Y9WA 2FS5A 4KOSA 4XPDC 2ARHA 3P2FA 4YFJA 2Y0MA 4KLWA 3D3SA 3K9UA 3I9SA 4HNYB 3D8PA 1VHSA 4KORA 4II9A 4J3GA 3TO6A 2R98A 5EC4A 1VKCA 2D4OA 3WR7A 4R3KA 5CNPA 2K5TA 1YLEA 4XNHC 1XEBA 1YK3A 4JXRA 2QMLA 2ZW4A 1I12A 2FT0A 2ZPAA 1B6BA 1ON0A 2FCKA 3V8IA 3I3GA 2QIRA 5C82A 4JWPA 2FXFA 1M4IA 3TCVA 4NEXA 2Q0YA 1Z4EA 2PR8A 4Y49B 1BOBA 3T90A 3EXNA 5DWNA 2AE6A 2VXKA 4E8OA 1XF8A 2GE3A 3H4QA 3S6GA 1XE4A 2FSRA 2I79A 4AB7A 3LD2A 4LUAA 1QSTA 1QSRA 4U5YA 2JDDA 4HNXB 4BMHA 4MI4A 1N71A 4I49A 4GS4A 1OZPA 4UBRA 1IYLA 2B3UA 1K4JA 1YX0A 4QB9A 3OWCA 2HQYA 1PUAA 4KOTA 2B3VA 2CNTA 4U9ZA 3VWEA 3B8GA 1V0CA 2CNSA 2OH1A 4ORFA 2OU2A 5FVJA 3FB3A 1S7NA 1S7FA 4KVME 4F6AA 2B58A 2FIWA 4FD5A 1RXTA 1Q2CA 4L8AA
chains in the Genus database with same CATH superfamily
1H8LA 4C2ZA 4QC6A 5LRKA 2R7HA 4TWEA 5HVFA 4IAVA 2ZEHA 1GHEA 2Z3LA 5G21A 2EUIA 4NGQA 3WABA 4CGOA 4F0YA 1CBXA 2GFQA 4GM5A 4MBUA 5LYIA 3KHZA 2EBJA 4PXEA 3S6KA 2YGWA 3CDXA 4WJBA 3D68A 4H2KA 1LRZA 3MN8A 2FVGA 4MXUA 3VH9A 4ZX9A 3DR8A 1KUXA 1KUYA 3DNSA 1VGYA 4P6YA 4XNHB 3FNCA 4C7HA 3P2HA 1TF9A 5IB9A 1Z4RA 2RB7A 3L2NA 3FECA 2ZXVA 3PB6X 4MJ8A 2WYRA 2AJ6A 2Q43A 3BXMA 4OIDA 4YGOA 3D67A 1X10A 2FE7A 2PE3A 1ZG7A 3V7ZA 3C26A 5J8CA 5K8OA 2JEVA 4BBHA 2FL4A 4Q7AA 4CYPA 1BLLE 3RBUA 3FRMA 3VWDA 3K2KA 3R95A 2PJBA 3KASA 3JRUA 4E2AA 4KVXA 2D4PA 3VATA 4IK2A 2ZEFA 1R3NA 2G3TA 2JLMA 2ZOGA 4KOXA 4DNCA 1S7LA 3FH4A 3FIXA 2ZW7A 4ONWA 3PBEA 4B5OA 4A2ZA 3FJUA 1Y0YA 4UF4A 1NMTA 4B11A 2DXQA 4MFLA 2PJ9A 2V77A 4F9VA 2J8NA 2ODFA 3FYNA 3EY5A 3GY9A 4G1PA 3SXOA 2Z3KA 4A39A 4MHDA 2BCOA 2VEZA 3PRTA 3LMSA 3RYOA 2O28A 4NGSA 3H8FA 1KWMA 3G3SA 4UA3A 4FBEA 2Q7BA 1IYKA 2GANA 3N5FA 3TT2A 4H89A 2PCUA 2PJ2A 3S6FA 1NE9A 1TXRA 3GKRA 4B14A 3CPAA 1QSOA 2QJ8A 1ZG8A 4NSQA 4H6ZA 1M4GA 2G9DA 5F48A 3DDDA 4UFVA 1J4JA 4CGMA 5CPAA 2P6EA 4HNWB 3QB8A 4FUUA 2VL1A 3E0KA 3R96A 4KSIA 4IUSA 2VQYA 3PB8X 3KHXA 2Q7SA 3B7IA 1Q2YA 2F5IA 3PB4X 1XFOA 1Z8WA 2Z0ZA 4KOYA 3B2YA 4CRZB 4P44A 1YR0A 2ANPA 3BJ8A 3LODA 4JXQA 1X12A 4AVCA 3QAHA 5K8MA 4P4FA 2J8RA 3IWEA 4KOUA 5AG5A 2Q04A 2P6FA 4HPSA 4NXYA 3TE4A 2AFWA 1EE3P 4PV6A 4OKOA 3CZXA 4AXVA 2HV2A 4L8AA 5LYFA 3CXQA 4UIBA 2V8VA 1QSNA 2ZEMA 1IICA 4KUAA 2ZEOA 1I1DA 4UWIA 2CY2A 1IIDA 3PGPA 3PP9A 4MHNA 4ZYQA 3MRUA 1UFHA 4Q38A 4XPKA 3WC7A 4PSWA 2Z3PA 3D2MA 2BEIA 5HVGA 2CXAA 3S9MA 4B5PB 4DUKA 2YNEA 2EK8A 1JQGA 5HXDA 4OAEA 5LRGA 3SJFA 1F2OA 1MJAA 1QSMA 1Z8LA 2ZEEA 4Z65A 4MHZA 2AFSA 3CPXA 3KR5A 3BJ7A 3FBUA 1WWZA 3DR6A 3KI9A 1RO5A 2NMTA 3B3SA 4MMOA 5JH9A 4JLYA 4PK3A 3IWGA 3NH5A 2B4DB 1DE4C 4UEFA 3W6XA 1YW4A 2QVPA 4X8IA 3W91A 1DTDA 3HLPA 4OADA 2JDCA 3QNVA 1MJ9A 7CPAA 1Y9KA 3B3WA 5JQ4A 1R57A 1M1DA 4RN7A 3D2PA 5J8FA 4CAXA 3S9NA 5CBMA 4NF1A 2PJ6A 3IGRA 2A4NA 4UEEA 2X7BA 4A94A 1YREA 2Z3OA 1P0HA 1XJOA 3B3TA 4NGNA 5ELYA 2OZGA 3TC8A 3IFEA 2R1IA 4K30A 1AYEA 1YMEA 3GB0A 2AFZA 4ZI6A 4CRYB 1SQHA 1F57A 2AFUA 2KCWA 1LAPA 1Y7EA 4E0AA 3N7ZA 4UCMA 4CYOA 3TO7A 3PFEA 4F8ZA 3GYAA 3RNZA 4C2YA 3EO4A 2PJAA 3H5ZA 1Y7RA 4RI1A 4KLVA 1YW6A 2C27A 4U9YA 5HH1A 4ZBGA 5A27A 3IO1A 1PU9A 5AG7A 4X3RA 4Q36A 4W9YA 1CPSA 3FEEA 2PDOA 5J1QA 1CP6A 2PVWA 4FAIA 4JD6A 1U6MA 4NGTA 1IU8A 4FD7A 4K3NA 1ELMP 4F9UA 4O23A 3CXPA 2B5GB 2R8VA 2XEGA 1TKJA 4H6UA 4MCRA 1S3ZA 4KOVA 2B4DA 2H5MA 2JEWA 2NYQA 4OLLA 5THWA 4OIWA 2ZW6A 2IL4A 2EVNA 2IMOA 3TO9A 4AVAA 1YVKA 2B4BA 4OC1A 4WWVA 2EWBA 1YLOA 1TKFA 5JPHA 4R57A 4UIAA 4HKFA 3FMCA 3SXNA 5E96A 3BI1A 4UFXA 4LX9A 1CJWA 4QUSA 3SI1A 1ELLP 1B87A 4MHYA 1LAMA 4JJXA 4IHMA 5G1ZA 3TOAA 1CPXA 2HC9A 3BLNA 4MY3A 2Q51A 3WC5A 1RTQA 3PZJA 2PR1A 1LANA 4UFWA 3SJXA 3B3CA 3R9EA 4GXHA 3K9TA 3SJEA 3ISZA 3JUWA 2EO8A 4UEZA 3LWUA 5F46A 3SI2A 3NE8A 1QMUA 3GUXA 5GCNA 4CPAA 3S9LA 1LCPA 4ZGYB 2EK9A 2J8MA 5C88A 1PYTB 1R43A 4R6TA 2PJ4A 1M4LA 1MK4A 2WZNA 1FNOA 4YRHA 4DJLA 4KOWA 4XPLA 2PC1A 3D66A 3IWWA 4ONUA 4C2XA 2QECA 3TTHA 3KL9A 1YVOA 1ARMA 2FIAA 1S7KA 3D4UA 5EMIA 5H86A 3DGVA 4A33A 2PJ8A 4CGPA 5I0CA 2B5GA 4MFKA 5F47A 3F8KA 4KS9A 3EFAA 3R1KA 4M6HA 4UCPA 2O4HA 4ZY1A 5A28A 5F09A 4OP4A 3IEHA 4P4BA 5LYLA 2ZW5A 4DYOA 3KGQA 4YWYA 4NJQA 2YNCC 2WPWA 2YNCA 2CF4A 1ARLA 2REEA 2OB0A 1UWYA 2I00A 3T8WA 3V38A 5DWMA 4AG7A 4AG9A 4F0XA 5LYDA 4ZY0A 4R3LA 5KTCA 2WUUA 2ZELA 3PB7X 2F7VA 2ATRA 5ISVA 2BL1A 4CS0B 1VHOA 6CPAA 3JVNA 1Q2DA 4L89A 2AFOA 4MFZA 3W6SA 1Z2LA 1IOIA 5DS0A 8CPAA 2BUEA 1XBUA 1M4DA 4RS2A 1Y0RA 1A2ZA 2Z10A 1S5KA 1XMBA 4FD6A 5HVHA 2ZEDA 4CAWA 4R8FA 2QYVA 1Q7LA 2C6GA 1ZO0A 2Q4YA 2VBQA 2VZYA 3KKWA 2IQ6A 4EVYA 4BD9A 4B6ZA 1BO4A 1XOVA 3D7DA 2PJ1A 2GIVA 2Z11A 4UWJA 4CAEA 2V8DA 4M6IA 4NCZA 3HUVA 5HMNA 1XMTA 1LOKA 3F0AA 2REFA 3NA6A 3CT9A 1TIQA 4P4DA 5EBVA 3R9GA 4YU9A 2XEJA 1I21A 1NSLA 4CGLA 2OZUA 4A95A 4MFQA 2GLJA 4QBJA 5AG6A 1BPMA 2Z3NA 2ZEGA 3IIBA 3PEIA 4P4EA 4C68A 4X5KA 3B3VA 5D29A 1Z8TA 4M3SA 5IX3A 4KSFA 3CXSA 2XEIA 3S6HA 3RAMA 2P0WA 1AMPA 2AFXA 4QVTA 4EWTA 2WPXA 4OC4A 2VZZA 5IB0A 2PRQA 4KUBA 5KTAA 2DF5A 4RUHA 3R9FA 2ZEPA 1Z5RA 4M85A 4R76A 5F49A 4AVBA 3SHPA 4NJRA 4CAVA 4MCQA 5IV0A 2P6GA 1M44A 3D7FA 2OZHA 4B5PA 5JM6A 3MGDA 1GYTA 1YGHA 4Y49C 1P4NA 4PSXA 5D8NA 2JBJA 4LQGA 2C1CA 3UY5A 4IF5A 2OR4A 3FVLA 2G3AA 3F5BA 1FY7A 3DSBA 1S60A 5LRJA 1YSJA 3KR4A 4TNUA 5G20A 2GLFA 1QQ9A 2PSWA 3D7HA 1IGBA 2PRBA 3G8WA 4B10A 4PXBA 4XPDB 1JWQA 1Z8XA 3H8GA 4MY0A 4KZTA 3IJ3A 4C7IA 1L0CA 2RC4A 3EC4A 1IY7A 2CIJA 3TOBA 2BSWA 4MHPA 4NGRA 2Q44A 3D7GA 4CYQA 2RFHA 1WK4A 2VI7A 3IU2A 3FXTA 1HDQA 1NSAA 3WT4A 1KUVA 3NE7A 5KTDA 5H84A 1VIXA 1CP7A 1CM0A 2PQ8A 3NH8A 4NFRA 3JTKA 4OMEA 3WC6A 2PIZA 3GLJA 1XIXA 2PJ0A 2PJ3A 4PQAA 4MCPA 5AG4A 2ZOFA 2AFMA 4R9MA 1CG2A 4R87A 4CAFA 3A9LA 3PB9X 2BOAA 3TFYA 1IB1E 1AUGA 1Z9UA 2DEAA 4FD4A 4B13A 3IU1A 2HUZA 1HEEA 3ZZIA 1ZLHA 3BHXA 3T9YA 3ZJ0A 1YQEA 1MJBA 3B35A 4CYNA 4PK2A 4EFDA 2G0BA 3SJGA 4KVOE 2XEFA 5BWAB 2CNMA 2GU2A 1KZFA 1F2PA 2Q4VA 5AGEA 1Y9WA 3I1UA 2DPSA 2FS5A 3ISXA 4KOSA 4B12A 4XPDC 3TX8A 4A30A 2ARHA 1TF8A 3P2FA 4YFJA 2Y0MA 4KLWA 3D3SA 4ZY2A 2I3CA 3K9UA 2PJ5A 3I9SA 3PFOA 1BAVA 4HNYB 2PJ7A 3D8PA 3KZWA 1VHSA 3BI0A 4KORA 3SI0A 4JYWA 1VHEA 4J3GA 1ZLIA 4PXCA 3TO6A 4II9A 2PVVA 2R98A 5EC4A 1VKCA 2D4OA 3WR7A 1FT7A 4R3KA 5CNPA 3FEDA 2K5TA 1YLEA 4UCNA 2HB6A 4XNHC 1XEBA 1YK3A 4JXRA 4P45A 2QMLA 2ZW4A 3NFZA 1I12A 2FT0A 2ZPAA 1B6BA 4MCSA 4OC0A 1ON0A 2FCKA 3V8IA 4X2TA 3I3GA 2QIRA 4A32A 5C82A 4M6GA 4BINA 1IOFA 2Z3MA 4JWPA 2FXFA 1M4IA 1TKHA 3TCVA 2YNDA 1CX8A 2Q0YA 4NEXA 5K8NA 1Z4EA 3NH4A 2PR8A 4Y49B 3VARA 4MRIA 1BOBA 3DLJA 1BPNA 3T90A 3EXNA 4OC3A 4PXDA 5DWNA 4EMEA 2AE6A 2NSMA 2Q4ZA 2VXKA 4E8OA 5I4MA 1XF8A 2GE3A 3H4QA 2O53A 3KQZA 2CTBA 4KSAA 4OC5A 4OC2A 3IC1A 3S6GA 1XE4A 2CTCA 2FSRA 1ZG9A 4R7MA 3RO0A 2I79A 3FX6A 2C6PA 4AB7A 1LFWA 4A38A 2PJCA 4MFPA 3LD2A 4LUAA 2F8HA 4P4JA 4ZX8A 1QSTA 2POKA 2WSAA 3QAYA 1OBRA 1QSRA 3H8EA 4U5YA 2V8GA 2JDDA 2J9AA 4HNXB 4BMHA 2BO9A 4MI4A 4A37A 4P10A 5K8PA 1N71A 1HDUA 2IJZA 4I49A 3FF3A 4CGNA 4GS4A 4LQ6A 4MFJA 4A31A 1OZPA 4UBRA 1IYLA 5JGFA 2B3UA 1K4JA 1YX0A 4QB9A 4JZ0A 5G22A 3KQXA 2GREA 3RZAA 3LACA 3OWCA 2HQYA 2PIYA 2DPTA 1PUAA 4P4IA 2V8HA 3GIUA 1XRYA 4KOTA 2B3VA 2CNTA 1PCAA 4U9ZA 3VWEA 3B8GA 1V0CA 2CNSA 2OH1A 3PBBA 2OOTA 4ORFA 2OU2A 5FVJA 4NGPA 3FB3A 1S7NA 1S7FA 2C6CA 2JBKA 4FWUA 4KVME 2B58A 4F6AA 2FIWA 2ZENA 4PPZA 4FD5A 1RXTA 4NGMA 1Q2CA 2ABZA
chains in the Genus database with same CATH topology
4C2ZA 4QC6A 2R7HA 5G21A 4CGOA 1GHEA 2Z3LA 2EUIA 4F0YA 4MBUA 3S6KA 2YGWA 1LRZA 3DR8A 1KUXA 1KUYA 3DNSA 4XNHB 3FNCA 4C7HA 3P2HA 1Z4RA 2ZXVA 4MJ8A 2AJ6A 4YGOA 2FE7A 3C26A 5J8CA 2JEVA 4BBHA 2FL4A 4CYPA 3VWDA 3FRMA 3R95A 4E2AA 4KVXA 2D4PA 2G3TA 2JLMA 4KOXA 4DNCA 1S7LA 3FIXA 2ZW7A 4B5OA 4A2ZA 1NMTA 4B11A 2DXQA 4MFLA 2J8NA 3FYNA 3EY5A 3GY9A 3SXOA 2Z3KA 4MHDA 2VEZA 3RYOA 2O28A 3G3SA 4UA3A 2Q7BA 1IYKA 2GANA 3TT2A 4H89A 3S6FA 1NE9A 3GKRA 4B14A 1QSOA 4NSQA 4H6ZA 1M4GA 5F48A 3DDDA 4UFVA 1J4JA 4CGMA 2P6EA 4HNWB 3QB8A 3R96A 3E0KA 4IUSA 2VQYA 1Q2YA 2F5IA 2Z0ZA 4KOYA 4CRZB 1YR0A 3BJ8A 4JXQA 3LODA 4AVCA 3QAHA 2J8RA 3IWEA 4KOUA 5AG5A 2Q04A 2P6FA 4NXYA 3TE4A 4PV6A 2HV2A 3CXQA 1QSNA 1IICA 4KUAA 1I1DA 4UWIA 2CY2A 1IIDA 3PGPA 3PP9A 1UFHA 4Q38A 4XPKA 4PSWA 2Z3PA 3D2MA 2BEIA 2CXAA 4B5PB 2YNEA 4OAEA 1MJAA 1QSMA 3FBUA 3BJ7A 1WWZA 3DR6A 1RO5A 2NMTA 4JLYA 4PK3A 3IWGA 2B4DB 3W6XA 3W91A 4OADA 2JDCA 1MJ9A 1Y9KA 5JQ4A 1R57A 1M1DA 3D2PA 5J8FA 4CAXA 4NF1A 3IGRA 2A4NA 2X7BA 1YREA 2Z3OA 1P0HA 2OZGA 2R1IA 4K30A 4CRYB 1SQHA 2KCWA 4E0AA 3N7ZA 4UCMA 4CYOA 3TO7A 3GYAA 4C2YA 3EO4A 4RI1A 3H5ZA 1Y7RA 4KLVA 2C27A 4U9YA 5HH1A 4ZBGA 5A27A 1PU9A 5AG7A 4Q36A 2PDOA 4JD6A 1U6MA 4FD7A 3CXPA 2B5GB 2R8VA 4H6UA 1S3ZA 4KOVA 2B4DA 2H5MA 4OLLA 2ZW6A 2IL4A 2EVNA 3TO9A 4AVAA 1YVKA 2B4BA 5JPHA 4R57A 4HKFA 3SXNA 5E96A 4UFXA 4LX9A 1CJWA 4QUSA 1B87A 4JJXA 5G1ZA 3TOAA 3BLNA 4MY3A 3PZJA 2PR1A 4UFWA 3R9EA 3JUWA 5F46A 5GCNA 4ZGYB 2J8MA 5C88A 1MK4A 4YRHA 4KOWA 4XPLA 2PC1A 4ONUA 4C2XA 2QECA 3TTHA 1YVOA 2FIAA 1S7KA 5H86A 4A33A 4CGPA 5I0CA 2B5GA 4MFKA 5F47A 3F8KA 4KS9A 3EFAA 3R1KA 4UCPA 5A28A 2ZW5A 2YNCC 2WPWA 2YNCA 2REEA 2OB0A 2I00A 5DWMA 4AG7A 4AG9A 4F0XA 4R3LA 5KTCA 2WUUA 2ATRA 5ISVA 2BL1A 4CS0B 3JVNA 1Q2DA 4L89A 4MFZA 3W6SA 2BUEA 1M4DA 4RS2A 2Z10A 1S5KA 4FD6A 4CAWA 1ZO0A 2Q4YA 2VBQA 2VZYA 3KKWA 4EVYA 1BO4A 2GIVA 2Z11A 4UWJA 4CAEA 4NCZA 5HMNA 1XMTA 3F0AA 2REFA 1TIQA 5EBVA 3R9GA 1I21A 1NSLA 4CGLA 2OZUA 4A95A 4MFQA 4QBJA 5AG6A 2Z3NA 4C68A 4X5KA 4M3SA 5IX3A 4KSFA 3CXSA 3S6HA 2P0WA 4QVTA 5IB0A 2WPXA 2VZZA 4KUBA 5KTAA 3R9FA 4M85A 5F49A 4AVBA 3SHPA 4CAVA 5IV0A 2P6GA 1M44A 2OZHA 4B5PA 3MGDA 1YGHA 4Y49C 1P4NA 4PSXA 3UY5A 4IF5A 2G3AA 3F5BA 1FY7A 3DSBA 1S60A 5G20A 2PSWA 2PRBA 3G8WA 4B10A 4XPDB 4MY0A 4KZTA 4C7IA 1L0CA 2RC4A 3EC4A 3TOBA 2BSWA 2Q44A 4CYQA 1WK4A 2VI7A 3IU2A 3FXTA 1KUVA 3NE7A 5KTDA 5H84A 1CM0A 2PQ8A 3JTKA 1XIXA 5AG4A 4R9MA 4R87A 4CAFA 3A9LA 3TFYA 1IB1E 1Z9UA 4FD4A 4B13A 3IU1A 2HUZA 3ZZIA 3T9YA 3ZJ0A 1MJBA 4CYNA 4PK2A 2G0BA 4KVOE 5BWAB 2CNMA 1KZFA 2Q4VA 5AGEA 1Y9WA 2DPSA 2FS5A 4KOSA 4B12A 4XPDC 4A30A 2ARHA 3P2FA 4YFJA 2Y0MA 4KLWA 3D3SA 3K9UA 3I9SA 4HNYB 3D8PA 1VHSA 4KORA 4II9A 4J3GA 3TO6A 2R98A 5EC4A 1VKCA 2D4OA 3WR7A 4R3KA 5CNPA 2K5TA 1YLEA 4UCNA 4XNHC 1XEBA 1YK3A 4JXRA 2QMLA 2ZW4A 1I12A 2FT0A 2ZPAA 1B6BA 1ON0A 2FCKA 3V8IA 3I3GA 2QIRA 4A32A 5C82A 2Z3MA 4JWPA 2FXFA 1M4IA 3TCVA 2YNDA 4NEXA 2Q0YA 1Z4EA 2PR8A 4Y49B 1BOBA 3T90A 3EXNA 5DWNA 2AE6A 2VXKA 4E8OA 1XF8A 2GE3A 3H4QA 4KSAA 3S6GA 1XE4A 2FSRA 2I79A 4AB7A 4MFPA 3LD2A 4LUAA 1QSTA 2WSAA 1QSRA 4U5YA 2JDDA 4HNXB 4BMHA 4MI4A 1N71A 4I49A 4CGNA 4GS4A 4MFJA 4A31A 1OZPA 4UBRA 1IYLA 2B3UA 1K4JA 1YX0A 4QB9A 5G22A 3OWCA 2HQYA 2DPTA 1PUAA 4KOTA 2B3VA 2CNTA 4U9ZA 3VWEA 3B8GA 1V0CA 2CNSA 2OH1A 4ORFA 2OU2A 5FVJA 3FB3A 1S7NA 1S7FA 4KVME 4F6AA 2B58A 2FIWA 4FD5A 1RXTA 1Q2CA 4L8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QC6 A;  2R7H A;  1GHE A;  2EUI A;  4F0Y A;  4MBU A;  3S6K A;  1LRZ A;  3DR8 A;  1KUX A;  1KUY A;  3DNS A;  4XNH B;  3FNC A;  3P2H A;  1Z4R A;  2ZXV A;  4MJ8 A;  2AJ6 A;  4YGO A;  2FE7 A;  3C26 A;  5J8C A;  2JEV A;  2FL4 A;  3VWD A;  3FRM A;  3R95 A;  4E2A A;  4KVX A;  2D4P A;  2G3T A;  2JLM A;  4KOX A;  4DNC A;  1S7L A;  3FIX A;  2ZW7 A;  4B5O A;  1NMT A;  2DXQ A;  2J8N A;  3FYN A;  3EY5 A;  3GY9 A;  3SXO A;  4MHD A;  2VEZ A;  3RYO A;  2O28 A;  3G3S A;  4UA3 A;  2Q7B A;  1IYK A;  2GAN A;  3TT2 A;  4H89 A;  3S6F A;  1NE9 A;  3GKR A;  1QSO A;  4NSQ A;  4H6Z A;  1M4G A;  5F48 A;  3DDD A;  1J4J A;  2P6E A;  4HNW B;  3QB8 A;  3R96 A;  3E0K A;  4IUS A;  2VQY A;  1Q2Y A;  2F5I A;  2Z0Z A;  4KOY A;  4CRZ B;  1YR0 A;  3BJ8 A;  4JXQ A;  3LOD A;  4AVC A;  3QAH A;  2J8R A;  4KOU A;  2Q04 A;  2P6F A;  4NXY A;  3TE4 A;  4PV6 A;  2HV2 A;  3CXQ A;  1QSN A;  1IIC A;  4KUA A;  1I1D A;  4UWI A;  2CY2 A;  1IID A;  3PGP A;  3PP9 A;  1UFH A;  4XPK A;  4PSW A;  3D2M A;  2BEI A;  4B5P B;  4OAE A;  1MJA A;  1QSM A;  3FBU A;  3BJ7 A;  1WWZ A;  3DR6 A;  1RO5 A;  2NMT A;  4JLY A;  4PK3 A;  3IWG A;  2B4D B;  3W6X A;  3W91 A;  4OAD A;  2JDC A;  1MJ9 A;  1Y9K A;  5JQ4 A;  1R57 A;  1M1D A;  3D2P A;  5J8F A;  4CAX A;  4NF1 A;  3IGR A;  2A4N A;  2X7B A;  1YRE A;  1P0H A;  2OZG A;  2R1I A;  4K30 A;  4CRY B;  1SQH A;  2KCW A;  4E0A A;  3N7Z A;  3TO7 A;  3GYA A;  3EO4 A;  4RI1 A;  1Y7R A;  4KLV A;  2C27 A;  4U9Y A;  5HH1 A;  4ZBG A;  1PU9 A;  2PDO A;  4JD6 A;  1U6M A;  4FD7 A;  3CXP A;  2B5G B;  2R8V A;  4H6U A;  1S3Z A;  4KOV A;  2B4D A;  2H5M A;  4OLL A;  2ZW6 A;  2IL4 A;  2EVN A;  3TO9 A;  4AVA A;  1YVK A;  2B4B A;  5JPH A;  4R57 A;  4HKF A;  3SXN A;  5E96 A;  4LX9 A;  1CJW A;  4QUS A;  1B87 A;  4JJX A;  3TOA A;  3BLN A;  4MY3 A;  3PZJ A;  2PR1 A;  3R9E A;  3JUW A;  5F46 A;  5GCN A;  2J8M A;  5C88 A;  1MK4 A;  4YRH A;  4KOW A;  4XPL A;  2PC1 A;  4ONU A;  2QEC A;  3TTH A;  1YVO A;  2FIA A;  1S7K A;  5H86 A;  5I0C A;  2B5G A;  5F47 A;  3F8K A;  3EFA A;  3R1K A;  2ZW5 A;  2WPW A;  2REE A;  2OB0 A;  2I00 A;  5DWM A;  4AG7 A;  4AG9 A;  4R3L A;  5KTC A;  2ATR A;  5ISV A;  2BL1 A;  4CS0 B;  3JVN A;  1Q2D A;  4L89 A;  3W6S A;  2BUE A;  1M4D A;  4RS2 A;  2Z10 A;  1S5K A;  4FD6 A;  4CAW A;  2VZY A;  2Q4Y A;  2VBQ A;  3KKW A;  4EVY A;  1BO4 A;  2GIV A;  2Z11 A;  4UWJ A;  4NCZ A;  5HMN A;  1XMT A;  3F0A A;  2REF A;  1TIQ A;  5EBV A;  3R9G A;  1I21 A;  1NSL A;  2OZU A;  4QBJ A;  4X5K A;  4M3S A;  5IX3 A;  3CXS A;  3S6H A;  2P0W A;  4QVT A;  5IB0 A;  2WPX A;  2VZZ A;  4KUB A;  5KTA A;  3R9F A;  4M85 A;  5F49 A;  4AVB A;  3SHP A;  4CAV A;  5IV0 A;  2P6G A;  1M44 A;  2OZH A;  4B5P A;  3MGD A;  1YGH A;  4Y49 C;  1P4N A;  4PSX A;  3UY5 A;  4IF5 A;  2G3A A;  3F5B A;  1FY7 A;  3DSB A;  1S60 A;  2PSW A;  2PRB A;  3G8W A;  4XPD B;  4MY0 A;  4KZT A;  1L0C A;  2RC4 A;  3EC4 A;  3TOB A;  2BSW A;  2Q44 A;  1WK4 A;  2VI7 A;  3FXT A;  1KUV A;  3NE7 A;  5KTD A;  5H84 A;  1CM0 A;  2PQ8 A;  1XIX A;  4R9M A;  4R87 A;  3TFY A;  1IB1 E;  1Z9U A;  4FD4 A;  3ZZI A;  2HUZ A;  3T9Y A;  3ZJ0 A;  1MJB A;  4PK2 A;  2G0B A;  4KVO E;  2CNM A;  1KZF A;  2Q4V A;  1Y9W A;  2FS5 A;  4KOS A;  4XPD C;  2ARH A;  3P2F A;  4YFJ A;  2Y0M A;  4KLW A;  3D3S A;  3K9U A;  3I9S A;  4HNY B;  3D8P A;  1VHS A;  4KOR A;  4II9 A;  4J3G A;  3TO6 A;  2R98 A;  5EC4 A;  1VKC A;  2D4O A;  3WR7 A;  4R3K A;  5CNP A;  2K5T A;  1YLE A;  4XNH C;  1XEB A;  1YK3 A;  4JXR A;  2QML A;  2ZW4 A;  1I12 A;  2FT0 A;  2ZPA A;  1B6B A;  1ON0 A;  2FCK A;  3V8I A;  3I3G A;  2QIR A;  5C82 A;  4JWP A;  2FXF A;  1M4I A;  3TCV A;  4NEX A;  2Q0Y A;  1Z4E A;  2PR8 A;  4Y49 B;  1BOB A;  3T90 A;  3EXN A;  5DWN A;  2AE6 A;  2VXK A;  4E8O A;  1XF8 A;  2GE3 A;  3H4Q A;  3S6G A;  1XE4 A;  2FSR A;  2I79 A;  4AB7 A;  3LD2 A;  4LUA A;  1QST A;  1QSR A;  4U5Y A;  2JDD A;  4HNX B;  4BMH A;  4MI4 A;  1N71 A;  4I49 A;  4GS4 A;  1OZP A;  4UBR A;  1IYL A;  2B3U A;  1K4J A;  1YX0 A;  4QB9 A;  3OWC A;  2HQY A;  1PUA A;  4KOT A;  2B3V A;  2CNT A;  4U9Z A;  3VWE A;  3B8G A;  1V0C A;  2CNS A;  2OH1 A;  4ORF A;  2OU2 A;  5FVJ A;  3FB3 A;  1S7N A;  1S7F A;  4KVM E;  4F6A A;  2B58 A;  2FIW A;  4FD5 A;  1RXT A;  1Q2C A;  4L8A A; 
#chains in the Genus database with same CATH topology
 1H8L A;  4C2Z A;  4QC6 A;  5LRK A;  2R7H A;  4TWE A;  5HVF A;  4IAV A;  2ZEH A;  1GHE A;  2Z3L A;  5G21 A;  2EUI A;  4NGQ A;  3WAB A;  4CGO A;  4F0Y A;  1CBX A;  2GFQ A;  4GM5 A;  4MBU A;  5LYI A;  3KHZ A;  2EBJ A;  4PXE A;  3S6K A;  2YGW A;  3CDX A;  4WJB A;  3D68 A;  4H2K A;  1LRZ A;  3MN8 A;  2FVG A;  4MXU A;  3VH9 A;  4ZX9 A;  3DR8 A;  1KUX A;  1KUY A;  3DNS A;  1VGY A;  4P6Y A;  4XNH B;  3FNC A;  4C7H A;  3P2H A;  1TF9 A;  5IB9 A;  1Z4R A;  2RB7 A;  3L2N A;  3FEC A;  2ZXV A;  3PB6 X;  4MJ8 A;  2WYR A;  2AJ6 A;  2Q43 A;  3BXM A;  4OID A;  4YGO A;  3D67 A;  1X10 A;  2FE7 A;  2PE3 A;  1ZG7 A;  3V7Z A;  3C26 A;  5J8C A;  5K8O A;  2JEV A;  4BBH A;  2FL4 A;  4Q7A A;  4CYP A;  1BLL E;  3RBU A;  3FRM A;  3VWD A;  3K2K A;  3R95 A;  2PJB A;  3KAS A;  3JRU A;  4E2A A;  4KVX A;  2D4P A;  3VAT A;  4IK2 A;  2ZEF A;  1R3N A;  2G3T A;  2JLM A;  2ZOG A;  4KOX A;  4DNC A;  1S7L A;  3FH4 A;  3FIX A;  2ZW7 A;  4ONW A;  3PBE A;  4B5O A;  4A2Z A;  3FJU A;  1Y0Y A;  4UF4 A;  1NMT A;  4B11 A;  2DXQ A;  4MFL A;  2PJ9 A;  2V77 A;  4F9V A;  2J8N A;  2ODF A;  3FYN A;  3EY5 A;  3GY9 A;  4G1P A;  3SXO A;  2Z3K A;  4A39 A;  4MHD A;  2BCO A;  2VEZ A;  3PRT A;  3LMS A;  3RYO A;  2O28 A;  4NGS A;  3H8F A;  1KWM A;  3G3S A;  4UA3 A;  4FBE A;  2Q7B A;  1IYK A;  2GAN A;  3N5F A;  3TT2 A;  4H89 A;  2PCU A;  2PJ2 A;  3S6F A;  1NE9 A;  1TXR A;  3GKR A;  4B14 A;  3CPA A;  1QSO A;  2QJ8 A;  1ZG8 A;  4NSQ A;  4H6Z A;  1M4G A;  2G9D A;  5F48 A;  3DDD A;  4UFV A;  1J4J A;  4CGM A;  5CPA A;  2P6E A;  4HNW B;  3QB8 A;  4FUU A;  2VL1 A;  3E0K A;  3R96 A;  4KSI A;  4IUS A;  2VQY A;  3PB8 X;  3KHX A;  2Q7S A;  3B7I A;  1Q2Y A;  2F5I A;  3PB4 X;  1XFO A;  1Z8W A;  2Z0Z A;  4KOY A;  3B2Y A;  4CRZ B;  4P44 A;  1YR0 A;  2ANP A;  3BJ8 A;  3LOD A;  4JXQ A;  1X12 A;  4AVC A;  3QAH A;  5K8M A;  4P4F A;  2J8R A;  3IWE A;  4KOU A;  5AG5 A;  2Q04 A;  2P6F A;  4HPS A;  4NXY A;  3TE4 A;  2AFW A;  1EE3 P;  4PV6 A;  4OKO A;  3CZX A;  4AXV A;  2HV2 A;  4L8A A;  5LYF A;  3CXQ A;  4UIB A;  2V8V A;  1QSN A;  2ZEM A;  1IIC A;  4KUA A;  2ZEO A;  1I1D A;  4UWI A;  2CY2 A;  1IID A;  3PGP A;  3PP9 A;  4MHN A;  4ZYQ A;  3MRU A;  1UFH A;  4Q38 A;  4XPK A;  3WC7 A;  4PSW A;  2Z3P A;  3D2M A;  2BEI A;  5HVG A;  2CXA A;  3S9M A;  4B5P B;  4DUK A;  2YNE A;  2EK8 A;  1JQG A;  5HXD A;  4OAE A;  5LRG A;  3SJF A;  1F2O A;  1MJA A;  1QSM A;  1Z8L A;  2ZEE A;  4Z65 A;  4MHZ A;  2AFS A;  3CPX A;  3KR5 A;  3BJ7 A;  3FBU A;  1WWZ A;  3DR6 A;  3KI9 A;  1RO5 A;  2NMT A;  3B3S A;  4MMO A;  5JH9 A;  4JLY A;  4PK3 A;  3IWG A;  3NH5 A;  2B4D B;  1DE4 C;  4UEF A;  3W6X A;  1YW4 A;  2QVP A;  4X8I A;  3W91 A;  1DTD A;  3HLP A;  4OAD A;  2JDC A;  3QNV A;  1MJ9 A;  7CPA A;  1Y9K A;  3B3W A;  5JQ4 A;  1R57 A;  1M1D A;  4RN7 A;  3D2P A;  5J8F A;  4CAX A;  3S9N A;  5CBM A;  4NF1 A;  2PJ6 A;  3IGR A;  2A4N A;  4UEE A;  2X7B A;  4A94 A;  1YRE A;  2Z3O A;  1P0H A;  1XJO A;  3B3T A;  4NGN A;  5ELY A;  2OZG A;  3TC8 A;  3IFE A;  2R1I A;  4K30 A;  1AYE A;  1YME A;  3GB0 A;  2AFZ A;  4ZI6 A;  4CRY B;  1SQH A;  1F57 A;  2AFU A;  2KCW A;  1LAP A;  1Y7E A;  4E0A A;  3N7Z A;  4UCM A;  4CYO A;  3TO7 A;  3PFE A;  4F8Z A;  3GYA A;  3RNZ A;  4C2Y A;  3EO4 A;  2PJA A;  3H5Z A;  1Y7R A;  4RI1 A;  4KLV A;  1YW6 A;  2C27 A;  4U9Y A;  5HH1 A;  4ZBG A;  5A27 A;  3IO1 A;  1PU9 A;  5AG7 A;  4X3R A;  4Q36 A;  4W9Y A;  1CPS A;  3FEE A;  2PDO A;  5J1Q A;  1CP6 A;  2PVW A;  4FAI A;  4JD6 A;  1U6M A;  4NGT A;  1IU8 A;  4FD7 A;  4K3N A;  1ELM P;  4F9U A;  4O23 A;  3CXP A;  2B5G B;  2R8V A;  2XEG A;  1TKJ A;  4H6U A;  4MCR A;  1S3Z A;  4KOV A;  2B4D A;  2H5M A;  2JEW A;  2NYQ A;  4OLL A;  5THW A;  4OIW A;  2ZW6 A;  2IL4 A;  2EVN A;  2IMO A;  3TO9 A;  4AVA A;  1YVK A;  2B4B A;  4OC1 A;  4WWV A;  2EWB A;  1YLO A;  1TKF A;  5JPH A;  4R57 A;  4UIA A;  4HKF A;  3FMC A;  3SXN A;  5E96 A;  3BI1 A;  4UFX A;  4LX9 A;  1CJW A;  4QUS A;  3SI1 A;  1ELL P;  1B87 A;  4MHY A;  1LAM A;  4JJX A;  4IHM A;  5G1Z A;  3TOA A;  1CPX A;  2HC9 A;  3BLN A;  4MY3 A;  2Q51 A;  3WC5 A;  1RTQ A;  3PZJ A;  2PR1 A;  1LAN A;  4UFW A;  3SJX A;  3B3C A;  3R9E A;  4GXH A;  3K9T A;  3SJE A;  3ISZ A;  3JUW A;  2EO8 A;  4UEZ A;  3LWU A;  5F46 A;  3SI2 A;  3NE8 A;  1QMU A;  3GUX A;  5GCN A;  4CPA A;  3S9L A;  1LCP A;  4ZGY B;  2EK9 A;  2J8M A;  5C88 A;  1PYT B;  1R43 A;  4R6T A;  2PJ4 A;  1M4L A;  1MK4 A;  2WZN A;  1FNO A;  4YRH A;  4DJL A;  4KOW A;  4XPL A;  2PC1 A;  3D66 A;  3IWW A;  4ONU A;  4C2X A;  2QEC A;  3TTH A;  3KL9 A;  1YVO A;  1ARM A;  2FIA A;  1S7K A;  3D4U A;  5EMI A;  5H86 A;  3DGV A;  4A33 A;  2PJ8 A;  4CGP A;  5I0C A;  2B5G A;  4MFK A;  5F47 A;  3F8K A;  4KS9 A;  3EFA A;  3R1K A;  4M6H A;  4UCP A;  2O4H A;  4ZY1 A;  5A28 A;  5F09 A;  4OP4 A;  3IEH A;  4P4B A;  5LYL A;  2ZW5 A;  4DYO A;  3KGQ A;  4YWY A;  4NJQ A;  2YNC C;  2WPW A;  2YNC A;  2CF4 A;  1ARL A;  2REE A;  2OB0 A;  1UWY A;  2I00 A;  3T8W A;  3V38 A;  5DWM A;  4AG7 A;  4AG9 A;  4F0X A;  5LYD A;  4ZY0 A;  4R3L A;  5KTC A;  2WUU A;  2ZEL A;  3PB7 X;  2F7V A;  2ATR A;  5ISV A;  2BL1 A;  4CS0 B;  1VHO A;  6CPA A;  3JVN A;  1Q2D A;  4L89 A;  2AFO A;  4MFZ A;  3W6S A;  1Z2L A;  1IOI A;  5DS0 A;  8CPA A;  2BUE A;  1XBU A;  1M4D A;  4RS2 A;  1Y0R A;  1A2Z A;  2Z10 A;  1S5K A;  1XMB A;  4FD6 A;  5HVH A;  2ZED A;  4CAW A;  4R8F A;  2QYV A;  1Q7L A;  2C6G A;  1ZO0 A;  2Q4Y A;  2VBQ A;  2VZY A;  3KKW A;  2IQ6 A;  4EVY A;  4BD9 A;  4B6Z A;  1BO4 A;  1XOV A;  3D7D A;  2PJ1 A;  2GIV A;  2Z11 A;  4UWJ A;  4CAE A;  2V8D A;  4M6I A;  4NCZ A;  3HUV A;  5HMN A;  1XMT A;  1LOK A;  3F0A A;  2REF A;  3NA6 A;  3CT9 A;  1TIQ A;  4P4D A;  5EBV A;  3R9G A;  4YU9 A;  2XEJ A;  1I21 A;  1NSL A;  4CGL A;  2OZU A;  4A95 A;  4MFQ A;  2GLJ A;  4QBJ A;  5AG6 A;  1BPM A;  2Z3N A;  2ZEG A;  3IIB A;  3PEI A;  4P4E A;  4C68 A;  4X5K A;  3B3V A;  5D29 A;  1Z8T A;  4M3S A;  5IX3 A;  4KSF A;  3CXS A;  2XEI A;  3S6H A;  3RAM A;  2P0W A;  1AMP A;  2AFX A;  4QVT A;  4EWT A;  2WPX A;  4OC4 A;  2VZZ A;  5IB0 A;  2PRQ A;  4KUB A;  5KTA A;  2DF5 A;  4RUH A;  3R9F A;  2ZEP A;  1Z5R A;  4M85 A;  4R76 A;  5F49 A;  4AVB A;  3SHP A;  4NJR A;  4CAV A;  4MCQ A;  5IV0 A;  2P6G A;  1M44 A;  3D7F A;  2OZH A;  4B5P A;  5JM6 A;  3MGD A;  1GYT A;  1YGH A;  4Y49 C;  1P4N A;  4PSX A;  5D8N A;  2JBJ A;  4LQG A;  2C1C A;  3UY5 A;  4IF5 A;  2OR4 A;  3FVL A;  2G3A A;  3F5B A;  1FY7 A;  3DSB A;  1S60 A;  5LRJ A;  1YSJ A;  3KR4 A;  4TNU A;  5G20 A;  2GLF A;  1QQ9 A;  2PSW A;  3D7H A;  1IGB A;  2PRB A;  3G8W A;  4B10 A;  4PXB A;  4XPD B;  1JWQ A;  1Z8X A;  3H8G A;  4MY0 A;  4KZT A;  3IJ3 A;  4C7I A;  1L0C A;  2RC4 A;  3EC4 A;  1IY7 A;  2CIJ A;  3TOB A;  2BSW A;  4MHP A;  4NGR A;  2Q44 A;  3D7G A;  4CYQ A;  2RFH A;  1WK4 A;  2VI7 A;  3IU2 A;  3FXT A;  1HDQ A;  1NSA A;  3WT4 A;  1KUV A;  3NE7 A;  5KTD A;  5H84 A;  1VIX A;  1CP7 A;  1CM0 A;  2PQ8 A;  3NH8 A;  4NFR A;  3JTK A;  4OME A;  3WC6 A;  2PIZ A;  3GLJ A;  1XIX A;  2PJ0 A;  2PJ3 A;  4PQA A;  4MCP A;  5AG4 A;  2ZOF A;  2AFM A;  4R9M A;  1CG2 A;  4R87 A;  4CAF A;  3A9L A;  3PB9 X;  2BOA A;  3TFY A;  1IB1 E;  1AUG A;  1Z9U A;  2DEA A;  4FD4 A;  4B13 A;  3IU1 A;  2HUZ A;  1HEE A;  3ZZI A;  1ZLH A;  3BHX A;  3T9Y A;  3ZJ0 A;  1YQE A;  1MJB A;  3B35 A;  4CYN A;  4PK2 A;  4EFD A;  2G0B A;  3SJG A;  4KVO E;  2XEF A;  5BWA B;  2CNM A;  2GU2 A;  1KZF A;  1F2P A;  2Q4V A;  5AGE A;  1Y9W A;  3I1U A;  2DPS A;  2FS5 A;  3ISX A;  4KOS A;  4B12 A;  4XPD C;  3TX8 A;  4A30 A;  2ARH A;  1TF8 A;  3P2F A;  4YFJ A;  2Y0M A;  4KLW A;  3D3S A;  4ZY2 A;  2I3C A;  3K9U A;  2PJ5 A;  3I9S A;  3PFO A;  1BAV A;  4HNY B;  2PJ7 A;  3D8P A;  3KZW A;  1VHS A;  3BI0 A;  4KOR A;  3SI0 A;  4JYW A;  1VHE A;  4J3G A;  1ZLI A;  4PXC A;  3TO6 A;  4II9 A;  2PVV A;  2R98 A;  5EC4 A;  1VKC A;  2D4O A;  3WR7 A;  1FT7 A;  4R3K A;  5CNP A;  3FED A;  2K5T A;  1YLE A;  4UCN A;  2HB6 A;  4XNH C;  1XEB A;  1YK3 A;  4JXR A;  4P45 A;  2QML A;  2ZW4 A;  3NFZ A;  1I12 A;  2FT0 A;  2ZPA A;  1B6B A;  4MCS A;  4OC0 A;  1ON0 A;  2FCK A;  3V8I A;  4X2T A;  3I3G A;  2QIR A;  4A32 A;  5C82 A;  4M6G A;  4BIN A;  1IOF A;  2Z3M A;  4JWP A;  2FXF A;  1M4I A;  1TKH A;  3TCV A;  2YND A;  1CX8 A;  2Q0Y A;  4NEX A;  5K8N A;  1Z4E A;  3NH4 A;  2PR8 A;  4Y49 B;  3VAR A;  4MRI A;  1BOB A;  3DLJ A;  1BPN A;  3T90 A;  3EXN A;  4OC3 A;  4PXD A;  5DWN A;  4EME A;  2AE6 A;  2NSM A;  2Q4Z A;  2VXK A;  4E8O A;  5I4M A;  1XF8 A;  2GE3 A;  3H4Q A;  2O53 A;  3KQZ A;  2CTB A;  4KSA A;  4OC5 A;  4OC2 A;  3IC1 A;  3S6G A;  1XE4 A;  2CTC A;  2FSR A;  1ZG9 A;  4R7M A;  3RO0 A;  2I79 A;  3FX6 A;  2C6P A;  4AB7 A;  1LFW A;  4A38 A;  2PJC A;  4MFP A;  3LD2 A;  4LUA A;  2F8H A;  4P4J A;  4ZX8 A;  1QST A;  2POK A;  2WSA A;  3QAY A;  1OBR A;  1QSR A;  3H8E A;  4U5Y A;  2V8G A;  2JDD A;  2J9A A;  4HNX B;  4BMH A;  2BO9 A;  4MI4 A;  4A37 A;  4P10 A;  5K8P A;  1N71 A;  1HDU A;  2IJZ A;  4I49 A;  3FF3 A;  4CGN A;  4GS4 A;  4LQ6 A;  4MFJ A;  4A31 A;  1OZP A;  4UBR A;  1IYL A;  5JGF A;  2B3U A;  1K4J A;  1YX0 A;  4QB9 A;  4JZ0 A;  5G22 A;  3KQX A;  2GRE A;  3RZA A;  3LAC A;  3OWC A;  2HQY A;  2PIY A;  2DPT A;  1PUA A;  4P4I A;  2V8H A;  3GIU A;  1XRY A;  4KOT A;  2B3V A;  2CNT A;  1PCA A;  4U9Z A;  3VWE A;  3B8G A;  1V0C A;  2CNS A;  2OH1 A;  3PBB A;  2OOT A;  4ORF A;  2OU2 A;  5FVJ A;  4NGP A;  3FB3 A;  1S7N A;  1S7F A;  2C6C A;  2JBK A;  4FWU A;  4KVM E;  2B58 A;  4F6A A;  2FIW A;  2ZEN A;  4PPZ A;  4FD5 A;  1RXT A;  4NGM A;  1Q2C A;  2ABZ A; 
#chains in the Genus database with same CATH homology
 4C2Z A;  4QC6 A;  2R7H A;  5G21 A;  4CGO A;  1GHE A;  2Z3L A;  2EUI A;  4F0Y A;  4MBU A;  3S6K A;  2YGW A;  1LRZ A;  3DR8 A;  1KUX A;  1KUY A;  3DNS A;  4XNH B;  3FNC A;  4C7H A;  3P2H A;  1Z4R A;  2ZXV A;  4MJ8 A;  2AJ6 A;  4YGO A;  2FE7 A;  3C26 A;  5J8C A;  2JEV A;  4BBH A;  2FL4 A;  4CYP A;  3VWD A;  3FRM A;  3R95 A;  4E2A A;  4KVX A;  2D4P A;  2G3T A;  2JLM A;  4KOX A;  4DNC A;  1S7L A;  3FIX A;  2ZW7 A;  4B5O A;  4A2Z A;  1NMT A;  4B11 A;  2DXQ A;  4MFL A;  2J8N A;  3FYN A;  3EY5 A;  3GY9 A;  3SXO A;  2Z3K A;  4MHD A;  2VEZ A;  3RYO A;  2O28 A;  3G3S A;  4UA3 A;  2Q7B A;  1IYK A;  2GAN A;  3TT2 A;  4H89 A;  3S6F A;  1NE9 A;  3GKR A;  4B14 A;  1QSO A;  4NSQ A;  4H6Z A;  1M4G A;  5F48 A;  3DDD A;  4UFV A;  1J4J A;  4CGM A;  2P6E A;  4HNW B;  3QB8 A;  3R96 A;  3E0K A;  4IUS A;  2VQY A;  1Q2Y A;  2F5I A;  2Z0Z A;  4KOY A;  4CRZ B;  1YR0 A;  3BJ8 A;  4JXQ A;  3LOD A;  4AVC A;  3QAH A;  2J8R A;  3IWE A;  4KOU A;  5AG5 A;  2Q04 A;  2P6F A;  4NXY A;  3TE4 A;  4PV6 A;  2HV2 A;  3CXQ A;  1QSN A;  1IIC A;  4KUA A;  1I1D A;  4UWI A;  2CY2 A;  1IID A;  3PGP A;  3PP9 A;  1UFH A;  4Q38 A;  4XPK A;  4PSW A;  2Z3P A;  3D2M A;  2BEI A;  2CXA A;  4B5P B;  2YNE A;  4OAE A;  1MJA A;  1QSM A;  3FBU A;  3BJ7 A;  1WWZ A;  3DR6 A;  1RO5 A;  2NMT A;  4JLY A;  4PK3 A;  3IWG A;  2B4D B;  3W6X A;  3W91 A;  4OAD A;  2JDC A;  1MJ9 A;  1Y9K A;  5JQ4 A;  1R57 A;  1M1D A;  3D2P A;  5J8F A;  4CAX A;  4NF1 A;  3IGR A;  2A4N A;  2X7B A;  1YRE A;  2Z3O A;  1P0H A;  2OZG A;  2R1I A;  4K30 A;  4CRY B;  1SQH A;  2KCW A;  4E0A A;  3N7Z A;  4UCM A;  4CYO A;  3TO7 A;  3GYA A;  4C2Y A;  3EO4 A;  4RI1 A;  3H5Z A;  1Y7R A;  4KLV A;  2C27 A;  4U9Y A;  5HH1 A;  4ZBG A;  5A27 A;  1PU9 A;  5AG7 A;  4Q36 A;  2PDO A;  4JD6 A;  1U6M A;  4FD7 A;  3CXP A;  2B5G B;  2R8V A;  4H6U A;  1S3Z A;  4KOV A;  2B4D A;  2H5M A;  4OLL A;  2ZW6 A;  2IL4 A;  2EVN A;  3TO9 A;  4AVA A;  1YVK A;  2B4B A;  5JPH A;  4R57 A;  4HKF A;  3SXN A;  5E96 A;  4UFX A;  4LX9 A;  1CJW A;  4QUS A;  1B87 A;  4JJX A;  5G1Z A;  3TOA A;  3BLN A;  4MY3 A;  3PZJ A;  2PR1 A;  4UFW A;  3R9E A;  3JUW A;  5F46 A;  5GCN A;  4ZGY B;  2J8M A;  5C88 A;  1MK4 A;  4YRH A;  4KOW A;  4XPL A;  2PC1 A;  4ONU A;  4C2X A;  2QEC A;  3TTH A;  1YVO A;  2FIA A;  1S7K A;  5H86 A;  4A33 A;  4CGP A;  5I0C A;  2B5G A;  4MFK A;  5F47 A;  3F8K A;  4KS9 A;  3EFA A;  3R1K A;  4UCP A;  5A28 A;  2ZW5 A;  2YNC C;  2WPW A;  2YNC A;  2REE A;  2OB0 A;  2I00 A;  5DWM A;  4AG7 A;  4AG9 A;  4F0X A;  4R3L A;  5KTC A;  2WUU A;  2ATR A;  5ISV A;  2BL1 A;  4CS0 B;  3JVN A;  1Q2D A;  4L89 A;  4MFZ A;  3W6S A;  2BUE A;  1M4D A;  4RS2 A;  2Z10 A;  1S5K A;  4FD6 A;  4CAW A;  1ZO0 A;  2Q4Y A;  2VBQ A;  2VZY A;  3KKW A;  4EVY A;  1BO4 A;  2GIV A;  2Z11 A;  4UWJ A;  4CAE A;  4NCZ A;  5HMN A;  1XMT A;  3F0A A;  2REF A;  1TIQ A;  5EBV A;  3R9G A;  1I21 A;  1NSL A;  4CGL A;  2OZU A;  4A95 A;  4MFQ A;  4QBJ A;  5AG6 A;  2Z3N A;  4C68 A;  4X5K A;  4M3S A;  5IX3 A;  4KSF A;  3CXS A;  3S6H A;  2P0W A;  4QVT A;  5IB0 A;  2WPX A;  2VZZ A;  4KUB A;  5KTA A;  3R9F A;  4M85 A;  5F49 A;  4AVB A;  3SHP A;  4CAV A;  5IV0 A;  2P6G A;  1M44 A;  2OZH A;  4B5P A;  3MGD A;  1YGH A;  4Y49 C;  1P4N A;  4PSX A;  3UY5 A;  4IF5 A;  2G3A A;  3F5B A;  1FY7 A;  3DSB A;  1S60 A;  5G20 A;  2PSW A;  2PRB A;  3G8W A;  4B10 A;  4XPD B;  4MY0 A;  4KZT A;  4C7I A;  1L0C A;  2RC4 A;  3EC4 A;  3TOB A;  2BSW A;  2Q44 A;  4CYQ A;  1WK4 A;  2VI7 A;  3IU2 A;  3FXT A;  1KUV A;  3NE7 A;  5KTD A;  5H84 A;  1CM0 A;  2PQ8 A;  3JTK A;  1XIX A;  5AG4 A;  4R9M A;  4R87 A;  4CAF A;  3A9L A;  3TFY A;  1IB1 E;  1Z9U A;  4FD4 A;  4B13 A;  3IU1 A;  2HUZ A;  3ZZI A;  3T9Y A;  3ZJ0 A;  1MJB A;  4CYN A;  4PK2 A;  2G0B A;  4KVO E;  5BWA B;  2CNM A;  1KZF A;  2Q4V A;  5AGE A;  1Y9W A;  2DPS A;  2FS5 A;  4KOS A;  4B12 A;  4XPD C;  4A30 A;  2ARH A;  3P2F A;  4YFJ A;  2Y0M A;  4KLW A;  3D3S A;  3K9U A;  3I9S A;  4HNY B;  3D8P A;  1VHS A;  4KOR A;  4II9 A;  4J3G A;  3TO6 A;  2R98 A;  5EC4 A;  1VKC A;  2D4O A;  3WR7 A;  4R3K A;  5CNP A;  2K5T A;  1YLE A;  4UCN A;  4XNH C;  1XEB A;  1YK3 A;  4JXR A;  2QML A;  2ZW4 A;  1I12 A;  2FT0 A;  2ZPA A;  1B6B A;  1ON0 A;  2FCK A;  3V8I A;  3I3G A;  2QIR A;  4A32 A;  5C82 A;  2Z3M A;  4JWP A;  2FXF A;  1M4I A;  3TCV A;  2YND A;  4NEX A;  2Q0Y A;  1Z4E A;  2PR8 A;  4Y49 B;  1BOB A;  3T90 A;  3EXN A;  5DWN A;  2AE6 A;  2VXK A;  4E8O A;  1XF8 A;  2GE3 A;  3H4Q A;  4KSA A;  3S6G A;  1XE4 A;  2FSR A;  2I79 A;  4AB7 A;  4MFP A;  3LD2 A;  4LUA A;  1QST A;  2WSA A;  1QSR A;  4U5Y A;  2JDD A;  4HNX B;  4BMH A;  4MI4 A;  1N71 A;  4I49 A;  4CGN A;  4GS4 A;  4MFJ A;  4A31 A;  1OZP A;  4UBR A;  1IYL A;  2B3U A;  1K4J A;  1YX0 A;  4QB9 A;  5G22 A;  3OWC A;  2HQY A;  2DPT A;  1PUA A;  4KOT A;  2B3V A;  2CNT A;  4U9Z A;  3VWE A;  3B8G A;  1V0C A;  2CNS A;  2OH1 A;  4ORF A;  2OU2 A;  5FVJ A;  3FB3 A;  1S7N A;  1S7F A;  4KVM E;  4F6A A;  2B58 A;  2FIW A;  4FD5 A;  1RXT A;  1Q2C A;  4L8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...