2JDDA

Glyphosate n-acetyltransferase bound to acetyl coa and 3-phosphoglycerate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title The molecular basis of glyphosate resistance by an optimized microbial acetyltransferase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Transferase
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jddA00
1BO4A 1YVKA 3CXQA 4IF5A 2REEA 2R7HA 1IICA 5IB0A 2VI7A 1K4JA 2DXQA 5EBVA 1MJBA 4KUAA 2J8RA 1KUYA 2G0BA 5JPHA 3FYNA 3SXNA 3UY5A 2VQYA 1NMTA 3E0KA 1RO5A 1Z4RA 4CS0B 5F47A 2BUEA 2PR8A 3F8KA 3BLNA 4B5PA 3R95A 5C88A 5E96A 4GS4A 2VZYA 4MBUA 3T90A 3T9YA 5FVJA 1WK4A 1YK3A 4Y49B 1PUAA 4AB7A 3FB3A 4U9YA 4HNYB 1IB1E 4CRYB 3TO6A 3TE4A 4FD5A 5DWMA 2FIWA 4AG7A 4E2AA 5GCNA 4CAXA 4HKFA 1P0HA 2WPXA 2VZZA 3G8WA 3K9UA 4LX9A 4OAEA 4CAWA 1V0CA 2OH1A 4HNXB 5IX3A 5ISVA 2CNMA 4LUAA 4R87A 4UWIA 3W91A 2JDDA 4DNCA 2R1IA 3W6XA 4AG9A 1ON0A 2HUZA 3EFAA 4R3KA 2GE3A 2FT0A 2CNSA 4R57A 4XPDB 4E8OA 2P6FA 1XE4A 1IIDA 2ZW4A 5HH1A 4F0YA 1XMTA 3CXPA 1S60A 3B8GA 4F6AA 4JLYA 3JUWA 2B4BA 2B3VA 2JLMA 5C82A 4M3SA 4R3LA 4IUSA 2G3AA 1Y9KA 2B5GA 4K30A 1SQHA 2G3TA 5F48A 5CNPA 3TFYA 3DSBA 2IL4A 4RS2A 4MY0A 2HV2A 5IV0A 2FCKA 2KCWA 2H5MA 2F5IA 1S7FA 4X5KA 4KVXA 4Y49C 3S6GA 5KTAA 3G3SA 3N7ZA 5EC4A 2QIRA 2ZXVA 4AVAA 1M4GA 4PV6A 1FY7A 3I3GA 1QSRA 3PZJA 4KZTA 4CAVA 1S7NA 1Q2CA 1XEBA 3PP9A 1NSLA 3R9EA 5F49A 2Q4VA 2RC4A 1YR0A 4EVYA 1M44A 4YGOA 1Q2DA 2P6GA 3R9FA 2FL4A 3PGPA 1M4IA 3FXTA 3OWCA 3DDDA 2B3UA 5DWNA 4H6UA 4NCZA 1N71A 3F0AA 3VWDA 4II9A 4XPDC 4OLLA 3TT2A 3QB8A 1YX0A 3GKRA 2ZW6A 4UBRA 2R98A 1NE9A 2ZW7A 2O28A 2X7BA 4UWJA 3BJ8A 4NXYA 3DR8A 1S5KA 3D2PA 1KZFA 1Q2YA 3DR6A 4BMHA 2VBQA 3EXNA 4OADA 2PRBA 4KOSA 3H4QA 1P4NA 4MY3A 2BL1A 2AE6A 2P0WA 1IYKA 1U6MA 2FS5A 4U5YA 4M85A 3WR7A 1BOBA 3TOBA 5J8FA 4PSXA 2NMTA 2B4DA 4PK2A 2AJ6A 1LRZA 2ZPAA 2EUIA 2B4DB 1IYLA 4ORFA 4KOTA 1Z4EA 4XNHB 4QUSA 2Q0YA 4KOUA 2OZUA 4RI1A 2C27A 4XPKA 1M1DA 3BJ7A 3LD2A 3IGRA 1MK4A 4JWPA 3R9GA 4KOYA 3S6FA 1MJAA 2GIVA 4NSQA 3P2HA 2J8MA 4YFJA 4KVOE 4QVTA 3DNSA 3R96A 1S7KA 2WPWA 2FE7A 4H89A 4U9ZA 4KOVA 4FD4A 5H86A 2PDOA 3ZJ0A 2Q4YA 3FIXA 1M4DA 4JXQA 2P6EA 1B87A 1QSTA 2OZHA 3V8IA 2ZW5A 2Z0ZA 3MGDA 4FD6A 1B6BA 2D4OA 4ZBGA 4H6ZA 3EY5A 3VWEA 5I0CA 3C26A 3ZZIA 1KUVA 2D4PA 3QAHA 1L0CA 1TIQA 4MI4A 5KTCA 3I9SA 4B5OA 3EC4A 4AVCA 4XPLA 1YLEA 5KTDA 2BEIA 2I79A 2OZGA 2Z10A 2CY2A 1J4JA 4R9MA 3F5BA 3NE7A 4AVBA 3TO9A 4CRZB 1RXTA 3EO4A 1XIXA 2PC1A 4MHDA 2PSWA 2Q7BA 3FRMA 4XNHC 3TCVA 3RYOA 3TTHA 5HMNA 2PR1A 1MJ9A 2Q44A 2OU2A 3LODA 5J8CA 2Q04A 2J8NA 3SHPA 2Y0MA 1WWZA 2R8VA 3FBUA 1S7LA 1S3ZA 2VXKA 4QC6A 4UA3A 2B58A 3D8PA 2A4NA 2ATRA 2HQYA 1GHEA 2EVNA 2QECA 4JJXA 1XF8A 3D2MA 3GY9A 4KUBA 1Z9UA 1PU9A 4KOWA 2GANA 4QB9A 3TO7A 2JDCA 4B5PB 2BSWA 1VKCA 4ONUA 4PSWA 2FXFA 3W6SA 5JQ4A 4I49A 4L8AA 2CNTA 2JEVA 2Z11A 5F46A 4KVME 2PQ8A 4E0AA 4YRHA 4L89A 4HNWB 4PK3A 1R57A 1CJWA 1YVOA 4KOXA 1VHSA 5H84A 4NF1A 4J3GA 1OZPA 3TOAA 3SXOA 1QSNA 1Y7RA 4QBJA 2REFA 4MJ8A 2OB0A 2VEZA 1I12A 1YGHA 3R1KA 1QSOA 1I1DA 2FSRA 4NEXA 2FIAA 3GYAA 2ARHA 3KKWA 1UFHA 1CM0A 1QSMA 1YREA 1KUXA 2I00A 3CXSA 3S6KA 3IWGA 4KLWA 4JD6A 2QMLA 3JVNA 4FD7A 2B5GB 4KLVA 3S6HA 1Y9WA 1I21A 2K5TA 3P2FA 4JXRA 3FNCA 4KORA 3D3SA
chains in the Genus database with same CATH superfamily
1BO4A 1TKFA 1YVKA 3CXQA 3D68A 4P6YA 5AGEA 2CIJA 3B3TA 2REEA 3CZXA 4IF5A 1ZLIA 2R7HA 1IICA 4A38A 2VI7A 3B3WA 5LRGA 1K4JA 3RBUA 5IB0A 5JGFA 3D7GA 2ZEOA 5IB9A 2YNEA 2DXQA 5EBVA 1MJBA 4KUAA 2J8RA 1KUYA 2G0BA 5JPHA 3KQXA 3FYNA 3SXNA 3S9MA 2F8HA 2JBJA 2ZEGA 5K8OA 1LAPA 3IIBA 1Z5RA 3UY5A 2VQYA 2ZEEA 2EWBA 3VH9A 4F9UA 1NMTA 3E0KA 1RO5A 1Z4RA 4CS0B 5F47A 1UWYA 2BOAA 2BUEA 3TX8A 2PR8A 3F8KA 2O4HA 3BLNA 4OC5A 4A94A 2XEGA 5G1ZA 4NGQA 2GFQA 3R95A 4B5PA 4ZI6A 5C88A 5E96A 4GS4A 5JM6A 3NFZA 1PCAA 1Z8TA 2VZYA 4MBUA 4UCNA 3T90A 3T9YA 4B10A 2DEAA 5FVJA 1WK4A 1YK3A 4Y49B 1PUAA 4AB7A 1CPSA 4IAVA 5D29A 4WWVA 4UIBA 2DPTA 5JH9A 4IK2A 3FB3A 4U9YA 4HNYB 3VATA 3D7DA 2WYRA 1IB1E 3JRUA 4CRYB 3TO6A 4P4BA 3TE4A 4FD5A 4ZYQA 1LAMA 2IQ6A 5DWMA 4BBHA 3LACA 2FIWA 1YSJA 4MFZA 2IMOA 4UCPA 4AG7A 4E2AA 5GCNA 2Q51A 4CAXA 4HKFA 4MHZA 4OKOA 1P0HA 2WPXA 4UFVA 2VZZA 3G8WA 3SJEA 5HXDA 1ZO0A 3GUXA 3K9UA 3PBEA 1DE4C 4A95A 2F7VA 5HVFA 4Q36A 4LX9A 4OAEA 4CAWA 1V0CA 2OH1A 4HNXB 5IX3A 4F0XA 5ISVA 2CNMA 4LUAA 3KR5A 4MMOA 2ZEFA 1Y0RA 2JDDA 2R1IA 4R87A 4UWIA 3W91A 1X12A 4OIWA 4DNCA 3PB7X 3W6XA 4PXCA 4AG9A 1ON0A 2HUZA 4OIDA 3EFAA 4CGPA 4R3KA 4MFPA 3PBBA 2GE3A 2FT0A 4BINA 1VGYA 2CNSA 4R57A 4XPDB 4ZX8A 4E8OA 2P6FA 1R3NA 1BPMA 2PVWA 5K8MA 3PRTA 1XE4A 3FJUA 2GLJA 3GB0A 3NH4A 3S9LA 1IIDA 2ZW4A 3KASA 4UIAA 5HH1A 4F0YA 5LRKA 1LOKA 1XMTA 1GYTA 3CXPA 3SI1A 1S60A 2V8HA 3B3SA 3B8GA 4F6AA 4JLYA 3JUWA 2B4BA 4KSAA 7CPAA 2B3VA 1LFWA 2JLMA 5C82A 1IOFA 4B11A 4M3SA 4R3LA 4IUSA 4MCRA 5K8NA 2G3AA 1ZG7A 1Y9KA 4KSIA 3A9LA 4UFXA 2B5GA 4K30A 1SQHA 5K8PA 2G3TA 5F48A 4CGOA 2EK8A 2Z3MA 5CNPA 3SI0A 3TFYA 2OOTA 1OBRA 3S9NA 2EO8A 4ZY1A 3DSBA 2IL4A 3PFOA 4MCPA 4RS2A 4MY0A 4Z65A 2CF4A 2HV2A 5IV0A 2FCKA 2KCWA 2H5MA 4ZY2A 1PYTB 2Z3LA 2F5IA 1CBXA 1S7FA 4GM5A 4EFDA 5DS0A 4X5KA 4KVXA 1ELLP 1CPXA 4P4IA 4Y49C 2JEWA 2Z3OA 3S6GA 2C6PA 3BI1A 5KTAA 3G3SA 3N7ZA 5EC4A 4C68A 2QIRA 2ZXVA 3TC8A 4AVAA 1M4GA 4C2XA 4MCSA 4PV6A 1FY7A 3I3GA 1QSRA 3PZJA 4KZTA 1CX8A 4CAVA 2ZOFA 3FMCA 2PJ8A 3FECA 3IU2A 3KR4A 1S7NA 1Q2CA 2C6CA 1XEBA 4UF4A 3PP9A 1NSLA 3R9EA 4ZGYB 5F49A 4R76A 2Q4VA 2V8VA 4CYPA 4TWEA 2RC4A 5I4MA 1YR0A 2PJ0A 4EVYA 4X8IA 1M44A 2CXAA 2PJ1A 4YGOA 4P4JA 2V77A 1Q2DA 2WSAA 3D3SA 3NE8A 3PB4X 4OC0A 2P6GA 3R9FA 8CPAA 4B12A 2FL4A 3WC5A 3PGPA 1IU8A 3D67A 1CP7A 1M4IA 3FXTA 4CAFA 3OWCA 3DDDA 1VHEA 3B7IA 2B3UA 2AFOA 3CPXA 5DWNA 4H6UA 4NCZA 2CTBA 1LANA 1N71A 3F0AA 2PVVA 3VWDA 5G20A 4G1PA 4II9A 3QAYA 1CP6A 3FX6A 4XPDC 1FNOA 4OLLA 3TT2A 1Z8XA 3IO1A 5A28A 3QB8A 3QNVA 4C2ZA 5EMIA 1JQGA 1YX0A 1TXRA 3GKRA 2ZW6A 4PXDA 4OC1A 4UBRA 4PXEA 3FF3A 5J1QA 2R98A 3D4UA 3IWEA 4MCQA 1NE9A 1Y7EA 2POKA 2ZW7A 4PQAA 1HDQA 1X10A 2O28A 2X7BA 4UWJA 2WZNA 3BJ8A 4X3RA 4NXYA 3DR8A 1S5KA 2PJ6A 3D2PA 1KZFA 1TKHA 4CGLA 4HPSA 1Q2YA 3DR6A 4LQGA 4TNUA 2VBQA 2DPSA 3EXNA 4OADA 4BMHA 1RTQA 2PRBA 4YWYA 4A33A 4KOSA 2YNDA 3H4QA 5HVHA 1P4NA 4MY3A 4NFRA 3IC1A 4ZX9A 2BL1A 2AE6A 2PJCA 2ZEDA 2P0WA 1IYKA 1U6MA 2FS5A 1Z8LA 4U5YA 1XFOA 4M85A 4UFWA 3WR7A 1BOBA 1TKJA 2AFWA 4NGPA 3TOBA 3IFEA 3DGVA 4C7IA 4ZY0A 5J8FA 4PSXA 6CPAA 1YLOA 2NMTA 2B4DA 4R8FA 4PK2A 4F9VA 2AJ6A 2C6GA 1NSAA 3WC6A 1LRZA 3D7FA 1AYEA 1Z2LA 2ZPAA 2ZENA 5A27A 2NSMA 2EUIA 2B4DB 1IYLA 4ORFA 2PE3A 4FWUA 4KOTA 4NJQA 1Z4EA 3N5FA 4XNHB 1ARMA 4QUSA 2Q0YA 2PJ3A 4KOUA 2YNCA 2OZUA 4RI1A 3SJGA 2HC9A 3SI2A 2C27A 4XPKA 5D8NA 3BXMA 4R6TA 1M1DA 3BJ7A 3LD2A 4P44A 3IGRA 1MK4A 2PIYA 4JWPA 3R9GA 5CPAA 4DUKA 4KOYA 2PJ7A 4MFKA 4DYOA 3S6FA 1MJAA 2GIVA 1IY7A 3P2HA 4NSQA 1VIXA 2J8MA 1YW6A 4YFJA 4NGNA 4B6ZA 1EE3P 3KL9A 4KVOE 4QVTA 2AFMA 3DNSA 5LRJA 1A2ZA 3R96A 1S7KA 2Z3PA 2WPWA 5ELYA 4CYOA 3RNZA 2VL1A 3CPAA 1XBUA 2PJBA 4UCMA 4OC3A 1DTDA 2CTCA 2FE7A 2V8DA 2ABZA 4H89A 4PPZA 4U9ZA 4EMEA 4KOVA 4FD4A 2PRQA 5H86A 2PDOA 3ZJ0A 2ZOGA 4Q38A 2Q4YA 3FIXA 3PB8X 3WABA 3RAMA 4C2YA 1M4DA 4K3NA 2Z3NA 2G9DA 2FVGA 4FUUA 2PJ2A 3JTKA 2P6EA 1TF8A 4JXQA 1B87A 2PJ5A 4UEFA 2EBJA 1QSTA 4W9YA 2OZHA 3HLPA 3V8IA 3IWWA 2ZW5A 2Z0ZA 4MFQA 1YMEA 4UEEA 2QYVA 3MGDA 5AG7A 4FD6A 4MHPA 1B6BA 3FEDA 2D4OA 4ZBGA 4ONWA 2DF5A 4OP4A 4H6ZA 3EY5A 2V8GA 1VHOA 3VWEA 3I1UA 3C26A 3ZZIA 5I0CA 1KUVA 2D4PA 3QAHA 1L0CA 1TIQA 4MI4A 4MHNA 3K9TA 3PFEA 5KTCA 3I9SA 1BLLE 1TF9A 2GREA 4FBEA 5F09A 4B5OA 3EC4A 4A2ZA 4AVCA 4KSFA 4XPLA 3GLJA 4M6HA 1YLEA 5KTDA 3D7HA 4A30A 2BCOA 4A39A 2BEIA 2I79A 2OZGA 5LYFA 2Z10A 2CY2A 3RZAA 1YW4A 1AUGA 4M6GA 1J4JA 3ISXA 4R9MA 3F5BA 2GLFA 2RB7A 3NE7A 3TO9A 4A31A 4AVBA 1ARLA 4CRZB 1RXTA 3EO4A 1XIXA 2C1CA 2ODFA 3PB6X 4P4DA 2PC1A 2PJ9A 4MHDA 2PSWA 2Q7BA 3FRMA 2O53A 4MFJA 3KQZA 4XNHC 2XEFA 3TCVA 3RYOA 3TTHA 3H8GA 4B14A 5HMNA 4NJRA 2PR1A 3V7ZA 1MJ9A 2Q44A 3FH4A 2OU2A 3KI9A 3BI0A 3LODA 5J8CA 1Q7LA 3PB9X 2AFUA 2YNCC 5AG5A 4CYQA 2Q04A 3KHXA 4FAIA 5HVGA 2J8NA 3D66A 3SHPA 2BO9A 2Y0MA 1F57A 2PJ4A 1BPNA 1WWZA 2R8VA 3FBUA 3LMSA 1S7LA 1S3ZA 2VXKA 4QC6A 4UA3A 1ZG9A 2B58A 3L2NA 1M4LA 1CG2A 1XJOA 4R7MA 3SJFA 3D8PA 4RUHA 2A4NA 2ATRA 2HQYA 3B3VA 2J9AA 4C7HA 2Q7SA 3B35A 2ZEHA 2RFHA 1GHEA 2EVNA 2QECA 3NH5A 4MFLA 4JJXA 4MRIA 4O23A 4CGMA 2AFZA 4Q7AA 1XF8A 2AFSA 4A37A 4BD9A 4OMEA 2YGWA 3D2MA 3GY9A 1Z9UA 4KUBA 3BHXA 4M6IA 2OR4A 1PU9A 4OC4A 1ZG8A 5CBMA 4KOWA 2GANA 4QB9A 3TO7A 2JDCA 3NA6A 4B5PB 2BSWA 1VKCA 4ONUA 2ZEPA 3B2YA 4PSWA 1JWQA 2FXFA 3W6SA 4GXHA 5AG6A 4PXBA 5JQ4A 4I49A 4LQ6A 3VARA 3DLJA 4A32A 4RN7A 4L8AA 3B3CA 2CNTA 4CGNA 2JEVA 2Z11A 5LYIA 5F46A 5LYDA 2Q43A 2Z3KA 4KVME 1Z8WA 2PQ8A 2EK9A 3IEHA 2NYQA 4E0AA 4F8ZA 4YRHA 2Q4ZA 4L89A 1R43A 5LYLA 4CPAA 4IHMA 4HNWB 3GIUA 4PK3A 3LWUA 2IJZA 2XEIA 3K2KA 4MXUA 3NH8A 1R57A 3MN8A 1CJWA 1YVOA 4P4EA 4NGTA 4NGSA 2QVPA 4KOXA 2PJAA 4X2TA 3WC7A 1VHSA 5H84A 3KZWA 4NF1A 2AFXA 4J3GA 1OZPA 3FVLA 3TOAA 3SXOA 1QSNA 1Y7RA 3ISZA 3WT4A 4QBJA 2REFA 4MJ8A 4KS9A 4DJLA 3IU1A 2OB0A 1ZLHA 5AG4A 2VEZA 5BWAB 1IGBA 1I12A 5G21A 1YGHA 3R1KA 4CYNA 1QSOA 1I1DA 2I3CA 5THWA 1F2OA 2FSRA 4NEXA 4OC2A 2FIAA 4AXVA 3GYAA 1F2PA 3T8WA 4CAEA 1IOIA 4H2KA 2WUUA 1KWMA 4WJBA 4B13A 2ARHA 1FT7A 1XMBA 3KKWA 1UFHA 2ZELA 1QMUA 1CM0A 1ELMP 1QSMA 5G22A 1YREA 3H8EA 4NGRA 3CDXA 3H5ZA 1KUXA 2I00A 4MHYA 3KGQA 4P10A 1HDUA 3CXSA 3MRUA 2XEJA 3IWGA 3H8FA 3S6KA 1YQEA 4KLWA 4P4FA 2ANPA 1HEEA 4YU9A 4JD6A 4JYWA 1LCPA 2QMLA 3FEEA 3JVNA 4FD7A 4EWTA 1Y0YA 1QQ9A 2B5GB 3IJ3A 3V38A 1XOVA 4KLVA 2PCUA 1XRYA 2PIZA 3S6HA 1Y9WA 2ZEMA 3HUVA 1I21A 2K5TA 2GU2A 3P2FA 3KHZA 3FNCA 2HB6A 4JXRA 4KORA 4JZ0A 4NGMA 4UEZA 3SJXA 1H8LA 1BAVA 2QJ8A 2JBKA 3CT9A 3PEIA 3RO0A 4P45A 1AMPA
chains in the Genus database with same CATH topology
1BO4A 1YVKA 3CXQA 5AGEA 4IF5A 2REEA 2R7HA 1IICA 5IB0A 2VI7A 1K4JA 2YNEA 2DXQA 5EBVA 1MJBA 4KUAA 2J8RA 1KUYA 2G0BA 5JPHA 3FYNA 3SXNA 3UY5A 2VQYA 1NMTA 3E0KA 1RO5A 1Z4RA 4CS0B 5F47A 2BUEA 2PR8A 3F8KA 3BLNA 4B5PA 5G1ZA 3R95A 5C88A 5E96A 4GS4A 4UCNA 2VZYA 4MBUA 3T90A 3T9YA 4B10A 5FVJA 1WK4A 1YK3A 4Y49B 1PUAA 4AB7A 2DPTA 3FB3A 4U9YA 4HNYB 1IB1E 4CRYB 3TO6A 3TE4A 4FD5A 5DWMA 4BBHA 2FIWA 4MFZA 4UCPA 4AG7A 4E2AA 5GCNA 4CAXA 4HKFA 1P0HA 2WPXA 4UFVA 2VZZA 3G8WA 1ZO0A 3K9UA 4A95A 4Q36A 4LX9A 4OAEA 4CAWA 1V0CA 2OH1A 4HNXB 5IX3A 4F0XA 5ISVA 2CNMA 4LUAA 4R87A 4UWIA 3W91A 2JDDA 4DNCA 2R1IA 3W6XA 4AG9A 1ON0A 2HUZA 3EFAA 4CGPA 4R3KA 4MFPA 2GE3A 2FT0A 2CNSA 4R57A 4XPDB 4E8OA 2P6FA 1XE4A 1IIDA 2ZW4A 5HH1A 4F0YA 1XMTA 3CXPA 1S60A 3B8GA 4F6AA 4JLYA 3JUWA 2B4BA 4KSAA 2B3VA 2JLMA 5C82A 4B11A 4M3SA 4R3LA 4IUSA 2G3AA 1Y9KA 3A9LA 4UFXA 2B5GA 4K30A 1SQHA 2G3TA 5F48A 4CGOA 5CNPA 2Z3MA 3TFYA 3DSBA 2IL4A 4RS2A 4MY0A 2HV2A 5IV0A 2FCKA 2KCWA 2H5MA 2Z3LA 2F5IA 1S7FA 4X5KA 4KVXA 4Y49C 2Z3OA 3S6GA 5KTAA 3G3SA 3N7ZA 5EC4A 4C68A 2QIRA 2ZXVA 4AVAA 1M4GA 4C2XA 4PV6A 1FY7A 3I3GA 1QSRA 3PZJA 4KZTA 4CAVA 3IU2A 1S7NA 1Q2CA 1XEBA 3PP9A 1NSLA 3R9EA 4ZGYB 5F49A 4CYPA 2Q4VA 2RC4A 1YR0A 4EVYA 1M44A 2CXAA 4YGOA 1Q2DA 2WSAA 2P6GA 3R9FA 4B12A 2FL4A 3PGPA 1M4IA 3FXTA 4CAFA 3OWCA 3DDDA 2B3UA 5DWNA 4H6UA 4NCZA 1N71A 3F0AA 3VWDA 5G20A 4II9A 4XPDC 4OLLA 3TT2A 5A28A 3QB8A 4C2ZA 1YX0A 3GKRA 2ZW6A 4UBRA 2R98A 3IWEA 1NE9A 2ZW7A 2O28A 2X7BA 4UWJA 3BJ8A 4NXYA 3DR8A 1S5KA 3D2PA 1KZFA 4CGLA 1Q2YA 3DR6A 4BMHA 2VBQA 2DPSA 3EXNA 4OADA 2PRBA 4A33A 4KOSA 2YNDA 3H4QA 1P4NA 4MY3A 2BL1A 2AE6A 2P0WA 1IYKA 1U6MA 2FS5A 4U5YA 4M85A 4UFWA 3WR7A 1BOBA 3TOBA 4C7IA 5J8FA 4PSXA 2NMTA 2B4DA 4PK2A 2AJ6A 1LRZA 2ZPAA 5A27A 2EUIA 2B4DB 1IYLA 4ORFA 4KOTA 1Z4EA 4XNHB 4QUSA 2Q0YA 4KOUA 2YNCA 2OZUA 4RI1A 2C27A 4XPKA 1M1DA 3BJ7A 3LD2A 3IGRA 1MK4A 4JWPA 3R9GA 4KOYA 4MFKA 3S6FA 1MJAA 2GIVA 4NSQA 3P2HA 2J8MA 4YFJA 4KVOE 4QVTA 3DNSA 3R96A 1S7KA 2Z3PA 2WPWA 4CYOA 4UCMA 2FE7A 4H89A 4U9ZA 4KOVA 4FD4A 5H86A 2PDOA 3ZJ0A 4Q38A 2Q4YA 3FIXA 4C2YA 1M4DA 2Z3NA 3JTKA 2P6EA 4JXQA 1B87A 1QSTA 2OZHA 3V8IA 2ZW5A 2Z0ZA 4MFQA 3MGDA 5AG7A 4FD6A 1B6BA 2D4OA 4ZBGA 4H6ZA 3EY5A 3VWEA 5I0CA 3C26A 3ZZIA 1KUVA 2D4PA 3QAHA 1L0CA 1TIQA 4MI4A 5KTCA 3I9SA 4B5OA 3EC4A 4A2ZA 4AVCA 4KSFA 4XPLA 1YLEA 5KTDA 4A30A 2BEIA 2I79A 2OZGA 2Z10A 2CY2A 1J4JA 4R9MA 3F5BA 3NE7A 4AVBA 3TO9A 4A31A 4CRZB 1RXTA 3EO4A 1XIXA 2PC1A 4MHDA 2PSWA 2Q7BA 3FRMA 4MFJA 4XNHC 3TCVA 3RYOA 3TTHA 4B14A 5HMNA 2PR1A 1MJ9A 2Q44A 2OU2A 3LODA 5J8CA 2YNCC 5AG5A 4CYQA 2Q04A 2J8NA 3SHPA 2Y0MA 1WWZA 2R8VA 3FBUA 1S7LA 1S3ZA 2VXKA 4QC6A 4UA3A 2B58A 3D8PA 2A4NA 2ATRA 2HQYA 4C7HA 1GHEA 2EVNA 2QECA 4MFLA 4CGMA 4JJXA 1XF8A 2YGWA 3GY9A 3D2MA 1Z9UA 4KUBA 1PU9A 4KOWA 2GANA 4QB9A 3TO7A 2JDCA 4B5PB 2BSWA 1VKCA 4ONUA 4PSWA 2FXFA 3W6SA 5AG6A 5JQ4A 4I49A 4A32A 4L8AA 2CNTA 4CGNA 2JEVA 2Z11A 5F46A 2Z3KA 4KVME 2PQ8A 4E0AA 4YRHA 4L89A 4HNWB 4PK3A 1R57A 1CJWA 1YVOA 4KOXA 1VHSA 5H84A 4NF1A 4J3GA 1OZPA 3TOAA 3SXOA 1QSNA 1Y7RA 4QBJA 2REFA 4MJ8A 4KS9A 3IU1A 2OB0A 5AG4A 2VEZA 5BWAB 1I12A 5G21A 1YGHA 3R1KA 4CYNA 1QSOA 1I1DA 2FSRA 4NEXA 2FIAA 3GYAA 4CAEA 2WUUA 4B13A 2ARHA 3KKWA 1UFHA 1CM0A 1QSMA 5G22A 1YREA 3H5ZA 1KUXA 2I00A 3CXSA 3S6KA 3IWGA 4KLWA 4JD6A 2QMLA 3JVNA 4FD7A 2B5GB 4KLVA 3S6HA 1Y9WA 1I21A 2K5TA 3P2FA 4JXRA 3FNCA 4KORA 3D3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BO4 A;  1YVK A;  3CXQ A;  4IF5 A;  2REE A;  2R7H A;  1IIC A;  5IB0 A;  2VI7 A;  1K4J A;  2DXQ A;  5EBV A;  1MJB A;  4KUA A;  2J8R A;  1KUY A;  2G0B A;  5JPH A;  3FYN A;  3SXN A;  3UY5 A;  2VQY A;  1NMT A;  3E0K A;  1RO5 A;  1Z4R A;  4CS0 B;  5F47 A;  2BUE A;  2PR8 A;  3F8K A;  3BLN A;  4B5P A;  3R95 A;  5C88 A;  5E96 A;  4GS4 A;  2VZY A;  4MBU A;  3T90 A;  3T9Y A;  5FVJ A;  1WK4 A;  1YK3 A;  4Y49 B;  1PUA A;  4AB7 A;  3FB3 A;  4U9Y A;  4HNY B;  1IB1 E;  4CRY B;  3TO6 A;  3TE4 A;  4FD5 A;  5DWM A;  2FIW A;  4AG7 A;  4E2A A;  5GCN A;  4CAX A;  4HKF A;  1P0H A;  2WPX A;  2VZZ A;  3G8W A;  3K9U A;  4LX9 A;  4OAE A;  4CAW A;  1V0C A;  2OH1 A;  4HNX B;  5IX3 A;  5ISV A;  2CNM A;  4LUA A;  4R87 A;  4UWI A;  3W91 A;  2JDD A;  4DNC A;  2R1I A;  3W6X A;  4AG9 A;  1ON0 A;  2HUZ A;  3EFA A;  4R3K A;  2GE3 A;  2FT0 A;  2CNS A;  4R57 A;  4XPD B;  4E8O A;  2P6F A;  1XE4 A;  1IID A;  2ZW4 A;  5HH1 A;  4F0Y A;  1XMT A;  3CXP A;  1S60 A;  3B8G A;  4F6A A;  4JLY A;  3JUW A;  2B4B A;  2B3V A;  2JLM A;  5C82 A;  4M3S A;  4R3L A;  4IUS A;  2G3A A;  1Y9K A;  2B5G A;  4K30 A;  1SQH A;  2G3T A;  5F48 A;  5CNP A;  3TFY A;  3DSB A;  2IL4 A;  4RS2 A;  4MY0 A;  2HV2 A;  5IV0 A;  2FCK A;  2KCW A;  2H5M A;  2F5I A;  1S7F A;  4X5K A;  4KVX A;  4Y49 C;  3S6G A;  5KTA A;  3G3S A;  3N7Z A;  5EC4 A;  2QIR A;  2ZXV A;  4AVA A;  1M4G A;  4PV6 A;  1FY7 A;  3I3G A;  1QSR A;  3PZJ A;  4KZT A;  4CAV A;  1S7N A;  1Q2C A;  1XEB A;  3PP9 A;  1NSL A;  3R9E A;  5F49 A;  2Q4V A;  2RC4 A;  1YR0 A;  4EVY A;  1M44 A;  4YGO A;  1Q2D A;  2P6G A;  3R9F A;  2FL4 A;  3PGP A;  1M4I A;  3FXT A;  3OWC A;  3DDD A;  2B3U A;  5DWN A;  4H6U A;  4NCZ A;  1N71 A;  3F0A A;  3VWD A;  4II9 A;  4XPD C;  4OLL A;  3TT2 A;  3QB8 A;  1YX0 A;  3GKR A;  2ZW6 A;  4UBR A;  2R98 A;  1NE9 A;  2ZW7 A;  2O28 A;  2X7B A;  4UWJ A;  3BJ8 A;  4NXY A;  3DR8 A;  1S5K A;  3D2P A;  1KZF A;  1Q2Y A;  3DR6 A;  4BMH A;  2VBQ A;  3EXN A;  4OAD A;  2PRB A;  4KOS A;  3H4Q A;  1P4N A;  4MY3 A;  2BL1 A;  2AE6 A;  2P0W A;  1IYK A;  1U6M A;  2FS5 A;  4U5Y A;  4M85 A;  3WR7 A;  1BOB A;  3TOB A;  5J8F A;  4PSX A;  2NMT A;  2B4D A;  4PK2 A;  2AJ6 A;  1LRZ A;  2ZPA A;  2EUI A;  2B4D B;  1IYL A;  4ORF A;  4KOT A;  1Z4E A;  4XNH B;  4QUS A;  2Q0Y A;  4KOU A;  2OZU A;  4RI1 A;  2C27 A;  4XPK A;  1M1D A;  3BJ7 A;  3LD2 A;  3IGR A;  1MK4 A;  4JWP A;  3R9G A;  4KOY A;  3S6F A;  1MJA A;  2GIV A;  4NSQ A;  3P2H A;  2J8M A;  4YFJ A;  4KVO E;  4QVT A;  3DNS A;  3R96 A;  1S7K A;  2WPW A;  2FE7 A;  4H89 A;  4U9Z A;  4KOV A;  4FD4 A;  5H86 A;  2PDO A;  3ZJ0 A;  2Q4Y A;  3FIX A;  1M4D A;  4JXQ A;  2P6E A;  1B87 A;  1QST A;  2OZH A;  3V8I A;  2ZW5 A;  2Z0Z A;  3MGD A;  4FD6 A;  1B6B A;  2D4O A;  4ZBG A;  4H6Z A;  3EY5 A;  3VWE A;  5I0C A;  3C26 A;  3ZZI A;  1KUV A;  2D4P A;  3QAH A;  1L0C A;  1TIQ A;  4MI4 A;  5KTC A;  3I9S A;  4B5O A;  3EC4 A;  4AVC A;  4XPL A;  1YLE A;  5KTD A;  2BEI A;  2I79 A;  2OZG A;  2Z10 A;  2CY2 A;  1J4J A;  4R9M A;  3F5B A;  3NE7 A;  4AVB A;  3TO9 A;  4CRZ B;  1RXT A;  3EO4 A;  1XIX A;  2PC1 A;  4MHD A;  2PSW A;  2Q7B A;  3FRM A;  4XNH C;  3TCV A;  3RYO A;  3TTH A;  5HMN A;  2PR1 A;  1MJ9 A;  2Q44 A;  2OU2 A;  3LOD A;  5J8C A;  2Q04 A;  2J8N A;  3SHP A;  2Y0M A;  1WWZ A;  2R8V A;  3FBU A;  1S7L A;  1S3Z A;  2VXK A;  4QC6 A;  4UA3 A;  2B58 A;  3D8P A;  2A4N A;  2ATR A;  2HQY A;  1GHE A;  2EVN A;  2QEC A;  4JJX A;  1XF8 A;  3D2M A;  3GY9 A;  4KUB A;  1Z9U A;  1PU9 A;  4KOW A;  2GAN A;  4QB9 A;  3TO7 A;  2JDC A;  4B5P B;  2BSW A;  1VKC A;  4ONU A;  4PSW A;  2FXF A;  3W6S A;  5JQ4 A;  4I49 A;  4L8A A;  2CNT A;  2JEV A;  2Z11 A;  5F46 A;  4KVM E;  2PQ8 A;  4E0A A;  4YRH A;  4L89 A;  4HNW B;  4PK3 A;  1R57 A;  1CJW A;  1YVO A;  4KOX A;  1VHS A;  5H84 A;  4NF1 A;  4J3G A;  1OZP A;  3TOA A;  3SXO A;  1QSN A;  1Y7R A;  4QBJ A;  2REF A;  4MJ8 A;  2OB0 A;  2VEZ A;  1I12 A;  1YGH A;  3R1K A;  1QSO A;  1I1D A;  2FSR A;  4NEX A;  2FIA A;  3GYA A;  2ARH A;  3KKW A;  1UFH A;  1CM0 A;  1QSM A;  1YRE A;  1KUX A;  2I00 A;  3CXS A;  3S6K A;  3IWG A;  4KLW A;  4JD6 A;  2QML A;  3JVN A;  4FD7 A;  2B5G B;  4KLV A;  3S6H A;  1Y9W A;  1I21 A;  2K5T A;  3P2F A;  4JXR A;  3FNC A;  4KOR A;  3D3S A; 
#chains in the Genus database with same CATH topology
 1BO4 A;  1TKF A;  1YVK A;  3CXQ A;  3D68 A;  4P6Y A;  5AGE A;  2CIJ A;  3B3T A;  2REE A;  3CZX A;  4IF5 A;  1ZLI A;  2R7H A;  1IIC A;  4A38 A;  2VI7 A;  3B3W A;  5LRG A;  1K4J A;  3RBU A;  5IB0 A;  5JGF A;  3D7G A;  2ZEO A;  5IB9 A;  2YNE A;  2DXQ A;  5EBV A;  1MJB A;  4KUA A;  2J8R A;  1KUY A;  2G0B A;  5JPH A;  3KQX A;  3FYN A;  3SXN A;  3S9M A;  2F8H A;  2JBJ A;  2ZEG A;  5K8O A;  1LAP A;  3IIB A;  1Z5R A;  3UY5 A;  2VQY A;  2ZEE A;  2EWB A;  3VH9 A;  4F9U A;  1NMT A;  3E0K A;  1RO5 A;  1Z4R A;  4CS0 B;  5F47 A;  1UWY A;  2BOA A;  2BUE A;  3TX8 A;  2PR8 A;  3F8K A;  2O4H A;  3BLN A;  4OC5 A;  4A94 A;  2XEG A;  5G1Z A;  4NGQ A;  2GFQ A;  3R95 A;  4B5P A;  4ZI6 A;  5C88 A;  5E96 A;  4GS4 A;  5JM6 A;  3NFZ A;  1PCA A;  1Z8T A;  2VZY A;  4MBU A;  4UCN A;  3T90 A;  3T9Y A;  4B10 A;  2DEA A;  5FVJ A;  1WK4 A;  1YK3 A;  4Y49 B;  1PUA A;  4AB7 A;  1CPS A;  4IAV A;  5D29 A;  4WWV A;  4UIB A;  2DPT A;  5JH9 A;  4IK2 A;  3FB3 A;  4U9Y A;  4HNY B;  3VAT A;  3D7D A;  2WYR A;  1IB1 E;  3JRU A;  4CRY B;  3TO6 A;  4P4B A;  3TE4 A;  4FD5 A;  4ZYQ A;  1LAM A;  2IQ6 A;  5DWM A;  4BBH A;  3LAC A;  2FIW A;  1YSJ A;  4MFZ A;  2IMO A;  4UCP A;  4AG7 A;  4E2A A;  5GCN A;  2Q51 A;  4CAX A;  4HKF A;  4MHZ A;  4OKO A;  1P0H A;  2WPX A;  4UFV A;  2VZZ A;  3G8W A;  3SJE A;  5HXD A;  1ZO0 A;  3GUX A;  3K9U A;  3PBE A;  1DE4 C;  4A95 A;  2F7V A;  5HVF A;  4Q36 A;  4LX9 A;  4OAE A;  4CAW A;  1V0C A;  2OH1 A;  4HNX B;  5IX3 A;  4F0X A;  5ISV A;  2CNM A;  4LUA A;  3KR5 A;  4MMO A;  2ZEF A;  1Y0R A;  2JDD A;  2R1I A;  4R87 A;  4UWI A;  3W91 A;  1X12 A;  4OIW A;  4DNC A;  3PB7 X;  3W6X A;  4PXC A;  4AG9 A;  1ON0 A;  2HUZ A;  4OID A;  3EFA A;  4CGP A;  4R3K A;  4MFP A;  3PBB A;  2GE3 A;  2FT0 A;  4BIN A;  1VGY A;  2CNS A;  4R57 A;  4XPD B;  4ZX8 A;  4E8O A;  2P6F A;  1R3N A;  1BPM A;  2PVW A;  5K8M A;  3PRT A;  1XE4 A;  3FJU A;  2GLJ A;  3GB0 A;  3NH4 A;  3S9L A;  1IID A;  2ZW4 A;  3KAS A;  4UIA A;  5HH1 A;  4F0Y A;  5LRK A;  1LOK A;  1XMT A;  1GYT A;  3CXP A;  3SI1 A;  1S60 A;  2V8H A;  3B3S A;  3B8G A;  4F6A A;  4JLY A;  3JUW A;  2B4B A;  4KSA A;  7CPA A;  2B3V A;  1LFW A;  2JLM A;  5C82 A;  1IOF A;  4B11 A;  4M3S A;  4R3L A;  4IUS A;  4MCR A;  5K8N A;  2G3A A;  1ZG7 A;  1Y9K A;  4KSI A;  3A9L A;  4UFX A;  2B5G A;  4K30 A;  1SQH A;  5K8P A;  2G3T A;  5F48 A;  4CGO A;  2EK8 A;  2Z3M A;  5CNP A;  3SI0 A;  3TFY A;  2OOT A;  1OBR A;  3S9N A;  2EO8 A;  4ZY1 A;  3DSB A;  2IL4 A;  3PFO A;  4MCP A;  4RS2 A;  4MY0 A;  4Z65 A;  2CF4 A;  2HV2 A;  5IV0 A;  2FCK A;  2KCW A;  2H5M A;  4ZY2 A;  1PYT B;  2Z3L A;  2F5I A;  1CBX A;  1S7F A;  4GM5 A;  4EFD A;  5DS0 A;  4X5K A;  4KVX A;  1ELL P;  1CPX A;  4P4I A;  4Y49 C;  2JEW A;  2Z3O A;  3S6G A;  2C6P A;  3BI1 A;  5KTA A;  3G3S A;  3N7Z A;  5EC4 A;  4C68 A;  2QIR A;  2ZXV A;  3TC8 A;  4AVA A;  1M4G A;  4C2X A;  4MCS A;  4PV6 A;  1FY7 A;  3I3G A;  1QSR A;  3PZJ A;  4KZT A;  1CX8 A;  4CAV A;  2ZOF A;  3FMC A;  2PJ8 A;  3FEC A;  3IU2 A;  3KR4 A;  1S7N A;  1Q2C A;  2C6C A;  1XEB A;  4UF4 A;  3PP9 A;  1NSL A;  3R9E A;  4ZGY B;  5F49 A;  4R76 A;  2Q4V A;  2V8V A;  4CYP A;  4TWE A;  2RC4 A;  5I4M A;  1YR0 A;  2PJ0 A;  4EVY A;  4X8I A;  1M44 A;  2CXA A;  2PJ1 A;  4YGO A;  4P4J A;  2V77 A;  1Q2D A;  2WSA A;  3D3S A;  3NE8 A;  3PB4 X;  4OC0 A;  2P6G A;  3R9F A;  8CPA A;  4B12 A;  2FL4 A;  3WC5 A;  3PGP A;  1IU8 A;  3D67 A;  1CP7 A;  1M4I A;  3FXT A;  4CAF A;  3OWC A;  3DDD A;  1VHE A;  3B7I A;  2B3U A;  2AFO A;  3CPX A;  5DWN A;  4H6U A;  4NCZ A;  2CTB A;  1LAN A;  1N71 A;  3F0A A;  2PVV A;  3VWD A;  5G20 A;  4G1P A;  4II9 A;  3QAY A;  1CP6 A;  3FX6 A;  4XPD C;  1FNO A;  4OLL A;  3TT2 A;  1Z8X A;  3IO1 A;  5A28 A;  3QB8 A;  3QNV A;  4C2Z A;  5EMI A;  1JQG A;  1YX0 A;  1TXR A;  3GKR A;  2ZW6 A;  4PXD A;  4OC1 A;  4UBR A;  4PXE A;  3FF3 A;  5J1Q A;  2R98 A;  3D4U A;  3IWE A;  4MCQ A;  1NE9 A;  1Y7E A;  2POK A;  2ZW7 A;  4PQA A;  1HDQ A;  1X10 A;  2O28 A;  2X7B A;  4UWJ A;  2WZN A;  3BJ8 A;  4X3R A;  4NXY A;  3DR8 A;  1S5K A;  2PJ6 A;  3D2P A;  1KZF A;  1TKH A;  4CGL A;  4HPS A;  1Q2Y A;  3DR6 A;  4LQG A;  4TNU A;  2VBQ A;  2DPS A;  3EXN A;  4OAD A;  4BMH A;  1RTQ A;  2PRB A;  4YWY A;  4A33 A;  4KOS A;  2YND A;  3H4Q A;  5HVH A;  1P4N A;  4MY3 A;  4NFR A;  3IC1 A;  4ZX9 A;  2BL1 A;  2AE6 A;  2PJC A;  2ZED A;  2P0W A;  1IYK A;  1U6M A;  2FS5 A;  1Z8L A;  4U5Y A;  1XFO A;  4M85 A;  4UFW A;  3WR7 A;  1BOB A;  1TKJ A;  2AFW A;  4NGP A;  3TOB A;  3IFE A;  3DGV A;  4C7I A;  4ZY0 A;  5J8F A;  4PSX A;  6CPA A;  1YLO A;  2NMT A;  2B4D A;  4R8F A;  4PK2 A;  4F9V A;  2AJ6 A;  2C6G A;  1NSA A;  3WC6 A;  1LRZ A;  3D7F A;  1AYE A;  1Z2L A;  2ZPA A;  2ZEN A;  5A27 A;  2NSM A;  2EUI A;  2B4D B;  1IYL A;  4ORF A;  2PE3 A;  4FWU A;  4KOT A;  4NJQ A;  1Z4E A;  3N5F A;  4XNH B;  1ARM A;  4QUS A;  2Q0Y A;  2PJ3 A;  4KOU A;  2YNC A;  2OZU A;  4RI1 A;  3SJG A;  2HC9 A;  3SI2 A;  2C27 A;  4XPK A;  5D8N A;  3BXM A;  4R6T A;  1M1D A;  3BJ7 A;  3LD2 A;  4P44 A;  3IGR A;  1MK4 A;  2PIY A;  4JWP A;  3R9G A;  5CPA A;  4DUK A;  4KOY A;  2PJ7 A;  4MFK A;  4DYO A;  3S6F A;  1MJA A;  2GIV A;  1IY7 A;  3P2H A;  4NSQ A;  1VIX A;  2J8M A;  1YW6 A;  4YFJ A;  4NGN A;  4B6Z A;  1EE3 P;  3KL9 A;  4KVO E;  4QVT A;  2AFM A;  3DNS A;  5LRJ A;  1A2Z A;  3R96 A;  1S7K A;  2Z3P A;  2WPW A;  5ELY A;  4CYO A;  3RNZ A;  2VL1 A;  3CPA A;  1XBU A;  2PJB A;  4UCM A;  4OC3 A;  1DTD A;  2CTC A;  2FE7 A;  2V8D A;  2ABZ A;  4H89 A;  4PPZ A;  4U9Z A;  4EME A;  4KOV A;  4FD4 A;  2PRQ A;  5H86 A;  2PDO A;  3ZJ0 A;  2ZOG A;  4Q38 A;  2Q4Y A;  3FIX A;  3PB8 X;  3WAB A;  3RAM A;  4C2Y A;  1M4D A;  4K3N A;  2Z3N A;  2G9D A;  2FVG A;  4FUU A;  2PJ2 A;  3JTK A;  2P6E A;  1TF8 A;  4JXQ A;  1B87 A;  2PJ5 A;  4UEF A;  2EBJ A;  1QST A;  4W9Y A;  2OZH A;  3HLP A;  3V8I A;  3IWW A;  2ZW5 A;  2Z0Z A;  4MFQ A;  1YME A;  4UEE A;  2QYV A;  3MGD A;  5AG7 A;  4FD6 A;  4MHP A;  1B6B A;  3FED A;  2D4O A;  4ZBG A;  4ONW A;  2DF5 A;  4OP4 A;  4H6Z A;  3EY5 A;  2V8G A;  1VHO A;  3VWE A;  3I1U A;  3C26 A;  3ZZI A;  5I0C A;  1KUV A;  2D4P A;  3QAH A;  1L0C A;  1TIQ A;  4MI4 A;  4MHN A;  3K9T A;  3PFE A;  5KTC A;  3I9S A;  1BLL E;  1TF9 A;  2GRE A;  4FBE A;  5F09 A;  4B5O A;  3EC4 A;  4A2Z A;  4AVC A;  4KSF A;  4XPL A;  3GLJ A;  4M6H A;  1YLE A;  5KTD A;  3D7H A;  4A30 A;  2BCO A;  4A39 A;  2BEI A;  2I79 A;  2OZG A;  5LYF A;  2Z10 A;  2CY2 A;  3RZA A;  1YW4 A;  1AUG A;  4M6G A;  1J4J A;  3ISX A;  4R9M A;  3F5B A;  2GLF A;  2RB7 A;  3NE7 A;  3TO9 A;  4A31 A;  4AVB A;  1ARL A;  4CRZ B;  1RXT A;  3EO4 A;  1XIX A;  2C1C A;  2ODF A;  3PB6 X;  4P4D A;  2PC1 A;  2PJ9 A;  4MHD A;  2PSW A;  2Q7B A;  3FRM A;  2O53 A;  4MFJ A;  3KQZ A;  4XNH C;  2XEF A;  3TCV A;  3RYO A;  3TTH A;  3H8G A;  4B14 A;  5HMN A;  4NJR A;  2PR1 A;  3V7Z A;  1MJ9 A;  2Q44 A;  3FH4 A;  2OU2 A;  3KI9 A;  3BI0 A;  3LOD A;  5J8C A;  1Q7L A;  3PB9 X;  2AFU A;  2YNC C;  5AG5 A;  4CYQ A;  2Q04 A;  3KHX A;  4FAI A;  5HVG A;  2J8N A;  3D66 A;  3SHP A;  2BO9 A;  2Y0M A;  1F57 A;  2PJ4 A;  1BPN A;  1WWZ A;  2R8V A;  3FBU A;  3LMS A;  1S7L A;  1S3Z A;  2VXK A;  4QC6 A;  4UA3 A;  1ZG9 A;  2B58 A;  3L2N A;  1M4L A;  1CG2 A;  1XJO A;  4R7M A;  3SJF A;  3D8P A;  4RUH A;  2A4N A;  2ATR A;  2HQY A;  3B3V A;  2J9A A;  4C7H A;  2Q7S A;  3B35 A;  2ZEH A;  2RFH A;  1GHE A;  2EVN A;  2QEC A;  3NH5 A;  4MFL A;  4JJX A;  4MRI A;  4O23 A;  4CGM A;  2AFZ A;  4Q7A A;  1XF8 A;  2AFS A;  4A37 A;  4BD9 A;  4OME A;  2YGW A;  3D2M A;  3GY9 A;  1Z9U A;  4KUB A;  3BHX A;  4M6I A;  2OR4 A;  1PU9 A;  4OC4 A;  1ZG8 A;  5CBM A;  4KOW A;  2GAN A;  4QB9 A;  3TO7 A;  2JDC A;  3NA6 A;  4B5P B;  2BSW A;  1VKC A;  4ONU A;  2ZEP A;  3B2Y A;  4PSW A;  1JWQ A;  2FXF A;  3W6S A;  4GXH A;  5AG6 A;  4PXB A;  5JQ4 A;  4I49 A;  4LQ6 A;  3VAR A;  3DLJ A;  4A32 A;  4RN7 A;  4L8A A;  3B3C A;  2CNT A;  4CGN A;  2JEV A;  2Z11 A;  5LYI A;  5F46 A;  5LYD A;  2Q43 A;  2Z3K A;  4KVM E;  1Z8W A;  2PQ8 A;  2EK9 A;  3IEH A;  2NYQ A;  4E0A A;  4F8Z A;  4YRH A;  2Q4Z A;  4L89 A;  1R43 A;  5LYL A;  4CPA A;  4IHM A;  4HNW B;  3GIU A;  4PK3 A;  3LWU A;  2IJZ A;  2XEI A;  3K2K A;  4MXU A;  3NH8 A;  1R57 A;  3MN8 A;  1CJW A;  1YVO A;  4P4E A;  4NGT A;  4NGS A;  2QVP A;  4KOX A;  2PJA A;  4X2T A;  3WC7 A;  1VHS A;  5H84 A;  3KZW A;  4NF1 A;  2AFX A;  4J3G A;  1OZP A;  3FVL A;  3TOA A;  3SXO A;  1QSN A;  1Y7R A;  3ISZ A;  3WT4 A;  4QBJ A;  2REF A;  4MJ8 A;  4KS9 A;  4DJL A;  3IU1 A;  2OB0 A;  1ZLH A;  5AG4 A;  2VEZ A;  5BWA B;  1IGB A;  1I12 A;  5G21 A;  1YGH A;  3R1K A;  4CYN A;  1QSO A;  1I1D A;  2I3C A;  5THW A;  1F2O A;  2FSR A;  4NEX A;  4OC2 A;  2FIA A;  4AXV A;  3GYA A;  1F2P A;  3T8W A;  4CAE A;  1IOI A;  4H2K A;  2WUU A;  1KWM A;  4WJB A;  4B13 A;  2ARH A;  1FT7 A;  1XMB A;  3KKW A;  1UFH A;  2ZEL A;  1QMU A;  1CM0 A;  1ELM P;  1QSM A;  5G22 A;  1YRE A;  3H8E A;  4NGR A;  3CDX A;  3H5Z A;  1KUX A;  2I00 A;  4MHY A;  3KGQ A;  4P10 A;  1HDU A;  3CXS A;  3MRU A;  2XEJ A;  3IWG A;  3H8F A;  3S6K A;  1YQE A;  4KLW A;  4P4F A;  2ANP A;  1HEE A;  4YU9 A;  4JD6 A;  4JYW A;  1LCP A;  2QML A;  3FEE A;  3JVN A;  4FD7 A;  4EWT A;  1Y0Y A;  1QQ9 A;  2B5G B;  3IJ3 A;  3V38 A;  1XOV A;  4KLV A;  2PCU A;  1XRY A;  2PIZ A;  3S6H A;  1Y9W A;  2ZEM A;  3HUV A;  1I21 A;  2K5T A;  2GU2 A;  3P2F A;  3KHZ A;  3FNC A;  2HB6 A;  4JXR A;  4KOR A;  4JZ0 A;  4NGM A;  4UEZ A;  3SJX A;  1H8L A;  1BAV A;  2QJ8 A;  2JBK A;  3CT9 A;  3PEI A;  3RO0 A;  4P45 A;  1AMP A; 
#chains in the Genus database with same CATH homology
 1BO4 A;  1YVK A;  3CXQ A;  5AGE A;  4IF5 A;  2REE A;  2R7H A;  1IIC A;  5IB0 A;  2VI7 A;  1K4J A;  2YNE A;  2DXQ A;  5EBV A;  1MJB A;  4KUA A;  2J8R A;  1KUY A;  2G0B A;  5JPH A;  3FYN A;  3SXN A;  3UY5 A;  2VQY A;  1NMT A;  3E0K A;  1RO5 A;  1Z4R A;  4CS0 B;  5F47 A;  2BUE A;  2PR8 A;  3F8K A;  3BLN A;  4B5P A;  5G1Z A;  3R95 A;  5C88 A;  5E96 A;  4GS4 A;  4UCN A;  2VZY A;  4MBU A;  3T90 A;  3T9Y A;  4B10 A;  5FVJ A;  1WK4 A;  1YK3 A;  4Y49 B;  1PUA A;  4AB7 A;  2DPT A;  3FB3 A;  4U9Y A;  4HNY B;  1IB1 E;  4CRY B;  3TO6 A;  3TE4 A;  4FD5 A;  5DWM A;  4BBH A;  2FIW A;  4MFZ A;  4UCP A;  4AG7 A;  4E2A A;  5GCN A;  4CAX A;  4HKF A;  1P0H A;  2WPX A;  4UFV A;  2VZZ A;  3G8W A;  1ZO0 A;  3K9U A;  4A95 A;  4Q36 A;  4LX9 A;  4OAE A;  4CAW A;  1V0C A;  2OH1 A;  4HNX B;  5IX3 A;  4F0X A;  5ISV A;  2CNM A;  4LUA A;  4R87 A;  4UWI A;  3W91 A;  2JDD A;  4DNC A;  2R1I A;  3W6X A;  4AG9 A;  1ON0 A;  2HUZ A;  3EFA A;  4CGP A;  4R3K A;  4MFP A;  2GE3 A;  2FT0 A;  2CNS A;  4R57 A;  4XPD B;  4E8O A;  2P6F A;  1XE4 A;  1IID A;  2ZW4 A;  5HH1 A;  4F0Y A;  1XMT A;  3CXP A;  1S60 A;  3B8G A;  4F6A A;  4JLY A;  3JUW A;  2B4B A;  4KSA A;  2B3V A;  2JLM A;  5C82 A;  4B11 A;  4M3S A;  4R3L A;  4IUS A;  2G3A A;  1Y9K A;  3A9L A;  4UFX A;  2B5G A;  4K30 A;  1SQH A;  2G3T A;  5F48 A;  4CGO A;  5CNP A;  2Z3M A;  3TFY A;  3DSB A;  2IL4 A;  4RS2 A;  4MY0 A;  2HV2 A;  5IV0 A;  2FCK A;  2KCW A;  2H5M A;  2Z3L A;  2F5I A;  1S7F A;  4X5K A;  4KVX A;  4Y49 C;  2Z3O A;  3S6G A;  5KTA A;  3G3S A;  3N7Z A;  5EC4 A;  4C68 A;  2QIR A;  2ZXV A;  4AVA A;  1M4G A;  4C2X A;  4PV6 A;  1FY7 A;  3I3G A;  1QSR A;  3PZJ A;  4KZT A;  4CAV A;  3IU2 A;  1S7N A;  1Q2C A;  1XEB A;  3PP9 A;  1NSL A;  3R9E A;  4ZGY B;  5F49 A;  4CYP A;  2Q4V A;  2RC4 A;  1YR0 A;  4EVY A;  1M44 A;  2CXA A;  4YGO A;  1Q2D A;  2WSA A;  2P6G A;  3R9F A;  4B12 A;  2FL4 A;  3PGP A;  1M4I A;  3FXT A;  4CAF A;  3OWC A;  3DDD A;  2B3U A;  5DWN A;  4H6U A;  4NCZ A;  1N71 A;  3F0A A;  3VWD A;  5G20 A;  4II9 A;  4XPD C;  4OLL A;  3TT2 A;  5A28 A;  3QB8 A;  4C2Z A;  1YX0 A;  3GKR A;  2ZW6 A;  4UBR A;  2R98 A;  3IWE A;  1NE9 A;  2ZW7 A;  2O28 A;  2X7B A;  4UWJ A;  3BJ8 A;  4NXY A;  3DR8 A;  1S5K A;  3D2P A;  1KZF A;  4CGL A;  1Q2Y A;  3DR6 A;  4BMH A;  2VBQ A;  2DPS A;  3EXN A;  4OAD A;  2PRB A;  4A33 A;  4KOS A;  2YND A;  3H4Q A;  1P4N A;  4MY3 A;  2BL1 A;  2AE6 A;  2P0W A;  1IYK A;  1U6M A;  2FS5 A;  4U5Y A;  4M85 A;  4UFW A;  3WR7 A;  1BOB A;  3TOB A;  4C7I A;  5J8F A;  4PSX A;  2NMT A;  2B4D A;  4PK2 A;  2AJ6 A;  1LRZ A;  2ZPA A;  5A27 A;  2EUI A;  2B4D B;  1IYL A;  4ORF A;  4KOT A;  1Z4E A;  4XNH B;  4QUS A;  2Q0Y A;  4KOU A;  2YNC A;  2OZU A;  4RI1 A;  2C27 A;  4XPK A;  1M1D A;  3BJ7 A;  3LD2 A;  3IGR A;  1MK4 A;  4JWP A;  3R9G A;  4KOY A;  4MFK A;  3S6F A;  1MJA A;  2GIV A;  4NSQ A;  3P2H A;  2J8M A;  4YFJ A;  4KVO E;  4QVT A;  3DNS A;  3R96 A;  1S7K A;  2Z3P A;  2WPW A;  4CYO A;  4UCM A;  2FE7 A;  4H89 A;  4U9Z A;  4KOV A;  4FD4 A;  5H86 A;  2PDO A;  3ZJ0 A;  4Q38 A;  2Q4Y A;  3FIX A;  4C2Y A;  1M4D A;  2Z3N A;  3JTK A;  2P6E A;  4JXQ A;  1B87 A;  1QST A;  2OZH A;  3V8I A;  2ZW5 A;  2Z0Z A;  4MFQ A;  3MGD A;  5AG7 A;  4FD6 A;  1B6B A;  2D4O A;  4ZBG A;  4H6Z A;  3EY5 A;  3VWE A;  5I0C A;  3C26 A;  3ZZI A;  1KUV A;  2D4P A;  3QAH A;  1L0C A;  1TIQ A;  4MI4 A;  5KTC A;  3I9S A;  4B5O A;  3EC4 A;  4A2Z A;  4AVC A;  4KSF A;  4XPL A;  1YLE A;  5KTD A;  4A30 A;  2BEI A;  2I79 A;  2OZG A;  2Z10 A;  2CY2 A;  1J4J A;  4R9M A;  3F5B A;  3NE7 A;  4AVB A;  3TO9 A;  4A31 A;  4CRZ B;  1RXT A;  3EO4 A;  1XIX A;  2PC1 A;  4MHD A;  2PSW A;  2Q7B A;  3FRM A;  4MFJ A;  4XNH C;  3TCV A;  3RYO A;  3TTH A;  4B14 A;  5HMN A;  2PR1 A;  1MJ9 A;  2Q44 A;  2OU2 A;  3LOD A;  5J8C A;  2YNC C;  5AG5 A;  4CYQ A;  2Q04 A;  2J8N A;  3SHP A;  2Y0M A;  1WWZ A;  2R8V A;  3FBU A;  1S7L A;  1S3Z A;  2VXK A;  4QC6 A;  4UA3 A;  2B58 A;  3D8P A;  2A4N A;  2ATR A;  2HQY A;  4C7H A;  1GHE A;  2EVN A;  2QEC A;  4MFL A;  4CGM A;  4JJX A;  1XF8 A;  2YGW A;  3GY9 A;  3D2M A;  1Z9U A;  4KUB A;  1PU9 A;  4KOW A;  2GAN A;  4QB9 A;  3TO7 A;  2JDC A;  4B5P B;  2BSW A;  1VKC A;  4ONU A;  4PSW A;  2FXF A;  3W6S A;  5AG6 A;  5JQ4 A;  4I49 A;  4A32 A;  4L8A A;  2CNT A;  4CGN A;  2JEV A;  2Z11 A;  5F46 A;  2Z3K A;  4KVM E;  2PQ8 A;  4E0A A;  4YRH A;  4L89 A;  4HNW B;  4PK3 A;  1R57 A;  1CJW A;  1YVO A;  4KOX A;  1VHS A;  5H84 A;  4NF1 A;  4J3G A;  1OZP A;  3TOA A;  3SXO A;  1QSN A;  1Y7R A;  4QBJ A;  2REF A;  4MJ8 A;  4KS9 A;  3IU1 A;  2OB0 A;  5AG4 A;  2VEZ A;  5BWA B;  1I12 A;  5G21 A;  1YGH A;  3R1K A;  4CYN A;  1QSO A;  1I1D A;  2FSR A;  4NEX A;  2FIA A;  3GYA A;  4CAE A;  2WUU A;  4B13 A;  2ARH A;  3KKW A;  1UFH A;  1CM0 A;  1QSM A;  5G22 A;  1YRE A;  3H5Z A;  1KUX A;  2I00 A;  3CXS A;  3S6K A;  3IWG A;  4KLW A;  4JD6 A;  2QML A;  3JVN A;  4FD7 A;  2B5G B;  4KLV A;  3S6H A;  1Y9W A;  1I21 A;  2K5T A;  3P2F A;  4JXR A;  3FNC A;  4KOR A;  3D3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...