5HXDA

Crystal structure of murein-tripeptide amidase mpaa from escherichia coli o157
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRESGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRNFPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPLACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEASEKYLFAMANLLRWHPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein MpaA
publication title Crystal Structure of Murein-Tripeptide Amidase MpaA from Escherichia coli O157 at 2.6 angstrom Resolution
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Hydrolase
total genus 67
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5hxdA00
4IK2A 4NFRA 3T8WA 8CPAA 4GM5A 2NSMA 3KQZA 4P44A 4OC5A 1CP7A 4MMOA 2V77A 3PRTA 1ZG8A 1DTDA 4X2TA 2PJCA 1KWMA 1TKJA 1TXRA 3WC6A 1LAMA 3HUVA 2ABZA 3S9NA 3MRUA 2AFUA 4MCQA 5LRGA 4ZI6A 4MHNA 4OC3A 1M4LA 4MRIA 5DS0A 2I3CA 3VARA 3RAMA 1TKFA 3H8FA 2ZEMA 4OIWA 2NYQA 5JGFA 3D7DA 1LFWA 1CPXA 5CBMA 2J9AA 2PJ0A 3SJGA 4OC0A 2PIZA 3BI1A 1PYTB 3B3SA 4ZY1A 4ONWA 1F57A 4ZX8A 4JYWA 3LMSA 1VIXA 1HEEA 3NA6A 2F8HA 2VL1A 3PB8X 3H8EA 2G9DA 2JBKA 2PJ7A 4DJLA 2BO9A 3SJXA 3CPAA 4X3RA 4NGTA 2HB6A 3WC7A 1ARLA 2PJBA 1XMBA 1LAPA 4PXEA 2OR4A 4F9UA 1ELMP 4NGPA 5LRKA 4MCSA 4P4IA 1FT7A 1XRYA 4IHMA 6CPAA 1Z8LA 2XEGA 4EMEA 5LYFA 1BPMA 4JZ0A 3IFEA 3FJUA 3SI2A 1OBRA 4G1PA 5LYIA 5JM6A 2PVWA 1CPSA 5LRJA 1IGBA 2PJ4A 2AFXA 1VHOA 4UEZA 3D4UA 2OOTA 4AXVA 2IJZA 4OC1A 4UEFA 1TKHA 4EFDA 4PXDA 1LOKA 3NFZA 4K3NA 4W9YA 5CPAA 4LQGA 3B35A 4X8IA 4B6ZA 2AFWA 3FX6A 3VATA 1IY7A 2Q51A 3PB4X 4NGNA 2CIJA 4WJBA 3IWWA 3IEHA 2ZEEA 4NJQA 4PPZA 3HLPA 3D7HA 4NGMA 5D29A 3QNVA 1ELLP 1YMEA 3KGQA 2ZOFA 1CX8A 4RUHA 2AFOA 1Z5RA 3D7GA 4EWTA 3TX8A 4MHYA 2RB7A 3KR4A 2PE3A 3DGVA 2ZOGA 3ISXA 2AFZA 5I4MA 4TNUA 1NSAA 2CTCA 5ELYA 1EE3P 5LYDA 1TF8A 2PJ8A 3VH9A 3B3VA 4F9VA 2PJ3A 2POKA 3PFOA 2IMOA 2BCOA 2WYRA 3B3WA 4R6TA 3B7IA 3KHZA 1TF9A 2XEFA 3WT4A 2ZEGA 2ZEOA 4OC2A 2QVPA 3MN8A 2O53A 1HDQA 1Q7LA 3CPXA 4UIAA 4OKOA 2C6GA 1CBXA 1CP6A 2HC9A 2PIYA 1YW4A 3KQXA 3L2NA 2AFMA 4NGSA 1R3NA 1AYEA 2ZEHA 4ZYQA 4PQAA 3FF3A 3GB0A 3KZWA 3V7ZA 3S9MA 3BXMA 3KR5A 3RBUA 3FMCA 2V8HA 2ZEFA 2PJ9A 4NGRA 3NH4A 5HXDA 2WZNA 1UWYA 1BAVA 3WABA 4PXCA 3KHXA 2XEJA 1F2PA 3BHXA 3CDXA 1R43A 2QYVA 1ZLHA 3BI0A 5F09A 3K2KA 4YU9A 1YLOA 1YSJA 3CT9A 1H8LA 3GLJA 3N5FA 2EK9A 5HVFA 3WC5A 3PEIA 2GLJA 2Q4ZA 3DLJA 1JQGA 1XBUA 3B3TA 4R76A 4A38A 4P4EA 2C1CA 2ZELA 1Y0YA 2ZEPA 1QQ9A 1QMUA 3S9LA 1XFOA 4WWVA 1LANA 4UF4A 4DYOA 4OIDA 3SI1A 2C6PA 4Z65A 4FBEA 2JEWA 3SJEA 2CF4A 2RFHA 2GLFA 4P4JA 5HVHA 2ANPA 1GYTA 4R7MA 2V8VA 4Q7AA 2EK8A 3B3CA 2GREA 4A39A 4P45A 4KSIA 2PJAA 3H8GA 3FECA 1ZLIA 3NH5A 3RZAA 3NH8A 2IQ6A 2V8DA 3SJFA 4UEEA 4P4BA 1ZG7A 3PB6X 4ZY0A 2GU2A 1YW6A 1Z2LA 4UIBA 1BLLE 3GUXA 5K8NA 2XEIA 3KASA 3IC1A 2AFSA 3KI9A 4MHPA 2PJ1A 4P10A 4ZY2A 4NJRA 5LYLA 2BOAA 3IJ3A 1XJOA 4YWYA 2JBJA 2PJ5A 3SI0A 1PCAA 3JRUA 3IIBA 3TC8A 3D7FA 2ZENA 1DE4C 5K8OA 2FVGA 2C6CA 4A37A 4P6YA 5K8PA 1FNOA 3LWUA 3FVLA 3PBBA 4R8FA 4OP4A 4FAIA 4FUUA 4OMEA 3PBEA 3D66A 1CG2A 3PB9X 4H2KA 1ARMA 1VHEA 2O4HA 4FWUA 4MHZA 1RTQA 4MCPA 3FEDA 2PRQA 3K9TA 5D8NA 1F2OA 4MXUA 4O23A 4DUKA 3V38A 3IO1A 1LCPA 2PJ2A 3KL9A 5K8MA 5IB9A 1HDUA 4A94A 2V8GA 1Y0RA 4ZX9A 2ZEDA 4CPAA 2CTBA 1BPNA 3PFEA 3ISZA 4F8ZA 3I1UA 1AMPA 1ZG9A 1VGYA 3B2YA 3PB7X 4TWEA 4IAVA 4MCRA 3D67A 3D68A 2F7VA 2DEAA 1Y7EA 3FEEA 3FH4A 2Q43A 4P4DA 5J1QA 2EWBA 4NGQA 4OC4A 2PJ6A 4PXBA 5HVGA 5JH9A 4BD9A 2PVVA 2PCUA 2QJ8A 7CPAA 4P4FA 5THWA
chains in the Genus database with same CATH superfamily
2VI7A 4IK2A 4NFRA 3T8WA 8CPAA 4B5PB 4GM5A 2NSMA 3KQZA 1M1DA 2C27A 4XPLA 2O28A 4P44A 4OC5A 1S3ZA 4XPKA 4JJXA 4UFXA 5A28A 4MJ8A 1CP7A 1M4DA 4MMOA 5JQ4A 3FIXA 5KTDA 2V77A 3PRTA 4U9ZA 1B87A 1ZG8A 1U6MA 1DTDA 4UCNA 4X2TA 2PJCA 1KWMA 4YFJA 1R57A 1TKJA 1TXRA 3WC6A 1S60A 1LAMA 4CAFA 1M44A 3HUVA 4BMHA 5EBVA 2ABZA 2ODFA 2ZW5A 3BJ8A 3CZXA 3E0KA 3RYOA 3S9NA 3MRUA 3R1KA 4M6HA 2AFUA 4HNYB 2Q04A 4MCQA 5LRGA 4AVBA 4ZI6A 4MHNA 4OC3A 4CAEA 1M4LA 2OB0A 3D2MA 4MRIA 5DS0A 4ZGYB 2ARHA 2I3CA 1X10A 2CNMA 3RAMA 3VARA 3JUWA 1TKFA 4GXHA 3H8FA 5J8FA 2D4OA 2P6EA 2ZEMA 2R8VA 2Z3KA 4OIWA 1YK3A 2NYQA 4KOUA 5JGFA 1XMTA 3D7DA 4LQ6A 1LFWA 1CPXA 1XEBA 1KUXA 3K9UA 4ORFA 3W6SA 5CBMA 2F5IA 2J9AA 1AUGA 4MFJA 2PJ0A 3LODA 3TO6A 4CGMA 3P2FA 1VHSA 2G0BA 3SJGA 4OC0A 1Z8WA 2PIZA 3BI1A 1PYTB 3B3SA 4HNXB 4UFWA 3UY5A 1QSTA 4ZY1A 4CS0B 4KLWA 4ONWA 1F57A 4ZX8A 4JYWA 1MJAA 4UWIA 3LMSA 1HEEA 1VIXA 3NA6A 4E8OA 2F8HA 1IB1E 1S7KA 2VL1A 3H8EA 3PB8X 4L8AA 2G9DA 4UA3A 4JLYA 4C68A 2JBKA 2HV2A 1UFHA 4F6AA 4PK2A 4XNHB 3S6FA 4CYQA 4C2XA 4EVYA 2Q4VA 2FSRA 4B14A 2PJ7A 4DJLA 2PRBA 3C26A 2BO9A 3SJXA 3VWDA 1XIXA 3CPAA 4X3RA 4NGTA 2HB6A 4KUBA 3WC7A 1ARLA 1N71A 1SQHA 2PJBA 5GCNA 3CXPA 1XMBA 1LAPA 4PXEA 3I9SA 3CXQA 2OR4A 4F9UA 1ELMP 4NGPA 1XOVA 1LRZA 4MCSA 5LRKA 2BSWA 4P4IA 1FT7A 1XRYA 4NCZA 4UWJA 4IHMA 2GANA 4FD5A 4OLLA 6CPAA 1Q2DA 1Z8LA 2PDOA 4C2YA 2XEGA 4EMEA 4MI4A 5IX3A 1Q2YA 1BPMA 4CGLA 5LYFA 4JZ0A 4PSWA 4MFLA 3IFEA 2J8MA 3FJUA 3SI2A 1OBRA 1QSMA 4G1PA 5LYIA 4YGOA 5H84A 2FL4A 4J3GA 5JM6A 2PVWA 1Z9UA 1CPSA 5LRJA 1IGBA 2VZYA 2PJ4A 3CXSA 2AFXA 1VHOA 4UEZA 5KTCA 1MJ9A 3D4UA 2HUZA 2OOTA 4AXVA 2IJZA 4AVAA 5F46A 4OC1A 4UEFA 1Q2CA 1WWZA 1TKHA 5AGEA 3W91A 4EFDA 3V8IA 2DPSA 4PXDA 1KZFA 1LOKA 3NFZA 4H6UA 1XE4A 4JXRA 4K3NA 2IL4A 4KOXA 4KOVA 1X12A 4W9YA 2G3AA 4LQGA 2YGWA 2I00A 2YNDA 3B35A 2EVNA 3QAYA 4KS9A 4KVXA 4RS2A 5KTAA 1YVKA 4HPSA 4M3SA 4X8IA 4MFKA 4UCMA 4MFQA 4RI1A 4B6ZA 2AFWA 3FX6A 4KUAA 4MBUA 3TTHA 3VATA 1IY7A 3I3GA 2AE6A 2Q51A 2EBJA 3PB4X 4NGNA 2CIJA 4WJBA 1I12A 3IWWA 3IEHA 4FD4A 4AVCA 2ZEEA 1QSRA 4NJQA 3DR6A 4R57A 5DWNA 4PPZA 3HLPA 4ZBGA 3D7HA 2WPXA 4FD6A 4NGMA 3EY5A 3IWGA 5D29A 3NE7A 1IOFA 4I49A 2K5TA 4OADA 1ELLP 3QNVA 1YMEA 3KGQA 3LACA 2ZOFA 2Q7SA 1CX8A 5G20A 1Z8XA 4RUHA 2AFOA 4CGOA 1Z5RA 3FRMA 3D7GA 4EWTA 4JWPA 1IICA 3TX8A 3IU1A 4DNCA 4MHYA 4MHDA 1BOBA 3EO4A 2RB7A 3KR4A 3R96A 2PE3A 5EMIA 3DGVA 5AG7A 4XPDC 2ZOGA 4KOSA 3ISXA 4CYNA 2AFZA 3RO0A 4TNUA 3D2PA 2VBQA 3DDDA 5I4MA 1NSAA 3F5BA 2B3UA 2CTCA 5ELYA 4CAVA 1EE3P 2R1IA 5LYDA 1Y9KA 2ZW4A 4A95A 1TF8A 4U5YA 2PJ8A 4BBHA 2JDDA 4E2AA 3VH9A 1IOIA 1IYKA 3B3VA 2Q44A 4NSQA 3ZJ0A 2PJ3A 4F9VA 2POKA 3EXNA 3FYNA 5H86A 3DR8A 2BUEA 2IMOA 3PFOA 1YVOA 2BCOA 2Z11A 2WYRA 3B3WA 4AB7A 4R6TA 3TT2A 3B7IA 4QBJA 1TF9A 2XEFA 3KHZA 3WT4A 2ZEGA 2GE3A 1Y7RA 2ZEOA 4HNWB 2B3VA 3FB3A 4OC2A 2QVPA 3MN8A 2O53A 3D3SA 1S5KA 4C7HA 1HDQA 3W6XA 1Q7LA 2OZUA 2Y0MA 3CPXA 4UIAA 4XPDB 2ATRA 4OKOA 2C6GA 5CPAA 4E0AA 4KVOE 1CBXA 2FS5A 1CP6A 2Z3LA 3ZZIA 2HC9A 2PIYA 1YW4A 3KQXA 2PR8A 3L2NA 2AFMA 4NGSA 1L0CA 1AYEA 1R3NA 2ZEHA 4PQAA 3FF3A 4AG7A 4CAXA 4ZYQA 3T90A 3GB0A 3H4QA 2CNSA 4PV6A 3SXOA 4LUAA 3KZWA 3V7ZA 3S9MA 3BXMA 4R9MA 3KR5A 1Z8TA 1CM0A 3RBUA 1YR0A 3FMCA 2V8HA 1WK4A 4CGNA 2ZEFA 2QECA 4PK3A 4PSXA 2PJ9A 5DWMA 4B13A 4L89A 4NGRA 2KCWA 3NH4A 2WZNA 5HXDA 1UWYA 1BAVA 1B6BA 3TCVA 2Z3OA 4PXCA 1Y9WA 1YX0A 3KHXA 2XEJA 3NE8A 3WABA 1F2PA 3BHXA 3KKWA 3IGRA 3CDXA 4CAWA 1R43A 2QYVA 3G3SA 5A27A 3VWEA 3JVNA 1ZLHA 3BI0A 5F09A 3K2KA 3FBUA 1QSOA 3GIUA 1YLOA 1YSJA 4YU9A 3CT9A 3S6KA 2YNCC 2B58A 4CRYB 1H8LA 3GLJA 3N5FA 5AG5A 2EK9A 5HVFA 3WC5A 2OU2A 3PEIA 3S6GA 2DXQA 2GLJA 1P0HA 2Q4ZA 3T9YA 3DLJA 2X7BA 3EC4A 2ZW6A 4KZTA 1JQGA 2ZW7A 1P4NA 1XBUA 3B3TA 3TE4A 2FT0A 5C82A 4R76A 5IB0A 1YREA 4A38A 1FY7A 5HMNA 4P4EA 4KVME 2C1CA 2ZELA 4MY3A 2PSWA 1Y0YA 4NF1A 1I1DA 4B12A 5IV0A 5AG6A 2ZEPA 4QUSA 5FVJA 4Q36A 4R87A 4JXQA 1QQ9A 1QMUA 2Z3MA 3S9LA 1XFOA 4H6ZA 4NEXA 2Q4YA 4AG9A 4QB9A 4WWVA 1ZO0A 2CNTA 1LANA 3EFAA 2REFA 4UF4A 4DYOA 4OIDA 4KORA 2A4NA 2FCKA 1RXTA 2B4BA 3TFYA 3SI1A 1MK4A 2C6PA 4Z65A 2QMLA 2JLMA 4R3KA 3B8GA 3LD2A 4FBEA 3G8WA 1NE9A 2JEWA 3SJEA 1BO4A 2CF4A 2RFHA 1YQEA 1TIQA 2OZGA 2GLFA 1M4GA 4P4JA 5EC4A 4B5PA 2R98A 1JWQA 5HVHA 2ANPA 3P2HA 1VKCA 2HQYA 1RO5A 1XF8A 2Z3NA 1GYTA 4ONUA 4X5KA 5G21A 4R7MA 2V8VA 2B5GA 4Q7AA 2EK8A 3D8PA 3N7ZA 2Q7BA 2Z0ZA 3B3CA 1KUVA 2CXAA 2GREA 5HH1A 4H89A 4A39A 4P45A 4KSIA 2PJAA 3H8GA 2R7HA 3FECA 1ZLIA 5J8CA 4CYOA 3H5ZA 2BL1A 5E96A 3NH5A 4M6GA 4U9YA 5F49A 2GIVA 3RZAA 3NH8A 2FIAA 3TOBA 2VQYA 2REEA 4KSAA 4NXYA 1S7FA 2WPWA 4C2ZA 2B5GB 2IQ6A 2JEVA 2B4DA 2V8DA 3R9FA 3SJFA 1QSNA 4UEEA 2CY2A 4P4BA 1ZG7A 3PB6X 4ZY0A 3PP9A 2GU2A 2G3TA 1YW6A 5G22A 1Z2LA 5C88A 4Y49C 4M6IA 4BINA 4K30A 4UIBA 1YLEA 4KOTA 3BJ7A 4XNHC 5AG4A 4B11A 1BLLE 3GUXA 5K8NA 5F48A 4CRZB 2FXFA 4KOWA 3F8KA 4A30A 2XEIA 3KASA 3R95A 2WUUA 3IC1A 2YNEA 2AFSA 4YRHA 1OZPA 2B4DB 3KI9A 4IUSA 4MHPA 2PJ1A 2ZPAA 2BEIA 3F0AA 4P10A 4ZY2A 4II9A 2OZHA 4NJRA 3TOAA 4B10A 3PZJA 1I21A 3IWEA 5LYLA 4OAEA 2BOAA 4GS4A 3IJ3A 5CNPA 1YGHA 1XJOA 3QAHA 4YWYA 1S7NA 2GFQA 2JBJA 2PJ5A 4MFPA 3IU2A 3SI0A 1PCAA 3BLNA 3JRUA 2Q0YA 4Q38A 3GKRA 3SXNA 1Z4EA 3IIBA 3R9EA 3DSBA 1K4JA 3D7FA 1M4IA 3SHPA 2ZENA 3TC8A 3DNSA 1DE4C 3RNZA 3JTKA 5F47A 3S6HA 3TO7A 5K8OA 2FVGA 2C6CA 4Y49B 4A37A 4P6YA 4C7IA 5K8PA 4HKFA 2Z10A 1FNOA 3LWUA 4QC6A 3FVLA 3PBBA 1IU8A 3PGPA 4KSFA 2VEZA 4KLVA 5G1ZA 4R8FA 4UFVA 4B5OA 4OP4A 4LX9A 4CYPA 4FAIA 4FUUA 4MY0A 4OMEA 1IIDA 2P0WA 1Z4RA 3PBEA 3D66A 1CG2A 2JDCA 3PB9X 2D4PA 4H2KA 2EO8A 1ARMA 1VHEA 2O4HA 2RC4A 4FWUA 4MHZA 1RTQA 4MCPA 3FEDA 4A2ZA 2PRQA 1NMTA 3GYAA 3K9TA 5D8NA 4A32A 4RN7A 1J4JA 1F2OA 2Z3PA 1NSLA 1S7LA 1KUYA 4KOYA 4QVTA 1CJWA 3GY9A 3MGDA 4A33A 4MXUA 4O23A 1MJBA 4DUKA 3V38A 2EUIA 3IO1A 1LCPA 2PJ2A 3KL9A 5K8MA 2NMTA 2PQ8A 1A2ZA 4MFZA 3R9GA 5IB9A 3OWCA 2DPTA 2FIWA 2H5MA 3WR7A 2QIRA 1HDUA 1PU9A 4A94A 2V8GA 2PR1A 1Y0RA 4ZX9A 2YNCA 2ZEDA 4CPAA 2CTBA 4FD7A 1BPNA 3PFEA 3ISZA 2PC1A 4F8ZA 3I1UA 1AMPA 4F0YA 1ZG9A 4A31A 1VGYA 4F0XA 2DF5A 2P6FA 2AJ6A 2J8RA 3B2YA 2FE7A 3PB7X 4TWEA 4IAVA 5BWAB 4MCRA 3D67A 3D68A 1ON0A 2F7VA 3QB8A 1IYLA 2DEAA 5JPHA 1Y7EA 2OH1A 3FEEA 1PUAA 2WSAA 2ZXVA 3FXTA 3FH4A 4CGPA 5I0CA 5ISVA 2Q43A 4M85A 4P4DA 2VZZA 1V0CA 5J1QA 2EWBA 4NGQA 4OC4A 2PJ6A 4PXBA 5HVGA 5JH9A 3FNCA 2PVVA 4R3LA 4BD9A 4UBRA 2J8NA 4IF5A 2PCUA 2QJ8A 4UCPA 1GHEA 7CPAA 4JD6A 2I79A 2P6GA 4P4FA 3TO9A 2VXKA 3A9LA 5THWA
chains in the Genus database with same CATH topology
4IK2A 4NFRA 3T8WA 8CPAA 4GM5A 2NSMA 3KQZA 4P44A 4OC5A 1CP7A 4MMOA 2V77A 3PRTA 1ZG8A 1DTDA 4X2TA 2PJCA 1KWMA 1TKJA 1TXRA 3WC6A 1LAMA 3HUVA 2ABZA 3S9NA 3MRUA 2AFUA 4MCQA 5LRGA 4ZI6A 4MHNA 4OC3A 1M4LA 4MRIA 5DS0A 2I3CA 3VARA 3RAMA 1TKFA 3H8FA 2ZEMA 4OIWA 2NYQA 5JGFA 3D7DA 1LFWA 1CPXA 5CBMA 2J9AA 2PJ0A 3SJGA 4OC0A 2PIZA 3BI1A 1PYTB 3B3SA 4ZY1A 4ONWA 1F57A 4ZX8A 4JYWA 3LMSA 1VIXA 1HEEA 3NA6A 2F8HA 2VL1A 3PB8X 3H8EA 2G9DA 2JBKA 2PJ7A 4DJLA 2BO9A 3SJXA 3CPAA 4X3RA 4NGTA 2HB6A 3WC7A 1ARLA 2PJBA 1XMBA 1LAPA 4PXEA 2OR4A 4F9UA 1ELMP 4NGPA 5LRKA 4MCSA 4P4IA 1FT7A 1XRYA 4IHMA 6CPAA 1Z8LA 2XEGA 4EMEA 5LYFA 1BPMA 4JZ0A 3IFEA 3FJUA 3SI2A 1OBRA 4G1PA 5LYIA 5JM6A 2PVWA 1CPSA 5LRJA 1IGBA 2PJ4A 2AFXA 1VHOA 4UEZA 3D4UA 2OOTA 4AXVA 2IJZA 4OC1A 4UEFA 1TKHA 4EFDA 4PXDA 1LOKA 3NFZA 4K3NA 4W9YA 5CPAA 4LQGA 3B35A 4X8IA 4B6ZA 2AFWA 3FX6A 3VATA 1IY7A 2Q51A 3PB4X 4NGNA 2CIJA 4WJBA 3IWWA 3IEHA 2ZEEA 4NJQA 4PPZA 3HLPA 3D7HA 4NGMA 5D29A 3QNVA 1ELLP 1YMEA 3KGQA 2ZOFA 1CX8A 4RUHA 2AFOA 1Z5RA 3D7GA 4EWTA 3TX8A 4MHYA 2RB7A 3KR4A 2PE3A 3DGVA 2ZOGA 3ISXA 2AFZA 5I4MA 4TNUA 1NSAA 2CTCA 5ELYA 1EE3P 5LYDA 1TF8A 2PJ8A 3VH9A 3B3VA 4F9VA 2PJ3A 2POKA 3PFOA 2IMOA 2BCOA 2WYRA 3B3WA 4R6TA 3B7IA 3KHZA 1TF9A 2XEFA 3WT4A 2ZEGA 2ZEOA 4OC2A 2QVPA 3MN8A 2O53A 1HDQA 1Q7LA 3CPXA 4UIAA 4OKOA 2C6GA 1CBXA 1CP6A 2HC9A 2PIYA 1YW4A 3KQXA 3L2NA 2AFMA 4NGSA 1R3NA 1AYEA 2ZEHA 4ZYQA 4PQAA 3FF3A 3GB0A 3KZWA 3V7ZA 3S9MA 3BXMA 3KR5A 3RBUA 3FMCA 2V8HA 2ZEFA 2PJ9A 4NGRA 3NH4A 5HXDA 2WZNA 1UWYA 1BAVA 3WABA 4PXCA 3KHXA 2XEJA 1F2PA 3BHXA 3CDXA 1R43A 2QYVA 1ZLHA 3BI0A 5F09A 3K2KA 4YU9A 1YLOA 1YSJA 3CT9A 1H8LA 3GLJA 3N5FA 2EK9A 5HVFA 3WC5A 3PEIA 2GLJA 2Q4ZA 3DLJA 1JQGA 1XBUA 3B3TA 4R76A 4A38A 4P4EA 2C1CA 2ZELA 1Y0YA 2ZEPA 1QQ9A 1QMUA 3S9LA 1XFOA 4WWVA 1LANA 4UF4A 4DYOA 4OIDA 3SI1A 2C6PA 4Z65A 4FBEA 2JEWA 3SJEA 2CF4A 2RFHA 2GLFA 4P4JA 5HVHA 2ANPA 1GYTA 4R7MA 2V8VA 4Q7AA 2EK8A 3B3CA 2GREA 4A39A 4P45A 4KSIA 2PJAA 3H8GA 3FECA 1ZLIA 3NH5A 3RZAA 3NH8A 2IQ6A 2V8DA 3SJFA 4UEEA 4P4BA 1ZG7A 3PB6X 4ZY0A 2GU2A 1YW6A 1Z2LA 4UIBA 1BLLE 3GUXA 5K8NA 2XEIA 3KASA 3IC1A 2AFSA 3KI9A 4MHPA 2PJ1A 4P10A 4ZY2A 4NJRA 5LYLA 2BOAA 3IJ3A 1XJOA 4YWYA 2JBJA 2PJ5A 3SI0A 1PCAA 3JRUA 3IIBA 3TC8A 3D7FA 2ZENA 1DE4C 5K8OA 2FVGA 2C6CA 4A37A 4P6YA 5K8PA 1FNOA 3LWUA 3FVLA 3PBBA 4R8FA 4OP4A 4FAIA 4FUUA 4OMEA 3PBEA 3D66A 1CG2A 3PB9X 4H2KA 1ARMA 1VHEA 2O4HA 4FWUA 4MHZA 1RTQA 4MCPA 3FEDA 2PRQA 3K9TA 5D8NA 1F2OA 4MXUA 4O23A 4DUKA 3V38A 3IO1A 1LCPA 2PJ2A 3KL9A 5K8MA 5IB9A 1HDUA 4A94A 2V8GA 1Y0RA 4ZX9A 2ZEDA 4CPAA 2CTBA 1BPNA 3PFEA 3ISZA 4F8ZA 3I1UA 1AMPA 1ZG9A 1VGYA 3B2YA 3PB7X 4TWEA 4IAVA 4MCRA 3D67A 3D68A 2F7VA 2DEAA 1Y7EA 3FEEA 3FH4A 2Q43A 4P4DA 5J1QA 2EWBA 4NGQA 4OC4A 2PJ6A 4PXBA 5HVGA 5JH9A 4BD9A 2PVVA 2PCUA 2QJ8A 7CPAA 4P4FA 5THWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IK2 A;  4NFR A;  3T8W A;  8CPA A;  4GM5 A;  2NSM A;  3KQZ A;  4P44 A;  4OC5 A;  1CP7 A;  4MMO A;  2V77 A;  3PRT A;  1ZG8 A;  1DTD A;  4X2T A;  2PJC A;  1KWM A;  1TKJ A;  1TXR A;  3WC6 A;  1LAM A;  3HUV A;  2ABZ A;  3S9N A;  3MRU A;  2AFU A;  4MCQ A;  5LRG A;  4ZI6 A;  4MHN A;  4OC3 A;  1M4L A;  4MRI A;  5DS0 A;  2I3C A;  3VAR A;  3RAM A;  1TKF A;  3H8F A;  2ZEM A;  4OIW A;  2NYQ A;  5JGF A;  3D7D A;  1LFW A;  1CPX A;  5CBM A;  2J9A A;  2PJ0 A;  3SJG A;  4OC0 A;  2PIZ A;  3BI1 A;  1PYT B;  3B3S A;  4ZY1 A;  4ONW A;  1F57 A;  4ZX8 A;  4JYW A;  3LMS A;  1VIX A;  1HEE A;  3NA6 A;  2F8H A;  2VL1 A;  3PB8 X;  3H8E A;  2G9D A;  2JBK A;  2PJ7 A;  4DJL A;  2BO9 A;  3SJX A;  3CPA A;  4X3R A;  4NGT A;  2HB6 A;  3WC7 A;  1ARL A;  2PJB A;  1XMB A;  1LAP A;  4PXE A;  2OR4 A;  4F9U A;  1ELM P;  4NGP A;  5LRK A;  4MCS A;  4P4I A;  1FT7 A;  1XRY A;  4IHM A;  6CPA A;  1Z8L A;  2XEG A;  4EME A;  5LYF A;  1BPM A;  4JZ0 A;  3IFE A;  3FJU A;  3SI2 A;  1OBR A;  4G1P A;  5LYI A;  5JM6 A;  2PVW A;  1CPS A;  5LRJ A;  1IGB A;  2PJ4 A;  2AFX A;  1VHO A;  4UEZ A;  3D4U A;  2OOT A;  4AXV A;  2IJZ A;  4OC1 A;  4UEF A;  1TKH A;  4EFD A;  4PXD A;  1LOK A;  3NFZ A;  4K3N A;  4W9Y A;  5CPA A;  4LQG A;  3B35 A;  4X8I A;  4B6Z A;  2AFW A;  3FX6 A;  3VAT A;  1IY7 A;  2Q51 A;  3PB4 X;  4NGN A;  2CIJ A;  4WJB A;  3IWW A;  3IEH A;  2ZEE A;  4NJQ A;  4PPZ A;  3HLP A;  3D7H A;  4NGM A;  5D29 A;  3QNV A;  1ELL P;  1YME A;  3KGQ A;  2ZOF A;  1CX8 A;  4RUH A;  2AFO A;  1Z5R A;  3D7G A;  4EWT A;  3TX8 A;  4MHY A;  2RB7 A;  3KR4 A;  2PE3 A;  3DGV A;  2ZOG A;  3ISX A;  2AFZ A;  5I4M A;  4TNU A;  1NSA A;  2CTC A;  5ELY A;  1EE3 P;  5LYD A;  1TF8 A;  2PJ8 A;  3VH9 A;  3B3V A;  4F9V A;  2PJ3 A;  2POK A;  3PFO A;  2IMO A;  2BCO A;  2WYR A;  3B3W A;  4R6T A;  3B7I A;  3KHZ A;  1TF9 A;  2XEF A;  3WT4 A;  2ZEG A;  2ZEO A;  4OC2 A;  2QVP A;  3MN8 A;  2O53 A;  1HDQ A;  1Q7L A;  3CPX A;  4UIA A;  4OKO A;  2C6G A;  1CBX A;  1CP6 A;  2HC9 A;  2PIY A;  1YW4 A;  3KQX A;  3L2N A;  2AFM A;  4NGS A;  1R3N A;  1AYE A;  2ZEH A;  4ZYQ A;  4PQA A;  3FF3 A;  3GB0 A;  3KZW A;  3V7Z A;  3S9M A;  3BXM A;  3KR5 A;  3RBU A;  3FMC A;  2V8H A;  2ZEF A;  2PJ9 A;  4NGR A;  3NH4 A;  5HXD A;  2WZN A;  1UWY A;  1BAV A;  3WAB A;  4PXC A;  3KHX A;  2XEJ A;  1F2P A;  3BHX A;  3CDX A;  1R43 A;  2QYV A;  1ZLH A;  3BI0 A;  5F09 A;  3K2K A;  4YU9 A;  1YLO A;  1YSJ A;  3CT9 A;  1H8L A;  3GLJ A;  3N5F A;  2EK9 A;  5HVF A;  3WC5 A;  3PEI A;  2GLJ A;  2Q4Z A;  3DLJ A;  1JQG A;  1XBU A;  3B3T A;  4R76 A;  4A38 A;  4P4E A;  2C1C A;  2ZEL A;  1Y0Y A;  2ZEP A;  1QQ9 A;  1QMU A;  3S9L A;  1XFO A;  4WWV A;  1LAN A;  4UF4 A;  4DYO A;  4OID A;  3SI1 A;  2C6P A;  4Z65 A;  4FBE A;  2JEW A;  3SJE A;  2CF4 A;  2RFH A;  2GLF A;  4P4J A;  5HVH A;  2ANP A;  1GYT A;  4R7M A;  2V8V A;  4Q7A A;  2EK8 A;  3B3C A;  2GRE A;  4A39 A;  4P45 A;  4KSI A;  2PJA A;  3H8G A;  3FEC A;  1ZLI A;  3NH5 A;  3RZA A;  3NH8 A;  2IQ6 A;  2V8D A;  3SJF A;  4UEE A;  4P4B A;  1ZG7 A;  3PB6 X;  4ZY0 A;  2GU2 A;  1YW6 A;  1Z2L A;  4UIB A;  1BLL E;  3GUX A;  5K8N A;  2XEI A;  3KAS A;  3IC1 A;  2AFS A;  3KI9 A;  4MHP A;  2PJ1 A;  4P10 A;  4ZY2 A;  4NJR A;  5LYL A;  2BOA A;  3IJ3 A;  1XJO A;  4YWY A;  2JBJ A;  2PJ5 A;  3SI0 A;  1PCA A;  3JRU A;  3IIB A;  3TC8 A;  3D7F A;  2ZEN A;  1DE4 C;  5K8O A;  2FVG A;  2C6C A;  4A37 A;  4P6Y A;  5K8P A;  1FNO A;  3LWU A;  3FVL A;  3PBB A;  4R8F A;  4OP4 A;  4FAI A;  4FUU A;  4OME A;  3PBE A;  3D66 A;  1CG2 A;  3PB9 X;  4H2K A;  1ARM A;  1VHE A;  2O4H A;  4FWU A;  4MHZ A;  1RTQ A;  4MCP A;  3FED A;  2PRQ A;  3K9T A;  5D8N A;  1F2O A;  4MXU A;  4O23 A;  4DUK A;  3V38 A;  3IO1 A;  1LCP A;  2PJ2 A;  3KL9 A;  5K8M A;  5IB9 A;  1HDU A;  4A94 A;  2V8G A;  1Y0R A;  4ZX9 A;  2ZED A;  4CPA A;  2CTB A;  1BPN A;  3PFE A;  3ISZ A;  4F8Z A;  3I1U A;  1AMP A;  1ZG9 A;  1VGY A;  3B2Y A;  3PB7 X;  4TWE A;  4IAV A;  4MCR A;  3D67 A;  3D68 A;  2F7V A;  2DEA A;  1Y7E A;  3FEE A;  3FH4 A;  2Q43 A;  4P4D A;  5J1Q A;  2EWB A;  4NGQ A;  4OC4 A;  2PJ6 A;  4PXB A;  5HVG A;  5JH9 A;  4BD9 A;  2PVV A;  2PCU A;  2QJ8 A;  7CPA A;  4P4F A;  5THW A; 
#chains in the Genus database with same CATH topology
 2VI7 A;  4IK2 A;  4NFR A;  3T8W A;  8CPA A;  4B5P B;  4GM5 A;  2NSM A;  3KQZ A;  1M1D A;  2C27 A;  4XPL A;  2O28 A;  4P44 A;  4OC5 A;  1S3Z A;  4XPK A;  4JJX A;  4UFX A;  5A28 A;  4MJ8 A;  1CP7 A;  1M4D A;  4MMO A;  5JQ4 A;  3FIX A;  5KTD A;  2V77 A;  3PRT A;  4U9Z A;  1B87 A;  1ZG8 A;  1U6M A;  1DTD A;  4UCN A;  4X2T A;  2PJC A;  1KWM A;  4YFJ A;  1R57 A;  1TKJ A;  1TXR A;  3WC6 A;  1S60 A;  1LAM A;  4CAF A;  1M44 A;  3HUV A;  4BMH A;  5EBV A;  2ABZ A;  2ODF A;  2ZW5 A;  3BJ8 A;  3CZX A;  3E0K A;  3RYO A;  3S9N A;  3MRU A;  3R1K A;  4M6H A;  2AFU A;  4HNY B;  2Q04 A;  4MCQ A;  5LRG A;  4AVB A;  4ZI6 A;  4MHN A;  4OC3 A;  4CAE A;  1M4L A;  2OB0 A;  3D2M A;  4MRI A;  5DS0 A;  4ZGY B;  2ARH A;  2I3C A;  1X10 A;  2CNM A;  3RAM A;  3VAR A;  3JUW A;  1TKF A;  4GXH A;  3H8F A;  5J8F A;  2D4O A;  2P6E A;  2ZEM A;  2R8V A;  2Z3K A;  4OIW A;  1YK3 A;  2NYQ A;  4KOU A;  5JGF A;  1XMT A;  3D7D A;  4LQ6 A;  1LFW A;  1CPX A;  1XEB A;  1KUX A;  3K9U A;  4ORF A;  3W6S A;  5CBM A;  2F5I A;  2J9A A;  1AUG A;  4MFJ A;  2PJ0 A;  3LOD A;  3TO6 A;  4CGM A;  3P2F A;  1VHS A;  2G0B A;  3SJG A;  4OC0 A;  1Z8W A;  2PIZ A;  3BI1 A;  1PYT B;  3B3S A;  4HNX B;  4UFW A;  3UY5 A;  1QST A;  4ZY1 A;  4CS0 B;  4KLW A;  4ONW A;  1F57 A;  4ZX8 A;  4JYW A;  1MJA A;  4UWI A;  3LMS A;  1HEE A;  1VIX A;  3NA6 A;  4E8O A;  2F8H A;  1IB1 E;  1S7K A;  2VL1 A;  3H8E A;  3PB8 X;  4L8A A;  2G9D A;  4UA3 A;  4JLY A;  4C68 A;  2JBK A;  2HV2 A;  1UFH A;  4F6A A;  4PK2 A;  4XNH B;  3S6F A;  4CYQ A;  4C2X A;  4EVY A;  2Q4V A;  2FSR A;  4B14 A;  2PJ7 A;  4DJL A;  2PRB A;  3C26 A;  2BO9 A;  3SJX A;  3VWD A;  1XIX A;  3CPA A;  4X3R A;  4NGT A;  2HB6 A;  4KUB A;  3WC7 A;  1ARL A;  1N71 A;  1SQH A;  2PJB A;  5GCN A;  3CXP A;  1XMB A;  1LAP A;  4PXE A;  3I9S A;  3CXQ A;  2OR4 A;  4F9U A;  1ELM P;  4NGP A;  1XOV A;  1LRZ A;  4MCS A;  5LRK A;  2BSW A;  4P4I A;  1FT7 A;  1XRY A;  4NCZ A;  4UWJ A;  4IHM A;  2GAN A;  4FD5 A;  4OLL A;  6CPA A;  1Q2D A;  1Z8L A;  2PDO A;  4C2Y A;  2XEG A;  4EME A;  4MI4 A;  5IX3 A;  1Q2Y A;  1BPM A;  4CGL A;  5LYF A;  4JZ0 A;  4PSW A;  4MFL A;  3IFE A;  2J8M A;  3FJU A;  3SI2 A;  1OBR A;  1QSM A;  4G1P A;  5LYI A;  4YGO A;  5H84 A;  2FL4 A;  4J3G A;  5JM6 A;  2PVW A;  1Z9U A;  1CPS A;  5LRJ A;  1IGB A;  2VZY A;  2PJ4 A;  3CXS A;  2AFX A;  1VHO A;  4UEZ A;  5KTC A;  1MJ9 A;  3D4U A;  2HUZ A;  2OOT A;  4AXV A;  2IJZ A;  4AVA A;  5F46 A;  4OC1 A;  4UEF A;  1Q2C A;  1WWZ A;  1TKH A;  5AGE A;  3W91 A;  4EFD A;  3V8I A;  2DPS A;  4PXD A;  1KZF A;  1LOK A;  3NFZ A;  4H6U A;  1XE4 A;  4JXR A;  4K3N A;  2IL4 A;  4KOX A;  4KOV A;  1X12 A;  4W9Y A;  2G3A A;  4LQG A;  2YGW A;  2I00 A;  2YND A;  3B35 A;  2EVN A;  3QAY A;  4KS9 A;  4KVX A;  4RS2 A;  5KTA A;  1YVK A;  4HPS A;  4M3S A;  4X8I A;  4MFK A;  4UCM A;  4MFQ A;  4RI1 A;  4B6Z A;  2AFW A;  3FX6 A;  4KUA A;  4MBU A;  3TTH A;  3VAT A;  1IY7 A;  3I3G A;  2AE6 A;  2Q51 A;  2EBJ A;  3PB4 X;  4NGN A;  2CIJ A;  4WJB A;  1I12 A;  3IWW A;  3IEH A;  4FD4 A;  4AVC A;  2ZEE A;  1QSR A;  4NJQ A;  3DR6 A;  4R57 A;  5DWN A;  4PPZ A;  3HLP A;  4ZBG A;  3D7H A;  2WPX A;  4FD6 A;  4NGM A;  3EY5 A;  3IWG A;  5D29 A;  3NE7 A;  1IOF A;  4I49 A;  2K5T A;  4OAD A;  1ELL P;  3QNV A;  1YME A;  3KGQ A;  3LAC A;  2ZOF A;  2Q7S A;  1CX8 A;  5G20 A;  1Z8X A;  4RUH A;  2AFO A;  4CGO A;  1Z5R A;  3FRM A;  3D7G A;  4EWT A;  4JWP A;  1IIC A;  3TX8 A;  3IU1 A;  4DNC A;  4MHY A;  4MHD A;  1BOB A;  3EO4 A;  2RB7 A;  3KR4 A;  3R96 A;  2PE3 A;  5EMI A;  3DGV A;  5AG7 A;  4XPD C;  2ZOG A;  4KOS A;  3ISX A;  4CYN A;  2AFZ A;  3RO0 A;  4TNU A;  3D2P A;  2VBQ A;  3DDD A;  5I4M A;  1NSA A;  3F5B A;  2B3U A;  2CTC A;  5ELY A;  4CAV A;  1EE3 P;  2R1I A;  5LYD A;  1Y9K A;  2ZW4 A;  4A95 A;  1TF8 A;  4U5Y A;  2PJ8 A;  4BBH A;  2JDD A;  4E2A A;  3VH9 A;  1IOI A;  1IYK A;  3B3V A;  2Q44 A;  4NSQ A;  3ZJ0 A;  2PJ3 A;  4F9V A;  2POK A;  3EXN A;  3FYN A;  5H86 A;  3DR8 A;  2BUE A;  2IMO A;  3PFO A;  1YVO A;  2BCO A;  2Z11 A;  2WYR A;  3B3W A;  4AB7 A;  4R6T A;  3TT2 A;  3B7I A;  4QBJ A;  1TF9 A;  2XEF A;  3KHZ A;  3WT4 A;  2ZEG A;  2GE3 A;  1Y7R A;  2ZEO A;  4HNW B;  2B3V A;  3FB3 A;  4OC2 A;  2QVP A;  3MN8 A;  2O53 A;  3D3S A;  1S5K A;  4C7H A;  1HDQ A;  3W6X A;  1Q7L A;  2OZU A;  2Y0M A;  3CPX A;  4UIA A;  4XPD B;  2ATR A;  4OKO A;  2C6G A;  5CPA A;  4E0A A;  4KVO E;  1CBX A;  2FS5 A;  1CP6 A;  2Z3L A;  3ZZI A;  2HC9 A;  2PIY A;  1YW4 A;  3KQX A;  2PR8 A;  3L2N A;  2AFM A;  4NGS A;  1L0C A;  1AYE A;  1R3N A;  2ZEH A;  4PQA A;  3FF3 A;  4AG7 A;  4CAX A;  4ZYQ A;  3T90 A;  3GB0 A;  3H4Q A;  2CNS A;  4PV6 A;  3SXO A;  4LUA A;  3KZW A;  3V7Z A;  3S9M A;  3BXM A;  4R9M A;  3KR5 A;  1Z8T A;  1CM0 A;  3RBU A;  1YR0 A;  3FMC A;  2V8H A;  1WK4 A;  4CGN A;  2ZEF A;  2QEC A;  4PK3 A;  4PSX A;  2PJ9 A;  5DWM A;  4B13 A;  4L89 A;  4NGR A;  2KCW A;  3NH4 A;  2WZN A;  5HXD A;  1UWY A;  1BAV A;  1B6B A;  3TCV A;  2Z3O A;  4PXC A;  1Y9W A;  1YX0 A;  3KHX A;  2XEJ A;  3NE8 A;  3WAB A;  1F2P A;  3BHX A;  3KKW A;  3IGR A;  3CDX A;  4CAW A;  1R43 A;  2QYV A;  3G3S A;  5A27 A;  3VWE A;  3JVN A;  1ZLH A;  3BI0 A;  5F09 A;  3K2K A;  3FBU A;  1QSO A;  3GIU A;  1YLO A;  1YSJ A;  4YU9 A;  3CT9 A;  3S6K A;  2YNC C;  2B58 A;  4CRY B;  1H8L A;  3GLJ A;  3N5F A;  5AG5 A;  2EK9 A;  5HVF A;  3WC5 A;  2OU2 A;  3PEI A;  3S6G A;  2DXQ A;  2GLJ A;  1P0H A;  2Q4Z A;  3T9Y A;  3DLJ A;  2X7B A;  3EC4 A;  2ZW6 A;  4KZT A;  1JQG A;  2ZW7 A;  1P4N A;  1XBU A;  3B3T A;  3TE4 A;  2FT0 A;  5C82 A;  4R76 A;  5IB0 A;  1YRE A;  4A38 A;  1FY7 A;  5HMN A;  4P4E A;  4KVM E;  2C1C A;  2ZEL A;  4MY3 A;  2PSW A;  1Y0Y A;  4NF1 A;  1I1D A;  4B12 A;  5IV0 A;  5AG6 A;  2ZEP A;  4QUS A;  5FVJ A;  4Q36 A;  4R87 A;  4JXQ A;  1QQ9 A;  1QMU A;  2Z3M A;  3S9L A;  1XFO A;  4H6Z A;  4NEX A;  2Q4Y A;  4AG9 A;  4QB9 A;  4WWV A;  1ZO0 A;  2CNT A;  1LAN A;  3EFA A;  2REF A;  4UF4 A;  4DYO A;  4OID A;  4KOR A;  2A4N A;  2FCK A;  1RXT A;  2B4B A;  3TFY A;  3SI1 A;  1MK4 A;  2C6P A;  4Z65 A;  2QML A;  2JLM A;  4R3K A;  3B8G A;  3LD2 A;  4FBE A;  3G8W A;  1NE9 A;  2JEW A;  3SJE A;  1BO4 A;  2CF4 A;  2RFH A;  1YQE A;  1TIQ A;  2OZG A;  2GLF A;  1M4G A;  4P4J A;  5EC4 A;  4B5P A;  2R98 A;  1JWQ A;  5HVH A;  2ANP A;  3P2H A;  1VKC A;  2HQY A;  1RO5 A;  1XF8 A;  2Z3N A;  1GYT A;  4ONU A;  4X5K A;  5G21 A;  4R7M A;  2V8V A;  2B5G A;  4Q7A A;  2EK8 A;  3D8P A;  3N7Z A;  2Q7B A;  2Z0Z A;  3B3C A;  1KUV A;  2CXA A;  2GRE A;  5HH1 A;  4H89 A;  4A39 A;  4P45 A;  4KSI A;  2PJA A;  3H8G A;  2R7H A;  3FEC A;  1ZLI A;  5J8C A;  4CYO A;  3H5Z A;  2BL1 A;  5E96 A;  3NH5 A;  4M6G A;  4U9Y A;  5F49 A;  2GIV A;  3RZA A;  3NH8 A;  2FIA A;  3TOB A;  2VQY A;  2REE A;  4KSA A;  4NXY A;  1S7F A;  2WPW A;  4C2Z A;  2B5G B;  2IQ6 A;  2JEV A;  2B4D A;  2V8D A;  3R9F A;  3SJF A;  1QSN A;  4UEE A;  2CY2 A;  4P4B A;  1ZG7 A;  3PB6 X;  4ZY0 A;  3PP9 A;  2GU2 A;  2G3T A;  1YW6 A;  5G22 A;  1Z2L A;  5C88 A;  4Y49 C;  4M6I A;  4BIN A;  4K30 A;  4UIB A;  1YLE A;  4KOT A;  3BJ7 A;  4XNH C;  5AG4 A;  4B11 A;  1BLL E;  3GUX A;  5K8N A;  5F48 A;  4CRZ B;  2FXF A;  4KOW A;  3F8K A;  4A30 A;  2XEI A;  3KAS A;  3R95 A;  2WUU A;  3IC1 A;  2YNE A;  2AFS A;  4YRH A;  1OZP A;  2B4D B;  3KI9 A;  4IUS A;  4MHP A;  2PJ1 A;  2ZPA A;  2BEI A;  3F0A A;  4P10 A;  4ZY2 A;  4II9 A;  2OZH A;  4NJR A;  3TOA A;  4B10 A;  3PZJ A;  1I21 A;  3IWE A;  5LYL A;  4OAE A;  2BOA A;  4GS4 A;  3IJ3 A;  5CNP A;  1YGH A;  1XJO A;  3QAH A;  4YWY A;  1S7N A;  2GFQ A;  2JBJ A;  2PJ5 A;  4MFP A;  3IU2 A;  3SI0 A;  1PCA A;  3BLN A;  3JRU A;  2Q0Y A;  4Q38 A;  3GKR A;  3SXN A;  1Z4E A;  3IIB A;  3R9E A;  3DSB A;  1K4J A;  3D7F A;  1M4I A;  3SHP A;  2ZEN A;  3TC8 A;  3DNS A;  1DE4 C;  3RNZ A;  3JTK A;  5F47 A;  3S6H A;  3TO7 A;  5K8O A;  2FVG A;  2C6C A;  4Y49 B;  4A37 A;  4P6Y A;  4C7I A;  5K8P A;  4HKF A;  2Z10 A;  1FNO A;  3LWU A;  4QC6 A;  3FVL A;  3PBB A;  1IU8 A;  3PGP A;  4KSF A;  2VEZ A;  4KLV A;  5G1Z A;  4R8F A;  4UFV A;  4B5O A;  4OP4 A;  4LX9 A;  4CYP A;  4FAI A;  4FUU A;  4MY0 A;  4OME A;  1IID A;  2P0W A;  1Z4R A;  3PBE A;  3D66 A;  1CG2 A;  2JDC A;  3PB9 X;  2D4P A;  4H2K A;  2EO8 A;  1ARM A;  1VHE A;  2O4H A;  2RC4 A;  4FWU A;  4MHZ A;  1RTQ A;  4MCP A;  3FED A;  4A2Z A;  2PRQ A;  1NMT A;  3GYA A;  3K9T A;  5D8N A;  4A32 A;  4RN7 A;  1J4J A;  1F2O A;  2Z3P A;  1NSL A;  1S7L A;  1KUY A;  4KOY A;  4QVT A;  1CJW A;  3GY9 A;  3MGD A;  4A33 A;  4MXU A;  4O23 A;  1MJB A;  4DUK A;  3V38 A;  2EUI A;  3IO1 A;  1LCP A;  2PJ2 A;  3KL9 A;  5K8M A;  2NMT A;  2PQ8 A;  1A2Z A;  4MFZ A;  3R9G A;  5IB9 A;  3OWC A;  2DPT A;  2FIW A;  2H5M A;  3WR7 A;  2QIR A;  1HDU A;  1PU9 A;  4A94 A;  2V8G A;  2PR1 A;  1Y0R A;  4ZX9 A;  2YNC A;  2ZED A;  4CPA A;  2CTB A;  4FD7 A;  1BPN A;  3PFE A;  3ISZ A;  2PC1 A;  4F8Z A;  3I1U A;  1AMP A;  4F0Y A;  1ZG9 A;  4A31 A;  1VGY A;  4F0X A;  2DF5 A;  2P6F A;  2AJ6 A;  2J8R A;  3B2Y A;  2FE7 A;  3PB7 X;  4TWE A;  4IAV A;  5BWA B;  4MCR A;  3D67 A;  3D68 A;  1ON0 A;  2F7V A;  3QB8 A;  1IYL A;  2DEA A;  5JPH A;  1Y7E A;  2OH1 A;  3FEE A;  1PUA A;  2WSA A;  2ZXV A;  3FXT A;  3FH4 A;  4CGP A;  5I0C A;  5ISV A;  2Q43 A;  4M85 A;  4P4D A;  2VZZ A;  1V0C A;  5J1Q A;  2EWB A;  4NGQ A;  4OC4 A;  2PJ6 A;  4PXB A;  5HVG A;  5JH9 A;  3FNC A;  2PVV A;  4R3L A;  4BD9 A;  4UBR A;  2J8N A;  4IF5 A;  2PCU A;  2QJ8 A;  4UCP A;  1GHE A;  7CPA A;  4JD6 A;  2I79 A;  2P6G A;  4P4F A;  3TO9 A;  2VXK A;  3A9L A;  5THW A; 
#chains in the Genus database with same CATH homology
 4IK2 A;  4NFR A;  3T8W A;  8CPA A;  4GM5 A;  2NSM A;  3KQZ A;  4P44 A;  4OC5 A;  1CP7 A;  4MMO A;  2V77 A;  3PRT A;  1ZG8 A;  1DTD A;  4X2T A;  2PJC A;  1KWM A;  1TKJ A;  1TXR A;  3WC6 A;  1LAM A;  3HUV A;  2ABZ A;  3S9N A;  3MRU A;  2AFU A;  4MCQ A;  5LRG A;  4ZI6 A;  4MHN A;  4OC3 A;  1M4L A;  4MRI A;  5DS0 A;  2I3C A;  3VAR A;  3RAM A;  1TKF A;  3H8F A;  2ZEM A;  4OIW A;  2NYQ A;  5JGF A;  3D7D A;  1LFW A;  1CPX A;  5CBM A;  2J9A A;  2PJ0 A;  3SJG A;  4OC0 A;  2PIZ A;  3BI1 A;  1PYT B;  3B3S A;  4ZY1 A;  4ONW A;  1F57 A;  4ZX8 A;  4JYW A;  3LMS A;  1VIX A;  1HEE A;  3NA6 A;  2F8H A;  2VL1 A;  3PB8 X;  3H8E A;  2G9D A;  2JBK A;  2PJ7 A;  4DJL A;  2BO9 A;  3SJX A;  3CPA A;  4X3R A;  4NGT A;  2HB6 A;  3WC7 A;  1ARL A;  2PJB A;  1XMB A;  1LAP A;  4PXE A;  2OR4 A;  4F9U A;  1ELM P;  4NGP A;  5LRK A;  4MCS A;  4P4I A;  1FT7 A;  1XRY A;  4IHM A;  6CPA A;  1Z8L A;  2XEG A;  4EME A;  5LYF A;  1BPM A;  4JZ0 A;  3IFE A;  3FJU A;  3SI2 A;  1OBR A;  4G1P A;  5LYI A;  5JM6 A;  2PVW A;  1CPS A;  5LRJ A;  1IGB A;  2PJ4 A;  2AFX A;  1VHO A;  4UEZ A;  3D4U A;  2OOT A;  4AXV A;  2IJZ A;  4OC1 A;  4UEF A;  1TKH A;  4EFD A;  4PXD A;  1LOK A;  3NFZ A;  4K3N A;  4W9Y A;  5CPA A;  4LQG A;  3B35 A;  4X8I A;  4B6Z A;  2AFW A;  3FX6 A;  3VAT A;  1IY7 A;  2Q51 A;  3PB4 X;  4NGN A;  2CIJ A;  4WJB A;  3IWW A;  3IEH A;  2ZEE A;  4NJQ A;  4PPZ A;  3HLP A;  3D7H A;  4NGM A;  5D29 A;  3QNV A;  1ELL P;  1YME A;  3KGQ A;  2ZOF A;  1CX8 A;  4RUH A;  2AFO A;  1Z5R A;  3D7G A;  4EWT A;  3TX8 A;  4MHY A;  2RB7 A;  3KR4 A;  2PE3 A;  3DGV A;  2ZOG A;  3ISX A;  2AFZ A;  5I4M A;  4TNU A;  1NSA A;  2CTC A;  5ELY A;  1EE3 P;  5LYD A;  1TF8 A;  2PJ8 A;  3VH9 A;  3B3V A;  4F9V A;  2PJ3 A;  2POK A;  3PFO A;  2IMO A;  2BCO A;  2WYR A;  3B3W A;  4R6T A;  3B7I A;  3KHZ A;  1TF9 A;  2XEF A;  3WT4 A;  2ZEG A;  2ZEO A;  4OC2 A;  2QVP A;  3MN8 A;  2O53 A;  1HDQ A;  1Q7L A;  3CPX A;  4UIA A;  4OKO A;  2C6G A;  1CBX A;  1CP6 A;  2HC9 A;  2PIY A;  1YW4 A;  3KQX A;  3L2N A;  2AFM A;  4NGS A;  1R3N A;  1AYE A;  2ZEH A;  4ZYQ A;  4PQA A;  3FF3 A;  3GB0 A;  3KZW A;  3V7Z A;  3S9M A;  3BXM A;  3KR5 A;  3RBU A;  3FMC A;  2V8H A;  2ZEF A;  2PJ9 A;  4NGR A;  3NH4 A;  5HXD A;  2WZN A;  1UWY A;  1BAV A;  3WAB A;  4PXC A;  3KHX A;  2XEJ A;  1F2P A;  3BHX A;  3CDX A;  1R43 A;  2QYV A;  1ZLH A;  3BI0 A;  5F09 A;  3K2K A;  4YU9 A;  1YLO A;  1YSJ A;  3CT9 A;  1H8L A;  3GLJ A;  3N5F A;  2EK9 A;  5HVF A;  3WC5 A;  3PEI A;  2GLJ A;  2Q4Z A;  3DLJ A;  1JQG A;  1XBU A;  3B3T A;  4R76 A;  4A38 A;  4P4E A;  2C1C A;  2ZEL A;  1Y0Y A;  2ZEP A;  1QQ9 A;  1QMU A;  3S9L A;  1XFO A;  4WWV A;  1LAN A;  4UF4 A;  4DYO A;  4OID A;  3SI1 A;  2C6P A;  4Z65 A;  4FBE A;  2JEW A;  3SJE A;  2CF4 A;  2RFH A;  2GLF A;  4P4J A;  5HVH A;  2ANP A;  1GYT A;  4R7M A;  2V8V A;  4Q7A A;  2EK8 A;  3B3C A;  2GRE A;  4A39 A;  4P45 A;  4KSI A;  2PJA A;  3H8G A;  3FEC A;  1ZLI A;  3NH5 A;  3RZA A;  3NH8 A;  2IQ6 A;  2V8D A;  3SJF A;  4UEE A;  4P4B A;  1ZG7 A;  3PB6 X;  4ZY0 A;  2GU2 A;  1YW6 A;  1Z2L A;  4UIB A;  1BLL E;  3GUX A;  5K8N A;  2XEI A;  3KAS A;  3IC1 A;  2AFS A;  3KI9 A;  4MHP A;  2PJ1 A;  4P10 A;  4ZY2 A;  4NJR A;  5LYL A;  2BOA A;  3IJ3 A;  1XJO A;  4YWY A;  2JBJ A;  2PJ5 A;  3SI0 A;  1PCA A;  3JRU A;  3IIB A;  3TC8 A;  3D7F A;  2ZEN A;  1DE4 C;  5K8O A;  2FVG A;  2C6C A;  4A37 A;  4P6Y A;  5K8P A;  1FNO A;  3LWU A;  3FVL A;  3PBB A;  4R8F A;  4OP4 A;  4FAI A;  4FUU A;  4OME A;  3PBE A;  3D66 A;  1CG2 A;  3PB9 X;  4H2K A;  1ARM A;  1VHE A;  2O4H A;  4FWU A;  4MHZ A;  1RTQ A;  4MCP A;  3FED A;  2PRQ A;  3K9T A;  5D8N A;  1F2O A;  4MXU A;  4O23 A;  4DUK A;  3V38 A;  3IO1 A;  1LCP A;  2PJ2 A;  3KL9 A;  5K8M A;  5IB9 A;  1HDU A;  4A94 A;  2V8G A;  1Y0R A;  4ZX9 A;  2ZED A;  4CPA A;  2CTB A;  1BPN A;  3PFE A;  3ISZ A;  4F8Z A;  3I1U A;  1AMP A;  1ZG9 A;  1VGY A;  3B2Y A;  3PB7 X;  4TWE A;  4IAV A;  4MCR A;  3D67 A;  3D68 A;  2F7V A;  2DEA A;  1Y7E A;  3FEE A;  3FH4 A;  2Q43 A;  4P4D A;  5J1Q A;  2EWB A;  4NGQ A;  4OC4 A;  2PJ6 A;  4PXB A;  5HVG A;  5JH9 A;  4BD9 A;  2PVV A;  2PCU A;  2QJ8 A;  7CPA A;  4P4F A;  5THW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...