2D4OA

Crystal structure of ttha1254 (i68m mutant) from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
b'MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRMEGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA1254
publication title Crystal structure of TTHA1254 (I68M mutant) from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 33
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09390 DUF1999 Protein of unknown function (DUF1999)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2d4oA00
2AJ6A 3JUWA 5DWNA 3EC4A 3GY9A 4KVXA 4R57A 2Q04A 4AVCA 1J4JA 3F8KA 2GIVA 3UY5A 3C26A 4MY3A 1YVKA 4KORA 4F0YA 3G8WA 3R9GA 1RXTA 1K4JA 2FXFA 1CM0A 3D3SA 4KOVA 1KUYA 1M4IA 1WK4A 4F6AA 3B8GA 2CNSA 4ONUA 4RS2A 2EUIA 3S6HA 2Z0ZA 3I3GA 1CJWA 4XPKA 2JDCA 1Y9KA 4KOXA 3FB3A 4UA3A 3W6XA 2PDOA 4PSWA 4U9ZA 4UBRA 5CNPA 4OAEA 1YR0A 4LUAA 4KZTA 3W6SA 5KTDA 3RYOA 2VBQA 1VKCA 1I12A 3EO4A 2HQYA 1QSNA 4OADA 3TO6A 4PV6A 2P0WA 1KUVA 4HKFA 4XNHC 3E0KA 2C27A 4B5OA 3LD2A 3QB8A 5C88A 2ARHA 2Y0MA 4FD5A 2OB0A 2R1IA 1QSMA 2WPWA 5EC4A 1Z4RA 5HMNA 2AE6A 2PSWA 4XPLA 1S7FA 4L8AA 1Q2YA 2IL4A 4MY0A 3D8PA 1QSTA 2CNMA 4U9YA 2A4NA 1P4NA 1YX0A 2Q0YA 1MJ9A 1Y7RA 4AVAA 2VI7A 2Q7BA 3R96A 2B3VA 1TIQA 2G3TA 4FD4A 4JLYA 1NMTA 3OWCA 2B5GA 2DXQA 5GCNA 2B5GB 3T90A 3WR7A 3TO9A 2FIAA 4FD6A 3DNSA 5J8FA 2X7BA 2RC4A 1SQHA 3R9FA 5C82A 2PQ8A 4R9MA 3TO7A 2I79A 4HNWB 4IF5A 1S7KA 4R3KA 2J8MA 4QBJA 2Z10A 4ORFA 1P0HA 3FBUA 3V8IA 4H6UA 3TOBA 4KUAA 3BJ8A 4HNYB 2H5MA 2VZYA 4Y49C 2VZZA 4ZBGA 3BJ7A 2ZPAA 1XEBA 2QECA 4UWIA 4H6ZA 5EBVA 1IYKA 1R57A 4KOWA 4KUBA 4QB9A 3N7ZA 2VEZA 1S60A 4E8OA 2JLMA 4MBUA 4K30A 2O28A 3R9EA 2FIWA 5F48A 4JD6A 1OZPA 4AVBA 3QAHA 4KOSA 1XF8A 3S6FA 4Y49B 2PC1A 4QC6A 2R8VA 2B4BA 2G0BA 2R98A 2F5IA 2FT0A 1S7LA 3VWEA 4IUSA 2PRBA 1IIDA 4BMHA 1VHSA 4NXYA 3CXQA 5IX3A 1UFHA 2BL1A 1YLEA 2FCKA 2HUZA 3S6KA 3K9UA 2WPXA 4CS0B 4E0AA 4R3LA 4CAWA 3TTHA 5J8CA 4MI4A 4U5YA 3EXNA 4KVME 3EFAA 5F46A 4II9A 2J8RA 4YRHA 4AB7A 4KLVA 5ISVA 4NCZA 2HV2A 4J3GA 1ON0A 2BSWA 2FE7A 3TT2A 1XMTA 3PP9A 2OZGA 4CRZB 2ZW7A 1LRZA 3PGPA 1Q2CA 2VQYA 3FIXA 3R95A 3BLNA 4JWPA 2GE3A 3P2HA 5DWMA 3DDDA 3TFYA 1MJBA 2D4OA 3TE4A 3NE7A 2VXKA 1PU9A 1YGHA 3H4QA 2G3AA 1MJAA 4L89A 3IWGA 3W91A 3JVNA 3G3SA 4GS4A 4YFJA 3F0AA 5IV0A 1GHEA 1IYLA 1MK4A 1Q2DA 1M44A 3DR8A 3MGDA 3S6GA 3EY5A 1B6BA 1FY7A 2P6EA 4R87A 4HNXB 3TOAA 1BO4A 2B3UA 2P6FA 2J8NA 2OH1A 2PR1A 2Q4VA 3DSBA 3CXSA 3R1KA 1S5KA 5JPHA 1XIXA 2B4DA 1YK3A 1KUXA 2B4DB 2FL4A 3SXNA 3ZJ0A 4X5KA 2Q4YA 5FVJA 4JXQA 1Z9UA 3I9SA 3LODA 5H86A 2ATRA 1M1DA 2CY2A 5I0CA 5F49A 5KTCA 4I49A 4QVTA 1WWZA 5HH1A 3D2MA 1Z4EA 4EVYA 3KKWA 3GKRA 1L0CA 2R7HA 3TCVA 4KOTA 4PSXA 1S7NA 4MJ8A 1M4DA 3VWDA 2BUEA 4AG9A 4XPDC 3DR6A 2OU2A 1I21A 1U6MA 3F5BA 4CRYB 2ZXVA 3PZJA 2EVNA 1IICA 1I1DA 1NE9A 3ZZIA 1YVOA 1B87A 4RI1A 4B5PA 4B5PB 4JJXA 4XPDB 3IGRA 4M3SA 4NF1A 4KOYA 2P6GA 2OZHA 4UWJA 1BOBA 5KTAA 2NMTA 4KVOE 4CAXA 2D4PA 4PK3A 4E2AA 4QUSA 2CNTA 4NEXA 1RO5A 2OZUA 3FXTA 2BEIA 2QMLA 1QSRA 2I00A 1V0CA 3P2FA 4M85A 3SHPA 2FSRA 3FRMA 2REEA 2ZW4A 2PR8A 2KCWA 5F47A 4JXRA 2GANA 4MHDA 2JEVA 5JQ4A 4YGOA 4DNCA 4PK2A 2Q44A 4H89A 5IB0A 4XNHB 4OLLA 1QSOA 1N71A 3D2PA 4LX9A 1IB1E 2FS5A 4KLWA 4CAVA 1KZFA 3FNCA 3GYAA 2B58A 2REFA 3FYNA 2ZW5A 2ZW6A 5E96A 4FD7A 4KOUA 1YREA 1S3ZA 4NSQA 1XE4A 5H84A 2Z11A 4AG7A 3CXPA 2JDDA 3SXOA 2QIRA 1NSLA 1PUAA 1Y9WA 3T9YA 1M4GA 2K5TA
chains in the Genus database with same CATH superfamily
3JRUA 2AJ6A 3JUWA 4NGTA 5DWNA 4EWTA 3EC4A 1LANA 2XEFA 2CTCA 4JZ0A 4MHYA 5AG6A 3GY9A 4KVXA 2DPTA 3IWWA 4R57A 1LOKA 2Q04A 4KS9A 4P44A 1BAVA 4AVCA 5K8MA 4UCPA 1J4JA 3F8KA 2GIVA 3UY5A 3C26A 4OIWA 4MY3A 1R3NA 1YVKA 1YW4A 2PVWA 4KORA 4NGSA 4MFJA 3G8WA 4P4JA 3R9GA 1RXTA 4MFLA 4F0YA 2F8HA 2ANPA 4F8ZA 3B3VA 3IJ3A 1K4JA 2FXFA 4OMEA 1CM0A 4NGNA 1KWMA 2PJAA 3D3SA 3IFEA 4K3NA 4B12A 3KL9A 4O23A 4KOVA 1KUYA 1M4IA 4P10A 4B6ZA 4UIBA 2WSAA 1WK4A 4F6AA 4ZY0A 3WT4A 4BINA 3B8GA 4MCSA 3S9MA 3FF3A 4MRIA 2CNSA 2AFZA 2AFXA 5G21A 4ONUA 1XFOA 4RS2A 4A39A 2EUIA 3S6HA 1Z5RA 4DYOA 2PJ3A 2Z0ZA 3I3GA 1CJWA 5JGFA 4XPKA 2PJCA 4W9YA 2JDCA 4P6YA 1CP6A 2QYVA 1Y9KA 2F7VA 2PJ4A 2WUUA 3K2KA 4KOXA 4YWYA 4MFKA 3FB3A 4UA3A 3W6XA 2PDOA 2NYQA 2GU2A 4PSWA 4PXEA 4U9ZA 4UBRA 5CNPA 4OAEA 1FNOA 1YR0A 4LUAA 1TKJA 4ZYQA 4KZTA 3W6SA 5KTDA 2YGWA 3PFOA 2Q43A 3RYOA 2VBQA 1CPXA 1VKCA 2RB7A 1I12A 1ZG9A 1PYTB 2HQYA 3EO4A 4OIDA 3JTKA 4C7IA 5LYLA 2POKA 2OOTA 3IEHA 1R43A 1QSNA 2PJ2A 4EMEA 4OADA 3TO6A 4PV6A 1VIXA 2P0WA 4CYNA 4UFXA 2ZEGA 5G22A 4A2ZA 1KUVA 1YMEA 4HKFA 4P4DA 4AXVA 4XNHC 3E0KA 5J1QA 5LRKA 4NJQA 2C27A 4ZY1A 4B5OA 3LD2A 3QB8A 4OC1A 3BHXA 1DTDA 4R76A 4A32A 1CBXA 5C88A 1YSJA 2ARHA 2Y0MA 3PRTA 4FD5A 2ODFA 2OB0A 2R1IA 3DGVA 1QSMA 2PJ5A 4F9UA 2WPWA 5EC4A 1HDUA 1HDQA 1Z4RA 2EBJA 4B11A 5HMNA 1CPSA 2AE6A 4P4EA 4TWEA 5LYDA 2PIYA 2PSWA 4XPLA 1S7FA 4L8AA 4UIAA 4A33A 1Q2YA 2IL4A 4MY0A 3D8PA 1QSTA 1Y7EA 3D4UA 2CNMA 3PB8X 4U9YA 3FJUA 2AFMA 2PCUA 3S9NA 2A4NA 2C1CA 1AMPA 1LAPA 3IWEA 4A37A 3HUVA 3PB6X 4CYPA 1P4NA 1YX0A 2ZEOA 2ZELA 4CGMA 2Q0YA 4GM5A 5K8OA 4UFWA 1MJ9A 3IC1A 1Y7RA 3WC7A 2VI7A 4AVAA 4ZX8A 1XMBA 5JH9A 2I3CA 2CXAA 2Q7BA 3BXMA 5HVFA 2XEIA 3R96A 2B3VA 1TIQA 3D68A 2G3TA 4FD4A 4JLYA 4Q7AA 3RO0A 1NMTA 1FT7A 3OWCA 3VARA 3FVLA 3PBEA 4UEZA 5HVGA 2B5GA 2DXQA 5GCNA 1CG2A 5IX3A 2C6CA 2B5GB 3T90A 3WR7A 5A28A 3TO9A 2FIAA 4FD6A 3DNSA 5J8FA 1GYTA 2X7BA 2RC4A 1ZLIA 3I1UA 1Z2LA 1SQHA 3R9FA 5C82A 3GLJA 2PQ8A 4R9MA 3TO7A 2I79A 4HNWB 4IF5A 1S7KA 4R3KA 4C2YA 2J8MA 3SI2A 4QBJA 5AG4A 2Z10A 2Q4ZA 4NGPA 4ORFA 2QVPA 3V38A 1P0HA 3DLJA 4UCNA 3FBUA 5ELYA 3KGQA 3V8IA 4H6UA 3ISZA 3TOBA 2PJ7A 1VHOA 4KUAA 2PJBA 3BJ8A 4HNYB 1TF8A 5LYFA 4UF4A 2Z3LA 3SJXA 4LQ6A 2H5MA 4C2XA 3SJEA 4UFVA 3NH5A 2VZYA 4Y49C 2VZZA 2XEJA 4ZBGA 5LRJA 3BJ7A 4F0XA 2ZPAA 1AUGA 3IU2A 4PXCA 1XEBA 2QECA 2ZEPA 3D7GA 4H6ZA 4UWIA 2ZOFA 5EBVA 3A9LA 5K8PA 1IYKA 4MCQA 1R57A 4KOWA 4KUBA 3WC5A 4QB9A 3N7ZA 2DF5A 4FAIA 2VEZA 3KASA 1OBRA 1S60A 4G1PA 2AFUA 4E8OA 2PVVA 2JLMA 4MBUA 4K30A 2O28A 3R9EA 4CGNA 2FIWA 4ZI6A 1X10A 1IGBA 2JBJA 5F48A 3D67A 5I0CA 4P4FA 4JD6A 1OZPA 1Y0RA 4AVBA 3QAHA 4KOSA 3NFZA 1XF8A 2QJ8A 4MCRA 4OC4A 3S6FA 4Y49B 3FH4A 2PC1A 3CT9A 1Z8XA 2DPSA 4QC6A 3VH9A 2JEWA 4BBHA 2R8VA 2B4BA 1LCPA 2G0BA 4GXHA 4LQGA 2R98A 2NSMA 2F5IA 2PRQA 3LACA 1UWYA 5DS0A 2V8DA 2FT0A 1S7LA 1XBUA 1YLOA 3VWEA 3TX8A 4IUSA 2PRBA 4PQAA 1IIDA 1F2PA 4NGRA 4MMOA 4UEFA 4WWVA 1VHSA 4NXYA 3CXQA 4PXDA 4BMHA 1UFHA 4CGLA 2ABZA 2BL1A 4EFDA 7CPAA 1YLEA 2FCKA 2HUZA 3SJGA 3S6KA 3K9UA 2WPXA 4CS0B 4E0AA 1PCAA 1XOVA 4R3LA 1Z8TA 5I4MA 2XEGA 4CAWA 4IHMA 2Z3KA 3TTHA 2ZENA 5J8CA 1NSAA 4MI4A 4U5YA 3B3CA 3EXNA 4KVME 3EFAA 3KHXA 4OC2A 5F46A 4II9A 4IAVA 3SI0A 1H8LA 2J8RA 4YRHA 5K8NA 4ZY2A 4R6TA 4AB7A 4KLVA 5ISVA 1VGYA 4MFPA 2HV2A 4J3GA 4NCZA 1ON0A 4OC0A 2EWBA 2BSWA 2O4HA 2FE7A 3LMSA 2JBKA 1XMTA 3TT2A 3PP9A 4IK2A 3NH8A 2OZGA 4CRZB 5CBMA 2ZW7A 1LRZA 2AFOA 3IO1A 1LAMA 2Z3MA 3CDXA 2IJZA 4X2TA 3PGPA 4NJRA 1Q2CA 2VQYA 3FIXA 3R95A 3BLNA 4JWPA 2PJ9A 4PXBA 2GE3A 3P2HA 4OKOA 4X8IA 5DWMA 3DDDA 8CPAA 4RN7A 5F09A 3TFYA 1MJBA 2D4OA 3TE4A 3RZAA 1X12A 3NE7A 5HXDA 2VXKA 1PU9A 2PIZA 1JWQA 3NE8A 2V8VA 2EK8A 4CPAA 1YGHA 3H4QA 5G20A 2G3AA 1MJAA 4C2ZA 2C6GA 2VL1A 3PB7X 1JQGA 4L89A 3IWGA 1IOFA 2YNCA 1TKFA 3W91A 3CPXA 5D8NA 2BCOA 3KI9A 4NGMA 3JVNA 4P45A 5D29A 4ZX9A 4A31A 5BWAB 3G3SA 4GS4A 4YFJA 5JM6A 4A94A 3F0AA 5IV0A 3B7IA 1GHEA 2CTBA 4WJBA 1XRYA 2BO9A 4ZGYB 1IYLA 1MK4A 1Q2DA 1M44A 3DR8A 4C7HA 3MGDA 3S6GA 3EY5A 1B6BA 4UEEA 1FY7A 2P6EA 4R87A 4JYWA 2V8GA 1ZG8A 4HNXB 3TOAA 1BO4A 2B3UA 3PB4X 3H5ZA 4R8FA 1ZG7A 3SJFA 3B3WA 1YW6A 2P6FA 2J8NA 1BPMA 4OC3A 2OH1A 1ZLHA 1M4LA 2PR1A 2Q4VA 3B35A 3DSBA 1EE3P 3CXSA 5LRGA 1A2ZA 3R1KA 2EO8A 1CP7A 4CAEA 1S5KA 5JPHA 4B14A 1XIXA 2B4DA 1YK3A 1KUXA 3SI1A 3KR4A 2B4DB 3GIUA 2FL4A 2V77A 3BI0A 4KSFA 3SXNA 3ZJ0A 4DJLA 4X5KA 2EK9A 4B10A 4DUKA 3NH4A 3KQXA 3KQZA 1ARMA 2Q4YA 3IIBA 2GFQA 4JXQA 5FVJA 1Z9UA 2ZEMA 3I9SA 3LODA 1F57A 1M1DA 2ATRA 2CY2A 4PPZA 5F49A 5H86A 5KTCA 4I49A 2OR4A 2ZEEA 4ONWA 5EMIA 3H8GA 4QVTA 4P4IA 1WWZA 3CPAA 3WC6A 3V7ZA 1CX8A 1DE4C 4TNUA 4M6GA 3RAMA 5HH1A 2PE3A 3D2MA 3RNZA 1Z4EA 1ARLA 3RBUA 3D7HA 1HEEA 4EVYA 4RUHA 3KKWA 3GKRA 1L0CA 2R7HA 3TCVA 4KOTA 4PSXA 1S7NA 4MJ8A 5AGEA 1M4DA 3VWDA 2BUEA 4AG9A 1QMUA 2WZNA 3D7DA 4XPDC 5HVHA 4F9VA 3DR6A 3PFEA 2OU2A 1I21A 3N5FA 2HB6A 1U6MA 4MXUA 5CPAA 2IMOA 2Q7SA 3F5BA 2Q51A 1TXRA 4CRYB 1IY7A 3H8FA 2ZXVA 2IQ6A 3L2NA 2EVNA 1IICA 1I1DA 3D66A 3PZJA 1NE9A 1BLLE 4M6HA 4P4BA 1YVOA 2CF4A 2YNEA 1Y0YA 3ZZIA 4FWUA 1B87A 2PJ0A 2ZOGA 4B13A 3S9LA 4RI1A 4B5PA 3FX6A 2AFWA 3FEDA 4B5PB 3IU1A 4NFRA 2AFSA 4JJXA 3IGRA 4XPDB 4M3SA 4MHNA 4KOYA 4NF1A 4A30A 3D7FA 3TC8A 2WYRA 4CYQA 2P6GA 3WABA 2OZHA 3BI1A 4FUUA 4UWJA 3QAYA 3LWUA 1BOBA 4MHPA 2NMTA 3KZWA 5KTAA 1QQ9A 4Q38A 1ELLP 4KVOE 1BPNA 1Q7LA 2GLJA 3B3TA 2O53A 4CAXA 2PJ1A 2PJ8A 6CPAA 1TF9A 2D4PA 4PK3A 3PB9X 4E2AA 1F2OA 3CZXA 4QUSA 2GREA 2YNCC 2CNTA 1TKHA 4NEXA 4R7MA 1RO5A 2OZUA 2ZEFA 3FXTA 2Z3OA 3T8WA 4X3RA 3PBBA 4A95A 2BEIA 3B3SA 5AG5A 3FMCA 2QMLA 1QSRA 4UCMA 3H8EA 2I00A 3KR5A 1V0CA 3P2FA 4Z65A 4CGPA 2GLFA 4M85A 3SHPA 3B2YA 2FSRA 3FRMA 4Q36A 2REEA 2ZW4A 2PR8A 2KCWA 3KHZA 5F47A 4CYOA 4JXRA 2GANA 3GUXA 5THWA 4C68A 1ZO0A 5G1ZA 1IOIA 2JEVA 4MHDA 5JQ4A 1Z8LA 2G9DA 4KSAA 4YGOA 2C6PA 4DNCA 1RTQA 4MFZA 5IB9A 4PK2A 3FECA 2Q44A 4H89A 3FEEA 1IU8A 1LFWA 3VATA 5IB0A 4XNHB 4OLLA 1QSOA 4MCPA 1N71A 3D2PA 4H2KA 3PEIA 1IB1E 2BOAA 4LX9A 1VHEA 2FS5A 4A38A 4KLWA 4CAVA 2HC9A 2Z3PA 4BD9A 1KZFA 3FNCA 2Z3NA 4MFQA 3GYAA 4OC5A 2B58A 4YU9A 2REFA 2V8HA 2YNDA 2ZW5A 3FYNA 2ZW6A 3K9TA 1XJOA 5LYIA 4OP4A 5E96A 4FD7A 3QNVA 3NA6A 4KSIA 3HLPA 4CAFA 4KOUA 4FBEA 1Z8WA 1YREA 2ZEHA 1S3ZA 4HPSA 1YQEA 1ELMP 4NSQA 2RFHA 2CIJA 2ZEDA 3GB0A 4NGQA 3MN8A 2PJ6A 5A27A 2J9AA 2FVGA 1XE4A 3MRUA 5H84A 2Z11A 4MHZA 1AYEA 4CGOA 4AG7A 3CXPA 2JDDA 4M6IA 3SXOA 2QIRA 1NSLA 1PUAA 1Y9WA 5AG7A 3T9YA 1M4GA 3ISXA 2K5TA 2DEAA
chains in the Genus database with same CATH topology
2AJ6A 3JUWA 5DWNA 3EC4A 5AG6A 3GY9A 4KVXA 2DPTA 4R57A 2Q04A 4KS9A 4AVCA 4UCPA 1J4JA 3F8KA 2GIVA 3UY5A 3C26A 4MY3A 1YVKA 4KORA 4MFJA 3G8WA 3R9GA 4F0YA 1RXTA 4MFLA 1K4JA 2FXFA 1CM0A 3D3SA 4B12A 4KOVA 1KUYA 1M4IA 2WSAA 1WK4A 4F6AA 3B8GA 2CNSA 5G21A 4ONUA 4RS2A 2EUIA 3S6HA 2Z0ZA 3I3GA 1CJWA 4XPKA 2JDCA 1Y9KA 2WUUA 4KOXA 4MFKA 3FB3A 4UA3A 3W6XA 2PDOA 4PSWA 4U9ZA 4UBRA 5CNPA 4OAEA 1YR0A 4LUAA 4KZTA 3W6SA 5KTDA 2YGWA 3RYOA 2VBQA 1VKCA 1I12A 3EO4A 2HQYA 4C7IA 3JTKA 1QSNA 4OADA 3TO6A 4PV6A 2P0WA 4CYNA 4UFXA 5G22A 4A2ZA 1KUVA 4HKFA 4XNHC 3E0KA 2C27A 4B5OA 3LD2A 3QB8A 4A32A 5C88A 2ARHA 2Y0MA 4FD5A 2OB0A 2R1IA 1QSMA 2WPWA 5EC4A 1Z4RA 4B11A 5HMNA 2AE6A 2PSWA 4XPLA 1S7FA 4L8AA 4A33A 1Q2YA 2IL4A 4MY0A 3D8PA 1QSTA 2CNMA 4U9YA 2A4NA 3IWEA 4CYPA 1P4NA 1YX0A 4CGMA 2Q0YA 4UFWA 1MJ9A 1Y7RA 4AVAA 2VI7A 2CXAA 2Q7BA 3R96A 2B3VA 1TIQA 2G3TA 4FD4A 4JLYA 1NMTA 3OWCA 2B5GA 2DXQA 5GCNA 2B5GB 3T90A 3WR7A 5A28A 3TO9A 2FIAA 4FD6A 3DNSA 5J8FA 2X7BA 2RC4A 1SQHA 3R9FA 5C82A 2PQ8A 4R9MA 3TO7A 2I79A 4HNWB 4IF5A 1S7KA 4R3KA 4C2YA 2J8MA 4QBJA 5AG4A 2Z10A 4ORFA 1P0HA 4UCNA 3FBUA 3V8IA 4H6UA 3TOBA 4KUAA 3BJ8A 4HNYB 2Z3LA 4C2XA 2H5MA 4UFVA 2VZYA 4Y49C 2VZZA 4ZBGA 3BJ7A 4F0XA 2ZPAA 3IU2A 1XEBA 2QECA 4UWIA 4H6ZA 5EBVA 3A9LA 1IYKA 1R57A 4KOWA 4KUBA 4QB9A 3N7ZA 2VEZA 1S60A 4E8OA 2JLMA 4MBUA 4K30A 2O28A 3R9EA 4CGNA 2FIWA 5F48A 4JD6A 1OZPA 4AVBA 3QAHA 4KOSA 1XF8A 3S6FA 4Y49B 2PC1A 2DPSA 4QC6A 4BBHA 2R8VA 2B4BA 2G0BA 2R98A 2F5IA 2FT0A 1S7LA 3VWEA 4IUSA 2PRBA 1IIDA 4BMHA 1VHSA 4NXYA 3CXQA 5IX3A 1UFHA 4CGLA 2BL1A 1YLEA 2FCKA 2HUZA 3S6KA 3K9UA 2WPXA 4CS0B 4E0AA 4R3LA 4CAWA 2Z3KA 3TTHA 5J8CA 4MI4A 4U5YA 3EXNA 4KVME 3EFAA 5F46A 4II9A 2J8RA 4YRHA 4AB7A 4KLVA 5ISVA 4MFPA 4NCZA 2HV2A 4J3GA 1ON0A 2BSWA 2FE7A 3TT2A 1XMTA 3PP9A 2OZGA 4CRZB 2ZW7A 1LRZA 2Z3MA 3PGPA 1Q2CA 2VQYA 3FIXA 3R95A 3BLNA 4JWPA 2GE3A 3P2HA 5DWMA 3DDDA 3TFYA 1MJBA 2D4OA 3TE4A 3NE7A 2VXKA 1PU9A 1YGHA 3H4QA 5G20A 2G3AA 1MJAA 4C2ZA 4L89A 3IWGA 2YNCA 3W91A 4A31A 3JVNA 5BWAB 3G3SA 4GS4A 4YFJA 3F0AA 5IV0A 1GHEA 4ZGYB 1IYLA 1MK4A 1Q2DA 1M44A 3DR8A 4C7HA 3MGDA 3S6GA 3EY5A 1B6BA 1FY7A 2P6EA 4R87A 4HNXB 3TOAA 1BO4A 2B3UA 3H5ZA 2P6FA 2J8NA 2OH1A 2PR1A 2Q4VA 3DSBA 3CXSA 3R1KA 4CAEA 1S5KA 5JPHA 4B14A 1XIXA 2B4DA 1YK3A 1KUXA 2B4DB 2FL4A 4KSFA 3SXNA 3ZJ0A 4X5KA 4B10A 2Q4YA 5FVJA 4JXQA 1Z9UA 3I9SA 3LODA 5H86A 2ATRA 1M1DA 2CY2A 5I0CA 5F49A 5KTCA 4I49A 4QVTA 1WWZA 5HH1A 3D2MA 1Z4EA 4EVYA 3KKWA 3GKRA 1L0CA 2R7HA 3TCVA 4KOTA 4PSXA 1S7NA 4MJ8A 5AGEA 1M4DA 3VWDA 2BUEA 4AG9A 4XPDC 3DR6A 2OU2A 1I21A 1U6MA 3F5BA 4CRYB 2ZXVA 3PZJA 2EVNA 1IICA 1I1DA 1NE9A 3ZZIA 1YVOA 2YNEA 4B13A 1B87A 4RI1A 4B5PA 4B5PB 3IU1A 4JJXA 4XPDB 3IGRA 4M3SA 4NF1A 4KOYA 4A30A 4CYQA 2P6GA 2OZHA 4UWJA 1BOBA 5KTAA 2NMTA 4Q38A 4KVOE 4CAXA 2D4PA 4PK3A 4E2AA 4QUSA 2YNCC 2CNTA 4NEXA 1RO5A 2OZUA 3FXTA 2Z3OA 4A95A 2BEIA 5AG5A 2QMLA 1QSRA 4UCMA 2I00A 1V0CA 3P2FA 4CGPA 4M85A 3SHPA 2FSRA 3FRMA 4Q36A 2REEA 2ZW4A 2PR8A 2KCWA 5F47A 4CYOA 4JXRA 2GANA 4C68A 1ZO0A 5G1ZA 4MHDA 2JEVA 5JQ4A 4KSAA 4YGOA 4DNCA 4MFZA 4PK2A 2Q44A 4H89A 5IB0A 4XNHB 4OLLA 1QSOA 1N71A 3D2PA 4LX9A 1IB1E 2FS5A 4KLWA 4CAVA 2Z3PA 1KZFA 3FNCA 2Z3NA 4MFQA 3GYAA 2B58A 2REFA 3FYNA 2YNDA 2ZW5A 2ZW6A 5E96A 4FD7A 4CAFA 4KOUA 1YREA 1S3ZA 4NSQA 5A27A 1XE4A 5H84A 2Z11A 4CGOA 4AG7A 3CXPA 2JDDA 3SXOA 2QIRA 1NSLA 1PUAA 1Y9WA 5AG7A 3T9YA 1M4GA 2K5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJ6 A;  3JUW A;  5DWN A;  3EC4 A;  3GY9 A;  4KVX A;  4R57 A;  2Q04 A;  4AVC A;  1J4J A;  3F8K A;  2GIV A;  3UY5 A;  3C26 A;  4MY3 A;  1YVK A;  4KOR A;  4F0Y A;  3G8W A;  3R9G A;  1RXT A;  1K4J A;  2FXF A;  1CM0 A;  3D3S A;  4KOV A;  1KUY A;  1M4I A;  1WK4 A;  4F6A A;  3B8G A;  2CNS A;  4ONU A;  4RS2 A;  2EUI A;  3S6H A;  2Z0Z A;  3I3G A;  1CJW A;  4XPK A;  2JDC A;  1Y9K A;  4KOX A;  3FB3 A;  4UA3 A;  3W6X A;  2PDO A;  4PSW A;  4U9Z A;  4UBR A;  5CNP A;  4OAE A;  1YR0 A;  4LUA A;  4KZT A;  3W6S A;  5KTD A;  3RYO A;  2VBQ A;  1VKC A;  1I12 A;  3EO4 A;  2HQY A;  1QSN A;  4OAD A;  3TO6 A;  4PV6 A;  2P0W A;  1KUV A;  4HKF A;  4XNH C;  3E0K A;  2C27 A;  4B5O A;  3LD2 A;  3QB8 A;  5C88 A;  2ARH A;  2Y0M A;  4FD5 A;  2OB0 A;  2R1I A;  1QSM A;  2WPW A;  5EC4 A;  1Z4R A;  5HMN A;  2AE6 A;  2PSW A;  4XPL A;  1S7F A;  4L8A A;  1Q2Y A;  2IL4 A;  4MY0 A;  3D8P A;  1QST A;  2CNM A;  4U9Y A;  2A4N A;  1P4N A;  1YX0 A;  2Q0Y A;  1MJ9 A;  1Y7R A;  4AVA A;  2VI7 A;  2Q7B A;  3R96 A;  2B3V A;  1TIQ A;  2G3T A;  4FD4 A;  4JLY A;  1NMT A;  3OWC A;  2B5G A;  2DXQ A;  5GCN A;  2B5G B;  3T90 A;  3WR7 A;  3TO9 A;  2FIA A;  4FD6 A;  3DNS A;  5J8F A;  2X7B A;  2RC4 A;  1SQH A;  3R9F A;  5C82 A;  2PQ8 A;  4R9M A;  3TO7 A;  2I79 A;  4HNW B;  4IF5 A;  1S7K A;  4R3K A;  2J8M A;  4QBJ A;  2Z10 A;  4ORF A;  1P0H A;  3FBU A;  3V8I A;  4H6U A;  3TOB A;  4KUA A;  3BJ8 A;  4HNY B;  2H5M A;  2VZY A;  4Y49 C;  2VZZ A;  4ZBG A;  3BJ7 A;  2ZPA A;  1XEB A;  2QEC A;  4UWI A;  4H6Z A;  5EBV A;  1IYK A;  1R57 A;  4KOW A;  4KUB A;  4QB9 A;  3N7Z A;  2VEZ A;  1S60 A;  4E8O A;  2JLM A;  4MBU A;  4K30 A;  2O28 A;  3R9E A;  2FIW A;  5F48 A;  4JD6 A;  1OZP A;  4AVB A;  3QAH A;  4KOS A;  1XF8 A;  3S6F A;  4Y49 B;  2PC1 A;  4QC6 A;  2R8V A;  2B4B A;  2G0B A;  2R98 A;  2F5I A;  2FT0 A;  1S7L A;  3VWE A;  4IUS A;  2PRB A;  1IID A;  4BMH A;  1VHS A;  4NXY A;  3CXQ A;  5IX3 A;  1UFH A;  2BL1 A;  1YLE A;  2FCK A;  2HUZ A;  3S6K A;  3K9U A;  2WPX A;  4CS0 B;  4E0A A;  4R3L A;  4CAW A;  3TTH A;  5J8C A;  4MI4 A;  4U5Y A;  3EXN A;  4KVM E;  3EFA A;  5F46 A;  4II9 A;  2J8R A;  4YRH A;  4AB7 A;  4KLV A;  5ISV A;  4NCZ A;  2HV2 A;  4J3G A;  1ON0 A;  2BSW A;  2FE7 A;  3TT2 A;  1XMT A;  3PP9 A;  2OZG A;  4CRZ B;  2ZW7 A;  1LRZ A;  3PGP A;  1Q2C A;  2VQY A;  3FIX A;  3R95 A;  3BLN A;  4JWP A;  2GE3 A;  3P2H A;  5DWM A;  3DDD A;  3TFY A;  1MJB A;  2D4O A;  3TE4 A;  3NE7 A;  2VXK A;  1PU9 A;  1YGH A;  3H4Q A;  2G3A A;  1MJA A;  4L89 A;  3IWG A;  3W91 A;  3JVN A;  3G3S A;  4GS4 A;  4YFJ A;  3F0A A;  5IV0 A;  1GHE A;  1IYL A;  1MK4 A;  1Q2D A;  1M44 A;  3DR8 A;  3MGD A;  3S6G A;  3EY5 A;  1B6B A;  1FY7 A;  2P6E A;  4R87 A;  4HNX B;  3TOA A;  1BO4 A;  2B3U A;  2P6F A;  2J8N A;  2OH1 A;  2PR1 A;  2Q4V A;  3DSB A;  3CXS A;  3R1K A;  1S5K A;  5JPH A;  1XIX A;  2B4D A;  1YK3 A;  1KUX A;  2B4D B;  2FL4 A;  3SXN A;  3ZJ0 A;  4X5K A;  2Q4Y A;  5FVJ A;  4JXQ A;  1Z9U A;  3I9S A;  3LOD A;  5H86 A;  2ATR A;  1M1D A;  2CY2 A;  5I0C A;  5F49 A;  5KTC A;  4I49 A;  4QVT A;  1WWZ A;  5HH1 A;  3D2M A;  1Z4E A;  4EVY A;  3KKW A;  3GKR A;  1L0C A;  2R7H A;  3TCV A;  4KOT A;  4PSX A;  1S7N A;  4MJ8 A;  1M4D A;  3VWD A;  2BUE A;  4AG9 A;  4XPD C;  3DR6 A;  2OU2 A;  1I21 A;  1U6M A;  3F5B A;  4CRY B;  2ZXV A;  3PZJ A;  2EVN A;  1IIC A;  1I1D A;  1NE9 A;  3ZZI A;  1YVO A;  1B87 A;  4RI1 A;  4B5P A;  4B5P B;  4JJX A;  4XPD B;  3IGR A;  4M3S A;  4NF1 A;  4KOY A;  2P6G A;  2OZH A;  4UWJ A;  1BOB A;  5KTA A;  2NMT A;  4KVO E;  4CAX A;  2D4P A;  4PK3 A;  4E2A A;  4QUS A;  2CNT A;  4NEX A;  1RO5 A;  2OZU A;  3FXT A;  2BEI A;  2QML A;  1QSR A;  2I00 A;  1V0C A;  3P2F A;  4M85 A;  3SHP A;  2FSR A;  3FRM A;  2REE A;  2ZW4 A;  2PR8 A;  2KCW A;  5F47 A;  4JXR A;  2GAN A;  4MHD A;  2JEV A;  5JQ4 A;  4YGO A;  4DNC A;  4PK2 A;  2Q44 A;  4H89 A;  5IB0 A;  4XNH B;  4OLL A;  1QSO A;  1N71 A;  3D2P A;  4LX9 A;  1IB1 E;  2FS5 A;  4KLW A;  4CAV A;  1KZF A;  3FNC A;  3GYA A;  2B58 A;  2REF A;  3FYN A;  2ZW5 A;  2ZW6 A;  5E96 A;  4FD7 A;  4KOU A;  1YRE A;  1S3Z A;  4NSQ A;  1XE4 A;  5H84 A;  2Z11 A;  4AG7 A;  3CXP A;  2JDD A;  3SXO A;  2QIR A;  1NSL A;  1PUA A;  1Y9W A;  3T9Y A;  1M4G A;  2K5T A; 
#chains in the Genus database with same CATH topology
 3JRU A;  2AJ6 A;  3JUW A;  4NGT A;  5DWN A;  4EWT A;  3EC4 A;  1LAN A;  2XEF A;  2CTC A;  4JZ0 A;  4MHY A;  5AG6 A;  3GY9 A;  4KVX A;  2DPT A;  3IWW A;  4R57 A;  1LOK A;  2Q04 A;  4KS9 A;  4P44 A;  1BAV A;  4AVC A;  5K8M A;  4UCP A;  1J4J A;  3F8K A;  2GIV A;  3UY5 A;  3C26 A;  4OIW A;  4MY3 A;  1R3N A;  1YVK A;  1YW4 A;  2PVW A;  4KOR A;  4NGS A;  4MFJ A;  3G8W A;  4P4J A;  3R9G A;  1RXT A;  4MFL A;  4F0Y A;  2F8H A;  2ANP A;  4F8Z A;  3B3V A;  3IJ3 A;  1K4J A;  2FXF A;  4OME A;  1CM0 A;  4NGN A;  1KWM A;  2PJA A;  3D3S A;  3IFE A;  4K3N A;  4B12 A;  3KL9 A;  4O23 A;  4KOV A;  1KUY A;  1M4I A;  4P10 A;  4B6Z A;  4UIB A;  2WSA A;  1WK4 A;  4F6A A;  4ZY0 A;  3WT4 A;  4BIN A;  3B8G A;  4MCS A;  3S9M A;  3FF3 A;  4MRI A;  2CNS A;  2AFZ A;  2AFX A;  5G21 A;  4ONU A;  1XFO A;  4RS2 A;  4A39 A;  2EUI A;  3S6H A;  1Z5R A;  4DYO A;  2PJ3 A;  2Z0Z A;  3I3G A;  1CJW A;  5JGF A;  4XPK A;  2PJC A;  4W9Y A;  2JDC A;  4P6Y A;  1CP6 A;  2QYV A;  1Y9K A;  2F7V A;  2PJ4 A;  2WUU A;  3K2K A;  4KOX A;  4YWY A;  4MFK A;  3FB3 A;  4UA3 A;  3W6X A;  2PDO A;  2NYQ A;  2GU2 A;  4PSW A;  4PXE A;  4U9Z A;  4UBR A;  5CNP A;  4OAE A;  1FNO A;  1YR0 A;  4LUA A;  1TKJ A;  4ZYQ A;  4KZT A;  3W6S A;  5KTD A;  2YGW A;  3PFO A;  2Q43 A;  3RYO A;  2VBQ A;  1CPX A;  1VKC A;  2RB7 A;  1I12 A;  1ZG9 A;  1PYT B;  2HQY A;  3EO4 A;  4OID A;  3JTK A;  4C7I A;  5LYL A;  2POK A;  2OOT A;  3IEH A;  1R43 A;  1QSN A;  2PJ2 A;  4EME A;  4OAD A;  3TO6 A;  4PV6 A;  1VIX A;  2P0W A;  4CYN A;  4UFX A;  2ZEG A;  5G22 A;  4A2Z A;  1KUV A;  1YME A;  4HKF A;  4P4D A;  4AXV A;  4XNH C;  3E0K A;  5J1Q A;  5LRK A;  4NJQ A;  2C27 A;  4ZY1 A;  4B5O A;  3LD2 A;  3QB8 A;  4OC1 A;  3BHX A;  1DTD A;  4R76 A;  4A32 A;  1CBX A;  5C88 A;  1YSJ A;  2ARH A;  2Y0M A;  3PRT A;  4FD5 A;  2ODF A;  2OB0 A;  2R1I A;  3DGV A;  1QSM A;  2PJ5 A;  4F9U A;  2WPW A;  5EC4 A;  1HDU A;  1HDQ A;  1Z4R A;  2EBJ A;  4B11 A;  5HMN A;  1CPS A;  2AE6 A;  4P4E A;  4TWE A;  5LYD A;  2PIY A;  2PSW A;  4XPL A;  1S7F A;  4L8A A;  4UIA A;  4A33 A;  1Q2Y A;  2IL4 A;  4MY0 A;  3D8P A;  1QST A;  1Y7E A;  3D4U A;  2CNM A;  3PB8 X;  4U9Y A;  3FJU A;  2AFM A;  2PCU A;  3S9N A;  2A4N A;  2C1C A;  1AMP A;  1LAP A;  3IWE A;  4A37 A;  3HUV A;  3PB6 X;  4CYP A;  1P4N A;  1YX0 A;  2ZEO A;  2ZEL A;  4CGM A;  2Q0Y A;  4GM5 A;  5K8O A;  4UFW A;  1MJ9 A;  3IC1 A;  1Y7R A;  3WC7 A;  2VI7 A;  4AVA A;  4ZX8 A;  1XMB A;  5JH9 A;  2I3C A;  2CXA A;  2Q7B A;  3BXM A;  5HVF A;  2XEI A;  3R96 A;  2B3V A;  1TIQ A;  3D68 A;  2G3T A;  4FD4 A;  4JLY A;  4Q7A A;  3RO0 A;  1NMT A;  1FT7 A;  3OWC A;  3VAR A;  3FVL A;  3PBE A;  4UEZ A;  5HVG A;  2B5G A;  2DXQ A;  5GCN A;  1CG2 A;  5IX3 A;  2C6C A;  2B5G B;  3T90 A;  3WR7 A;  5A28 A;  3TO9 A;  2FIA A;  4FD6 A;  3DNS A;  5J8F A;  1GYT A;  2X7B A;  2RC4 A;  1ZLI A;  3I1U A;  1Z2L A;  1SQH A;  3R9F A;  5C82 A;  3GLJ A;  2PQ8 A;  4R9M A;  3TO7 A;  2I79 A;  4HNW B;  4IF5 A;  1S7K A;  4R3K A;  4C2Y A;  2J8M A;  3SI2 A;  4QBJ A;  5AG4 A;  2Z10 A;  2Q4Z A;  4NGP A;  4ORF A;  2QVP A;  3V38 A;  1P0H A;  3DLJ A;  4UCN A;  3FBU A;  5ELY A;  3KGQ A;  3V8I A;  4H6U A;  3ISZ A;  3TOB A;  2PJ7 A;  1VHO A;  4KUA A;  2PJB A;  3BJ8 A;  4HNY B;  1TF8 A;  5LYF A;  4UF4 A;  2Z3L A;  3SJX A;  4LQ6 A;  2H5M A;  4C2X A;  3SJE A;  4UFV A;  3NH5 A;  2VZY A;  4Y49 C;  2VZZ A;  2XEJ A;  4ZBG A;  5LRJ A;  3BJ7 A;  4F0X A;  2ZPA A;  1AUG A;  3IU2 A;  4PXC A;  1XEB A;  2QEC A;  2ZEP A;  3D7G A;  4H6Z A;  4UWI A;  2ZOF A;  5EBV A;  3A9L A;  5K8P A;  1IYK A;  4MCQ A;  1R57 A;  4KOW A;  4KUB A;  3WC5 A;  4QB9 A;  3N7Z A;  2DF5 A;  4FAI A;  2VEZ A;  3KAS A;  1OBR A;  1S60 A;  4G1P A;  2AFU A;  4E8O A;  2PVV A;  2JLM A;  4MBU A;  4K30 A;  2O28 A;  3R9E A;  4CGN A;  2FIW A;  4ZI6 A;  1X10 A;  1IGB A;  2JBJ A;  5F48 A;  3D67 A;  5I0C A;  4P4F A;  4JD6 A;  1OZP A;  1Y0R A;  4AVB A;  3QAH A;  4KOS A;  3NFZ A;  1XF8 A;  2QJ8 A;  4MCR A;  4OC4 A;  3S6F A;  4Y49 B;  3FH4 A;  2PC1 A;  3CT9 A;  1Z8X A;  2DPS A;  4QC6 A;  3VH9 A;  2JEW A;  4BBH A;  2R8V A;  2B4B A;  1LCP A;  2G0B A;  4GXH A;  4LQG A;  2R98 A;  2NSM A;  2F5I A;  2PRQ A;  3LAC A;  1UWY A;  5DS0 A;  2V8D A;  2FT0 A;  1S7L A;  1XBU A;  1YLO A;  3VWE A;  3TX8 A;  4IUS A;  2PRB A;  4PQA A;  1IID A;  1F2P A;  4NGR A;  4MMO A;  4UEF A;  4WWV A;  1VHS A;  4NXY A;  3CXQ A;  4PXD A;  4BMH A;  1UFH A;  4CGL A;  2ABZ A;  2BL1 A;  4EFD A;  7CPA A;  1YLE A;  2FCK A;  2HUZ A;  3SJG A;  3S6K A;  3K9U A;  2WPX A;  4CS0 B;  4E0A A;  1PCA A;  1XOV A;  4R3L A;  1Z8T A;  5I4M A;  2XEG A;  4CAW A;  4IHM A;  2Z3K A;  3TTH A;  2ZEN A;  5J8C A;  1NSA A;  4MI4 A;  4U5Y A;  3B3C A;  3EXN A;  4KVM E;  3EFA A;  3KHX A;  4OC2 A;  5F46 A;  4II9 A;  4IAV A;  3SI0 A;  1H8L A;  2J8R A;  4YRH A;  5K8N A;  4ZY2 A;  4R6T A;  4AB7 A;  4KLV A;  5ISV A;  1VGY A;  4MFP A;  2HV2 A;  4J3G A;  4NCZ A;  1ON0 A;  4OC0 A;  2EWB A;  2BSW A;  2O4H A;  2FE7 A;  3LMS A;  2JBK A;  1XMT A;  3TT2 A;  3PP9 A;  4IK2 A;  3NH8 A;  2OZG A;  4CRZ B;  5CBM A;  2ZW7 A;  1LRZ A;  2AFO A;  3IO1 A;  1LAM A;  2Z3M A;  3CDX A;  2IJZ A;  4X2T A;  3PGP A;  4NJR A;  1Q2C A;  2VQY A;  3FIX A;  3R95 A;  3BLN A;  4JWP A;  2PJ9 A;  4PXB A;  2GE3 A;  3P2H A;  4OKO A;  4X8I A;  5DWM A;  3DDD A;  8CPA A;  4RN7 A;  5F09 A;  3TFY A;  1MJB A;  2D4O A;  3TE4 A;  3RZA A;  1X12 A;  3NE7 A;  5HXD A;  2VXK A;  1PU9 A;  2PIZ A;  1JWQ A;  3NE8 A;  2V8V A;  2EK8 A;  4CPA A;  1YGH A;  3H4Q A;  5G20 A;  2G3A A;  1MJA A;  4C2Z A;  2C6G A;  2VL1 A;  3PB7 X;  1JQG A;  4L89 A;  3IWG A;  1IOF A;  2YNC A;  1TKF A;  3W91 A;  3CPX A;  5D8N A;  2BCO A;  3KI9 A;  4NGM A;  3JVN A;  4P45 A;  5D29 A;  4ZX9 A;  4A31 A;  5BWA B;  3G3S A;  4GS4 A;  4YFJ A;  5JM6 A;  4A94 A;  3F0A A;  5IV0 A;  3B7I A;  1GHE A;  2CTB A;  4WJB A;  1XRY A;  2BO9 A;  4ZGY B;  1IYL A;  1MK4 A;  1Q2D A;  1M44 A;  3DR8 A;  4C7H A;  3MGD A;  3S6G A;  3EY5 A;  1B6B A;  4UEE A;  1FY7 A;  2P6E A;  4R87 A;  4JYW A;  2V8G A;  1ZG8 A;  4HNX B;  3TOA A;  1BO4 A;  2B3U A;  3PB4 X;  3H5Z A;  4R8F A;  1ZG7 A;  3SJF A;  3B3W A;  1YW6 A;  2P6F A;  2J8N A;  1BPM A;  4OC3 A;  2OH1 A;  1ZLH A;  1M4L A;  2PR1 A;  2Q4V A;  3B35 A;  3DSB A;  1EE3 P;  3CXS A;  5LRG A;  1A2Z A;  3R1K A;  2EO8 A;  1CP7 A;  4CAE A;  1S5K A;  5JPH A;  4B14 A;  1XIX A;  2B4D A;  1YK3 A;  1KUX A;  3SI1 A;  3KR4 A;  2B4D B;  3GIU A;  2FL4 A;  2V77 A;  3BI0 A;  4KSF A;  3SXN A;  3ZJ0 A;  4DJL A;  4X5K A;  2EK9 A;  4B10 A;  4DUK A;  3NH4 A;  3KQX A;  3KQZ A;  1ARM A;  2Q4Y A;  3IIB A;  2GFQ A;  4JXQ A;  5FVJ A;  1Z9U A;  2ZEM A;  3I9S A;  3LOD A;  1F57 A;  1M1D A;  2ATR A;  2CY2 A;  4PPZ A;  5F49 A;  5H86 A;  5KTC A;  4I49 A;  2OR4 A;  2ZEE A;  4ONW A;  5EMI A;  3H8G A;  4QVT A;  4P4I A;  1WWZ A;  3CPA A;  3WC6 A;  3V7Z A;  1CX8 A;  1DE4 C;  4TNU A;  4M6G A;  3RAM A;  5HH1 A;  2PE3 A;  3D2M A;  3RNZ A;  1Z4E A;  1ARL A;  3RBU A;  3D7H A;  1HEE A;  4EVY A;  4RUH A;  3KKW A;  3GKR A;  1L0C A;  2R7H A;  3TCV A;  4KOT A;  4PSX A;  1S7N A;  4MJ8 A;  5AGE A;  1M4D A;  3VWD A;  2BUE A;  4AG9 A;  1QMU A;  2WZN A;  3D7D A;  4XPD C;  5HVH A;  4F9V A;  3DR6 A;  3PFE A;  2OU2 A;  1I21 A;  3N5F A;  2HB6 A;  1U6M A;  4MXU A;  5CPA A;  2IMO A;  2Q7S A;  3F5B A;  2Q51 A;  1TXR A;  4CRY B;  1IY7 A;  3H8F A;  2ZXV A;  2IQ6 A;  3L2N A;  2EVN A;  1IIC A;  1I1D A;  3D66 A;  3PZJ A;  1NE9 A;  1BLL E;  4M6H A;  4P4B A;  1YVO A;  2CF4 A;  2YNE A;  1Y0Y A;  3ZZI A;  4FWU A;  1B87 A;  2PJ0 A;  2ZOG A;  4B13 A;  3S9L A;  4RI1 A;  4B5P A;  3FX6 A;  2AFW A;  3FED A;  4B5P B;  3IU1 A;  4NFR A;  2AFS A;  4JJX A;  3IGR A;  4XPD B;  4M3S A;  4MHN A;  4KOY A;  4NF1 A;  4A30 A;  3D7F A;  3TC8 A;  2WYR A;  4CYQ A;  2P6G A;  3WAB A;  2OZH A;  3BI1 A;  4FUU A;  4UWJ A;  3QAY A;  3LWU A;  1BOB A;  4MHP A;  2NMT A;  3KZW A;  5KTA A;  1QQ9 A;  4Q38 A;  1ELL P;  4KVO E;  1BPN A;  1Q7L A;  2GLJ A;  3B3T A;  2O53 A;  4CAX A;  2PJ1 A;  2PJ8 A;  6CPA A;  1TF9 A;  2D4P A;  4PK3 A;  3PB9 X;  4E2A A;  1F2O A;  3CZX A;  4QUS A;  2GRE A;  2YNC C;  2CNT A;  1TKH A;  4NEX A;  4R7M A;  1RO5 A;  2OZU A;  2ZEF A;  3FXT A;  2Z3O A;  3T8W A;  4X3R A;  3PBB A;  4A95 A;  2BEI A;  3B3S A;  5AG5 A;  3FMC A;  2QML A;  1QSR A;  4UCM A;  3H8E A;  2I00 A;  3KR5 A;  1V0C A;  3P2F A;  4Z65 A;  4CGP A;  2GLF A;  4M85 A;  3SHP A;  3B2Y A;  2FSR A;  3FRM A;  4Q36 A;  2REE A;  2ZW4 A;  2PR8 A;  2KCW A;  3KHZ A;  5F47 A;  4CYO A;  4JXR A;  2GAN A;  3GUX A;  5THW A;  4C68 A;  1ZO0 A;  5G1Z A;  1IOI A;  2JEV A;  4MHD A;  5JQ4 A;  1Z8L A;  2G9D A;  4KSA A;  4YGO A;  2C6P A;  4DNC A;  1RTQ A;  4MFZ A;  5IB9 A;  4PK2 A;  3FEC A;  2Q44 A;  4H89 A;  3FEE A;  1IU8 A;  1LFW A;  3VAT A;  5IB0 A;  4XNH B;  4OLL A;  1QSO A;  4MCP A;  1N71 A;  3D2P A;  4H2K A;  3PEI A;  1IB1 E;  2BOA A;  4LX9 A;  1VHE A;  2FS5 A;  4A38 A;  4KLW A;  4CAV A;  2HC9 A;  2Z3P A;  4BD9 A;  1KZF A;  3FNC A;  2Z3N A;  4MFQ A;  3GYA A;  4OC5 A;  2B58 A;  4YU9 A;  2REF A;  2V8H A;  2YND A;  2ZW5 A;  3FYN A;  2ZW6 A;  3K9T A;  1XJO A;  5LYI A;  4OP4 A;  5E96 A;  4FD7 A;  3QNV A;  3NA6 A;  4KSI A;  3HLP A;  4CAF A;  4KOU A;  4FBE A;  1Z8W A;  1YRE A;  2ZEH A;  1S3Z A;  4HPS A;  1YQE A;  1ELM P;  4NSQ A;  2RFH A;  2CIJ A;  2ZED A;  3GB0 A;  4NGQ A;  3MN8 A;  2PJ6 A;  5A27 A;  2J9A A;  2FVG A;  1XE4 A;  3MRU A;  5H84 A;  2Z11 A;  4MHZ A;  1AYE A;  4CGO A;  4AG7 A;  3CXP A;  2JDD A;  4M6I A;  3SXO A;  2QIR A;  1NSL A;  1PUA A;  1Y9W A;  5AG7 A;  3T9Y A;  1M4G A;  3ISX A;  2K5T A;  2DEA A; 
#chains in the Genus database with same CATH homology
 2AJ6 A;  3JUW A;  5DWN A;  3EC4 A;  5AG6 A;  3GY9 A;  4KVX A;  2DPT A;  4R57 A;  2Q04 A;  4KS9 A;  4AVC A;  4UCP A;  1J4J A;  3F8K A;  2GIV A;  3UY5 A;  3C26 A;  4MY3 A;  1YVK A;  4KOR A;  4MFJ A;  3G8W A;  3R9G A;  4F0Y A;  1RXT A;  4MFL A;  1K4J A;  2FXF A;  1CM0 A;  3D3S A;  4B12 A;  4KOV A;  1KUY A;  1M4I A;  2WSA A;  1WK4 A;  4F6A A;  3B8G A;  2CNS A;  5G21 A;  4ONU A;  4RS2 A;  2EUI A;  3S6H A;  2Z0Z A;  3I3G A;  1CJW A;  4XPK A;  2JDC A;  1Y9K A;  2WUU A;  4KOX A;  4MFK A;  3FB3 A;  4UA3 A;  3W6X A;  2PDO A;  4PSW A;  4U9Z A;  4UBR A;  5CNP A;  4OAE A;  1YR0 A;  4LUA A;  4KZT A;  3W6S A;  5KTD A;  2YGW A;  3RYO A;  2VBQ A;  1VKC A;  1I12 A;  3EO4 A;  2HQY A;  4C7I A;  3JTK A;  1QSN A;  4OAD A;  3TO6 A;  4PV6 A;  2P0W A;  4CYN A;  4UFX A;  5G22 A;  4A2Z A;  1KUV A;  4HKF A;  4XNH C;  3E0K A;  2C27 A;  4B5O A;  3LD2 A;  3QB8 A;  4A32 A;  5C88 A;  2ARH A;  2Y0M A;  4FD5 A;  2OB0 A;  2R1I A;  1QSM A;  2WPW A;  5EC4 A;  1Z4R A;  4B11 A;  5HMN A;  2AE6 A;  2PSW A;  4XPL A;  1S7F A;  4L8A A;  4A33 A;  1Q2Y A;  2IL4 A;  4MY0 A;  3D8P A;  1QST A;  2CNM A;  4U9Y A;  2A4N A;  3IWE A;  4CYP A;  1P4N A;  1YX0 A;  4CGM A;  2Q0Y A;  4UFW A;  1MJ9 A;  1Y7R A;  4AVA A;  2VI7 A;  2CXA A;  2Q7B A;  3R96 A;  2B3V A;  1TIQ A;  2G3T A;  4FD4 A;  4JLY A;  1NMT A;  3OWC A;  2B5G A;  2DXQ A;  5GCN A;  2B5G B;  3T90 A;  3WR7 A;  5A28 A;  3TO9 A;  2FIA A;  4FD6 A;  3DNS A;  5J8F A;  2X7B A;  2RC4 A;  1SQH A;  3R9F A;  5C82 A;  2PQ8 A;  4R9M A;  3TO7 A;  2I79 A;  4HNW B;  4IF5 A;  1S7K A;  4R3K A;  4C2Y A;  2J8M A;  4QBJ A;  5AG4 A;  2Z10 A;  4ORF A;  1P0H A;  4UCN A;  3FBU A;  3V8I A;  4H6U A;  3TOB A;  4KUA A;  3BJ8 A;  4HNY B;  2Z3L A;  4C2X A;  2H5M A;  4UFV A;  2VZY A;  4Y49 C;  2VZZ A;  4ZBG A;  3BJ7 A;  4F0X A;  2ZPA A;  3IU2 A;  1XEB A;  2QEC A;  4UWI A;  4H6Z A;  5EBV A;  3A9L A;  1IYK A;  1R57 A;  4KOW A;  4KUB A;  4QB9 A;  3N7Z A;  2VEZ A;  1S60 A;  4E8O A;  2JLM A;  4MBU A;  4K30 A;  2O28 A;  3R9E A;  4CGN A;  2FIW A;  5F48 A;  4JD6 A;  1OZP A;  4AVB A;  3QAH A;  4KOS A;  1XF8 A;  3S6F A;  4Y49 B;  2PC1 A;  2DPS A;  4QC6 A;  4BBH A;  2R8V A;  2B4B A;  2G0B A;  2R98 A;  2F5I A;  2FT0 A;  1S7L A;  3VWE A;  4IUS A;  2PRB A;  1IID A;  4BMH A;  1VHS A;  4NXY A;  3CXQ A;  5IX3 A;  1UFH A;  4CGL A;  2BL1 A;  1YLE A;  2FCK A;  2HUZ A;  3S6K A;  3K9U A;  2WPX A;  4CS0 B;  4E0A A;  4R3L A;  4CAW A;  2Z3K A;  3TTH A;  5J8C A;  4MI4 A;  4U5Y A;  3EXN A;  4KVM E;  3EFA A;  5F46 A;  4II9 A;  2J8R A;  4YRH A;  4AB7 A;  4KLV A;  5ISV A;  4MFP A;  4NCZ A;  2HV2 A;  4J3G A;  1ON0 A;  2BSW A;  2FE7 A;  3TT2 A;  1XMT A;  3PP9 A;  2OZG A;  4CRZ B;  2ZW7 A;  1LRZ A;  2Z3M A;  3PGP A;  1Q2C A;  2VQY A;  3FIX A;  3R95 A;  3BLN A;  4JWP A;  2GE3 A;  3P2H A;  5DWM A;  3DDD A;  3TFY A;  1MJB A;  2D4O A;  3TE4 A;  3NE7 A;  2VXK A;  1PU9 A;  1YGH A;  3H4Q A;  5G20 A;  2G3A A;  1MJA A;  4C2Z A;  4L89 A;  3IWG A;  2YNC A;  3W91 A;  4A31 A;  3JVN A;  5BWA B;  3G3S A;  4GS4 A;  4YFJ A;  3F0A A;  5IV0 A;  1GHE A;  4ZGY B;  1IYL A;  1MK4 A;  1Q2D A;  1M44 A;  3DR8 A;  4C7H A;  3MGD A;  3S6G A;  3EY5 A;  1B6B A;  1FY7 A;  2P6E A;  4R87 A;  4HNX B;  3TOA A;  1BO4 A;  2B3U A;  3H5Z A;  2P6F A;  2J8N A;  2OH1 A;  2PR1 A;  2Q4V A;  3DSB A;  3CXS A;  3R1K A;  4CAE A;  1S5K A;  5JPH A;  4B14 A;  1XIX A;  2B4D A;  1YK3 A;  1KUX A;  2B4D B;  2FL4 A;  4KSF A;  3SXN A;  3ZJ0 A;  4X5K A;  4B10 A;  2Q4Y A;  5FVJ A;  4JXQ A;  1Z9U A;  3I9S A;  3LOD A;  5H86 A;  2ATR A;  1M1D A;  2CY2 A;  5I0C A;  5F49 A;  5KTC A;  4I49 A;  4QVT A;  1WWZ A;  5HH1 A;  3D2M A;  1Z4E A;  4EVY A;  3KKW A;  3GKR A;  1L0C A;  2R7H A;  3TCV A;  4KOT A;  4PSX A;  1S7N A;  4MJ8 A;  5AGE A;  1M4D A;  3VWD A;  2BUE A;  4AG9 A;  4XPD C;  3DR6 A;  2OU2 A;  1I21 A;  1U6M A;  3F5B A;  4CRY B;  2ZXV A;  3PZJ A;  2EVN A;  1IIC A;  1I1D A;  1NE9 A;  3ZZI A;  1YVO A;  2YNE A;  4B13 A;  1B87 A;  4RI1 A;  4B5P A;  4B5P B;  3IU1 A;  4JJX A;  4XPD B;  3IGR A;  4M3S A;  4NF1 A;  4KOY A;  4A30 A;  4CYQ A;  2P6G A;  2OZH A;  4UWJ A;  1BOB A;  5KTA A;  2NMT A;  4Q38 A;  4KVO E;  4CAX A;  2D4P A;  4PK3 A;  4E2A A;  4QUS A;  2YNC C;  2CNT A;  4NEX A;  1RO5 A;  2OZU A;  3FXT A;  2Z3O A;  4A95 A;  2BEI A;  5AG5 A;  2QML A;  1QSR A;  4UCM A;  2I00 A;  1V0C A;  3P2F A;  4CGP A;  4M85 A;  3SHP A;  2FSR A;  3FRM A;  4Q36 A;  2REE A;  2ZW4 A;  2PR8 A;  2KCW A;  5F47 A;  4CYO A;  4JXR A;  2GAN A;  4C68 A;  1ZO0 A;  5G1Z A;  4MHD A;  2JEV A;  5JQ4 A;  4KSA A;  4YGO A;  4DNC A;  4MFZ A;  4PK2 A;  2Q44 A;  4H89 A;  5IB0 A;  4XNH B;  4OLL A;  1QSO A;  1N71 A;  3D2P A;  4LX9 A;  1IB1 E;  2FS5 A;  4KLW A;  4CAV A;  2Z3P A;  1KZF A;  3FNC A;  2Z3N A;  4MFQ A;  3GYA A;  2B58 A;  2REF A;  3FYN A;  2YND A;  2ZW5 A;  2ZW6 A;  5E96 A;  4FD7 A;  4CAF A;  4KOU A;  1YRE A;  1S3Z A;  4NSQ A;  5A27 A;  1XE4 A;  5H84 A;  2Z11 A;  4CGO A;  4AG7 A;  3CXP A;  2JDD A;  3SXO A;  2QIR A;  1NSL A;  1PUA A;  1Y9W A;  5AG7 A;  3T9Y A;  1M4G A;  2K5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...