2D4OA

Crystal structure of ttha1254 (i68m mutant) from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRMEGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA1254
publication title Crystal structure of TTHA1254 (I68M mutant) from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 33
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09390 DUF1999 Protein of unknown function (DUF1999)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2d4oA00
1WK4A 4UBRA 5IV0A 1S7LA 2PR1A 2OU2A 3FNCA 4MJ8A 4KOSA 3TOBA 2OH1A 2Q04A 4MBUA 3I9SA 2PC1A 2A4NA 3K9UA 3G8WA 4CAVA 2GIVA 2P0WA 3FRMA 4AB7A 2B3VA 3CXPA 3WR7A 3TO7A 1U6MA 5EBVA 2IL4A 3ZZIA 1I12A 3RYOA 2F5IA 1YLEA 4M3SA 2Q4VA 1KZFA 3VWDA 2BSWA 3DR6A 4PK2A 3I3GA 3KKWA 4RS2A 4XPDB 1Z4RA 5KTCA 3NE7A 1XE4A 2ZXVA 1UFHA 4XNHC 5JQ4A 2BUEA 1Y7RA 3BJ7A 4JD6A 2REEA 3BJ8A 1Z9UA 4H6UA 1KUXA 1I21A 1S5KA 2VEZA 3GY9A 4HNYB 1CM0A 2PDOA 5ISVA 5HH1A 4FD4A 2HV2A 5F48A 1XEBA 5KTDA 1M1DA 1ON0A 1RXTA 2H5MA 3DSBA 4QBJA 3QB8A 3FYNA 3EXNA 2Q0YA 4QUSA 3PZJA 2ATRA 1YK3A 4LUAA 2EVNA 2OZHA 2Q44A 4YGOA 3P2FA 2BL1A 1P4NA 3D2MA 3IWGA 2R8VA 3VWEA 2ZW4A 3W6XA 4HNXB 2PQ8A 3D3SA 3R9FA 2J8RA 3PGPA 3R9GA 5I0CA 1M4IA 4KLVA 4CAWA 4KOYA 4NCZA 3F8KA 3FBUA 4XPDC 3S6GA 2EUIA 2REFA 2QECA 1IYLA 1OZPA 1KUVA 1XF8A 3SXNA 3PP9A 3GKRA 4XNHB 3MGDA 1PUAA 4AG7A 4XPKA 1NSLA 1QSRA 2J8MA 4ZBGA 5CNPA 2G0BA 3T9YA 2JDDA 1MJAA 4II9A 3R96A 2VQYA 3CXSA 2B5GB 2FL4A 2CY2A 4GS4A 2CNTA 2GE3A 3JUWA 4DNCA 3ZJ0A 1S3ZA 1VHSA 2ZPAA 1QSNA 4KORA 3T90A 1Y9KA 3CXQA 2RC4A 4Y49C 5HMNA 5H86A 4HNWB 1S7FA 2ZW5A 4F0YA 4E0AA 2QMLA 3LD2A 3FXTA 4FD5A 3TO6A 4X5KA 1YVKA 4KOTA 2PR8A 2ZW6A 4OADA 1CJWA 2FS5A 1BOBA 2DXQA 1XMTA 4FD7A 4LX9A 3SHPA 1B87A 1I1DA 4UWJA 4E8OA 3TOAA 5E96A 2B3UA 2WPWA 3TO9A 3N7ZA 2P6EA 4JXQA 3EY5A 3D2PA 4IUSA 2B4DA 1KUYA 4MHDA 2Z0ZA 4E2AA 4PV6A 3FB3A 2R1IA 4KUAA 4JXRA 5J8FA 4KOVA 1MK4A 1M4DA 4OAEA 1QSTA 1Q2CA 3W6SA 2FXFA 1RO5A 4PSWA 4IF5A 5DWMA 4B5PB 4U9ZA 4M85A 3EC4A 2X7BA 3H4QA 4Y49B 5F47A 2KCWA 4MY3A 1M44A 2VXKA 1S7KA 4CRZB 1YGHA 2CNMA 1P0HA 5EC4A 4H6ZA 2VZZA 3QAHA 1R57A 3FIXA 3G3SA 2R7HA 4R57A 3W91A 2Z11A 3C26A 1VKCA 1MJBA 4YFJA 4B5OA 1YR0A 4K30A 4R87A 4H89A 2AE6A 2NMTA 5F49A 1GHEA 3SXOA 3F0AA 3R95A 2ZW7A 2JLMA 1S7NA 3EFAA 4R3LA 4NSQA 2G3AA 1WWZA 4CS0B 4NF1A 4KVXA 2B5GA 3LODA 2BEIA 2PSWA 4MI4A 4FD6A 2Y0MA 2D4PA 4KOWA 1K4JA 2FE7A 5IX3A 2AJ6A 2OB0A 4KVOE 3E0KA 2Q7BA 1Q2YA 3F5BA 1Z4EA 2B4BA 2FIAA 4PK3A 4XPLA 1QSMA 2FIWA 5KTAA 3S6KA 2VI7A 4UA3A 5F46A 2G3TA 1MJ9A 2R98A 4NXYA 3JVNA 1L0CA 5GCNA 4PSXA 3D8PA 5C88A 3EO4A 4R9MA 2I79A 5H84A 4ORFA 1IIDA 1PU9A 4F6AA 1BO4A 2J8NA 4QB9A 4KUBA 2P6FA 4I49A 3DNSA 4BMHA 2D4OA 5IB0A 3TT2A 1QSOA 3DDDA 4EVYA 3V8IA 4KOUA 4RI1A 4CRYB 2ARHA 1YREA 2B4DB 4B5PA 4AVBA 4QVTA 4HKFA 2JEVA 1M4GA 1V0CA 4JLYA 4KLWA 4KZTA 4AVAA 1J4JA 1NMTA 3S6HA 3R1KA 3UY5A 1N71A 2GANA 1B6BA 2FT0A 1FY7A 1IB1E 4KVME 1LRZA 3IGRA 4AVCA 3BLNA 1YX0A 2Z10A 2WPXA 2C27A 2I00A 5JPHA 4YRHA 1NE9A 2HQYA 4U5YA 2VBQA 4R3KA 3TTHA 5C82A 2CNSA 2VZYA 3TE4A 2QIRA 3B8GA 1YVOA 4UWIA 3TFYA 1S60A 1SQHA 2O28A 2FSRA 4KOXA 1IICA 3OWCA 2PRBA 4QC6A 4AG9A 3DR8A 4U9YA 1XIXA 4L89A 4L8AA 2Q4YA 5FVJA 4CAXA 4ONUA 4JWPA 2P6GA 2OZGA 4NEXA 3R9EA 2HUZA 1TIQA 3TCVA 2OZUA 4JJXA 1IYKA 2JDCA 5DWNA 2K5TA 4MY0A 2FCKA 4J3GA 3P2HA 2B58A 4OLLA 3GYAA 1Y9WA 3S6FA 5J8CA 1Q2DA
chains in the Genus database with same CATH superfamily
1WK4A 4B14A 4UBRA 1DE4C 5IV0A 1PYTB 3FX6A 4TNUA 1S7LA 1Z8LA 2OU2A 2PR1A 3FNCA 3SJXA 4MJ8A 5AG5A 2ANPA 4CYOA 3PEIA 2O4HA 4KOSA 3TOBA 2OH1A 2Q04A 2NSMA 4MBUA 4P4FA 2Z3OA 3I9SA 4CGPA 1LAMA 5IB9A 1LFWA 2ZEFA 2PC1A 2A4NA 2AFSA 3GB0A 3IJ3A 3K9UA 2PJ3A 2ABZA 3G8WA 4CAVA 4KSIA 2GIVA 2P0WA 3D68A 2OR4A 3IEHA 3FRMA 2CXAA 3IU2A 3IWEA 3FEEA 4AB7A 2B3VA 2YNCA 3CXPA 1Z8XA 4IK2A 2BCOA 3WR7A 3TO7A 1U6MA 5J1QA 5EBVA 2IL4A 3ZZIA 1I12A 1JWQA 4OC3A 2F5IA 1YLEA 4M3SA 3RYOA 2Q4VA 3PB4X 4LQ6A 1KZFA 1F2OA 2GLJA 3D67A 3PBBA 4M6GA 3SJFA 3VWDA 2BSWA 3KZWA 3DR6A 4FBEA 5I4MA 2JEWA 4PK2A 3I3GA 3KKWA 4CAEA 1YLOA 3NA6A 4RS2A 4XPDB 1Z4RA 5KTCA 2EBJA 2Z3NA 4OC2A 3CZXA 3NE7A 1XE4A 1HDQA 2ZXVA 5JH9A 2F8HA 2ZOGA 1UFHA 4HPSA 4XNHC 3NH5A 3KR4A 5JQ4A 2BUEA 3B3TA 8CPAA 1Y7EA 1Y7RA 3FEDA 1LOKA 3BJ7A 4JD6A 4IHMA 1XRYA 2REEA 3BJ8A 3IIBA 1FT7A 1Z9UA 2BO9A 2ODFA 2ZEEA 1X12A 4H6UA 1KUXA 1Q7LA 1LAPA 4OC0A 1I21A 1S5KA 4B6ZA 2VEZA 3GY9A 4HNYB 1CM0A 4ZY0A 2PDOA 3D66A 4GXHA 4CAFA 5ISVA 2F7VA 4YU9A 5HH1A 4FD4A 2C6GA 2HV2A 5G20A 3KL9A 5F48A 5LYFA 4MHNA 1XEBA 5KTDA 1M1DA 1ON0A 1RXTA 2H5MA 3DSBA 4QBJA 4DJLA 3QB8A 3FYNA 3EXNA 4A39A 4KSAA 2DF5A 3B3SA 3HUVA 2Q0YA 2QVPA 4QUSA 7CPAA 3KQXA 3PZJA 2ATRA 4CGLA 1YK3A 1XMBA 4RUHA 4LUAA 2EVNA 3JTKA 2OZHA 1F57A 5LRJA 2Q44A 4YGOA 4F8ZA 4CGMA 3NH4A 3P2FA 2BL1A 1P4NA 2C6PA 3D2MA 3IWGA 2C1CA 2R8VA 3VWEA 2ZW4A 3W6XA 2PIYA 4HNXB 4Z65A 2PQ8A 1TF8A 3D3SA 3R9FA 2J8RA 3PGPA 3KI9A 1H8LA 1M4IA 2IJZA 2XEJA 4MCRA 3R9GA 5I0CA 4KLVA 4CAWA 4A95A 2YNEA 4KOYA 4NFRA 4NCZA 3F8KA 1BPMA 4UCNA 3FBUA 5JGFA 2PIZA 4MCSA 2EUIA 2REFA 4XPDC 3B3CA 5AGEA 2QECA 1IYLA 3S6GA 3VATA 4EWTA 1OZPA 2WYRA 1KUVA 1XF8A 3SXNA 2CIJA 4ZY1A 3PP9A 3GKRA 3T8WA 4XNHB 3MGDA 1PUAA 4AG7A 4XPKA 2ZEMA 1NSLA 3NH8A 1Y0YA 4K3NA 3S9NA 4CGOA 1QSRA 4MRIA 4C2YA 5A27A 2J8MA 3PFOA 1AYEA 4ZBGA 4P44A 5CNPA 1FNOA 3L2NA 2G0BA 3T9YA 2C6CA 2JDDA 1CG2A 3B3VA 2PJ4A 1MJAA 2RB7A 4II9A 3R96A 4MFPA 2VQYA 3CXSA 2B5GB 1GYTA 2FL4A 2RFHA 1Y0RA 3QAYA 2CY2A 4GS4A 4AXVA 3D7DA 2G9DA 1IU8A 2CNTA 2GE3A 3D7GA 3JUWA 3ZJ0A 4DNCA 3V7ZA 2Z3PA 1S3ZA 5AG6A 3B7IA 3QNVA 4OIDA 1BLLE 4F0XA 2PJ9A 1VHSA 2PJBA 2ZPAA 1HDUA 1QSNA 3HLPA 4KORA 3T90A 1Y9KA 2PJ0A 1XBUA 3CXQA 2RC4A 5HVFA 4CYNA 4FAIA 2XEFA 4A30A 4Y49C 2PJCA 4UF4A 5H86A 4HNWB 1S7FA 3TX8A 4A37A 2ZW5A 4F0YA 4E0AA 2QMLA 3CDXA 3LD2A 4OKOA 4IAVA 4MHPA 5JM6A 1HEEA 2V8DA 3FXTA 4FD5A 3TO6A 4X5KA 1VIXA 1YVKA 1TF9A 4KOTA 2PR8A 4BBHA 4UEZA 2ZW6A 4OADA 2ZOFA 3BXMA 4OC4A 1CJWA 2FS5A 4DYOA 4ZI6A 3FF3A 2PVWA 1BOBA 1IY7A 3D7FA 2Z3KA 6CPAA 2YGWA 3PB8X 2DXQA 2PJ7A 4X8IA 4NGRA 4ZY2A 1XMTA 4P10A 2EWBA 4FD7A 4LX9A 5F09A 3ISXA 3SHPA 1B87A 4Q38A 4AVCA 4WWVA 1I1DA 4UFXA 2DPSA 4UWJA 2JBKA 3DGVA 3K2KA 4RN7A 4E8OA 3TOAA 1OBRA 1LCPA 5E96A 2NYQA 4CYQA 2B3UA 2WPWA 3TO9A 3B2YA 3FVLA 3N5FA 4NGPA 3N7ZA 2P6EA 1EE3P 3H8EA 4JXQA 3EY5A 4ONWA 1CP6A 5DS0A 3TC8A 3D2PA 4LQGA 3NFZA 5CPAA 4JZ0A 4IUSA 3RBUA 2B4DA 5AG7A 4MFZA 4UCPA 5BWAB 1R43A 1KUYA 4MHDA 2QYVA 2Z0ZA 4KSFA 4B13A 5A28A 4E2AA 2CTCA 1DTDA 3FB3A 4PV6A 4CGNA 3SI1A 3FECA 4NGTA 2R1IA 1CPXA 4P4EA 4KUAA 4JXRA 5J8FA 3LACA 4KOVA 2Z3MA 1MK4A 3IO1A 3SI0A 4P45A 1M4DA 2EK8A 4NGQA 4OAEA 1VHEA 2PVVA 1QSTA 1Q2CA 3IFEA 3WC6A 2EO8A 2PJ2A 2I3CA 3GLJA 3W6SA 2WUUA 2FXFA 1RO5A 4PSWA 4IF5A 5LYDA 5DWMA 4CYPA 2V77A 1YW4A 4B5PB 3WT4A 4U9ZA 4M85A 4B12A 2Q51A 3EC4A 2X7BA 3H4QA 4PXDA 1ARMA 1ZLHA 4Y49B 2Q4ZA 5F47A 3WABA 2IMOA 3WC7A 3GUXA 2KCWA 4ZX8A 4MY3A 2GLFA 1IOIA 1CPSA 1M44A 1NSAA 2VXKA 1S7KA 3JRUA 3MRUA 4M6HA 1YGHA 4OIWA 4CRZB 2HB6A 2CNMA 1P0HA 2ZEGA 5EC4A 4H6ZA 2VZZA 3WC5A 3A9LA 1R57A 3QAHA 3FIXA 3G3SA 4CPAA 3CPXA 1VHOA 2R7HA 4R57A 5G21A 3KR5A 3W91A 4MFKA 3BI0A 2Z11A 3H8GA 2ZEDA 4UCMA 5K8NA 3C26A 4FWUA 1VKCA 1MJBA 3RZAA 4UFWA 5ELYA 5K8OA 3KASA 3FMCA 2ZEHA 1BAVA 4B5OA 4YFJA 2DEAA 1YR0A 4K30A 2AFZA 4R87A 4H89A 2AE6A 2NMTA 4UFVA 5F49A 4ZX9A 2QJ8A 3RAMA 3PFEA 1GHEA 3SXOA 2YNCC 3F0AA 3R95A 2V8GA 3ISZA 2ZW7A 2VL1A 2JLMA 4OC5A 1S7NA 3EFAA 2O53A 4R3LA 1ZG8A 4NSQA 2G3AA 1WWZA 4C2XA 4CS0B 4EFDA 3GIUA 2XEGA 4NF1A 5LYIA 3SJEA 1TXRA 4KVXA 4R6TA 2PRQA 1YW6A 2B5GA 3LMSA 3LODA 2BEIA 2PSWA 4B11A 4MI4A 4FD6A 1JQGA 2Y0MA 2D4PA 4P4DA 4KOWA 1K4JA 2FE7A 5IX3A 1R3NA 2Q7SA 2AJ6A 4B10A 2AFOA 3V38A 1QMUA 2OB0A 2PJAA 3PRTA 4MFQA 1UWYA 4KVOE 3S9MA 3VH9A 3KGQA 3E0KA 4A94A 4TWEA 3IWWA 4MCQA 2AFXA 2XEIA 3FH4A 2Q7BA 1Q2YA 4C68A 5HMNA 3KHZA 4MFJA 2V8VA 1F2PA 3F5BA 1Z4EA 5HXDA 2HC9A 2EK9A 2B4BA 2FIAA 4PK3A 2PJ6A 4NJQA 4XPLA 1CX8A 3RNZA 1QSMA 4OMEA 1Z5RA 2FIWA 5KTAA 3S6KA 2VI7A 4UA3A 4A31A 5LYLA 1PCAA 5F46A 4A32A 2G3TA 4R8FA 2J9AA 1MJ9A 2R98A 2AFWA 4NXYA 5K8PA 3JVNA 1L0CA 3K9TA 4F9VA 5GCNA 4PSXA 2GU2A 5D8NA 1XJOA 3PBEA 5G1ZA 3D8PA 3H8FA 3EO4A 1QQ9A 4G1PA 2I79A 4R9MA 1LANA 4UEEA 5C88A 3KQZA 4A38A 3BHXA 5H84A 1TKJA 4H2KA 4R7MA 3D7HA 4BINA 2ZELA 4ORFA 1IIDA 1M4LA 2CTBA 4UIAA 3PB9X 1PU9A 4F6AA 3IC1A 1BO4A 2J8NA 1TKHA 4M6IA 4P4BA 4QB9A 4KUBA 2P6FA 4I49A 5EMIA 3DNSA 2AFUA 4BMHA 4NGSA 4X2TA 3CT9A 2D4OA 4W9YA 5IB0A 3DLJA 3TT2A 4OP4A 2CF4A 1IGBA 2ZEPA 3MN8A 4MFLA 4EMEA 1QSOA 4NJRA 2GFQA 1X10A 4Q36A 5LRKA 3DDDA 2ZEOA 4EVYA 1BPNA 3V8IA 4KOUA 4P6YA 4RI1A 4YWYA 4CRYB 2ARHA 1YREA 2B4DB 3D4UA 4B5PA 4AVBA 3PB6X 1YSJA 4QVTA 4HKFA 4MHZA 2JEVA 1M4GA 4PQAA 1V0CA 4JLYA 4KLWA 1ZLIA 4KZTA 2PJ8A 4AVAA 1Z2LA 4MXUA 1J4JA 1NMTA 2PJ5A 3R1KA 4JYWA 3S6HA 3UY5A 3I1UA 4DUKA 5CBMA 1N71A 4F9UA 2WZNA 2GANA 4PXCA 1B6BA 2FT0A 1FY7A 3SJGA 3SI2A 4NGMA 3LWUA 1IB1E 1LRZA 4KVME 3B3WA 3CPAA 2PJ1A 3IGRA 3BLNA 1YX0A 2Z10A 2WPXA 2C27A 1YMEA 4UIBA 2OOTA 2I00A 2GREA 5JPHA 5K8MA 4P4JA 1IOFA 1XOVA 2FVGA 4YRHA 4C7IA 1NE9A 2HQYA 3H5ZA 2Z3LA 4OC1A 1YQEA 4U5YA 2VBQA 4ZYQA 4R3KA 4P4IA 3TTHA 5C82A 1A2ZA 5HVHA 1ZO0A 4C7HA 3PB7X 4KS9A 2CNSA 2VZYA 5HVGA 1AMPA 3TE4A 2QIRA 3B8GA 1TKFA 1YVOA 4UWIA 3TFYA 3VARA 1S60A 1SQHA 1ZG9A 4PXBA 2O28A 3RO0A 1CP7A 2WSAA 5AG4A 2FSRA 1RTQA 4KOXA 3B35A 4ZGYB 1IICA 4X3RA 1XFOA 1VGYA 2IQ6A 2JBJA 3OWCA 4WJBA 2PRBA 4BD9A 4QC6A 4AG9A 4GM5A 4PXEA 1KWMA 4FUUA 3DR8A 4U9YA 1XIXA 2PCUA 4L89A 2ZENA 4MHYA 1ELMP 4L8AA 2Q4YA 5FVJA 3IU1A 4ONUA 4PPZA 4CAXA 2YNDA 4JWPA 2PE3A 2P6GA 2OZGA 2Q43A 3NE8A 4NEXA 3R9EA 4Q7AA 2POKA 5G22A 2HUZA 1TIQA 2V8HA 2AFMA 3FJUA 1ZG7A 3TCVA 2OZUA 4JJXA 3KHXA 4C2ZA 1Z8WA 4A33A 4R76A 1IYKA 1ARLA 1AUGA 3BI1A 2JDCA 4O23A 5LRGA 5DWNA 2K5TA 4MY0A 4MCPA 1Z8TA 2FCKA 4NGNA 2BOAA 4A2ZA 3S9LA 4J3GA 5THWA 3P2HA 4MMOA 2DPTA 2B58A 4UEFA 4OLLA 1ELLP 1CBXA 3GYAA 5D29A 1Y9WA 3S6FA 5J8CA 1Q2DA
chains in the Genus database with same CATH topology
1WK4A 4B14A 4UBRA 5IV0A 1S7LA 2PR1A 2OU2A 3FNCA 4MJ8A 5AG5A 4CYOA 4KOSA 3TOBA 2OH1A 2Q04A 4MBUA 2Z3OA 3I9SA 4CGPA 2PC1A 2A4NA 3K9UA 3G8WA 4CAVA 2GIVA 2P0WA 3FRMA 2CXAA 3IU2A 3IWEA 4AB7A 2B3VA 2YNCA 3CXPA 3WR7A 3TO7A 1U6MA 5EBVA 2IL4A 3ZZIA 1I12A 3RYOA 2F5IA 1YLEA 4M3SA 2Q4VA 1KZFA 3VWDA 2BSWA 3DR6A 4PK2A 3I3GA 3KKWA 4CAEA 4RS2A 4XPDB 1Z4RA 5KTCA 2Z3NA 3NE7A 1XE4A 2ZXVA 1UFHA 4XNHC 5JQ4A 2BUEA 1Y7RA 3BJ7A 4JD6A 2REEA 3BJ8A 1Z9UA 4H6UA 1KUXA 1I21A 1S5KA 2VEZA 3GY9A 4HNYB 1CM0A 2PDOA 4CAFA 5ISVA 5HH1A 4FD4A 2HV2A 5G20A 5F48A 1XEBA 5KTDA 1M1DA 1ON0A 1RXTA 2H5MA 3DSBA 4QBJA 3QB8A 3FYNA 3EXNA 4KSAA 2Q0YA 4QUSA 3PZJA 2ATRA 4CGLA 1YK3A 4LUAA 2EVNA 3JTKA 2OZHA 2Q44A 4YGOA 4CGMA 3P2FA 2BL1A 1P4NA 3D2MA 3IWGA 2R8VA 3VWEA 2ZW4A 3W6XA 4HNXB 2PQ8A 3D3SA 3R9FA 2J8RA 3PGPA 3R9GA 5I0CA 1M4IA 4KLVA 4CAWA 4A95A 2YNEA 4KOYA 4UCNA 4NCZA 3F8KA 3FBUA 4XPDC 3S6GA 2EUIA 2REFA 5AGEA 2QECA 1IYLA 1OZPA 1KUVA 1XF8A 3SXNA 3PP9A 3GKRA 4XNHB 3MGDA 1PUAA 4AG7A 4XPKA 1NSLA 4CGOA 1QSRA 5A27A 4C2YA 2J8MA 4ZBGA 5CNPA 2G0BA 3T9YA 2JDDA 1MJAA 4II9A 3R96A 4MFPA 2VQYA 3CXSA 2B5GB 2FL4A 2CY2A 4GS4A 2CNTA 2GE3A 3JUWA 4DNCA 3ZJ0A 2Z3PA 1S3ZA 5AG6A 4F0XA 1VHSA 2ZPAA 1QSNA 4KORA 3T90A 1Y9KA 3CXQA 2RC4A 4CYNA 4A30A 4Y49C 5HMNA 5H86A 4HNWB 1S7FA 2ZW5A 4F0YA 4E0AA 2QMLA 3LD2A 3FXTA 4FD5A 3TO6A 4X5KA 4BBHA 1YVKA 4KOTA 2PR8A 2ZW6A 4OADA 1CJWA 2FS5A 1BOBA 2Z3KA 2YGWA 2DXQA 1XMTA 4FD7A 4LX9A 3SHPA 1B87A 4Q38A 1I1DA 4UFXA 2DPSA 4UWJA 4E8OA 3TOAA 5E96A 4CYQA 2B3UA 2WPWA 3TO9A 3N7ZA 2P6EA 4JXQA 3EY5A 3D2PA 4IUSA 2B4DA 5AG7A 4MFZA 4UCPA 5BWAB 1KUYA 4MHDA 2Z0ZA 4KSFA 4B13A 5A28A 4E2AA 4PV6A 3FB3A 4CGNA 2R1IA 4KUAA 4JXRA 5J8FA 4KOVA 2Z3MA 1MK4A 1M4DA 4OAEA 1QSTA 1Q2CA 3W6SA 2WUUA 2FXFA 1RO5A 4PSWA 4IF5A 5DWMA 4CYPA 4B5PB 4U9ZA 4M85A 4B12A 3EC4A 2X7BA 3H4QA 4Y49B 5F47A 2KCWA 4MY3A 1M44A 2VXKA 1S7KA 4CRZB 1YGHA 2CNMA 1P0HA 5EC4A 4H6ZA 2VZZA 3A9LA 1R57A 3QAHA 3FIXA 3G3SA 2R7HA 4R57A 5G21A 3W91A 4MFKA 2Z11A 4UCMA 3C26A 1VKCA 1MJBA 4UFWA 4YFJA 4B5OA 1YR0A 4K30A 4R87A 4H89A 2AE6A 2NMTA 4UFVA 5F49A 1GHEA 3SXOA 2YNCC 3F0AA 3R95A 2ZW7A 2JLMA 1S7NA 3EFAA 4R3LA 4NSQA 2G3AA 1WWZA 4C2XA 4CS0B 4NF1A 4KVXA 2B5GA 3LODA 2BEIA 2PSWA 4B11A 4MI4A 4FD6A 2Y0MA 2D4PA 4KOWA 1K4JA 2FE7A 5IX3A 4B10A 2AJ6A 2OB0A 4MFQA 4KVOE 3E0KA 2Q7BA 1Q2YA 4C68A 4MFJA 3F5BA 1Z4EA 2B4BA 2FIAA 4PK3A 4XPLA 1QSMA 2FIWA 5KTAA 3S6KA 2VI7A 4UA3A 4A31A 5F46A 4A32A 2G3TA 1MJ9A 2R98A 4NXYA 3JVNA 1L0CA 5GCNA 4PSXA 5G1ZA 3D8PA 5C88A 3EO4A 4R9MA 2I79A 5H84A 4ORFA 1IIDA 1PU9A 4F6AA 1BO4A 2J8NA 4QB9A 4KUBA 2P6FA 4I49A 3DNSA 4BMHA 2D4OA 5IB0A 3TT2A 4MFLA 1QSOA 4Q36A 3DDDA 4EVYA 3V8IA 4KOUA 4RI1A 4CRYB 2ARHA 1YREA 2B4DB 4B5PA 4AVBA 4QVTA 4HKFA 2JEVA 1M4GA 1V0CA 4JLYA 4KLWA 4KZTA 4AVAA 1J4JA 1NMTA 3S6HA 3R1KA 3UY5A 1N71A 2GANA 1B6BA 2FT0A 1FY7A 1IB1E 1LRZA 4KVME 3IGRA 4AVCA 3BLNA 1YX0A 2Z10A 2WPXA 2C27A 2I00A 5JPHA 4YRHA 4C7IA 1NE9A 2HQYA 3H5ZA 2Z3LA 4U5YA 2VBQA 4R3KA 3TTHA 5C82A 1ZO0A 4C7HA 4KS9A 2CNSA 2VZYA 3TE4A 2QIRA 3B8GA 1YVOA 4UWIA 3TFYA 1S60A 1SQHA 2O28A 2WSAA 5AG4A 2FSRA 4KOXA 4ZGYB 1IICA 3OWCA 2PRBA 4QC6A 4AG9A 3DR8A 4U9YA 1XIXA 4L89A 4L8AA 2Q4YA 5FVJA 3IU1A 4ONUA 4CAXA 2YNDA 4JWPA 2P6GA 2OZGA 4NEXA 3R9EA 5G22A 2HUZA 1TIQA 3TCVA 2OZUA 4JJXA 4C2ZA 4A33A 1IYKA 2JDCA 5DWNA 2K5TA 4MY0A 4A2ZA 2FCKA 4J3GA 3P2HA 2DPTA 2B58A 4OLLA 3GYAA 1Y9WA 3S6FA 5J8CA 1Q2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WK4 A;  4UBR A;  5IV0 A;  1S7L A;  2PR1 A;  2OU2 A;  3FNC A;  4MJ8 A;  4KOS A;  3TOB A;  2OH1 A;  2Q04 A;  4MBU A;  3I9S A;  2PC1 A;  2A4N A;  3K9U A;  3G8W A;  4CAV A;  2GIV A;  2P0W A;  3FRM A;  4AB7 A;  2B3V A;  3CXP A;  3WR7 A;  3TO7 A;  1U6M A;  5EBV A;  2IL4 A;  3ZZI A;  1I12 A;  3RYO A;  2F5I A;  1YLE A;  4M3S A;  2Q4V A;  1KZF A;  3VWD A;  2BSW A;  3DR6 A;  4PK2 A;  3I3G A;  3KKW A;  4RS2 A;  4XPD B;  1Z4R A;  5KTC A;  3NE7 A;  1XE4 A;  2ZXV A;  1UFH A;  4XNH C;  5JQ4 A;  2BUE A;  1Y7R A;  3BJ7 A;  4JD6 A;  2REE A;  3BJ8 A;  1Z9U A;  4H6U A;  1KUX A;  1I21 A;  1S5K A;  2VEZ A;  3GY9 A;  4HNY B;  1CM0 A;  2PDO A;  5ISV A;  5HH1 A;  4FD4 A;  2HV2 A;  5F48 A;  1XEB A;  5KTD A;  1M1D A;  1ON0 A;  1RXT A;  2H5M A;  3DSB A;  4QBJ A;  3QB8 A;  3FYN A;  3EXN A;  2Q0Y A;  4QUS A;  3PZJ A;  2ATR A;  1YK3 A;  4LUA A;  2EVN A;  2OZH A;  2Q44 A;  4YGO A;  3P2F A;  2BL1 A;  1P4N A;  3D2M A;  3IWG A;  2R8V A;  3VWE A;  2ZW4 A;  3W6X A;  4HNX B;  2PQ8 A;  3D3S A;  3R9F A;  2J8R A;  3PGP A;  3R9G A;  5I0C A;  1M4I A;  4KLV A;  4CAW A;  4KOY A;  4NCZ A;  3F8K A;  3FBU A;  4XPD C;  3S6G A;  2EUI A;  2REF A;  2QEC A;  1IYL A;  1OZP A;  1KUV A;  1XF8 A;  3SXN A;  3PP9 A;  3GKR A;  4XNH B;  3MGD A;  1PUA A;  4AG7 A;  4XPK A;  1NSL A;  1QSR A;  2J8M A;  4ZBG A;  5CNP A;  2G0B A;  3T9Y A;  2JDD A;  1MJA A;  4II9 A;  3R96 A;  2VQY A;  3CXS A;  2B5G B;  2FL4 A;  2CY2 A;  4GS4 A;  2CNT A;  2GE3 A;  3JUW A;  4DNC A;  3ZJ0 A;  1S3Z A;  1VHS A;  2ZPA A;  1QSN A;  4KOR A;  3T90 A;  1Y9K A;  3CXQ A;  2RC4 A;  4Y49 C;  5HMN A;  5H86 A;  4HNW B;  1S7F A;  2ZW5 A;  4F0Y A;  4E0A A;  2QML A;  3LD2 A;  3FXT A;  4FD5 A;  3TO6 A;  4X5K A;  1YVK A;  4KOT A;  2PR8 A;  2ZW6 A;  4OAD A;  1CJW A;  2FS5 A;  1BOB A;  2DXQ A;  1XMT A;  4FD7 A;  4LX9 A;  3SHP A;  1B87 A;  1I1D A;  4UWJ A;  4E8O A;  3TOA A;  5E96 A;  2B3U A;  2WPW A;  3TO9 A;  3N7Z A;  2P6E A;  4JXQ A;  3EY5 A;  3D2P A;  4IUS A;  2B4D A;  1KUY A;  4MHD A;  2Z0Z A;  4E2A A;  4PV6 A;  3FB3 A;  2R1I A;  4KUA A;  4JXR A;  5J8F A;  4KOV A;  1MK4 A;  1M4D A;  4OAE A;  1QST A;  1Q2C A;  3W6S A;  2FXF A;  1RO5 A;  4PSW A;  4IF5 A;  5DWM A;  4B5P B;  4U9Z A;  4M85 A;  3EC4 A;  2X7B A;  3H4Q A;  4Y49 B;  5F47 A;  2KCW A;  4MY3 A;  1M44 A;  2VXK A;  1S7K A;  4CRZ B;  1YGH A;  2CNM A;  1P0H A;  5EC4 A;  4H6Z A;  2VZZ A;  3QAH A;  1R57 A;  3FIX A;  3G3S A;  2R7H A;  4R57 A;  3W91 A;  2Z11 A;  3C26 A;  1VKC A;  1MJB A;  4YFJ A;  4B5O A;  1YR0 A;  4K30 A;  4R87 A;  4H89 A;  2AE6 A;  2NMT A;  5F49 A;  1GHE A;  3SXO A;  3F0A A;  3R95 A;  2ZW7 A;  2JLM A;  1S7N A;  3EFA A;  4R3L A;  4NSQ A;  2G3A A;  1WWZ A;  4CS0 B;  4NF1 A;  4KVX A;  2B5G A;  3LOD A;  2BEI A;  2PSW A;  4MI4 A;  4FD6 A;  2Y0M A;  2D4P A;  4KOW A;  1K4J A;  2FE7 A;  5IX3 A;  2AJ6 A;  2OB0 A;  4KVO E;  3E0K A;  2Q7B A;  1Q2Y A;  3F5B A;  1Z4E A;  2B4B A;  2FIA A;  4PK3 A;  4XPL A;  1QSM A;  2FIW A;  5KTA A;  3S6K A;  2VI7 A;  4UA3 A;  5F46 A;  2G3T A;  1MJ9 A;  2R98 A;  4NXY A;  3JVN A;  1L0C A;  5GCN A;  4PSX A;  3D8P A;  5C88 A;  3EO4 A;  4R9M A;  2I79 A;  5H84 A;  4ORF A;  1IID A;  1PU9 A;  4F6A A;  1BO4 A;  2J8N A;  4QB9 A;  4KUB A;  2P6F A;  4I49 A;  3DNS A;  4BMH A;  2D4O A;  5IB0 A;  3TT2 A;  1QSO A;  3DDD A;  4EVY A;  3V8I A;  4KOU A;  4RI1 A;  4CRY B;  2ARH A;  1YRE A;  2B4D B;  4B5P A;  4AVB A;  4QVT A;  4HKF A;  2JEV A;  1M4G A;  1V0C A;  4JLY A;  4KLW A;  4KZT A;  4AVA A;  1J4J A;  1NMT A;  3S6H A;  3R1K A;  3UY5 A;  1N71 A;  2GAN A;  1B6B A;  2FT0 A;  1FY7 A;  1IB1 E;  4KVM E;  1LRZ A;  3IGR A;  4AVC A;  3BLN A;  1YX0 A;  2Z10 A;  2WPX A;  2C27 A;  2I00 A;  5JPH A;  4YRH A;  1NE9 A;  2HQY A;  4U5Y A;  2VBQ A;  4R3K A;  3TTH A;  5C82 A;  2CNS A;  2VZY A;  3TE4 A;  2QIR A;  3B8G A;  1YVO A;  4UWI A;  3TFY A;  1S60 A;  1SQH A;  2O28 A;  2FSR A;  4KOX A;  1IIC A;  3OWC A;  2PRB A;  4QC6 A;  4AG9 A;  3DR8 A;  4U9Y A;  1XIX A;  4L89 A;  4L8A A;  2Q4Y A;  5FVJ A;  4CAX A;  4ONU A;  4JWP A;  2P6G A;  2OZG A;  4NEX A;  3R9E A;  2HUZ A;  1TIQ A;  3TCV A;  2OZU A;  4JJX A;  1IYK A;  2JDC A;  5DWN A;  2K5T A;  4MY0 A;  2FCK A;  4J3G A;  3P2H A;  2B58 A;  4OLL A;  3GYA A;  1Y9W A;  3S6F A;  5J8C A;  1Q2D A; 
#chains in the Genus database with same CATH topology
 1WK4 A;  4B14 A;  4UBR A;  1DE4 C;  5IV0 A;  1PYT B;  3FX6 A;  4TNU A;  1S7L A;  1Z8L A;  2OU2 A;  2PR1 A;  3FNC A;  3SJX A;  4MJ8 A;  5AG5 A;  2ANP A;  4CYO A;  3PEI A;  2O4H A;  4KOS A;  3TOB A;  2OH1 A;  2Q04 A;  2NSM A;  4MBU A;  4P4F A;  2Z3O A;  3I9S A;  4CGP A;  1LAM A;  5IB9 A;  1LFW A;  2ZEF A;  2PC1 A;  2A4N A;  2AFS A;  3GB0 A;  3IJ3 A;  3K9U A;  2PJ3 A;  2ABZ A;  3G8W A;  4CAV A;  4KSI A;  2GIV A;  2P0W A;  3D68 A;  2OR4 A;  3IEH A;  3FRM A;  2CXA A;  3IU2 A;  3IWE A;  3FEE A;  4AB7 A;  2B3V A;  2YNC A;  3CXP A;  1Z8X A;  4IK2 A;  2BCO A;  3WR7 A;  3TO7 A;  1U6M A;  5J1Q A;  5EBV A;  2IL4 A;  3ZZI A;  1I12 A;  1JWQ A;  4OC3 A;  2F5I A;  1YLE A;  4M3S A;  3RYO A;  2Q4V A;  3PB4 X;  4LQ6 A;  1KZF A;  1F2O A;  2GLJ A;  3D67 A;  3PBB A;  4M6G A;  3SJF A;  3VWD A;  2BSW A;  3KZW A;  3DR6 A;  4FBE A;  5I4M A;  2JEW A;  4PK2 A;  3I3G A;  3KKW A;  4CAE A;  1YLO A;  3NA6 A;  4RS2 A;  4XPD B;  1Z4R A;  5KTC A;  2EBJ A;  2Z3N A;  4OC2 A;  3CZX A;  3NE7 A;  1XE4 A;  1HDQ A;  2ZXV A;  5JH9 A;  2F8H A;  2ZOG A;  1UFH A;  4HPS A;  4XNH C;  3NH5 A;  3KR4 A;  5JQ4 A;  2BUE A;  3B3T A;  8CPA A;  1Y7E A;  1Y7R A;  3FED A;  1LOK A;  3BJ7 A;  4JD6 A;  4IHM A;  1XRY A;  2REE A;  3BJ8 A;  3IIB A;  1FT7 A;  1Z9U A;  2BO9 A;  2ODF A;  2ZEE A;  1X12 A;  4H6U A;  1KUX A;  1Q7L A;  1LAP A;  4OC0 A;  1I21 A;  1S5K A;  4B6Z A;  2VEZ A;  3GY9 A;  4HNY B;  1CM0 A;  4ZY0 A;  2PDO A;  3D66 A;  4GXH A;  4CAF A;  5ISV A;  2F7V A;  4YU9 A;  5HH1 A;  4FD4 A;  2C6G A;  2HV2 A;  5G20 A;  3KL9 A;  5F48 A;  5LYF A;  4MHN A;  1XEB A;  5KTD A;  1M1D A;  1ON0 A;  1RXT A;  2H5M A;  3DSB A;  4QBJ A;  4DJL A;  3QB8 A;  3FYN A;  3EXN A;  4A39 A;  4KSA A;  2DF5 A;  3B3S A;  3HUV A;  2Q0Y A;  2QVP A;  4QUS A;  7CPA A;  3KQX A;  3PZJ A;  2ATR A;  4CGL A;  1YK3 A;  1XMB A;  4RUH A;  4LUA A;  2EVN A;  3JTK A;  2OZH A;  1F57 A;  5LRJ A;  2Q44 A;  4YGO A;  4F8Z A;  4CGM A;  3NH4 A;  3P2F A;  2BL1 A;  1P4N A;  2C6P A;  3D2M A;  3IWG A;  2C1C A;  2R8V A;  3VWE A;  2ZW4 A;  3W6X A;  2PIY A;  4HNX B;  4Z65 A;  2PQ8 A;  1TF8 A;  3D3S A;  3R9F A;  2J8R A;  3PGP A;  3KI9 A;  1H8L A;  1M4I A;  2IJZ A;  2XEJ A;  4MCR A;  3R9G A;  5I0C A;  4KLV A;  4CAW A;  4A95 A;  2YNE A;  4KOY A;  4NFR A;  4NCZ A;  3F8K A;  1BPM A;  4UCN A;  3FBU A;  5JGF A;  2PIZ A;  4MCS A;  2EUI A;  2REF A;  4XPD C;  3B3C A;  5AGE A;  2QEC A;  1IYL A;  3S6G A;  3VAT A;  4EWT A;  1OZP A;  2WYR A;  1KUV A;  1XF8 A;  3SXN A;  2CIJ A;  4ZY1 A;  3PP9 A;  3GKR A;  3T8W A;  4XNH B;  3MGD A;  1PUA A;  4AG7 A;  4XPK A;  2ZEM A;  1NSL A;  3NH8 A;  1Y0Y A;  4K3N A;  3S9N A;  4CGO A;  1QSR A;  4MRI A;  4C2Y A;  5A27 A;  2J8M A;  3PFO A;  1AYE A;  4ZBG A;  4P44 A;  5CNP A;  1FNO A;  3L2N A;  2G0B A;  3T9Y A;  2C6C A;  2JDD A;  1CG2 A;  3B3V A;  2PJ4 A;  1MJA A;  2RB7 A;  4II9 A;  3R96 A;  4MFP A;  2VQY A;  3CXS A;  2B5G B;  1GYT A;  2FL4 A;  2RFH A;  1Y0R A;  3QAY A;  2CY2 A;  4GS4 A;  4AXV A;  3D7D A;  2G9D A;  1IU8 A;  2CNT A;  2GE3 A;  3D7G A;  3JUW A;  3ZJ0 A;  4DNC A;  3V7Z A;  2Z3P A;  1S3Z A;  5AG6 A;  3B7I A;  3QNV A;  4OID A;  1BLL E;  4F0X A;  2PJ9 A;  1VHS A;  2PJB A;  2ZPA A;  1HDU A;  1QSN A;  3HLP A;  4KOR A;  3T90 A;  1Y9K A;  2PJ0 A;  1XBU A;  3CXQ A;  2RC4 A;  5HVF A;  4CYN A;  4FAI A;  2XEF A;  4A30 A;  4Y49 C;  2PJC A;  4UF4 A;  5H86 A;  4HNW B;  1S7F A;  3TX8 A;  4A37 A;  2ZW5 A;  4F0Y A;  4E0A A;  2QML A;  3CDX A;  3LD2 A;  4OKO A;  4IAV A;  4MHP A;  5JM6 A;  1HEE A;  2V8D A;  3FXT A;  4FD5 A;  3TO6 A;  4X5K A;  1VIX A;  1YVK A;  1TF9 A;  4KOT A;  2PR8 A;  4BBH A;  4UEZ A;  2ZW6 A;  4OAD A;  2ZOF A;  3BXM A;  4OC4 A;  1CJW A;  2FS5 A;  4DYO A;  4ZI6 A;  3FF3 A;  2PVW A;  1BOB A;  1IY7 A;  3D7F A;  2Z3K A;  6CPA A;  2YGW A;  3PB8 X;  2DXQ A;  2PJ7 A;  4X8I A;  4NGR A;  4ZY2 A;  1XMT A;  4P10 A;  2EWB A;  4FD7 A;  4LX9 A;  5F09 A;  3ISX A;  3SHP A;  1B87 A;  4Q38 A;  4AVC A;  4WWV A;  1I1D A;  4UFX A;  2DPS A;  4UWJ A;  2JBK A;  3DGV A;  3K2K A;  4RN7 A;  4E8O A;  3TOA A;  1OBR A;  1LCP A;  5E96 A;  2NYQ A;  4CYQ A;  2B3U A;  2WPW A;  3TO9 A;  3B2Y A;  3FVL A;  3N5F A;  4NGP A;  3N7Z A;  2P6E A;  1EE3 P;  3H8E A;  4JXQ A;  3EY5 A;  4ONW A;  1CP6 A;  5DS0 A;  3TC8 A;  3D2P A;  4LQG A;  3NFZ A;  5CPA A;  4JZ0 A;  4IUS A;  3RBU A;  2B4D A;  5AG7 A;  4MFZ A;  4UCP A;  5BWA B;  1R43 A;  1KUY A;  4MHD A;  2QYV A;  2Z0Z A;  4KSF A;  4B13 A;  5A28 A;  4E2A A;  2CTC A;  1DTD A;  3FB3 A;  4PV6 A;  4CGN A;  3SI1 A;  3FEC A;  4NGT A;  2R1I A;  1CPX A;  4P4E A;  4KUA A;  4JXR A;  5J8F A;  3LAC A;  4KOV A;  2Z3M A;  1MK4 A;  3IO1 A;  3SI0 A;  4P45 A;  1M4D A;  2EK8 A;  4NGQ A;  4OAE A;  1VHE A;  2PVV A;  1QST A;  1Q2C A;  3IFE A;  3WC6 A;  2EO8 A;  2PJ2 A;  2I3C A;  3GLJ A;  3W6S A;  2WUU A;  2FXF A;  1RO5 A;  4PSW A;  4IF5 A;  5LYD A;  5DWM A;  4CYP A;  2V77 A;  1YW4 A;  4B5P B;  3WT4 A;  4U9Z A;  4M85 A;  4B12 A;  2Q51 A;  3EC4 A;  2X7B A;  3H4Q A;  4PXD A;  1ARM A;  1ZLH A;  4Y49 B;  2Q4Z A;  5F47 A;  3WAB A;  2IMO A;  3WC7 A;  3GUX A;  2KCW A;  4ZX8 A;  4MY3 A;  2GLF A;  1IOI A;  1CPS A;  1M44 A;  1NSA A;  2VXK A;  1S7K A;  3JRU A;  3MRU A;  4M6H A;  1YGH A;  4OIW A;  4CRZ B;  2HB6 A;  2CNM A;  1P0H A;  2ZEG A;  5EC4 A;  4H6Z A;  2VZZ A;  3WC5 A;  3A9L A;  1R57 A;  3QAH A;  3FIX A;  3G3S A;  4CPA A;  3CPX A;  1VHO A;  2R7H A;  4R57 A;  5G21 A;  3KR5 A;  3W91 A;  4MFK A;  3BI0 A;  2Z11 A;  3H8G A;  2ZED A;  4UCM A;  5K8N A;  3C26 A;  4FWU A;  1VKC A;  1MJB A;  3RZA A;  4UFW A;  5ELY A;  5K8O A;  3KAS A;  3FMC A;  2ZEH A;  1BAV A;  4B5O A;  4YFJ A;  2DEA A;  1YR0 A;  4K30 A;  2AFZ A;  4R87 A;  4H89 A;  2AE6 A;  2NMT A;  4UFV A;  5F49 A;  4ZX9 A;  2QJ8 A;  3RAM A;  3PFE A;  1GHE A;  3SXO A;  2YNC C;  3F0A A;  3R95 A;  2V8G A;  3ISZ A;  2ZW7 A;  2VL1 A;  2JLM A;  4OC5 A;  1S7N A;  3EFA A;  2O53 A;  4R3L A;  1ZG8 A;  4NSQ A;  2G3A A;  1WWZ A;  4C2X A;  4CS0 B;  4EFD A;  3GIU A;  2XEG A;  4NF1 A;  5LYI A;  3SJE A;  1TXR A;  4KVX A;  4R6T A;  2PRQ A;  1YW6 A;  2B5G A;  3LMS A;  3LOD A;  2BEI A;  2PSW A;  4B11 A;  4MI4 A;  4FD6 A;  1JQG A;  2Y0M A;  2D4P A;  4P4D A;  4KOW A;  1K4J A;  2FE7 A;  5IX3 A;  1R3N A;  2Q7S A;  2AJ6 A;  4B10 A;  2AFO A;  3V38 A;  1QMU A;  2OB0 A;  2PJA A;  3PRT A;  4MFQ A;  1UWY A;  4KVO E;  3S9M A;  3VH9 A;  3KGQ A;  3E0K A;  4A94 A;  4TWE A;  3IWW A;  4MCQ A;  2AFX A;  2XEI A;  3FH4 A;  2Q7B A;  1Q2Y A;  4C68 A;  5HMN A;  3KHZ A;  4MFJ A;  2V8V A;  1F2P A;  3F5B A;  1Z4E A;  5HXD A;  2HC9 A;  2EK9 A;  2B4B A;  2FIA A;  4PK3 A;  2PJ6 A;  4NJQ A;  4XPL A;  1CX8 A;  3RNZ A;  1QSM A;  4OME A;  1Z5R A;  2FIW A;  5KTA A;  3S6K A;  2VI7 A;  4UA3 A;  4A31 A;  5LYL A;  1PCA A;  5F46 A;  4A32 A;  2G3T A;  4R8F A;  2J9A A;  1MJ9 A;  2R98 A;  2AFW A;  4NXY A;  5K8P A;  3JVN A;  1L0C A;  3K9T A;  4F9V A;  5GCN A;  4PSX A;  2GU2 A;  5D8N A;  1XJO A;  3PBE A;  5G1Z A;  3D8P A;  3H8F A;  3EO4 A;  1QQ9 A;  4G1P A;  2I79 A;  4R9M A;  1LAN A;  4UEE A;  5C88 A;  3KQZ A;  4A38 A;  3BHX A;  5H84 A;  1TKJ A;  4H2K A;  4R7M A;  3D7H A;  4BIN A;  2ZEL A;  4ORF A;  1IID A;  1M4L A;  2CTB A;  4UIA A;  3PB9 X;  1PU9 A;  4F6A A;  3IC1 A;  1BO4 A;  2J8N A;  1TKH A;  4M6I A;  4P4B A;  4QB9 A;  4KUB A;  2P6F A;  4I49 A;  5EMI A;  3DNS A;  2AFU A;  4BMH A;  4NGS A;  4X2T A;  3CT9 A;  2D4O A;  4W9Y A;  5IB0 A;  3DLJ A;  3TT2 A;  4OP4 A;  2CF4 A;  1IGB A;  2ZEP A;  3MN8 A;  4MFL A;  4EME A;  1QSO A;  4NJR A;  2GFQ A;  1X10 A;  4Q36 A;  5LRK A;  3DDD A;  2ZEO A;  4EVY A;  1BPN A;  3V8I A;  4KOU A;  4P6Y A;  4RI1 A;  4YWY A;  4CRY B;  2ARH A;  1YRE A;  2B4D B;  3D4U A;  4B5P A;  4AVB A;  3PB6 X;  1YSJ A;  4QVT A;  4HKF A;  4MHZ A;  2JEV A;  1M4G A;  4PQA A;  1V0C A;  4JLY A;  4KLW A;  1ZLI A;  4KZT A;  2PJ8 A;  4AVA A;  1Z2L A;  4MXU A;  1J4J A;  1NMT A;  2PJ5 A;  3R1K A;  4JYW A;  3S6H A;  3UY5 A;  3I1U A;  4DUK A;  5CBM A;  1N71 A;  4F9U A;  2WZN A;  2GAN A;  4PXC A;  1B6B A;  2FT0 A;  1FY7 A;  3SJG A;  3SI2 A;  4NGM A;  3LWU A;  1IB1 E;  1LRZ A;  4KVM E;  3B3W A;  3CPA A;  2PJ1 A;  3IGR A;  3BLN A;  1YX0 A;  2Z10 A;  2WPX A;  2C27 A;  1YME A;  4UIB A;  2OOT A;  2I00 A;  2GRE A;  5JPH A;  5K8M A;  4P4J A;  1IOF A;  1XOV A;  2FVG A;  4YRH A;  4C7I A;  1NE9 A;  2HQY A;  3H5Z A;  2Z3L A;  4OC1 A;  1YQE A;  4U5Y A;  2VBQ A;  4ZYQ A;  4R3K A;  4P4I A;  3TTH A;  5C82 A;  1A2Z A;  5HVH A;  1ZO0 A;  4C7H A;  3PB7 X;  4KS9 A;  2CNS A;  2VZY A;  5HVG A;  1AMP A;  3TE4 A;  2QIR A;  3B8G A;  1TKF A;  1YVO A;  4UWI A;  3TFY A;  3VAR A;  1S60 A;  1SQH A;  1ZG9 A;  4PXB A;  2O28 A;  3RO0 A;  1CP7 A;  2WSA A;  5AG4 A;  2FSR A;  1RTQ A;  4KOX A;  3B35 A;  4ZGY B;  1IIC A;  4X3R A;  1XFO A;  1VGY A;  2IQ6 A;  2JBJ A;  3OWC A;  4WJB A;  2PRB A;  4BD9 A;  4QC6 A;  4AG9 A;  4GM5 A;  4PXE A;  1KWM A;  4FUU A;  3DR8 A;  4U9Y A;  1XIX A;  2PCU A;  4L89 A;  2ZEN A;  4MHY A;  1ELM P;  4L8A A;  2Q4Y A;  5FVJ A;  3IU1 A;  4ONU A;  4PPZ A;  4CAX A;  2YND A;  4JWP A;  2PE3 A;  2P6G A;  2OZG A;  2Q43 A;  3NE8 A;  4NEX A;  3R9E A;  4Q7A A;  2POK A;  5G22 A;  2HUZ A;  1TIQ A;  2V8H A;  2AFM A;  3FJU A;  1ZG7 A;  3TCV A;  2OZU A;  4JJX A;  3KHX A;  4C2Z A;  1Z8W A;  4A33 A;  4R76 A;  1IYK A;  1ARL A;  1AUG A;  3BI1 A;  2JDC A;  4O23 A;  5LRG A;  5DWN A;  2K5T A;  4MY0 A;  4MCP A;  1Z8T A;  2FCK A;  4NGN A;  2BOA A;  4A2Z A;  3S9L A;  4J3G A;  5THW A;  3P2H A;  4MMO A;  2DPT A;  2B58 A;  4UEF A;  4OLL A;  1ELL P;  1CBX A;  3GYA A;  5D29 A;  1Y9W A;  3S6F A;  5J8C A;  1Q2D A; 
#chains in the Genus database with same CATH homology
 1WK4 A;  4B14 A;  4UBR A;  5IV0 A;  1S7L A;  2PR1 A;  2OU2 A;  3FNC A;  4MJ8 A;  5AG5 A;  4CYO A;  4KOS A;  3TOB A;  2OH1 A;  2Q04 A;  4MBU A;  2Z3O A;  3I9S A;  4CGP A;  2PC1 A;  2A4N A;  3K9U A;  3G8W A;  4CAV A;  2GIV A;  2P0W A;  3FRM A;  2CXA A;  3IU2 A;  3IWE A;  4AB7 A;  2B3V A;  2YNC A;  3CXP A;  3WR7 A;  3TO7 A;  1U6M A;  5EBV A;  2IL4 A;  3ZZI A;  1I12 A;  3RYO A;  2F5I A;  1YLE A;  4M3S A;  2Q4V A;  1KZF A;  3VWD A;  2BSW A;  3DR6 A;  4PK2 A;  3I3G A;  3KKW A;  4CAE A;  4RS2 A;  4XPD B;  1Z4R A;  5KTC A;  2Z3N A;  3NE7 A;  1XE4 A;  2ZXV A;  1UFH A;  4XNH C;  5JQ4 A;  2BUE A;  1Y7R A;  3BJ7 A;  4JD6 A;  2REE A;  3BJ8 A;  1Z9U A;  4H6U A;  1KUX A;  1I21 A;  1S5K A;  2VEZ A;  3GY9 A;  4HNY B;  1CM0 A;  2PDO A;  4CAF A;  5ISV A;  5HH1 A;  4FD4 A;  2HV2 A;  5G20 A;  5F48 A;  1XEB A;  5KTD A;  1M1D A;  1ON0 A;  1RXT A;  2H5M A;  3DSB A;  4QBJ A;  3QB8 A;  3FYN A;  3EXN A;  4KSA A;  2Q0Y A;  4QUS A;  3PZJ A;  2ATR A;  4CGL A;  1YK3 A;  4LUA A;  2EVN A;  3JTK A;  2OZH A;  2Q44 A;  4YGO A;  4CGM A;  3P2F A;  2BL1 A;  1P4N A;  3D2M A;  3IWG A;  2R8V A;  3VWE A;  2ZW4 A;  3W6X A;  4HNX B;  2PQ8 A;  3D3S A;  3R9F A;  2J8R A;  3PGP A;  3R9G A;  5I0C A;  1M4I A;  4KLV A;  4CAW A;  4A95 A;  2YNE A;  4KOY A;  4UCN A;  4NCZ A;  3F8K A;  3FBU A;  4XPD C;  3S6G A;  2EUI A;  2REF A;  5AGE A;  2QEC A;  1IYL A;  1OZP A;  1KUV A;  1XF8 A;  3SXN A;  3PP9 A;  3GKR A;  4XNH B;  3MGD A;  1PUA A;  4AG7 A;  4XPK A;  1NSL A;  4CGO A;  1QSR A;  5A27 A;  4C2Y A;  2J8M A;  4ZBG A;  5CNP A;  2G0B A;  3T9Y A;  2JDD A;  1MJA A;  4II9 A;  3R96 A;  4MFP A;  2VQY A;  3CXS A;  2B5G B;  2FL4 A;  2CY2 A;  4GS4 A;  2CNT A;  2GE3 A;  3JUW A;  4DNC A;  3ZJ0 A;  2Z3P A;  1S3Z A;  5AG6 A;  4F0X A;  1VHS A;  2ZPA A;  1QSN A;  4KOR A;  3T90 A;  1Y9K A;  3CXQ A;  2RC4 A;  4CYN A;  4A30 A;  4Y49 C;  5HMN A;  5H86 A;  4HNW B;  1S7F A;  2ZW5 A;  4F0Y A;  4E0A A;  2QML A;  3LD2 A;  3FXT A;  4FD5 A;  3TO6 A;  4X5K A;  4BBH A;  1YVK A;  4KOT A;  2PR8 A;  2ZW6 A;  4OAD A;  1CJW A;  2FS5 A;  1BOB A;  2Z3K A;  2YGW A;  2DXQ A;  1XMT A;  4FD7 A;  4LX9 A;  3SHP A;  1B87 A;  4Q38 A;  1I1D A;  4UFX A;  2DPS A;  4UWJ A;  4E8O A;  3TOA A;  5E96 A;  4CYQ A;  2B3U A;  2WPW A;  3TO9 A;  3N7Z A;  2P6E A;  4JXQ A;  3EY5 A;  3D2P A;  4IUS A;  2B4D A;  5AG7 A;  4MFZ A;  4UCP A;  5BWA B;  1KUY A;  4MHD A;  2Z0Z A;  4KSF A;  4B13 A;  5A28 A;  4E2A A;  4PV6 A;  3FB3 A;  4CGN A;  2R1I A;  4KUA A;  4JXR A;  5J8F A;  4KOV A;  2Z3M A;  1MK4 A;  1M4D A;  4OAE A;  1QST A;  1Q2C A;  3W6S A;  2WUU A;  2FXF A;  1RO5 A;  4PSW A;  4IF5 A;  5DWM A;  4CYP A;  4B5P B;  4U9Z A;  4M85 A;  4B12 A;  3EC4 A;  2X7B A;  3H4Q A;  4Y49 B;  5F47 A;  2KCW A;  4MY3 A;  1M44 A;  2VXK A;  1S7K A;  4CRZ B;  1YGH A;  2CNM A;  1P0H A;  5EC4 A;  4H6Z A;  2VZZ A;  3A9L A;  1R57 A;  3QAH A;  3FIX A;  3G3S A;  2R7H A;  4R57 A;  5G21 A;  3W91 A;  4MFK A;  2Z11 A;  4UCM A;  3C26 A;  1VKC A;  1MJB A;  4UFW A;  4YFJ A;  4B5O A;  1YR0 A;  4K30 A;  4R87 A;  4H89 A;  2AE6 A;  2NMT A;  4UFV A;  5F49 A;  1GHE A;  3SXO A;  2YNC C;  3F0A A;  3R95 A;  2ZW7 A;  2JLM A;  1S7N A;  3EFA A;  4R3L A;  4NSQ A;  2G3A A;  1WWZ A;  4C2X A;  4CS0 B;  4NF1 A;  4KVX A;  2B5G A;  3LOD A;  2BEI A;  2PSW A;  4B11 A;  4MI4 A;  4FD6 A;  2Y0M A;  2D4P A;  4KOW A;  1K4J A;  2FE7 A;  5IX3 A;  4B10 A;  2AJ6 A;  2OB0 A;  4MFQ A;  4KVO E;  3E0K A;  2Q7B A;  1Q2Y A;  4C68 A;  4MFJ A;  3F5B A;  1Z4E A;  2B4B A;  2FIA A;  4PK3 A;  4XPL A;  1QSM A;  2FIW A;  5KTA A;  3S6K A;  2VI7 A;  4UA3 A;  4A31 A;  5F46 A;  4A32 A;  2G3T A;  1MJ9 A;  2R98 A;  4NXY A;  3JVN A;  1L0C A;  5GCN A;  4PSX A;  5G1Z A;  3D8P A;  5C88 A;  3EO4 A;  4R9M A;  2I79 A;  5H84 A;  4ORF A;  1IID A;  1PU9 A;  4F6A A;  1BO4 A;  2J8N A;  4QB9 A;  4KUB A;  2P6F A;  4I49 A;  3DNS A;  4BMH A;  2D4O A;  5IB0 A;  3TT2 A;  4MFL A;  1QSO A;  4Q36 A;  3DDD A;  4EVY A;  3V8I A;  4KOU A;  4RI1 A;  4CRY B;  2ARH A;  1YRE A;  2B4D B;  4B5P A;  4AVB A;  4QVT A;  4HKF A;  2JEV A;  1M4G A;  1V0C A;  4JLY A;  4KLW A;  4KZT A;  4AVA A;  1J4J A;  1NMT A;  3S6H A;  3R1K A;  3UY5 A;  1N71 A;  2GAN A;  1B6B A;  2FT0 A;  1FY7 A;  1IB1 E;  1LRZ A;  4KVM E;  3IGR A;  4AVC A;  3BLN A;  1YX0 A;  2Z10 A;  2WPX A;  2C27 A;  2I00 A;  5JPH A;  4YRH A;  4C7I A;  1NE9 A;  2HQY A;  3H5Z A;  2Z3L A;  4U5Y A;  2VBQ A;  4R3K A;  3TTH A;  5C82 A;  1ZO0 A;  4C7H A;  4KS9 A;  2CNS A;  2VZY A;  3TE4 A;  2QIR A;  3B8G A;  1YVO A;  4UWI A;  3TFY A;  1S60 A;  1SQH A;  2O28 A;  2WSA A;  5AG4 A;  2FSR A;  4KOX A;  4ZGY B;  1IIC A;  3OWC A;  2PRB A;  4QC6 A;  4AG9 A;  3DR8 A;  4U9Y A;  1XIX A;  4L89 A;  4L8A A;  2Q4Y A;  5FVJ A;  3IU1 A;  4ONU A;  4CAX A;  2YND A;  4JWP A;  2P6G A;  2OZG A;  4NEX A;  3R9E A;  5G22 A;  2HUZ A;  1TIQ A;  3TCV A;  2OZU A;  4JJX A;  4C2Z A;  4A33 A;  1IYK A;  2JDC A;  5DWN A;  2K5T A;  4MY0 A;  4A2Z A;  2FCK A;  4J3G A;  3P2H A;  2DPT A;  2B58 A;  4OLL A;  3GYA A;  1Y9W A;  3S6F A;  5J8C A;  1Q2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...