2D4OA

Crystal structure of ttha1254 (i68m mutant) from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRMEGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA1254
publication title Crystal structure of TTHA1254 (I68M mutant) from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 33
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09390 DUF1999 Protein of unknown function (DUF1999)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2d4oA00
3TFYA 1FY7A 2HV2A 4CAWA 2PR8A 3R9EA 3DDDA 3B8GA 4QB9A 1WK4A 5H86A 4PV6A 4XPKA 4F6AA 3PGPA 3F8KA 3T9YA 1YLEA 1IB1E 2K5TA 3TO6A 1KUVA 3N7ZA 4NSQA 3BJ7A 4E0AA 2B5GB 3W6XA 2D4OA 4PK2A 4B5PB 5DWNA 4KUBA 3F0AA 2R98A 4RI1A 5JPHA 3TT2A 1IICA 1YR0A 2P6GA 2FT0A 5ISVA 1MJAA 1XEBA 2R8VA 2R7HA 5IX3A 2VXKA 4CS0B 3DR6A 1NMTA 2EVNA 2PQ8A 4R9MA 1S7LA 5H84A 4KVOE 4L89A 2Y0MA 4U5YA 3TOAA 4R3KA 1M4IA 2B58A 3V8IA 3EFAA 3S6FA 4KUAA 1LRZA 2ARHA 4L8AA 4UWIA 4KOYA 4JD6A 2P6FA 3R1KA 2VZZA 4E2AA 2O28A 1I21A 4FD7A 3JUWA 1SQHA 1S5KA 4UBRA 2BL1A 5EC4A 1S3ZA 4JLYA 4JXQA 3QAHA 5J8FA 3P2HA 4EVYA 3TOBA 1WWZA 4KOTA 3FBUA 1BO4A 2B4DB 2CNSA 1S7FA 1IYKA 1M1DA 1YVKA 5HMNA 1QSOA 2WPWA 1B87A 4AG9A 2Q7BA 4LUAA 3EY5A 4AVAA 3F5BA 1XIXA 2Z10A 4QC6A 4K30A 3FIXA 1QSRA 2HUZA 1ON0A 2OB0A 5C88A 1RXTA 3JVNA 3R9FA 2QIRA 3G8WA 2B3UA 3E0KA 3I3GA 4YRHA 2QMLA 1IIDA 3TO9A 5KTAA 1YREA 4AVCA 2ZW5A 2OH1A 3DNSA 2FIAA 2J8MA 2Q4VA 4NCZA 3FRMA 1Y9KA 2B4BA 1Q2CA 3DR8A 1QSMA 1YK3A 3ZJ0A 2B5GA 4H6ZA 1QSNA 4B5PA 5KTDA 2G3TA 2J8NA 1XF8A 4RS2A 3KKWA 1I12A 3EO4A 3GY9A 4IUSA 4R57A 5DWMA 4KOXA 2VBQA 3TE4A 2Z0ZA 1VHSA 4NXYA 4H6UA 2D4PA 1R57A 3D2PA 4Y49C 4MJ8A 2FE7A 2PSWA 4I49A 3D2MA 4NF1A 2DXQA 3RYOA 2GANA 2BUEA 1YX0A 2PC1A 4MBUA 1M4GA 1NSLA 1BOBA 4NEXA 4II9A 2OZHA 2JLMA 4QBJA 4XNHC 4PK3A 2FSRA 3VWDA 4JJXA 2PRBA 3BJ8A 1Q2DA 3EXNA 2B4DA 2EUIA 3FB3A 3OWCA 2P0WA 2ZXVA 2R1IA 3W91A 4MHDA 1N71A 4GS4A 4XPDC 3W6SA 2B3VA 4CAXA 4HNXB 3K9UA 3PP9A 3GKRA 4XNHB 4KZTA 5E96A 4CAVA 4HNWB 3ZZIA 2I79A 3NE7A 4PSXA 2A4NA 2CNMA 4E8OA 1KUYA 3D8PA 3BLNA 1PU9A 2HQYA 1MK4A 2IL4A 5F47A 2FS5A 2FXFA 4JWPA 3LODA 3GYAA 2CNTA 3UY5A 1V0CA 1IYLA 4AG7A 2REFA 1Y7RA 4H89A 2Q04A 5IB0A 1S7NA 2FIWA 4ONUA 1UFHA 2H5MA 2BSWA 2Z11A 2FCKA 1KZFA 2CY2A 4LX9A 4BMHA 3WR7A 2ZPAA 3FXTA 4UA3A 3TCVA 1XE4A 4FD4A 5J8CA 3FNCA 4J3GA 5CNPA 4QUSA 3S6KA 4DNCA 3C26A 5C82A 2BEIA 2OZUA 4HKFA 4FD5A 1RO5A 4YGOA 1Q2YA 1KUXA 3IGRA 3CXSA 2WPXA 3TTHA 4UWJA 3LD2A 4M85A 3CXPA 1Z4RA 3P2FA 2ZW6A 3IWGA 2REEA 1OZPA 2F5IA 1MJ9A 4KORA 4CRYB 2ZW4A 1MJBA 2ATRA 4QVTA 3PZJA 3CXQA 4F0YA 1J4JA 4HNYB 5F48A 5GCNA 4MI4A 4FD6A 5KTCA 1VKCA 5F46A 2GIVA 4M3SA 1S60A 2AE6A 4CRZB 1Z4EA 2AJ6A 3VWEA 5FVJA 3MGDA 2VZYA 1M44A 4KLVA 4Y49B 5IV0A 4KLWA 3R9GA 2FL4A 3H4QA 3T90A 4B5OA 4KOVA 1CM0A 2J8RA 1S7KA 3I9SA 4IF5A 3QB8A 3S6GA 4OAEA 2Q44A 1Z9UA 2OZGA 3TO7A 2GE3A 4OLLA 2ZW7A 2P6EA 1P0HA 2OU2A 3SXNA 2G3AA 2JDCA 4KVME 4XPLA 3D3SA 3DSBA 4KVXA 4U9YA 2Q0YA 4MY0A 2I00A 3SHPA 4MY3A 4KOWA 4KOSA 4XPDB 2X7BA 1CJWA 4OADA 5I0CA 1YGHA 2JEVA 2VEZA 3S6HA 1NE9A 3R95A 2NMTA 5HH1A 3G3SA 1QSTA 1XMTA 5EBVA 2C27A 2Q4YA 1K4JA 1B6BA 4JXRA 1TIQA 4X5KA 4ORFA 2KCWA 1GHEA 2VI7A 4YFJA 1M4DA 2JDDA 4AVBA 1Y9WA 1P4NA 2G0BA 1I1DA 2PR1A 3FYNA 5JQ4A 2PDOA 1YVOA 3SXOA 4R3LA 4PSWA 1L0CA 4KOUA 2VQYA 2QECA 4U9ZA 1U6MA 4AB7A 1PUAA 2RC4A 3EC4A 4ZBGA 5F49A 4R87A 3R96A
chains in the Genus database with same CATH superfamily
5G22A 3A9LA 4MFKA 3TFYA 1FY7A 2HV2A 4UEFA 3TC8A 4CAWA 2PR8A 3R9EA 2PJ0A 3DDDA 3B8GA 4NGRA 4WWVA 3I1UA 4QB9A 1WK4A 4UCNA 1HEEA 5H86A 4A39A 4A33A 1ZLIA 5G21A 4PV6A 4XPKA 5LRGA 4F6AA 3PGPA 3F8KA 1PCAA 3PB7X 4NGTA 3T9YA 1YLEA 2O53A 2Z3NA 3QAYA 1IB1E 2K5TA 3TO6A 1KUVA 3N7ZA 2PJCA 3S9LA 4NSQA 2C6CA 3CZXA 4MFPA 2EWBA 3BJ7A 2B5GB 4E0AA 4ONWA 3W6XA 2D4OA 4PK2A 4B5PB 5DWNA 4KUBA 2ZOGA 3F0AA 4PXDA 1XBUA 2R98A 3D7FA 2PJBA 3S9NA 4RI1A 3RBUA 3TT2A 5JPHA 2IQ6A 2DF5A 3CPXA 4X2TA 1IICA 5CPAA 4EFDA 4ZGYB 1YR0A 4DYOA 3KHZA 4H2KA 2P6GA 2FT0A 5AG4A 5ISVA 1LAMA 1MJAA 1VHEA 3CPAA 2PIYA 4R6TA 4M6IA 1XEBA 2R8VA 2R7HA 2YNCC 4KSAA 2PE3A 3D7GA 2VXKA 3DGVA 3H8FA 4CAEA 5IX3A 4CS0B 4OC0A 2GREA 2I3CA 4NFRA 2OOTA 1NSAA 4MCPA 1XRYA 2AFZA 3DR6A 1NMTA 2EVNA 2PQ8A 3QNVA 4R9MA 2F8HA 1S7LA 2XEIA 5H84A 4CYQA 4R76A 4P4JA 2AFSA 2Z3PA 3KR4A 2V8VA 4TWEA 4KVOE 4L89A 4M6GA 4UIAA 1IY7A 4HPSA 3MRUA 1JWQA 4B13A 3K2KA 2Y0MA 1PYTB 4U5YA 4R3KA 1ARMA 1M4IA 2B58A 3TOAA 3V8IA 3EFAA 3S6FA 4KUAA 4OC4A 4UEEA 3SI1A 1A2ZA 3TX8A 4CGPA 4C7HA 1LRZA 2IMOA 2ARHA 4UFWA 3JTKA 4L8AA 4UWIA 4KOYA 4JD6A 4PQAA 4BD9A 2P6FA 3R1KA 2VZZA 4E2AA 4F8ZA 2O28A 5THWA 1I21A 2WYRA 4FD7A 6CPAA 3JUWA 1SQHA 1UWYA 1S5KA 3KI9A 4UBRA 2BL1A 3FMCA 5EC4A 1S3ZA 1JQGA 2HC9A 4JLYA 4JXQA 3QAHA 2CF4A 3FECA 5J8FA 2JEWA 3P2HA 4BINA 4EVYA 3TOBA 1WWZA 4KOTA 3FBUA 4FWUA 1BO4A 2B4DB 2CNSA 5HVGA 1S7FA 3H8EA 4P4EA 2PVWA 1IYKA 4ZY1A 2BOAA 3BI0A 4NGSA 4CGOA 4MFZA 1M1DA 1YVKA 4OIWA 1F2OA 1QSOA 2WPWA 5HMNA 1B87A 2Q43A 4AG9A 2XEJA 2Q7BA 5LYFA 2PVVA 1GYTA 1YSJA 1AUGA 2CXAA 2PJ9A 3EY5A 4LUAA 2PJ3A 4NGQA 4AVAA 5JH9A 4OP4A 3F5BA 1XIXA 3GLJA 2Z10A 4QC6A 1XOVA 4K30A 2ZEPA 4Q36A 2YNEA 3FIXA 4Z65A 4ZYQA 1QSRA 1Z2LA 3IC1A 2HUZA 1ON0A 2WUUA 3KQZA 5G1ZA 3WC5A 4C2ZA 2OB0A 5C88A 1RXTA 3JVNA 2QVPA 3R9FA 4FBEA 4C2XA 2QIRA 3FEDA 3KQXA 4ZX9A 2BO9A 4ZY2A 3G8WA 5IB9A 2B3UA 3E0KA 3B3TA 3I3GA 4JZ0A 4YRHA 4ZY0A 1ELMP 2QMLA 3NH5A 1IIDA 3FJUA 3TO9A 5KTAA 1BLLE 1DE4C 1YREA 4AVCA 2ZW5A 2OH1A 4RN7A 3DNSA 4A94A 4NGNA 2FIAA 2J8MA 2PJ1A 4IAVA 4B14A 2PJ7A 2Q4VA 4NCZA 3FRMA 2FVGA 1DTDA 3FEEA 2XEGA 1Y9KA 2B4BA 1Q2CA 1TXRA 2PJ2A 1QSMA 1YK3A 1YW4A 2ZENA 3DR8A 4G1PA 3GUXA 4R87A 5ELYA 2B5GA 4H6ZA 3WC6A 3ZJ0A 4DJLA 8CPAA 1QSNA 4B5PA 5KTDA 5G20A 2G3TA 2J8NA 1XF8A 5AG7A 4UEZA 3V7ZA 1X12A 4RS2A 3KKWA 1I12A 4B11A 2J9AA 1CPXA 4P4IA 3EO4A 2ZELA 3GY9A 4IUSA 4M6HA 4KOXA 4P4DA 4R57A 5DWMA 2VBQA 3ISZA 3TE4A 2Z0ZA 4CYOA 1VHSA 5K8MA 1QQ9A 2EK8A 5CBMA 4FUUA 4NXYA 3B2YA 4H6UA 4P45A 1F2PA 4OKOA 2D4PA 1R57A 4UIBA 3D2PA 3D66A 1Z5RA 4IHMA 4CGLA 4Y49C 4MJ8A 2FE7A 4MHPA 2PSWA 1ZLHA 4OMEA 2PCUA 1YW6A 4I49A 3D2MA 2ABZA 4NF1A 3N5FA 3H5ZA 2DXQA 3RYOA 2GANA 2JBJA 2WSAA 4P10A 4OC1A 2Z3KA 5HVFA 2ODFA 2BUEA 2QJ8A 2V8GA 1YX0A 4A38A 2PC1A 3B3WA 4NJRA 4MBUA 4NJQA 4MCSA 3PRTA 1IGBA 1HDUA 3HLPA 4Q38A 5D29A 1M4GA 1NSLA 3VH9A 5K8OA 2EBJA 1BOBA 4NEXA 4II9A 2OZHA 4CYPA 5LRKA 2RB7A 2JLMA 4A37A 1CP6A 2PIZA 4QBJA 2C6GA 3LACA 5K8PA 4XNHC 2YNCA 4OC3A 1LAPA 1XMBA 4PK3A 3SJEA 1XJOA 2FSRA 3IEHA 4MXUA 2QYVA 4JJXA 4P6YA 3VWDA 3PFOA 2PRBA 3BJ8A 3B3CA 1Q2DA 3CDXA 3D7HA 1LANA 3EXNA 1Z8LA 2V77A 2Q4ZA 3ISXA 1VHOA 2B4DA 2AFUA 1VIXA 2EUIA 1Y0RA 3D4UA 3FB3A 1IOFA 1EE3P 3OWCA 2P0WA 1FNOA 2ZXVA 2R1IA 2CTCA 4O23A 3W91A 4MHDA 1M4LA 4ZI6A 3NH8A 1N71A 4IK2A 4GS4A 4XPDC 1TKJA 3KASA 3T8WA 3W6SA 1AYEA 3KL9A 4TNUA 2B3VA 4MFJA 5JGFA 3GB0A 1Z8TA 4HNXB 4Q7AA 3L2NA 4CAXA 3K9UA 3KGQA 4P4FA 3PP9A 3GKRA 4LQ6A 4XNHB 4KZTA 1CBXA 5E96A 3SJGA 4CAVA 3B35A 4HNWB 3DLJA 3IWWA 2VL1A 3CT9A 3ZZIA 3B7IA 3JRUA 4MHZA 3IFEA 3KR5A 4W9YA 3NA6A 2I79A 3WABA 4A31A 3NE7A 4PSXA 1ZO0A 2A4NA 5A27A 3S9MA 2CNMA 4PXBA 4LQGA 4E8OA 2AFOA 4CYNA 4MFLA 1KUYA 2BCOA 3D8PA 2G9DA 3BLNA 1PU9A 2HQYA 5D8NA 1MK4A 2IL4A 5F47A 2FS5A 1TF9A 2FXFA 4JWPA 3LODA 1H8LA 3GYAA 4MMOA 4A2ZA 4YU9A 5A28A 2CNTA 4P44A 3LMSA 1X10A 3UY5A 4RUHA 1V0CA 7CPAA 1IYLA 1ZG7A 3KHXA 4AG7A 4X8IA 2GFQA 2REFA 1Y7RA 4H89A 2ZEEA 5JM6A 2Q04A 1CG2A 4EMEA 5IB0A 1VGYA 1S7NA 4CGMA 1BPMA 2FIWA 4ONUA 1UFHA 3IU1A 2H5MA 2BSWA 2Z11A 2FCKA 1KZFA 1BAVA 2CY2A 1F57A 4LX9A 4UCMA 4BMHA 2PJ8A 3WR7A 2ZPAA 3FXTA 4UA3A 2ZEOA 3TCVA 1ZG9A 4MHYA 4OC2A 5DS0A 1XE4A 4B6ZA 5K8NA 4FD4A 5J8CA 3FNCA 3RZAA 1HDQA 4J3GA 4MHNA 4B12A 5CNPA 2Z3OA 5J1QA 4QUSA 3S6KA 4CGNA 4MRIA 4DNCA 2PJ5A 3PFEA 3C26A 3SJXA 5C82A 2BEIA 2OZUA 4HKFA 4CPAA 3FF3A 4FD5A 4FAIA 3V38A 1RO5A 2DEAA 2ZOFA 4YGOA 1Q2YA 1KUXA 3IGRA 3CXSA 2WPXA 3BI1A 4UWJA 5AG6A 4KSIA 3RNZA 1R43A 3TTHA 3LD2A 4M85A 3CXPA 1Q7LA 1Z4RA 3P2FA 4B10A 2EK9A 2ZW6A 2JBKA 1R3NA 2EO8A 3SI2A 3IWGA 1YLOA 1OZPA 2F5IA 2REEA 3D67A 1LCPA 1MJ9A 1TKHA 5LYIA 4KORA 4CRYB 3WT4A 2POKA 3K9TA 1XFOA 2ZW4A 1MJBA 3D68A 4X3RA 2IJZA 2ATRA 4QVTA 4ZX8A 3PB6X 3PZJA 3CXQA 4F0YA 2CIJA 4C2YA 5I4MA 1J4JA 4HNYB 1YMEA 5F48A 1RTQA 5GCNA 4MI4A 3IO1A 5HXDA 4FD6A 2HB6A 5KTCA 4NGMA 3NH4A 1VKCA 5F46A 2GIVA 1ZG8A 4C7IA 3B3VA 4M3SA 1S60A 2AE6A 4PPZA 1IOIA 4CRZB 1Z4EA 2AJ6A 3VWEA 2YGWA 5FVJA 2V8DA 2DPSA 3MGDA 2VZYA 1BPNA 1M44A 4KLVA 4Y49B 3RO0A 3SI0A 4AXVA 5IV0A 3PBEA 4KLWA 4WJBA 3R9GA 2FL4A 3H4QA 3T90A 4B5OA 1YQEA 5LYLA 4KOVA 2GLFA 1Z8WA 3SJFA 1CM0A 5EMIA 2ZEDA 2J8RA 1S7KA 3I9SA 3IIBA 1TF8A 4IF5A 3NFZA 2C6PA 2YNDA 3PB8X 3QB8A 1FT7A 3S6GA 3HUVA 4F0XA 4MFQA 3PBBA 2Q44A 3FH4A 1CP7A 1Z9UA 4GXHA 4OAEA 3WC7A 2OZGA 3TO7A 2GE3A 4KS9A 4OLLA 2ZW7A 2P6EA 2ZEHA 1ELLP 1P0HA 3FVLA 2OU2A 4PXEA 5LYDA 3SXNA 2ZEGA 2G3AA 2JDCA 2NYQA 4KVME 1TKFA 4P4BA 4UF4A 4XPLA 1LFWA 3D3SA 3DSBA 4KVXA 4MCRA 4PXCA 4U9YA 1AMPA 2PJAA 2Q0YA 5AG5A 2ZEFA 2I00A 4MY0A 3SHPA 2NSMA 3PB4X 2OR4A 2AFXA 3IWEA 4MY3A 4R7MA 4EWTA 1KWMA 4KOWA 4KOSA 2AFMA 4XPDB 3IJ3A 2X7BA 1CJWA 3NE8A 4OADA 2Q51A 4UFXA 5I0CA 1YGHA 2JEVA 2Z3MA 4UFVA 2VEZA 3S6HA 1NE9A 3R95A 2NMTA 1OBRA 4OIDA 5HH1A 4BBHA 3G3SA 3PB9X 4K3NA 1QSTA 2RFHA 1XMTA 5EBVA 1Z8XA 2PRQA 3MN8A 1CPSA 5F09A 2C27A 3IU2A 2Q4YA 1IU8A 2ANPA 2PJ6A 1K4JA 1B6BA 3BHXA 4JXRA 4C68A 1TIQA 1ARLA 2ZEMA 2C1CA 3PEIA 4JYWA 3VARA 4GM5A 2GLJA 2Z3LA 4X5KA 2PJ4A 4A30A 5BWAB 4ORFA 4A95A 2KCWA 4F9UA 4F9VA 3GIUA 3BXMA 1GHEA 2VI7A 3D7DA 4YFJA 1M4DA 3RAMA 2JDDA 4AVBA 1Y9WA 3LWUA 1P4NA 2G0BA 4KSFA 2O4HA 2AFWA 1I1DA 2PR1A 4CAFA 1LOKA 2V8HA 3FYNA 4MCQA 5JQ4A 3KZWA 2PDOA 1YVOA 3SXOA 4A32A 4R3LA 2F7VA 2WZNA 4YWYA 4PSWA 3VATA 5HVHA 1L0CA 1QMUA 2VQYA 4KOUA 2QECA 5AGEA 2Q7SA 3FX6A 4U9ZA 4UCPA 1U6MA 2CTBA 1PUAA 1Y0YA 2DPTA 4AB7A 3H8GA 4R8FA 2XEFA 4NGPA 4OC5A 2RC4A 1CX8A 5LRJA 3EC4A 4ZBGA 5F49A 3B3SA 4DUKA 1Y7EA 2GU2A 3R96A
chains in the Genus database with same CATH topology
5G22A 3A9LA 4MFKA 3TFYA 1FY7A 2HV2A 4CAWA 2PR8A 3R9EA 3DDDA 3B8GA 4QB9A 1WK4A 4UCNA 5H86A 4A33A 5G21A 4PV6A 4XPKA 4F6AA 3PGPA 3F8KA 3T9YA 1YLEA 2Z3NA 1IB1E 2K5TA 3TO6A 1KUVA 3N7ZA 4NSQA 4MFPA 3BJ7A 4E0AA 2B5GB 3W6XA 2D4OA 4PK2A 4B5PB 5DWNA 4KUBA 3F0AA 2R98A 4RI1A 5JPHA 3TT2A 1IICA 4ZGYB 1YR0A 2P6GA 2FT0A 5AG4A 5ISVA 1MJAA 1XEBA 2R8VA 2R7HA 2YNCC 4KSAA 4CAEA 5IX3A 2VXKA 4CS0B 3DR6A 1NMTA 2EVNA 2PQ8A 4R9MA 1S7LA 5H84A 4CYQA 2Z3PA 4KVOE 4L89A 4B13A 2Y0MA 4U5YA 3TOAA 4R3KA 1M4IA 2B58A 3V8IA 3EFAA 3S6FA 4KUAA 4CGPA 4C7HA 1LRZA 2ARHA 4UFWA 3JTKA 4L8AA 4UWIA 4KOYA 4JD6A 2P6FA 3R1KA 2VZZA 4E2AA 2O28A 1I21A 4FD7A 3JUWA 1SQHA 1S5KA 4UBRA 2BL1A 5EC4A 1S3ZA 4JLYA 4JXQA 3QAHA 5J8FA 3P2HA 4EVYA 3TOBA 1WWZA 4KOTA 3FBUA 1BO4A 2B4DB 2CNSA 1S7FA 1IYKA 4CGOA 4MFZA 1M1DA 1YVKA 5HMNA 1QSOA 2WPWA 1B87A 4AG9A 2Q7BA 2CXAA 4LUAA 3EY5A 4AVAA 3F5BA 1XIXA 2Z10A 4QC6A 4K30A 4Q36A 2YNEA 3FIXA 1QSRA 2HUZA 1ON0A 2WUUA 5G1ZA 4C2ZA 2OB0A 5C88A 1RXTA 3JVNA 3R9FA 4C2XA 2QIRA 3G8WA 2B3UA 3E0KA 3I3GA 4YRHA 2QMLA 1IIDA 3TO9A 5KTAA 1YREA 4AVCA 2ZW5A 2OH1A 3DNSA 2FIAA 2J8MA 4B14A 2Q4VA 4NCZA 3FRMA 1Y9KA 2B4BA 1Q2CA 3DR8A 1QSMA 1YK3A 3ZJ0A 2B5GA 4H6ZA 1QSNA 4B5PA 5KTDA 5G20A 2G3TA 2J8NA 1XF8A 5AG7A 4RS2A 3KKWA 1I12A 4B11A 3EO4A 3GY9A 4IUSA 4R57A 5DWMA 4KOXA 2VBQA 3TE4A 2Z0ZA 4CYOA 1VHSA 4NXYA 4H6UA 2D4PA 1R57A 3D2PA 4CGLA 4Y49C 4MJ8A 2FE7A 2PSWA 4I49A 3D2MA 4NF1A 3H5ZA 2DXQA 3RYOA 2GANA 2WSAA 2Z3KA 2BUEA 1YX0A 2PC1A 4MBUA 4Q38A 1M4GA 1NSLA 1BOBA 4NEXA 4II9A 2OZHA 4CYPA 2JLMA 4QBJA 4XNHC 2YNCA 4PK3A 2FSRA 3VWDA 4JJXA 2PRBA 3BJ8A 1Q2DA 3EXNA 2B4DA 2EUIA 3FB3A 3OWCA 2P0WA 2ZXVA 2R1IA 3W91A 4MHDA 1N71A 4GS4A 4XPDC 3W6SA 2B3VA 4MFJA 4CAXA 4HNXB 3K9UA 3PP9A 3GKRA 4XNHB 4KZTA 5E96A 4CAVA 4HNWB 3ZZIA 4A31A 2I79A 3NE7A 4PSXA 1ZO0A 2A4NA 5A27A 2CNMA 4E8OA 4CYNA 4MFLA 1KUYA 3D8PA 3BLNA 1PU9A 2HQYA 1MK4A 2IL4A 5F47A 2FS5A 2FXFA 4JWPA 3LODA 3GYAA 4A2ZA 5A28A 2CNTA 3UY5A 1V0CA 1IYLA 4AG7A 2REFA 1Y7RA 4H89A 2Q04A 5IB0A 1S7NA 4CGMA 2FIWA 4ONUA 1UFHA 3IU1A 2H5MA 2BSWA 2Z11A 2FCKA 1KZFA 2CY2A 4LX9A 4UCMA 4BMHA 3WR7A 2ZPAA 3FXTA 4UA3A 3TCVA 1XE4A 4FD4A 5J8CA 3FNCA 4J3GA 4B12A 5CNPA 2Z3OA 4QUSA 3S6KA 4CGNA 4DNCA 3C26A 5C82A 2BEIA 2OZUA 4HKFA 4FD5A 1RO5A 4YGOA 1Q2YA 1KUXA 3IGRA 3CXSA 2WPXA 5AG6A 4UWJA 3TTHA 3LD2A 4M85A 3CXPA 1Z4RA 3P2FA 4B10A 2ZW6A 3IWGA 2REEA 1OZPA 2F5IA 1MJ9A 4KORA 4CRYB 2ZW4A 1MJBA 2ATRA 4QVTA 3PZJA 3CXQA 4F0YA 4C2YA 1J4JA 4HNYB 5F48A 5GCNA 4MI4A 4FD6A 5KTCA 1VKCA 5F46A 2GIVA 4C7IA 4M3SA 1S60A 2AE6A 4CRZB 1Z4EA 2AJ6A 3VWEA 2YGWA 5FVJA 2DPSA 3MGDA 2VZYA 1M44A 4KLVA 4Y49B 5IV0A 4KLWA 3R9GA 2FL4A 3H4QA 3T90A 4B5OA 4KOVA 1CM0A 2J8RA 1S7KA 3I9SA 4IF5A 2YNDA 3QB8A 3S6GA 4F0XA 4MFQA 4OAEA 2Q44A 1Z9UA 2OZGA 3TO7A 2GE3A 4KS9A 4OLLA 2ZW7A 2P6EA 1P0HA 2OU2A 3SXNA 2G3AA 2JDCA 4KVME 4XPLA 3D3SA 3DSBA 4KVXA 4U9YA 2Q0YA 5AG5A 4MY0A 2I00A 3SHPA 3IWEA 4MY3A 4KOWA 4KOSA 4XPDB 2X7BA 1CJWA 4OADA 4UFXA 5I0CA 1YGHA 2JEVA 2Z3MA 4UFVA 2VEZA 3S6HA 1NE9A 3R95A 2NMTA 5HH1A 4BBHA 3G3SA 1QSTA 1XMTA 5EBVA 2C27A 3IU2A 2Q4YA 1K4JA 1B6BA 4C68A 4JXRA 1TIQA 2Z3LA 5BWAB 4X5KA 4A30A 4ORFA 4A95A 2KCWA 1GHEA 2VI7A 4YFJA 1M4DA 2JDDA 4AVBA 1Y9WA 1P4NA 2G0BA 4KSFA 4CAFA 1I1DA 2PR1A 3FYNA 5JQ4A 2PDOA 1YVOA 3SXOA 4A32A 4R3LA 4PSWA 1L0CA 4KOUA 2VQYA 5AGEA 2QECA 4U9ZA 4UCPA 1U6MA 4AB7A 1PUAA 2DPTA 2RC4A 3EC4A 4ZBGA 5F49A 4R87A 3R96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TFY A;  1FY7 A;  2HV2 A;  4CAW A;  2PR8 A;  3R9E A;  3DDD A;  3B8G A;  4QB9 A;  1WK4 A;  5H86 A;  4PV6 A;  4XPK A;  4F6A A;  3PGP A;  3F8K A;  3T9Y A;  1YLE A;  1IB1 E;  2K5T A;  3TO6 A;  1KUV A;  3N7Z A;  4NSQ A;  3BJ7 A;  4E0A A;  2B5G B;  3W6X A;  2D4O A;  4PK2 A;  4B5P B;  5DWN A;  4KUB A;  3F0A A;  2R98 A;  4RI1 A;  5JPH A;  3TT2 A;  1IIC A;  1YR0 A;  2P6G A;  2FT0 A;  5ISV A;  1MJA A;  1XEB A;  2R8V A;  2R7H A;  5IX3 A;  2VXK A;  4CS0 B;  3DR6 A;  1NMT A;  2EVN A;  2PQ8 A;  4R9M A;  1S7L A;  5H84 A;  4KVO E;  4L89 A;  2Y0M A;  4U5Y A;  3TOA A;  4R3K A;  1M4I A;  2B58 A;  3V8I A;  3EFA A;  3S6F A;  4KUA A;  1LRZ A;  2ARH A;  4L8A A;  4UWI A;  4KOY A;  4JD6 A;  2P6F A;  3R1K A;  2VZZ A;  4E2A A;  2O28 A;  1I21 A;  4FD7 A;  3JUW A;  1SQH A;  1S5K A;  4UBR A;  2BL1 A;  5EC4 A;  1S3Z A;  4JLY A;  4JXQ A;  3QAH A;  5J8F A;  3P2H A;  4EVY A;  3TOB A;  1WWZ A;  4KOT A;  3FBU A;  1BO4 A;  2B4D B;  2CNS A;  1S7F A;  1IYK A;  1M1D A;  1YVK A;  5HMN A;  1QSO A;  2WPW A;  1B87 A;  4AG9 A;  2Q7B A;  4LUA A;  3EY5 A;  4AVA A;  3F5B A;  1XIX A;  2Z10 A;  4QC6 A;  4K30 A;  3FIX A;  1QSR A;  2HUZ A;  1ON0 A;  2OB0 A;  5C88 A;  1RXT A;  3JVN A;  3R9F A;  2QIR A;  3G8W A;  2B3U A;  3E0K A;  3I3G A;  4YRH A;  2QML A;  1IID A;  3TO9 A;  5KTA A;  1YRE A;  4AVC A;  2ZW5 A;  2OH1 A;  3DNS A;  2FIA A;  2J8M A;  2Q4V A;  4NCZ A;  3FRM A;  1Y9K A;  2B4B A;  1Q2C A;  3DR8 A;  1QSM A;  1YK3 A;  3ZJ0 A;  2B5G A;  4H6Z A;  1QSN A;  4B5P A;  5KTD A;  2G3T A;  2J8N A;  1XF8 A;  4RS2 A;  3KKW A;  1I12 A;  3EO4 A;  3GY9 A;  4IUS A;  4R57 A;  5DWM A;  4KOX A;  2VBQ A;  3TE4 A;  2Z0Z A;  1VHS A;  4NXY A;  4H6U A;  2D4P A;  1R57 A;  3D2P A;  4Y49 C;  4MJ8 A;  2FE7 A;  2PSW A;  4I49 A;  3D2M A;  4NF1 A;  2DXQ A;  3RYO A;  2GAN A;  2BUE A;  1YX0 A;  2PC1 A;  4MBU A;  1M4G A;  1NSL A;  1BOB A;  4NEX A;  4II9 A;  2OZH A;  2JLM A;  4QBJ A;  4XNH C;  4PK3 A;  2FSR A;  3VWD A;  4JJX A;  2PRB A;  3BJ8 A;  1Q2D A;  3EXN A;  2B4D A;  2EUI A;  3FB3 A;  3OWC A;  2P0W A;  2ZXV A;  2R1I A;  3W91 A;  4MHD A;  1N71 A;  4GS4 A;  4XPD C;  3W6S A;  2B3V A;  4CAX A;  4HNX B;  3K9U A;  3PP9 A;  3GKR A;  4XNH B;  4KZT A;  5E96 A;  4CAV A;  4HNW B;  3ZZI A;  2I79 A;  3NE7 A;  4PSX A;  2A4N A;  2CNM A;  4E8O A;  1KUY A;  3D8P A;  3BLN A;  1PU9 A;  2HQY A;  1MK4 A;  2IL4 A;  5F47 A;  2FS5 A;  2FXF A;  4JWP A;  3LOD A;  3GYA A;  2CNT A;  3UY5 A;  1V0C A;  1IYL A;  4AG7 A;  2REF A;  1Y7R A;  4H89 A;  2Q04 A;  5IB0 A;  1S7N A;  2FIW A;  4ONU A;  1UFH A;  2H5M A;  2BSW A;  2Z11 A;  2FCK A;  1KZF A;  2CY2 A;  4LX9 A;  4BMH A;  3WR7 A;  2ZPA A;  3FXT A;  4UA3 A;  3TCV A;  1XE4 A;  4FD4 A;  5J8C A;  3FNC A;  4J3G A;  5CNP A;  4QUS A;  3S6K A;  4DNC A;  3C26 A;  5C82 A;  2BEI A;  2OZU A;  4HKF A;  4FD5 A;  1RO5 A;  4YGO A;  1Q2Y A;  1KUX A;  3IGR A;  3CXS A;  2WPX A;  3TTH A;  4UWJ A;  3LD2 A;  4M85 A;  3CXP A;  1Z4R A;  3P2F A;  2ZW6 A;  3IWG A;  2REE A;  1OZP A;  2F5I A;  1MJ9 A;  4KOR A;  4CRY B;  2ZW4 A;  1MJB A;  2ATR A;  4QVT A;  3PZJ A;  3CXQ A;  4F0Y A;  1J4J A;  4HNY B;  5F48 A;  5GCN A;  4MI4 A;  4FD6 A;  5KTC A;  1VKC A;  5F46 A;  2GIV A;  4M3S A;  1S60 A;  2AE6 A;  4CRZ B;  1Z4E A;  2AJ6 A;  3VWE A;  5FVJ A;  3MGD A;  2VZY A;  1M44 A;  4KLV A;  4Y49 B;  5IV0 A;  4KLW A;  3R9G A;  2FL4 A;  3H4Q A;  3T90 A;  4B5O A;  4KOV A;  1CM0 A;  2J8R A;  1S7K A;  3I9S A;  4IF5 A;  3QB8 A;  3S6G A;  4OAE A;  2Q44 A;  1Z9U A;  2OZG A;  3TO7 A;  2GE3 A;  4OLL A;  2ZW7 A;  2P6E A;  1P0H A;  2OU2 A;  3SXN A;  2G3A A;  2JDC A;  4KVM E;  4XPL A;  3D3S A;  3DSB A;  4KVX A;  4U9Y A;  2Q0Y A;  4MY0 A;  2I00 A;  3SHP A;  4MY3 A;  4KOW A;  4KOS A;  4XPD B;  2X7B A;  1CJW A;  4OAD A;  5I0C A;  1YGH A;  2JEV A;  2VEZ A;  3S6H A;  1NE9 A;  3R95 A;  2NMT A;  5HH1 A;  3G3S A;  1QST A;  1XMT A;  5EBV A;  2C27 A;  2Q4Y A;  1K4J A;  1B6B A;  4JXR A;  1TIQ A;  4X5K A;  4ORF A;  2KCW A;  1GHE A;  2VI7 A;  4YFJ A;  1M4D A;  2JDD A;  4AVB A;  1Y9W A;  1P4N A;  2G0B A;  1I1D A;  2PR1 A;  3FYN A;  5JQ4 A;  2PDO A;  1YVO A;  3SXO A;  4R3L A;  4PSW A;  1L0C A;  4KOU A;  2VQY A;  2QEC A;  4U9Z A;  1U6M A;  4AB7 A;  1PUA A;  2RC4 A;  3EC4 A;  4ZBG A;  5F49 A;  4R87 A;  3R96 A; 
#chains in the Genus database with same CATH topology
 5G22 A;  3A9L A;  4MFK A;  3TFY A;  1FY7 A;  2HV2 A;  4UEF A;  3TC8 A;  4CAW A;  2PR8 A;  3R9E A;  2PJ0 A;  3DDD A;  3B8G A;  4NGR A;  4WWV A;  3I1U A;  4QB9 A;  1WK4 A;  4UCN A;  1HEE A;  5H86 A;  4A39 A;  4A33 A;  1ZLI A;  5G21 A;  4PV6 A;  4XPK A;  5LRG A;  4F6A A;  3PGP A;  3F8K A;  1PCA A;  3PB7 X;  4NGT A;  3T9Y A;  1YLE A;  2O53 A;  2Z3N A;  3QAY A;  1IB1 E;  2K5T A;  3TO6 A;  1KUV A;  3N7Z A;  2PJC A;  3S9L A;  4NSQ A;  2C6C A;  3CZX A;  4MFP A;  2EWB A;  3BJ7 A;  2B5G B;  4E0A A;  4ONW A;  3W6X A;  2D4O A;  4PK2 A;  4B5P B;  5DWN A;  4KUB A;  2ZOG A;  3F0A A;  4PXD A;  1XBU A;  2R98 A;  3D7F A;  2PJB A;  3S9N A;  4RI1 A;  3RBU A;  3TT2 A;  5JPH A;  2IQ6 A;  2DF5 A;  3CPX A;  4X2T A;  1IIC A;  5CPA A;  4EFD A;  4ZGY B;  1YR0 A;  4DYO A;  3KHZ A;  4H2K A;  2P6G A;  2FT0 A;  5AG4 A;  5ISV A;  1LAM A;  1MJA A;  1VHE A;  3CPA A;  2PIY A;  4R6T A;  4M6I A;  1XEB A;  2R8V A;  2R7H A;  2YNC C;  4KSA A;  2PE3 A;  3D7G A;  2VXK A;  3DGV A;  3H8F A;  4CAE A;  5IX3 A;  4CS0 B;  4OC0 A;  2GRE A;  2I3C A;  4NFR A;  2OOT A;  1NSA A;  4MCP A;  1XRY A;  2AFZ A;  3DR6 A;  1NMT A;  2EVN A;  2PQ8 A;  3QNV A;  4R9M A;  2F8H A;  1S7L A;  2XEI A;  5H84 A;  4CYQ A;  4R76 A;  4P4J A;  2AFS A;  2Z3P A;  3KR4 A;  2V8V A;  4TWE A;  4KVO E;  4L89 A;  4M6G A;  4UIA A;  1IY7 A;  4HPS A;  3MRU A;  1JWQ A;  4B13 A;  3K2K A;  2Y0M A;  1PYT B;  4U5Y A;  4R3K A;  1ARM A;  1M4I A;  2B58 A;  3TOA A;  3V8I A;  3EFA A;  3S6F A;  4KUA A;  4OC4 A;  4UEE A;  3SI1 A;  1A2Z A;  3TX8 A;  4CGP A;  4C7H A;  1LRZ A;  2IMO A;  2ARH A;  4UFW A;  3JTK A;  4L8A A;  4UWI A;  4KOY A;  4JD6 A;  4PQA A;  4BD9 A;  2P6F A;  3R1K A;  2VZZ A;  4E2A A;  4F8Z A;  2O28 A;  5THW A;  1I21 A;  2WYR A;  4FD7 A;  6CPA A;  3JUW A;  1SQH A;  1UWY A;  1S5K A;  3KI9 A;  4UBR A;  2BL1 A;  3FMC A;  5EC4 A;  1S3Z A;  1JQG A;  2HC9 A;  4JLY A;  4JXQ A;  3QAH A;  2CF4 A;  3FEC A;  5J8F A;  2JEW A;  3P2H A;  4BIN A;  4EVY A;  3TOB A;  1WWZ A;  4KOT A;  3FBU A;  4FWU A;  1BO4 A;  2B4D B;  2CNS A;  5HVG A;  1S7F A;  3H8E A;  4P4E A;  2PVW A;  1IYK A;  4ZY1 A;  2BOA A;  3BI0 A;  4NGS A;  4CGO A;  4MFZ A;  1M1D A;  1YVK A;  4OIW A;  1F2O A;  1QSO A;  2WPW A;  5HMN A;  1B87 A;  2Q43 A;  4AG9 A;  2XEJ A;  2Q7B A;  5LYF A;  2PVV A;  1GYT A;  1YSJ A;  1AUG A;  2CXA A;  2PJ9 A;  3EY5 A;  4LUA A;  2PJ3 A;  4NGQ A;  4AVA A;  5JH9 A;  4OP4 A;  3F5B A;  1XIX A;  3GLJ A;  2Z10 A;  4QC6 A;  1XOV A;  4K30 A;  2ZEP A;  4Q36 A;  2YNE A;  3FIX A;  4Z65 A;  4ZYQ A;  1QSR A;  1Z2L A;  3IC1 A;  2HUZ A;  1ON0 A;  2WUU A;  3KQZ A;  5G1Z A;  3WC5 A;  4C2Z A;  2OB0 A;  5C88 A;  1RXT A;  3JVN A;  2QVP A;  3R9F A;  4FBE A;  4C2X A;  2QIR A;  3FED A;  3KQX A;  4ZX9 A;  2BO9 A;  4ZY2 A;  3G8W A;  5IB9 A;  2B3U A;  3E0K A;  3B3T A;  3I3G A;  4JZ0 A;  4YRH A;  4ZY0 A;  1ELM P;  2QML A;  3NH5 A;  1IID A;  3FJU A;  3TO9 A;  5KTA A;  1BLL E;  1DE4 C;  1YRE A;  4AVC A;  2ZW5 A;  2OH1 A;  4RN7 A;  3DNS A;  4A94 A;  4NGN A;  2FIA A;  2J8M A;  2PJ1 A;  4IAV A;  4B14 A;  2PJ7 A;  2Q4V A;  4NCZ A;  3FRM A;  2FVG A;  1DTD A;  3FEE A;  2XEG A;  1Y9K A;  2B4B A;  1Q2C A;  1TXR A;  2PJ2 A;  1QSM A;  1YK3 A;  1YW4 A;  2ZEN A;  3DR8 A;  4G1P A;  3GUX A;  4R87 A;  5ELY A;  2B5G A;  4H6Z A;  3WC6 A;  3ZJ0 A;  4DJL A;  8CPA A;  1QSN A;  4B5P A;  5KTD A;  5G20 A;  2G3T A;  2J8N A;  1XF8 A;  5AG7 A;  4UEZ A;  3V7Z A;  1X12 A;  4RS2 A;  3KKW A;  1I12 A;  4B11 A;  2J9A A;  1CPX A;  4P4I A;  3EO4 A;  2ZEL A;  3GY9 A;  4IUS A;  4M6H A;  4KOX A;  4P4D A;  4R57 A;  5DWM A;  2VBQ A;  3ISZ A;  3TE4 A;  2Z0Z A;  4CYO A;  1VHS A;  5K8M A;  1QQ9 A;  2EK8 A;  5CBM A;  4FUU A;  4NXY A;  3B2Y A;  4H6U A;  4P45 A;  1F2P A;  4OKO A;  2D4P A;  1R57 A;  4UIB A;  3D2P A;  3D66 A;  1Z5R A;  4IHM A;  4CGL A;  4Y49 C;  4MJ8 A;  2FE7 A;  4MHP A;  2PSW A;  1ZLH A;  4OME A;  2PCU A;  1YW6 A;  4I49 A;  3D2M A;  2ABZ A;  4NF1 A;  3N5F A;  3H5Z A;  2DXQ A;  3RYO A;  2GAN A;  2JBJ A;  2WSA A;  4P10 A;  4OC1 A;  2Z3K A;  5HVF A;  2ODF A;  2BUE A;  2QJ8 A;  2V8G A;  1YX0 A;  4A38 A;  2PC1 A;  3B3W A;  4NJR A;  4MBU A;  4NJQ A;  4MCS A;  3PRT A;  1IGB A;  1HDU A;  3HLP A;  4Q38 A;  5D29 A;  1M4G A;  1NSL A;  3VH9 A;  5K8O A;  2EBJ A;  1BOB A;  4NEX A;  4II9 A;  2OZH A;  4CYP A;  5LRK A;  2RB7 A;  2JLM A;  4A37 A;  1CP6 A;  2PIZ A;  4QBJ A;  2C6G A;  3LAC A;  5K8P A;  4XNH C;  2YNC A;  4OC3 A;  1LAP A;  1XMB A;  4PK3 A;  3SJE A;  1XJO A;  2FSR A;  3IEH A;  4MXU A;  2QYV A;  4JJX A;  4P6Y A;  3VWD A;  3PFO A;  2PRB A;  3BJ8 A;  3B3C A;  1Q2D A;  3CDX A;  3D7H A;  1LAN A;  3EXN A;  1Z8L A;  2V77 A;  2Q4Z A;  3ISX A;  1VHO A;  2B4D A;  2AFU A;  1VIX A;  2EUI A;  1Y0R A;  3D4U A;  3FB3 A;  1IOF A;  1EE3 P;  3OWC A;  2P0W A;  1FNO A;  2ZXV A;  2R1I A;  2CTC A;  4O23 A;  3W91 A;  4MHD A;  1M4L A;  4ZI6 A;  3NH8 A;  1N71 A;  4IK2 A;  4GS4 A;  4XPD C;  1TKJ A;  3KAS A;  3T8W A;  3W6S A;  1AYE A;  3KL9 A;  4TNU A;  2B3V A;  4MFJ A;  5JGF A;  3GB0 A;  1Z8T A;  4HNX B;  4Q7A A;  3L2N A;  4CAX A;  3K9U A;  3KGQ A;  4P4F A;  3PP9 A;  3GKR A;  4LQ6 A;  4XNH B;  4KZT A;  1CBX A;  5E96 A;  3SJG A;  4CAV A;  3B35 A;  4HNW B;  3DLJ A;  3IWW A;  2VL1 A;  3CT9 A;  3ZZI A;  3B7I A;  3JRU A;  4MHZ A;  3IFE A;  3KR5 A;  4W9Y A;  3NA6 A;  2I79 A;  3WAB A;  4A31 A;  3NE7 A;  4PSX A;  1ZO0 A;  2A4N A;  5A27 A;  3S9M A;  2CNM A;  4PXB A;  4LQG A;  4E8O A;  2AFO A;  4CYN A;  4MFL A;  1KUY A;  2BCO A;  3D8P A;  2G9D A;  3BLN A;  1PU9 A;  2HQY A;  5D8N A;  1MK4 A;  2IL4 A;  5F47 A;  2FS5 A;  1TF9 A;  2FXF A;  4JWP A;  3LOD A;  1H8L A;  3GYA A;  4MMO A;  4A2Z A;  4YU9 A;  5A28 A;  2CNT A;  4P44 A;  3LMS A;  1X10 A;  3UY5 A;  4RUH A;  1V0C A;  7CPA A;  1IYL A;  1ZG7 A;  3KHX A;  4AG7 A;  4X8I A;  2GFQ A;  2REF A;  1Y7R A;  4H89 A;  2ZEE A;  5JM6 A;  2Q04 A;  1CG2 A;  4EME A;  5IB0 A;  1VGY A;  1S7N A;  4CGM A;  1BPM A;  2FIW A;  4ONU A;  1UFH A;  3IU1 A;  2H5M A;  2BSW A;  2Z11 A;  2FCK A;  1KZF A;  1BAV A;  2CY2 A;  1F57 A;  4LX9 A;  4UCM A;  4BMH A;  2PJ8 A;  3WR7 A;  2ZPA A;  3FXT A;  4UA3 A;  2ZEO A;  3TCV A;  1ZG9 A;  4MHY A;  4OC2 A;  5DS0 A;  1XE4 A;  4B6Z A;  5K8N A;  4FD4 A;  5J8C A;  3FNC A;  3RZA A;  1HDQ A;  4J3G A;  4MHN A;  4B12 A;  5CNP A;  2Z3O A;  5J1Q A;  4QUS A;  3S6K A;  4CGN A;  4MRI A;  4DNC A;  2PJ5 A;  3PFE A;  3C26 A;  3SJX A;  5C82 A;  2BEI A;  2OZU A;  4HKF A;  4CPA A;  3FF3 A;  4FD5 A;  4FAI A;  3V38 A;  1RO5 A;  2DEA A;  2ZOF A;  4YGO A;  1Q2Y A;  1KUX A;  3IGR A;  3CXS A;  2WPX A;  3BI1 A;  4UWJ A;  5AG6 A;  4KSI A;  3RNZ A;  1R43 A;  3TTH A;  3LD2 A;  4M85 A;  3CXP A;  1Q7L A;  1Z4R A;  3P2F A;  4B10 A;  2EK9 A;  2ZW6 A;  2JBK A;  1R3N A;  2EO8 A;  3SI2 A;  3IWG A;  1YLO A;  1OZP A;  2F5I A;  2REE A;  3D67 A;  1LCP A;  1MJ9 A;  1TKH A;  5LYI A;  4KOR A;  4CRY B;  3WT4 A;  2POK A;  3K9T A;  1XFO A;  2ZW4 A;  1MJB A;  3D68 A;  4X3R A;  2IJZ A;  2ATR A;  4QVT A;  4ZX8 A;  3PB6 X;  3PZJ A;  3CXQ A;  4F0Y A;  2CIJ A;  4C2Y A;  5I4M A;  1J4J A;  4HNY B;  1YME A;  5F48 A;  1RTQ A;  5GCN A;  4MI4 A;  3IO1 A;  5HXD A;  4FD6 A;  2HB6 A;  5KTC A;  4NGM A;  3NH4 A;  1VKC A;  5F46 A;  2GIV A;  1ZG8 A;  4C7I A;  3B3V A;  4M3S A;  1S60 A;  2AE6 A;  4PPZ A;  1IOI A;  4CRZ B;  1Z4E A;  2AJ6 A;  3VWE A;  2YGW A;  5FVJ A;  2V8D A;  2DPS A;  3MGD A;  2VZY A;  1BPN A;  1M44 A;  4KLV A;  4Y49 B;  3RO0 A;  3SI0 A;  4AXV A;  5IV0 A;  3PBE A;  4KLW A;  4WJB A;  3R9G A;  2FL4 A;  3H4Q A;  3T90 A;  4B5O A;  1YQE A;  5LYL A;  4KOV A;  2GLF A;  1Z8W A;  3SJF A;  1CM0 A;  5EMI A;  2ZED A;  2J8R A;  1S7K A;  3I9S A;  3IIB A;  1TF8 A;  4IF5 A;  3NFZ A;  2C6P A;  2YND A;  3PB8 X;  3QB8 A;  1FT7 A;  3S6G A;  3HUV A;  4F0X A;  4MFQ A;  3PBB A;  2Q44 A;  3FH4 A;  1CP7 A;  1Z9U A;  4GXH A;  4OAE A;  3WC7 A;  2OZG A;  3TO7 A;  2GE3 A;  4KS9 A;  4OLL A;  2ZW7 A;  2P6E A;  2ZEH A;  1ELL P;  1P0H A;  3FVL A;  2OU2 A;  4PXE A;  5LYD A;  3SXN A;  2ZEG A;  2G3A A;  2JDC A;  2NYQ A;  4KVM E;  1TKF A;  4P4B A;  4UF4 A;  4XPL A;  1LFW A;  3D3S A;  3DSB A;  4KVX A;  4MCR A;  4PXC A;  4U9Y A;  1AMP A;  2PJA A;  2Q0Y A;  5AG5 A;  2ZEF A;  2I00 A;  4MY0 A;  3SHP A;  2NSM A;  3PB4 X;  2OR4 A;  2AFX A;  3IWE A;  4MY3 A;  4R7M A;  4EWT A;  1KWM A;  4KOW A;  4KOS A;  2AFM A;  4XPD B;  3IJ3 A;  2X7B A;  1CJW A;  3NE8 A;  4OAD A;  2Q51 A;  4UFX A;  5I0C A;  1YGH A;  2JEV A;  2Z3M A;  4UFV A;  2VEZ A;  3S6H A;  1NE9 A;  3R95 A;  2NMT A;  1OBR A;  4OID A;  5HH1 A;  4BBH A;  3G3S A;  3PB9 X;  4K3N A;  1QST A;  2RFH A;  1XMT A;  5EBV A;  1Z8X A;  2PRQ A;  3MN8 A;  1CPS A;  5F09 A;  2C27 A;  3IU2 A;  2Q4Y A;  1IU8 A;  2ANP A;  2PJ6 A;  1K4J A;  1B6B A;  3BHX A;  4JXR A;  4C68 A;  1TIQ A;  1ARL A;  2ZEM A;  2C1C A;  3PEI A;  4JYW A;  3VAR A;  4GM5 A;  2GLJ A;  2Z3L A;  4X5K A;  2PJ4 A;  4A30 A;  5BWA B;  4ORF A;  4A95 A;  2KCW A;  4F9U A;  4F9V A;  3GIU A;  3BXM A;  1GHE A;  2VI7 A;  3D7D A;  4YFJ A;  1M4D A;  3RAM A;  2JDD A;  4AVB A;  1Y9W A;  3LWU A;  1P4N A;  2G0B A;  4KSF A;  2O4H A;  2AFW A;  1I1D A;  2PR1 A;  4CAF A;  1LOK A;  2V8H A;  3FYN A;  4MCQ A;  5JQ4 A;  3KZW A;  2PDO A;  1YVO A;  3SXO A;  4A32 A;  4R3L A;  2F7V A;  2WZN A;  4YWY A;  4PSW A;  3VAT A;  5HVH A;  1L0C A;  1QMU A;  2VQY A;  4KOU A;  2QEC A;  5AGE A;  2Q7S A;  3FX6 A;  4U9Z A;  4UCP A;  1U6M A;  2CTB A;  1PUA A;  1Y0Y A;  2DPT A;  4AB7 A;  3H8G A;  4R8F A;  2XEF A;  4NGP A;  4OC5 A;  2RC4 A;  1CX8 A;  5LRJ A;  3EC4 A;  4ZBG A;  5F49 A;  3B3S A;  4DUK A;  1Y7E A;  2GU2 A;  3R96 A; 
#chains in the Genus database with same CATH homology
 5G22 A;  3A9L A;  4MFK A;  3TFY A;  1FY7 A;  2HV2 A;  4CAW A;  2PR8 A;  3R9E A;  3DDD A;  3B8G A;  4QB9 A;  1WK4 A;  4UCN A;  5H86 A;  4A33 A;  5G21 A;  4PV6 A;  4XPK A;  4F6A A;  3PGP A;  3F8K A;  3T9Y A;  1YLE A;  2Z3N A;  1IB1 E;  2K5T A;  3TO6 A;  1KUV A;  3N7Z A;  4NSQ A;  4MFP A;  3BJ7 A;  4E0A A;  2B5G B;  3W6X A;  2D4O A;  4PK2 A;  4B5P B;  5DWN A;  4KUB A;  3F0A A;  2R98 A;  4RI1 A;  5JPH A;  3TT2 A;  1IIC A;  4ZGY B;  1YR0 A;  2P6G A;  2FT0 A;  5AG4 A;  5ISV A;  1MJA A;  1XEB A;  2R8V A;  2R7H A;  2YNC C;  4KSA A;  4CAE A;  5IX3 A;  2VXK A;  4CS0 B;  3DR6 A;  1NMT A;  2EVN A;  2PQ8 A;  4R9M A;  1S7L A;  5H84 A;  4CYQ A;  2Z3P A;  4KVO E;  4L89 A;  4B13 A;  2Y0M A;  4U5Y A;  3TOA A;  4R3K A;  1M4I A;  2B58 A;  3V8I A;  3EFA A;  3S6F A;  4KUA A;  4CGP A;  4C7H A;  1LRZ A;  2ARH A;  4UFW A;  3JTK A;  4L8A A;  4UWI A;  4KOY A;  4JD6 A;  2P6F A;  3R1K A;  2VZZ A;  4E2A A;  2O28 A;  1I21 A;  4FD7 A;  3JUW A;  1SQH A;  1S5K A;  4UBR A;  2BL1 A;  5EC4 A;  1S3Z A;  4JLY A;  4JXQ A;  3QAH A;  5J8F A;  3P2H A;  4EVY A;  3TOB A;  1WWZ A;  4KOT A;  3FBU A;  1BO4 A;  2B4D B;  2CNS A;  1S7F A;  1IYK A;  4CGO A;  4MFZ A;  1M1D A;  1YVK A;  5HMN A;  1QSO A;  2WPW A;  1B87 A;  4AG9 A;  2Q7B A;  2CXA A;  4LUA A;  3EY5 A;  4AVA A;  3F5B A;  1XIX A;  2Z10 A;  4QC6 A;  4K30 A;  4Q36 A;  2YNE A;  3FIX A;  1QSR A;  2HUZ A;  1ON0 A;  2WUU A;  5G1Z A;  4C2Z A;  2OB0 A;  5C88 A;  1RXT A;  3JVN A;  3R9F A;  4C2X A;  2QIR A;  3G8W A;  2B3U A;  3E0K A;  3I3G A;  4YRH A;  2QML A;  1IID A;  3TO9 A;  5KTA A;  1YRE A;  4AVC A;  2ZW5 A;  2OH1 A;  3DNS A;  2FIA A;  2J8M A;  4B14 A;  2Q4V A;  4NCZ A;  3FRM A;  1Y9K A;  2B4B A;  1Q2C A;  3DR8 A;  1QSM A;  1YK3 A;  3ZJ0 A;  2B5G A;  4H6Z A;  1QSN A;  4B5P A;  5KTD A;  5G20 A;  2G3T A;  2J8N A;  1XF8 A;  5AG7 A;  4RS2 A;  3KKW A;  1I12 A;  4B11 A;  3EO4 A;  3GY9 A;  4IUS A;  4R57 A;  5DWM A;  4KOX A;  2VBQ A;  3TE4 A;  2Z0Z A;  4CYO A;  1VHS A;  4NXY A;  4H6U A;  2D4P A;  1R57 A;  3D2P A;  4CGL A;  4Y49 C;  4MJ8 A;  2FE7 A;  2PSW A;  4I49 A;  3D2M A;  4NF1 A;  3H5Z A;  2DXQ A;  3RYO A;  2GAN A;  2WSA A;  2Z3K A;  2BUE A;  1YX0 A;  2PC1 A;  4MBU A;  4Q38 A;  1M4G A;  1NSL A;  1BOB A;  4NEX A;  4II9 A;  2OZH A;  4CYP A;  2JLM A;  4QBJ A;  4XNH C;  2YNC A;  4PK3 A;  2FSR A;  3VWD A;  4JJX A;  2PRB A;  3BJ8 A;  1Q2D A;  3EXN A;  2B4D A;  2EUI A;  3FB3 A;  3OWC A;  2P0W A;  2ZXV A;  2R1I A;  3W91 A;  4MHD A;  1N71 A;  4GS4 A;  4XPD C;  3W6S A;  2B3V A;  4MFJ A;  4CAX A;  4HNX B;  3K9U A;  3PP9 A;  3GKR A;  4XNH B;  4KZT A;  5E96 A;  4CAV A;  4HNW B;  3ZZI A;  4A31 A;  2I79 A;  3NE7 A;  4PSX A;  1ZO0 A;  2A4N A;  5A27 A;  2CNM A;  4E8O A;  4CYN A;  4MFL A;  1KUY A;  3D8P A;  3BLN A;  1PU9 A;  2HQY A;  1MK4 A;  2IL4 A;  5F47 A;  2FS5 A;  2FXF A;  4JWP A;  3LOD A;  3GYA A;  4A2Z A;  5A28 A;  2CNT A;  3UY5 A;  1V0C A;  1IYL A;  4AG7 A;  2REF A;  1Y7R A;  4H89 A;  2Q04 A;  5IB0 A;  1S7N A;  4CGM A;  2FIW A;  4ONU A;  1UFH A;  3IU1 A;  2H5M A;  2BSW A;  2Z11 A;  2FCK A;  1KZF A;  2CY2 A;  4LX9 A;  4UCM A;  4BMH A;  3WR7 A;  2ZPA A;  3FXT A;  4UA3 A;  3TCV A;  1XE4 A;  4FD4 A;  5J8C A;  3FNC A;  4J3G A;  4B12 A;  5CNP A;  2Z3O A;  4QUS A;  3S6K A;  4CGN A;  4DNC A;  3C26 A;  5C82 A;  2BEI A;  2OZU A;  4HKF A;  4FD5 A;  1RO5 A;  4YGO A;  1Q2Y A;  1KUX A;  3IGR A;  3CXS A;  2WPX A;  5AG6 A;  4UWJ A;  3TTH A;  3LD2 A;  4M85 A;  3CXP A;  1Z4R A;  3P2F A;  4B10 A;  2ZW6 A;  3IWG A;  2REE A;  1OZP A;  2F5I A;  1MJ9 A;  4KOR A;  4CRY B;  2ZW4 A;  1MJB A;  2ATR A;  4QVT A;  3PZJ A;  3CXQ A;  4F0Y A;  4C2Y A;  1J4J A;  4HNY B;  5F48 A;  5GCN A;  4MI4 A;  4FD6 A;  5KTC A;  1VKC A;  5F46 A;  2GIV A;  4C7I A;  4M3S A;  1S60 A;  2AE6 A;  4CRZ B;  1Z4E A;  2AJ6 A;  3VWE A;  2YGW A;  5FVJ A;  2DPS A;  3MGD A;  2VZY A;  1M44 A;  4KLV A;  4Y49 B;  5IV0 A;  4KLW A;  3R9G A;  2FL4 A;  3H4Q A;  3T90 A;  4B5O A;  4KOV A;  1CM0 A;  2J8R A;  1S7K A;  3I9S A;  4IF5 A;  2YND A;  3QB8 A;  3S6G A;  4F0X A;  4MFQ A;  4OAE A;  2Q44 A;  1Z9U A;  2OZG A;  3TO7 A;  2GE3 A;  4KS9 A;  4OLL A;  2ZW7 A;  2P6E A;  1P0H A;  2OU2 A;  3SXN A;  2G3A A;  2JDC A;  4KVM E;  4XPL A;  3D3S A;  3DSB A;  4KVX A;  4U9Y A;  2Q0Y A;  5AG5 A;  4MY0 A;  2I00 A;  3SHP A;  3IWE A;  4MY3 A;  4KOW A;  4KOS A;  4XPD B;  2X7B A;  1CJW A;  4OAD A;  4UFX A;  5I0C A;  1YGH A;  2JEV A;  2Z3M A;  4UFV A;  2VEZ A;  3S6H A;  1NE9 A;  3R95 A;  2NMT A;  5HH1 A;  4BBH A;  3G3S A;  1QST A;  1XMT A;  5EBV A;  2C27 A;  3IU2 A;  2Q4Y A;  1K4J A;  1B6B A;  4C68 A;  4JXR A;  1TIQ A;  2Z3L A;  5BWA B;  4X5K A;  4A30 A;  4ORF A;  4A95 A;  2KCW A;  1GHE A;  2VI7 A;  4YFJ A;  1M4D A;  2JDD A;  4AVB A;  1Y9W A;  1P4N A;  2G0B A;  4KSF A;  4CAF A;  1I1D A;  2PR1 A;  3FYN A;  5JQ4 A;  2PDO A;  1YVO A;  3SXO A;  4A32 A;  4R3L A;  4PSW A;  1L0C A;  4KOU A;  2VQY A;  5AGE A;  2QEC A;  4U9Z A;  4UCP A;  1U6M A;  4AB7 A;  1PUA A;  2DPT A;  2RC4 A;  3EC4 A;  4ZBG A;  5F49 A;  4R87 A;  3R96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...