2JDDA

Glyphosate n-acetyltransferase bound to acetyl coa and 3-phosphoglycerate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
publication title The molecular basis of glyphosate resistance by an optimized microbial acetyltransferase.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jddA00
2VQYA 1VHSA 3TTHA 1XF8A 3GKRA 4NF1A 3TO6A 4R87A 1VKCA 1IICA 2OZGA 2VEZA 4NSQA 1N71A 1IB1E 4RS2A 4QB9A 5F49A 2ZW7A 2OZUA 1S3ZA 5H86A 4PK2A 2OH1A 4JLYA 5C82A 1QSTA 1Z9UA 3EY5A 4E0AA 4NCZA 4AG7A 3LODA 3F5BA 2B5GA 3PP9A 4KLWA 1Q2YA 2VZZA 3F8KA 1YVKA 4PSXA 3D2PA 4JJXA 3FB3A 1S7LA 3DSBA 2JDDA 4Y49B 4MY3A 2A4NA 3DDDA 3R1KA 3R9EA 1CJWA 1OZPA 3GYAA 2GIVA 2VI7A 1YVOA 4XNHB 4AVBA 4PK3A 1QSNA 1L0CA 1YREA 4B5PA 1I1DA 1XE4A 4FD6A 2FT0A 2K5TA 1Y9KA 2B4DB 3TT2A 4AG9A 3TE4A 1YX0A 3FBUA 3OWCA 4JXRA 3IGRA 4KVXA 4CRZB 2B4BA 2P6FA 5DWNA 3TFYA 1S7FA 1P4NA 1RXTA 3B8GA 5FVJA 5ISVA 2OB0A 1XEBA 1NSLA 1MK4A 1M44A 2R8VA 1S60A 5EBVA 2GANA 4OADA 1MJ9A 4B5PB 1KUVA 1K4JA 3SXOA 4XPKA 3D8PA 4L89A 2J8NA 2Q44A 4CS0B 1KUYA 4X5KA 1J4JA 4AB7A 2EVNA 2C27A 4MY0A 1WK4A 2Y0MA 3I3GA 4LX9A 2Z11A 2ZXVA 4FD4A 4KLVA 1CM0A 1M4DA 2O28A 4QUSA 3LD2A 2OU2A 4F0YA 4H6UA 2ZW4A 2B3VA 5IV0A 2AJ6A 3TOBA 4HNYB 4UWIA 5HH1A 4U9YA 3E0KA 4QC6A 2QIRA 5KTAA 1M4GA 3SXNA 3P2FA 3T9YA 4K30A 1IYLA 3G3SA 1YGHA 3PZJA 4IF5A 5F47A 2CNSA 2FS5A 4R3KA 2PSWA 2I79A 4KOTA 3FRMA 2B58A 1BOBA 3TO7A 1SQHA 1ON0A 3FNCA 2B4DA 5DWMA 3S6FA 3VWDA 2JDCA 2RC4A 5C88A 2HUZA 1GHEA 3EC4A 2ATRA 1PUAA 2B3UA 2VZYA 3JVNA 2DXQA 4QBJA 3CXSA 4MI4A 3I9SA 2VBQA 4JXQA 2CNTA 3QAHA 2PR8A 2FE7A 3S6HA 4ONUA 2G3AA 3EXNA 1LRZA 4CAXA 2GE3A 2D4OA 1XIXA 4MHDA 4UA3A 4XPLA 3G8WA 3DR8A 4AVAA 2BSWA 1FY7A 4ORFA 2Q4VA 2REFA 3QB8A 1BO4A 1V0CA 5IB0A 4J3GA 3W6XA 1Z4EA 2Q7BA 4R3LA 5KTDA 3TO9A 4II9A 4XPDC 3C26A 4KZTA 4B5OA 4ZBGA 1U6MA 4HKFA 3PGPA 3BLNA 2WPWA 3TOAA 3V8IA 3H4QA 2Z0ZA 3R9FA 4KOXA 3FXTA 2PR1A 3ZZIA 3SHPA 5F48A 4CAWA 2KCWA 2EUIA 3S6KA 4CRYB 2AE6A 3W91A 2PDOA 2HQYA 4R9MA 1RO5A 3P2HA 2QMLA 1S7NA 5E96A 2IL4A 3MGDA 1TIQA 3F0AA 4KOSA 5GCNA 4NEXA 2G3TA 2ARHA 4UBRA 4FD7A 4HNXB 3DR6A 4HNWB 4R57A 3S6GA 3WR7A 2FXFA 1Q2CA 1IIDA 4GS4A 4IUSA 4KOYA 2P6GA 4PSWA 3EFAA 4I49A 4U5YA 2X7BA 2WPXA 1MJAA 3D2MA 4H6ZA 4BMHA 4LUAA 1UFHA 2Q04A 4PV6A 4E2AA 1XMTA 3NE7A 3JUWA 4UWJA 3R96A 5IX3A 2BEIA 2CY2A 4CAVA 1YR0A 2J8RA 1Y7RA 1I12A 1M1DA 5HMNA 5JQ4A 2J8MA 3KKWA 1S7KA 1NE9A 1QSRA 1Q2DA 4KOWA 4KUBA 4KOUA 2QECA 5J8CA 1B87A 5EC4A 2ZW5A 4KORA 4RI1A 4AVCA 4MBUA 1KZFA 4QVTA 3FYNA 4DNCA 4M85A 1NMTA 2FIWA 2P6EA 2F5IA 2R1IA 2PC1A 3W6SA 3UY5A 4Y49C 3ZJ0A 1PU9A 5KTCA 1IYKA 1S5KA 2FCKA 4KVME 2FSRA 5JPHA 4MJ8A 1QSMA 1Z4RA 2ZPAA 4XNHC 4H89A 2JEVA 1P0HA 4XPDB 2BL1A 2FL4A 2FIAA 4F6AA 2REEA 4YRHA 2Q4YA 3TCVA 2PQ8A 5F46A 2P0WA 4KVOE 4L8AA 4FD5A 1WWZA 1I21A 2B5GB 2ZW6A 2Z10A 2H5MA 3N7ZA 1QSOA 2VXKA 2OZHA 2PRBA 4JD6A 3R9GA 4KOVA 2G0BA 3CXQA 3T90A 1KUXA 2JLMA 2HV2A 1Y9WA 5H84A 2NMTA 2CNMA 4JWPA 5I0CA 1YK3A 4NXYA 3CXPA 5J8FA 1MJBA 3VWEA 2R7HA 4U9ZA 3BJ7A 3R95A 2R98A 4E8OA 3D3SA 1YLEA 2Q0YA 4M3SA 3EO4A 1R57A 4EVYA 4OAEA 3FIXA 4YGOA 3BJ8A 5CNPA 3K9UA 4KUAA 3RYOA 4OLLA 3DNSA 3IWGA 1M4IA 1B6BA 2D4PA 2BUEA 2I00A 3GY9A 4YFJA
chains in the Genus database with same CATH superfamily
2VQYA 4X3RA 4PXDA 1VHSA 3TTHA 3JTKA 3KL9A 5AGEA 1XF8A 3T8WA 3GKRA 4NJQA 4NF1A 2PVVA 3TO6A 1HDQA 3FX6A 4R87A 1CBXA 1VKCA 1IICA 2OZGA 2VEZA 3PB6X 4NSQA 4OC0A 1N71A 1IB1E 4RS2A 4B13A 1XBUA 4QB9A 1Y0RA 1CP7A 3D4UA 5F49A 2ZW7A 2OZUA 3PB9X 1QMUA 1S3ZA 5H86A 1X12A 4PK2A 2PVWA 3SI0A 4PXEA 2OH1A 4CAFA 4JLYA 5C82A 4ZYQA 1QSTA 1Z9UA 3EY5A 4E0AA 4NCZA 4AG7A 3A9LA 3LODA 4A39A 5LYFA 2ZEMA 1QQ9A 3KI9A 4MFJA 4MFQA 3F5BA 3KQZA 2AFOA 2B5GA 2GU2A 3PP9A 4KLWA 4OKOA 4P4EA 5A27A 1NSAA 1RTQA 3D7FA 3RAMA 1Q2YA 4A95A 2VZZA 3F8KA 3SI1A 1YVKA 2YNCA 4PSXA 1YMEA 4TNUA 3D2PA 4JJXA 2NYQA 3FB3A 4NFRA 1S7LA 3DSBA 4P44A 2JDDA 4Y49B 3WABA 3NFZA 2IJZA 4AXVA 4X2TA 4MY3A 5CBMA 2A4NA 2XEFA 2ZEPA 3DDDA 3R1KA 3VH9A 4GM5A 3R9EA 1CJWA 5K8OA 3B3SA 1OZPA 3GYAA 2GIVA 3PBBA 1EE3P 5DS0A 1TXRA 4MFLA 1BPNA 2VI7A 1CPSA 4MFZA 3BI1A 4B6ZA 1YVOA 4A31A 4XNHB 1IOIA 1AYEA 4P4IA 4UEZA 4AVBA 2FVGA 4KS9A 4A2ZA 4C7HA 2AFSA 4K3NA 4PK3A 5HVGA 1QSNA 4MXUA 1L0CA 4EFDA 1YREA 3K9TA 1I1DA 2PJAA 4B5PA 1Q7LA 2YGWA 1TKHA 4P4DA 2JBJA 5EMIA 1XE4A 4FD6A 2FT0A 2K5TA 1Y9KA 3LMSA 2B4DB 2ZEEA 3TT2A 3L2NA 4AG9A 3D68A 3TE4A 1LFWA 2PJ2A 1YX0A 3FBUA 2ZOFA 3OWCA 4H2KA 2PJ4A 4JXRA 2V8HA 3BI0A 3IGRA 4KVXA 4CRZB 3HLPA 3SI2A 2B4BA 2P6FA 4LQ6A 5DWNA 1XMBA 3TFYA 2VL1A 5AG7A 3MRUA 3MN8A 3BHXA 3JRUA 3NH8A 1S7FA 4UCPA 1P4NA 2PRQA 1RXTA 3FJUA 1M4LA 3B8GA 3ISZA 3KASA 5FVJA 5ISVA 1YQEA 2OB0A 4UCNA 1XEBA 2AFWA 1NSLA 1MK4A 2WUUA 4OC5A 2C1CA 4MFKA 4OIDA 4WJBA 1M44A 2R8VA 1S60A 5G21A 2QVPA 2AFXA 5EBVA 4P4BA 4UEFA 2GANA 4OADA 1MJ9A 4B10A 4B5PB 1KUVA 1K4JA 2OOTA 3SXOA 5CPAA 3SJEA 4XPKA 3S9LA 3D8PA 4L89A 5HVHA 2J8NA 4KSIA 2Q44A 4R6TA 4CS0B 1KUYA 4UCMA 3V7ZA 4CGNA 2GREA 1J4JA 4X5KA 4A38A 4AB7A 1OBRA 4FBEA 3D67A 2EVNA 5LYLA 3B3CA 4M6GA 2C27A 4MY0A 1WK4A 2Y0MA 3I3GA 5LRKA 4LX9A 4YU9A 2Z11A 2ZXVA 4FD4A 4KLVA 1CM0A 1M4DA 2PIYA 2O28A 4QUSA 3LD2A 2OU2A 4MHYA 2DEAA 4F0YA 5J1QA 2CIJA 4H6UA 2ZW4A 4MFPA 3B35A 2B3VA 2EK8A 2RB7A 5IV0A 2AJ6A 4PXBA 3TOBA 4HNYB 4C2XA 4IAVA 4UWIA 5HH1A 4U9YA 3E0KA 4QC6A 2QIRA 5KTAA 1M4GA 2PCUA 3SXNA 3P2FA 3WC5A 1XRYA 4NGQA 4RUHA 2PE3A 3T9YA 4K30A 1IYLA 3G3SA 1YGHA 1ARMA 4ZY0A 3PZJA 3VARA 5G1ZA 4IF5A 5F47A 2CNSA 2FS5A 2PJ9A 4R3KA 2PSWA 2I79A 1GYTA 4KOTA 4KSFA 3KHXA 3GUXA 2Z3KA 3FRMA 2B58A 1LANA 1BOBA 4G1PA 3TO7A 2O4HA 1SQHA 5AG5A 1ON0A 3FNCA 3GIUA 5AG6A 3QAYA 3CT9A 3HUVA 2B4DA 5DWMA 4X8IA 4MCQA 3S6FA 3VWDA 2ZOGA 3FEEA 3IU1A 4JYWA 3S9MA 4R7MA 2JDCA 2RC4A 5JGFA 2Q43A 4OC3A 1IGBA 2HUZA 5C88A 1GHEA 3RNZA 5F09A 4UIAA 3EC4A 3SJGA 2ATRA 1PUAA 2B3UA 1YW6A 3H8EA 5HXDA 2VZYA 3JVNA 4P45A 2ZELA 5BWAB 1Z5RA 4B14A 2DXQA 4QBJA 3CXSA 4MI4A 3I9SA 2NSMA 2VBQA 3S9NA 2POKA 2CNTA 3QAHA 2F8HA 4JXQA 2PR8A 3WC6A 4ZGYB 1HDUA 2FE7A 5G22A 3IFEA 2C6CA 4BD9A 3S6HA 4CGMA 4ONUA 2G3AA 3EXNA 1LRZA 1ZLHA 3KGQA 2GE3A 4CAXA 2D4OA 1XIXA 2PJCA 3H8FA 1TKJA 4MHDA 3TX8A 3WT4A 1Y0YA 4UA3A 3IC1A 3IWWA 4XPLA 3G8WA 3DR8A 1VGYA 4AVAA 4CGLA 3CPXA 2BSWA 2C6GA 2ZEGA 2GLFA 1Z8WA 1F57A 1IU8A 3B3VA 4FUUA 4DUKA 5K8MA 5JH9A 1FY7A 4ORFA 5THWA 4EWTA 2Q4VA 4DYOA 4B12A 4F0XA 2REFA 4NGTA 3QB8A 3KZWA 4ZI6A 2Q4ZA 1BLLE 2WZNA 4MRIA 1BO4A 1CX8A 1V0CA 2ZEOA 3BXMA 5G20A 3KHZA 4P4JA 4J3GA 6CPAA 5IB0A 3W6XA 2CTBA 1Z4EA 2Q7BA 4WWVA 4NGNA 4R3LA 5KTDA 4OC2A 3TO9A 1XJOA 4II9A 4XPDC 4PXCA 3C26A 3KR5A 4KZTA 4B5OA 4ZBGA 2ODFA 1LAPA 1U6MA 4HKFA 1LOKA 3PGPA 1ZG8A 4IK2A 4MCPA 3RBUA 3KR4A 4Q36A 2CXAA 3BLNA 2WPWA 4ZX8A 2YNEA 3TOAA 3V8IA 3H4QA 2WSAA 4UEEA 3SJXA 2Z0ZA 2ZEFA 3R9FA 3IWEA 4KOXA 5K8NA 1AUGA 3FXTA 4FWUA 2PR1A 3ZZIA 2HC9A 4MHPA 3I1UA 3SHPA 1YW4A 5F48A 2XEGA 4CAWA 2EO8A 2KCWA 2EUIA 1LAMA 2JEWA 4MCRA 3S6KA 4PPZA 4CRYB 2AE6A 3W91A 4C2YA 2PDOA 2HQYA 4TWEA 1VHEA 4P6YA 4R9MA 2WYRA 1CG2A 4PQAA 1RO5A 5LRJA 1CP6A 2QMLA 3P2HA 5I4MA 2PJ0A 1DE4C 1S7NA 4MCSA 5A28A 5E96A 2IL4A 2ABZA 5LYIA 2Z3LA 4Q38A 4CYNA 2OR4A 3ISXA 3MGDA 1TIQA 5LYDA 3F0AA 1CPXA 4KOSA 4OC1A 5GCNA 4NEXA 2G3TA 3NH4A 2ARHA 3PFOA 4UBRA 4FD7A 4HNXB 3DR6A 4OC4A 3RO0A 4UFWA 4HNWB 3DLJA 2XEJA 4KSAA 4R57A 3S6GA 3WR7A 2FXFA 1UWYA 1Q2CA 2QYVA 2Z3MA 3DGVA 3NE8A 1VIXA 4OMEA 2DF5A 1IIDA 1R43A 4GS4A 2AFZA 4IUSA 4KOYA 2BO9A 2IMOA 3D66A 1Z8LA 2EBJA 2P6GA 3N5FA 1TF9A 1ZG9A 2PJBA 4PSWA 3PB7X 1ZO0A 3EFAA 4I49A 4U5YA 4B11A 7CPAA 4UF4A 2X7BA 4OIWA 2WPXA 4A94A 4RN7A 5IB9A 4C68A 1MJAA 3D2MA 4H6ZA 4BMHA 3NH5A 4C7IA 4LUAA 2QJ8A 3FECA 1PYTB 1UFHA 2Q04A 4PV6A 4E2AA 1YLOA 1F2PA 1XMTA 2Q7SA 3NE7A 2CF4A 2GLJA 1IOFA 3JUWA 2CTCA 3PB4X 4HPSA 4C2ZA 4UWJA 8CPAA 4NGMA 3R96A 5IX3A 2BEIA 3IO1A 1ARLA 2CY2A 4BBHA 4CAVA 1YR0A 4MHZA 2J8RA 3LACA 4R76A 1Y7RA 1FT7A 1I12A 1M1DA 2I3CA 2O53A 3PFEA 5HMNA 3IIBA 3FEDA 3LWUA 5JQ4A 2J8MA 3KKWA 3FVLA 1BAVA 1S7KA 3H5ZA 1NE9A 1QSRA 1Q2DA 2RFHA 4KOWA 4KUBA 2AFMA 3D7GA 4KOUA 4ONWA 5HVFA 4FAIA 1XFOA 1TKFA 2QECA 3IEHA 4NGPA 4MMOA 2BOAA 5J8CA 2DPTA 3CDXA 5JPHA 4A32A 1B87A 5EC4A 5K8PA 3SJFA 2ANPA 2Z3PA 2ZW5A 4LQGA 2HB6A 4Q7AA 4UFVA 4ZY1A 4KORA 5JM6A 1ELMP 1TF8A 2IQ6A 3CZXA 4RI1A 4AVCA 4MBUA 1KZFA 5LRGA 4QVTA 2PJ6A 3FYNA 4EMEA 4DNCA 2G9DA 1Y7EA 4M85A 4NGRA 4OP4A 1NMTA 3TC8A 2FIWA 2P6EA 2Z3NA 2F5IA 3PB8X 2R1IA 2PC1A 3IJ3A 5D8NA 3W6SA 3WC7A 3UY5A 4O23A 4Y49C 3ZJ0A 1PU9A 2DPSA 4CGOA 2YNDA 1F2OA 5KTCA 1IYKA 4NGSA 1S5KA 2FCKA 4KVME 1IY7A 2V8GA 2FSRA 2PJ5A 1LCPA 1X10A 3PBEA 1KWMA 1QSMA 1Z4RA 2ZPAA 3CPAA 4H89A 4MJ8A 2JEVA 1P0HA 2AFUA 3KQXA 4XNHC 4CYQA 4Z65A 4UIBA 2BL1A 2FL4A 2FIAA 4XPDB 4YWYA 4F6AA 3B3TA 2REEA 1VHOA 4P10A 1DTDA 2PIZA 4P4FA 4YRHA 2Q4YA 1JWQA 4GXHA 4W9YA 3TCVA 2PQ8A 5F46A 4M6HA 1Z8XA 2P0WA 2V77A 4KVOE 3VATA 3B3WA 2V8VA 4L8AA 4FD5A 3RZAA 2PJ8A 1AMPA 3V38A 2PJ1A 3IU2A 3FMCA 1WWZA 1I21A 2Z3OA 2B5GB 2ZW6A 4UFXA 2Z10A 2H5MA 4A37A 3N7ZA 4F8ZA 1QSOA 2VXKA 2OZHA 2EWBA 3NA6A 2YNCC 4CGPA 1XOVA 1BPMA 4M6IA 2PRBA 4ZX9A 4JD6A 3R9GA 3B2YA 3QNVA 4KOVA 4CYOA 2G0BA 3CXQA 3T90A 1KUXA 2JLMA 2HV2A 1Y9WA 5H84A 4A30A 2NMTA 4F9UA 2CNMA 5ELYA 4JWPA 5I0CA 2ZEHA 1YK3A 4CYPA 4NXYA 3CXPA 5J8FA 1MJBA 3VWEA 4BINA 2EK9A 4MHNA 2ZENA 3PRTA 2PJ3A 2R7HA 1Z8TA 4U9ZA 4F9VA 3B7IA 1Z2LA 4IHMA 4JZ0A 3BJ7A 5D29A 3R95A 1R3NA 2R98A 3FH4A 4DJLA 4E8OA 3D3SA 1YLEA 1HEEA 2Q0YA 2V8DA 3EO4A 1A2ZA 1R57A 1YSJA 3K2KA 1H8LA 2F7VA 4EVYA 1ZG7A 4OAEA 3FIXA 4YGOA 3BJ8A 1ZLIA 3D7HA 2BCOA 5AG4A 5CNPA 4ZY2A 3K9UA 2J9AA 2Q51A 1FNOA 4KUAA 3RYOA 4OLLA 2PJ7A 2ZEDA 3DNSA 3D7DA 3IWGA 2C6PA 3H8GA 4CAEA 2GFQA 1M4IA 1B6BA 3GLJA 3GB0A 3PEIA 4CPAA 2D4PA 4R8FA 4A33A 2BUEA 2XEIA 2JBKA 4M3SA 2I00A 3GY9A 1ELLP 4NJRA 4YFJA 3FF3A 1PCAA 1JQGA
chains in the Genus database with same CATH topology
2VQYA 1VHSA 3TTHA 3JTKA 5AGEA 1XF8A 3GKRA 4NF1A 3TO6A 4R87A 1VKCA 1IICA 2OZGA 2VEZA 4NSQA 1N71A 1IB1E 4RS2A 4B13A 4QB9A 5F49A 2ZW7A 2OZUA 1S3ZA 5H86A 4PK2A 2OH1A 4CAFA 4JLYA 5C82A 1QSTA 1Z9UA 3EY5A 4E0AA 4NCZA 4AG7A 3A9LA 3LODA 4MFJA 4MFQA 3F5BA 2B5GA 3PP9A 4KLWA 5A27A 1Q2YA 4A95A 2VZZA 3F8KA 1YVKA 2YNCA 4PSXA 3D2PA 4JJXA 3FB3A 1S7LA 3DSBA 2JDDA 4Y49B 4MY3A 2A4NA 3DDDA 3R1KA 3R9EA 1CJWA 1OZPA 3GYAA 2GIVA 4MFLA 2VI7A 4MFZA 1YVOA 4A31A 4XNHB 4AVBA 4KS9A 4A2ZA 4C7HA 4PK3A 1QSNA 1L0CA 1YREA 4B5PA 1I1DA 2YGWA 1XE4A 4FD6A 2FT0A 2K5TA 1Y9KA 2B4DB 3TT2A 4AG9A 3TE4A 1YX0A 3FBUA 3OWCA 4JXRA 3IGRA 4KVXA 4CRZB 2B4BA 2P6FA 5DWNA 3TFYA 5AG7A 1S7FA 4UCPA 1P4NA 1RXTA 3B8GA 5FVJA 5ISVA 2OB0A 4UCNA 1XEBA 1NSLA 1MK4A 2WUUA 4MFKA 1M44A 2R8VA 1S60A 5G21A 5EBVA 2GANA 4OADA 1MJ9A 4B10A 4B5PB 1KUVA 1K4JA 3SXOA 4XPKA 3D8PA 4L89A 2J8NA 2Q44A 4CS0B 1KUYA 4UCMA 4CGNA 4X5KA 1J4JA 4AB7A 2EVNA 2C27A 4MY0A 1WK4A 2Y0MA 3I3GA 4LX9A 2Z11A 2ZXVA 4FD4A 4KLVA 1CM0A 1M4DA 2O28A 4QUSA 3LD2A 2OU2A 4F0YA 4H6UA 2ZW4A 4MFPA 2B3VA 5IV0A 2AJ6A 3TOBA 4HNYB 4C2XA 4UWIA 5HH1A 4U9YA 3E0KA 4QC6A 2QIRA 5KTAA 1M4GA 3SXNA 3P2FA 3T9YA 4K30A 1IYLA 3G3SA 1YGHA 3PZJA 5G1ZA 4IF5A 5F47A 2CNSA 2FS5A 4R3KA 2PSWA 2I79A 4KOTA 4KSFA 2Z3KA 3FRMA 2B58A 1BOBA 3TO7A 1SQHA 5AG5A 1ON0A 3FNCA 5AG6A 2B4DA 5DWMA 3S6FA 3VWDA 3IU1A 2JDCA 2RC4A 5C88A 2HUZA 1GHEA 3EC4A 2ATRA 1PUAA 2B3UA 2VZYA 3JVNA 5BWAB 4B14A 2DXQA 4QBJA 3CXSA 4MI4A 3I9SA 2VBQA 4JXQA 2CNTA 3QAHA 2PR8A 4ZGYB 2FE7A 5G22A 3S6HA 4CGMA 4ONUA 2G3AA 3EXNA 1LRZA 4CAXA 2GE3A 2D4OA 1XIXA 4MHDA 4UA3A 4XPLA 3G8WA 3DR8A 4AVAA 4CGLA 2BSWA 1FY7A 4ORFA 2Q4VA 4B12A 4F0XA 2REFA 3QB8A 1BO4A 1V0CA 5G20A 5IB0A 4J3GA 3W6XA 1Z4EA 2Q7BA 4R3LA 5KTDA 3TO9A 4II9A 4XPDC 3C26A 4KZTA 4B5OA 4ZBGA 1U6MA 4HKFA 3PGPA 4Q36A 2CXAA 3BLNA 2WPWA 2YNEA 3TOAA 3V8IA 3H4QA 2WSAA 2Z0ZA 3R9FA 3IWEA 4KOXA 3FXTA 2PR1A 3ZZIA 3SHPA 5F48A 4CAWA 2KCWA 2EUIA 3S6KA 4CRYB 2AE6A 3W91A 4C2YA 2PDOA 2HQYA 4R9MA 1RO5A 3P2HA 2QMLA 1S7NA 5A28A 5E96A 2IL4A 2Z3LA 4Q38A 4CYNA 3MGDA 1TIQA 3F0AA 4KOSA 5GCNA 4NEXA 2G3TA 2ARHA 4UBRA 4FD7A 4HNXB 3DR6A 4UFWA 4HNWB 4KSAA 4R57A 3S6GA 3WR7A 2FXFA 1Q2CA 2Z3MA 1IIDA 4GS4A 4IUSA 4KOYA 2P6GA 4PSWA 1ZO0A 3EFAA 4I49A 4U5YA 4B11A 2X7BA 2WPXA 4C68A 1MJAA 3D2MA 4H6ZA 4BMHA 4C7IA 4LUAA 1UFHA 2Q04A 4PV6A 4E2AA 1XMTA 3NE7A 3JUWA 4C2ZA 4UWJA 3R96A 5IX3A 2BEIA 2CY2A 4BBHA 4CAVA 1YR0A 2J8RA 1Y7RA 1I12A 1M1DA 5HMNA 5JQ4A 2J8MA 3KKWA 1S7KA 3H5ZA 1NE9A 1QSRA 1Q2DA 4KOWA 4KUBA 4KOUA 2QECA 5J8CA 2DPTA 4A32A 1B87A 5EC4A 2Z3PA 2ZW5A 4UFVA 4KORA 4RI1A 4AVCA 4MBUA 1KZFA 4QVTA 3FYNA 4DNCA 4M85A 1NMTA 2FIWA 2P6EA 2Z3NA 2F5IA 2R1IA 2PC1A 3W6SA 3UY5A 4Y49C 3ZJ0A 1PU9A 2DPSA 4CGOA 2YNDA 5KTCA 1IYKA 1S5KA 2FCKA 4KVME 2FSRA 5JPHA 4MJ8A 1QSMA 1Z4RA 2ZPAA 4XNHC 4H89A 4CYQA 2JEVA 1P0HA 4XPDB 2BL1A 2FL4A 2FIAA 4F6AA 2REEA 4YRHA 2Q4YA 3TCVA 2PQ8A 5F46A 2P0WA 4KVOE 4L8AA 4FD5A 3IU2A 1WWZA 1I21A 2Z3OA 2B5GB 2ZW6A 4UFXA 2Z10A 2H5MA 3N7ZA 1QSOA 2VXKA 2OZHA 2YNCC 4CGPA 2PRBA 4JD6A 3R9GA 4KOVA 4CYOA 2G0BA 3CXQA 3T90A 1KUXA 2JLMA 2HV2A 1Y9WA 5H84A 4A30A 2NMTA 2CNMA 4JWPA 5I0CA 1YK3A 4CYPA 4NXYA 3CXPA 5J8FA 1MJBA 3VWEA 2R7HA 4U9ZA 3BJ7A 3R95A 2R98A 4E8OA 3D3SA 1YLEA 2Q0YA 4M3SA 3EO4A 1R57A 4EVYA 4OAEA 3FIXA 4YGOA 3BJ8A 5AG4A 5CNPA 3K9UA 4KUAA 3RYOA 4OLLA 3DNSA 3IWGA 4CAEA 1M4IA 1B6BA 2D4PA 4A33A 2BUEA 2I00A 3GY9A 4YFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQY A;  1VHS A;  3TTH A;  1XF8 A;  3GKR A;  4NF1 A;  3TO6 A;  4R87 A;  1VKC A;  1IIC A;  2OZG A;  2VEZ A;  4NSQ A;  1N71 A;  1IB1 E;  4RS2 A;  4QB9 A;  5F49 A;  2ZW7 A;  2OZU A;  1S3Z A;  5H86 A;  4PK2 A;  2OH1 A;  4JLY A;  5C82 A;  1QST A;  1Z9U A;  3EY5 A;  4E0A A;  4NCZ A;  4AG7 A;  3LOD A;  3F5B A;  2B5G A;  3PP9 A;  4KLW A;  1Q2Y A;  2VZZ A;  3F8K A;  1YVK A;  4PSX A;  3D2P A;  4JJX A;  3FB3 A;  1S7L A;  3DSB A;  2JDD A;  4Y49 B;  4MY3 A;  2A4N A;  3DDD A;  3R1K A;  3R9E A;  1CJW A;  1OZP A;  3GYA A;  2GIV A;  2VI7 A;  1YVO A;  4XNH B;  4AVB A;  4PK3 A;  1QSN A;  1L0C A;  1YRE A;  4B5P A;  1I1D A;  1XE4 A;  4FD6 A;  2FT0 A;  2K5T A;  1Y9K A;  2B4D B;  3TT2 A;  4AG9 A;  3TE4 A;  1YX0 A;  3FBU A;  3OWC A;  4JXR A;  3IGR A;  4KVX A;  4CRZ B;  2B4B A;  2P6F A;  5DWN A;  3TFY A;  1S7F A;  1P4N A;  1RXT A;  3B8G A;  5FVJ A;  5ISV A;  2OB0 A;  1XEB A;  1NSL A;  1MK4 A;  1M44 A;  2R8V A;  1S60 A;  5EBV A;  2GAN A;  4OAD A;  1MJ9 A;  4B5P B;  1KUV A;  1K4J A;  3SXO A;  4XPK A;  3D8P A;  4L89 A;  2J8N A;  2Q44 A;  4CS0 B;  1KUY A;  4X5K A;  1J4J A;  4AB7 A;  2EVN A;  2C27 A;  4MY0 A;  1WK4 A;  2Y0M A;  3I3G A;  4LX9 A;  2Z11 A;  2ZXV A;  4FD4 A;  4KLV A;  1CM0 A;  1M4D A;  2O28 A;  4QUS A;  3LD2 A;  2OU2 A;  4F0Y A;  4H6U A;  2ZW4 A;  2B3V A;  5IV0 A;  2AJ6 A;  3TOB A;  4HNY B;  4UWI A;  5HH1 A;  4U9Y A;  3E0K A;  4QC6 A;  2QIR A;  5KTA A;  1M4G A;  3SXN A;  3P2F A;  3T9Y A;  4K30 A;  1IYL A;  3G3S A;  1YGH A;  3PZJ A;  4IF5 A;  5F47 A;  2CNS A;  2FS5 A;  4R3K A;  2PSW A;  2I79 A;  4KOT A;  3FRM A;  2B58 A;  1BOB A;  3TO7 A;  1SQH A;  1ON0 A;  3FNC A;  2B4D A;  5DWM A;  3S6F A;  3VWD A;  2JDC A;  2RC4 A;  5C88 A;  2HUZ A;  1GHE A;  3EC4 A;  2ATR A;  1PUA A;  2B3U A;  2VZY A;  3JVN A;  2DXQ A;  4QBJ A;  3CXS A;  4MI4 A;  3I9S A;  2VBQ A;  4JXQ A;  2CNT A;  3QAH A;  2PR8 A;  2FE7 A;  3S6H A;  4ONU A;  2G3A A;  3EXN A;  1LRZ A;  4CAX A;  2GE3 A;  2D4O A;  1XIX A;  4MHD A;  4UA3 A;  4XPL A;  3G8W A;  3DR8 A;  4AVA A;  2BSW A;  1FY7 A;  4ORF A;  2Q4V A;  2REF A;  3QB8 A;  1BO4 A;  1V0C A;  5IB0 A;  4J3G A;  3W6X A;  1Z4E A;  2Q7B A;  4R3L A;  5KTD A;  3TO9 A;  4II9 A;  4XPD C;  3C26 A;  4KZT A;  4B5O A;  4ZBG A;  1U6M A;  4HKF A;  3PGP A;  3BLN A;  2WPW A;  3TOA A;  3V8I A;  3H4Q A;  2Z0Z A;  3R9F A;  4KOX A;  3FXT A;  2PR1 A;  3ZZI A;  3SHP A;  5F48 A;  4CAW A;  2KCW A;  2EUI A;  3S6K A;  4CRY B;  2AE6 A;  3W91 A;  2PDO A;  2HQY A;  4R9M A;  1RO5 A;  3P2H A;  2QML A;  1S7N A;  5E96 A;  2IL4 A;  3MGD A;  1TIQ A;  3F0A A;  4KOS A;  5GCN A;  4NEX A;  2G3T A;  2ARH A;  4UBR A;  4FD7 A;  4HNX B;  3DR6 A;  4HNW B;  4R57 A;  3S6G A;  3WR7 A;  2FXF A;  1Q2C A;  1IID A;  4GS4 A;  4IUS A;  4KOY A;  2P6G A;  4PSW A;  3EFA A;  4I49 A;  4U5Y A;  2X7B A;  2WPX A;  1MJA A;  3D2M A;  4H6Z A;  4BMH A;  4LUA A;  1UFH A;  2Q04 A;  4PV6 A;  4E2A A;  1XMT A;  3NE7 A;  3JUW A;  4UWJ A;  3R96 A;  5IX3 A;  2BEI A;  2CY2 A;  4CAV A;  1YR0 A;  2J8R A;  1Y7R A;  1I12 A;  1M1D A;  5HMN A;  5JQ4 A;  2J8M A;  3KKW A;  1S7K A;  1NE9 A;  1QSR A;  1Q2D A;  4KOW A;  4KUB A;  4KOU A;  2QEC A;  5J8C A;  1B87 A;  5EC4 A;  2ZW5 A;  4KOR A;  4RI1 A;  4AVC A;  4MBU A;  1KZF A;  4QVT A;  3FYN A;  4DNC A;  4M85 A;  1NMT A;  2FIW A;  2P6E A;  2F5I A;  2R1I A;  2PC1 A;  3W6S A;  3UY5 A;  4Y49 C;  3ZJ0 A;  1PU9 A;  5KTC A;  1IYK A;  1S5K A;  2FCK A;  4KVM E;  2FSR A;  5JPH A;  4MJ8 A;  1QSM A;  1Z4R A;  2ZPA A;  4XNH C;  4H89 A;  2JEV A;  1P0H A;  4XPD B;  2BL1 A;  2FL4 A;  2FIA A;  4F6A A;  2REE A;  4YRH A;  2Q4Y A;  3TCV A;  2PQ8 A;  5F46 A;  2P0W A;  4KVO E;  4L8A A;  4FD5 A;  1WWZ A;  1I21 A;  2B5G B;  2ZW6 A;  2Z10 A;  2H5M A;  3N7Z A;  1QSO A;  2VXK A;  2OZH A;  2PRB A;  4JD6 A;  3R9G A;  4KOV A;  2G0B A;  3CXQ A;  3T90 A;  1KUX A;  2JLM A;  2HV2 A;  1Y9W A;  5H84 A;  2NMT A;  2CNM A;  4JWP A;  5I0C A;  1YK3 A;  4NXY A;  3CXP A;  5J8F A;  1MJB A;  3VWE A;  2R7H A;  4U9Z A;  3BJ7 A;  3R95 A;  2R98 A;  4E8O A;  3D3S A;  1YLE A;  2Q0Y A;  4M3S A;  3EO4 A;  1R57 A;  4EVY A;  4OAE A;  3FIX A;  4YGO A;  3BJ8 A;  5CNP A;  3K9U A;  4KUA A;  3RYO A;  4OLL A;  3DNS A;  3IWG A;  1M4I A;  1B6B A;  2D4P A;  2BUE A;  2I00 A;  3GY9 A;  4YFJ A; 
#chains in the Genus database with same CATH topology
 2VQY A;  4X3R A;  4PXD A;  1VHS A;  3TTH A;  3JTK A;  3KL9 A;  5AGE A;  1XF8 A;  3T8W A;  3GKR A;  4NJQ A;  4NF1 A;  2PVV A;  3TO6 A;  1HDQ A;  3FX6 A;  4R87 A;  1CBX A;  1VKC A;  1IIC A;  2OZG A;  2VEZ A;  3PB6 X;  4NSQ A;  4OC0 A;  1N71 A;  1IB1 E;  4RS2 A;  4B13 A;  1XBU A;  4QB9 A;  1Y0R A;  1CP7 A;  3D4U A;  5F49 A;  2ZW7 A;  2OZU A;  3PB9 X;  1QMU A;  1S3Z A;  5H86 A;  1X12 A;  4PK2 A;  2PVW A;  3SI0 A;  4PXE A;  2OH1 A;  4CAF A;  4JLY A;  5C82 A;  4ZYQ A;  1QST A;  1Z9U A;  3EY5 A;  4E0A A;  4NCZ A;  4AG7 A;  3A9L A;  3LOD A;  4A39 A;  5LYF A;  2ZEM A;  1QQ9 A;  3KI9 A;  4MFJ A;  4MFQ A;  3F5B A;  3KQZ A;  2AFO A;  2B5G A;  2GU2 A;  3PP9 A;  4KLW A;  4OKO A;  4P4E A;  5A27 A;  1NSA A;  1RTQ A;  3D7F A;  3RAM A;  1Q2Y A;  4A95 A;  2VZZ A;  3F8K A;  3SI1 A;  1YVK A;  2YNC A;  4PSX A;  1YME A;  4TNU A;  3D2P A;  4JJX A;  2NYQ A;  3FB3 A;  4NFR A;  1S7L A;  3DSB A;  4P44 A;  2JDD A;  4Y49 B;  3WAB A;  3NFZ A;  2IJZ A;  4AXV A;  4X2T A;  4MY3 A;  5CBM A;  2A4N A;  2XEF A;  2ZEP A;  3DDD A;  3R1K A;  3VH9 A;  4GM5 A;  3R9E A;  1CJW A;  5K8O A;  3B3S A;  1OZP A;  3GYA A;  2GIV A;  3PBB A;  1EE3 P;  5DS0 A;  1TXR A;  4MFL A;  1BPN A;  2VI7 A;  1CPS A;  4MFZ A;  3BI1 A;  4B6Z A;  1YVO A;  4A31 A;  4XNH B;  1IOI A;  1AYE A;  4P4I A;  4UEZ A;  4AVB A;  2FVG A;  4KS9 A;  4A2Z A;  4C7H A;  2AFS A;  4K3N A;  4PK3 A;  5HVG A;  1QSN A;  4MXU A;  1L0C A;  4EFD A;  1YRE A;  3K9T A;  1I1D A;  2PJA A;  4B5P A;  1Q7L A;  2YGW A;  1TKH A;  4P4D A;  2JBJ A;  5EMI A;  1XE4 A;  4FD6 A;  2FT0 A;  2K5T A;  1Y9K A;  3LMS A;  2B4D B;  2ZEE A;  3TT2 A;  3L2N A;  4AG9 A;  3D68 A;  3TE4 A;  1LFW A;  2PJ2 A;  1YX0 A;  3FBU A;  2ZOF A;  3OWC A;  4H2K A;  2PJ4 A;  4JXR A;  2V8H A;  3BI0 A;  3IGR A;  4KVX A;  4CRZ B;  3HLP A;  3SI2 A;  2B4B A;  2P6F A;  4LQ6 A;  5DWN A;  1XMB A;  3TFY A;  2VL1 A;  5AG7 A;  3MRU A;  3MN8 A;  3BHX A;  3JRU A;  3NH8 A;  1S7F A;  4UCP A;  1P4N A;  2PRQ A;  1RXT A;  3FJU A;  1M4L A;  3B8G A;  3ISZ A;  3KAS A;  5FVJ A;  5ISV A;  1YQE A;  2OB0 A;  4UCN A;  1XEB A;  2AFW A;  1NSL A;  1MK4 A;  2WUU A;  4OC5 A;  2C1C A;  4MFK A;  4OID A;  4WJB A;  1M44 A;  2R8V A;  1S60 A;  5G21 A;  2QVP A;  2AFX A;  5EBV A;  4P4B A;  4UEF A;  2GAN A;  4OAD A;  1MJ9 A;  4B10 A;  4B5P B;  1KUV A;  1K4J A;  2OOT A;  3SXO A;  5CPA A;  3SJE A;  4XPK A;  3S9L A;  3D8P A;  4L89 A;  5HVH A;  2J8N A;  4KSI A;  2Q44 A;  4R6T A;  4CS0 B;  1KUY A;  4UCM A;  3V7Z A;  4CGN A;  2GRE A;  1J4J A;  4X5K A;  4A38 A;  4AB7 A;  1OBR A;  4FBE A;  3D67 A;  2EVN A;  5LYL A;  3B3C A;  4M6G A;  2C27 A;  4MY0 A;  1WK4 A;  2Y0M A;  3I3G A;  5LRK A;  4LX9 A;  4YU9 A;  2Z11 A;  2ZXV A;  4FD4 A;  4KLV A;  1CM0 A;  1M4D A;  2PIY A;  2O28 A;  4QUS A;  3LD2 A;  2OU2 A;  4MHY A;  2DEA A;  4F0Y A;  5J1Q A;  2CIJ A;  4H6U A;  2ZW4 A;  4MFP A;  3B35 A;  2B3V A;  2EK8 A;  2RB7 A;  5IV0 A;  2AJ6 A;  4PXB A;  3TOB A;  4HNY B;  4C2X A;  4IAV A;  4UWI A;  5HH1 A;  4U9Y A;  3E0K A;  4QC6 A;  2QIR A;  5KTA A;  1M4G A;  2PCU A;  3SXN A;  3P2F A;  3WC5 A;  1XRY A;  4NGQ A;  4RUH A;  2PE3 A;  3T9Y A;  4K30 A;  1IYL A;  3G3S A;  1YGH A;  1ARM A;  4ZY0 A;  3PZJ A;  3VAR A;  5G1Z A;  4IF5 A;  5F47 A;  2CNS A;  2FS5 A;  2PJ9 A;  4R3K A;  2PSW A;  2I79 A;  1GYT A;  4KOT A;  4KSF A;  3KHX A;  3GUX A;  2Z3K A;  3FRM A;  2B58 A;  1LAN A;  1BOB A;  4G1P A;  3TO7 A;  2O4H A;  1SQH A;  5AG5 A;  1ON0 A;  3FNC A;  3GIU A;  5AG6 A;  3QAY A;  3CT9 A;  3HUV A;  2B4D A;  5DWM A;  4X8I A;  4MCQ A;  3S6F A;  3VWD A;  2ZOG A;  3FEE A;  3IU1 A;  4JYW A;  3S9M A;  4R7M A;  2JDC A;  2RC4 A;  5JGF A;  2Q43 A;  4OC3 A;  1IGB A;  2HUZ A;  5C88 A;  1GHE A;  3RNZ A;  5F09 A;  4UIA A;  3EC4 A;  3SJG A;  2ATR A;  1PUA A;  2B3U A;  1YW6 A;  3H8E A;  5HXD A;  2VZY A;  3JVN A;  4P45 A;  2ZEL A;  5BWA B;  1Z5R A;  4B14 A;  2DXQ A;  4QBJ A;  3CXS A;  4MI4 A;  3I9S A;  2NSM A;  2VBQ A;  3S9N A;  2POK A;  2CNT A;  3QAH A;  2F8H A;  4JXQ A;  2PR8 A;  3WC6 A;  4ZGY B;  1HDU A;  2FE7 A;  5G22 A;  3IFE A;  2C6C A;  4BD9 A;  3S6H A;  4CGM A;  4ONU A;  2G3A A;  3EXN A;  1LRZ A;  1ZLH A;  3KGQ A;  2GE3 A;  4CAX A;  2D4O A;  1XIX A;  2PJC A;  3H8F A;  1TKJ A;  4MHD A;  3TX8 A;  3WT4 A;  1Y0Y A;  4UA3 A;  3IC1 A;  3IWW A;  4XPL A;  3G8W A;  3DR8 A;  1VGY A;  4AVA A;  4CGL A;  3CPX A;  2BSW A;  2C6G A;  2ZEG A;  2GLF A;  1Z8W A;  1F57 A;  1IU8 A;  3B3V A;  4FUU A;  4DUK A;  5K8M A;  5JH9 A;  1FY7 A;  4ORF A;  5THW A;  4EWT A;  2Q4V A;  4DYO A;  4B12 A;  4F0X A;  2REF A;  4NGT A;  3QB8 A;  3KZW A;  4ZI6 A;  2Q4Z A;  1BLL E;  2WZN A;  4MRI A;  1BO4 A;  1CX8 A;  1V0C A;  2ZEO A;  3BXM A;  5G20 A;  3KHZ A;  4P4J A;  4J3G A;  6CPA A;  5IB0 A;  3W6X A;  2CTB A;  1Z4E A;  2Q7B A;  4WWV A;  4NGN A;  4R3L A;  5KTD A;  4OC2 A;  3TO9 A;  1XJO A;  4II9 A;  4XPD C;  4PXC A;  3C26 A;  3KR5 A;  4KZT A;  4B5O A;  4ZBG A;  2ODF A;  1LAP A;  1U6M A;  4HKF A;  1LOK A;  3PGP A;  1ZG8 A;  4IK2 A;  4MCP A;  3RBU A;  3KR4 A;  4Q36 A;  2CXA A;  3BLN A;  2WPW A;  4ZX8 A;  2YNE A;  3TOA A;  3V8I A;  3H4Q A;  2WSA A;  4UEE A;  3SJX A;  2Z0Z A;  2ZEF A;  3R9F A;  3IWE A;  4KOX A;  5K8N A;  1AUG A;  3FXT A;  4FWU A;  2PR1 A;  3ZZI A;  2HC9 A;  4MHP A;  3I1U A;  3SHP A;  1YW4 A;  5F48 A;  2XEG A;  4CAW A;  2EO8 A;  2KCW A;  2EUI A;  1LAM A;  2JEW A;  4MCR A;  3S6K A;  4PPZ A;  4CRY B;  2AE6 A;  3W91 A;  4C2Y A;  2PDO A;  2HQY A;  4TWE A;  1VHE A;  4P6Y A;  4R9M A;  2WYR A;  1CG2 A;  4PQA A;  1RO5 A;  5LRJ A;  1CP6 A;  2QML A;  3P2H A;  5I4M A;  2PJ0 A;  1DE4 C;  1S7N A;  4MCS A;  5A28 A;  5E96 A;  2IL4 A;  2ABZ A;  5LYI A;  2Z3L A;  4Q38 A;  4CYN A;  2OR4 A;  3ISX A;  3MGD A;  1TIQ A;  5LYD A;  3F0A A;  1CPX A;  4KOS A;  4OC1 A;  5GCN A;  4NEX A;  2G3T A;  3NH4 A;  2ARH A;  3PFO A;  4UBR A;  4FD7 A;  4HNX B;  3DR6 A;  4OC4 A;  3RO0 A;  4UFW A;  4HNW B;  3DLJ A;  2XEJ A;  4KSA A;  4R57 A;  3S6G A;  3WR7 A;  2FXF A;  1UWY A;  1Q2C A;  2QYV A;  2Z3M A;  3DGV A;  3NE8 A;  1VIX A;  4OME A;  2DF5 A;  1IID A;  1R43 A;  4GS4 A;  2AFZ A;  4IUS A;  4KOY A;  2BO9 A;  2IMO A;  3D66 A;  1Z8L A;  2EBJ A;  2P6G A;  3N5F A;  1TF9 A;  1ZG9 A;  2PJB A;  4PSW A;  3PB7 X;  1ZO0 A;  3EFA A;  4I49 A;  4U5Y A;  4B11 A;  7CPA A;  4UF4 A;  2X7B A;  4OIW A;  2WPX A;  4A94 A;  4RN7 A;  5IB9 A;  4C68 A;  1MJA A;  3D2M A;  4H6Z A;  4BMH A;  3NH5 A;  4C7I A;  4LUA A;  2QJ8 A;  3FEC A;  1PYT B;  1UFH A;  2Q04 A;  4PV6 A;  4E2A A;  1YLO A;  1F2P A;  1XMT A;  2Q7S A;  3NE7 A;  2CF4 A;  2GLJ A;  1IOF A;  3JUW A;  2CTC A;  3PB4 X;  4HPS A;  4C2Z A;  4UWJ A;  8CPA A;  4NGM A;  3R96 A;  5IX3 A;  2BEI A;  3IO1 A;  1ARL A;  2CY2 A;  4BBH A;  4CAV A;  1YR0 A;  4MHZ A;  2J8R A;  3LAC A;  4R76 A;  1Y7R A;  1FT7 A;  1I12 A;  1M1D A;  2I3C A;  2O53 A;  3PFE A;  5HMN A;  3IIB A;  3FED A;  3LWU A;  5JQ4 A;  2J8M A;  3KKW A;  3FVL A;  1BAV A;  1S7K A;  3H5Z A;  1NE9 A;  1QSR A;  1Q2D A;  2RFH A;  4KOW A;  4KUB A;  2AFM A;  3D7G A;  4KOU A;  4ONW A;  5HVF A;  4FAI A;  1XFO A;  1TKF A;  2QEC A;  3IEH A;  4NGP A;  4MMO A;  2BOA A;  5J8C A;  2DPT A;  3CDX A;  5JPH A;  4A32 A;  1B87 A;  5EC4 A;  5K8P A;  3SJF A;  2ANP A;  2Z3P A;  2ZW5 A;  4LQG A;  2HB6 A;  4Q7A A;  4UFV A;  4ZY1 A;  4KOR A;  5JM6 A;  1ELM P;  1TF8 A;  2IQ6 A;  3CZX A;  4RI1 A;  4AVC A;  4MBU A;  1KZF A;  5LRG A;  4QVT A;  2PJ6 A;  3FYN A;  4EME A;  4DNC A;  2G9D A;  1Y7E A;  4M85 A;  4NGR A;  4OP4 A;  1NMT A;  3TC8 A;  2FIW A;  2P6E A;  2Z3N A;  2F5I A;  3PB8 X;  2R1I A;  2PC1 A;  3IJ3 A;  5D8N A;  3W6S A;  3WC7 A;  3UY5 A;  4O23 A;  4Y49 C;  3ZJ0 A;  1PU9 A;  2DPS A;  4CGO A;  2YND A;  1F2O A;  5KTC A;  1IYK A;  4NGS A;  1S5K A;  2FCK A;  4KVM E;  1IY7 A;  2V8G A;  2FSR A;  2PJ5 A;  1LCP A;  1X10 A;  3PBE A;  1KWM A;  1QSM A;  1Z4R A;  2ZPA A;  3CPA A;  4H89 A;  4MJ8 A;  2JEV A;  1P0H A;  2AFU A;  3KQX A;  4XNH C;  4CYQ A;  4Z65 A;  4UIB A;  2BL1 A;  2FL4 A;  2FIA A;  4XPD B;  4YWY A;  4F6A A;  3B3T A;  2REE A;  1VHO A;  4P10 A;  1DTD A;  2PIZ A;  4P4F A;  4YRH A;  2Q4Y A;  1JWQ A;  4GXH A;  4W9Y A;  3TCV A;  2PQ8 A;  5F46 A;  4M6H A;  1Z8X A;  2P0W A;  2V77 A;  4KVO E;  3VAT A;  3B3W A;  2V8V A;  4L8A A;  4FD5 A;  3RZA A;  2PJ8 A;  1AMP A;  3V38 A;  2PJ1 A;  3IU2 A;  3FMC A;  1WWZ A;  1I21 A;  2Z3O A;  2B5G B;  2ZW6 A;  4UFX A;  2Z10 A;  2H5M A;  4A37 A;  3N7Z A;  4F8Z A;  1QSO A;  2VXK A;  2OZH A;  2EWB A;  3NA6 A;  2YNC C;  4CGP A;  1XOV A;  1BPM A;  4M6I A;  2PRB A;  4ZX9 A;  4JD6 A;  3R9G A;  3B2Y A;  3QNV A;  4KOV A;  4CYO A;  2G0B A;  3CXQ A;  3T90 A;  1KUX A;  2JLM A;  2HV2 A;  1Y9W A;  5H84 A;  4A30 A;  2NMT A;  4F9U A;  2CNM A;  5ELY A;  4JWP A;  5I0C A;  2ZEH A;  1YK3 A;  4CYP A;  4NXY A;  3CXP A;  5J8F A;  1MJB A;  3VWE A;  4BIN A;  2EK9 A;  4MHN A;  2ZEN A;  3PRT A;  2PJ3 A;  2R7H A;  1Z8T A;  4U9Z A;  4F9V A;  3B7I A;  1Z2L A;  4IHM A;  4JZ0 A;  3BJ7 A;  5D29 A;  3R95 A;  1R3N A;  2R98 A;  3FH4 A;  4DJL A;  4E8O A;  3D3S A;  1YLE A;  1HEE A;  2Q0Y A;  2V8D A;  3EO4 A;  1A2Z A;  1R57 A;  1YSJ A;  3K2K A;  1H8L A;  2F7V A;  4EVY A;  1ZG7 A;  4OAE A;  3FIX A;  4YGO A;  3BJ8 A;  1ZLI A;  3D7H A;  2BCO A;  5AG4 A;  5CNP A;  4ZY2 A;  3K9U A;  2J9A A;  2Q51 A;  1FNO A;  4KUA A;  3RYO A;  4OLL A;  2PJ7 A;  2ZED A;  3DNS A;  3D7D A;  3IWG A;  2C6P A;  3H8G A;  4CAE A;  2GFQ A;  1M4I A;  1B6B A;  3GLJ A;  3GB0 A;  3PEI A;  4CPA A;  2D4P A;  4R8F A;  4A33 A;  2BUE A;  2XEI A;  2JBK A;  4M3S A;  2I00 A;  3GY9 A;  1ELL P;  4NJR A;  4YFJ A;  3FF3 A;  1PCA A;  1JQG A; 
#chains in the Genus database with same CATH homology
 2VQY A;  1VHS A;  3TTH A;  3JTK A;  5AGE A;  1XF8 A;  3GKR A;  4NF1 A;  3TO6 A;  4R87 A;  1VKC A;  1IIC A;  2OZG A;  2VEZ A;  4NSQ A;  1N71 A;  1IB1 E;  4RS2 A;  4B13 A;  4QB9 A;  5F49 A;  2ZW7 A;  2OZU A;  1S3Z A;  5H86 A;  4PK2 A;  2OH1 A;  4CAF A;  4JLY A;  5C82 A;  1QST A;  1Z9U A;  3EY5 A;  4E0A A;  4NCZ A;  4AG7 A;  3A9L A;  3LOD A;  4MFJ A;  4MFQ A;  3F5B A;  2B5G A;  3PP9 A;  4KLW A;  5A27 A;  1Q2Y A;  4A95 A;  2VZZ A;  3F8K A;  1YVK A;  2YNC A;  4PSX A;  3D2P A;  4JJX A;  3FB3 A;  1S7L A;  3DSB A;  2JDD A;  4Y49 B;  4MY3 A;  2A4N A;  3DDD A;  3R1K A;  3R9E A;  1CJW A;  1OZP A;  3GYA A;  2GIV A;  4MFL A;  2VI7 A;  4MFZ A;  1YVO A;  4A31 A;  4XNH B;  4AVB A;  4KS9 A;  4A2Z A;  4C7H A;  4PK3 A;  1QSN A;  1L0C A;  1YRE A;  4B5P A;  1I1D A;  2YGW A;  1XE4 A;  4FD6 A;  2FT0 A;  2K5T A;  1Y9K A;  2B4D B;  3TT2 A;  4AG9 A;  3TE4 A;  1YX0 A;  3FBU A;  3OWC A;  4JXR A;  3IGR A;  4KVX A;  4CRZ B;  2B4B A;  2P6F A;  5DWN A;  3TFY A;  5AG7 A;  1S7F A;  4UCP A;  1P4N A;  1RXT A;  3B8G A;  5FVJ A;  5ISV A;  2OB0 A;  4UCN A;  1XEB A;  1NSL A;  1MK4 A;  2WUU A;  4MFK A;  1M44 A;  2R8V A;  1S60 A;  5G21 A;  5EBV A;  2GAN A;  4OAD A;  1MJ9 A;  4B10 A;  4B5P B;  1KUV A;  1K4J A;  3SXO A;  4XPK A;  3D8P A;  4L89 A;  2J8N A;  2Q44 A;  4CS0 B;  1KUY A;  4UCM A;  4CGN A;  4X5K A;  1J4J A;  4AB7 A;  2EVN A;  2C27 A;  4MY0 A;  1WK4 A;  2Y0M A;  3I3G A;  4LX9 A;  2Z11 A;  2ZXV A;  4FD4 A;  4KLV A;  1CM0 A;  1M4D A;  2O28 A;  4QUS A;  3LD2 A;  2OU2 A;  4F0Y A;  4H6U A;  2ZW4 A;  4MFP A;  2B3V A;  5IV0 A;  2AJ6 A;  3TOB A;  4HNY B;  4C2X A;  4UWI A;  5HH1 A;  4U9Y A;  3E0K A;  4QC6 A;  2QIR A;  5KTA A;  1M4G A;  3SXN A;  3P2F A;  3T9Y A;  4K30 A;  1IYL A;  3G3S A;  1YGH A;  3PZJ A;  5G1Z A;  4IF5 A;  5F47 A;  2CNS A;  2FS5 A;  4R3K A;  2PSW A;  2I79 A;  4KOT A;  4KSF A;  2Z3K A;  3FRM A;  2B58 A;  1BOB A;  3TO7 A;  1SQH A;  5AG5 A;  1ON0 A;  3FNC A;  5AG6 A;  2B4D A;  5DWM A;  3S6F A;  3VWD A;  3IU1 A;  2JDC A;  2RC4 A;  5C88 A;  2HUZ A;  1GHE A;  3EC4 A;  2ATR A;  1PUA A;  2B3U A;  2VZY A;  3JVN A;  5BWA B;  4B14 A;  2DXQ A;  4QBJ A;  3CXS A;  4MI4 A;  3I9S A;  2VBQ A;  4JXQ A;  2CNT A;  3QAH A;  2PR8 A;  4ZGY B;  2FE7 A;  5G22 A;  3S6H A;  4CGM A;  4ONU A;  2G3A A;  3EXN A;  1LRZ A;  4CAX A;  2GE3 A;  2D4O A;  1XIX A;  4MHD A;  4UA3 A;  4XPL A;  3G8W A;  3DR8 A;  4AVA A;  4CGL A;  2BSW A;  1FY7 A;  4ORF A;  2Q4V A;  4B12 A;  4F0X A;  2REF A;  3QB8 A;  1BO4 A;  1V0C A;  5G20 A;  5IB0 A;  4J3G A;  3W6X A;  1Z4E A;  2Q7B A;  4R3L A;  5KTD A;  3TO9 A;  4II9 A;  4XPD C;  3C26 A;  4KZT A;  4B5O A;  4ZBG A;  1U6M A;  4HKF A;  3PGP A;  4Q36 A;  2CXA A;  3BLN A;  2WPW A;  2YNE A;  3TOA A;  3V8I A;  3H4Q A;  2WSA A;  2Z0Z A;  3R9F A;  3IWE A;  4KOX A;  3FXT A;  2PR1 A;  3ZZI A;  3SHP A;  5F48 A;  4CAW A;  2KCW A;  2EUI A;  3S6K A;  4CRY B;  2AE6 A;  3W91 A;  4C2Y A;  2PDO A;  2HQY A;  4R9M A;  1RO5 A;  3P2H A;  2QML A;  1S7N A;  5A28 A;  5E96 A;  2IL4 A;  2Z3L A;  4Q38 A;  4CYN A;  3MGD A;  1TIQ A;  3F0A A;  4KOS A;  5GCN A;  4NEX A;  2G3T A;  2ARH A;  4UBR A;  4FD7 A;  4HNX B;  3DR6 A;  4UFW A;  4HNW B;  4KSA A;  4R57 A;  3S6G A;  3WR7 A;  2FXF A;  1Q2C A;  2Z3M A;  1IID A;  4GS4 A;  4IUS A;  4KOY A;  2P6G A;  4PSW A;  1ZO0 A;  3EFA A;  4I49 A;  4U5Y A;  4B11 A;  2X7B A;  2WPX A;  4C68 A;  1MJA A;  3D2M A;  4H6Z A;  4BMH A;  4C7I A;  4LUA A;  1UFH A;  2Q04 A;  4PV6 A;  4E2A A;  1XMT A;  3NE7 A;  3JUW A;  4C2Z A;  4UWJ A;  3R96 A;  5IX3 A;  2BEI A;  2CY2 A;  4BBH A;  4CAV A;  1YR0 A;  2J8R A;  1Y7R A;  1I12 A;  1M1D A;  5HMN A;  5JQ4 A;  2J8M A;  3KKW A;  1S7K A;  3H5Z A;  1NE9 A;  1QSR A;  1Q2D A;  4KOW A;  4KUB A;  4KOU A;  2QEC A;  5J8C A;  2DPT A;  4A32 A;  1B87 A;  5EC4 A;  2Z3P A;  2ZW5 A;  4UFV A;  4KOR A;  4RI1 A;  4AVC A;  4MBU A;  1KZF A;  4QVT A;  3FYN A;  4DNC A;  4M85 A;  1NMT A;  2FIW A;  2P6E A;  2Z3N A;  2F5I A;  2R1I A;  2PC1 A;  3W6S A;  3UY5 A;  4Y49 C;  3ZJ0 A;  1PU9 A;  2DPS A;  4CGO A;  2YND A;  5KTC A;  1IYK A;  1S5K A;  2FCK A;  4KVM E;  2FSR A;  5JPH A;  4MJ8 A;  1QSM A;  1Z4R A;  2ZPA A;  4XNH C;  4H89 A;  4CYQ A;  2JEV A;  1P0H A;  4XPD B;  2BL1 A;  2FL4 A;  2FIA A;  4F6A A;  2REE A;  4YRH A;  2Q4Y A;  3TCV A;  2PQ8 A;  5F46 A;  2P0W A;  4KVO E;  4L8A A;  4FD5 A;  3IU2 A;  1WWZ A;  1I21 A;  2Z3O A;  2B5G B;  2ZW6 A;  4UFX A;  2Z10 A;  2H5M A;  3N7Z A;  1QSO A;  2VXK A;  2OZH A;  2YNC C;  4CGP A;  2PRB A;  4JD6 A;  3R9G A;  4KOV A;  4CYO A;  2G0B A;  3CXQ A;  3T90 A;  1KUX A;  2JLM A;  2HV2 A;  1Y9W A;  5H84 A;  4A30 A;  2NMT A;  2CNM A;  4JWP A;  5I0C A;  1YK3 A;  4CYP A;  4NXY A;  3CXP A;  5J8F A;  1MJB A;  3VWE A;  2R7H A;  4U9Z A;  3BJ7 A;  3R95 A;  2R98 A;  4E8O A;  3D3S A;  1YLE A;  2Q0Y A;  4M3S A;  3EO4 A;  1R57 A;  4EVY A;  4OAE A;  3FIX A;  4YGO A;  3BJ8 A;  5AG4 A;  5CNP A;  3K9U A;  4KUA A;  3RYO A;  4OLL A;  3DNS A;  3IWG A;  4CAE A;  1M4I A;  1B6B A;  2D4P A;  4A33 A;  2BUE A;  2I00 A;  3GY9 A;  4YFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...