2JDDA

Glyphosate n-acetyltransferase bound to acetyl coa and 3-phosphoglycerate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
IEVKPINAEDTYELRHRILRPNQPIEACMFESDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLRGMATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEVFDTPPVGPHILMYKRIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis of glyphosate resistance by an optimized microbial acetyltransferase.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Transferase
molecule keywords GLYPHOSATE N-ACETYLTRANSFERASE
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jddA00
4KUBA 3BJ8A 1QSNA 3LODA 5JPHA 4XPKA 1QSMA 2J8NA 4IUSA 3EC4A 1VHSA 1MK4A 3FBUA 4B5OA 4KOVA 5I0CA 2Q04A 5FVJA 2B4DB 4YFJA 3GYAA 2EVNA 2OH1A 1UFHA 1KZFA 1U6MA 3MGDA 1VKCA 2OB0A 4QB9A 4FD4A 3TTHA 2FXFA 3P2HA 3TT2A 4DNCA 3F0AA 3BLNA 2PRBA 5IB0A 3SXOA 2R1IA 1CJWA 1TIQA 4NXYA 2I00A 4PK2A 5F49A 1N71A 4JJXA 2B4BA 1MJBA 4HNWB 3CXSA 1ON0A 2VXKA 3EXNA 3FNCA 3N7ZA 5H86A 1Y7RA 3GKRA 1XIXA 2ZPAA 3PZJA 4XPLA 4PK3A 2CNSA 3TE4A 3TOBA 2AE6A 1LRZA 4R9MA 1Y9KA 2I79A 3TO9A 2Q4VA 1YR0A 3K9UA 4AG7A 1IB1E 1SQHA 5HMNA 4HKFA 2PDOA 2HQYA 2VBQA 3FRMA 4OLLA 1WWZA 4ZBGA 4KOWA 2PR1A 3EFAA 4QBJA 2OU2A 4U5YA 3ZZIA 3LD2A 2HUZA 1MJ9A 2FCKA 1IYKA 2P0WA 2B4DA 4JD6A 2BEIA 4MJ8A 2OZHA 4OAEA 4UWJA 4E0AA 4X5KA 3D2PA 4GS4A 3JUWA 1S7LA 2G0BA 3OWCA 3QAHA 1S7NA 2REEA 1RO5A 2G3AA 3TOAA 3KKWA 1M4GA 1S3ZA 4B5PA 1IYLA 2B5GB 1OZPA 3TO7A 1QSTA 1P4NA 3D8PA 4H89A 3W6SA 2ZW7A 3FYNA 4XPDC 2VQYA 2FSRA 4AB7A 1M4IA 3DNSA 5J8CA 4KOTA 1K4JA 4MY3A 1YGHA 4KVXA 2R98A 4JWPA 4KOXA 2C27A 3F5BA 2ATRA 4RS2A 4CAWA 2GIVA 4M3SA 2BL1A 1WK4A 4KVOE 4M85A 4KOYA 4NSQA 4CAXA 2Q7BA 1Q2CA 4MI4A 4PV6A 3UY5A 4UBRA 4LX9A 2OZGA 4EVYA 4Y49B 2VEZA 1I21A 2ZW6A 3E0KA 1B87A 2PC1A 1KUYA 2GE3A 2Z0ZA 4R3LA 2FE7A 2JDDA 3BJ7A 1IICA 1XE4A 4KOSA 3F8KA 3I3GA 4CRYB 1YVOA 1Z4EA 4MHDA 5IV0A 2R8VA 3D2MA 3SHPA 2P6EA 3CXPA 2P6FA 5J8FA 2GANA 1GHEA 2EUIA 2D4OA 4AVCA 4H6UA 4MY0A 4AG9A 4U9ZA 1XF8A 2BUEA 4JLYA 3FB3A 2QECA 3ZJ0A 4E2AA 4CRZB 4LUAA 5C82A 1KUVA 3FXTA 2REFA 2B5GA 2VZYA 4E8OA 5CNPA 2J8RA 4B5PB 3S6KA 4R87A 1YLEA 3R96A 1BOBA 2QIRA 4FD5A 3H4QA 3W6XA 1L0CA 1S7FA 3EY5A 2Q0YA 4QC6A 3G8WA 5E96A 4RI1A 2PR8A 5KTAA 3D3SA 4F6AA 1B6BA 2DXQA 3R9GA 3C26A 4YRHA 4YGOA 1XEBA 1J4JA 4PSWA 3IWGA 4MBUA 3S6HA 4BMHA 3R9EA 1PUAA 4HNYB 2Z11A 2JDCA 2JLMA 2A4NA 3I9SA 1Q2DA 2FIAA 4IF5A 3TCVA 4NCZA 1YX0A 1Z4RA 2F5IA 2JEVA 1I1DA 4XNHB 3PGPA 2ZW5A 5IX3A 1I12A 4ORFA 1V0CA 4KLVA 3PP9A 5HH1A 4KLWA 4AVBA 1S7KA 2K5TA 2ARHA 5ISVA 4NF1A 4R57A 3JVNA 3DR8A 2G3TA 4OADA 1M44A 5KTDA 4L8AA 3B8GA 4Y49C 3QB8A 4KVME 3DSBA 5EBVA 3V8IA 5H84A 2J8MA 1QSOA 3G3SA 3CXQA 3T90A 4CAVA 2BSWA 2PQ8A 3IGRA 3P2FA 4H6ZA 2AJ6A 1P0HA 4NEXA 1NMTA 3R1KA 4QUSA 2NMTA 1RXTA 2O28A 3NE7A 3R9FA 5F46A 4U9YA 4QVTA 4I49A 1M4DA 1MJAA 2Z10A 2P6GA 1PU9A 4XNHC 3VWEA 4UA3A 2Q44A 4ONUA 2X7BA 1Y9WA 2FS5A 5DWNA 2CNMA 4AVAA 4XPDB 2D4PA 2HV2A 5F48A 3FIXA 1S60A 3S6GA 1Q2YA 2KCWA 5F47A 3TO6A 5JQ4A 4JXRA 3VWDA 2IL4A 4KOUA 1XMTA 2R7HA 4K30A 1NSLA 3R95A 1QSRA 1S5KA 5EC4A 3WR7A 2B3UA 1YVKA 5DWMA 1CM0A 3GY9A 4KORA 2B3VA 3T9YA 1YK3A 2PSWA 4PSXA 2CNTA 3RYOA 4CS0B 4II9A 4KZTA 5KTCA 1YREA 2Q4YA 3DR6A 2WPWA 2H5MA 5C88A 3TFYA 2VZZA 2QMLA 3W91A 4FD7A 1KUXA 2OZUA 2B58A 4HNXB 2RC4A 1BO4A 4FD6A 4JXQA 3S6FA 1IIDA 2FL4A 4UWIA 3SXNA 1M1DA 4J3GA 1Z9UA 4KUAA 4L89A 5GCNA 1FY7A 2WPXA 3DDDA 1NE9A 2FT0A 2ZW4A 4F0YA 1R57A 3EO4A 2Y0MA 2VI7A 2CY2A 2ZXVA 2FIWA 4R3KA
chains in the Genus database with same CATH superfamily
2PJCA 3KL9A 4KUBA 2IMOA 2AFOA 3BJ8A 3H5ZA 1QSNA 1LOKA 3LODA 5AG5A 5JPHA 3WT4A 2CTBA 4PXEA 4XPKA 4A31A 1QSMA 2J8NA 4IUSA 3EC4A 1VHSA 3LWUA 2ODFA 5G21A 4OIDA 1HEEA 1Y0RA 1IU8A 1NSAA 4R6TA 1MK4A 3CDXA 3CZXA 3FBUA 1ZG8A 3PEIA 4OP4A 2PJAA 4B5OA 4KOVA 4P10A 4UEFA 2PJ0A 5A27A 4GXHA 4MHPA 3MN8A 1LAPA 2V8DA 4NJRA 5D29A 5I0CA 5LYLA 2Q04A 4P4EA 4CAFA 4CGMA 5FVJA 2B4DB 4Q38A 4ZX8A 4YFJA 4CGNA 3GYAA 2EVNA 2OH1A 3ISZA 1UFHA 1KZFA 1DE4C 3IU2A 4JZ0A 3PB9X 5BWAB 1PCAA 4NGMA 1U6MA 5DS0A 3MGDA 3D68A 5IB9A 1HDUA 1VKCA 2AFMA 2BOAA 3FVLA 4JYWA 2XEJA 1CP6A 2OB0A 4NJQA 1OBRA 4FD4A 4QB9A 4OIWA 3TTHA 2FXFA 3D7DA 3P2HA 3TT2A 4M6GA 3PFOA 3IWEA 4DNCA 2ZELA 3F0AA 4X8IA 4P4BA 2DEAA 4OC3A 1ZLIA 4MCSA 3BLNA 1DTDA 2J9AA 5LRJA 2PRBA 2PIYA 2WZNA 1F2OA 4FWUA 4IAVA 5IB0A 3IO1A 4MRIA 1ELLP 2YNCC 3SXOA 2R1IA 4YWYA 3S9NA 1CJWA 2RB7A 4UCPA 1TIQA 3NFZA 3BI1A 4RUHA 4NXYA 4MFLA 2I00A 4PPZA 4PK2A 2ZEPA 1N71A 5F49A 4JJXA 2B4BA 1MJBA 1RTQA 2NSMA 3CXSA 4HNWB 4DYOA 1ON0A 1TKHA 2YNDA 2VXKA 1AUGA 4CPAA 1PYTB 3EXNA 4R8FA 3FNCA 3ISXA 1EE3P 3NH5A 4ZY2A 3N7ZA 5H86A 2YNCA 4A38A 4BINA 4DJLA 5HVGA 1Y7RA 1XIXA 3GKRA 2ZPAA 3PZJA 4WWVA 4XPLA 2OOTA 3TC8A 2PE3A 4PK3A 2CNSA 3RZAA 4A30A 3TE4A 3TOBA 2AE6A 2XEFA 1YSJA 1LRZA 4F8ZA 3S9MA 4R9MA 4UFVA 1Y9KA 2I79A 3TO9A 2Q4VA 1AYEA 1YR0A 1GYTA 1CPSA 3K9UA 1XOVA 4AG7A 2QJ8A 3KQXA 1IB1E 1SQHA 5HMNA 4HKFA 2PDOA 2HQYA 2VBQA 4LQ6A 2PJ6A 3FRMA 4OLLA 1WWZA 4ZBGA 4PXBA 2AFXA 2EO8A 3IC1A 3WABA 5LRKA 4OC2A 4H2KA 4KOWA 1BAVA 1R3NA 2PR1A 1Y7EA 3SI0A 3EFAA 4W9YA 3IU1A 7CPAA 5JH9A 4QBJA 2OU2A 2QVPA 1YLOA 2ANPA 3PB4X 4KSFA 4NGNA 3V7ZA 1Y0YA 4U5YA 1Z2LA 4MCQA 3ZZIA 2RFHA 3LD2A 2V8VA 4MHYA 2CF4A 2HUZA 3IIBA 4CYQA 1MJ9A 2FCKA 3VARA 2C6CA 1IYKA 4FBEA 2P0WA 5HVFA 3PRTA 4UCMA 1CG2A 2B4DA 4JD6A 2BEIA 3IEHA 1YQEA 4C2ZA 2NYQA 2OZHA 2V8HA 4MJ8A 4OAEA 2C6PA 4UWJA 4E0AA 3D7GA 4X5KA 3D2PA 4GS4A 3JUWA 1S7LA 2G0BA 3OWCA 3QAHA 5G22A 1KWMA 2FVGA 4B13A 1S7NA 2REEA 1RO5A 2O4HA 2G3AA 3TOAA 3DLJA 3D66A 3KKWA 3FJUA 3SI1A 1M4GA 1ZG7A 1S3ZA 4PXCA 4B5PA 1QMUA 3BXMA 4MFZA 4CGOA 1IYLA 2B5GB 5D8NA 2GFQA 1OZPA 3SJFA 1FT7A 4CGPA 4EMEA 3TO7A 2Z3PA 1QSTA 4ZYQA 1CBXA 2CIJA 1P4NA 2Z3NA 3D8PA 1CP7A 3D7FA 1X10A 4H89A 2ZOFA 4UIAA 3W6SA 4C7IA 2ZW7A 3FYNA 4P45A 4XPDC 2VQYA 2FSRA 2ZOGA 4IK2A 4AB7A 1M4IA 5A28A 3DNSA 2C1CA 2JEWA 3NE8A 4F9UA 4KOTA 1K4JA 4UFWA 5J8CA 2I3CA 2CTCA 4MY3A 1YGHA 4KVXA 2R98A 3SI2A 5LYFA 4JWPA 4KOXA 2C27A 3F5BA 2ATRA 4MXUA 4RS2A 4CAWA 1X12A 2GIVA 4M3SA 5I4MA 2BL1A 1WK4A 4KVOE 4LQGA 4M85A 4KOYA 4NGPA 4NSQA 4FAIA 1ZO0A 1H8LA 3FECA 2AFZA 1IY7A 3B3SA 4CAXA 2Q7BA 1Q2CA 4MI4A 4PV6A 3UY5A 4P4JA 4O23A 4UBRA 4LX9A 3HLPA 4M6IA 4BBHA 4UEZA 2OZGA 3CT9A 4BD9A 4EVYA 4Y49B 2JBJA 3T8WA 2PJ2A 3KZWA 2EWBA 2PCUA 2VEZA 3K2KA 1I21A 3B3CA 4R7MA 2ZW6A 3E0KA 1B87A 2PC1A 1KUYA 2GE3A 2Z0ZA 4R3LA 5AG6A 2FE7A 2JDDA 3BJ7A 3PB7X 1IICA 1XE4A 3PBEA 3KASA 4KOSA 3F8KA 1YMEA 1TKFA 4X2TA 3I3GA 1TF9A 3IFEA 3RBUA 4CRYB 1YVOA 1Z4EA 3WC6A 3QAYA 4MHDA 1VHEA 5IV0A 5ELYA 1Z8TA 3GB0A 3PB6X 1XJOA 4P4DA 2IQ6A 2R8VA 3D2MA 4YU9A 4P6YA 3SHPA 2P6EA 3CXPA 2P6FA 4FUUA 2GANA 4X3RA 5J8FA 1GHEA 2EUIA 2D4OA 2POKA 4AVCA 4H6UA 1JQGA 4ZY1A 4CYPA 4B10A 1TF8A 4MY0A 4AG9A 4U9ZA 2ZEFA 4CGLA 1XF8A 3RO0A 3RAMA 2BUEA 4JLYA 3FB3A 2DPSA 2QECA 4CAEA 4K3NA 2F7VA 3ZJ0A 3QNVA 4LUAA 4CRZB 4E2AA 5C82A 4ONWA 1KUVA 2B5GA 2REFA 2F8HA 2VZYA 3FXTA 4E8OA 5CNPA 4C2YA 4OKOA 2J8RA 3A9LA 4B5PB 3S6KA 3PB8X 4R87A 1YLEA 2ZEOA 3B2YA 1BOBA 3R96A 3D67A 2Q4ZA 2QIRA 4F0XA 4MCPA 3KGQA 3KR5A 4FD5A 4NGRA 2C6GA 3H4QA 4ZX9A 1BLLE 3W6XA 1L0CA 4A33A 4AXVA 1S7FA 3EY5A 2Q0YA 1ARMA 1LFWA 4QC6A 4ZI6A 1FNOA 3G8WA 1XMBA 2Z3LA 5E96A 4OC1A 3JTKA 4EWTA 2BCOA 4RI1A 2PR8A 2AFSA 2ZEEA 4HPSA 4MMOA 4Q7AA 5LYIA 3D3SA 3V38A 5KTAA 4F6AA 3KQZA 1B6BA 1BPMA 3CPAA 2DXQA 1A2ZA 3HUVA 3R9GA 3C26A 4YRHA 2GLJA 4YGOA 2DPTA 1XEBA 1J4JA 4PSWA 3IWGA 4MBUA 3S6HA 4BMHA 3R9EA 3FEDA 1PUAA 4HNYB 5J1QA 2Z11A 3FX6A 1VGYA 4P4IA 2JDCA 3SJXA 2EK9A 2JLMA 4EFDA 2A4NA 2ZENA 3I9SA 1Q2DA 2FIAA 4IF5A 3TCVA 4ZY0A 3MRUA 4NCZA 1YX0A 4NGSA 1Z4RA 2F5IA 2JEVA 3H8GA 5EMIA 1I1DA 1F57A 1LANA 2Z3KA 2PVVA 1UWYA 2PIZA 4XNHB 1IGBA 5LYDA 3DGVA 2XEIA 4NGTA 2ZEMA 4ZGYB 2CXAA 5AG7A 3PGPA 2ZW5A 1F2PA 1ELMP 3H8EA 5IX3A 4P4FA 1I12A 4ORFA 1V0CA 3FH4A 2PJ9A 2PJ8A 4MHNA 4KLVA 1CX8A 3PP9A 2Q51A 4B6ZA 5HH1A 4KLWA 1IOFA 4UF4A 4AVBA 5AG4A 1S7KA 2K5TA 2ARHA 4A2ZA 5ISVA 5LRGA 4NF1A 3VATA 2DF5A 2EK8A 5HXDA 2BO9A 3JVNA 4R57A 3DR8A 5THWA 2G3TA 4OADA 5JM6A 3S9LA 1M44A 1VHOA 3FMCA 4NFRA 2Q7SA 4NGQA 5KTDA 4MFJA 5JGFA 4PXDA 4L8AA 3B8GA 1ZLHA 1HDQA 4Y49C 3LACA 2ZEGA 3QB8A 3PBBA 4A37A 4KVME 4MCRA 2WYRA 3DSBA 1LAMA 4G1PA 5EBVA 4OMEA 2GU2A 3L2NA 4A95A 4B12A 3V8IA 3NH4A 2PJ1A 4UIBA 5H84A 4KSIA 4GM5A 1M4LA 2HB6A 2WSAA 1R43A 3NA6A 2J8MA 3B35A 2YGWA 5CBMA 2PVWA 1QSOA 3G3SA 3CXQA 3T90A 1TKJA 2Z3OA 4IHMA 4CAVA 5K8PA 2BSWA 2PQ8A 3IGRA 3P2FA 4H6ZA 2AJ6A 1ZG9A 1P0HA 4NEXA 1NMTA 3R1KA 1VIXA 3GIUA 4QUSA 2NMTA 1RXTA 2O28A 3NE7A 3R9FA 4Q36A 3H8FA 3RNZA 5F46A 4R76A 4U9YA 3KHZA 2ZEDA 4QVTA 4I49A 3I1UA 3GUXA 4RN7A 4UEEA 5F09A 1M4DA 1MJAA 2Z10A 2ZEHA 3LMSA 3BI0A 5HVHA 2P6GA 1PU9A 4A94A 4XNHC 5K8OA 3SJEA 3VWEA 4UA3A 2Q44A 4ONUA 1JWQA 4OC4A 4A39A 2X7BA 3SJGA 4UCNA 3IWWA 1Y9WA 1ARLA 2FS5A 5DWNA 2CNMA 1IOIA 4AVAA 4XPDB 2D4PA 2HV2A 2VL1A 3KR4A 5F48A 3FIXA 1S60A 3S6GA 2V77A 1Z5RA 1Q2YA 2KCWA 4DUKA 2PJ3A 5F47A 2Q43A 2QYVA 3B3VA 3TO6A 5JQ4A 5K8MA 3NH8A 2ABZA 4KS9A 1AMPA 1Z8WA 4JXRA 3VWDA 2IL4A 4KOUA 1XMTA 2JBKA 2R7HA 4MFKA 4K30A 1NSLA 3R95A 5K8NA 3B7IA 1QSRA 3CPXA 4MFQA 1XBUA 1S5KA 3KI9A 5G20A 2PJ7A 2G9DA 4C7HA 3K9TA 1YW4A 5EC4A 4A32A 4C68A 1Z8XA 2IJZA 3WR7A 2B3UA 1YVKA 2WUUA 5DWMA 1CM0A 4B11A 3IJ3A 2GREA 3GY9A 4KORA 3B3TA 2XEGA 1BPNA 4Z65A 2B3VA 3T9YA 1YK3A 4MHZA 2PSWA 4PSXA 2O53A 4CYOA 2CNTA 3RYOA 4CS0B 4WJBA 4II9A 4KZTA 5KTCA 2PJBA 1YREA 2Q4YA 3DR6A 2WPWA 4B14A 1TXRA 3B3WA 2H5MA 5CPAA 5C88A 2VZZA 3TFYA 2QMLA 2V8GA 2Z3MA 1XRYA 4FD7A 5AGEA 3W91A 3WC7A 1KUXA 3D7HA 1Z8LA 8CPAA 2OZUA 4UFXA 4F9VA 2AFWA 2B58A 3PFEA 4HNXB 2YNEA 4MFPA 5G1ZA 2RC4A 4C2XA 1BO4A 2PJ4A 1Q7LA 1LCPA 2PRQA 4FD6A 4KSAA 2PJ5A 2OR4A 3TX8A 3FF3A 4JXQA 4P44A 6CPAA 2GLFA 1IIDA 3S6FA 2AFUA 4TWEA 2FL4A 4UWIA 1YW6A 3SXNA 3JRUA 1M1DA 4J3GA 1Z9UA 3KHXA 3D4UA 4KUAA 4L89A 3WC5A 4OC0A 5GCNA 1FY7A 1QQ9A 2WPXA 1XFOA 3DDDA 1NE9A 2FT0A 2ZW4A 2HC9A 1CPXA 4F0YA 2EBJA 1R57A 4M6HA 4PQAA 3BHXA 3EO4A 4TNUA 3GLJA 3VH9A 2Y0MA 2VI7A 3FEEA 2CY2A 4CYNA 2ZXVA 3N5FA 2FIWA 4OC5A 4R3KA
chains in the Genus database with same CATH topology
4KUBA 3BJ8A 3H5ZA 1QSNA 3LODA 5AG5A 5JPHA 4XPKA 4A31A 1QSMA 2J8NA 4IUSA 3EC4A 1VHSA 5G21A 1MK4A 3FBUA 4B5OA 4KOVA 5A27A 5I0CA 2Q04A 4CAFA 4CGMA 5FVJA 2B4DB 4Q38A 4YFJA 4CGNA 3GYAA 2EVNA 2OH1A 1UFHA 1KZFA 3IU2A 5BWAB 1U6MA 3MGDA 1VKCA 2OB0A 4QB9A 4FD4A 3TTHA 2FXFA 3P2HA 3TT2A 3IWEA 4DNCA 3F0AA 3BLNA 2PRBA 5IB0A 3SXOA 2YNCC 2R1IA 1CJWA 4UCPA 1TIQA 4NXYA 4MFLA 2I00A 4PK2A 5F49A 1N71A 4JJXA 2B4BA 1MJBA 4HNWB 3CXSA 1ON0A 2YNDA 2VXKA 3EXNA 3FNCA 3N7ZA 5H86A 2YNCA 1Y7RA 3GKRA 1XIXA 2ZPAA 3PZJA 4XPLA 4PK3A 2CNSA 4A30A 3TE4A 3TOBA 2AE6A 1LRZA 4R9MA 4UFVA 1Y9KA 2I79A 3TO9A 2Q4VA 1YR0A 3K9UA 4AG7A 1IB1E 1SQHA 5HMNA 4HKFA 2PDOA 2HQYA 2VBQA 3FRMA 4OLLA 1WWZA 4ZBGA 4KOWA 2PR1A 3EFAA 3IU1A 4QBJA 2OU2A 4KSFA 4U5YA 3ZZIA 3LD2A 2HUZA 4CYQA 1MJ9A 2FCKA 1IYKA 2P0WA 4UCMA 2B4DA 4JD6A 2BEIA 4C2ZA 4MJ8A 2OZHA 4OAEA 4UWJA 4E0AA 4X5KA 3D2PA 4GS4A 3JUWA 1S7LA 2G0BA 3OWCA 3QAHA 5G22A 4B13A 1S7NA 2REEA 1RO5A 2G3AA 3TOAA 3KKWA 1M4GA 1S3ZA 4B5PA 4MFZA 4CGOA 1IYLA 2B5GB 4CGPA 1OZPA 3TO7A 2Z3PA 1QSTA 1P4NA 2Z3NA 3D8PA 4H89A 4C7IA 3W6SA 2ZW7A 3FYNA 4XPDC 2VQYA 2FSRA 5A28A 4AB7A 1M4IA 3DNSA 5J8CA 4KOTA 1K4JA 4UFWA 4MY3A 1YGHA 4KVXA 2R98A 4JWPA 4KOXA 2C27A 3F5BA 2ATRA 4RS2A 4CAWA 2GIVA 4M3SA 2BL1A 1WK4A 4KVOE 4M85A 4KOYA 4NSQA 1ZO0A 4CAXA 2Q7BA 1Q2CA 4MI4A 4PV6A 3UY5A 4UBRA 4LX9A 4BBHA 2OZGA 4EVYA 4Y49B 2VEZA 1I21A 2ZW6A 3E0KA 1B87A 2PC1A 1KUYA 2GE3A 2Z0ZA 4R3LA 5AG6A 2FE7A 2JDDA 3BJ7A 1IICA 1XE4A 4KOSA 3F8KA 3I3GA 4CRYB 1YVOA 1Z4EA 4MHDA 5IV0A 2R8VA 3D2MA 3SHPA 2P6EA 3CXPA 2P6FA 5J8FA 2GANA 1GHEA 2EUIA 2D4OA 4AVCA 4H6UA 4CYPA 4B10A 4MY0A 4AG9A 4CGLA 4U9ZA 1XF8A 2BUEA 4JLYA 3FB3A 2DPSA 2QECA 4CAEA 3ZJ0A 4E2AA 4CRZB 4LUAA 5C82A 1KUVA 3FXTA 2REFA 2B5GA 2VZYA 4E8OA 5CNPA 4C2YA 2J8RA 3A9LA 4B5PB 3S6KA 4R87A 1YLEA 3R96A 1BOBA 4F0XA 2QIRA 4FD5A 3H4QA 3W6XA 1L0CA 4A33A 1S7FA 3EY5A 2Q0YA 4QC6A 3G8WA 2Z3LA 5E96A 3JTKA 4RI1A 2PR8A 5KTAA 3D3SA 4F6AA 1B6BA 2DXQA 3R9GA 3C26A 4YRHA 4YGOA 2DPTA 1XEBA 1J4JA 4PSWA 3IWGA 4MBUA 3S6HA 4BMHA 3R9EA 1PUAA 4HNYB 2Z11A 2JDCA 2JLMA 2A4NA 3I9SA 1Q2DA 2FIAA 4IF5A 3TCVA 4NCZA 1YX0A 1Z4RA 2F5IA 2JEVA 1I1DA 2Z3KA 4XNHB 4ZGYB 2CXAA 5AG7A 3PGPA 2ZW5A 5IX3A 1I12A 4ORFA 1V0CA 4KLVA 3PP9A 5HH1A 4KLWA 4AVBA 5AG4A 1S7KA 2K5TA 2ARHA 4A2ZA 5ISVA 4NF1A 4R57A 3JVNA 3DR8A 2G3TA 4OADA 1M44A 5KTDA 4MFJA 4L8AA 3B8GA 4Y49C 3QB8A 4KVME 3DSBA 5EBVA 4A95A 4B12A 3V8IA 5H84A 2WSAA 2J8MA 2YGWA 1QSOA 3G3SA 3CXQA 3T90A 2Z3OA 4CAVA 2BSWA 2PQ8A 3IGRA 3P2FA 4H6ZA 2AJ6A 1P0HA 4NEXA 1NMTA 3R1KA 4QUSA 2NMTA 1RXTA 2O28A 3NE7A 3R9FA 4Q36A 5F46A 4U9YA 4QVTA 4I49A 1M4DA 1MJAA 2Z10A 2P6GA 1PU9A 4XNHC 3VWEA 4UA3A 2Q44A 4ONUA 2X7BA 4UCNA 1Y9WA 2FS5A 5DWNA 2CNMA 4AVAA 4XPDB 2D4PA 2HV2A 5F48A 3FIXA 1S60A 3S6GA 1Q2YA 2KCWA 5F47A 3TO6A 5JQ4A 4KS9A 4JXRA 3VWDA 2IL4A 4KOUA 1XMTA 2R7HA 4MFKA 4K30A 1NSLA 3R95A 1QSRA 4MFQA 1S5KA 5G20A 4C7HA 5EC4A 4A32A 4C68A 3WR7A 2B3UA 1YVKA 2WUUA 5DWMA 1CM0A 4B11A 3GY9A 4KORA 2B3VA 3T9YA 1YK3A 2PSWA 4PSXA 4CYOA 2CNTA 3RYOA 4CS0B 4II9A 4KZTA 5KTCA 1YREA 2Q4YA 3DR6A 2WPWA 4B14A 2H5MA 5C88A 3TFYA 2VZZA 2QMLA 2Z3MA 4FD7A 3W91A 5AGEA 1KUXA 2OZUA 4UFXA 2B58A 4HNXB 2YNEA 4MFPA 5G1ZA 2RC4A 4C2XA 1BO4A 4FD6A 4KSAA 4JXQA 3S6FA 1IIDA 2FL4A 4UWIA 3SXNA 1M1DA 4J3GA 1Z9UA 4KUAA 4L89A 5GCNA 1FY7A 2WPXA 3DDDA 1NE9A 2FT0A 2ZW4A 4F0YA 1R57A 3EO4A 2Y0MA 2VI7A 2CY2A 4CYNA 2ZXVA 2FIWA 4R3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUB A;  3BJ8 A;  1QSN A;  3LOD A;  5JPH A;  4XPK A;  1QSM A;  2J8N A;  4IUS A;  3EC4 A;  1VHS A;  1MK4 A;  3FBU A;  4B5O A;  4KOV A;  5I0C A;  2Q04 A;  5FVJ A;  2B4D B;  4YFJ A;  3GYA A;  2EVN A;  2OH1 A;  1UFH A;  1KZF A;  1U6M A;  3MGD A;  1VKC A;  2OB0 A;  4QB9 A;  4FD4 A;  3TTH A;  2FXF A;  3P2H A;  3TT2 A;  4DNC A;  3F0A A;  3BLN A;  2PRB A;  5IB0 A;  3SXO A;  2R1I A;  1CJW A;  1TIQ A;  4NXY A;  2I00 A;  4PK2 A;  5F49 A;  1N71 A;  4JJX A;  2B4B A;  1MJB A;  4HNW B;  3CXS A;  1ON0 A;  2VXK A;  3EXN A;  3FNC A;  3N7Z A;  5H86 A;  1Y7R A;  3GKR A;  1XIX A;  2ZPA A;  3PZJ A;  4XPL A;  4PK3 A;  2CNS A;  3TE4 A;  3TOB A;  2AE6 A;  1LRZ A;  4R9M A;  1Y9K A;  2I79 A;  3TO9 A;  2Q4V A;  1YR0 A;  3K9U A;  4AG7 A;  1IB1 E;  1SQH A;  5HMN A;  4HKF A;  2PDO A;  2HQY A;  2VBQ A;  3FRM A;  4OLL A;  1WWZ A;  4ZBG A;  4KOW A;  2PR1 A;  3EFA A;  4QBJ A;  2OU2 A;  4U5Y A;  3ZZI A;  3LD2 A;  2HUZ A;  1MJ9 A;  2FCK A;  1IYK A;  2P0W A;  2B4D A;  4JD6 A;  2BEI A;  4MJ8 A;  2OZH A;  4OAE A;  4UWJ A;  4E0A A;  4X5K A;  3D2P A;  4GS4 A;  3JUW A;  1S7L A;  2G0B A;  3OWC A;  3QAH A;  1S7N A;  2REE A;  1RO5 A;  2G3A A;  3TOA A;  3KKW A;  1M4G A;  1S3Z A;  4B5P A;  1IYL A;  2B5G B;  1OZP A;  3TO7 A;  1QST A;  1P4N A;  3D8P A;  4H89 A;  3W6S A;  2ZW7 A;  3FYN A;  4XPD C;  2VQY A;  2FSR A;  4AB7 A;  1M4I A;  3DNS A;  5J8C A;  4KOT A;  1K4J A;  4MY3 A;  1YGH A;  4KVX A;  2R98 A;  4JWP A;  4KOX A;  2C27 A;  3F5B A;  2ATR A;  4RS2 A;  4CAW A;  2GIV A;  4M3S A;  2BL1 A;  1WK4 A;  4KVO E;  4M85 A;  4KOY A;  4NSQ A;  4CAX A;  2Q7B A;  1Q2C A;  4MI4 A;  4PV6 A;  3UY5 A;  4UBR A;  4LX9 A;  2OZG A;  4EVY A;  4Y49 B;  2VEZ A;  1I21 A;  2ZW6 A;  3E0K A;  1B87 A;  2PC1 A;  1KUY A;  2GE3 A;  2Z0Z A;  4R3L A;  2FE7 A;  2JDD A;  3BJ7 A;  1IIC A;  1XE4 A;  4KOS A;  3F8K A;  3I3G A;  4CRY B;  1YVO A;  1Z4E A;  4MHD A;  5IV0 A;  2R8V A;  3D2M A;  3SHP A;  2P6E A;  3CXP A;  2P6F A;  5J8F A;  2GAN A;  1GHE A;  2EUI A;  2D4O A;  4AVC A;  4H6U A;  4MY0 A;  4AG9 A;  4U9Z A;  1XF8 A;  2BUE A;  4JLY A;  3FB3 A;  2QEC A;  3ZJ0 A;  4E2A A;  4CRZ B;  4LUA A;  5C82 A;  1KUV A;  3FXT A;  2REF A;  2B5G A;  2VZY A;  4E8O A;  5CNP A;  2J8R A;  4B5P B;  3S6K A;  4R87 A;  1YLE A;  3R96 A;  1BOB A;  2QIR A;  4FD5 A;  3H4Q A;  3W6X A;  1L0C A;  1S7F A;  3EY5 A;  2Q0Y A;  4QC6 A;  3G8W A;  5E96 A;  4RI1 A;  2PR8 A;  5KTA A;  3D3S A;  4F6A A;  1B6B A;  2DXQ A;  3R9G A;  3C26 A;  4YRH A;  4YGO A;  1XEB A;  1J4J A;  4PSW A;  3IWG A;  4MBU A;  3S6H A;  4BMH A;  3R9E A;  1PUA A;  4HNY B;  2Z11 A;  2JDC A;  2JLM A;  2A4N A;  3I9S A;  1Q2D A;  2FIA A;  4IF5 A;  3TCV A;  4NCZ A;  1YX0 A;  1Z4R A;  2F5I A;  2JEV A;  1I1D A;  4XNH B;  3PGP A;  2ZW5 A;  5IX3 A;  1I12 A;  4ORF A;  1V0C A;  4KLV A;  3PP9 A;  5HH1 A;  4KLW A;  4AVB A;  1S7K A;  2K5T A;  2ARH A;  5ISV A;  4NF1 A;  4R57 A;  3JVN A;  3DR8 A;  2G3T A;  4OAD A;  1M44 A;  5KTD A;  4L8A A;  3B8G A;  4Y49 C;  3QB8 A;  4KVM E;  3DSB A;  5EBV A;  3V8I A;  5H84 A;  2J8M A;  1QSO A;  3G3S A;  3CXQ A;  3T90 A;  4CAV A;  2BSW A;  2PQ8 A;  3IGR A;  3P2F A;  4H6Z A;  2AJ6 A;  1P0H A;  4NEX A;  1NMT A;  3R1K A;  4QUS A;  2NMT A;  1RXT A;  2O28 A;  3NE7 A;  3R9F A;  5F46 A;  4U9Y A;  4QVT A;  4I49 A;  1M4D A;  1MJA A;  2Z10 A;  2P6G A;  1PU9 A;  4XNH C;  3VWE A;  4UA3 A;  2Q44 A;  4ONU A;  2X7B A;  1Y9W A;  2FS5 A;  5DWN A;  2CNM A;  4AVA A;  4XPD B;  2D4P A;  2HV2 A;  5F48 A;  3FIX A;  1S60 A;  3S6G A;  1Q2Y A;  2KCW A;  5F47 A;  3TO6 A;  5JQ4 A;  4JXR A;  3VWD A;  2IL4 A;  4KOU A;  1XMT A;  2R7H A;  4K30 A;  1NSL A;  3R95 A;  1QSR A;  1S5K A;  5EC4 A;  3WR7 A;  2B3U A;  1YVK A;  5DWM A;  1CM0 A;  3GY9 A;  4KOR A;  2B3V A;  3T9Y A;  1YK3 A;  2PSW A;  4PSX A;  2CNT A;  3RYO A;  4CS0 B;  4II9 A;  4KZT A;  5KTC A;  1YRE A;  2Q4Y A;  3DR6 A;  2WPW A;  2H5M A;  5C88 A;  3TFY A;  2VZZ A;  2QML A;  3W91 A;  4FD7 A;  1KUX A;  2OZU A;  2B58 A;  4HNX B;  2RC4 A;  1BO4 A;  4FD6 A;  4JXQ A;  3S6F A;  1IID A;  2FL4 A;  4UWI A;  3SXN A;  1M1D A;  4J3G A;  1Z9U A;  4KUA A;  4L89 A;  5GCN A;  1FY7 A;  2WPX A;  3DDD A;  1NE9 A;  2FT0 A;  2ZW4 A;  4F0Y A;  1R57 A;  3EO4 A;  2Y0M A;  2VI7 A;  2CY2 A;  2ZXV A;  2FIW A;  4R3K A; 
#chains in the Genus database with same CATH topology
 2PJC A;  3KL9 A;  4KUB A;  2IMO A;  2AFO A;  3BJ8 A;  3H5Z A;  1QSN A;  1LOK A;  3LOD A;  5AG5 A;  5JPH A;  3WT4 A;  2CTB A;  4PXE A;  4XPK A;  4A31 A;  1QSM A;  2J8N A;  4IUS A;  3EC4 A;  1VHS A;  3LWU A;  2ODF A;  5G21 A;  4OID A;  1HEE A;  1Y0R A;  1IU8 A;  1NSA A;  4R6T A;  1MK4 A;  3CDX A;  3CZX A;  3FBU A;  1ZG8 A;  3PEI A;  4OP4 A;  2PJA A;  4B5O A;  4KOV A;  4P10 A;  4UEF A;  2PJ0 A;  5A27 A;  4GXH A;  4MHP A;  3MN8 A;  1LAP A;  2V8D A;  4NJR A;  5D29 A;  5I0C A;  5LYL A;  2Q04 A;  4P4E A;  4CAF A;  4CGM A;  5FVJ A;  2B4D B;  4Q38 A;  4ZX8 A;  4YFJ A;  4CGN A;  3GYA A;  2EVN A;  2OH1 A;  3ISZ A;  1UFH A;  1KZF A;  1DE4 C;  3IU2 A;  4JZ0 A;  3PB9 X;  5BWA B;  1PCA A;  4NGM A;  1U6M A;  5DS0 A;  3MGD A;  3D68 A;  5IB9 A;  1HDU A;  1VKC A;  2AFM A;  2BOA A;  3FVL A;  4JYW A;  2XEJ A;  1CP6 A;  2OB0 A;  4NJQ A;  1OBR A;  4FD4 A;  4QB9 A;  4OIW A;  3TTH A;  2FXF A;  3D7D A;  3P2H A;  3TT2 A;  4M6G A;  3PFO A;  3IWE A;  4DNC A;  2ZEL A;  3F0A A;  4X8I A;  4P4B A;  2DEA A;  4OC3 A;  1ZLI A;  4MCS A;  3BLN A;  1DTD A;  2J9A A;  5LRJ A;  2PRB A;  2PIY A;  2WZN A;  1F2O A;  4FWU A;  4IAV A;  5IB0 A;  3IO1 A;  4MRI A;  1ELL P;  2YNC C;  3SXO A;  2R1I A;  4YWY A;  3S9N A;  1CJW A;  2RB7 A;  4UCP A;  1TIQ A;  3NFZ A;  3BI1 A;  4RUH A;  4NXY A;  4MFL A;  2I00 A;  4PPZ A;  4PK2 A;  2ZEP A;  1N71 A;  5F49 A;  4JJX A;  2B4B A;  1MJB A;  1RTQ A;  2NSM A;  3CXS A;  4HNW B;  4DYO A;  1ON0 A;  1TKH A;  2YND A;  2VXK A;  1AUG A;  4CPA A;  1PYT B;  3EXN A;  4R8F A;  3FNC A;  3ISX A;  1EE3 P;  3NH5 A;  4ZY2 A;  3N7Z A;  5H86 A;  2YNC A;  4A38 A;  4BIN A;  4DJL A;  5HVG A;  1Y7R A;  1XIX A;  3GKR A;  2ZPA A;  3PZJ A;  4WWV A;  4XPL A;  2OOT A;  3TC8 A;  2PE3 A;  4PK3 A;  2CNS A;  3RZA A;  4A30 A;  3TE4 A;  3TOB A;  2AE6 A;  2XEF A;  1YSJ A;  1LRZ A;  4F8Z A;  3S9M A;  4R9M A;  4UFV A;  1Y9K A;  2I79 A;  3TO9 A;  2Q4V A;  1AYE A;  1YR0 A;  1GYT A;  1CPS A;  3K9U A;  1XOV A;  4AG7 A;  2QJ8 A;  3KQX A;  1IB1 E;  1SQH A;  5HMN A;  4HKF A;  2PDO A;  2HQY A;  2VBQ A;  4LQ6 A;  2PJ6 A;  3FRM A;  4OLL A;  1WWZ A;  4ZBG A;  4PXB A;  2AFX A;  2EO8 A;  3IC1 A;  3WAB A;  5LRK A;  4OC2 A;  4H2K A;  4KOW A;  1BAV A;  1R3N A;  2PR1 A;  1Y7E A;  3SI0 A;  3EFA A;  4W9Y A;  3IU1 A;  7CPA A;  5JH9 A;  4QBJ A;  2OU2 A;  2QVP A;  1YLO A;  2ANP A;  3PB4 X;  4KSF A;  4NGN A;  3V7Z A;  1Y0Y A;  4U5Y A;  1Z2L A;  4MCQ A;  3ZZI A;  2RFH A;  3LD2 A;  2V8V A;  4MHY A;  2CF4 A;  2HUZ A;  3IIB A;  4CYQ A;  1MJ9 A;  2FCK A;  3VAR A;  2C6C A;  1IYK A;  4FBE A;  2P0W A;  5HVF A;  3PRT A;  4UCM A;  1CG2 A;  2B4D A;  4JD6 A;  2BEI A;  3IEH A;  1YQE A;  4C2Z A;  2NYQ A;  2OZH A;  2V8H A;  4MJ8 A;  4OAE A;  2C6P A;  4UWJ A;  4E0A A;  3D7G A;  4X5K A;  3D2P A;  4GS4 A;  3JUW A;  1S7L A;  2G0B A;  3OWC A;  3QAH A;  5G22 A;  1KWM A;  2FVG A;  4B13 A;  1S7N A;  2REE A;  1RO5 A;  2O4H A;  2G3A A;  3TOA A;  3DLJ A;  3D66 A;  3KKW A;  3FJU A;  3SI1 A;  1M4G A;  1ZG7 A;  1S3Z A;  4PXC A;  4B5P A;  1QMU A;  3BXM A;  4MFZ A;  4CGO A;  1IYL A;  2B5G B;  5D8N A;  2GFQ A;  1OZP A;  3SJF A;  1FT7 A;  4CGP A;  4EME A;  3TO7 A;  2Z3P A;  1QST A;  4ZYQ A;  1CBX A;  2CIJ A;  1P4N A;  2Z3N A;  3D8P A;  1CP7 A;  3D7F A;  1X10 A;  4H89 A;  2ZOF A;  4UIA A;  3W6S A;  4C7I A;  2ZW7 A;  3FYN A;  4P45 A;  4XPD C;  2VQY A;  2FSR A;  2ZOG A;  4IK2 A;  4AB7 A;  1M4I A;  5A28 A;  3DNS A;  2C1C A;  2JEW A;  3NE8 A;  4F9U A;  4KOT A;  1K4J A;  4UFW A;  5J8C A;  2I3C A;  2CTC A;  4MY3 A;  1YGH A;  4KVX A;  2R98 A;  3SI2 A;  5LYF A;  4JWP A;  4KOX A;  2C27 A;  3F5B A;  2ATR A;  4MXU A;  4RS2 A;  4CAW A;  1X12 A;  2GIV A;  4M3S A;  5I4M A;  2BL1 A;  1WK4 A;  4KVO E;  4LQG A;  4M85 A;  4KOY A;  4NGP A;  4NSQ A;  4FAI A;  1ZO0 A;  1H8L A;  3FEC A;  2AFZ A;  1IY7 A;  3B3S A;  4CAX A;  2Q7B A;  1Q2C A;  4MI4 A;  4PV6 A;  3UY5 A;  4P4J A;  4O23 A;  4UBR A;  4LX9 A;  3HLP A;  4M6I A;  4BBH A;  4UEZ A;  2OZG A;  3CT9 A;  4BD9 A;  4EVY A;  4Y49 B;  2JBJ A;  3T8W A;  2PJ2 A;  3KZW A;  2EWB A;  2PCU A;  2VEZ A;  3K2K A;  1I21 A;  3B3C A;  4R7M A;  2ZW6 A;  3E0K A;  1B87 A;  2PC1 A;  1KUY A;  2GE3 A;  2Z0Z A;  4R3L A;  5AG6 A;  2FE7 A;  2JDD A;  3BJ7 A;  3PB7 X;  1IIC A;  1XE4 A;  3PBE A;  3KAS A;  4KOS A;  3F8K A;  1YME A;  1TKF A;  4X2T A;  3I3G A;  1TF9 A;  3IFE A;  3RBU A;  4CRY B;  1YVO A;  1Z4E A;  3WC6 A;  3QAY A;  4MHD A;  1VHE A;  5IV0 A;  5ELY A;  1Z8T A;  3GB0 A;  3PB6 X;  1XJO A;  4P4D A;  2IQ6 A;  2R8V A;  3D2M A;  4YU9 A;  4P6Y A;  3SHP A;  2P6E A;  3CXP A;  2P6F A;  4FUU A;  2GAN A;  4X3R A;  5J8F A;  1GHE A;  2EUI A;  2D4O A;  2POK A;  4AVC A;  4H6U A;  1JQG A;  4ZY1 A;  4CYP A;  4B10 A;  1TF8 A;  4MY0 A;  4AG9 A;  4U9Z A;  2ZEF A;  4CGL A;  1XF8 A;  3RO0 A;  3RAM A;  2BUE A;  4JLY A;  3FB3 A;  2DPS A;  2QEC A;  4CAE A;  4K3N A;  2F7V A;  3ZJ0 A;  3QNV A;  4LUA A;  4CRZ B;  4E2A A;  5C82 A;  4ONW A;  1KUV A;  2B5G A;  2REF A;  2F8H A;  2VZY A;  3FXT A;  4E8O A;  5CNP A;  4C2Y A;  4OKO A;  2J8R A;  3A9L A;  4B5P B;  3S6K A;  3PB8 X;  4R87 A;  1YLE A;  2ZEO A;  3B2Y A;  1BOB A;  3R96 A;  3D67 A;  2Q4Z A;  2QIR A;  4F0X A;  4MCP A;  3KGQ A;  3KR5 A;  4FD5 A;  4NGR A;  2C6G A;  3H4Q A;  4ZX9 A;  1BLL E;  3W6X A;  1L0C A;  4A33 A;  4AXV A;  1S7F A;  3EY5 A;  2Q0Y A;  1ARM A;  1LFW A;  4QC6 A;  4ZI6 A;  1FNO A;  3G8W A;  1XMB A;  2Z3L A;  5E96 A;  4OC1 A;  3JTK A;  4EWT A;  2BCO A;  4RI1 A;  2PR8 A;  2AFS A;  2ZEE A;  4HPS A;  4MMO A;  4Q7A A;  5LYI A;  3D3S A;  3V38 A;  5KTA A;  4F6A A;  3KQZ A;  1B6B A;  1BPM A;  3CPA A;  2DXQ A;  1A2Z A;  3HUV A;  3R9G A;  3C26 A;  4YRH A;  2GLJ A;  4YGO A;  2DPT A;  1XEB A;  1J4J A;  4PSW A;  3IWG A;  4MBU A;  3S6H A;  4BMH A;  3R9E A;  3FED A;  1PUA A;  4HNY B;  5J1Q A;  2Z11 A;  3FX6 A;  1VGY A;  4P4I A;  2JDC A;  3SJX A;  2EK9 A;  2JLM A;  4EFD A;  2A4N A;  2ZEN A;  3I9S A;  1Q2D A;  2FIA A;  4IF5 A;  3TCV A;  4ZY0 A;  3MRU A;  4NCZ A;  1YX0 A;  4NGS A;  1Z4R A;  2F5I A;  2JEV A;  3H8G A;  5EMI A;  1I1D A;  1F57 A;  1LAN A;  2Z3K A;  2PVV A;  1UWY A;  2PIZ A;  4XNH B;  1IGB A;  5LYD A;  3DGV A;  2XEI A;  4NGT A;  2ZEM A;  4ZGY B;  2CXA A;  5AG7 A;  3PGP A;  2ZW5 A;  1F2P A;  1ELM P;  3H8E A;  5IX3 A;  4P4F A;  1I12 A;  4ORF A;  1V0C A;  3FH4 A;  2PJ9 A;  2PJ8 A;  4MHN A;  4KLV A;  1CX8 A;  3PP9 A;  2Q51 A;  4B6Z A;  5HH1 A;  4KLW A;  1IOF A;  4UF4 A;  4AVB A;  5AG4 A;  1S7K A;  2K5T A;  2ARH A;  4A2Z A;  5ISV A;  5LRG A;  4NF1 A;  3VAT A;  2DF5 A;  2EK8 A;  5HXD A;  2BO9 A;  3JVN A;  4R57 A;  3DR8 A;  5THW A;  2G3T A;  4OAD A;  5JM6 A;  3S9L A;  1M44 A;  1VHO A;  3FMC A;  4NFR A;  2Q7S A;  4NGQ A;  5KTD A;  4MFJ A;  5JGF A;  4PXD A;  4L8A A;  3B8G A;  1ZLH A;  1HDQ A;  4Y49 C;  3LAC A;  2ZEG A;  3QB8 A;  3PBB A;  4A37 A;  4KVM E;  4MCR A;  2WYR A;  3DSB A;  1LAM A;  4G1P A;  5EBV A;  4OME A;  2GU2 A;  3L2N A;  4A95 A;  4B12 A;  3V8I A;  3NH4 A;  2PJ1 A;  4UIB A;  5H84 A;  4KSI A;  4GM5 A;  1M4L A;  2HB6 A;  2WSA A;  1R43 A;  3NA6 A;  2J8M A;  3B35 A;  2YGW A;  5CBM A;  2PVW A;  1QSO A;  3G3S A;  3CXQ A;  3T90 A;  1TKJ A;  2Z3O A;  4IHM A;  4CAV A;  5K8P A;  2BSW A;  2PQ8 A;  3IGR A;  3P2F A;  4H6Z A;  2AJ6 A;  1ZG9 A;  1P0H A;  4NEX A;  1NMT A;  3R1K A;  1VIX A;  3GIU A;  4QUS A;  2NMT A;  1RXT A;  2O28 A;  3NE7 A;  3R9F A;  4Q36 A;  3H8F A;  3RNZ A;  5F46 A;  4R76 A;  4U9Y A;  3KHZ A;  2ZED A;  4QVT A;  4I49 A;  3I1U A;  3GUX A;  4RN7 A;  4UEE A;  5F09 A;  1M4D A;  1MJA A;  2Z10 A;  2ZEH A;  3LMS A;  3BI0 A;  5HVH A;  2P6G A;  1PU9 A;  4A94 A;  4XNH C;  5K8O A;  3SJE A;  3VWE A;  4UA3 A;  2Q44 A;  4ONU A;  1JWQ A;  4OC4 A;  4A39 A;  2X7B A;  3SJG A;  4UCN A;  3IWW A;  1Y9W A;  1ARL A;  2FS5 A;  5DWN A;  2CNM A;  1IOI A;  4AVA A;  4XPD B;  2D4P A;  2HV2 A;  2VL1 A;  3KR4 A;  5F48 A;  3FIX A;  1S60 A;  3S6G A;  2V77 A;  1Z5R A;  1Q2Y A;  2KCW A;  4DUK A;  2PJ3 A;  5F47 A;  2Q43 A;  2QYV A;  3B3V A;  3TO6 A;  5JQ4 A;  5K8M A;  3NH8 A;  2ABZ A;  4KS9 A;  1AMP A;  1Z8W A;  4JXR A;  3VWD A;  2IL4 A;  4KOU A;  1XMT A;  2JBK A;  2R7H A;  4MFK A;  4K30 A;  1NSL A;  3R95 A;  5K8N A;  3B7I A;  1QSR A;  3CPX A;  4MFQ A;  1XBU A;  1S5K A;  3KI9 A;  5G20 A;  2PJ7 A;  2G9D A;  4C7H A;  3K9T A;  1YW4 A;  5EC4 A;  4A32 A;  4C68 A;  1Z8X A;  2IJZ A;  3WR7 A;  2B3U A;  1YVK A;  2WUU A;  5DWM A;  1CM0 A;  4B11 A;  3IJ3 A;  2GRE A;  3GY9 A;  4KOR A;  3B3T A;  2XEG A;  1BPN A;  4Z65 A;  2B3V A;  3T9Y A;  1YK3 A;  4MHZ A;  2PSW A;  4PSX A;  2O53 A;  4CYO A;  2CNT A;  3RYO A;  4CS0 B;  4WJB A;  4II9 A;  4KZT A;  5KTC A;  2PJB A;  1YRE A;  2Q4Y A;  3DR6 A;  2WPW A;  4B14 A;  1TXR A;  3B3W A;  2H5M A;  5CPA A;  5C88 A;  2VZZ A;  3TFY A;  2QML A;  2V8G A;  2Z3M A;  1XRY A;  4FD7 A;  5AGE A;  3W91 A;  3WC7 A;  1KUX A;  3D7H A;  1Z8L A;  8CPA A;  2OZU A;  4UFX A;  4F9V A;  2AFW A;  2B58 A;  3PFE A;  4HNX B;  2YNE A;  4MFP A;  5G1Z A;  2RC4 A;  4C2X A;  1BO4 A;  2PJ4 A;  1Q7L A;  1LCP A;  2PRQ A;  4FD6 A;  4KSA A;  2PJ5 A;  2OR4 A;  3TX8 A;  3FF3 A;  4JXQ A;  4P44 A;  6CPA A;  2GLF A;  1IID A;  3S6F A;  2AFU A;  4TWE A;  2FL4 A;  4UWI A;  1YW6 A;  3SXN A;  3JRU A;  1M1D A;  4J3G A;  1Z9U A;  3KHX A;  3D4U A;  4KUA A;  4L89 A;  3WC5 A;  4OC0 A;  5GCN A;  1FY7 A;  1QQ9 A;  2WPX A;  1XFO A;  3DDD A;  1NE9 A;  2FT0 A;  2ZW4 A;  2HC9 A;  1CPX A;  4F0Y A;  2EBJ A;  1R57 A;  4M6H A;  4PQA A;  3BHX A;  3EO4 A;  4TNU A;  3GLJ A;  3VH9 A;  2Y0M A;  2VI7 A;  3FEE A;  2CY2 A;  4CYN A;  2ZXV A;  3N5F A;  2FIW A;  4OC5 A;  4R3K A; 
#chains in the Genus database with same CATH homology
 4KUB A;  3BJ8 A;  3H5Z A;  1QSN A;  3LOD A;  5AG5 A;  5JPH A;  4XPK A;  4A31 A;  1QSM A;  2J8N A;  4IUS A;  3EC4 A;  1VHS A;  5G21 A;  1MK4 A;  3FBU A;  4B5O A;  4KOV A;  5A27 A;  5I0C A;  2Q04 A;  4CAF A;  4CGM A;  5FVJ A;  2B4D B;  4Q38 A;  4YFJ A;  4CGN A;  3GYA A;  2EVN A;  2OH1 A;  1UFH A;  1KZF A;  3IU2 A;  5BWA B;  1U6M A;  3MGD A;  1VKC A;  2OB0 A;  4QB9 A;  4FD4 A;  3TTH A;  2FXF A;  3P2H A;  3TT2 A;  3IWE A;  4DNC A;  3F0A A;  3BLN A;  2PRB A;  5IB0 A;  3SXO A;  2YNC C;  2R1I A;  1CJW A;  4UCP A;  1TIQ A;  4NXY A;  4MFL A;  2I00 A;  4PK2 A;  5F49 A;  1N71 A;  4JJX A;  2B4B A;  1MJB A;  4HNW B;  3CXS A;  1ON0 A;  2YND A;  2VXK A;  3EXN A;  3FNC A;  3N7Z A;  5H86 A;  2YNC A;  1Y7R A;  3GKR A;  1XIX A;  2ZPA A;  3PZJ A;  4XPL A;  4PK3 A;  2CNS A;  4A30 A;  3TE4 A;  3TOB A;  2AE6 A;  1LRZ A;  4R9M A;  4UFV A;  1Y9K A;  2I79 A;  3TO9 A;  2Q4V A;  1YR0 A;  3K9U A;  4AG7 A;  1IB1 E;  1SQH A;  5HMN A;  4HKF A;  2PDO A;  2HQY A;  2VBQ A;  3FRM A;  4OLL A;  1WWZ A;  4ZBG A;  4KOW A;  2PR1 A;  3EFA A;  3IU1 A;  4QBJ A;  2OU2 A;  4KSF A;  4U5Y A;  3ZZI A;  3LD2 A;  2HUZ A;  4CYQ A;  1MJ9 A;  2FCK A;  1IYK A;  2P0W A;  4UCM A;  2B4D A;  4JD6 A;  2BEI A;  4C2Z A;  4MJ8 A;  2OZH A;  4OAE A;  4UWJ A;  4E0A A;  4X5K A;  3D2P A;  4GS4 A;  3JUW A;  1S7L A;  2G0B A;  3OWC A;  3QAH A;  5G22 A;  4B13 A;  1S7N A;  2REE A;  1RO5 A;  2G3A A;  3TOA A;  3KKW A;  1M4G A;  1S3Z A;  4B5P A;  4MFZ A;  4CGO A;  1IYL A;  2B5G B;  4CGP A;  1OZP A;  3TO7 A;  2Z3P A;  1QST A;  1P4N A;  2Z3N A;  3D8P A;  4H89 A;  4C7I A;  3W6S A;  2ZW7 A;  3FYN A;  4XPD C;  2VQY A;  2FSR A;  5A28 A;  4AB7 A;  1M4I A;  3DNS A;  5J8C A;  4KOT A;  1K4J A;  4UFW A;  4MY3 A;  1YGH A;  4KVX A;  2R98 A;  4JWP A;  4KOX A;  2C27 A;  3F5B A;  2ATR A;  4RS2 A;  4CAW A;  2GIV A;  4M3S A;  2BL1 A;  1WK4 A;  4KVO E;  4M85 A;  4KOY A;  4NSQ A;  1ZO0 A;  4CAX A;  2Q7B A;  1Q2C A;  4MI4 A;  4PV6 A;  3UY5 A;  4UBR A;  4LX9 A;  4BBH A;  2OZG A;  4EVY A;  4Y49 B;  2VEZ A;  1I21 A;  2ZW6 A;  3E0K A;  1B87 A;  2PC1 A;  1KUY A;  2GE3 A;  2Z0Z A;  4R3L A;  5AG6 A;  2FE7 A;  2JDD A;  3BJ7 A;  1IIC A;  1XE4 A;  4KOS A;  3F8K A;  3I3G A;  4CRY B;  1YVO A;  1Z4E A;  4MHD A;  5IV0 A;  2R8V A;  3D2M A;  3SHP A;  2P6E A;  3CXP A;  2P6F A;  5J8F A;  2GAN A;  1GHE A;  2EUI A;  2D4O A;  4AVC A;  4H6U A;  4CYP A;  4B10 A;  4MY0 A;  4AG9 A;  4CGL A;  4U9Z A;  1XF8 A;  2BUE A;  4JLY A;  3FB3 A;  2DPS A;  2QEC A;  4CAE A;  3ZJ0 A;  4E2A A;  4CRZ B;  4LUA A;  5C82 A;  1KUV A;  3FXT A;  2REF A;  2B5G A;  2VZY A;  4E8O A;  5CNP A;  4C2Y A;  2J8R A;  3A9L A;  4B5P B;  3S6K A;  4R87 A;  1YLE A;  3R96 A;  1BOB A;  4F0X A;  2QIR A;  4FD5 A;  3H4Q A;  3W6X A;  1L0C A;  4A33 A;  1S7F A;  3EY5 A;  2Q0Y A;  4QC6 A;  3G8W A;  2Z3L A;  5E96 A;  3JTK A;  4RI1 A;  2PR8 A;  5KTA A;  3D3S A;  4F6A A;  1B6B A;  2DXQ A;  3R9G A;  3C26 A;  4YRH A;  4YGO A;  2DPT A;  1XEB A;  1J4J A;  4PSW A;  3IWG A;  4MBU A;  3S6H A;  4BMH A;  3R9E A;  1PUA A;  4HNY B;  2Z11 A;  2JDC A;  2JLM A;  2A4N A;  3I9S A;  1Q2D A;  2FIA A;  4IF5 A;  3TCV A;  4NCZ A;  1YX0 A;  1Z4R A;  2F5I A;  2JEV A;  1I1D A;  2Z3K A;  4XNH B;  4ZGY B;  2CXA A;  5AG7 A;  3PGP A;  2ZW5 A;  5IX3 A;  1I12 A;  4ORF A;  1V0C A;  4KLV A;  3PP9 A;  5HH1 A;  4KLW A;  4AVB A;  5AG4 A;  1S7K A;  2K5T A;  2ARH A;  4A2Z A;  5ISV A;  4NF1 A;  4R57 A;  3JVN A;  3DR8 A;  2G3T A;  4OAD A;  1M44 A;  5KTD A;  4MFJ A;  4L8A A;  3B8G A;  4Y49 C;  3QB8 A;  4KVM E;  3DSB A;  5EBV A;  4A95 A;  4B12 A;  3V8I A;  5H84 A;  2WSA A;  2J8M A;  2YGW A;  1QSO A;  3G3S A;  3CXQ A;  3T90 A;  2Z3O A;  4CAV A;  2BSW A;  2PQ8 A;  3IGR A;  3P2F A;  4H6Z A;  2AJ6 A;  1P0H A;  4NEX A;  1NMT A;  3R1K A;  4QUS A;  2NMT A;  1RXT A;  2O28 A;  3NE7 A;  3R9F A;  4Q36 A;  5F46 A;  4U9Y A;  4QVT A;  4I49 A;  1M4D A;  1MJA A;  2Z10 A;  2P6G A;  1PU9 A;  4XNH C;  3VWE A;  4UA3 A;  2Q44 A;  4ONU A;  2X7B A;  4UCN A;  1Y9W A;  2FS5 A;  5DWN A;  2CNM A;  4AVA A;  4XPD B;  2D4P A;  2HV2 A;  5F48 A;  3FIX A;  1S60 A;  3S6G A;  1Q2Y A;  2KCW A;  5F47 A;  3TO6 A;  5JQ4 A;  4KS9 A;  4JXR A;  3VWD A;  2IL4 A;  4KOU A;  1XMT A;  2R7H A;  4MFK A;  4K30 A;  1NSL A;  3R95 A;  1QSR A;  4MFQ A;  1S5K A;  5G20 A;  4C7H A;  5EC4 A;  4A32 A;  4C68 A;  3WR7 A;  2B3U A;  1YVK A;  2WUU A;  5DWM A;  1CM0 A;  4B11 A;  3GY9 A;  4KOR A;  2B3V A;  3T9Y A;  1YK3 A;  2PSW A;  4PSX A;  4CYO A;  2CNT A;  3RYO A;  4CS0 B;  4II9 A;  4KZT A;  5KTC A;  1YRE A;  2Q4Y A;  3DR6 A;  2WPW A;  4B14 A;  2H5M A;  5C88 A;  3TFY A;  2VZZ A;  2QML A;  2Z3M A;  4FD7 A;  3W91 A;  5AGE A;  1KUX A;  2OZU A;  4UFX A;  2B58 A;  4HNX B;  2YNE A;  4MFP A;  5G1Z A;  2RC4 A;  4C2X A;  1BO4 A;  4FD6 A;  4KSA A;  4JXQ A;  3S6F A;  1IID A;  2FL4 A;  4UWI A;  3SXN A;  1M1D A;  4J3G A;  1Z9U A;  4KUA A;  4L89 A;  5GCN A;  1FY7 A;  2WPX A;  3DDD A;  1NE9 A;  2FT0 A;  2ZW4 A;  4F0Y A;  1R57 A;  3EO4 A;  2Y0M A;  2VI7 A;  2CY2 A;  4CYN A;  2ZXV A;  2FIW A;  4R3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...