5HXDA

Crystal structure of murein-tripeptide amidase mpaa from escherichia coli o157
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRESGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRNFPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPLACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEASEKYLFAMANLLRWHPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein MpaA
publication title Crystal Structure of Murein-Tripeptide Amidase MpaA from Escherichia coli O157 at 2.6 angstrom Resolution
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Hydrolase
total genus 67
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5hxdA00
1TF9A 4F8ZA 4WJBA 4B6ZA 2PIZA 1DE4C 4KSIA 2C6PA 5K8NA 1BLLE 4DYOA 2PIYA 2VL1A 2Q43A 2ZEDA 3SI2A 4P6YA 1VIXA 3B3SA 2RB7A 3KZWA 3B3WA 1GYTA 1XBUA 4CPAA 3WT4A 2AFXA 5JGFA 2PRQA 2BCOA 4FUUA 4P4IA 4A37A 3RAMA 2QVPA 4R76A 3V38A 3HLPA 1HEEA 4G1PA 4OC2A 1JQGA 2ANPA 3GUXA 2PJ4A 2RFHA 3PB7X 3WC7A 2EWBA 4OIDA 3IO1A 4K3NA 2V8GA 2ZEGA 3NH8A 5HVFA 4ZY1A 1R3NA 3D7HA 1YW6A 4YU9A 3KL9A 4PXCA 3NA6A 3D7FA 4UEFA 4ONWA 3TX8A 2PJBA 2HB6A 3KQZA 3FEDA 1TXRA 4P4DA 1FNOA 1LOKA 2QJ8A 1FT7A 4MHPA 3KHZA 3KASA 4X3RA 2XEFA 4UIBA 3H8EA 4OKOA 4H2KA 4NGMA 2EK8A 2ZELA 1IY7A 4ZX8A 5DS0A 2PVVA 4OC0A 4NGSA 3S9NA 3B7IA 4OIWA 1CP6A 4GM5A 4MXUA 1YSJA 2GREA 2PJ5A 5J1QA 2V8HA 3H8FA 3PEIA 3WC5A 4OP4A 4FAIA 4DJLA 4MCRA 2V8DA 3FVLA 3D66A 1H8LA 4JYWA 4NGNA 4ZY2A 3PB4X 1ELLP 2V77A 4MCSA 3RBUA 3PB6X 2NSMA 3IC1A 2HC9A 5D8NA 1Z5RA 4P45A 3PB8X 4MHZA 5LYLA 1TKFA 1XFOA 1Y7EA 2J9AA 3QNVA 4P44A 1KWMA 3TC8A 3H8GA 2PJ1A 1CG2A 4MCPA 3L2NA 3JRUA 4R8FA 2ZOFA 2Q51A 3KQXA 1ZLIA 3GLJA 5K8PA 1EE3P 2QYVA 4NGQA 1LCPA 4A38A 1F57A 3LWUA 5I4MA 2G9DA 4F9UA 2DEAA 2PJAA 2PJ0A 1AMPA 2POKA 1ZG9A 3KGQA 2FVGA 1ZG8A 3DGVA 2JEWA 4TWEA 3CPXA 5JH9A 3NH4A 4Z65A 2I3CA 2AFWA 1YMEA 2NYQA 3SJXA 1Z2LA 4OC5A 1LANA 4F9VA 2PJ7A 2PJ3A 2AFOA 5HXDA 3S9LA 2XEJA 5LRJA 1QQ9A 1VGYA 3K9TA 2C6GA 8CPAA 2ZENA 3FJUA 4PPZA 3FX6A 3PBEA 3T8WA 3CT9A 2O53A 3B35A 1NSAA 2ZEEA 5JM6A 2OOTA 2IMOA 4MHNA 4WWVA 5THWA 5F09A 1AYEA 3GB0A 3WC6A 3NH5A 4JZ0A 1IGBA 3HUVA 1CPSA 5IB9A 1HDUA 2GLJA 1ARMA 3MRUA 1UWYA 2C6CA 2ZOGA 1HDQA 3B3CA 4ZI6A 5ELYA 1LAPA 2PJ9A 4Q7AA 3PFEA 1DTDA 4TNUA 1CPXA 2AFMA 5HVHA 4ZYQA 3CDXA 4EMEA 4DUKA 2ABZA 3FMCA 3VH9A 3FEEA 1BAVA 1XMBA 4PXBA 1VHOA 1YLOA 3BI1A 4X8IA 4MRIA 2CIJA 2AFUA 1Y0YA 3V7ZA 4FBEA 5LRKA 3WABA 2JBKA 3N5FA 2PJ2A 3ISXA 2Q4ZA 1F2PA 5K8MA 2ZEOA 4UIAA 2IQ6A 4UF4A 3DLJA 1ZLHA 3PFOA 1QMUA 4P4JA 4PXEA 1TKJA 4A94A 3BI0A 4EWTA 4P10A 5D29A 1M4LA 1YW4A 2ZEMA 3FF3A 3KHXA 2ZEPA 3IEHA 2XEIA 1CP7A 2C1CA 1CX8A 2ZEHA 5LRGA 3VATA 5CBMA 1Y0RA 2PCUA 2CF4A 3KI9A 3BHXA 2JBJA 4IHMA 3PBBA 2PE3A 4A39A 1ZG7A 4RUHA 4X2TA 3D7GA 2PVWA 3KR4A 1CBXA 3BXMA 3NFZA 4IAVA 4P4FA 3VARA 3D67A 4OMEA 1LAMA 3SJGA 4OC3A 1TKHA 3S9MA 1VHEA 2PJCA 4W9YA 2GU2A 4PQAA 2F8HA 4LQGA 3RZAA 4ZX9A 3IJ3A 3D4UA 4FWUA 3IFEA 3ISZA 4NFRA 2AFZA 4IK2A 2OR4A 4YWYA 1Q7LA 2BO9A 4OC1A 3D7DA 4BD9A 6CPAA 4NGTA 4NJRA 1R43A 1TF8A 1XJOA 2PJ8A 2V8VA 4P4BA 3MN8A 4UEEA 2O4HA 2XEGA 1PYTB 2IJZA 2AFSA 4PXDA 4MMOA 4MHYA 3PRTA 1ARLA 3SI1A 2GLFA 4NGPA 3B3TA 1PCAA 5K8OA 2WZNA 4R7MA 1F2OA 2F7VA 2BOAA 4ZY0A 4NJQA 1RTQA 4O23A 3K2KA 3IWWA 4AXVA 4NGRA 3FECA 3FH4A 1BPMA 2ZEFA 2CTCA 3SI0A 2WYRA 5LYFA 3CPAA 4OC4A 3B2YA 2CTBA 5HVGA 1OBRA 5LYIA 1BPNA 4MCQA 3SJFA 4EFDA 1XRYA 5LYDA 3B3VA 1ELMP 2EK9A 3D68A 3SJEA 5CPAA 4R6TA 1LFWA 3I1UA 3PB9X 3IIBA 4P4EA 2PJ6A 7CPAA 4UEZA 3LMSA 1Z8LA 3KR5A
chains in the Genus database with same CATH superfamily
1TF9A 3LACA 4F8ZA 4WJBA 4B6ZA 2PIZA 2YGWA 3D8PA 1X12A 1DE4C 4KSIA 2C6PA 5K8NA 1BLLE 4A31A 4M85A 4A33A 4DYOA 5HMNA 2PIYA 5AG6A 2VL1A 3DR6A 4H6ZA 2J8NA 4L8AA 2FXFA 2Q43A 2X7BA 4KOXA 4KVOE 4AB7A 4KVXA 2VZZA 4BINA 2ZEDA 3SI2A 2P6GA 4P6YA 1VIXA 3G8WA 3B3SA 2RB7A 3KZWA 3B3WA 2FCKA 4KVME 3WR7A 4F0YA 3R9FA 1GYTA 1XBUA 4KSFA 3WT4A 2AFXA 4CPAA 5JGFA 2PRQA 4KOTA 4MFPA 1Y7RA 3IU1A 2BCOA 3W6XA 1KUXA 1CM0A 4B14A 5C82A 4FUUA 2VQYA 4P4IA 4A37A 3RAMA 2QVPA 2FL4A 4LQ6A 4R76A 4XPDB 3V38A 2OU2A 1WK4A 3HLPA 1HEEA 2B5GA 4JLYA 3GKRA 3KKWA 4G1PA 4OC2A 5AG4A 1JQGA 4B5OA 3H4QA 5AGEA 4CAXA 2R1IA 1NE9A 2ANPA 3IWGA 3GUXA 2PJ4A 1OZPA 2RFHA 2B5GB 3PB7X 2B58A 4LX9A 3WC7A 2EWBA 4F0XA 2RC4A 3IO1A 1M4IA 2V8GA 4K3NA 4OIDA 2ZEGA 4UBRA 3NH8A 5H86A 1M1DA 5HVFA 4CGNA 3JTKA 4ZY1A 4MFJA 1R3NA 4MHDA 3D7HA 1YW6A 4GXHA 4YU9A 3KL9A 5G21A 4PXCA 3VWDA 3NA6A 2B4DA 3FBUA 1MJAA 1SQHA 3D7FA 4UEFA 2Y0MA 4ONWA 3TX8A 4UWIA 2BUEA 2PJBA 3CXQA 2FSRA 4CRYB 2HB6A 1CJWA 3DSBA 3KQZA 1Z8XA 1YGHA 2ODFA 3FEDA 4R87A 5A27A 1TXRA 4P4DA 1FNOA 3LD2A 1LOKA 4IF5A 2NMTA 3ZZIA 4B12A 4BBHA 3D3SA 2QJ8A 1ON0A 2VEZA 1FT7A 4MHPA 2Z3NA 4C68A 4XPLA 2GFQA 3KHZA 4CAFA 3KASA 4X3RA 2XEFA 1QSRA 2OZUA 1XIXA 4UIBA 3H8EA 4Y49C 2OZHA 3NE7A 1Z9UA 4XPKA 4OKOA 2A4NA 4H2KA 2B3VA 4NGMA 3ZJ0A 2EK8A 2IL4A 2ZELA 5G22A 4XNHC 1IY7A 2BSWA 4RN7A 3DDDA 3EXNA 2QECA 3A9LA 4ZX8A 5DS0A 2VBQA 4ORFA 2PVVA 4OC0A 1Q2YA 4NGSA 3S9NA 3B7IA 4OIWA 5CNPA 5AG5A 1CP6A 5F46A 4GM5A 3EY5A 4MXUA 2HV2A 4JWPA 4AVAA 1YSJA 2GREA 1XF8A 2PJ5A 4QB9A 3QAHA 1Q2DA 3QB8A 4C7IA 2V8HA 3TFYA 5J1QA 3H8FA 3PEIA 3WC5A 4E2AA 4MI4A 4PSXA 4KOWA 2G3TA 4OP4A 4FAIA 4DJLA 4JXRA 4MCRA 4AVBA 2V8DA 5F49A 3I3GA 1QSMA 3MGDA 3FVLA 1YR0A 3D66A 1H8LA 4JYWA 4NGNA 4ZY2A 4KS9A 3PB4X 5J8FA 1ELLP 2R8VA 4U5YA 2V77A 4MCSA 4AG9A 3RBUA 3JVNA 4UFXA 3PB6X 2NSMA 4Q36A 3IC1A 3EC4A 2HC9A 5D8NA 1Z5RA 4P45A 3PB8X 4MHZA 4CGMA 5LYLA 1YLEA 1TKFA 2ZW5A 1XFOA 4QBJA 4J3GA 4UWJA 4AVCA 2J8MA 4QVTA 1XEBA 1Y7EA 2J9AA 2ZW7A 2CNSA 4B13A 3IWEA 3IU2A 3QNVA 4OLLA 1RO5A 2ZW6A 4P44A 1KWMA 4KLVA 4RI1A 3TC8A 1LRZA 3H8GA 2PJ1A 3JUWA 1CG2A 1YQEA 4HPSA 5G20A 2ZW4A 4MCPA 2R98A 2CNMA 3L2NA 4FD6A 1IICA 3PZJA 3JRUA 4R8FA 4YRHA 4KORA 2ZOFA 5JQ4A 2Q51A 1XE4A 3KQXA 1MJBA 1IB1E 1B87A 1ZLIA 2VZYA 1NMTA 2G3AA 4NCZA 4PSWA 2DXQA 3GLJA 1QSTA 3R96A 5K8PA 1EE3P 4C2ZA 2QYVA 4YGOA 2FS5A 4NGQA 1LCPA 2KCWA 4A38A 1F57A 3LWUA 2QMLA 5I4MA 2GE3A 2G9DA 5KTDA 3PP9A 4F9UA 3FYNA 2DEAA 2Z3MA 4L89A 4NSQA 4CYPA 2PJAA 2PJ0A 1AMPA 2FIWA 2POKA 1ZG9A 1Z4EA 4HNYB 3KGQA 5IV0A 2FVGA 1ZG8A 3DGVA 2DF5A 2Z10A 2JEWA 4TWEA 3CPXA 2B4BA 2FT0A 4H6UA 5JH9A 3NH4A 4Z65A 2I3CA 2AFWA 3DR8A 5KTAA 1YMEA 2NYQA 1IYLA 3SHPA 3SJXA 3TO6A 4MFKA 1Z2LA 1PU9A 1R57A 2OH1A 4OC5A 2GANA 1LANA 1KUYA 4HNWB 4F9VA 2PJ7A 1P0HA 2I79A 5GCNA 2PJ3A 2J8RA 2AFOA 2FE7A 5HXDA 3S9LA 2Z0ZA 2YNCC 2Z3OA 2XEJA 5LRJA 1XOVA 1QQ9A 1VHSA 1K4JA 1VGYA 2I00A 4HKFA 2B4DB 1V0CA 1S7FA 3K9TA 5IX3A 1J4JA 2C6GA 4IUSA 4C2YA 8CPAA 2ZENA 2QIRA 3FJUA 4PPZA 3FX6A 1U6MA 2VI7A 3P2HA 3PBEA 3T8WA 3CT9A 5FVJA 2PR8A 2O53A 1Y9KA 3S6GA 2YNDA 3B35A 4KUBA 4C2XA 1NSAA 2P6FA 2ZEEA 3CXPA 5JM6A 4II9A 2OOTA 2IMOA 4MHNA 4K30A 4ZBGA 4WWVA 5THWA 4DNCA 2P0WA 5F09A 2AE6A 1S3ZA 3BJ8A 1AYEA 1BO4A 3GB0A 3WC6A 4C7HA 1IYKA 3NH5A 2ZXVA 4R57A 4JZ0A 4AG7A 5KTCA 1IGBA 3GYAA 3HUVA 1CPSA 2ZPAA 3OWCA 2OZGA 5IB9A 1HDUA 2GLJA 4MJ8A 1ARMA 3MRUA 1UWYA 2D4OA 3QAYA 1QSNA 5EMIA 3UY5A 2C6CA 1I1DA 2ZOGA 1HDQA 3B3CA 2Z3LA 4ZI6A 5ELYA 3W6SA 1LAPA 2EO8A 2PJ9A 2PQ8A 1Z8TA 4Q7AA 5DWNA 3PFEA 1DTDA 4NEXA 5HH1A 5DWMA 4TNUA 4B5PA 1CPXA 1YVOA 1AUGA 2ATRA 2AFMA 5HVHA 3SXOA 1YREA 5I0CA 4I49A 4ZYQA 3CDXA 1JWQA 2EUIA 3RNZA 1FY7A 4EMEA 5JPHA 4DUKA 2ABZA 3FMCA 3VH9A 3BLNA 4PK3A 4MBUA 3FEEA 1BAVA 1I12A 1XMBA 4KOYA 4XPDC 1NSLA 3IGRA 4PXBA 2YNCA 4FD5A 4R3LA 1N71A 1M44A 3P2FA 2VXKA 1VHOA 1YLOA 3BI1A 4X8IA 1Q2CA 2CIJA 3FNCA 4MRIA 3FB3A 4FD7A 5H84A 4E8OA 4CYNA 4A32A 5J8CA 4CGOA 2AFUA 1Y0YA 1YK3A 2ARHA 3W91A 3TCVA 3V7ZA 4X5KA 4FBEA 5LRKA 4B10A 3H5ZA 3WABA 2JBKA 3N5FA 4A95A 2F5IA 3EO4A 3LODA 2PJ2A 3ISXA 2Q4ZA 1UFHA 1F2PA 2PSWA 5K8MA 2ZEOA 1P4NA 4UIAA 2IQ6A 2Q4VA 5C88A 4UF4A 3DLJA 2EVNA 1ZLHA 3PFOA 1QMUA 4M6GA 4P4JA 4PXEA 1TIQA 3GIUA 1I21A 4UA3A 1TKJA 3BJ7A 5ISVA 3FXTA 4A94A 1IU8A 1RXTA 3BI0A 1IIDA 4KOUA 2JDCA 4M3SA 4NF1A 2Z11A 4P10A 1M4LA 4Y49B 1YW4A 5D29A 4EWTA 2WPXA 2ZEMA 1Z8WA 2PRBA 4MFQA 3E0KA 3FF3A 3R9EA 4MFLA 4QC6A 3KHXA 2ZEPA 1ZO0A 3IEHA 2DPSA 2XEIA 1CP7A 2C1CA 1CX8A 1YX0A 5EC4A 4KUAA 2WSAA 2ZEHA 4KZTA 4XNHB 5LRGA 3VATA 5CBMA 1Y0RA 2PCUA 2REFA 2CF4A 3D2PA 3KI9A 3BHXA 2JBJA 1M4DA 4IHMA 2BL1A 1QSOA 3R1KA 3PBBA 2PE3A 2PR1A 1ZG7A 4A39A 2OB0A 4R9MA 4RUHA 2YNEA 2C27A 4ONUA 4X2TA 5F47A 4OAEA 3D7GA 3TO7A 4CAVA 3B8GA 3C26A 4U9ZA 2PVWA 3KR4A 1CBXA 3BXMA 3NFZA 4IAVA 4P4FA 3VARA 3K9UA 2P6EA 3D67A 4MY3A 3S6FA 4OMEA 3PGPA 1LAMA 1YVKA 4CGLA 3TTHA 1S7KA 3SJGA 3S6KA 2PDOA 2Q44A 4OC3A 1TKHA 1VKCA 4CGPA 1L0CA 3S9MA 1VHEA 2PJCA 4Q38A 4W9YA 5BWAB 2CY2A 2GU2A 2O28A 4B11A 4ZGYB 4PQAA 2WPWA 4UFWA 2F8HA 4LQGA 5EBVA 2Q7SA 4H89A 3RZAA 4ZX9A 1IOIA 3IJ3A 1XMTA 2EBJA 3VWEA 4KOVA 3N7ZA 3TO9A 2JLMA 3D4UA 4FWUA 3IFEA 3ISZA 2DPTA 4NFRA 2AFZA 4GS4A 2OR4A 2D4PA 2Q0YA 4IK2A 4CYQA 4M6HA 4YWYA 1Q7LA 1MK4A 2BO9A 3TOAA 5A28A 4OC1A 3D7DA 3S6HA 4BD9A 6CPAA 1S7NA 3T9YA 4NGTA 1IOFA 3F5BA 5G1ZA 3RYOA 4EVYA 1BOBA 2Z3PA 3NE8A 1Y9WA 4UFVA 2CNTA 4A2ZA 4NJRA 4HNXB 1R43A 1S5KA 1TF8A 4KOSA 4UCMA 1XJOA 1KUVA 2BEIA 2PJ8A 1Z4RA 2GIVA 2V8VA 3F8KA 4P4BA 3MN8A 4UEEA 4CAEA 4M6IA 3CXSA 2O4HA 2XEGA 2R7HA 1S7LA 1PYTB 2IJZA 4CYOA 4FD4A 4NXYA 4JXQA 4E0AA 2AFSA 2FIAA 2HQYA 4YFJA 4PXDA 4MMOA 2REEA 4MFZA 2CXAA 4MHYA 1M4GA 2G0BA 3PRTA 4B5PB 1ARLA 4PK2A 1GHEA 4CS0B 1KZFA 3SI1A 2GLFA 4NGPA 2JEVA 1MJ9A 3B3TA 1PCAA 5K8OA 2WZNA 4R7MA 1F2OA 2F7VA 1X10A 2BOAA 4BMHA 4U9YA 4ZY0A 2Q04A 3CZXA 3GY9A 4NJQA 1RTQA 3D2MA 4O23A 4F6AA 4KSAA 3K2KA 3IWWA 2Q7BA 4AXVA 2K5TA 4NGRA 3FECA 4MY0A 5F48A 3FH4A 4CRZB 5E96A 3TE4A 1BPMA 2ZEFA 2CTCA 3DNSA 4OADA 3FIXA 3F0AA 3RO0A 2WYRA 3SI0A 5LYFA 1PUAA 3CPAA 4OC4A 3B2YA 2H5MA 2CTBA 4JJXA 5HVGA 1B6BA 1OBRA 3EFAA 5LYIA 1BPNA 4MCQA 4A30A 5IB0A 3I9SA 3R95A 1S60A 2PC1A 3R9GA 3SJFA 4CAWA 5AG7A 4EFDA 1XRYA 5LYDA 3B3VA 1ELMP 2EK9A 4RS2A 3V8IA 3D68A 3SJEA 4LUAA 4KLWA 5CPAA 4R6TA 1LFWA 3G3SA 3I1UA 3IIBA 3PB9X 2Z3KA 1WWZA 4PV6A 4P4EA 4QUSA 3SXNA 2B3UA 2Q4YA 3TOBA 3FRMA 2PJ6A 1A2ZA 2AJ6A 3TT2A 4R3KA 7CPAA 2WUUA 4UEZA 3T90A 4UCPA 3LMSA 2HUZA 1Z8LA 4JD6A 3KR5A 4UCNA 2JDDA
chains in the Genus database with same CATH topology
1TF9A 4F8ZA 4WJBA 4B6ZA 2PIZA 1DE4C 4KSIA 2C6PA 5K8NA 1BLLE 4DYOA 2PIYA 2VL1A 2Q43A 2ZEDA 3SI2A 4P6YA 1VIXA 3B3SA 2RB7A 3KZWA 3B3WA 1GYTA 1XBUA 4CPAA 3WT4A 2AFXA 5JGFA 2PRQA 2BCOA 4FUUA 4P4IA 4A37A 3RAMA 2QVPA 4R76A 3V38A 3HLPA 1HEEA 4G1PA 4OC2A 1JQGA 2ANPA 3GUXA 2PJ4A 2RFHA 3PB7X 3WC7A 2EWBA 4OIDA 3IO1A 4K3NA 2V8GA 2ZEGA 3NH8A 5HVFA 4ZY1A 1R3NA 3D7HA 1YW6A 4YU9A 3KL9A 4PXCA 3NA6A 3D7FA 4UEFA 4ONWA 3TX8A 2PJBA 2HB6A 3KQZA 3FEDA 1TXRA 4P4DA 1FNOA 1LOKA 2QJ8A 1FT7A 4MHPA 3KHZA 3KASA 4X3RA 2XEFA 4UIBA 3H8EA 4OKOA 4H2KA 4NGMA 2EK8A 2ZELA 1IY7A 4ZX8A 5DS0A 2PVVA 4OC0A 4NGSA 3S9NA 3B7IA 4OIWA 1CP6A 4GM5A 4MXUA 1YSJA 2GREA 2PJ5A 5J1QA 2V8HA 3H8FA 3PEIA 3WC5A 4OP4A 4FAIA 4DJLA 4MCRA 2V8DA 3FVLA 3D66A 1H8LA 4JYWA 4NGNA 4ZY2A 3PB4X 1ELLP 2V77A 4MCSA 3RBUA 3PB6X 2NSMA 3IC1A 2HC9A 5D8NA 1Z5RA 4P45A 3PB8X 4MHZA 5LYLA 1TKFA 1XFOA 1Y7EA 2J9AA 3QNVA 4P44A 1KWMA 3TC8A 3H8GA 2PJ1A 1CG2A 4MCPA 3L2NA 3JRUA 4R8FA 2ZOFA 2Q51A 3KQXA 1ZLIA 3GLJA 5K8PA 1EE3P 2QYVA 4NGQA 1LCPA 4A38A 1F57A 3LWUA 5I4MA 2G9DA 4F9UA 2DEAA 2PJAA 2PJ0A 1AMPA 2POKA 1ZG9A 3KGQA 2FVGA 1ZG8A 3DGVA 2JEWA 4TWEA 3CPXA 5JH9A 3NH4A 4Z65A 2I3CA 2AFWA 1YMEA 2NYQA 3SJXA 1Z2LA 4OC5A 1LANA 4F9VA 2PJ7A 2PJ3A 2AFOA 5HXDA 3S9LA 2XEJA 5LRJA 1QQ9A 1VGYA 3K9TA 2C6GA 8CPAA 2ZENA 3FJUA 4PPZA 3FX6A 3PBEA 3T8WA 3CT9A 2O53A 3B35A 1NSAA 2ZEEA 5JM6A 2OOTA 2IMOA 4MHNA 4WWVA 5THWA 5F09A 1AYEA 3GB0A 3WC6A 3NH5A 4JZ0A 1IGBA 3HUVA 1CPSA 5IB9A 1HDUA 2GLJA 1ARMA 3MRUA 1UWYA 2C6CA 2ZOGA 1HDQA 3B3CA 4ZI6A 5ELYA 1LAPA 2PJ9A 4Q7AA 3PFEA 1DTDA 4TNUA 1CPXA 2AFMA 5HVHA 4ZYQA 3CDXA 4EMEA 4DUKA 2ABZA 3FMCA 3VH9A 3FEEA 1BAVA 1XMBA 4PXBA 1VHOA 1YLOA 3BI1A 4X8IA 4MRIA 2CIJA 2AFUA 1Y0YA 3V7ZA 4FBEA 5LRKA 3WABA 2JBKA 3N5FA 2PJ2A 3ISXA 2Q4ZA 1F2PA 5K8MA 2ZEOA 4UIAA 2IQ6A 4UF4A 3DLJA 1ZLHA 3PFOA 1QMUA 4P4JA 4PXEA 1TKJA 4A94A 3BI0A 4EWTA 4P10A 5D29A 1M4LA 1YW4A 2ZEMA 3FF3A 3KHXA 2ZEPA 3IEHA 2XEIA 1CP7A 2C1CA 1CX8A 2ZEHA 5LRGA 3VATA 5CBMA 1Y0RA 2PCUA 2CF4A 3KI9A 3BHXA 2JBJA 4IHMA 3PBBA 2PE3A 4A39A 1ZG7A 4RUHA 4X2TA 3D7GA 2PVWA 3KR4A 1CBXA 3BXMA 3NFZA 4IAVA 4P4FA 3VARA 3D67A 4OMEA 1LAMA 3SJGA 4OC3A 1TKHA 3S9MA 1VHEA 2PJCA 4W9YA 2GU2A 4PQAA 2F8HA 4LQGA 3RZAA 4ZX9A 3IJ3A 3D4UA 4FWUA 3IFEA 3ISZA 4NFRA 2AFZA 4IK2A 2OR4A 4YWYA 1Q7LA 2BO9A 4OC1A 3D7DA 4BD9A 6CPAA 4NGTA 4NJRA 1R43A 1TF8A 1XJOA 2PJ8A 2V8VA 4P4BA 3MN8A 4UEEA 2O4HA 2XEGA 1PYTB 2IJZA 2AFSA 4PXDA 4MMOA 4MHYA 3PRTA 1ARLA 3SI1A 2GLFA 4NGPA 3B3TA 1PCAA 5K8OA 2WZNA 4R7MA 1F2OA 2F7VA 2BOAA 4ZY0A 4NJQA 1RTQA 4O23A 3K2KA 3IWWA 4AXVA 4NGRA 3FECA 3FH4A 1BPMA 2ZEFA 2CTCA 3SI0A 2WYRA 5LYFA 3CPAA 4OC4A 3B2YA 2CTBA 5HVGA 1OBRA 5LYIA 1BPNA 4MCQA 3SJFA 4EFDA 1XRYA 5LYDA 3B3VA 1ELMP 2EK9A 3D68A 3SJEA 5CPAA 4R6TA 1LFWA 3I1UA 3PB9X 3IIBA 4P4EA 2PJ6A 7CPAA 4UEZA 3LMSA 1Z8LA 3KR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF9 A;  4F8Z A;  4WJB A;  4B6Z A;  2PIZ A;  1DE4 C;  4KSI A;  2C6P A;  5K8N A;  1BLL E;  4DYO A;  2PIY A;  2VL1 A;  2Q43 A;  2ZED A;  3SI2 A;  4P6Y A;  1VIX A;  3B3S A;  2RB7 A;  3KZW A;  3B3W A;  1GYT A;  1XBU A;  4CPA A;  3WT4 A;  2AFX A;  5JGF A;  2PRQ A;  2BCO A;  4FUU A;  4P4I A;  4A37 A;  3RAM A;  2QVP A;  4R76 A;  3V38 A;  3HLP A;  1HEE A;  4G1P A;  4OC2 A;  1JQG A;  2ANP A;  3GUX A;  2PJ4 A;  2RFH A;  3PB7 X;  3WC7 A;  2EWB A;  4OID A;  3IO1 A;  4K3N A;  2V8G A;  2ZEG A;  3NH8 A;  5HVF A;  4ZY1 A;  1R3N A;  3D7H A;  1YW6 A;  4YU9 A;  3KL9 A;  4PXC A;  3NA6 A;  3D7F A;  4UEF A;  4ONW A;  3TX8 A;  2PJB A;  2HB6 A;  3KQZ A;  3FED A;  1TXR A;  4P4D A;  1FNO A;  1LOK A;  2QJ8 A;  1FT7 A;  4MHP A;  3KHZ A;  3KAS A;  4X3R A;  2XEF A;  4UIB A;  3H8E A;  4OKO A;  4H2K A;  4NGM A;  2EK8 A;  2ZEL A;  1IY7 A;  4ZX8 A;  5DS0 A;  2PVV A;  4OC0 A;  4NGS A;  3S9N A;  3B7I A;  4OIW A;  1CP6 A;  4GM5 A;  4MXU A;  1YSJ A;  2GRE A;  2PJ5 A;  5J1Q A;  2V8H A;  3H8F A;  3PEI A;  3WC5 A;  4OP4 A;  4FAI A;  4DJL A;  4MCR A;  2V8D A;  3FVL A;  3D66 A;  1H8L A;  4JYW A;  4NGN A;  4ZY2 A;  3PB4 X;  1ELL P;  2V77 A;  4MCS A;  3RBU A;  3PB6 X;  2NSM A;  3IC1 A;  2HC9 A;  5D8N A;  1Z5R A;  4P45 A;  3PB8 X;  4MHZ A;  5LYL A;  1TKF A;  1XFO A;  1Y7E A;  2J9A A;  3QNV A;  4P44 A;  1KWM A;  3TC8 A;  3H8G A;  2PJ1 A;  1CG2 A;  4MCP A;  3L2N A;  3JRU A;  4R8F A;  2ZOF A;  2Q51 A;  3KQX A;  1ZLI A;  3GLJ A;  5K8P A;  1EE3 P;  2QYV A;  4NGQ A;  1LCP A;  4A38 A;  1F57 A;  3LWU A;  5I4M A;  2G9D A;  4F9U A;  2DEA A;  2PJA A;  2PJ0 A;  1AMP A;  2POK A;  1ZG9 A;  3KGQ A;  2FVG A;  1ZG8 A;  3DGV A;  2JEW A;  4TWE A;  3CPX A;  5JH9 A;  3NH4 A;  4Z65 A;  2I3C A;  2AFW A;  1YME A;  2NYQ A;  3SJX A;  1Z2L A;  4OC5 A;  1LAN A;  4F9V A;  2PJ7 A;  2PJ3 A;  2AFO A;  5HXD A;  3S9L A;  2XEJ A;  5LRJ A;  1QQ9 A;  1VGY A;  3K9T A;  2C6G A;  8CPA A;  2ZEN A;  3FJU A;  4PPZ A;  3FX6 A;  3PBE A;  3T8W A;  3CT9 A;  2O53 A;  3B35 A;  1NSA A;  2ZEE A;  5JM6 A;  2OOT A;  2IMO A;  4MHN A;  4WWV A;  5THW A;  5F09 A;  1AYE A;  3GB0 A;  3WC6 A;  3NH5 A;  4JZ0 A;  1IGB A;  3HUV A;  1CPS A;  5IB9 A;  1HDU A;  2GLJ A;  1ARM A;  3MRU A;  1UWY A;  2C6C A;  2ZOG A;  1HDQ A;  3B3C A;  4ZI6 A;  5ELY A;  1LAP A;  2PJ9 A;  4Q7A A;  3PFE A;  1DTD A;  4TNU A;  1CPX A;  2AFM A;  5HVH A;  4ZYQ A;  3CDX A;  4EME A;  4DUK A;  2ABZ A;  3FMC A;  3VH9 A;  3FEE A;  1BAV A;  1XMB A;  4PXB A;  1VHO A;  1YLO A;  3BI1 A;  4X8I A;  4MRI A;  2CIJ A;  2AFU A;  1Y0Y A;  3V7Z A;  4FBE A;  5LRK A;  3WAB A;  2JBK A;  3N5F A;  2PJ2 A;  3ISX A;  2Q4Z A;  1F2P A;  5K8M A;  2ZEO A;  4UIA A;  2IQ6 A;  4UF4 A;  3DLJ A;  1ZLH A;  3PFO A;  1QMU A;  4P4J A;  4PXE A;  1TKJ A;  4A94 A;  3BI0 A;  4EWT A;  4P10 A;  5D29 A;  1M4L A;  1YW4 A;  2ZEM A;  3FF3 A;  3KHX A;  2ZEP A;  3IEH A;  2XEI A;  1CP7 A;  2C1C A;  1CX8 A;  2ZEH A;  5LRG A;  3VAT A;  5CBM A;  1Y0R A;  2PCU A;  2CF4 A;  3KI9 A;  3BHX A;  2JBJ A;  4IHM A;  3PBB A;  2PE3 A;  4A39 A;  1ZG7 A;  4RUH A;  4X2T A;  3D7G A;  2PVW A;  3KR4 A;  1CBX A;  3BXM A;  3NFZ A;  4IAV A;  4P4F A;  3VAR A;  3D67 A;  4OME A;  1LAM A;  3SJG A;  4OC3 A;  1TKH A;  3S9M A;  1VHE A;  2PJC A;  4W9Y A;  2GU2 A;  4PQA A;  2F8H A;  4LQG A;  3RZA A;  4ZX9 A;  3IJ3 A;  3D4U A;  4FWU A;  3IFE A;  3ISZ A;  4NFR A;  2AFZ A;  4IK2 A;  2OR4 A;  4YWY A;  1Q7L A;  2BO9 A;  4OC1 A;  3D7D A;  4BD9 A;  6CPA A;  4NGT A;  4NJR A;  1R43 A;  1TF8 A;  1XJO A;  2PJ8 A;  2V8V A;  4P4B A;  3MN8 A;  4UEE A;  2O4H A;  2XEG A;  1PYT B;  2IJZ A;  2AFS A;  4PXD A;  4MMO A;  4MHY A;  3PRT A;  1ARL A;  3SI1 A;  2GLF A;  4NGP A;  3B3T A;  1PCA A;  5K8O A;  2WZN A;  4R7M A;  1F2O A;  2F7V A;  2BOA A;  4ZY0 A;  4NJQ A;  1RTQ A;  4O23 A;  3K2K A;  3IWW A;  4AXV A;  4NGR A;  3FEC A;  3FH4 A;  1BPM A;  2ZEF A;  2CTC A;  3SI0 A;  2WYR A;  5LYF A;  3CPA A;  4OC4 A;  3B2Y A;  2CTB A;  5HVG A;  1OBR A;  5LYI A;  1BPN A;  4MCQ A;  3SJF A;  4EFD A;  1XRY A;  5LYD A;  3B3V A;  1ELM P;  2EK9 A;  3D68 A;  3SJE A;  5CPA A;  4R6T A;  1LFW A;  3I1U A;  3PB9 X;  3IIB A;  4P4E A;  2PJ6 A;  7CPA A;  4UEZ A;  3LMS A;  1Z8L A;  3KR5 A; 
#chains in the Genus database with same CATH topology
 1TF9 A;  3LAC A;  4F8Z A;  4WJB A;  4B6Z A;  2PIZ A;  2YGW A;  3D8P A;  1X12 A;  1DE4 C;  4KSI A;  2C6P A;  5K8N A;  1BLL E;  4A31 A;  4M85 A;  4A33 A;  4DYO A;  5HMN A;  2PIY A;  5AG6 A;  2VL1 A;  3DR6 A;  4H6Z A;  2J8N A;  4L8A A;  2FXF A;  2Q43 A;  2X7B A;  4KOX A;  4KVO E;  4AB7 A;  4KVX A;  2VZZ A;  4BIN A;  2ZED A;  3SI2 A;  2P6G A;  4P6Y A;  1VIX A;  3G8W A;  3B3S A;  2RB7 A;  3KZW A;  3B3W A;  2FCK A;  4KVM E;  3WR7 A;  4F0Y A;  3R9F A;  1GYT A;  1XBU A;  4KSF A;  3WT4 A;  2AFX A;  4CPA A;  5JGF A;  2PRQ A;  4KOT A;  4MFP A;  1Y7R A;  3IU1 A;  2BCO A;  3W6X A;  1KUX A;  1CM0 A;  4B14 A;  5C82 A;  4FUU A;  2VQY A;  4P4I A;  4A37 A;  3RAM A;  2QVP A;  2FL4 A;  4LQ6 A;  4R76 A;  4XPD B;  3V38 A;  2OU2 A;  1WK4 A;  3HLP A;  1HEE A;  2B5G A;  4JLY A;  3GKR A;  3KKW A;  4G1P A;  4OC2 A;  5AG4 A;  1JQG A;  4B5O A;  3H4Q A;  5AGE A;  4CAX A;  2R1I A;  1NE9 A;  2ANP A;  3IWG A;  3GUX A;  2PJ4 A;  1OZP A;  2RFH A;  2B5G B;  3PB7 X;  2B58 A;  4LX9 A;  3WC7 A;  2EWB A;  4F0X A;  2RC4 A;  3IO1 A;  1M4I A;  2V8G A;  4K3N A;  4OID A;  2ZEG A;  4UBR A;  3NH8 A;  5H86 A;  1M1D A;  5HVF A;  4CGN A;  3JTK A;  4ZY1 A;  4MFJ A;  1R3N A;  4MHD A;  3D7H A;  1YW6 A;  4GXH A;  4YU9 A;  3KL9 A;  5G21 A;  4PXC A;  3VWD A;  3NA6 A;  2B4D A;  3FBU A;  1MJA A;  1SQH A;  3D7F A;  4UEF A;  2Y0M A;  4ONW A;  3TX8 A;  4UWI A;  2BUE A;  2PJB A;  3CXQ A;  2FSR A;  4CRY B;  2HB6 A;  1CJW A;  3DSB A;  3KQZ A;  1Z8X A;  1YGH A;  2ODF A;  3FED A;  4R87 A;  5A27 A;  1TXR A;  4P4D A;  1FNO A;  3LD2 A;  1LOK A;  4IF5 A;  2NMT A;  3ZZI A;  4B12 A;  4BBH A;  3D3S A;  2QJ8 A;  1ON0 A;  2VEZ A;  1FT7 A;  4MHP A;  2Z3N A;  4C68 A;  4XPL A;  2GFQ A;  3KHZ A;  4CAF A;  3KAS A;  4X3R A;  2XEF A;  1QSR A;  2OZU A;  1XIX A;  4UIB A;  3H8E A;  4Y49 C;  2OZH A;  3NE7 A;  1Z9U A;  4XPK A;  4OKO A;  2A4N A;  4H2K A;  2B3V A;  4NGM A;  3ZJ0 A;  2EK8 A;  2IL4 A;  2ZEL A;  5G22 A;  4XNH C;  1IY7 A;  2BSW A;  4RN7 A;  3DDD A;  3EXN A;  2QEC A;  3A9L A;  4ZX8 A;  5DS0 A;  2VBQ A;  4ORF A;  2PVV A;  4OC0 A;  1Q2Y A;  4NGS A;  3S9N A;  3B7I A;  4OIW A;  5CNP A;  5AG5 A;  1CP6 A;  5F46 A;  4GM5 A;  3EY5 A;  4MXU A;  2HV2 A;  4JWP A;  4AVA A;  1YSJ A;  2GRE A;  1XF8 A;  2PJ5 A;  4QB9 A;  3QAH A;  1Q2D A;  3QB8 A;  4C7I A;  2V8H A;  3TFY A;  5J1Q A;  3H8F A;  3PEI A;  3WC5 A;  4E2A A;  4MI4 A;  4PSX A;  4KOW A;  2G3T A;  4OP4 A;  4FAI A;  4DJL A;  4JXR A;  4MCR A;  4AVB A;  2V8D A;  5F49 A;  3I3G A;  1QSM A;  3MGD A;  3FVL A;  1YR0 A;  3D66 A;  1H8L A;  4JYW A;  4NGN A;  4ZY2 A;  4KS9 A;  3PB4 X;  5J8F A;  1ELL P;  2R8V A;  4U5Y A;  2V77 A;  4MCS A;  4AG9 A;  3RBU A;  3JVN A;  4UFX A;  3PB6 X;  2NSM A;  4Q36 A;  3IC1 A;  3EC4 A;  2HC9 A;  5D8N A;  1Z5R A;  4P45 A;  3PB8 X;  4MHZ A;  4CGM A;  5LYL A;  1YLE A;  1TKF A;  2ZW5 A;  1XFO A;  4QBJ A;  4J3G A;  4UWJ A;  4AVC A;  2J8M A;  4QVT A;  1XEB A;  1Y7E A;  2J9A A;  2ZW7 A;  2CNS A;  4B13 A;  3IWE A;  3IU2 A;  3QNV A;  4OLL A;  1RO5 A;  2ZW6 A;  4P44 A;  1KWM A;  4KLV A;  4RI1 A;  3TC8 A;  1LRZ A;  3H8G A;  2PJ1 A;  3JUW A;  1CG2 A;  1YQE A;  4HPS A;  5G20 A;  2ZW4 A;  4MCP A;  2R98 A;  2CNM A;  3L2N A;  4FD6 A;  1IIC A;  3PZJ A;  3JRU A;  4R8F A;  4YRH A;  4KOR A;  2ZOF A;  5JQ4 A;  2Q51 A;  1XE4 A;  3KQX A;  1MJB A;  1IB1 E;  1B87 A;  1ZLI A;  2VZY A;  1NMT A;  2G3A A;  4NCZ A;  4PSW A;  2DXQ A;  3GLJ A;  1QST A;  3R96 A;  5K8P A;  1EE3 P;  4C2Z A;  2QYV A;  4YGO A;  2FS5 A;  4NGQ A;  1LCP A;  2KCW A;  4A38 A;  1F57 A;  3LWU A;  2QML A;  5I4M A;  2GE3 A;  2G9D A;  5KTD A;  3PP9 A;  4F9U A;  3FYN A;  2DEA A;  2Z3M A;  4L89 A;  4NSQ A;  4CYP A;  2PJA A;  2PJ0 A;  1AMP A;  2FIW A;  2POK A;  1ZG9 A;  1Z4E A;  4HNY B;  3KGQ A;  5IV0 A;  2FVG A;  1ZG8 A;  3DGV A;  2DF5 A;  2Z10 A;  2JEW A;  4TWE A;  3CPX A;  2B4B A;  2FT0 A;  4H6U A;  5JH9 A;  3NH4 A;  4Z65 A;  2I3C A;  2AFW A;  3DR8 A;  5KTA A;  1YME A;  2NYQ A;  1IYL A;  3SHP A;  3SJX A;  3TO6 A;  4MFK A;  1Z2L A;  1PU9 A;  1R57 A;  2OH1 A;  4OC5 A;  2GAN A;  1LAN A;  1KUY A;  4HNW B;  4F9V A;  2PJ7 A;  1P0H A;  2I79 A;  5GCN A;  2PJ3 A;  2J8R A;  2AFO A;  2FE7 A;  5HXD A;  3S9L A;  2Z0Z A;  2YNC C;  2Z3O A;  2XEJ A;  5LRJ A;  1XOV A;  1QQ9 A;  1VHS A;  1K4J A;  1VGY A;  2I00 A;  4HKF A;  2B4D B;  1V0C A;  1S7F A;  3K9T A;  5IX3 A;  1J4J A;  2C6G A;  4IUS A;  4C2Y A;  8CPA A;  2ZEN A;  2QIR A;  3FJU A;  4PPZ A;  3FX6 A;  1U6M A;  2VI7 A;  3P2H A;  3PBE A;  3T8W A;  3CT9 A;  5FVJ A;  2PR8 A;  2O53 A;  1Y9K A;  3S6G A;  2YND A;  3B35 A;  4KUB A;  4C2X A;  1NSA A;  2P6F A;  2ZEE A;  3CXP A;  5JM6 A;  4II9 A;  2OOT A;  2IMO A;  4MHN A;  4K30 A;  4ZBG A;  4WWV A;  5THW A;  4DNC A;  2P0W A;  5F09 A;  2AE6 A;  1S3Z A;  3BJ8 A;  1AYE A;  1BO4 A;  3GB0 A;  3WC6 A;  4C7H A;  1IYK A;  3NH5 A;  2ZXV A;  4R57 A;  4JZ0 A;  4AG7 A;  5KTC A;  1IGB A;  3GYA A;  3HUV A;  1CPS A;  2ZPA A;  3OWC A;  2OZG A;  5IB9 A;  1HDU A;  2GLJ A;  4MJ8 A;  1ARM A;  3MRU A;  1UWY A;  2D4O A;  3QAY A;  1QSN A;  5EMI A;  3UY5 A;  2C6C A;  1I1D A;  2ZOG A;  1HDQ A;  3B3C A;  2Z3L A;  4ZI6 A;  5ELY A;  3W6S A;  1LAP A;  2EO8 A;  2PJ9 A;  2PQ8 A;  1Z8T A;  4Q7A A;  5DWN A;  3PFE A;  1DTD A;  4NEX A;  5HH1 A;  5DWM A;  4TNU A;  4B5P A;  1CPX A;  1YVO A;  1AUG A;  2ATR A;  2AFM A;  5HVH A;  3SXO A;  1YRE A;  5I0C A;  4I49 A;  4ZYQ A;  3CDX A;  1JWQ A;  2EUI A;  3RNZ A;  1FY7 A;  4EME A;  5JPH A;  4DUK A;  2ABZ A;  3FMC A;  3VH9 A;  3BLN A;  4PK3 A;  4MBU A;  3FEE A;  1BAV A;  1I12 A;  1XMB A;  4KOY A;  4XPD C;  1NSL A;  3IGR A;  4PXB A;  2YNC A;  4FD5 A;  4R3L A;  1N71 A;  1M44 A;  3P2F A;  2VXK A;  1VHO A;  1YLO A;  3BI1 A;  4X8I A;  1Q2C A;  2CIJ A;  3FNC A;  4MRI A;  3FB3 A;  4FD7 A;  5H84 A;  4E8O A;  4CYN A;  4A32 A;  5J8C A;  4CGO A;  2AFU A;  1Y0Y A;  1YK3 A;  2ARH A;  3W91 A;  3TCV A;  3V7Z A;  4X5K A;  4FBE A;  5LRK A;  4B10 A;  3H5Z A;  3WAB A;  2JBK A;  3N5F A;  4A95 A;  2F5I A;  3EO4 A;  3LOD A;  2PJ2 A;  3ISX A;  2Q4Z A;  1UFH A;  1F2P A;  2PSW A;  5K8M A;  2ZEO A;  1P4N A;  4UIA A;  2IQ6 A;  2Q4V A;  5C88 A;  4UF4 A;  3DLJ A;  2EVN A;  1ZLH A;  3PFO A;  1QMU A;  4M6G A;  4P4J A;  4PXE A;  1TIQ A;  3GIU A;  1I21 A;  4UA3 A;  1TKJ A;  3BJ7 A;  5ISV A;  3FXT A;  4A94 A;  1IU8 A;  1RXT A;  3BI0 A;  1IID A;  4KOU A;  2JDC A;  4M3S A;  4NF1 A;  2Z11 A;  4P10 A;  1M4L A;  4Y49 B;  1YW4 A;  5D29 A;  4EWT A;  2WPX A;  2ZEM A;  1Z8W A;  2PRB A;  4MFQ A;  3E0K A;  3FF3 A;  3R9E A;  4MFL A;  4QC6 A;  3KHX A;  2ZEP A;  1ZO0 A;  3IEH A;  2DPS A;  2XEI A;  1CP7 A;  2C1C A;  1CX8 A;  1YX0 A;  5EC4 A;  4KUA A;  2WSA A;  2ZEH A;  4KZT A;  4XNH B;  5LRG A;  3VAT A;  5CBM A;  1Y0R A;  2PCU A;  2REF A;  2CF4 A;  3D2P A;  3KI9 A;  3BHX A;  2JBJ A;  1M4D A;  4IHM A;  2BL1 A;  1QSO A;  3R1K A;  3PBB A;  2PE3 A;  2PR1 A;  1ZG7 A;  4A39 A;  2OB0 A;  4R9M A;  4RUH A;  2YNE A;  2C27 A;  4ONU A;  4X2T A;  5F47 A;  4OAE A;  3D7G A;  3TO7 A;  4CAV A;  3B8G A;  3C26 A;  4U9Z A;  2PVW A;  3KR4 A;  1CBX A;  3BXM A;  3NFZ A;  4IAV A;  4P4F A;  3VAR A;  3K9U A;  2P6E A;  3D67 A;  4MY3 A;  3S6F A;  4OME A;  3PGP A;  1LAM A;  1YVK A;  4CGL A;  3TTH A;  1S7K A;  3SJG A;  3S6K A;  2PDO A;  2Q44 A;  4OC3 A;  1TKH A;  1VKC A;  4CGP A;  1L0C A;  3S9M A;  1VHE A;  2PJC A;  4Q38 A;  4W9Y A;  5BWA B;  2CY2 A;  2GU2 A;  2O28 A;  4B11 A;  4ZGY B;  4PQA A;  2WPW A;  4UFW A;  2F8H A;  4LQG A;  5EBV A;  2Q7S A;  4H89 A;  3RZA A;  4ZX9 A;  1IOI A;  3IJ3 A;  1XMT A;  2EBJ A;  3VWE A;  4KOV A;  3N7Z A;  3TO9 A;  2JLM A;  3D4U A;  4FWU A;  3IFE A;  3ISZ A;  2DPT A;  4NFR A;  2AFZ A;  4GS4 A;  2OR4 A;  2D4P A;  2Q0Y A;  4IK2 A;  4CYQ A;  4M6H A;  4YWY A;  1Q7L A;  1MK4 A;  2BO9 A;  3TOA A;  5A28 A;  4OC1 A;  3D7D A;  3S6H A;  4BD9 A;  6CPA A;  1S7N A;  3T9Y A;  4NGT A;  1IOF A;  3F5B A;  5G1Z A;  3RYO A;  4EVY A;  1BOB A;  2Z3P A;  3NE8 A;  1Y9W A;  4UFV A;  2CNT A;  4A2Z A;  4NJR A;  4HNX B;  1R43 A;  1S5K A;  1TF8 A;  4KOS A;  4UCM A;  1XJO A;  1KUV A;  2BEI A;  2PJ8 A;  1Z4R A;  2GIV A;  2V8V A;  3F8K A;  4P4B A;  3MN8 A;  4UEE A;  4CAE A;  4M6I A;  3CXS A;  2O4H A;  2XEG A;  2R7H A;  1S7L A;  1PYT B;  2IJZ A;  4CYO A;  4FD4 A;  4NXY A;  4JXQ A;  4E0A A;  2AFS A;  2FIA A;  2HQY A;  4YFJ A;  4PXD A;  4MMO A;  2REE A;  4MFZ A;  2CXA A;  4MHY A;  1M4G A;  2G0B A;  3PRT A;  4B5P B;  1ARL A;  4PK2 A;  1GHE A;  4CS0 B;  1KZF A;  3SI1 A;  2GLF A;  4NGP A;  2JEV A;  1MJ9 A;  3B3T A;  1PCA A;  5K8O A;  2WZN A;  4R7M A;  1F2O A;  2F7V A;  1X10 A;  2BOA A;  4BMH A;  4U9Y A;  4ZY0 A;  2Q04 A;  3CZX A;  3GY9 A;  4NJQ A;  1RTQ A;  3D2M A;  4O23 A;  4F6A A;  4KSA A;  3K2K A;  3IWW A;  2Q7B A;  4AXV A;  2K5T A;  4NGR A;  3FEC A;  4MY0 A;  5F48 A;  3FH4 A;  4CRZ B;  5E96 A;  3TE4 A;  1BPM A;  2ZEF A;  2CTC A;  3DNS A;  4OAD A;  3FIX A;  3F0A A;  3RO0 A;  2WYR A;  3SI0 A;  5LYF A;  1PUA A;  3CPA A;  4OC4 A;  3B2Y A;  2H5M A;  2CTB A;  4JJX A;  5HVG A;  1B6B A;  1OBR A;  3EFA A;  5LYI A;  1BPN A;  4MCQ A;  4A30 A;  5IB0 A;  3I9S A;  3R95 A;  1S60 A;  2PC1 A;  3R9G A;  3SJF A;  4CAW A;  5AG7 A;  4EFD A;  1XRY A;  5LYD A;  3B3V A;  1ELM P;  2EK9 A;  4RS2 A;  3V8I A;  3D68 A;  3SJE A;  4LUA A;  4KLW A;  5CPA A;  4R6T A;  1LFW A;  3G3S A;  3I1U A;  3IIB A;  3PB9 X;  2Z3K A;  1WWZ A;  4PV6 A;  4P4E A;  4QUS A;  3SXN A;  2B3U A;  2Q4Y A;  3TOB A;  3FRM A;  2PJ6 A;  1A2Z A;  2AJ6 A;  3TT2 A;  4R3K A;  7CPA A;  2WUU A;  4UEZ A;  3T90 A;  4UCP A;  3LMS A;  2HUZ A;  1Z8L A;  4JD6 A;  3KR5 A;  4UCN A;  2JDD A; 
#chains in the Genus database with same CATH homology
 1TF9 A;  4F8Z A;  4WJB A;  4B6Z A;  2PIZ A;  1DE4 C;  4KSI A;  2C6P A;  5K8N A;  1BLL E;  4DYO A;  2PIY A;  2VL1 A;  2Q43 A;  2ZED A;  3SI2 A;  4P6Y A;  1VIX A;  3B3S A;  2RB7 A;  3KZW A;  3B3W A;  1GYT A;  1XBU A;  4CPA A;  3WT4 A;  2AFX A;  5JGF A;  2PRQ A;  2BCO A;  4FUU A;  4P4I A;  4A37 A;  3RAM A;  2QVP A;  4R76 A;  3V38 A;  3HLP A;  1HEE A;  4G1P A;  4OC2 A;  1JQG A;  2ANP A;  3GUX A;  2PJ4 A;  2RFH A;  3PB7 X;  3WC7 A;  2EWB A;  4OID A;  3IO1 A;  4K3N A;  2V8G A;  2ZEG A;  3NH8 A;  5HVF A;  4ZY1 A;  1R3N A;  3D7H A;  1YW6 A;  4YU9 A;  3KL9 A;  4PXC A;  3NA6 A;  3D7F A;  4UEF A;  4ONW A;  3TX8 A;  2PJB A;  2HB6 A;  3KQZ A;  3FED A;  1TXR A;  4P4D A;  1FNO A;  1LOK A;  2QJ8 A;  1FT7 A;  4MHP A;  3KHZ A;  3KAS A;  4X3R A;  2XEF A;  4UIB A;  3H8E A;  4OKO A;  4H2K A;  4NGM A;  2EK8 A;  2ZEL A;  1IY7 A;  4ZX8 A;  5DS0 A;  2PVV A;  4OC0 A;  4NGS A;  3S9N A;  3B7I A;  4OIW A;  1CP6 A;  4GM5 A;  4MXU A;  1YSJ A;  2GRE A;  2PJ5 A;  5J1Q A;  2V8H A;  3H8F A;  3PEI A;  3WC5 A;  4OP4 A;  4FAI A;  4DJL A;  4MCR A;  2V8D A;  3FVL A;  3D66 A;  1H8L A;  4JYW A;  4NGN A;  4ZY2 A;  3PB4 X;  1ELL P;  2V77 A;  4MCS A;  3RBU A;  3PB6 X;  2NSM A;  3IC1 A;  2HC9 A;  5D8N A;  1Z5R A;  4P45 A;  3PB8 X;  4MHZ A;  5LYL A;  1TKF A;  1XFO A;  1Y7E A;  2J9A A;  3QNV A;  4P44 A;  1KWM A;  3TC8 A;  3H8G A;  2PJ1 A;  1CG2 A;  4MCP A;  3L2N A;  3JRU A;  4R8F A;  2ZOF A;  2Q51 A;  3KQX A;  1ZLI A;  3GLJ A;  5K8P A;  1EE3 P;  2QYV A;  4NGQ A;  1LCP A;  4A38 A;  1F57 A;  3LWU A;  5I4M A;  2G9D A;  4F9U A;  2DEA A;  2PJA A;  2PJ0 A;  1AMP A;  2POK A;  1ZG9 A;  3KGQ A;  2FVG A;  1ZG8 A;  3DGV A;  2JEW A;  4TWE A;  3CPX A;  5JH9 A;  3NH4 A;  4Z65 A;  2I3C A;  2AFW A;  1YME A;  2NYQ A;  3SJX A;  1Z2L A;  4OC5 A;  1LAN A;  4F9V A;  2PJ7 A;  2PJ3 A;  2AFO A;  5HXD A;  3S9L A;  2XEJ A;  5LRJ A;  1QQ9 A;  1VGY A;  3K9T A;  2C6G A;  8CPA A;  2ZEN A;  3FJU A;  4PPZ A;  3FX6 A;  3PBE A;  3T8W A;  3CT9 A;  2O53 A;  3B35 A;  1NSA A;  2ZEE A;  5JM6 A;  2OOT A;  2IMO A;  4MHN A;  4WWV A;  5THW A;  5F09 A;  1AYE A;  3GB0 A;  3WC6 A;  3NH5 A;  4JZ0 A;  1IGB A;  3HUV A;  1CPS A;  5IB9 A;  1HDU A;  2GLJ A;  1ARM A;  3MRU A;  1UWY A;  2C6C A;  2ZOG A;  1HDQ A;  3B3C A;  4ZI6 A;  5ELY A;  1LAP A;  2PJ9 A;  4Q7A A;  3PFE A;  1DTD A;  4TNU A;  1CPX A;  2AFM A;  5HVH A;  4ZYQ A;  3CDX A;  4EME A;  4DUK A;  2ABZ A;  3FMC A;  3VH9 A;  3FEE A;  1BAV A;  1XMB A;  4PXB A;  1VHO A;  1YLO A;  3BI1 A;  4X8I A;  4MRI A;  2CIJ A;  2AFU A;  1Y0Y A;  3V7Z A;  4FBE A;  5LRK A;  3WAB A;  2JBK A;  3N5F A;  2PJ2 A;  3ISX A;  2Q4Z A;  1F2P A;  5K8M A;  2ZEO A;  4UIA A;  2IQ6 A;  4UF4 A;  3DLJ A;  1ZLH A;  3PFO A;  1QMU A;  4P4J A;  4PXE A;  1TKJ A;  4A94 A;  3BI0 A;  4EWT A;  4P10 A;  5D29 A;  1M4L A;  1YW4 A;  2ZEM A;  3FF3 A;  3KHX A;  2ZEP A;  3IEH A;  2XEI A;  1CP7 A;  2C1C A;  1CX8 A;  2ZEH A;  5LRG A;  3VAT A;  5CBM A;  1Y0R A;  2PCU A;  2CF4 A;  3KI9 A;  3BHX A;  2JBJ A;  4IHM A;  3PBB A;  2PE3 A;  4A39 A;  1ZG7 A;  4RUH A;  4X2T A;  3D7G A;  2PVW A;  3KR4 A;  1CBX A;  3BXM A;  3NFZ A;  4IAV A;  4P4F A;  3VAR A;  3D67 A;  4OME A;  1LAM A;  3SJG A;  4OC3 A;  1TKH A;  3S9M A;  1VHE A;  2PJC A;  4W9Y A;  2GU2 A;  4PQA A;  2F8H A;  4LQG A;  3RZA A;  4ZX9 A;  3IJ3 A;  3D4U A;  4FWU A;  3IFE A;  3ISZ A;  4NFR A;  2AFZ A;  4IK2 A;  2OR4 A;  4YWY A;  1Q7L A;  2BO9 A;  4OC1 A;  3D7D A;  4BD9 A;  6CPA A;  4NGT A;  4NJR A;  1R43 A;  1TF8 A;  1XJO A;  2PJ8 A;  2V8V A;  4P4B A;  3MN8 A;  4UEE A;  2O4H A;  2XEG A;  1PYT B;  2IJZ A;  2AFS A;  4PXD A;  4MMO A;  4MHY A;  3PRT A;  1ARL A;  3SI1 A;  2GLF A;  4NGP A;  3B3T A;  1PCA A;  5K8O A;  2WZN A;  4R7M A;  1F2O A;  2F7V A;  2BOA A;  4ZY0 A;  4NJQ A;  1RTQ A;  4O23 A;  3K2K A;  3IWW A;  4AXV A;  4NGR A;  3FEC A;  3FH4 A;  1BPM A;  2ZEF A;  2CTC A;  3SI0 A;  2WYR A;  5LYF A;  3CPA A;  4OC4 A;  3B2Y A;  2CTB A;  5HVG A;  1OBR A;  5LYI A;  1BPN A;  4MCQ A;  3SJF A;  4EFD A;  1XRY A;  5LYD A;  3B3V A;  1ELM P;  2EK9 A;  3D68 A;  3SJE A;  5CPA A;  4R6T A;  1LFW A;  3I1U A;  3PB9 X;  3IIB A;  4P4E A;  2PJ6 A;  7CPA A;  4UEZ A;  3LMS A;  1Z8L A;  3KR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...