2D4OA

Crystal structure of ttha1254 (i68m mutant) from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRMEGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHA1254 (I68M mutant) from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA1254
total genus 33
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09390 DUF1999 Protein of unknown function (DUF1999)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2d4oA00
3TE4A 3MGDA 2OU2A 4JWPA 1I12A 3I9SA 1YLEA 5C88A 1Y7RA 3TOBA 3ZZIA 4RI1A 4K30A 4H89A 2R1IA 5HH1A 1NSLA 4M85A 1IYLA 4MY3A 5F46A 4KOXA 4HNXB 3BLNA 3R96A 2VEZA 3VWEA 4UWIA 1OZPA 4JXQA 3TO6A 1K4JA 2X7BA 4H6UA 1P0HA 5F47A 4B5OA 4IF5A 3W6SA 5KTAA 3TTHA 4KLWA 2QECA 4AVBA 1B87A 2B58A 4JD6A 3D2PA 1QSOA 2DXQA 3IGRA 3N7ZA 4DNCA 2A4NA 5KTCA 4MHDA 4XPKA 2QMLA 4NF1A 4NEXA 1XE4A 4BMHA 4KOVA 1S60A 4NSQA 3F8KA 1L0CA 4NCZA 3BJ7A 3GY9A 1MK4A 1I21A 1PUAA 3QAHA 4QB9A 1IB1E 2B3UA 2EVNA 2Q4YA 5C82A 2VZZA 2GANA 2B4BA 4FD4A 2R98A 2F5IA 2Q04A 4FD7A 3DR8A 4KOUA 4KOSA 3D8PA 1S7KA 2PC1A 2Q7BA 1XIXA 4PSWA 2FIAA 1MJ9A 4CRYB 4AG9A 3R1KA 2CY2A 4LUAA 1GHEA 3NE7A 3CXPA 2PQ8A 1IIDA 4FD5A 2ATRA 1KUVA 3R9GA 2R7HA 4KOWA 5IV0A 3EXNA 2C27A 3CXSA 3P2HA 3RYOA 1IICA 4EVYA 5F48A 3GKRA 3D2MA 3DR6A 2CNSA 4PSXA 3OWCA 2HUZA 3W91A 2CNTA 3WR7A 4U9ZA 4PV6A 4CAWA 4R57A 5FVJA 5J8FA 4R9MA 2B5GA 2RC4A 2ZW7A 5EBVA 4B5PA 3PP9A 2P6FA 4U9YA 3DDDA 4CS0B 2Z0ZA 3D3SA 4XPLA 3UY5A 2I79A 3EY5A 3BJ8A 4PK3A 1S5KA 4KOTA 3G3SA 3F5BA 3KKWA 2WPXA 4GS4A 2Z11A 2VQYA 5ISVA 4LX9A 3DNSA 3B8GA 3EC4A 1KUYA 1WK4A 4CAXA 4XPDB 3E0KA 1XF8A 4MY0A 3T9YA 2B3VA 2PR1A 1Q2YA 1BOBA 4R87A 2FIWA 4QUSA 2ZW4A 4B5PB 4E2AA 2B4DB 2P6GA 3FB3A 4E0AA 1YR0A 4ORFA 4M3SA 2Q44A 2QIRA 4XPDC 2VXKA 2J8RA 1M44A 2P6EA 4RS2A 1TIQA 2J8MA 5JQ4A 3S6HA 4MI4A 4HNYB 2FXFA 2HV2A 1B6BA 3SHPA 3S6GA 3FRMA 4MBUA 3QB8A 2P0WA 4L8AA 1QSTA 1Y9WA 4AG7A 1YVOA 3TCVA 2Q4VA 4YRHA 4I49A 1MJAA 1Z9UA 1Z4EA 2ZW5A 1V0CA 1VKCA 4HNWB 3SXNA 4Y49C 4KOYA 3K9UA 4QBJA 4OAEA 4KLVA 1BO4A 4CAVA 4KUAA 2CNMA 4HKFA 2PDOA 4UBRA 2D4PA 2Z10A 2BUEA 3C26A 1SQHA 4Y49B 2VZYA 2BSWA 3R95A 1M4DA 2KCWA 2K5TA 2H5MA 4OLLA 1FY7A 5GCNA 1YK3A 4U5YA 3JUWA 4OADA 1S7NA 4XNHB 3S6FA 4PK2A 3EFAA 5IB0A 2FS5A 4KVOE 4JJXA 4IUSA 2G3AA 4JLYA 3S6KA 4XNHC 5H84A 5IX3A 1ON0A 1S3ZA 2B5GB 2BEIA 1CJWA 3FXTA 1YX0A 4MJ8A 2OH1A 4AVAA 2PRBA 4QC6A 1NMTA 3PGPA 1Y9KA 2I00A 4J3GA 1IYKA 1I1DA 4KZTA 3LD2A 4AB7A 2G0BA 1YGHA 1S7LA 2REFA 2D4OA 2GIVA 3TOAA 3GYAA 1PU9A 3W6XA 5KTDA 1Q2DA 4KORA 3FNCA 3P2FA 4YFJA 5F49A 2ZW6A 3TFYA 3FBUA 4YGOA 3TT2A 4F0YA 1UFHA 2FCKA 3CXQA 4ONUA 2WPWA 4UA3A 4ZBGA 2G3TA 5CNPA 5DWMA 2BL1A 3VWDA 1Z4RA 4AVCA 2Q0YA 4NXYA 1QSNA 2PR8A 3IWGA 1J4JA 2HQYA 3G8WA 4JXRA 3H4QA 1LRZA 4H6ZA 4KUBA 2J8NA 2R8VA 3TO7A 2O28A 5HMNA 4CRZB 2JLMA 1QSMA 3R9FA 2JDCA 1RO5A 3FYNA 2NMTA 3SXOA 3R9EA 1RXTA 2GE3A 2OB0A 4X5KA 3F0AA 2OZHA 2JDDA 2VI7A 4R3LA 2B4DA 5H86A 5E96A 4FD6A 4KVME 2REEA 1P4NA 2OZGA 1KZFA 4E8OA 4II9A 1N71A 2FE7A 1YREA 4QVTA 4KVXA 2IL4A 5J8CA 1YVKA 3PZJA 1M1DA 2EUIA 4F6AA 2AJ6A 2OZUA 1CM0A 2FL4A 3ZJ0A 2ZXVA 1XEBA 2FSRA 3I3GA 4R3KA 2JEVA 1QSRA 3DSBA 2PSWA 4L89A 3LODA 3TO9A 3FIXA 1M4GA 1NE9A 1R57A 2AE6A 3T90A 1M4IA 1S7FA 1U6MA 1Q2CA 5EC4A 1VHSA 1XMTA 2Y0MA 3JVNA 5I0CA 5JPHA 2ARHA 2FT0A 1WWZA 4UWJA 2ZPAA 1MJBA 5DWNA 2VBQA 3EO4A 1KUXA 3V8IA
chains in the Genus database with same CATH superfamily
3TE4A 3MGDA 4R7MA 2OU2A 3RZAA 4JWPA 1I12A 3I9SA 1YLEA 3NH4A 3VARA 5C88A 4UIAA 1Y7RA 4P45A 2PRQA 4IK2A 3D7DA 3TOBA 3H8FA 3ZZIA 2AFOA 4UFVA 4RI1A 4K30A 4YWYA 4H89A 1TKFA 4TNUA 2R1IA 5HH1A 1HDQA 3PRTA 1NSLA 4M85A 5BWAB 4X3RA 1IYLA 2I3CA 4MY3A 5F46A 4KOXA 3IU1A 1Z8XA 4FUUA 2DPSA 3IO1A 3RAMA 3GIUA 3D68A 4HNXB 3A9LA 4WJBA 2NYQA 1F57A 3L2NA 3BLNA 3R96A 2VEZA 3VWEA 4UWIA 1OZPA 3QAYA 4JXQA 3TO6A 1YLOA 1K4JA 2X7BA 4MXUA 2PJ6A 4H6UA 2ZEFA 4KSIA 5G22A 4RUHA 3WABA 1P0HA 4DJLA 5F47A 4H2KA 1ZLIA 5HVFA 1AYEA 1LAMA 4B5OA 2WYRA 4IF5A 3W6SA 4ZX8A 5KTAA 3TTHA 2JBKA 4MCQA 4KLWA 2QECA 2ZELA 3KZWA 4AVBA 2ZEGA 1B87A 2B58A 2PJAA 3D2PA 3FH4A 4JD6A 4MFPA 1ZG8A 3RO0A 1TF8A 2ZEPA 1QSOA 2IQ6A 3N5FA 2DXQA 3IGRA 4ONWA 4Q36A 3N7ZA 2ZEMA 1ARMA 1CBXA 4DNCA 2A4NA 1Z8LA 4B10A 5KTCA 4MHDA 4XPKA 4P4EA 2QMLA 5D29A 3CDXA 4C2YA 4NF1A 3CPXA 4NEXA 1XE4A 2O53A 5HXDA 4P4DA 2C1CA 4BINA 4BMHA 3D66A 4FWUA 2PVWA 4KOVA 4PXCA 2Z3OA 4CGMA 4OKOA 1S60A 1OBRA 3KHXA 2EO8A 4NSQA 3F8KA 1L0CA 1H8LA 4NCZA 3BJ7A 3LACA 3D7GA 4EFDA 4A31A 1PCAA 4CYOA 3SJEA 4CYQA 3GY9A 3JRUA 4P10A 5AG5A 3ISZA 1MK4A 3K9TA 5AGEA 3KASA 4OC5A 4MHZA 1I21A 2YNDA 1PUAA 3QAHA 3NH8A 4QB9A 1IB1E 3JTKA 2WZNA 1QMUA 4X8IA 5DS0A 2B3UA 5LRKA 4ZY2A 3NFZA 2EVNA 2Q4YA 5C82A 5HVGA 2IJZA 2VZZA 1YMEA 2GANA 3WT4A 2B4BA 4MCRA 4JZ0A 3FX6A 5CPAA 4FD4A 2YNCA 2R98A 2RB7A 1JQGA 5F09A 2ZOFA 2F5IA 2XEGA 2Q04A 3FF3A 4FD7A 1RTQA 3DR8A 2AFXA 4KOSA 4KOUA 3D8PA 2PIYA 1S7KA 2ZENA 2PC1A 4MHYA 2Q7BA 1XIXA 4X2TA 3FECA 4A30A 2AFUA 3PEIA 4P44A 4CGNA 4MMOA 2POKA 3BI1A 1IU8A 2FIAA 1FT7A 4OC2A 1IOFA 4PSWA 1MJ9A 4CRYB 2AFSA 2ZEEA 4AG9A 2CTBA 1CX8A 2PJ9A 3R1KA 2CY2A 3B7IA 4LUAA 1GHEA 3NE7A 3CXPA 2PQ8A 1IIDA 4FD5A 2ATRA 1KUVA 3R9GA 3I1UA 4PXDA 3GUXA 2R7HA 4KOWA 5IV0A 4OP4A 2WSAA 3S9MA 2PJ0A 3EXNA 2C27A 4PPZA 3CXSA 3BXMA 1IY7A 2ZEOA 3P2HA 2C6CA 4R6TA 3RYOA 2AFZA 2V8GA 1IICA 4EVYA 5F48A 5G1ZA 4UCMA 3GKRA 3D2MA 2GLFA 2Z3NA 2DPTA 4B12A 1AUGA 2PJBA 2PVVA 3DR6A 3KQXA 5K8NA 5LRJA 3GLJA 2CNSA 4PSXA 3OWCA 1DTDA 2HUZA 3W91A 4ZI6A 2CNTA 3WR7A 4U9ZA 1CPSA 4PV6A 4KSFA 4P4IA 4NGRA 4CAWA 4R57A 5AG4A 4K3NA 2EK9A 5FVJA 4UEFA 5J8FA 4R9MA 2B5GA 2RC4A 2ZW7A 2VL1A 5EBVA 4B5PA 3PP9A 2P6FA 4P6YA 1A2ZA 2Q4ZA 3D4UA 4U9YA 2PJ3A 1YW4A 3DDDA 4CS0B 2PJCA 4UF4A 2HB6A 5K8OA 4OIDA 5HVHA 2Z0ZA 1TF9A 5LYLA 2GLJA 3IFEA 3D3SA 1YSJA 4LQGA 4XPLA 3UY5A 5IB9A 4Z65A 1F2PA 2I79A 4CGOA 2YNEA 4MFQA 1TXRA 3SJXA 1Y0YA 3WC5A 3H8EA 1HDUA 3EY5A 3BJ8A 1XMBA 4PK3A 3VATA 1S5KA 1EE3P 4KOTA 3G3SA 3S9LA 3F5BA 3IWWA 1BPNA 4MFLA 4CYPA 3KKWA 2WPXA 4P4FA 4GS4A 2Z11A 4A33A 3IEHA 3FMCA 3PBBA 2Z3KA 5AG6A 3SJFA 4B14A 2Z3MA 3WC7A 1CP6A 3NH5A 2VQYA 4FAIA 5ISVA 4LX9A 1AMPA 3DNSA 2BCOA 5JM6A 5D8NA 3B8GA 4Q38A 3EC4A 2JEWA 2Q43A 1IGBA 1KUYA 1WK4A 4CAXA 4R76A 2CF4A 4XPDB 3B2YA 3E0KA 5LYIA 1XF8A 3HUVA 4MY0A 3T9YA 2B3VA 4A95A 2PR1A 4IHMA 1Q2YA 2NSMA 1BOBA 2FIWA 4R87A 1BLLE 4QUSA 2ZW4A 1CG2A 1LCPA 4B5PB 4F0XA 4E2AA 2B4DB 2P6GA 3VH9A 3FB3A 4E0AA 1YR0A 4ORFA 4M3SA 4A38A 2Q44A 3NE8A 4M6GA 2QIRA 4XPDC 4C2ZA 2VXKA 1JWQA 2J8RA 1M44A 2P6EA 4CAFA 4RS2A 2OR4A 1TIQA 4O23A 4OIWA 2J8MA 4CAEA 5JQ4A 2ZOGA 4NGMA 1DE4C 3S6HA 4MI4A 4HNYB 2FXFA 2HV2A 2ZEHA 1B6BA 3SHPA 4NFRA 3FRMA 2Z3PA 4MBUA 3S6GA 4CGLA 3QB8A 5G20A 2P0WA 1CP7A 4L8AA 2HC9A 4MHPA 4UEEA 1QSTA 1YW6A 1Y9WA 4AG7A 1YVOA 3TCVA 2Q4VA 4YRHA 4I49A 5K8PA 1MJAA 4P4JA 2ODFA 1Z9UA 3KI9A 5AG7A 1Z4EA 2ZW5A 1VIXA 2J9AA 1V0CA 3CT9A 1VKCA 4HNWB 4W9YA 2PCUA 4KSAA 1Y0RA 3SXNA 7CPAA 4Y49C 3SI0A 1M4LA 4KOYA 2GREA 3K9UA 4QBJA 2BO9A 4OAEA 5JH9A 1TKHA 1LFWA 4BBHA 4UFWA 6CPAA 4KLVA 1BO4A 4CAVA 4KUAA 1FNOA 2CNMA 4HKFA 2Z3LA 2PDOA 4FBEA 4OC1A 1NSAA 4ZGYB 2G9DA 2D4PA 4UBRA 4DYOA 4EWTA 2Z10A 2BUEA 3IU2A 2YNCC 4NGPA 4PQAA 3C26A 1SQHA 3KGQA 2AFWA 2PJ2A 2VZYA 4WWVA 4Y49B 4CGPA 4F9UA 5LRGA 3B3WA 3CPAA 2BSWA 3R95A 1M4DA 3IWEA 1VGYA 2EK8A 2KCWA 2K5TA 4F9VA 4KS9A 4MCPA 3PBEA 3TC8A 2H5MA 3D7FA 4OLLA 4HPSA 5LYDA 1PYTB 3CZXA 2Q7SA 1FY7A 5GCNA 5A27A 1YK3A 2QJ8A 1ARLA 4RN7A 4U5YA 3D7HA 4F8ZA 4Q7AA 1HEEA 3JUWA 3PB6X 4OADA 1Q7LA 1TKJA 1S7NA 4XNHB 4MHNA 3S6FA 2Q51A 3IC1A 1KWMA 1IOIA 3D67A 3H5ZA 1Z5RA 3EFAA 4PK2A 2AFMA 5CBMA 5IB0A 3B3CA 3H8GA 5THWA 4ZYQA 2FS5A 3MRUA 4KVOE 2C6GA 4CYNA 4JJXA 4UCNA 4IUSA 2G3AA 4JLYA 4ZY0A 4B13A 3S6KA 4EMEA 4PXBA 4XNHC 5H84A 2XEFA 4TWEA 5IX3A 1ON0A 1S3ZA 2B5GB 2BEIA 1CJWA 1X12A 3FXTA 4M6IA 1YX0A 4UCPA 4GXHA 4MJ8A 2OH1A 3B35A 4AVAA 2PRBA 4UEZA 2PJ5A 4QC6A 4BD9A 5K8MA 1R43A 1XBUA 1XFOA 4MCSA 1VHOA 4OC0A 2C6PA 1NMTA 2PJ8A 3FJUA 3PGPA 1Y9KA 2I00A 3FVLA 4MRIA 3B3VA 4J3GA 3SI2A 2QYVA 1BAVA 2XEJA 1IYKA 3K2KA 1I1DA 1Z2LA 1XJOA 3B3SA 4KZTA 4MFZA 3LD2A 4AB7A 3PFEA 2G0BA 1YGHA 1S7LA 2REFA 2DF5A 2D4OA 2GIVA 3TOAA 2DEAA 3GYAA 1PU9A 3SI1A 3W6XA 5KTDA 1Q2DA 4KORA 3FNCA 3B3TA 3P2FA 4YFJA 5LYFA 1Z8WA 3V7ZA 5F49A 1ZO0A 2ZW6A 2V77A 3TFYA 3RBUA 3KHZA 2GFQA 4NGQA 3FBUA 4YGOA 4A39A 3TT2A 4F0YA 1UFHA 4B6ZA 5I4MA 1Z8TA 2FCKA 3CXQA 4ONUA 2WPWA 4UA3A 4UFXA 1YQEA 2G3TA 4ZBGA 1QQ9A 4NJQA 5CNPA 2PJ4A 5J1QA 2YGWA 5DWMA 4A2ZA 3DGVA 3FEDA 3ISXA 2BL1A 3T8WA 3VWDA 8CPAA 3DLJA 3KR4A 1Z4RA 4AVCA 2Q0YA 4GM5A 4NXYA 4ZX9A 2GU2A 4NGNA 2XEIA 4G1PA 4MFKA 1QSNA 2PR8A 3PB4X 3IWGA 1J4JA 1ELMP 3TX8A 4M6HA 4C7HA 2HQYA 3G8WA 4JXRA 3H4QA 1LRZA 2EWBA 4H6ZA 4KUBA 3NA6A 2WUUA 2J8NA 2R8VA 2CIJA 3TO7A 2O28A 5HMNA 4CRZB 2BOAA 2JLMA 1QSMA 3R9FA 2JDCA 1RO5A 3FYNA 2NMTA 4A37A 3SXOA 3IJ3A 4PXEA 5JGFA 3KQZA 2PIZA 3R9EA 1RXTA 2EBJA 2GE3A 3MN8A 4R8FA 4DUKA 4IAVA 4LQ6A 2OB0A 2PE3A 4X5KA 5ELYA 2V8HA 1ZLHA 3F0AA 1GYTA 3IIBA 4OC3A 2V8VA 2OZHA 3QNVA 3LWUA 2CXAA 2JDDA 2VI7A 4R3LA 4B11A 2B4DA 2F7VA 3PB8X 5H86A 5E96A 4FD6A 4KVME 2REEA 1P4NA 2F8HA 2OZGA 1KZFA 4E8OA 1X10A 2PJ1A 5EMIA 4II9A 2ANPA 1UWYA 1N71A 2FE7A 1ELLP 1YREA 2ABZA 4KVXA 4QVTA 3S9NA 1LAPA 1BPMA 2IL4A 1YVKA 3SJGA 1R3NA 2CTCA 2ZEDA 4NJRA 3PZJA 5J8CA 1CPXA 1M1DA 2EUIA 4CPAA 4A32A 3V38A 4F6AA 2AJ6A 3KR5A 2OZUA 1CM0A 2V8DA 4JYWA 4YU9A 2FL4A 1ZG7A 3ZJ0A 2JBJA 1ZG9A 2IMOA 2QVPA 2ZXVA 3RNZA 4UIBA 1LANA 1XEBA 2FSRA 3I3GA 4A94A 3GB0A 4R3KA 2RFHA 2JEVA 1QSRA 4ZY1A 1LOKA 3DSBA 2PSWA 4C68A 3PB7X 4OC4A 4L89A 3LODA 2PJ7A 3TO9A 1XOVA 3FIXA 3HLPA 1M4GA 1NE9A 1R57A 2AE6A 3T90A 1M4IA 4C2XA 1S7FA 1U6MA 1F2OA 1Q2CA 5EC4A 1XRYA 3KL9A 1VHSA 1XMTA 3PFOA 2Y0MA 4NGSA 3JVNA 1Y7EA 5I0CA 5JPHA 2ARHA 4P4BA 2FT0A 4AXVA 1WWZA 3WC6A 4UWJA 4C7IA 2ZPAA 1MJBA 1VHEA 3LMSA 3PB9X 2FVGA 3BHXA 3BI0A 2O4HA 2VBQA 5DWNA 4NGTA 3EO4A 4MFJA 5G21A 3FEEA 1KUXA 2OOTA 5A28A 3V8IA 4OMEA
chains in the Genus database with same CATH topology
3TE4A 3MGDA 2OU2A 4JWPA 1I12A 3I9SA 1YLEA 5C88A 1Y7RA 3TOBA 3ZZIA 4UFVA 4RI1A 4K30A 4H89A 2R1IA 5HH1A 1NSLA 4M85A 5BWAB 1IYLA 4MY3A 5F46A 4KOXA 3IU1A 2DPSA 4HNXB 3A9LA 3BLNA 3R96A 2VEZA 3VWEA 4UWIA 1OZPA 4JXQA 3TO6A 1K4JA 2X7BA 4H6UA 5G22A 1P0HA 5F47A 4B5OA 4IF5A 3W6SA 5KTAA 3TTHA 4KLWA 2QECA 4AVBA 1B87A 2B58A 4JD6A 3D2PA 4MFPA 1QSOA 2DXQA 3IGRA 4Q36A 3N7ZA 4DNCA 2A4NA 4B10A 5KTCA 4MHDA 4XPKA 2QMLA 4C2YA 4NF1A 4NEXA 1XE4A 4BMHA 4KOVA 2Z3OA 4CGMA 1S60A 4NSQA 3F8KA 1L0CA 4NCZA 3BJ7A 4A31A 4CYOA 4CYQA 3GY9A 5AG5A 1MK4A 5AGEA 1I21A 2YNDA 1PUAA 3QAHA 4QB9A 1IB1E 3JTKA 2B3UA 2EVNA 2Q4YA 5C82A 2VZZA 2GANA 2B4BA 4FD4A 2YNCA 2R98A 2F5IA 2Q04A 4FD7A 3DR8A 4KOUA 4KOSA 3D8PA 1S7KA 2PC1A 2Q7BA 1XIXA 4A30A 4CGNA 4PSWA 2FIAA 1MJ9A 4CRYB 4AG9A 3R1KA 2CY2A 4LUAA 1GHEA 3NE7A 3CXPA 2PQ8A 1IIDA 4FD5A 2ATRA 1KUVA 3R9GA 2R7HA 4KOWA 5IV0A 2WSAA 3EXNA 2C27A 3CXSA 3P2HA 3RYOA 1IICA 4EVYA 5F48A 5G1ZA 4UCMA 3GKRA 3D2MA 2Z3NA 4B12A 2DPTA 3DR6A 2CNSA 4PSXA 3OWCA 2HUZA 3W91A 2CNTA 3WR7A 4U9ZA 4PV6A 4KSFA 4CAWA 4R57A 5AG4A 5FVJA 5J8FA 4R9MA 2B5GA 2RC4A 2ZW7A 5EBVA 4B5PA 3PP9A 2P6FA 4U9YA 3DDDA 4CS0B 2Z0ZA 3D3SA 4XPLA 3UY5A 2I79A 4CGOA 2YNEA 4MFQA 3EY5A 3BJ8A 4PK3A 1S5KA 4KOTA 3G3SA 3F5BA 4MFLA 4CYPA 3KKWA 2WPXA 4A33A 4GS4A 2Z11A 4B14A 2Z3KA 5AG6A 2Z3MA 2VQYA 5ISVA 4LX9A 3DNSA 3B8GA 4Q38A 3EC4A 1KUYA 1WK4A 4CAXA 4XPDB 3E0KA 1XF8A 4MY0A 4A95A 3T9YA 2B3VA 2PR1A 1Q2YA 1BOBA 4R87A 2FIWA 4QUSA 2ZW4A 4B5PB 4F0XA 4E2AA 2B4DB 2P6GA 3FB3A 4E0AA 1YR0A 4ORFA 4M3SA 2Q44A 2QIRA 4XPDC 4C2ZA 2VXKA 2J8RA 1M44A 2P6EA 4CAFA 4RS2A 1TIQA 4CAEA 2J8MA 5JQ4A 3S6HA 4MI4A 4HNYB 2FXFA 2HV2A 1B6BA 3SHPA 3S6GA 3FRMA 2Z3PA 4MBUA 4CGLA 3QB8A 5G20A 2P0WA 4L8AA 1QSTA 1Y9WA 4AG7A 1YVOA 3TCVA 2Q4VA 4YRHA 4I49A 1MJAA 1Z9UA 5AG7A 1Z4EA 2ZW5A 1V0CA 1VKCA 4HNWB 4KSAA 3SXNA 4Y49C 4KOYA 3K9UA 4QBJA 4OAEA 4BBHA 4UFWA 4KLVA 1BO4A 4CAVA 4KUAA 2CNMA 4HKFA 2Z3LA 2PDOA 4ZGYB 4UBRA 2D4PA 2Z10A 2BUEA 3IU2A 2YNCC 3C26A 1SQHA 4Y49B 4CGPA 2VZYA 2BSWA 3R95A 1M4DA 3IWEA 2KCWA 2K5TA 4KS9A 2H5MA 4OLLA 1FY7A 5GCNA 5A27A 1YK3A 4U5YA 3JUWA 4OADA 1S7NA 4XNHB 3S6FA 3H5ZA 3EFAA 4PK2A 5IB0A 2FS5A 4CYNA 4KVOE 4JJXA 4UCNA 4IUSA 2G3AA 4JLYA 4B13A 3S6KA 4XNHC 5H84A 5IX3A 1ON0A 1S3ZA 2B5GB 2BEIA 1CJWA 3FXTA 1YX0A 4UCPA 4MJ8A 2OH1A 4AVAA 2PRBA 4QC6A 1NMTA 3PGPA 1Y9KA 2I00A 4J3GA 1IYKA 1I1DA 4KZTA 4MFZA 3LD2A 4AB7A 2G0BA 1YGHA 1S7LA 2REFA 2D4OA 2GIVA 3TOAA 3GYAA 1PU9A 3W6XA 5KTDA 1Q2DA 4KORA 3FNCA 3P2FA 4YFJA 5F49A 1ZO0A 2ZW6A 3TFYA 3FBUA 4YGOA 3TT2A 4F0YA 1UFHA 2FCKA 3CXQA 4ONUA 2WPWA 4UA3A 4UFXA 4ZBGA 2G3TA 5CNPA 2YGWA 5DWMA 4A2ZA 2BL1A 3VWDA 1Z4RA 4AVCA 2Q0YA 4NXYA 4MFKA 1QSNA 2PR8A 3IWGA 1J4JA 4C7HA 2HQYA 3G8WA 4JXRA 3H4QA 1LRZA 4H6ZA 4KUBA 2WUUA 2J8NA 2R8VA 3TO7A 2O28A 5HMNA 4CRZB 2JLMA 1QSMA 3R9FA 2JDCA 1RO5A 3FYNA 2NMTA 3SXOA 3R9EA 1RXTA 2GE3A 2OB0A 4X5KA 3F0AA 2OZHA 2CXAA 2JDDA 2VI7A 4R3LA 4B11A 2B4DA 5H86A 5E96A 4FD6A 4KVME 2REEA 1P4NA 2OZGA 1KZFA 4E8OA 4II9A 1N71A 2FE7A 1YREA 4QVTA 4KVXA 2IL4A 5J8CA 1YVKA 3PZJA 1M1DA 2EUIA 4A32A 4F6AA 2AJ6A 2OZUA 1CM0A 2FL4A 3ZJ0A 2ZXVA 1XEBA 2FSRA 3I3GA 4R3KA 2JEVA 1QSRA 3DSBA 4C68A 2PSWA 4L89A 3LODA 3TO9A 3FIXA 1M4GA 1NE9A 1R57A 2AE6A 3T90A 1M4IA 4C2XA 1S7FA 1U6MA 1Q2CA 5EC4A 1VHSA 1XMTA 2Y0MA 3JVNA 5I0CA 5JPHA 2ARHA 2FT0A 1WWZA 4UWJA 4C7IA 2ZPAA 1MJBA 5DWNA 2VBQA 3EO4A 4MFJA 5G21A 1KUXA 5A28A 3V8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TE4 A;  3MGD A;  2OU2 A;  4JWP A;  1I12 A;  3I9S A;  1YLE A;  5C88 A;  1Y7R A;  3TOB A;  3ZZI A;  4RI1 A;  4K30 A;  4H89 A;  2R1I A;  5HH1 A;  1NSL A;  4M85 A;  1IYL A;  4MY3 A;  5F46 A;  4KOX A;  4HNX B;  3BLN A;  3R96 A;  2VEZ A;  3VWE A;  4UWI A;  1OZP A;  4JXQ A;  3TO6 A;  1K4J A;  2X7B A;  4H6U A;  1P0H A;  5F47 A;  4B5O A;  4IF5 A;  3W6S A;  5KTA A;  3TTH A;  4KLW A;  2QEC A;  4AVB A;  1B87 A;  2B58 A;  4JD6 A;  3D2P A;  1QSO A;  2DXQ A;  3IGR A;  3N7Z A;  4DNC A;  2A4N A;  5KTC A;  4MHD A;  4XPK A;  2QML A;  4NF1 A;  4NEX A;  1XE4 A;  4BMH A;  4KOV A;  1S60 A;  4NSQ A;  3F8K A;  1L0C A;  4NCZ A;  3BJ7 A;  3GY9 A;  1MK4 A;  1I21 A;  1PUA A;  3QAH A;  4QB9 A;  1IB1 E;  2B3U A;  2EVN A;  2Q4Y A;  5C82 A;  2VZZ A;  2GAN A;  2B4B A;  4FD4 A;  2R98 A;  2F5I A;  2Q04 A;  4FD7 A;  3DR8 A;  4KOU A;  4KOS A;  3D8P A;  1S7K A;  2PC1 A;  2Q7B A;  1XIX A;  4PSW A;  2FIA A;  1MJ9 A;  4CRY B;  4AG9 A;  3R1K A;  2CY2 A;  4LUA A;  1GHE A;  3NE7 A;  3CXP A;  2PQ8 A;  1IID A;  4FD5 A;  2ATR A;  1KUV A;  3R9G A;  2R7H A;  4KOW A;  5IV0 A;  3EXN A;  2C27 A;  3CXS A;  3P2H A;  3RYO A;  1IIC A;  4EVY A;  5F48 A;  3GKR A;  3D2M A;  3DR6 A;  2CNS A;  4PSX A;  3OWC A;  2HUZ A;  3W91 A;  2CNT A;  3WR7 A;  4U9Z A;  4PV6 A;  4CAW A;  4R57 A;  5FVJ A;  5J8F A;  4R9M A;  2B5G A;  2RC4 A;  2ZW7 A;  5EBV A;  4B5P A;  3PP9 A;  2P6F A;  4U9Y A;  3DDD A;  4CS0 B;  2Z0Z A;  3D3S A;  4XPL A;  3UY5 A;  2I79 A;  3EY5 A;  3BJ8 A;  4PK3 A;  1S5K A;  4KOT A;  3G3S A;  3F5B A;  3KKW A;  2WPX A;  4GS4 A;  2Z11 A;  2VQY A;  5ISV A;  4LX9 A;  3DNS A;  3B8G A;  3EC4 A;  1KUY A;  1WK4 A;  4CAX A;  4XPD B;  3E0K A;  1XF8 A;  4MY0 A;  3T9Y A;  2B3V A;  2PR1 A;  1Q2Y A;  1BOB A;  4R87 A;  2FIW A;  4QUS A;  2ZW4 A;  4B5P B;  4E2A A;  2B4D B;  2P6G A;  3FB3 A;  4E0A A;  1YR0 A;  4ORF A;  4M3S A;  2Q44 A;  2QIR A;  4XPD C;  2VXK A;  2J8R A;  1M44 A;  2P6E A;  4RS2 A;  1TIQ A;  2J8M A;  5JQ4 A;  3S6H A;  4MI4 A;  4HNY B;  2FXF A;  2HV2 A;  1B6B A;  3SHP A;  3S6G A;  3FRM A;  4MBU A;  3QB8 A;  2P0W A;  4L8A A;  1QST A;  1Y9W A;  4AG7 A;  1YVO A;  3TCV A;  2Q4V A;  4YRH A;  4I49 A;  1MJA A;  1Z9U A;  1Z4E A;  2ZW5 A;  1V0C A;  1VKC A;  4HNW B;  3SXN A;  4Y49 C;  4KOY A;  3K9U A;  4QBJ A;  4OAE A;  4KLV A;  1BO4 A;  4CAV A;  4KUA A;  2CNM A;  4HKF A;  2PDO A;  4UBR A;  2D4P A;  2Z10 A;  2BUE A;  3C26 A;  1SQH A;  4Y49 B;  2VZY A;  2BSW A;  3R95 A;  1M4D A;  2KCW A;  2K5T A;  2H5M A;  4OLL A;  1FY7 A;  5GCN A;  1YK3 A;  4U5Y A;  3JUW A;  4OAD A;  1S7N A;  4XNH B;  3S6F A;  4PK2 A;  3EFA A;  5IB0 A;  2FS5 A;  4KVO E;  4JJX A;  4IUS A;  2G3A A;  4JLY A;  3S6K A;  4XNH C;  5H84 A;  5IX3 A;  1ON0 A;  1S3Z A;  2B5G B;  2BEI A;  1CJW A;  3FXT A;  1YX0 A;  4MJ8 A;  2OH1 A;  4AVA A;  2PRB A;  4QC6 A;  1NMT A;  3PGP A;  1Y9K A;  2I00 A;  4J3G A;  1IYK A;  1I1D A;  4KZT A;  3LD2 A;  4AB7 A;  2G0B A;  1YGH A;  1S7L A;  2REF A;  2D4O A;  2GIV A;  3TOA A;  3GYA A;  1PU9 A;  3W6X A;  5KTD A;  1Q2D A;  4KOR A;  3FNC A;  3P2F A;  4YFJ A;  5F49 A;  2ZW6 A;  3TFY A;  3FBU A;  4YGO A;  3TT2 A;  4F0Y A;  1UFH A;  2FCK A;  3CXQ A;  4ONU A;  2WPW A;  4UA3 A;  4ZBG A;  2G3T A;  5CNP A;  5DWM A;  2BL1 A;  3VWD A;  1Z4R A;  4AVC A;  2Q0Y A;  4NXY A;  1QSN A;  2PR8 A;  3IWG A;  1J4J A;  2HQY A;  3G8W A;  4JXR A;  3H4Q A;  1LRZ A;  4H6Z A;  4KUB A;  2J8N A;  2R8V A;  3TO7 A;  2O28 A;  5HMN A;  4CRZ B;  2JLM A;  1QSM A;  3R9F A;  2JDC A;  1RO5 A;  3FYN A;  2NMT A;  3SXO A;  3R9E A;  1RXT A;  2GE3 A;  2OB0 A;  4X5K A;  3F0A A;  2OZH A;  2JDD A;  2VI7 A;  4R3L A;  2B4D A;  5H86 A;  5E96 A;  4FD6 A;  4KVM E;  2REE A;  1P4N A;  2OZG A;  1KZF A;  4E8O A;  4II9 A;  1N71 A;  2FE7 A;  1YRE A;  4QVT A;  4KVX A;  2IL4 A;  5J8C A;  1YVK A;  3PZJ A;  1M1D A;  2EUI A;  4F6A A;  2AJ6 A;  2OZU A;  1CM0 A;  2FL4 A;  3ZJ0 A;  2ZXV A;  1XEB A;  2FSR A;  3I3G A;  4R3K A;  2JEV A;  1QSR A;  3DSB A;  2PSW A;  4L89 A;  3LOD A;  3TO9 A;  3FIX A;  1M4G A;  1NE9 A;  1R57 A;  2AE6 A;  3T90 A;  1M4I A;  1S7F A;  1U6M A;  1Q2C A;  5EC4 A;  1VHS A;  1XMT A;  2Y0M A;  3JVN A;  5I0C A;  5JPH A;  2ARH A;  2FT0 A;  1WWZ A;  4UWJ A;  2ZPA A;  1MJB A;  5DWN A;  2VBQ A;  3EO4 A;  1KUX A;  3V8I A; 
#chains in the Genus database with same CATH topology
 3TE4 A;  3MGD A;  4R7M A;  2OU2 A;  3RZA A;  4JWP A;  1I12 A;  3I9S A;  1YLE A;  3NH4 A;  3VAR A;  5C88 A;  4UIA A;  1Y7R A;  4P45 A;  2PRQ A;  4IK2 A;  3D7D A;  3TOB A;  3H8F A;  3ZZI A;  2AFO A;  4UFV A;  4RI1 A;  4K30 A;  4YWY A;  4H89 A;  1TKF A;  4TNU A;  2R1I A;  5HH1 A;  1HDQ A;  3PRT A;  1NSL A;  4M85 A;  5BWA B;  4X3R A;  1IYL A;  2I3C A;  4MY3 A;  5F46 A;  4KOX A;  3IU1 A;  1Z8X A;  4FUU A;  2DPS A;  3IO1 A;  3RAM A;  3GIU A;  3D68 A;  4HNX B;  3A9L A;  4WJB A;  2NYQ A;  1F57 A;  3L2N A;  3BLN A;  3R96 A;  2VEZ A;  3VWE A;  4UWI A;  1OZP A;  3QAY A;  4JXQ A;  3TO6 A;  1YLO A;  1K4J A;  2X7B A;  4MXU A;  2PJ6 A;  4H6U A;  2ZEF A;  4KSI A;  5G22 A;  4RUH A;  3WAB A;  1P0H A;  4DJL A;  5F47 A;  4H2K A;  1ZLI A;  5HVF A;  1AYE A;  1LAM A;  4B5O A;  2WYR A;  4IF5 A;  3W6S A;  4ZX8 A;  5KTA A;  3TTH A;  2JBK A;  4MCQ A;  4KLW A;  2QEC A;  2ZEL A;  3KZW A;  4AVB A;  2ZEG A;  1B87 A;  2B58 A;  2PJA A;  3D2P A;  3FH4 A;  4JD6 A;  4MFP A;  1ZG8 A;  3RO0 A;  1TF8 A;  2ZEP A;  1QSO A;  2IQ6 A;  3N5F A;  2DXQ A;  3IGR A;  4ONW A;  4Q36 A;  3N7Z A;  2ZEM A;  1ARM A;  1CBX A;  4DNC A;  2A4N A;  1Z8L A;  4B10 A;  5KTC A;  4MHD A;  4XPK A;  4P4E A;  2QML A;  5D29 A;  3CDX A;  4C2Y A;  4NF1 A;  3CPX A;  4NEX A;  1XE4 A;  2O53 A;  5HXD A;  4P4D A;  2C1C A;  4BIN A;  4BMH A;  3D66 A;  4FWU A;  2PVW A;  4KOV A;  4PXC A;  2Z3O A;  4CGM A;  4OKO A;  1S60 A;  1OBR A;  3KHX A;  2EO8 A;  4NSQ A;  3F8K A;  1L0C A;  1H8L A;  4NCZ A;  3BJ7 A;  3LAC A;  3D7G A;  4EFD A;  4A31 A;  1PCA A;  4CYO A;  3SJE A;  4CYQ A;  3GY9 A;  3JRU A;  4P10 A;  5AG5 A;  3ISZ A;  1MK4 A;  3K9T A;  5AGE A;  3KAS A;  4OC5 A;  4MHZ A;  1I21 A;  2YND A;  1PUA A;  3QAH A;  3NH8 A;  4QB9 A;  1IB1 E;  3JTK A;  2WZN A;  1QMU A;  4X8I A;  5DS0 A;  2B3U A;  5LRK A;  4ZY2 A;  3NFZ A;  2EVN A;  2Q4Y A;  5C82 A;  5HVG A;  2IJZ A;  2VZZ A;  1YME A;  2GAN A;  3WT4 A;  2B4B A;  4MCR A;  4JZ0 A;  3FX6 A;  5CPA A;  4FD4 A;  2YNC A;  2R98 A;  2RB7 A;  1JQG A;  5F09 A;  2ZOF A;  2F5I A;  2XEG A;  2Q04 A;  3FF3 A;  4FD7 A;  1RTQ A;  3DR8 A;  2AFX A;  4KOS A;  4KOU A;  3D8P A;  2PIY A;  1S7K A;  2ZEN A;  2PC1 A;  4MHY A;  2Q7B A;  1XIX A;  4X2T A;  3FEC A;  4A30 A;  2AFU A;  3PEI A;  4P44 A;  4CGN A;  4MMO A;  2POK A;  3BI1 A;  1IU8 A;  2FIA A;  1FT7 A;  4OC2 A;  1IOF A;  4PSW A;  1MJ9 A;  4CRY B;  2AFS A;  2ZEE A;  4AG9 A;  2CTB A;  1CX8 A;  2PJ9 A;  3R1K A;  2CY2 A;  3B7I A;  4LUA A;  1GHE A;  3NE7 A;  3CXP A;  2PQ8 A;  1IID A;  4FD5 A;  2ATR A;  1KUV A;  3R9G A;  3I1U A;  4PXD A;  3GUX A;  2R7H A;  4KOW A;  5IV0 A;  4OP4 A;  2WSA A;  3S9M A;  2PJ0 A;  3EXN A;  2C27 A;  4PPZ A;  3CXS A;  3BXM A;  1IY7 A;  2ZEO A;  3P2H A;  2C6C A;  4R6T A;  3RYO A;  2AFZ A;  2V8G A;  1IIC A;  4EVY A;  5F48 A;  5G1Z A;  4UCM A;  3GKR A;  3D2M A;  2GLF A;  2Z3N A;  2DPT A;  4B12 A;  1AUG A;  2PJB A;  2PVV A;  3DR6 A;  3KQX A;  5K8N A;  5LRJ A;  3GLJ A;  2CNS A;  4PSX A;  3OWC A;  1DTD A;  2HUZ A;  3W91 A;  4ZI6 A;  2CNT A;  3WR7 A;  4U9Z A;  1CPS A;  4PV6 A;  4KSF A;  4P4I A;  4NGR A;  4CAW A;  4R57 A;  5AG4 A;  4K3N A;  2EK9 A;  5FVJ A;  4UEF A;  5J8F A;  4R9M A;  2B5G A;  2RC4 A;  2ZW7 A;  2VL1 A;  5EBV A;  4B5P A;  3PP9 A;  2P6F A;  4P6Y A;  1A2Z A;  2Q4Z A;  3D4U A;  4U9Y A;  2PJ3 A;  1YW4 A;  3DDD A;  4CS0 B;  2PJC A;  4UF4 A;  2HB6 A;  5K8O A;  4OID A;  5HVH A;  2Z0Z A;  1TF9 A;  5LYL A;  2GLJ A;  3IFE A;  3D3S A;  1YSJ A;  4LQG A;  4XPL A;  3UY5 A;  5IB9 A;  4Z65 A;  1F2P A;  2I79 A;  4CGO A;  2YNE A;  4MFQ A;  1TXR A;  3SJX A;  1Y0Y A;  3WC5 A;  3H8E A;  1HDU A;  3EY5 A;  3BJ8 A;  1XMB A;  4PK3 A;  3VAT A;  1S5K A;  1EE3 P;  4KOT A;  3G3S A;  3S9L A;  3F5B A;  3IWW A;  1BPN A;  4MFL A;  4CYP A;  3KKW A;  2WPX A;  4P4F A;  4GS4 A;  2Z11 A;  4A33 A;  3IEH A;  3FMC A;  3PBB A;  2Z3K A;  5AG6 A;  3SJF A;  4B14 A;  2Z3M A;  3WC7 A;  1CP6 A;  3NH5 A;  2VQY A;  4FAI A;  5ISV A;  4LX9 A;  1AMP A;  3DNS A;  2BCO A;  5JM6 A;  5D8N A;  3B8G A;  4Q38 A;  3EC4 A;  2JEW A;  2Q43 A;  1IGB A;  1KUY A;  1WK4 A;  4CAX A;  4R76 A;  2CF4 A;  4XPD B;  3B2Y A;  3E0K A;  5LYI A;  1XF8 A;  3HUV A;  4MY0 A;  3T9Y A;  2B3V A;  4A95 A;  2PR1 A;  4IHM A;  1Q2Y A;  2NSM A;  1BOB A;  2FIW A;  4R87 A;  1BLL E;  4QUS A;  2ZW4 A;  1CG2 A;  1LCP A;  4B5P B;  4F0X A;  4E2A A;  2B4D B;  2P6G A;  3VH9 A;  3FB3 A;  4E0A A;  1YR0 A;  4ORF A;  4M3S A;  4A38 A;  2Q44 A;  3NE8 A;  4M6G A;  2QIR A;  4XPD C;  4C2Z A;  2VXK A;  1JWQ A;  2J8R A;  1M44 A;  2P6E A;  4CAF A;  4RS2 A;  2OR4 A;  1TIQ A;  4O23 A;  4OIW A;  2J8M A;  4CAE A;  5JQ4 A;  2ZOG A;  4NGM A;  1DE4 C;  3S6H A;  4MI4 A;  4HNY B;  2FXF A;  2HV2 A;  2ZEH A;  1B6B A;  3SHP A;  4NFR A;  3FRM A;  2Z3P A;  4MBU A;  3S6G A;  4CGL A;  3QB8 A;  5G20 A;  2P0W A;  1CP7 A;  4L8A A;  2HC9 A;  4MHP A;  4UEE A;  1QST A;  1YW6 A;  1Y9W A;  4AG7 A;  1YVO A;  3TCV A;  2Q4V A;  4YRH A;  4I49 A;  5K8P A;  1MJA A;  4P4J A;  2ODF A;  1Z9U A;  3KI9 A;  5AG7 A;  1Z4E A;  2ZW5 A;  1VIX A;  2J9A A;  1V0C A;  3CT9 A;  1VKC A;  4HNW B;  4W9Y A;  2PCU A;  4KSA A;  1Y0R A;  3SXN A;  7CPA A;  4Y49 C;  3SI0 A;  1M4L A;  4KOY A;  2GRE A;  3K9U A;  4QBJ A;  2BO9 A;  4OAE A;  5JH9 A;  1TKH A;  1LFW A;  4BBH A;  4UFW A;  6CPA A;  4KLV A;  1BO4 A;  4CAV A;  4KUA A;  1FNO A;  2CNM A;  4HKF A;  2Z3L A;  2PDO A;  4FBE A;  4OC1 A;  1NSA A;  4ZGY B;  2G9D A;  2D4P A;  4UBR A;  4DYO A;  4EWT A;  2Z10 A;  2BUE A;  3IU2 A;  2YNC C;  4NGP A;  4PQA A;  3C26 A;  1SQH A;  3KGQ A;  2AFW A;  2PJ2 A;  2VZY A;  4WWV A;  4Y49 B;  4CGP A;  4F9U A;  5LRG A;  3B3W A;  3CPA A;  2BSW A;  3R95 A;  1M4D A;  3IWE A;  1VGY A;  2EK8 A;  2KCW A;  2K5T A;  4F9V A;  4KS9 A;  4MCP A;  3PBE A;  3TC8 A;  2H5M A;  3D7F A;  4OLL A;  4HPS A;  5LYD A;  1PYT B;  3CZX A;  2Q7S A;  1FY7 A;  5GCN A;  5A27 A;  1YK3 A;  2QJ8 A;  1ARL A;  4RN7 A;  4U5Y A;  3D7H A;  4F8Z A;  4Q7A A;  1HEE A;  3JUW A;  3PB6 X;  4OAD A;  1Q7L A;  1TKJ A;  1S7N A;  4XNH B;  4MHN A;  3S6F A;  2Q51 A;  3IC1 A;  1KWM A;  1IOI A;  3D67 A;  3H5Z A;  1Z5R A;  3EFA A;  4PK2 A;  2AFM A;  5CBM A;  5IB0 A;  3B3C A;  3H8G A;  5THW A;  4ZYQ A;  2FS5 A;  3MRU A;  4KVO E;  2C6G A;  4CYN A;  4JJX A;  4UCN A;  4IUS A;  2G3A A;  4JLY A;  4ZY0 A;  4B13 A;  3S6K A;  4EME A;  4PXB A;  4XNH C;  5H84 A;  2XEF A;  4TWE A;  5IX3 A;  1ON0 A;  1S3Z A;  2B5G B;  2BEI A;  1CJW A;  1X12 A;  3FXT A;  4M6I A;  1YX0 A;  4UCP A;  4GXH A;  4MJ8 A;  2OH1 A;  3B35 A;  4AVA A;  2PRB A;  4UEZ A;  2PJ5 A;  4QC6 A;  4BD9 A;  5K8M A;  1R43 A;  1XBU A;  1XFO A;  4MCS A;  1VHO A;  4OC0 A;  2C6P A;  1NMT A;  2PJ8 A;  3FJU A;  3PGP A;  1Y9K A;  2I00 A;  3FVL A;  4MRI A;  3B3V A;  4J3G A;  3SI2 A;  2QYV A;  1BAV A;  2XEJ A;  1IYK A;  3K2K A;  1I1D A;  1Z2L A;  1XJO A;  3B3S A;  4KZT A;  4MFZ A;  3LD2 A;  4AB7 A;  3PFE A;  2G0B A;  1YGH A;  1S7L A;  2REF A;  2DF5 A;  2D4O A;  2GIV A;  3TOA A;  2DEA A;  3GYA A;  1PU9 A;  3SI1 A;  3W6X A;  5KTD A;  1Q2D A;  4KOR A;  3FNC A;  3B3T A;  3P2F A;  4YFJ A;  5LYF A;  1Z8W A;  3V7Z A;  5F49 A;  1ZO0 A;  2ZW6 A;  2V77 A;  3TFY A;  3RBU A;  3KHZ A;  2GFQ A;  4NGQ A;  3FBU A;  4YGO A;  4A39 A;  3TT2 A;  4F0Y A;  1UFH A;  4B6Z A;  5I4M A;  1Z8T A;  2FCK A;  3CXQ A;  4ONU A;  2WPW A;  4UA3 A;  4UFX A;  1YQE A;  2G3T A;  4ZBG A;  1QQ9 A;  4NJQ A;  5CNP A;  2PJ4 A;  5J1Q A;  2YGW A;  5DWM A;  4A2Z A;  3DGV A;  3FED A;  3ISX A;  2BL1 A;  3T8W A;  3VWD A;  8CPA A;  3DLJ A;  3KR4 A;  1Z4R A;  4AVC A;  2Q0Y A;  4GM5 A;  4NXY A;  4ZX9 A;  2GU2 A;  4NGN A;  2XEI A;  4G1P A;  4MFK A;  1QSN A;  2PR8 A;  3PB4 X;  3IWG A;  1J4J A;  1ELM P;  3TX8 A;  4M6H A;  4C7H A;  2HQY A;  3G8W A;  4JXR A;  3H4Q A;  1LRZ A;  2EWB A;  4H6Z A;  4KUB A;  3NA6 A;  2WUU A;  2J8N A;  2R8V A;  2CIJ A;  3TO7 A;  2O28 A;  5HMN A;  4CRZ B;  2BOA A;  2JLM A;  1QSM A;  3R9F A;  2JDC A;  1RO5 A;  3FYN A;  2NMT A;  4A37 A;  3SXO A;  3IJ3 A;  4PXE A;  5JGF A;  3KQZ A;  2PIZ A;  3R9E A;  1RXT A;  2EBJ A;  2GE3 A;  3MN8 A;  4R8F A;  4DUK A;  4IAV A;  4LQ6 A;  2OB0 A;  2PE3 A;  4X5K A;  5ELY A;  2V8H A;  1ZLH A;  3F0A A;  1GYT A;  3IIB A;  4OC3 A;  2V8V A;  2OZH A;  3QNV A;  3LWU A;  2CXA A;  2JDD A;  2VI7 A;  4R3L A;  4B11 A;  2B4D A;  2F7V A;  3PB8 X;  5H86 A;  5E96 A;  4FD6 A;  4KVM E;  2REE A;  1P4N A;  2F8H A;  2OZG A;  1KZF A;  4E8O A;  1X10 A;  2PJ1 A;  5EMI A;  4II9 A;  2ANP A;  1UWY A;  1N71 A;  2FE7 A;  1ELL P;  1YRE A;  2ABZ A;  4KVX A;  4QVT A;  3S9N A;  1LAP A;  1BPM A;  2IL4 A;  1YVK A;  3SJG A;  1R3N A;  2CTC A;  2ZED A;  4NJR A;  3PZJ A;  5J8C A;  1CPX A;  1M1D A;  2EUI A;  4CPA A;  4A32 A;  3V38 A;  4F6A A;  2AJ6 A;  3KR5 A;  2OZU A;  1CM0 A;  2V8D A;  4JYW A;  4YU9 A;  2FL4 A;  1ZG7 A;  3ZJ0 A;  2JBJ A;  1ZG9 A;  2IMO A;  2QVP A;  2ZXV A;  3RNZ A;  4UIB A;  1LAN A;  1XEB A;  2FSR A;  3I3G A;  4A94 A;  3GB0 A;  4R3K A;  2RFH A;  2JEV A;  1QSR A;  4ZY1 A;  1LOK A;  3DSB A;  2PSW A;  4C68 A;  3PB7 X;  4OC4 A;  4L89 A;  3LOD A;  2PJ7 A;  3TO9 A;  1XOV A;  3FIX A;  3HLP A;  1M4G A;  1NE9 A;  1R57 A;  2AE6 A;  3T90 A;  1M4I A;  4C2X A;  1S7F A;  1U6M A;  1F2O A;  1Q2C A;  5EC4 A;  1XRY A;  3KL9 A;  1VHS A;  1XMT A;  3PFO A;  2Y0M A;  4NGS A;  3JVN A;  1Y7E A;  5I0C A;  5JPH A;  2ARH A;  4P4B A;  2FT0 A;  4AXV A;  1WWZ A;  3WC6 A;  4UWJ A;  4C7I A;  2ZPA A;  1MJB A;  1VHE A;  3LMS A;  3PB9 X;  2FVG A;  3BHX A;  3BI0 A;  2O4H A;  2VBQ A;  5DWN A;  4NGT A;  3EO4 A;  4MFJ A;  5G21 A;  3FEE A;  1KUX A;  2OOT A;  5A28 A;  3V8I A;  4OME A; 
#chains in the Genus database with same CATH homology
 3TE4 A;  3MGD A;  2OU2 A;  4JWP A;  1I12 A;  3I9S A;  1YLE A;  5C88 A;  1Y7R A;  3TOB A;  3ZZI A;  4UFV A;  4RI1 A;  4K30 A;  4H89 A;  2R1I A;  5HH1 A;  1NSL A;  4M85 A;  5BWA B;  1IYL A;  4MY3 A;  5F46 A;  4KOX A;  3IU1 A;  2DPS A;  4HNX B;  3A9L A;  3BLN A;  3R96 A;  2VEZ A;  3VWE A;  4UWI A;  1OZP A;  4JXQ A;  3TO6 A;  1K4J A;  2X7B A;  4H6U A;  5G22 A;  1P0H A;  5F47 A;  4B5O A;  4IF5 A;  3W6S A;  5KTA A;  3TTH A;  4KLW A;  2QEC A;  4AVB A;  1B87 A;  2B58 A;  4JD6 A;  3D2P A;  4MFP A;  1QSO A;  2DXQ A;  3IGR A;  4Q36 A;  3N7Z A;  4DNC A;  2A4N A;  4B10 A;  5KTC A;  4MHD A;  4XPK A;  2QML A;  4C2Y A;  4NF1 A;  4NEX A;  1XE4 A;  4BMH A;  4KOV A;  2Z3O A;  4CGM A;  1S60 A;  4NSQ A;  3F8K A;  1L0C A;  4NCZ A;  3BJ7 A;  4A31 A;  4CYO A;  4CYQ A;  3GY9 A;  5AG5 A;  1MK4 A;  5AGE A;  1I21 A;  2YND A;  1PUA A;  3QAH A;  4QB9 A;  1IB1 E;  3JTK A;  2B3U A;  2EVN A;  2Q4Y A;  5C82 A;  2VZZ A;  2GAN A;  2B4B A;  4FD4 A;  2YNC A;  2R98 A;  2F5I A;  2Q04 A;  4FD7 A;  3DR8 A;  4KOU A;  4KOS A;  3D8P A;  1S7K A;  2PC1 A;  2Q7B A;  1XIX A;  4A30 A;  4CGN A;  4PSW A;  2FIA A;  1MJ9 A;  4CRY B;  4AG9 A;  3R1K A;  2CY2 A;  4LUA A;  1GHE A;  3NE7 A;  3CXP A;  2PQ8 A;  1IID A;  4FD5 A;  2ATR A;  1KUV A;  3R9G A;  2R7H A;  4KOW A;  5IV0 A;  2WSA A;  3EXN A;  2C27 A;  3CXS A;  3P2H A;  3RYO A;  1IIC A;  4EVY A;  5F48 A;  5G1Z A;  4UCM A;  3GKR A;  3D2M A;  2Z3N A;  4B12 A;  2DPT A;  3DR6 A;  2CNS A;  4PSX A;  3OWC A;  2HUZ A;  3W91 A;  2CNT A;  3WR7 A;  4U9Z A;  4PV6 A;  4KSF A;  4CAW A;  4R57 A;  5AG4 A;  5FVJ A;  5J8F A;  4R9M A;  2B5G A;  2RC4 A;  2ZW7 A;  5EBV A;  4B5P A;  3PP9 A;  2P6F A;  4U9Y A;  3DDD A;  4CS0 B;  2Z0Z A;  3D3S A;  4XPL A;  3UY5 A;  2I79 A;  4CGO A;  2YNE A;  4MFQ A;  3EY5 A;  3BJ8 A;  4PK3 A;  1S5K A;  4KOT A;  3G3S A;  3F5B A;  4MFL A;  4CYP A;  3KKW A;  2WPX A;  4A33 A;  4GS4 A;  2Z11 A;  4B14 A;  2Z3K A;  5AG6 A;  2Z3M A;  2VQY A;  5ISV A;  4LX9 A;  3DNS A;  3B8G A;  4Q38 A;  3EC4 A;  1KUY A;  1WK4 A;  4CAX A;  4XPD B;  3E0K A;  1XF8 A;  4MY0 A;  4A95 A;  3T9Y A;  2B3V A;  2PR1 A;  1Q2Y A;  1BOB A;  4R87 A;  2FIW A;  4QUS A;  2ZW4 A;  4B5P B;  4F0X A;  4E2A A;  2B4D B;  2P6G A;  3FB3 A;  4E0A A;  1YR0 A;  4ORF A;  4M3S A;  2Q44 A;  2QIR A;  4XPD C;  4C2Z A;  2VXK A;  2J8R A;  1M44 A;  2P6E A;  4CAF A;  4RS2 A;  1TIQ A;  4CAE A;  2J8M A;  5JQ4 A;  3S6H A;  4MI4 A;  4HNY B;  2FXF A;  2HV2 A;  1B6B A;  3SHP A;  3S6G A;  3FRM A;  2Z3P A;  4MBU A;  4CGL A;  3QB8 A;  5G20 A;  2P0W A;  4L8A A;  1QST A;  1Y9W A;  4AG7 A;  1YVO A;  3TCV A;  2Q4V A;  4YRH A;  4I49 A;  1MJA A;  1Z9U A;  5AG7 A;  1Z4E A;  2ZW5 A;  1V0C A;  1VKC A;  4HNW B;  4KSA A;  3SXN A;  4Y49 C;  4KOY A;  3K9U A;  4QBJ A;  4OAE A;  4BBH A;  4UFW A;  4KLV A;  1BO4 A;  4CAV A;  4KUA A;  2CNM A;  4HKF A;  2Z3L A;  2PDO A;  4ZGY B;  4UBR A;  2D4P A;  2Z10 A;  2BUE A;  3IU2 A;  2YNC C;  3C26 A;  1SQH A;  4Y49 B;  4CGP A;  2VZY A;  2BSW A;  3R95 A;  1M4D A;  3IWE A;  2KCW A;  2K5T A;  4KS9 A;  2H5M A;  4OLL A;  1FY7 A;  5GCN A;  5A27 A;  1YK3 A;  4U5Y A;  3JUW A;  4OAD A;  1S7N A;  4XNH B;  3S6F A;  3H5Z A;  3EFA A;  4PK2 A;  5IB0 A;  2FS5 A;  4CYN A;  4KVO E;  4JJX A;  4UCN A;  4IUS A;  2G3A A;  4JLY A;  4B13 A;  3S6K A;  4XNH C;  5H84 A;  5IX3 A;  1ON0 A;  1S3Z A;  2B5G B;  2BEI A;  1CJW A;  3FXT A;  1YX0 A;  4UCP A;  4MJ8 A;  2OH1 A;  4AVA A;  2PRB A;  4QC6 A;  1NMT A;  3PGP A;  1Y9K A;  2I00 A;  4J3G A;  1IYK A;  1I1D A;  4KZT A;  4MFZ A;  3LD2 A;  4AB7 A;  2G0B A;  1YGH A;  1S7L A;  2REF A;  2D4O A;  2GIV A;  3TOA A;  3GYA A;  1PU9 A;  3W6X A;  5KTD A;  1Q2D A;  4KOR A;  3FNC A;  3P2F A;  4YFJ A;  5F49 A;  1ZO0 A;  2ZW6 A;  3TFY A;  3FBU A;  4YGO A;  3TT2 A;  4F0Y A;  1UFH A;  2FCK A;  3CXQ A;  4ONU A;  2WPW A;  4UA3 A;  4UFX A;  4ZBG A;  2G3T A;  5CNP A;  2YGW A;  5DWM A;  4A2Z A;  2BL1 A;  3VWD A;  1Z4R A;  4AVC A;  2Q0Y A;  4NXY A;  4MFK A;  1QSN A;  2PR8 A;  3IWG A;  1J4J A;  4C7H A;  2HQY A;  3G8W A;  4JXR A;  3H4Q A;  1LRZ A;  4H6Z A;  4KUB A;  2WUU A;  2J8N A;  2R8V A;  3TO7 A;  2O28 A;  5HMN A;  4CRZ B;  2JLM A;  1QSM A;  3R9F A;  2JDC A;  1RO5 A;  3FYN A;  2NMT A;  3SXO A;  3R9E A;  1RXT A;  2GE3 A;  2OB0 A;  4X5K A;  3F0A A;  2OZH A;  2CXA A;  2JDD A;  2VI7 A;  4R3L A;  4B11 A;  2B4D A;  5H86 A;  5E96 A;  4FD6 A;  4KVM E;  2REE A;  1P4N A;  2OZG A;  1KZF A;  4E8O A;  4II9 A;  1N71 A;  2FE7 A;  1YRE A;  4QVT A;  4KVX A;  2IL4 A;  5J8C A;  1YVK A;  3PZJ A;  1M1D A;  2EUI A;  4A32 A;  4F6A A;  2AJ6 A;  2OZU A;  1CM0 A;  2FL4 A;  3ZJ0 A;  2ZXV A;  1XEB A;  2FSR A;  3I3G A;  4R3K A;  2JEV A;  1QSR A;  3DSB A;  4C68 A;  2PSW A;  4L89 A;  3LOD A;  3TO9 A;  3FIX A;  1M4G A;  1NE9 A;  1R57 A;  2AE6 A;  3T90 A;  1M4I A;  4C2X A;  1S7F A;  1U6M A;  1Q2C A;  5EC4 A;  1VHS A;  1XMT A;  2Y0M A;  3JVN A;  5I0C A;  5JPH A;  2ARH A;  2FT0 A;  1WWZ A;  4UWJ A;  4C7I A;  2ZPA A;  1MJB A;  5DWN A;  2VBQ A;  3EO4 A;  4MFJ A;  5G21 A;  1KUX A;  5A28 A;  3V8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...