5HXDA

Crystal structure of murein-tripeptide amidase mpaa from escherichia coli o157
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
237
structure length
237
Chain Sequence
MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRESGLILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRNFPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPLACIEDPRHSELGEWLAQAFELPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEASEKYLFAMANLLRWHPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein MpaA
publication title Crystal Structure of Murein-Tripeptide Amidase MpaA from Escherichia coli O157 at 2.6 angstrom Resolution
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 67
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5hxdA00
1TXRA 1IY7A 3NH4A 3FEEA 1XBUA 2RB7A 3FVLA 4DJLA 5J1QA 1CPSA 3PEIA 4R7MA 3B3VA 4K3NA 4IAVA 2BCOA 4R8FA 3FMCA 3PB6X 3NH8A 1Y0RA 2ZENA 1Z5RA 4OC1A 3BI0A 5HXDA 1YLOA 4P4BA 2QVPA 1BPNA 2PVVA 4MHZA 3QNVA 2ZEHA 4UEEA 5D29A 1ZG9A 2EK8A 1YMEA 1CP6A 4X8IA 2BOAA 2IQ6A 3B3CA 4PXDA 1TKHA 4F9VA 2XEGA 3RAMA 1HEEA 2C6GA 3K9TA 1TF9A 5HVFA 2ZEMA 4G1PA 1VGYA 2GLJA 2V8DA 1GYTA 2V8HA 2WYRA 3WC5A 3VATA 2PVWA 6CPAA 3D7DA 2AFZA 4ZI6A 3SJEA 5K8MA 4B6ZA 2IMOA 2ZEOA 3FH4A 1PCAA 3WC7A 3JRUA 5LRKA 2AFUA 2FVGA 1F2PA 3KASA 5IB9A 5JGFA 5LYLA 1ZG8A 3B35A 1XFOA 2WZNA 2JBJA 3WT4A 5DS0A 4WWVA 4P6YA 3WC6A 4MXUA 2OOTA 3MRUA 4NJRA 4WJBA 4GM5A 4EWTA 4JZ0A 5ELYA 2PJ4A 2ANPA 1EE3P 4MCQA 3T8WA 1HDUA 1VHOA 5LYFA 2PJ1A 4MCRA 1R3NA 4F8ZA 3D67A 1F57A 2PJ0A 1UWYA 1HDQA 3TC8A 2QJ8A 2CF4A 4PXCA 4UIBA 1VIXA 1AMPA 3LWUA 4ZY2A 4MHNA 2ZOFA 4NGTA 1LFWA 1LCPA 3IIBA 4MHYA 2ZEEA 3D7HA 3FEDA 1TF8A 1XMBA 4LQGA 3I1UA 4FBEA 4CPAA 2F8HA 4OC2A 2PJ2A 4NGMA 3HLPA 4UEFA 1ELLP 4OP4A 4BD9A 5JH9A 3D66A 3IEHA 2XEFA 4P4FA 3SI2A 4R76A 1CBXA 2I3CA 3B2YA 3KHXA 2ZEDA 2AFOA 4Z65A 4FAIA 1ARMA 1BAVA 4ZY1A 2ZEGA 4PQAA 4UF4A 2PRQA 4MMOA 3SI0A 4ZY0A 4W9YA 4ONWA 4R6TA 3CPXA 1JQGA 3D7GA 2QYVA 1LAPA 3IWWA 4P44A 4MHPA 1OBRA 2V8VA 2ZEPA 1BPMA 4JYWA 2O4HA 4NGQA 3N5FA 3KZWA 4FUUA 1PYTB 5HVHA 2DEAA 2JEWA 3BHXA 1LANA 1LOKA 1DE4C 5D8NA 3NA6A 2ABZA 4NJQA 2PJAA 4MCPA 3ISXA 1CP7A 3PFOA 2V8GA 2PJ3A 2Q51A 4FWUA 4A38A 3VH9A 3WABA 4NGPA 3TX8A 4ZX9A 1YSJA 1XRYA 2EWBA 1F2OA 4X3RA 3B3SA 2ZOGA 3H8FA 3FJUA 3GB0A 4A39A 5JM6A 4EMEA 3PFEA 3BXMA 1TKFA 1YW6A 1QMUA 1QQ9A 3B3TA 2ZELA 2GREA 4PPZA 4P10A 1R43A 3CDXA 1RTQA 3IJ3A 4IK2A 3KGQA 4TNUA 4NGNA 1Q7LA 4H2KA 4OKOA 4X2TA 2VL1A 4OC3A 1Y0YA 2CIJA 4P45A 3KL9A 3V7ZA 2PJCA 2OR4A 1LAMA 2PIYA 2NYQA 3GUXA 1FNOA 4DYOA 4PXEA 2HB6A 2AFMA 1NSAA 4OC0A 5F09A 2GLFA 3VARA 3KQZA 2AFWA 4YU9A 5LRJA 3D7FA 2PJ7A 3IFEA 4YWYA 2HC9A 4ZYQA 3NFZA 3FF3A 1ZLHA 1Z8LA 4NGSA 1YW4A 3L2NA 3H8EA 4A94A 3IC1A 5K8OA 1ARLA 2EK9A 2POKA 4AXVA 4P4JA 3S9LA 2CTCA 3PRTA 4OIWA 2PE3A 1ZG7A 3PB4X 4OIDA 4P4DA 4F9UA 8CPAA 2GU2A 1BLLE 3PBBA 5I4MA 3KHZA 2O53A 3SI1A 4NGRA 2ZEFA 3ISZA 5THWA 5LRGA 2PJ8A 4MRIA 2PJ9A 1Z2LA 3PB9X 2PJ6A 4P4EA 2PJBA 3SJGA 4NFRA 2AFXA 2F7VA 3S9MA 3H8GA 2G9DA 1FT7A 5K8PA 3D68A 3KR4A 1CX8A 3BI1A 1ELMP 3KI9A 3FX6A 5CBMA 4TWEA 4A37A 3S9NA 5LYDA 2XEJA 4OMEA 2PIZA 1ZLIA 5LYIA 3FECA 4MCSA 7CPAA 4IHMA 2C6CA 1H8LA 1KWMA 3MN8A 2NSMA 3SJXA 4P4IA 3KR5A 1Y7EA 1IGBA 3SJFA 4Q7AA 1AYEA 2BO9A 3PB7X 4RUHA 2Q4ZA 4UEZA 3IO1A 3KQXA 2AFSA 1TKJA 2C6PA 2XEIA 3V38A 3RZAA 4DUKA 2PCUA 4KSIA 3K2KA 3GLJA 1CPXA 2RFHA 3CPAA 4ZX8A 4EFDA 2PJ5A 2C1CA 5HVGA 3B7IA 3DLJA 1VHEA 4UIAA 2CTBA 3B3WA 3PB8X 4OC4A 5CPAA 3NH5A 3DGVA 1M4LA 1DTDA 3LMSA 4OC5A 2JBKA 2Q43A 2V77A 3RBUA 3PBEA 1CG2A 2IJZA 4O23A 2J9AA 3CT9A 3HUVA 3D4UA 5K8NA 1XJOA 4PXBA
chains in the Genus database with same CATH superfamily
2EO8A 4FD7A 3IU2A 3D2PA 1TXRA 4NXYA 1S3ZA 1IY7A 3PGPA 3NH4A 4A30A 4K30A 3FEEA 1XBUA 2RB7A 5EBVA 2AJ6A 4H6UA 4R3LA 5G22A 3FVLA 4OAEA 1M4IA 4IUSA 1S7NA 4BMHA 4E8OA 2OZUA 4FD4A 1M4DA 4MFPA 4DJLA 3TOAA 2PDOA 5J1QA 1CPSA 3PEIA 4R7MA 3B3VA 4K3NA 4B12A 4IAVA 2BCOA 4R87A 4R8FA 3FMCA 3SXOA 2J8NA 3PB6X 3NH8A 1Y0RA 2CNMA 4A31A 2ZENA 1Z5RA 4KVXA 4PK3A 1GHEA 2R8VA 1AUGA 4OC1A 3BI0A 1IICA 5HXDA 1YLOA 4P4BA 2QVPA 4HNXB 1BPNA 4AVAA 2PVVA 4MHZA 3QNVA 2ZEHA 3F8KA 2FCKA 4UEEA 2CXAA 5D29A 3R9EA 4CYPA 1ZG9A 2EK8A 1YMEA 1CP6A 4X8IA 2PRBA 3D3SA 5EMIA 4CAVA 2BOAA 4PV6A 2G3TA 2IQ6A 2VXKA 3B3CA 4PXDA 3W6SA 2GFQA 4NSQA 2R1IA 5BWAB 3P2FA 1QSTA 3QB8A 3R96A 1TKHA 1J4JA 4F9VA 2XEGA 1V0CA 3RAMA 1HEEA 3W6XA 2C6GA 2OU2A 3K9TA 4M6HA 4UFWA 2GIVA 1TF9A 2QECA 1CM0A 5AG7A 2ZEMA 5AGEA 4U9YA 5HVFA 1S7FA 4G1PA 4B14A 1VGYA 1PU9A 2GLJA 2V8DA 1GYTA 2V8HA 4UCPA 5G20A 1PUAA 2WYRA 5KTCA 2FT0A 2Q4YA 4M3SA 3VATA 3WC5A 2PVWA 1S5KA 3QAHA 5C82A 3D7DA 2YNDA 4ZGYB 6CPAA 2AFZA 2BUEA 4PSWA 4ZI6A 3SJEA 1IOFA 5K8MA 4MI4A 5DWNA 3RO0A 1YVKA 4IF5A 4KZTA 4B6ZA 2B5GB 3DSBA 1ZO0A 2IMOA 2ZEOA 4DNCA 3FXTA 4KUBA 2EVNA 4YGOA 3FH4A 1PCAA 3WC7A 3JRUA 2Q0YA 3R1KA 2AFUA 5LRKA 2FVGA 4BINA 1MJ9A 1F2PA 3KASA 1P4NA 5IB9A 5JGFA 5LYLA 3DR8A 1ZG8A 4KOXA 3B35A 1QSOA 1XFOA 1YLEA 2WZNA 4CYNA 2JBJA 3WT4A 5DS0A 4WWVA 4P6YA 3WC6A 4MXUA 4AG7A 1M44A 2OOTA 2P6GA 3MRUA 3VWDA 4LX9A 4NJRA 4WJBA 2B3VA 4GM5A 4JZ0A 4EWTA 1Z4RA 5ELYA 2PJ4A 2ANPA 3FIXA 1EE3P 3EY5A 4MCQA 1HDUA 1VHOA 3F5BA 1YREA 1Z4EA 2PJ1A 2AE6A 1R3NA 4M85A 4MCRA 4MY0A 4F8ZA 3D67A 3LACA 3DNSA 1F57A 2I79A 2PJ0A 1UWYA 1WK4A 1HDQA 1RXTA 3TC8A 5F48A 2C27A 4B11A 4C2YA 2QJ8A 4CAXA 2CF4A 4PXCA 4UIBA 2OZGA 4X5KA 4B13A 2VI7A 1KUYA 1VIXA 2Y0MA 1AMPA 4CAFA 3H4QA 3E0KA 2DPSA 3LWUA 5IX3A 4ZY2A 4MHNA 5ISVA 2ZOFA 1BOBA 1LFWA 1LCPA 2Q7SA 3IIBA 4NGTA 4I49A 5EC4A 3S6GA 4F0XA 4MHYA 2PSWA 2ZEEA 1TIQA 3D7HA 5LYFA 3TT2A 3FEDA 1TF8A 1XMBA 4LQGA 3I1UA 2VEZA 4FBEA 3FRMA 4JWPA 2P6FA 4MFZA 4MFKA 4CPAA 2F8HA 2OH1A 4OC2A 2PJ2A 5E96A 2B4DA 4NGMA 4JXQA 3HLPA 4UEFA 4B5OA 3DR6A 1YK3A 4MFLA 1ELLP 1KZFA 4OP4A 4BD9A 5JH9A 3D66A 3IEHA 2CY2A 2XEFA 4P4FA 4XPKA 3SI2A 5FVJA 4H6ZA 2PQ8A 2EBJA 4KUAA 3D2MA 1LRZA 4R76A 3F0AA 1CBXA 1R57A 2I3CA 3B2YA 3FNCA 2WSAA 3EO4A 3KHXA 3NE8A 2B58A 4CGMA 2ZEDA 2IL4A 4R9MA 2AFOA 1FY7A 2FIWA 2X7BA 4Z65A 4FAIA 1WWZA 5CNPA 3PP9A 4R57A 4AG9A 4A95A 3H5ZA 4OLLA 1ARMA 1BAVA 4ZY1A 2ZEGA 1YQEA 4PQAA 4UA3A 4UF4A 3CXQA 4E0AA 3FBUA 4RN7A 4Y49C 5H86A 5H84A 1XE4A 4CGNA 4KSFA 2PRQA 1S60A 1MK4A 4MMOA 3SI0A 2P6EA 4ZY0A 4W9YA 3EFAA 4ONWA 4R6TA 3CPXA 2Z3NA 2J8MA 1JQGA 1M1DA 3C26A 3D7GA 2QYVA 4HNYB 4CS0B 1LAPA 3CXPA 3IWWA 2Z3LA 4P44A 4MHPA 3GYAA 1OBRA 2V8VA 2ZEPA 1BPMA 4JYWA 4UFVA 1K4JA 4OADA 4XPDC 2YNEA 1JWQA 2O4HA 4KORA 5HMNA 2J8RA 3IU1A 3N5FA 4NGQA 3KZWA 4FUUA 4UBRA 3K9UA 1PYTB 4NEXA 4ONUA 5HVHA 3CXSA 2DEAA 2JEWA 3BHXA 1LANA 2EUIA 2Z3PA 1Z9UA 2WPWA 3FYNA 2FS5A 1B87A 5DWMA 1LOKA 1DE4C 5D8NA 5J8CA 3NA6A 2ABZA 1B6BA 4NJQA 2PJAA 2B3UA 2WUUA 4MCPA 2PR1A 3ISXA 5I0CA 4KVME 4LQ6A 1CP7A 3PFOA 4CAEA 2V8GA 2PJ3A 4JD6A 2H5MA 3N7ZA 5G1ZA 1IIDA 4B5PA 5A27A 2Q51A 4KVOE 3CZXA 4HNWB 2WPXA 1Q2YA 4FWUA 1RO5A 3D4UA 4AVCA 4A38A 1Q2CA 3VH9A 2Z3OA 3WABA 4MFQA 4KOYA 2VQYA 4UFXA 2Q4VA 4KOUA 3V8IA 4NGPA 1XEBA 3TX8A 3W91A 2O28A 2JDDA 1YSJA 1XRYA 2EWBA 4FD6A 4ZX9A 3S6KA 4C7HA 3RYOA 2Z10A 3DDDA 2R7HA 4U9ZA 1F2OA 4FD5A 1IOIA 2ZOGA 3B3SA 4MHDA 4X3RA 3UY5A 4C68A 3H8FA 1Z8WA 3S6FA 1S7LA 3FJUA 4HKFA 4CAWA 1VHSA 1XIXA 2R98A 3GB0A 3SHPA 2ZW4A 4A39A 5JM6A 4EMEA 2Z11A 3PFEA 3BXMA 1TKFA 1YW6A 1QMUA 1QQ9A 4RS2A 2VZZA 2ZELA 3B3TA 4H89A 4MBUA 4II9A 2GREA 1MJAA 4PPZA 4Q38A 4P10A 2JEVA 4L89A 3TTHA 4UCMA 1R43A 3CDXA 5JPHA 1RTQA 3IJ3A 1OZPA 1Y9KA 4AVBA 2QMLA 4IK2A 1NMTA 3KGQA 4A33A 1UFHA 3NE7A 4TNUA 1CJWA 3KKWA 4NGNA 1I21A 1Q7LA 3JTKA 4H2KA 2ZXVA 4OKOA 2CNSA 4X2TA 2VL1A 4OC3A 1I12A 1Y0YA 2CIJA 4P45A 3KL9A 4UWIA 3V7ZA 2ODFA 2PJCA 2OR4A 4F6AA 1LAMA 2PIYA 3G3SA 3QAYA 4EVYA 4C7IA 3I9SA 2NYQA 1QSRA 2ZW6A 3GUXA 1FNOA 4PSXA 2BL1A 4DYOA 2CNTA 4PXEA 2VZYA 3BJ7A 3EC4A 2HB6A 2AFMA 1NSAA 2B4DB 4NF1A 4OC0A 5F09A 2GLFA 4JLYA 3VARA 3RNZA 3KQZA 4R3KA 1Z8TA 4XPDB 4QUSA 2AFWA 2Z3MA 4YU9A 4KOSA 5LRJA 4YFJA 2DXQA 3D7FA 4UWJA 4A32A 4E2AA 2PJ7A 5F46A 3IFEA 1N71A 4YWYA 4M6IA 2HC9A 5G21A 4ZYQA 3NFZA 1YX0A 3FF3A 4RI1A 2G0BA 1ZLHA 1Z8LA 2FE7A 4JJXA 4M6GA 4NGSA 1YW4A 3L2NA 3H8EA 4A94A 2ATRA 3IC1A 3I3GA 2JDCA 3LD2A 2PR8A 5K8OA 1ARLA 4KLWA 4ORFA 2EK9A 3WR7A 2POKA 2Q7BA 1YGHA 4AXVA 3PZJA 4P4JA 3S9LA 3EXNA 2CTCA 5J8FA 1M4GA 3PRTA 5KTDA 2GE3A 2HV2A 4OIWA 3S6HA 5JQ4A 2PE3A 1Q2DA 3TE4A 1IYKA 1X12A 5AG4A 2Z0ZA 1ZG7A 3TOBA 3PB4X 4OIDA 4P4DA 3TCVA 4CGLA 4CRYB 5IB0A 4F9UA 8CPAA 4C2ZA 2GU2A 3MGDA 3TO9A 1BLLE 3PBBA 4Q36A 5I4MA 2OZHA 3KHZA 3T8WA 3P2HA 4CYOA 5K8NA 2O53A 4QB9A 3SI1A 4KOVA 4PK2A 2FIAA 4NGRA 3VWEA 1P0HA 2ZEFA 4CGPA 3ISZA 1YR0A 5THWA 1X10A 1IU8A 2YNCA 5LRGA 2PJ8A 3IWEA 4QVTA 3SXNA 4MRIA 2PJ9A 1Z2LA 3PB9X 2PJ6A 5GCNA 4P4EA 2PJBA 1L0CA 2D4PA 2Q44A 2ZW5A 2QIRA 4NFRA 3SJGA 3TO6A 2HQYA 3OWCA 2AFXA 2F7VA 5AG5A 3S9MA 1Y7RA 5F49A 3H8GA 1NSLA 2G9DA 1FT7A 4B5PB 4KOWA 3D8PA 5K8PA 3D68A 2JLMA 3KR4A 4QC6A 4CYQA 1CX8A 3BI1A 4AB7A 3ZJ0A 4XNHC 4J3GA 1ELMP 3FB3A 1Z8XA 2OB0A 1KUXA 2B4BA 3KI9A 2K5TA 3FX6A 3GY9A 4NCZA 4B10A 5CBMA 2DPTA 4TWEA 2FL4A 4A37A 2KCWA 3T9YA 4GS4A 3S9NA 2PC1A 5LYDA 2XEJA 3T90A 4BBHA 3GIUA 5IV0A 4OMEA 2PIZA 1ZLIA 4MY3A 4YRHA 5LYIA 4C2XA 2B5GA 3FECA 4GXHA 4MCSA 3JVNA 7CPAA 1XOVA 4IHMA 3TO7A 2C6CA 3ZZIA 1H8LA 1IYLA 1KWMA 3MN8A 2NSMA 4ZBGA 1Y9WA 3SJXA 4P4IA 4CGOA 3KR5A 3JUWA 2GANA 1I1DA 1Y7EA 3G8WA 1SQHA 1IGBA 3SJFA 3TFYA 4Q7AA 1AYEA 1U6MA 2BO9A 2YNCC 3PB7X 3R95A 5A28A 4MFJA 4RUHA 2Q4ZA 4UEZA 2REEA 3B8GA 3IO1A 3KQXA 2AFSA 4Y49B 4A2ZA 1TKJA 2C6PA 2XEIA 2G3AA 1VKCA 2A4NA 2D4OA 3V38A 3GKRA 3RZAA 2F5IA 4DUKA 2YGWA 5C88A 2BSWA 2RC4A 1BO4A 5HH1A 4KOTA 4KSAA 1QSMA 1ON0A 5F47A 2PCUA 4KSIA 2BEIA 3K2KA 1NE9A 1XMTA 2Z3KA 1QSNA 3R9FA 3GLJA 3BJ8A 1CPXA 2RFHA 2Q04A 3CPAA 4KS9A 4ZX8A 2ZPAA 4EFDA 5KTAA 2P0WA 1XF8A 4UCNA 2PJ5A 2HUZA 2DF5A 2C1CA 5HVGA 3LODA 3B7IA 4MJ8A 4U5YA 4JXRA 1KUVA 3DLJA 3IGRA 1VHEA 4UIAA 1S7KA 2CTBA 2REFA 4F0YA 5AG6A 4L8AA 2FXFA 3A9LA 1IB1E 3B3WA 3PB8X 3BLNA 4OC4A 5CPAA 4CRZB 3NH5A 4QBJA 3IWGA 2FSRA 3DGVA 4XPLA 3R9GA 1A2ZA 2NMTA 4LUAA 1M4LA 1DTDA 3LMSA 4OC5A 2ZW7A 2JBKA 2Q43A 2V77A 3RBUA 3PBEA 1CG2A 1MJBA 2I00A 2IJZA 4HPSA 4O23A 2J9AA 2VBQA 1YVOA 3CT9A 4KLVA 3HUVA 2ARHA 4XNHB 1XJOA 4PXBA
chains in the Genus database with same CATH topology
1TXRA 1IY7A 3NH4A 3FEEA 1XBUA 2RB7A 3FVLA 4DJLA 5J1QA 1CPSA 3PEIA 4R7MA 3B3VA 4K3NA 4IAVA 2BCOA 4R8FA 3FMCA 3PB6X 3NH8A 1Y0RA 2ZENA 1Z5RA 4OC1A 3BI0A 5HXDA 1YLOA 4P4BA 2QVPA 1BPNA 2PVVA 4MHZA 3QNVA 2ZEHA 4UEEA 5D29A 1ZG9A 2EK8A 1YMEA 1CP6A 4X8IA 2BOAA 2IQ6A 3B3CA 4PXDA 1TKHA 4F9VA 2XEGA 3RAMA 1HEEA 2C6GA 3K9TA 1TF9A 5HVFA 2ZEMA 4G1PA 1VGYA 2GLJA 2V8DA 1GYTA 2V8HA 2WYRA 3WC5A 3VATA 2PVWA 6CPAA 3D7DA 2AFZA 4ZI6A 3SJEA 5K8MA 4B6ZA 2IMOA 2ZEOA 3FH4A 1PCAA 3WC7A 3JRUA 5LRKA 2AFUA 2FVGA 1F2PA 3KASA 5IB9A 5JGFA 5LYLA 1ZG8A 3B35A 1XFOA 2WZNA 2JBJA 3WT4A 5DS0A 4WWVA 4P6YA 3WC6A 4MXUA 2OOTA 3MRUA 4NJRA 4WJBA 4GM5A 4EWTA 4JZ0A 5ELYA 2PJ4A 2ANPA 1EE3P 4MCQA 3T8WA 1HDUA 1VHOA 5LYFA 2PJ1A 4MCRA 1R3NA 4F8ZA 3D67A 1F57A 2PJ0A 1UWYA 1HDQA 3TC8A 2QJ8A 2CF4A 4PXCA 4UIBA 1VIXA 1AMPA 3LWUA 4ZY2A 4MHNA 2ZOFA 4NGTA 1LFWA 1LCPA 3IIBA 4MHYA 2ZEEA 3D7HA 3FEDA 1TF8A 1XMBA 4LQGA 3I1UA 4FBEA 4CPAA 2F8HA 4OC2A 2PJ2A 4NGMA 3HLPA 4UEFA 1ELLP 4OP4A 4BD9A 5JH9A 3D66A 3IEHA 2XEFA 4P4FA 3SI2A 4R76A 1CBXA 2I3CA 3B2YA 3KHXA 2ZEDA 2AFOA 4Z65A 4FAIA 1ARMA 1BAVA 4ZY1A 2ZEGA 4PQAA 4UF4A 2PRQA 4MMOA 3SI0A 4ZY0A 4W9YA 4ONWA 4R6TA 3CPXA 1JQGA 3D7GA 2QYVA 1LAPA 3IWWA 4P44A 4MHPA 1OBRA 2V8VA 2ZEPA 1BPMA 4JYWA 2O4HA 4NGQA 3N5FA 3KZWA 4FUUA 1PYTB 5HVHA 2DEAA 2JEWA 3BHXA 1LANA 1LOKA 1DE4C 5D8NA 3NA6A 2ABZA 4NJQA 2PJAA 4MCPA 3ISXA 1CP7A 3PFOA 2V8GA 2PJ3A 2Q51A 4FWUA 4A38A 3VH9A 3WABA 4NGPA 3TX8A 4ZX9A 1YSJA 1XRYA 2EWBA 1F2OA 4X3RA 3B3SA 2ZOGA 3H8FA 3FJUA 3GB0A 4A39A 5JM6A 4EMEA 3PFEA 3BXMA 1TKFA 1YW6A 1QMUA 1QQ9A 3B3TA 2ZELA 2GREA 4PPZA 4P10A 1R43A 3CDXA 1RTQA 3IJ3A 4IK2A 3KGQA 4TNUA 4NGNA 1Q7LA 4H2KA 4OKOA 4X2TA 2VL1A 4OC3A 1Y0YA 2CIJA 4P45A 3KL9A 3V7ZA 2PJCA 2OR4A 1LAMA 2PIYA 2NYQA 3GUXA 1FNOA 4DYOA 4PXEA 2HB6A 2AFMA 1NSAA 4OC0A 5F09A 2GLFA 3VARA 3KQZA 2AFWA 4YU9A 5LRJA 3D7FA 2PJ7A 3IFEA 4YWYA 2HC9A 4ZYQA 3NFZA 3FF3A 1ZLHA 1Z8LA 4NGSA 1YW4A 3L2NA 3H8EA 4A94A 3IC1A 5K8OA 1ARLA 2EK9A 2POKA 4AXVA 4P4JA 3S9LA 2CTCA 3PRTA 4OIWA 2PE3A 1ZG7A 3PB4X 4OIDA 4P4DA 4F9UA 8CPAA 2GU2A 1BLLE 3PBBA 5I4MA 3KHZA 2O53A 3SI1A 4NGRA 2ZEFA 3ISZA 5THWA 5LRGA 2PJ8A 4MRIA 2PJ9A 1Z2LA 3PB9X 2PJ6A 4P4EA 2PJBA 3SJGA 4NFRA 2AFXA 2F7VA 3S9MA 3H8GA 2G9DA 1FT7A 5K8PA 3D68A 3KR4A 1CX8A 3BI1A 1ELMP 3KI9A 3FX6A 5CBMA 4TWEA 4A37A 3S9NA 5LYDA 2XEJA 4OMEA 2PIZA 1ZLIA 5LYIA 3FECA 4MCSA 7CPAA 4IHMA 2C6CA 1H8LA 1KWMA 3MN8A 2NSMA 3SJXA 4P4IA 3KR5A 1Y7EA 1IGBA 3SJFA 4Q7AA 1AYEA 2BO9A 3PB7X 4RUHA 2Q4ZA 4UEZA 3IO1A 3KQXA 2AFSA 1TKJA 2C6PA 2XEIA 3V38A 3RZAA 4DUKA 2PCUA 4KSIA 3K2KA 3GLJA 1CPXA 2RFHA 3CPAA 4ZX8A 4EFDA 2PJ5A 2C1CA 5HVGA 3B7IA 3DLJA 1VHEA 4UIAA 2CTBA 3B3WA 3PB8X 4OC4A 5CPAA 3NH5A 3DGVA 1M4LA 1DTDA 3LMSA 4OC5A 2JBKA 2Q43A 2V77A 3RBUA 3PBEA 1CG2A 2IJZA 4O23A 2J9AA 3CT9A 3HUVA 3D4UA 5K8NA 1XJOA 4PXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXR A;  1IY7 A;  3NH4 A;  3FEE A;  1XBU A;  2RB7 A;  3FVL A;  4DJL A;  5J1Q A;  1CPS A;  3PEI A;  4R7M A;  3B3V A;  4K3N A;  4IAV A;  2BCO A;  4R8F A;  3FMC A;  3PB6 X;  3NH8 A;  1Y0R A;  2ZEN A;  1Z5R A;  4OC1 A;  3BI0 A;  5HXD A;  1YLO A;  4P4B A;  2QVP A;  1BPN A;  2PVV A;  4MHZ A;  3QNV A;  2ZEH A;  4UEE A;  5D29 A;  1ZG9 A;  2EK8 A;  1YME A;  1CP6 A;  4X8I A;  2BOA A;  2IQ6 A;  3B3C A;  4PXD A;  1TKH A;  4F9V A;  2XEG A;  3RAM A;  1HEE A;  2C6G A;  3K9T A;  1TF9 A;  5HVF A;  2ZEM A;  4G1P A;  1VGY A;  2GLJ A;  2V8D A;  1GYT A;  2V8H A;  2WYR A;  3WC5 A;  3VAT A;  2PVW A;  6CPA A;  3D7D A;  2AFZ A;  4ZI6 A;  3SJE A;  5K8M A;  4B6Z A;  2IMO A;  2ZEO A;  3FH4 A;  1PCA A;  3WC7 A;  3JRU A;  5LRK A;  2AFU A;  2FVG A;  1F2P A;  3KAS A;  5IB9 A;  5JGF A;  5LYL A;  1ZG8 A;  3B35 A;  1XFO A;  2WZN A;  2JBJ A;  3WT4 A;  5DS0 A;  4WWV A;  4P6Y A;  3WC6 A;  4MXU A;  2OOT A;  3MRU A;  4NJR A;  4WJB A;  4GM5 A;  4EWT A;  4JZ0 A;  5ELY A;  2PJ4 A;  2ANP A;  1EE3 P;  4MCQ A;  3T8W A;  1HDU A;  1VHO A;  5LYF A;  2PJ1 A;  4MCR A;  1R3N A;  4F8Z A;  3D67 A;  1F57 A;  2PJ0 A;  1UWY A;  1HDQ A;  3TC8 A;  2QJ8 A;  2CF4 A;  4PXC A;  4UIB A;  1VIX A;  1AMP A;  3LWU A;  4ZY2 A;  4MHN A;  2ZOF A;  4NGT A;  1LFW A;  1LCP A;  3IIB A;  4MHY A;  2ZEE A;  3D7H A;  3FED A;  1TF8 A;  1XMB A;  4LQG A;  3I1U A;  4FBE A;  4CPA A;  2F8H A;  4OC2 A;  2PJ2 A;  4NGM A;  3HLP A;  4UEF A;  1ELL P;  4OP4 A;  4BD9 A;  5JH9 A;  3D66 A;  3IEH A;  2XEF A;  4P4F A;  3SI2 A;  4R76 A;  1CBX A;  2I3C A;  3B2Y A;  3KHX A;  2ZED A;  2AFO A;  4Z65 A;  4FAI A;  1ARM A;  1BAV A;  4ZY1 A;  2ZEG A;  4PQA A;  4UF4 A;  2PRQ A;  4MMO A;  3SI0 A;  4ZY0 A;  4W9Y A;  4ONW A;  4R6T A;  3CPX A;  1JQG A;  3D7G A;  2QYV A;  1LAP A;  3IWW A;  4P44 A;  4MHP A;  1OBR A;  2V8V A;  2ZEP A;  1BPM A;  4JYW A;  2O4H A;  4NGQ A;  3N5F A;  3KZW A;  4FUU A;  1PYT B;  5HVH A;  2DEA A;  2JEW A;  3BHX A;  1LAN A;  1LOK A;  1DE4 C;  5D8N A;  3NA6 A;  2ABZ A;  4NJQ A;  2PJA A;  4MCP A;  3ISX A;  1CP7 A;  3PFO A;  2V8G A;  2PJ3 A;  2Q51 A;  4FWU A;  4A38 A;  3VH9 A;  3WAB A;  4NGP A;  3TX8 A;  4ZX9 A;  1YSJ A;  1XRY A;  2EWB A;  1F2O A;  4X3R A;  3B3S A;  2ZOG A;  3H8F A;  3FJU A;  3GB0 A;  4A39 A;  5JM6 A;  4EME A;  3PFE A;  3BXM A;  1TKF A;  1YW6 A;  1QMU A;  1QQ9 A;  3B3T A;  2ZEL A;  2GRE A;  4PPZ A;  4P10 A;  1R43 A;  3CDX A;  1RTQ A;  3IJ3 A;  4IK2 A;  3KGQ A;  4TNU A;  4NGN A;  1Q7L A;  4H2K A;  4OKO A;  4X2T A;  2VL1 A;  4OC3 A;  1Y0Y A;  2CIJ A;  4P45 A;  3KL9 A;  3V7Z A;  2PJC A;  2OR4 A;  1LAM A;  2PIY A;  2NYQ A;  3GUX A;  1FNO A;  4DYO A;  4PXE A;  2HB6 A;  2AFM A;  1NSA A;  4OC0 A;  5F09 A;  2GLF A;  3VAR A;  3KQZ A;  2AFW A;  4YU9 A;  5LRJ A;  3D7F A;  2PJ7 A;  3IFE A;  4YWY A;  2HC9 A;  4ZYQ A;  3NFZ A;  3FF3 A;  1ZLH A;  1Z8L A;  4NGS A;  1YW4 A;  3L2N A;  3H8E A;  4A94 A;  3IC1 A;  5K8O A;  1ARL A;  2EK9 A;  2POK A;  4AXV A;  4P4J A;  3S9L A;  2CTC A;  3PRT A;  4OIW A;  2PE3 A;  1ZG7 A;  3PB4 X;  4OID A;  4P4D A;  4F9U A;  8CPA A;  2GU2 A;  1BLL E;  3PBB A;  5I4M A;  3KHZ A;  2O53 A;  3SI1 A;  4NGR A;  2ZEF A;  3ISZ A;  5THW A;  5LRG A;  2PJ8 A;  4MRI A;  2PJ9 A;  1Z2L A;  3PB9 X;  2PJ6 A;  4P4E A;  2PJB A;  3SJG A;  4NFR A;  2AFX A;  2F7V A;  3S9M A;  3H8G A;  2G9D A;  1FT7 A;  5K8P A;  3D68 A;  3KR4 A;  1CX8 A;  3BI1 A;  1ELM P;  3KI9 A;  3FX6 A;  5CBM A;  4TWE A;  4A37 A;  3S9N A;  5LYD A;  2XEJ A;  4OME A;  2PIZ A;  1ZLI A;  5LYI A;  3FEC A;  4MCS A;  7CPA A;  4IHM A;  2C6C A;  1H8L A;  1KWM A;  3MN8 A;  2NSM A;  3SJX A;  4P4I A;  3KR5 A;  1Y7E A;  1IGB A;  3SJF A;  4Q7A A;  1AYE A;  2BO9 A;  3PB7 X;  4RUH A;  2Q4Z A;  4UEZ A;  3IO1 A;  3KQX A;  2AFS A;  1TKJ A;  2C6P A;  2XEI A;  3V38 A;  3RZA A;  4DUK A;  2PCU A;  4KSI A;  3K2K A;  3GLJ A;  1CPX A;  2RFH A;  3CPA A;  4ZX8 A;  4EFD A;  2PJ5 A;  2C1C A;  5HVG A;  3B7I A;  3DLJ A;  1VHE A;  4UIA A;  2CTB A;  3B3W A;  3PB8 X;  4OC4 A;  5CPA A;  3NH5 A;  3DGV A;  1M4L A;  1DTD A;  3LMS A;  4OC5 A;  2JBK A;  2Q43 A;  2V77 A;  3RBU A;  3PBE A;  1CG2 A;  2IJZ A;  4O23 A;  2J9A A;  3CT9 A;  3HUV A;  3D4U A;  5K8N A;  1XJO A;  4PXB A; 
#chains in the Genus database with same CATH topology
 2EO8 A;  4FD7 A;  3IU2 A;  3D2P A;  1TXR A;  4NXY A;  1S3Z A;  1IY7 A;  3PGP A;  3NH4 A;  4A30 A;  4K30 A;  3FEE A;  1XBU A;  2RB7 A;  5EBV A;  2AJ6 A;  4H6U A;  4R3L A;  5G22 A;  3FVL A;  4OAE A;  1M4I A;  4IUS A;  1S7N A;  4BMH A;  4E8O A;  2OZU A;  4FD4 A;  1M4D A;  4MFP A;  4DJL A;  3TOA A;  2PDO A;  5J1Q A;  1CPS A;  3PEI A;  4R7M A;  3B3V A;  4K3N A;  4B12 A;  4IAV A;  2BCO A;  4R87 A;  4R8F A;  3FMC A;  3SXO A;  2J8N A;  3PB6 X;  3NH8 A;  1Y0R A;  2CNM A;  4A31 A;  2ZEN A;  1Z5R A;  4KVX A;  4PK3 A;  1GHE A;  2R8V A;  1AUG A;  4OC1 A;  3BI0 A;  1IIC A;  5HXD A;  1YLO A;  4P4B A;  2QVP A;  4HNX B;  1BPN A;  4AVA A;  2PVV A;  4MHZ A;  3QNV A;  2ZEH A;  3F8K A;  2FCK A;  4UEE A;  2CXA A;  5D29 A;  3R9E A;  4CYP A;  1ZG9 A;  2EK8 A;  1YME A;  1CP6 A;  4X8I A;  2PRB A;  3D3S A;  5EMI A;  4CAV A;  2BOA A;  4PV6 A;  2G3T A;  2IQ6 A;  2VXK A;  3B3C A;  4PXD A;  3W6S A;  2GFQ A;  4NSQ A;  2R1I A;  5BWA B;  3P2F A;  1QST A;  3QB8 A;  3R96 A;  1TKH A;  1J4J A;  4F9V A;  2XEG A;  1V0C A;  3RAM A;  1HEE A;  3W6X A;  2C6G A;  2OU2 A;  3K9T A;  4M6H A;  4UFW A;  2GIV A;  1TF9 A;  2QEC A;  1CM0 A;  5AG7 A;  2ZEM A;  5AGE A;  4U9Y A;  5HVF A;  1S7F A;  4G1P A;  4B14 A;  1VGY A;  1PU9 A;  2GLJ A;  2V8D A;  1GYT A;  2V8H A;  4UCP A;  5G20 A;  1PUA A;  2WYR A;  5KTC A;  2FT0 A;  2Q4Y A;  4M3S A;  3VAT A;  3WC5 A;  2PVW A;  1S5K A;  3QAH A;  5C82 A;  3D7D A;  2YND A;  4ZGY B;  6CPA A;  2AFZ A;  2BUE A;  4PSW A;  4ZI6 A;  3SJE A;  1IOF A;  5K8M A;  4MI4 A;  5DWN A;  3RO0 A;  1YVK A;  4IF5 A;  4KZT A;  4B6Z A;  2B5G B;  3DSB A;  1ZO0 A;  2IMO A;  2ZEO A;  4DNC A;  3FXT A;  4KUB A;  2EVN A;  4YGO A;  3FH4 A;  1PCA A;  3WC7 A;  3JRU A;  2Q0Y A;  3R1K A;  2AFU A;  5LRK A;  2FVG A;  4BIN A;  1MJ9 A;  1F2P A;  3KAS A;  1P4N A;  5IB9 A;  5JGF A;  5LYL A;  3DR8 A;  1ZG8 A;  4KOX A;  3B35 A;  1QSO A;  1XFO A;  1YLE A;  2WZN A;  4CYN A;  2JBJ A;  3WT4 A;  5DS0 A;  4WWV A;  4P6Y A;  3WC6 A;  4MXU A;  4AG7 A;  1M44 A;  2OOT A;  2P6G A;  3MRU A;  3VWD A;  4LX9 A;  4NJR A;  4WJB A;  2B3V A;  4GM5 A;  4JZ0 A;  4EWT A;  1Z4R A;  5ELY A;  2PJ4 A;  2ANP A;  3FIX A;  1EE3 P;  3EY5 A;  4MCQ A;  1HDU A;  1VHO A;  3F5B A;  1YRE A;  1Z4E A;  2PJ1 A;  2AE6 A;  1R3N A;  4M85 A;  4MCR A;  4MY0 A;  4F8Z A;  3D67 A;  3LAC A;  3DNS A;  1F57 A;  2I79 A;  2PJ0 A;  1UWY A;  1WK4 A;  1HDQ A;  1RXT A;  3TC8 A;  5F48 A;  2C27 A;  4B11 A;  4C2Y A;  2QJ8 A;  4CAX A;  2CF4 A;  4PXC A;  4UIB A;  2OZG A;  4X5K A;  4B13 A;  2VI7 A;  1KUY A;  1VIX A;  2Y0M A;  1AMP A;  4CAF A;  3H4Q A;  3E0K A;  2DPS A;  3LWU A;  5IX3 A;  4ZY2 A;  4MHN A;  5ISV A;  2ZOF A;  1BOB A;  1LFW A;  1LCP A;  2Q7S A;  3IIB A;  4NGT A;  4I49 A;  5EC4 A;  3S6G A;  4F0X A;  4MHY A;  2PSW A;  2ZEE A;  1TIQ A;  3D7H A;  5LYF A;  3TT2 A;  3FED A;  1TF8 A;  1XMB A;  4LQG A;  3I1U A;  2VEZ A;  4FBE A;  3FRM A;  4JWP A;  2P6F A;  4MFZ A;  4MFK A;  4CPA A;  2F8H A;  2OH1 A;  4OC2 A;  2PJ2 A;  5E96 A;  2B4D A;  4NGM A;  4JXQ A;  3HLP A;  4UEF A;  4B5O A;  3DR6 A;  1YK3 A;  4MFL A;  1ELL P;  1KZF A;  4OP4 A;  4BD9 A;  5JH9 A;  3D66 A;  3IEH A;  2CY2 A;  2XEF A;  4P4F A;  4XPK A;  3SI2 A;  5FVJ A;  4H6Z A;  2PQ8 A;  2EBJ A;  4KUA A;  3D2M A;  1LRZ A;  4R76 A;  3F0A A;  1CBX A;  1R57 A;  2I3C A;  3B2Y A;  3FNC A;  2WSA A;  3EO4 A;  3KHX A;  3NE8 A;  2B58 A;  4CGM A;  2ZED A;  2IL4 A;  4R9M A;  2AFO A;  1FY7 A;  2FIW A;  2X7B A;  4Z65 A;  4FAI A;  1WWZ A;  5CNP A;  3PP9 A;  4R57 A;  4AG9 A;  4A95 A;  3H5Z A;  4OLL A;  1ARM A;  1BAV A;  4ZY1 A;  2ZEG A;  1YQE A;  4PQA A;  4UA3 A;  4UF4 A;  3CXQ A;  4E0A A;  3FBU A;  4RN7 A;  4Y49 C;  5H86 A;  5H84 A;  1XE4 A;  4CGN A;  4KSF A;  2PRQ A;  1S60 A;  1MK4 A;  4MMO A;  3SI0 A;  2P6E A;  4ZY0 A;  4W9Y A;  3EFA A;  4ONW A;  4R6T A;  3CPX A;  2Z3N A;  2J8M A;  1JQG A;  1M1D A;  3C26 A;  3D7G A;  2QYV A;  4HNY B;  4CS0 B;  1LAP A;  3CXP A;  3IWW A;  2Z3L A;  4P44 A;  4MHP A;  3GYA A;  1OBR A;  2V8V A;  2ZEP A;  1BPM A;  4JYW A;  4UFV A;  1K4J A;  4OAD A;  4XPD C;  2YNE A;  1JWQ A;  2O4H A;  4KOR A;  5HMN A;  2J8R A;  3IU1 A;  3N5F A;  4NGQ A;  3KZW A;  4FUU A;  4UBR A;  3K9U A;  1PYT B;  4NEX A;  4ONU A;  5HVH A;  3CXS A;  2DEA A;  2JEW A;  3BHX A;  1LAN A;  2EUI A;  2Z3P A;  1Z9U A;  2WPW A;  3FYN A;  2FS5 A;  1B87 A;  5DWM A;  1LOK A;  1DE4 C;  5D8N A;  5J8C A;  3NA6 A;  2ABZ A;  1B6B A;  4NJQ A;  2PJA A;  2B3U A;  2WUU A;  4MCP A;  2PR1 A;  3ISX A;  5I0C A;  4KVM E;  4LQ6 A;  1CP7 A;  3PFO A;  4CAE A;  2V8G A;  2PJ3 A;  4JD6 A;  2H5M A;  3N7Z A;  5G1Z A;  1IID A;  4B5P A;  5A27 A;  2Q51 A;  4KVO E;  3CZX A;  4HNW B;  2WPX A;  1Q2Y A;  4FWU A;  1RO5 A;  3D4U A;  4AVC A;  4A38 A;  1Q2C A;  3VH9 A;  2Z3O A;  3WAB A;  4MFQ A;  4KOY A;  2VQY A;  4UFX A;  2Q4V A;  4KOU A;  3V8I A;  4NGP A;  1XEB A;  3TX8 A;  3W91 A;  2O28 A;  2JDD A;  1YSJ A;  1XRY A;  2EWB A;  4FD6 A;  4ZX9 A;  3S6K A;  4C7H A;  3RYO A;  2Z10 A;  3DDD A;  2R7H A;  4U9Z A;  1F2O A;  4FD5 A;  1IOI A;  2ZOG A;  3B3S A;  4MHD A;  4X3R A;  3UY5 A;  4C68 A;  3H8F A;  1Z8W A;  3S6F A;  1S7L A;  3FJU A;  4HKF A;  4CAW A;  1VHS A;  1XIX A;  2R98 A;  3GB0 A;  3SHP A;  2ZW4 A;  4A39 A;  5JM6 A;  4EME A;  2Z11 A;  3PFE A;  3BXM A;  1TKF A;  1YW6 A;  1QMU A;  1QQ9 A;  4RS2 A;  2VZZ A;  2ZEL A;  3B3T A;  4H89 A;  4MBU A;  4II9 A;  2GRE A;  1MJA A;  4PPZ A;  4Q38 A;  4P10 A;  2JEV A;  4L89 A;  3TTH A;  4UCM A;  1R43 A;  3CDX A;  5JPH A;  1RTQ A;  3IJ3 A;  1OZP A;  1Y9K A;  4AVB A;  2QML A;  4IK2 A;  1NMT A;  3KGQ A;  4A33 A;  1UFH A;  3NE7 A;  4TNU A;  1CJW A;  3KKW A;  4NGN A;  1I21 A;  1Q7L A;  3JTK A;  4H2K A;  2ZXV A;  4OKO A;  2CNS A;  4X2T A;  2VL1 A;  4OC3 A;  1I12 A;  1Y0Y A;  2CIJ A;  4P45 A;  3KL9 A;  4UWI A;  3V7Z A;  2ODF A;  2PJC A;  2OR4 A;  4F6A A;  1LAM A;  2PIY A;  3G3S A;  3QAY A;  4EVY A;  4C7I A;  3I9S A;  2NYQ A;  1QSR A;  2ZW6 A;  3GUX A;  1FNO A;  4PSX A;  2BL1 A;  4DYO A;  2CNT A;  4PXE A;  2VZY A;  3BJ7 A;  3EC4 A;  2HB6 A;  2AFM A;  1NSA A;  2B4D B;  4NF1 A;  4OC0 A;  5F09 A;  2GLF A;  4JLY A;  3VAR A;  3RNZ A;  3KQZ A;  4R3K A;  1Z8T A;  4XPD B;  4QUS A;  2AFW A;  2Z3M A;  4YU9 A;  4KOS A;  5LRJ A;  4YFJ A;  2DXQ A;  3D7F A;  4UWJ A;  4A32 A;  4E2A A;  2PJ7 A;  5F46 A;  3IFE A;  1N71 A;  4YWY A;  4M6I A;  2HC9 A;  5G21 A;  4ZYQ A;  3NFZ A;  1YX0 A;  3FF3 A;  4RI1 A;  2G0B A;  1ZLH A;  1Z8L A;  2FE7 A;  4JJX A;  4M6G A;  4NGS A;  1YW4 A;  3L2N A;  3H8E A;  4A94 A;  2ATR A;  3IC1 A;  3I3G A;  2JDC A;  3LD2 A;  2PR8 A;  5K8O A;  1ARL A;  4KLW A;  4ORF A;  2EK9 A;  3WR7 A;  2POK A;  2Q7B A;  1YGH A;  4AXV A;  3PZJ A;  4P4J A;  3S9L A;  3EXN A;  2CTC A;  5J8F A;  1M4G A;  3PRT A;  5KTD A;  2GE3 A;  2HV2 A;  4OIW A;  3S6H A;  5JQ4 A;  2PE3 A;  1Q2D A;  3TE4 A;  1IYK A;  1X12 A;  5AG4 A;  2Z0Z A;  1ZG7 A;  3TOB A;  3PB4 X;  4OID A;  4P4D A;  3TCV A;  4CGL A;  4CRY B;  5IB0 A;  4F9U A;  8CPA A;  4C2Z A;  2GU2 A;  3MGD A;  3TO9 A;  1BLL E;  3PBB A;  4Q36 A;  5I4M A;  2OZH A;  3KHZ A;  3T8W A;  3P2H A;  4CYO A;  5K8N A;  2O53 A;  4QB9 A;  3SI1 A;  4KOV A;  4PK2 A;  2FIA A;  4NGR A;  3VWE A;  1P0H A;  2ZEF A;  4CGP A;  3ISZ A;  1YR0 A;  5THW A;  1X10 A;  1IU8 A;  2YNC A;  5LRG A;  2PJ8 A;  3IWE A;  4QVT A;  3SXN A;  4MRI A;  2PJ9 A;  1Z2L A;  3PB9 X;  2PJ6 A;  5GCN A;  4P4E A;  2PJB A;  1L0C A;  2D4P A;  2Q44 A;  2ZW5 A;  2QIR A;  4NFR A;  3SJG A;  3TO6 A;  2HQY A;  3OWC A;  2AFX A;  2F7V A;  5AG5 A;  3S9M A;  1Y7R A;  5F49 A;  3H8G A;  1NSL A;  2G9D A;  1FT7 A;  4B5P B;  4KOW A;  3D8P A;  5K8P A;  3D68 A;  2JLM A;  3KR4 A;  4QC6 A;  4CYQ A;  1CX8 A;  3BI1 A;  4AB7 A;  3ZJ0 A;  4XNH C;  4J3G A;  1ELM P;  3FB3 A;  1Z8X A;  2OB0 A;  1KUX A;  2B4B A;  3KI9 A;  2K5T A;  3FX6 A;  3GY9 A;  4NCZ A;  4B10 A;  5CBM A;  2DPT A;  4TWE A;  2FL4 A;  4A37 A;  2KCW A;  3T9Y A;  4GS4 A;  3S9N A;  2PC1 A;  5LYD A;  2XEJ A;  3T90 A;  4BBH A;  3GIU A;  5IV0 A;  4OME A;  2PIZ A;  1ZLI A;  4MY3 A;  4YRH A;  5LYI A;  4C2X A;  2B5G A;  3FEC A;  4GXH A;  4MCS A;  3JVN A;  7CPA A;  1XOV A;  4IHM A;  3TO7 A;  2C6C A;  3ZZI A;  1H8L A;  1IYL A;  1KWM A;  3MN8 A;  2NSM A;  4ZBG A;  1Y9W A;  3SJX A;  4P4I A;  4CGO A;  3KR5 A;  3JUW A;  2GAN A;  1I1D A;  1Y7E A;  3G8W A;  1SQH A;  1IGB A;  3SJF A;  3TFY A;  4Q7A A;  1AYE A;  1U6M A;  2BO9 A;  2YNC C;  3PB7 X;  3R95 A;  5A28 A;  4MFJ A;  4RUH A;  2Q4Z A;  4UEZ A;  2REE A;  3B8G A;  3IO1 A;  3KQX A;  2AFS A;  4Y49 B;  4A2Z A;  1TKJ A;  2C6P A;  2XEI A;  2G3A A;  1VKC A;  2A4N A;  2D4O A;  3V38 A;  3GKR A;  3RZA A;  2F5I A;  4DUK A;  2YGW A;  5C88 A;  2BSW A;  2RC4 A;  1BO4 A;  5HH1 A;  4KOT A;  4KSA A;  1QSM A;  1ON0 A;  5F47 A;  2PCU A;  4KSI A;  2BEI A;  3K2K A;  1NE9 A;  1XMT A;  2Z3K A;  1QSN A;  3R9F A;  3GLJ A;  3BJ8 A;  1CPX A;  2RFH A;  2Q04 A;  3CPA A;  4KS9 A;  4ZX8 A;  2ZPA A;  4EFD A;  5KTA A;  2P0W A;  1XF8 A;  4UCN A;  2PJ5 A;  2HUZ A;  2DF5 A;  2C1C A;  5HVG A;  3LOD A;  3B7I A;  4MJ8 A;  4U5Y A;  4JXR A;  1KUV A;  3DLJ A;  3IGR A;  1VHE A;  4UIA A;  1S7K A;  2CTB A;  2REF A;  4F0Y A;  5AG6 A;  4L8A A;  2FXF A;  3A9L A;  1IB1 E;  3B3W A;  3PB8 X;  3BLN A;  4OC4 A;  5CPA A;  4CRZ B;  3NH5 A;  4QBJ A;  3IWG A;  2FSR A;  3DGV A;  4XPL A;  3R9G A;  1A2Z A;  2NMT A;  4LUA A;  1M4L A;  1DTD A;  3LMS A;  4OC5 A;  2ZW7 A;  2JBK A;  2Q43 A;  2V77 A;  3RBU A;  3PBE A;  1CG2 A;  1MJB A;  2I00 A;  2IJZ A;  4HPS A;  4O23 A;  2J9A A;  2VBQ A;  1YVO A;  3CT9 A;  4KLV A;  3HUV A;  2ARH A;  4XNH B;  1XJO A;  4PXB A; 
#chains in the Genus database with same CATH homology
 1TXR A;  1IY7 A;  3NH4 A;  3FEE A;  1XBU A;  2RB7 A;  3FVL A;  4DJL A;  5J1Q A;  1CPS A;  3PEI A;  4R7M A;  3B3V A;  4K3N A;  4IAV A;  2BCO A;  4R8F A;  3FMC A;  3PB6 X;  3NH8 A;  1Y0R A;  2ZEN A;  1Z5R A;  4OC1 A;  3BI0 A;  5HXD A;  1YLO A;  4P4B A;  2QVP A;  1BPN A;  2PVV A;  4MHZ A;  3QNV A;  2ZEH A;  4UEE A;  5D29 A;  1ZG9 A;  2EK8 A;  1YME A;  1CP6 A;  4X8I A;  2BOA A;  2IQ6 A;  3B3C A;  4PXD A;  1TKH A;  4F9V A;  2XEG A;  3RAM A;  1HEE A;  2C6G A;  3K9T A;  1TF9 A;  5HVF A;  2ZEM A;  4G1P A;  1VGY A;  2GLJ A;  2V8D A;  1GYT A;  2V8H A;  2WYR A;  3WC5 A;  3VAT A;  2PVW A;  6CPA A;  3D7D A;  2AFZ A;  4ZI6 A;  3SJE A;  5K8M A;  4B6Z A;  2IMO A;  2ZEO A;  3FH4 A;  1PCA A;  3WC7 A;  3JRU A;  5LRK A;  2AFU A;  2FVG A;  1F2P A;  3KAS A;  5IB9 A;  5JGF A;  5LYL A;  1ZG8 A;  3B35 A;  1XFO A;  2WZN A;  2JBJ A;  3WT4 A;  5DS0 A;  4WWV A;  4P6Y A;  3WC6 A;  4MXU A;  2OOT A;  3MRU A;  4NJR A;  4WJB A;  4GM5 A;  4EWT A;  4JZ0 A;  5ELY A;  2PJ4 A;  2ANP A;  1EE3 P;  4MCQ A;  3T8W A;  1HDU A;  1VHO A;  5LYF A;  2PJ1 A;  4MCR A;  1R3N A;  4F8Z A;  3D67 A;  1F57 A;  2PJ0 A;  1UWY A;  1HDQ A;  3TC8 A;  2QJ8 A;  2CF4 A;  4PXC A;  4UIB A;  1VIX A;  1AMP A;  3LWU A;  4ZY2 A;  4MHN A;  2ZOF A;  4NGT A;  1LFW A;  1LCP A;  3IIB A;  4MHY A;  2ZEE A;  3D7H A;  3FED A;  1TF8 A;  1XMB A;  4LQG A;  3I1U A;  4FBE A;  4CPA A;  2F8H A;  4OC2 A;  2PJ2 A;  4NGM A;  3HLP A;  4UEF A;  1ELL P;  4OP4 A;  4BD9 A;  5JH9 A;  3D66 A;  3IEH A;  2XEF A;  4P4F A;  3SI2 A;  4R76 A;  1CBX A;  2I3C A;  3B2Y A;  3KHX A;  2ZED A;  2AFO A;  4Z65 A;  4FAI A;  1ARM A;  1BAV A;  4ZY1 A;  2ZEG A;  4PQA A;  4UF4 A;  2PRQ A;  4MMO A;  3SI0 A;  4ZY0 A;  4W9Y A;  4ONW A;  4R6T A;  3CPX A;  1JQG A;  3D7G A;  2QYV A;  1LAP A;  3IWW A;  4P44 A;  4MHP A;  1OBR A;  2V8V A;  2ZEP A;  1BPM A;  4JYW A;  2O4H A;  4NGQ A;  3N5F A;  3KZW A;  4FUU A;  1PYT B;  5HVH A;  2DEA A;  2JEW A;  3BHX A;  1LAN A;  1LOK A;  1DE4 C;  5D8N A;  3NA6 A;  2ABZ A;  4NJQ A;  2PJA A;  4MCP A;  3ISX A;  1CP7 A;  3PFO A;  2V8G A;  2PJ3 A;  2Q51 A;  4FWU A;  4A38 A;  3VH9 A;  3WAB A;  4NGP A;  3TX8 A;  4ZX9 A;  1YSJ A;  1XRY A;  2EWB A;  1F2O A;  4X3R A;  3B3S A;  2ZOG A;  3H8F A;  3FJU A;  3GB0 A;  4A39 A;  5JM6 A;  4EME A;  3PFE A;  3BXM A;  1TKF A;  1YW6 A;  1QMU A;  1QQ9 A;  3B3T A;  2ZEL A;  2GRE A;  4PPZ A;  4P10 A;  1R43 A;  3CDX A;  1RTQ A;  3IJ3 A;  4IK2 A;  3KGQ A;  4TNU A;  4NGN A;  1Q7L A;  4H2K A;  4OKO A;  4X2T A;  2VL1 A;  4OC3 A;  1Y0Y A;  2CIJ A;  4P45 A;  3KL9 A;  3V7Z A;  2PJC A;  2OR4 A;  1LAM A;  2PIY A;  2NYQ A;  3GUX A;  1FNO A;  4DYO A;  4PXE A;  2HB6 A;  2AFM A;  1NSA A;  4OC0 A;  5F09 A;  2GLF A;  3VAR A;  3KQZ A;  2AFW A;  4YU9 A;  5LRJ A;  3D7F A;  2PJ7 A;  3IFE A;  4YWY A;  2HC9 A;  4ZYQ A;  3NFZ A;  3FF3 A;  1ZLH A;  1Z8L A;  4NGS A;  1YW4 A;  3L2N A;  3H8E A;  4A94 A;  3IC1 A;  5K8O A;  1ARL A;  2EK9 A;  2POK A;  4AXV A;  4P4J A;  3S9L A;  2CTC A;  3PRT A;  4OIW A;  2PE3 A;  1ZG7 A;  3PB4 X;  4OID A;  4P4D A;  4F9U A;  8CPA A;  2GU2 A;  1BLL E;  3PBB A;  5I4M A;  3KHZ A;  2O53 A;  3SI1 A;  4NGR A;  2ZEF A;  3ISZ A;  5THW A;  5LRG A;  2PJ8 A;  4MRI A;  2PJ9 A;  1Z2L A;  3PB9 X;  2PJ6 A;  4P4E A;  2PJB A;  3SJG A;  4NFR A;  2AFX A;  2F7V A;  3S9M A;  3H8G A;  2G9D A;  1FT7 A;  5K8P A;  3D68 A;  3KR4 A;  1CX8 A;  3BI1 A;  1ELM P;  3KI9 A;  3FX6 A;  5CBM A;  4TWE A;  4A37 A;  3S9N A;  5LYD A;  2XEJ A;  4OME A;  2PIZ A;  1ZLI A;  5LYI A;  3FEC A;  4MCS A;  7CPA A;  4IHM A;  2C6C A;  1H8L A;  1KWM A;  3MN8 A;  2NSM A;  3SJX A;  4P4I A;  3KR5 A;  1Y7E A;  1IGB A;  3SJF A;  4Q7A A;  1AYE A;  2BO9 A;  3PB7 X;  4RUH A;  2Q4Z A;  4UEZ A;  3IO1 A;  3KQX A;  2AFS A;  1TKJ A;  2C6P A;  2XEI A;  3V38 A;  3RZA A;  4DUK A;  2PCU A;  4KSI A;  3K2K A;  3GLJ A;  1CPX A;  2RFH A;  3CPA A;  4ZX8 A;  4EFD A;  2PJ5 A;  2C1C A;  5HVG A;  3B7I A;  3DLJ A;  1VHE A;  4UIA A;  2CTB A;  3B3W A;  3PB8 X;  4OC4 A;  5CPA A;  3NH5 A;  3DGV A;  1M4L A;  1DTD A;  3LMS A;  4OC5 A;  2JBK A;  2Q43 A;  2V77 A;  3RBU A;  3PBE A;  1CG2 A;  2IJZ A;  4O23 A;  2J9A A;  3CT9 A;  3HUV A;  3D4U A;  5K8N A;  1XJO A;  4PXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...