3FXTA

Crystal structure of the n-terminal domain of human nudt6
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
90
structure length
90
Chain Sequence
QSMDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Nucleoside diphosphate-linked moiety X motif 6
publication title Crystal structure of the N-terminal domain of human NUDT6
rcsb
source organism Homo sapiens
total genus 27
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18290 Nudix_hydro Nudix hydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fxtA00
5EBVA 1R57A 2IL4A 1QSRA 2Q44A 4HKFA 2FT0A 2ZW5A 3F8KA 3K9UA 2FIWA 3VWDA 2RC4A 2PR1A 2PDOA 4KOTA 5IX3A 4BMHA 3EXNA 4CRYB 5DWMA 1Z4EA 1QSOA 5ISVA 4EVYA 1IYLA 4YFJA 2O28A 4YGOA 4K30A 4XPDC 5F48A 4CS0B 1P4NA 4PSXA 1M1DA 3S6FA 3T90A 5KTAA 3N7ZA 4FD5A 3PZJA 4KUBA 2VQYA 4H89A 1KUXA 3UY5A 5DWNA 1UFHA 4KVXA 3W6SA 4ZBGA 3E0KA 2GIVA 3TO9A 1I21A 1QSMA 3R9GA 4MHDA 4NSQA 2ARHA 2B4DB 1IB1E 5HMNA 1P0HA 2ZW4A 2ZPAA 3R96A 4KLVA 2FCKA 1WK4A 3DR6A 5I0CA 5GCNA 2JDCA 4KOXA 3QAHA 2G3TA 3B8GA 1Z9UA 1S7KA 4NF1A 4U9YA 4FD4A 1MJAA 2G3AA 3F5BA 4PK2A 1B87A 4I49A 4KOVA 1IYKA 2NMTA 3CXSA 4KVME 3FB3A 2P0WA 4KVOE 1Q2DA 2CNTA 3S6KA 2CY2A 4QBJA 1V0CA 1VKCA 2VXKA 4UA3A 2BEIA 1M4DA 4R57A 4F6AA 1NE9A 5EC4A 5FVJA 1GHEA 1IIDA 4E2AA 2J8MA 4XNHC 3QB8A 4B5PA 4LX9A 2WPXA 1CJWA 3DSBA 4HNWB 1S5KA 4HNXB 4R9MA 2K5TA 2EVNA 4H6ZA 1RO5A 2H5MA 4XPDB 3T9YA 3DR8A 3F0AA 4CAXA 3WR7A 3R9EA 2DXQA 2J8NA 4IUSA 2Q7BA 3TO7A 4II9A 2GE3A 2AJ6A 2BSWA 3TCVA 5F49A 2REEA 1N71A 3C26A 2OZHA 3FYNA 2WPWA 3IGRA 4NCZA 1XMTA 3FXTA 4FD7A 4JXRA 2P6FA 4JWPA 1ON0A 5E96A 4MY3A 1YVOA 3TO6A 4YRHA 4E8OA 5F46A 3R95A 1I1DA 2B5GB 3ZJ0A 2D4PA 2VEZA 2FIAA 2OZGA 4CAWA 1YREA 3D2MA 2R98A 1U6MA 2VI7A 2R7HA 2Q04A 2REFA 2JLMA 2PRBA 5CNPA 1M4GA 4L89A 2B3UA 5C88A 4M85A 3SXNA 4JLYA 4AVAA 3JVNA 4FD6A 4MY0A 4CAVA 1Y9WA 5H84A 2EUIA 2R1IA 3FBUA 4X5KA 3TOBA 1M4IA 3JUWA 1LRZA 2Y0MA 4KLWA 1K4JA 2R8VA 4KOSA 2A4NA 1WWZA 1Z4RA 1BO4A 1YGHA 3EY5A 4OLLA 1SQHA 4XNHB 1Y7RA 4MJ8A 3MGDA 4HNYB 4PSWA 2OH1A 4OAEA 4NXYA 2HQYA 4IF5A 5F47A 3VWEA 3KKWA 5IB0A 4U9ZA 2AE6A 4KOYA 2J8RA 4AVCA 3TE4A 2B4BA 2HUZA 4E0AA 4LUAA 5JQ4A 4F0YA 5KTCA 3GY9A 3TTHA 1I12A 3S6GA 1YLEA 4Y49C 1NMTA 3EFAA 4NEXA 2PR8A 4CRZB 4B5OA 2I00A 3DDDA 1KZFA 2KCWA 4R87A 2VZZA 3TFYA 3GYAA 2X7BA 1VHSA 4KUAA 4AG9A 4JD6A 4JJXA 3D8PA 3TOAA 3R1KA 3DNSA 4JXQA 1S7NA 4PK3A 3S6HA 1IICA 3FRMA 5J8CA 4KOWA 2P6GA 2Q4YA 1Q2CA 4QUSA 2PSWA 2PC1A 2ZXVA 3G8WA 3FNCA 1XEBA 3IWGA 4L8AA 1PUAA 2CNSA 4UWJA 5H86A 4AB7A 1S7LA 1KUYA 3BJ8A 4MBUA 1J4JA 1Q2YA 3W91A 5J8FA 2ZW6A 2D4OA 2OU2A 2I79A 4R3LA 3BLNA 3LODA 3EO4A 1OZPA 4ORFA 3SHPA 2PQ8A 2Z11A 2FS5A 2QECA 4M3SA 2C27A 2FXFA 4DNCA 5HH1A 4GS4A 2HV2A 2B58A 1XIXA 2ATRA 1XF8A 4XPKA 3OWCA 3CXPA 1BOBA 1M44A 1MJ9A 2B5GA 3PP9A 2B3VA 2F5IA 2Q0YA 2VBQA 1MK4A 4RI1A 4AVBA 4OADA 3ZZIA 1RXTA 4MI4A 3I9SA 1YVKA 1YX0A 3SXOA 5JPHA 4KORA 2GANA 2G0BA 4RS2A 5IV0A 4R3KA 1S60A 2QIRA 1KUVA 4KOUA 1MJBA 2B4DA 3H4QA 4Y49B 2BL1A 3G3SA 2JEVA 4QVTA 3V8IA 4U5YA 2Q4VA 1YR0A 1S3ZA 2P6EA 3RYOA 3I3GA 3BJ7A 3D2PA 1PU9A 2BUEA 1YK3A 3NE7A 4B5PB 3TT2A 2FSRA 2JDDA 2OZUA 3R9FA 3W6XA 2VZYA 4J3GA 3CXQA 3EC4A 1FY7A 2QMLA 2Z0ZA 4KZTA 1XE4A 1CM0A 5C82A 3P2FA 2FE7A 4QC6A 3LD2A 5KTDA 3PGPA 1L0CA 1QSTA 1QSNA 2Z10A 1TIQA 3P2HA 4PV6A 2CNMA 2OB0A 1B6BA 1S7FA 3FIXA 2FL4A 3GKRA 4AG7A 2ZW7A 4UWIA 4XPLA 4H6UA 4ONUA 1NSLA 1Y9KA 3D3SA 4QB9A 4UBRA
chains in the Genus database with same CATH superfamily
5EBVA 2PJ0A 2ZEFA 2ABZA 1Q7LA 1R57A 3IWEA 2IL4A 5THWA 1YMEA 1QSRA 2Q44A 2F8HA 4M6IA 4C2XA 4C7HA 3SI2A 4B6ZA 5AG6A 4HKFA 4C68A 4X2TA 2FT0A 2ZW5A 3F8KA 2OR4A 3K9UA 4UFWA 4W9YA 3RNZA 2FIWA 3VWDA 3WABA 5JGFA 2RC4A 2PR1A 2PDOA 4R6TA 4TWEA 3LACA 4KOTA 4MFQA 4YWYA 4B11A 5IX3A 4NJQA 4BMHA 3EXNA 4PXEA 4CRYB 5DWMA 4Q7AA 2YNEA 4NGNA 4UIBA 1Z4EA 1QSOA 1R43A 1FT7A 4PXDA 5AG5A 4EVYA 5ISVA 1IYLA 4FWUA 4YFJA 2O28A 4YGOA 4K30A 4XPDC 5F48A 3CZXA 1VHEA 1PYTB 4CS0B 1P4NA 1TKFA 5D29A 4PSXA 1M1DA 3S6FA 3T90A 4CPAA 3N7ZA 5KTAA 4P4FA 2ZEDA 4WWVA 4FD5A 3PZJA 2CF4A 1BPMA 1VIXA 1GYTA 2VQYA 4KUBA 1YSJA 1TF8A 4H89A 1Z8WA 2V77A 4CGMA 1KUXA 3JRUA 2AFWA 4OIDA 5J1QA 3SJEA 3UY5A 2GLFA 5HVFA 2BCOA 5DWNA 2XEFA 4UEFA 1UFHA 3H8GA 2G9DA 1IOFA 3PRTA 1ZG9A 2C1CA 1XMBA 4KVXA 5ELYA 2PJ1A 3TC8A 3W6SA 4B10A 4KS9A 4ZBGA 3E0KA 2GIVA 3B3CA 3TO9A 4M6HA 1CP6A 4P10A 1I21A 4R7MA 1QSMA 4ZY2A 3R9GA 4MHDA 4NSQA 3D7DA 2ARHA 2B4DB 1IB1E 2AFSA 5HMNA 1P0HA 2ZW4A 2VL1A 1Z8XA 2ZENA 2ZPAA 3IJ3A 3PFOA 4PXBA 6CPAA 3R96A 4CGNA 4KLVA 4HPSA 4P6YA 4C7IA 2Z3LA 5HVGA 3IWWA 3KGQA 2FCKA 1WK4A 2ZEEA 3DR6A 1YW6A 1ZLHA 2O53A 4IK2A 3VH9A 5I0CA 3DLJA 1ELLP 3IU1A 5GCNA 5CBMA 1XBUA 2XEIA 1VGYA 5G1ZA 2JDCA 4KOXA 1M4LA 3QAHA 2GFQA 2G3TA 2ODFA 5LYLA 1CBXA 1YLOA 4C2YA 3B8GA 1Z9UA 1S7KA 4NF1A 4UFXA 4U9YA 4FD4A 5AGEA 5JH9A 1MJAA 4CGPA 2G3AA 3B3TA 3F5BA 4PK2A 1ELMP 1BAVA 3RAMA 1B87A 3PB9X 4I49A 2V8DA 4MHYA 4KSIA 4KOVA 1IYKA 2NMTA 3CXSA 4UCNA 2ZEHA 4FUUA 4KVME 3HLPA 3KQZA 3QNVA 3FJUA 4P4DA 1F57A 3FEEA 1YW4A 3FB3A 2P0WA 2HC9A 4KVOE 1Q2DA 2CNTA 4R8FA 3S6KA 2EO8A 2CY2A 3BI1A 1Z8LA 4A39A 4MXUA 2CTCA 3KHXA 3NA6A 4QBJA 1V0CA 2ZOGA 3CPXA 1HEEA 1VKCA 2ZEGA 3D7HA 2VXKA 4Z65A 4UA3A 2PVWA 5LYDA 2BEIA 1M4DA 4R57A 4F6AA 1NE9A 5JM6A 4ZY0A 2Z3KA 5EC4A 5FVJA 1GHEA 1IIDA 4E2AA 2J8MA 4XNHC 4DUKA 3S9MA 2PCUA 3QB8A 4B5PA 3KASA 4LX9A 2WPXA 1CJWA 3DSBA 5I4MA 4UFVA 4HNWB 1S5KA 2XEJA 4HNXB 4R9MA 2K5TA 2EVNA 4FAIA 1LAMA 2CIJA 4H6ZA 1RO5A 2YGWA 2QVPA 2V8VA 4JZ0A 4MFLA 3S9NA 5HXDA 2IMOA 1CPSA 5F09A 2BOAA 2H5MA 4XPDB 4A32A 1HDQA 2O4HA 2DF5A 3T9YA 3DR8A 3CPAA 1JQGA 3F0AA 4A38A 3WR7A 3R9EA 2DXQA 2J8NA 4CAXA 4X8IA 3PFEA 4IUSA 2Q7BA 3JTKA 4CYPA 3TO7A 3WC5A 3WC7A 4II9A 3B7IA 2GE3A 7CPAA 3NH5A 5CPAA 3RBUA 2AJ6A 2BSWA 3TCVA 5F49A 3FX6A 1DE4C 2REEA 1CG2A 4F9UA 1N71A 1QMUA 2BO9A 3S9LA 3C26A 2OZHA 3FYNA 3IC1A 4A33A 2WPWA 2PJ3A 3IGRA 4NCZA 1XMTA 4MHZA 3FXTA 4FD7A 1LAPA 4K3NA 3KHZA 4JXRA 1TKHA 4NGQA 2P6FA 4JWPA 1ON0A 5E96A 4MY3A 1YVOA 2AFOA 3TO6A 4YRHA 4ZI6A 4C2ZA 4E8OA 4A37A 3R95A 1I1DA 2V8GA 2PJ5A 4OC1A 4OKOA 4ZX9A 5A28A 3GLJA 3WT4A 4B14A 1QQ9A 4A31A 2B5GB 4AXVA 1F2PA 5EMIA 2D4PA 4MCPA 2RFHA 5LYIA 3SI1A 3ZJ0A 1AYEA 2VEZA 2FIAA 4B12A 2OZGA 4CAWA 1YREA 3D2MA 2R98A 1U6MA 1RTQA 2YNDA 1FNOA 2VI7A 3FF3A 2R7HA 3CT9A 3MN8A 2Q04A 2REFA 4UEEA 4MHNA 2JLMA 2EWBA 2PRBA 2V8HA 1F2OA 5CNPA 1M4GA 4L89A 3B3WA 3D68A 2B3UA 4EMEA 5C88A 5G22A 4OC0A 1ZO0A 4M85A 3SXNA 4OC2A 4EFDA 2DEAA 2QJ8A 2Z3PA 4JLYA 1TF9A 4NGSA 3FECA 4AVAA 1UWYA 2NSMA 3JVNA 4FD6A 5LRGA 3GUXA 4MY0A 4CAVA 1X12A 1IU8A 1CPXA 1Y9WA 5H84A 2EUIA 2FVGA 2R1IA 4MFZA 4OC4A 3D7FA 3FBUA 4X5KA 4MFKA 4CYOA 1Y0RA 4UEZA 4DJLA 3TOBA 1BPNA 2PE3A 2PJBA 4PXCA 2Z3NA 5LRKA 1M4IA 2C6PA 2DPSA 3JUWA 4F9VA 1KWMA 1LRZA 2AFMA 1X10A 4GXHA 2Y0MA 4NGMA 4KLWA 1K4JA 5LYFA 2R8VA 4KOSA 4RN7A 1DTDA 4BINA 4ZYQA 5C82A 2A4NA 1WWZA 1Z4RA 3GB0A 1BO4A 2YNCA 4P4JA 3SJFA 1ARMA 2JEWA 1YGHA 4OP4A 2CTBA 3MRUA 3EY5A 1HDUA 4OLLA 1SQHA 3IEHA 3D66A 4XNHB 3NH4A 2C6CA 1Y7RA 4MJ8A 3MGDA 4O23A 4HNYB 1Z5RA 3T8WA 4PSWA 4ZY1A 2OH1A 3PB7X 5K8MA 1IGBA 4OAEA 4NXYA 2HQYA 4Q36A 4IF5A 4MFJA 5F47A 3VWEA 2POKA 4B13A 3L2NA 5K8PA 4OC5A 3KKWA 5IB0A 4OMEA 3QAYA 2QYVA 4U9ZA 2AFXA 2AE6A 4KOYA 2J8RA 4AVCA 3RZAA 5IB9A 2B4BA 2PJ7A 4MRIA 3TE4A 2HUZA 3D4UA 3KZWA 4LUAA 4E0AA 5JQ4A 2IJZA 4F0YA 1EE3P 3GY9A 4MMOA 3B2YA 4RUHA 1IY7A 1I12A 3TTHA 4CGOA 5KTCA 3S6GA 1YLEA 4Y49C 1NMTA 3EFAA 3FVLA 4NEXA 2PR8A 3CDXA 4IHMA 5LRJA 4CRZB 4B5OA 2I00A 4MFPA 2EK8A 1KZFA 3DDDA 2KCWA 2WZNA 4R87A 4A2ZA 1CX8A 2VZZA 2GREA 4NJRA 4X3RA 3TFYA 3GYAA 3K9TA 5A27A 2X7BA 1VHSA 2I3CA 3LMSA 4KUAA 1LCPA 4ONWA 4AG9A 4A94A 2PJ6A 4JD6A 4JJXA 3VATA 3V38A 3PB8X 3D8PA 3TOAA 2ZELA 2JBKA 1A2ZA 3KR4A 4DYOA 3R1KA 3DNSA 3LWUA 1S7NA 4JXQA 4MCQA 4PK3A 3S6HA 3A9LA 5F46A 2CXAA 1IICA 1ZLIA 3FRMA 3H5ZA 3B3SA 5J8CA 4KOWA 1AMPA 2P6GA 2Q4YA 8CPAA 3ISZA 3KL9A 1Q2CA 4QUSA 2PSWA 2PC1A 3KI9A 2ZXVA 2IQ6A 2PJ8A 2RB7A 1R3NA 3G8WA 4KSFA 5K8OA 3FNCA 3PBEA 3NH8A 1XEBA 2ZEMA 3IWGA 1PUAA 4L8AA 4YU9A 2CNSA 3B35A 4UWJA 3PBBA 4GM5A 5H86A 2ZEPA 3TX8A 4AB7A 3K2KA 1S7LA 3D7GA 1KUYA 3BJ8A 4MBUA 4UCMA 2ZEOA 1YQEA 1NSAA 1LOKA 4P45A 1J4JA 1Q2YA 3W91A 5J8FA 2ZW6A 4G1PA 2D4OA 1Y0YA 4IAVA 2OU2A 2I79A 5DS0A 1BLLE 1LANA 2PJ2A 2WUUA 3SI0A 2Q51A 3BLNA 4R3LA 2Q43A 3LODA 4M6GA 3H8EA 3EO4A 1OZPA 4ORFA 1XRYA 3I1UA 2PQ8A 2Z11A 2FS5A 3SHPA 2QECA 3BI0A 4M3SA 2C27A 4H2KA 4P44A 4WJBA 2FXFA 4DNCA 5HH1A 4GS4A 2WSAA 2HV2A 4ZGYB 3SJXA 2PIYA 2B58A 1XIXA 4UIAA 2ATRA 1XF8A 4MHPA 4XPKA 3OWCA 3CXPA 4CGLA 1BOBA 1M44A 1MJ9A 2DPTA 3KR5A 2B5GA 3PP9A 1ARLA 2B3VA 2PIZA 4NFRA 2F5IA 2PJ4A 2Q0YA 2VBQA 3WC6A 1MK4A 1XOVA 4CAEA 4RI1A 4AVBA 1CP7A 3NFZA 4OADA 4LQGA 3IFEA 4PPZA 3ZZIA 3H8FA 1H8LA 1RXTA 3IU2A 4ZX8A 1JWQA 4MI4A 3BHXA 2EK9A 1Z8TA 3I9SA 1YVKA 4P4BA 1YX0A 2WYRA 3SXOA 5JPHA 2Q4ZA 3ISXA 4KORA 1OBRA 4PQAA 4TNUA 4F0XA 2HB6A 2GANA 1TKJA 3V7ZA 2G0BA 4CYQA 4RS2A 5IV0A 4R3KA 1S60A 3NE8A 2GLJA 2Q7SA 3FEDA 2QIRA 1KUVA 1ZG7A 4KOUA 1MJBA 2B4DA 3H4QA 4Y49B 4OIWA 2BL1A 4NGPA 3G3SA 1VHOA 1Y7EA 2JEVA 1TXRA 3PEIA 4LQ6A 4QVTA 2ZOFA 3BXMA 2F7VA 3V8IA 4U5YA 4A95A 2Q4VA 3PB4X 2PRQA 1YR0A 1S3ZA 2GU2A 2P6EA 4JYWA 3FMCA 3N5FA 2PVVA 3RYOA 5HVHA 4CAFA 5AG4A 3I3GA 5AG7A 3BJ7A 4NGRA 2PJ9A 3D2PA 5G20A 1PU9A 2BUEA 2YNCC 1XFOA 3D67A 1AUGA 1YK3A 3NE7A 5G21A 4P4EA 1LFWA 4B5PB 4BD9A 4MCSA 1IOIA 5D8NA 3TT2A 2FSRA 2JDDA 2AFZA 2OZUA 2PJCA 3VARA 3R9FA 2ANPA 2NYQA 3W6XA 2C6GA 4A30A 3IIBA 3DGVA 4FBEA 2VZYA 4J3GA 3CXQA 3EC4A 4OC3A 2Z3MA 4Q38A 1FY7A 2QMLA 2Z0ZA 4NGTA 1ZG8A 2J9AA 4P4IA 4KZTA 2XEGA 1XE4A 3IO1A 3PB6X 2EBJA 4F8ZA 1CM0A 2Z3OA 4CYNA 2PJAA 3P2FA 2FE7A 4QC6A 4BBHA 5BWAB 4UF4A 3LD2A 5KTDA 3PGPA 1L0CA 3GIUA 1QSTA 3SJGA 1QSNA 3RO0A 2OOTA 4UCPA 2Z10A 3KQXA 1TIQA 3FH4A 3P2HA 4PV6A 2AFUA 2OB0A 1B6BA 1S7FA 2CNMA 3FIXA 2FL4A 3GKRA 1XJOA 2ZW7A 4UWIA 3HUVA 4R76A 4AG7A 4XPLA 4H6UA 4MCRA 4ONUA 1NSLA 3B3VA 4KSAA 1Y9KA 3D3SA 2JBJA 1PCAA 4QB9A 4UBRA 1Z2LA 5K8NA 4EWTA
chains in the Genus database with same CATH topology
5EBVA 3IWEA 1R57A 2IL4A 1QSRA 2Q44A 4C2XA 4C7HA 5AG6A 4HKFA 4C68A 2FT0A 2ZW5A 3F8KA 4UFWA 3K9UA 2FIWA 3VWDA 2RC4A 2PR1A 2PDOA 4KOTA 4MFQA 4B11A 5IX3A 4BMHA 3EXNA 4CRYB 5DWMA 2YNEA 1Z4EA 1QSOA 5AG5A 4EVYA 5ISVA 1IYLA 4YFJA 2O28A 4YGOA 4K30A 4XPDC 5F48A 4CS0B 1P4NA 4PSXA 1M1DA 3S6FA 3T90A 5KTAA 3N7ZA 4FD5A 3PZJA 4KUBA 2VQYA 4H89A 4CGMA 1KUXA 3UY5A 5DWNA 1UFHA 4KVXA 3W6SA 4B10A 4KS9A 4ZBGA 3E0KA 2GIVA 3TO9A 1I21A 1QSMA 3R9GA 4MHDA 4NSQA 2ARHA 2B4DB 1IB1E 5HMNA 1P0HA 2ZW4A 2ZPAA 3R96A 4CGNA 4KLVA 4C7IA 2Z3LA 2FCKA 1WK4A 3DR6A 5I0CA 3IU1A 5GCNA 5G1ZA 2JDCA 4KOXA 3QAHA 2G3TA 4C2YA 3B8GA 1Z9UA 1S7KA 4NF1A 4UFXA 4U9YA 4FD4A 5AGEA 1MJAA 4CGPA 2G3AA 3F5BA 4PK2A 1B87A 4I49A 4KOVA 1IYKA 2NMTA 3CXSA 4UCNA 4KVME 3FB3A 2P0WA 4KVOE 1Q2DA 2CNTA 3S6KA 2CY2A 4QBJA 1V0CA 1VKCA 2VXKA 4UA3A 2BEIA 1M4DA 4R57A 4F6AA 1NE9A 2Z3KA 5EC4A 5FVJA 1GHEA 1IIDA 4E2AA 2J8MA 4XNHC 3QB8A 4B5PA 4LX9A 2WPXA 1CJWA 3DSBA 4UFVA 4HNWB 1S5KA 4HNXB 4R9MA 2K5TA 2EVNA 4H6ZA 1RO5A 2YGWA 4MFLA 2H5MA 4XPDB 4A32A 3T9YA 3DR8A 3F0AA 4CAXA 3WR7A 3R9EA 2DXQA 2J8NA 4CYPA 4IUSA 2Q7BA 3JTKA 3TO7A 4II9A 2GE3A 2AJ6A 2BSWA 3TCVA 5F49A 2REEA 1N71A 3C26A 2OZHA 3FYNA 4A33A 2WPWA 3IGRA 4NCZA 1XMTA 3FXTA 4FD7A 4JXRA 2P6FA 4JWPA 1ON0A 5E96A 4MY3A 1YVOA 3TO6A 4YRHA 4C2ZA 4E8OA 5F46A 3R95A 1I1DA 5A28A 4B14A 4A31A 2B5GB 3ZJ0A 2D4PA 2VEZA 2FIAA 4B12A 2OZGA 4CAWA 1YREA 3D2MA 2R98A 1U6MA 2YNDA 2VI7A 2R7HA 2Q04A 2REFA 2JLMA 2PRBA 5CNPA 1M4GA 4L89A 2B3UA 5C88A 5G22A 1ZO0A 4M85A 3SXNA 4JLYA 2Z3PA 4AVAA 3JVNA 4FD6A 4MY0A 4CAVA 1Y9WA 5H84A 2EUIA 2R1IA 4MFZA 3FBUA 4X5KA 4MFKA 4CYOA 3TOBA 2Z3NA 1M4IA 2DPSA 3JUWA 1LRZA 2Y0MA 4KLWA 1K4JA 2R8VA 4KOSA 2A4NA 1WWZA 1Z4RA 1BO4A 2YNCA 1YGHA 3EY5A 4OLLA 1SQHA 4XNHB 1Y7RA 4MJ8A 3MGDA 4HNYB 4PSWA 2OH1A 4OAEA 4NXYA 2HQYA 4Q36A 4IF5A 4MFJA 5F47A 3VWEA 4B13A 3KKWA 5IB0A 4U9ZA 2AE6A 4KOYA 2J8RA 4AVCA 3TE4A 2B4BA 2HUZA 4E0AA 4LUAA 5JQ4A 4F0YA 5KTCA 3GY9A 3TTHA 1I12A 4CGOA 3S6GA 1YLEA 4Y49C 1NMTA 3EFAA 4NEXA 2PR8A 4CRZB 4B5OA 2I00A 4MFPA 3DDDA 1KZFA 2KCWA 4R87A 4A2ZA 2VZZA 3TFYA 3GYAA 5A27A 2X7BA 1VHSA 4KUAA 4AG9A 4JD6A 4JJXA 3D8PA 3TOAA 3R1KA 3DNSA 4JXQA 1S7NA 4PK3A 3S6HA 3A9LA 2CXAA 1IICA 3FRMA 3H5ZA 5J8CA 4KOWA 2P6GA 2Q4YA 1Q2CA 4QUSA 2PSWA 2PC1A 2ZXVA 3G8WA 4KSFA 3FNCA 1XEBA 3IWGA 4L8AA 1PUAA 2CNSA 4UWJA 5H86A 4AB7A 1S7LA 1KUYA 3BJ8A 4MBUA 4UCMA 1J4JA 1Q2YA 3W91A 5J8FA 2ZW6A 2D4OA 2OU2A 2I79A 2WUUA 4R3LA 3BLNA 3LODA 3EO4A 1OZPA 4ORFA 3SHPA 2PQ8A 2Z11A 2FS5A 2QECA 4M3SA 2C27A 2FXFA 4DNCA 5HH1A 4GS4A 2WSAA 2HV2A 4ZGYB 2B58A 1XIXA 2ATRA 1XF8A 4XPKA 3OWCA 3CXPA 4CGLA 1BOBA 1M44A 1MJ9A 2DPTA 2B5GA 3PP9A 2B3VA 2F5IA 2Q0YA 2VBQA 1MK4A 4CAEA 4RI1A 4AVBA 4OADA 3ZZIA 3IU2A 1RXTA 4MI4A 3I9SA 1YVKA 1YX0A 3SXOA 5JPHA 4KORA 4F0XA 2GANA 2G0BA 4CYQA 4RS2A 5IV0A 4R3KA 1S60A 2QIRA 1KUVA 4KOUA 1MJBA 2B4DA 3H4QA 4Y49B 2BL1A 3G3SA 2JEVA 4QVTA 3V8IA 4U5YA 4A95A 2Q4VA 1YR0A 1S3ZA 2P6EA 3RYOA 4CAFA 5AG4A 3I3GA 5AG7A 3BJ7A 3D2PA 5G20A 1PU9A 2BUEA 2YNCC 1YK3A 3NE7A 5G21A 4B5PB 3TT2A 2FSRA 2JDDA 2OZUA 3R9FA 3W6XA 4A30A 2VZYA 4J3GA 3CXQA 3EC4A 2Z3MA 4Q38A 1FY7A 2QMLA 2Z0ZA 4KZTA 1XE4A 1CM0A 2Z3OA 4CYNA 5C82A 3P2FA 2FE7A 4QC6A 4BBHA 5BWAB 3LD2A 5KTDA 3PGPA 1L0CA 1QSTA 1QSNA 4UCPA 2Z10A 1TIQA 3P2HA 4PV6A 2CNMA 2OB0A 1B6BA 1S7FA 3FIXA 2FL4A 3GKRA 4AG7A 2ZW7A 4UWIA 4XPLA 4H6UA 4ONUA 1NSLA 4KSAA 1Y9KA 3D3SA 4QB9A 4UBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBV A;  1R57 A;  2IL4 A;  1QSR A;  2Q44 A;  4HKF A;  2FT0 A;  2ZW5 A;  3F8K A;  3K9U A;  2FIW A;  3VWD A;  2RC4 A;  2PR1 A;  2PDO A;  4KOT A;  5IX3 A;  4BMH A;  3EXN A;  4CRY B;  5DWM A;  1Z4E A;  1QSO A;  5ISV A;  4EVY A;  1IYL A;  4YFJ A;  2O28 A;  4YGO A;  4K30 A;  4XPD C;  5F48 A;  4CS0 B;  1P4N A;  4PSX A;  1M1D A;  3S6F A;  3T90 A;  5KTA A;  3N7Z A;  4FD5 A;  3PZJ A;  4KUB A;  2VQY A;  4H89 A;  1KUX A;  3UY5 A;  5DWN A;  1UFH A;  4KVX A;  3W6S A;  4ZBG A;  3E0K A;  2GIV A;  3TO9 A;  1I21 A;  1QSM A;  3R9G A;  4MHD A;  4NSQ A;  2ARH A;  2B4D B;  1IB1 E;  5HMN A;  1P0H A;  2ZW4 A;  2ZPA A;  3R96 A;  4KLV A;  2FCK A;  1WK4 A;  3DR6 A;  5I0C A;  5GCN A;  2JDC A;  4KOX A;  3QAH A;  2G3T A;  3B8G A;  1Z9U A;  1S7K A;  4NF1 A;  4U9Y A;  4FD4 A;  1MJA A;  2G3A A;  3F5B A;  4PK2 A;  1B87 A;  4I49 A;  4KOV A;  1IYK A;  2NMT A;  3CXS A;  4KVM E;  3FB3 A;  2P0W A;  4KVO E;  1Q2D A;  2CNT A;  3S6K A;  2CY2 A;  4QBJ A;  1V0C A;  1VKC A;  2VXK A;  4UA3 A;  2BEI A;  1M4D A;  4R57 A;  4F6A A;  1NE9 A;  5EC4 A;  5FVJ A;  1GHE A;  1IID A;  4E2A A;  2J8M A;  4XNH C;  3QB8 A;  4B5P A;  4LX9 A;  2WPX A;  1CJW A;  3DSB A;  4HNW B;  1S5K A;  4HNX B;  4R9M A;  2K5T A;  2EVN A;  4H6Z A;  1RO5 A;  2H5M A;  4XPD B;  3T9Y A;  3DR8 A;  3F0A A;  4CAX A;  3WR7 A;  3R9E A;  2DXQ A;  2J8N A;  4IUS A;  2Q7B A;  3TO7 A;  4II9 A;  2GE3 A;  2AJ6 A;  2BSW A;  3TCV A;  5F49 A;  2REE A;  1N71 A;  3C26 A;  2OZH A;  3FYN A;  2WPW A;  3IGR A;  4NCZ A;  1XMT A;  3FXT A;  4FD7 A;  4JXR A;  2P6F A;  4JWP A;  1ON0 A;  5E96 A;  4MY3 A;  1YVO A;  3TO6 A;  4YRH A;  4E8O A;  5F46 A;  3R95 A;  1I1D A;  2B5G B;  3ZJ0 A;  2D4P A;  2VEZ A;  2FIA A;  2OZG A;  4CAW A;  1YRE A;  3D2M A;  2R98 A;  1U6M A;  2VI7 A;  2R7H A;  2Q04 A;  2REF A;  2JLM A;  2PRB A;  5CNP A;  1M4G A;  4L89 A;  2B3U A;  5C88 A;  4M85 A;  3SXN A;  4JLY A;  4AVA A;  3JVN A;  4FD6 A;  4MY0 A;  4CAV A;  1Y9W A;  5H84 A;  2EUI A;  2R1I A;  3FBU A;  4X5K A;  3TOB A;  1M4I A;  3JUW A;  1LRZ A;  2Y0M A;  4KLW A;  1K4J A;  2R8V A;  4KOS A;  2A4N A;  1WWZ A;  1Z4R A;  1BO4 A;  1YGH A;  3EY5 A;  4OLL A;  1SQH A;  4XNH B;  1Y7R A;  4MJ8 A;  3MGD A;  4HNY B;  4PSW A;  2OH1 A;  4OAE A;  4NXY A;  2HQY A;  4IF5 A;  5F47 A;  3VWE A;  3KKW A;  5IB0 A;  4U9Z A;  2AE6 A;  4KOY A;  2J8R A;  4AVC A;  3TE4 A;  2B4B A;  2HUZ A;  4E0A A;  4LUA A;  5JQ4 A;  4F0Y A;  5KTC A;  3GY9 A;  3TTH A;  1I12 A;  3S6G A;  1YLE A;  4Y49 C;  1NMT A;  3EFA A;  4NEX A;  2PR8 A;  4CRZ B;  4B5O A;  2I00 A;  3DDD A;  1KZF A;  2KCW A;  4R87 A;  2VZZ A;  3TFY A;  3GYA A;  2X7B A;  1VHS A;  4KUA A;  4AG9 A;  4JD6 A;  4JJX A;  3D8P A;  3TOA A;  3R1K A;  3DNS A;  4JXQ A;  1S7N A;  4PK3 A;  3S6H A;  1IIC A;  3FRM A;  5J8C A;  4KOW A;  2P6G A;  2Q4Y A;  1Q2C A;  4QUS A;  2PSW A;  2PC1 A;  2ZXV A;  3G8W A;  3FNC A;  1XEB A;  3IWG A;  4L8A A;  1PUA A;  2CNS A;  4UWJ A;  5H86 A;  4AB7 A;  1S7L A;  1KUY A;  3BJ8 A;  4MBU A;  1J4J A;  1Q2Y A;  3W91 A;  5J8F A;  2ZW6 A;  2D4O A;  2OU2 A;  2I79 A;  4R3L A;  3BLN A;  3LOD A;  3EO4 A;  1OZP A;  4ORF A;  3SHP A;  2PQ8 A;  2Z11 A;  2FS5 A;  2QEC A;  4M3S A;  2C27 A;  2FXF A;  4DNC A;  5HH1 A;  4GS4 A;  2HV2 A;  2B58 A;  1XIX A;  2ATR A;  1XF8 A;  4XPK A;  3OWC A;  3CXP A;  1BOB A;  1M44 A;  1MJ9 A;  2B5G A;  3PP9 A;  2B3V A;  2F5I A;  2Q0Y A;  2VBQ A;  1MK4 A;  4RI1 A;  4AVB A;  4OAD A;  3ZZI A;  1RXT A;  4MI4 A;  3I9S A;  1YVK A;  1YX0 A;  3SXO A;  5JPH A;  4KOR A;  2GAN A;  2G0B A;  4RS2 A;  5IV0 A;  4R3K A;  1S60 A;  2QIR A;  1KUV A;  4KOU A;  1MJB A;  2B4D A;  3H4Q A;  4Y49 B;  2BL1 A;  3G3S A;  2JEV A;  4QVT A;  3V8I A;  4U5Y A;  2Q4V A;  1YR0 A;  1S3Z A;  2P6E A;  3RYO A;  3I3G A;  3BJ7 A;  3D2P A;  1PU9 A;  2BUE A;  1YK3 A;  3NE7 A;  4B5P B;  3TT2 A;  2FSR A;  2JDD A;  2OZU A;  3R9F A;  3W6X A;  2VZY A;  4J3G A;  3CXQ A;  3EC4 A;  1FY7 A;  2QML A;  2Z0Z A;  4KZT A;  1XE4 A;  1CM0 A;  5C82 A;  3P2F A;  2FE7 A;  4QC6 A;  3LD2 A;  5KTD A;  3PGP A;  1L0C A;  1QST A;  1QSN A;  2Z10 A;  1TIQ A;  3P2H A;  4PV6 A;  2CNM A;  2OB0 A;  1B6B A;  1S7F A;  3FIX A;  2FL4 A;  3GKR A;  4AG7 A;  2ZW7 A;  4UWI A;  4XPL A;  4H6U A;  4ONU A;  1NSL A;  1Y9K A;  3D3S A;  4QB9 A;  4UBR A; 
#chains in the Genus database with same CATH topology
 5EBV A;  2PJ0 A;  2ZEF A;  2ABZ A;  1Q7L A;  1R57 A;  3IWE A;  2IL4 A;  5THW A;  1YME A;  1QSR A;  2Q44 A;  2F8H A;  4M6I A;  4C2X A;  4C7H A;  3SI2 A;  4B6Z A;  5AG6 A;  4HKF A;  4C68 A;  4X2T A;  2FT0 A;  2ZW5 A;  3F8K A;  2OR4 A;  3K9U A;  4UFW A;  4W9Y A;  3RNZ A;  2FIW A;  3VWD A;  3WAB A;  5JGF A;  2RC4 A;  2PR1 A;  2PDO A;  4R6T A;  4TWE A;  3LAC A;  4KOT A;  4MFQ A;  4YWY A;  4B11 A;  5IX3 A;  4NJQ A;  4BMH A;  3EXN A;  4PXE A;  4CRY B;  5DWM A;  4Q7A A;  2YNE A;  4NGN A;  4UIB A;  1Z4E A;  1QSO A;  1R43 A;  1FT7 A;  4PXD A;  5AG5 A;  4EVY A;  5ISV A;  1IYL A;  4FWU A;  4YFJ A;  2O28 A;  4YGO A;  4K30 A;  4XPD C;  5F48 A;  3CZX A;  1VHE A;  1PYT B;  4CS0 B;  1P4N A;  1TKF A;  5D29 A;  4PSX A;  1M1D A;  3S6F A;  3T90 A;  4CPA A;  3N7Z A;  5KTA A;  4P4F A;  2ZED A;  4WWV A;  4FD5 A;  3PZJ A;  2CF4 A;  1BPM A;  1VIX A;  1GYT A;  2VQY A;  4KUB A;  1YSJ A;  1TF8 A;  4H89 A;  1Z8W A;  2V77 A;  4CGM A;  1KUX A;  3JRU A;  2AFW A;  4OID A;  5J1Q A;  3SJE A;  3UY5 A;  2GLF A;  5HVF A;  2BCO A;  5DWN A;  2XEF A;  4UEF A;  1UFH A;  3H8G A;  2G9D A;  1IOF A;  3PRT A;  1ZG9 A;  2C1C A;  1XMB A;  4KVX A;  5ELY A;  2PJ1 A;  3TC8 A;  3W6S A;  4B10 A;  4KS9 A;  4ZBG A;  3E0K A;  2GIV A;  3B3C A;  3TO9 A;  4M6H A;  1CP6 A;  4P10 A;  1I21 A;  4R7M A;  1QSM A;  4ZY2 A;  3R9G A;  4MHD A;  4NSQ A;  3D7D A;  2ARH A;  2B4D B;  1IB1 E;  2AFS A;  5HMN A;  1P0H A;  2ZW4 A;  2VL1 A;  1Z8X A;  2ZEN A;  2ZPA A;  3IJ3 A;  3PFO A;  4PXB A;  6CPA A;  3R96 A;  4CGN A;  4KLV A;  4HPS A;  4P6Y A;  4C7I A;  2Z3L A;  5HVG A;  3IWW A;  3KGQ A;  2FCK A;  1WK4 A;  2ZEE A;  3DR6 A;  1YW6 A;  1ZLH A;  2O53 A;  4IK2 A;  3VH9 A;  5I0C A;  3DLJ A;  1ELL P;  3IU1 A;  5GCN A;  5CBM A;  1XBU A;  2XEI A;  1VGY A;  5G1Z A;  2JDC A;  4KOX A;  1M4L A;  3QAH A;  2GFQ A;  2G3T A;  2ODF A;  5LYL A;  1CBX A;  1YLO A;  4C2Y A;  3B8G A;  1Z9U A;  1S7K A;  4NF1 A;  4UFX A;  4U9Y A;  4FD4 A;  5AGE A;  5JH9 A;  1MJA A;  4CGP A;  2G3A A;  3B3T A;  3F5B A;  4PK2 A;  1ELM P;  1BAV A;  3RAM A;  1B87 A;  3PB9 X;  4I49 A;  2V8D A;  4MHY A;  4KSI A;  4KOV A;  1IYK A;  2NMT A;  3CXS A;  4UCN A;  2ZEH A;  4FUU A;  4KVM E;  3HLP A;  3KQZ A;  3QNV A;  3FJU A;  4P4D A;  1F57 A;  3FEE A;  1YW4 A;  3FB3 A;  2P0W A;  2HC9 A;  4KVO E;  1Q2D A;  2CNT A;  4R8F A;  3S6K A;  2EO8 A;  2CY2 A;  3BI1 A;  1Z8L A;  4A39 A;  4MXU A;  2CTC A;  3KHX A;  3NA6 A;  4QBJ A;  1V0C A;  2ZOG A;  3CPX A;  1HEE A;  1VKC A;  2ZEG A;  3D7H A;  2VXK A;  4Z65 A;  4UA3 A;  2PVW A;  5LYD A;  2BEI A;  1M4D A;  4R57 A;  4F6A A;  1NE9 A;  5JM6 A;  4ZY0 A;  2Z3K A;  5EC4 A;  5FVJ A;  1GHE A;  1IID A;  4E2A A;  2J8M A;  4XNH C;  4DUK A;  3S9M A;  2PCU A;  3QB8 A;  4B5P A;  3KAS A;  4LX9 A;  2WPX A;  1CJW A;  3DSB A;  5I4M A;  4UFV A;  4HNW B;  1S5K A;  2XEJ A;  4HNX B;  4R9M A;  2K5T A;  2EVN A;  4FAI A;  1LAM A;  2CIJ A;  4H6Z A;  1RO5 A;  2YGW A;  2QVP A;  2V8V A;  4JZ0 A;  4MFL A;  3S9N A;  5HXD A;  2IMO A;  1CPS A;  5F09 A;  2BOA A;  2H5M A;  4XPD B;  4A32 A;  1HDQ A;  2O4H A;  2DF5 A;  3T9Y A;  3DR8 A;  3CPA A;  1JQG A;  3F0A A;  4A38 A;  3WR7 A;  3R9E A;  2DXQ A;  2J8N A;  4CAX A;  4X8I A;  3PFE A;  4IUS A;  2Q7B A;  3JTK A;  4CYP A;  3TO7 A;  3WC5 A;  3WC7 A;  4II9 A;  3B7I A;  2GE3 A;  7CPA A;  3NH5 A;  5CPA A;  3RBU A;  2AJ6 A;  2BSW A;  3TCV A;  5F49 A;  3FX6 A;  1DE4 C;  2REE A;  1CG2 A;  4F9U A;  1N71 A;  1QMU A;  2BO9 A;  3S9L A;  3C26 A;  2OZH A;  3FYN A;  3IC1 A;  4A33 A;  2WPW A;  2PJ3 A;  3IGR A;  4NCZ A;  1XMT A;  4MHZ A;  3FXT A;  4FD7 A;  1LAP A;  4K3N A;  3KHZ A;  4JXR A;  1TKH A;  4NGQ A;  2P6F A;  4JWP A;  1ON0 A;  5E96 A;  4MY3 A;  1YVO A;  2AFO A;  3TO6 A;  4YRH A;  4ZI6 A;  4C2Z A;  4E8O A;  4A37 A;  3R95 A;  1I1D A;  2V8G A;  2PJ5 A;  4OC1 A;  4OKO A;  4ZX9 A;  5A28 A;  3GLJ A;  3WT4 A;  4B14 A;  1QQ9 A;  4A31 A;  2B5G B;  4AXV A;  1F2P A;  5EMI A;  2D4P A;  4MCP A;  2RFH A;  5LYI A;  3SI1 A;  3ZJ0 A;  1AYE A;  2VEZ A;  2FIA A;  4B12 A;  2OZG A;  4CAW A;  1YRE A;  3D2M A;  2R98 A;  1U6M A;  1RTQ A;  2YND A;  1FNO A;  2VI7 A;  3FF3 A;  2R7H A;  3CT9 A;  3MN8 A;  2Q04 A;  2REF A;  4UEE A;  4MHN A;  2JLM A;  2EWB A;  2PRB A;  2V8H A;  1F2O A;  5CNP A;  1M4G A;  4L89 A;  3B3W A;  3D68 A;  2B3U A;  4EME A;  5C88 A;  5G22 A;  4OC0 A;  1ZO0 A;  4M85 A;  3SXN A;  4OC2 A;  4EFD A;  2DEA A;  2QJ8 A;  2Z3P A;  4JLY A;  1TF9 A;  4NGS A;  3FEC A;  4AVA A;  1UWY A;  2NSM A;  3JVN A;  4FD6 A;  5LRG A;  3GUX A;  4MY0 A;  4CAV A;  1X12 A;  1IU8 A;  1CPX A;  1Y9W A;  5H84 A;  2EUI A;  2FVG A;  2R1I A;  4MFZ A;  4OC4 A;  3D7F A;  3FBU A;  4X5K A;  4MFK A;  4CYO A;  1Y0R A;  4UEZ A;  4DJL A;  3TOB A;  1BPN A;  2PE3 A;  2PJB A;  4PXC A;  2Z3N A;  5LRK A;  1M4I A;  2C6P A;  2DPS A;  3JUW A;  4F9V A;  1KWM A;  1LRZ A;  2AFM A;  1X10 A;  4GXH A;  2Y0M A;  4NGM A;  4KLW A;  1K4J A;  5LYF A;  2R8V A;  4KOS A;  4RN7 A;  1DTD A;  4BIN A;  4ZYQ A;  5C82 A;  2A4N A;  1WWZ A;  1Z4R A;  3GB0 A;  1BO4 A;  2YNC A;  4P4J A;  3SJF A;  1ARM A;  2JEW A;  1YGH A;  4OP4 A;  2CTB A;  3MRU A;  3EY5 A;  1HDU A;  4OLL A;  1SQH A;  3IEH A;  3D66 A;  4XNH B;  3NH4 A;  2C6C A;  1Y7R A;  4MJ8 A;  3MGD A;  4O23 A;  4HNY B;  1Z5R A;  3T8W A;  4PSW A;  4ZY1 A;  2OH1 A;  3PB7 X;  5K8M A;  1IGB A;  4OAE A;  4NXY A;  2HQY A;  4Q36 A;  4IF5 A;  4MFJ A;  5F47 A;  3VWE A;  2POK A;  4B13 A;  3L2N A;  5K8P A;  4OC5 A;  3KKW A;  5IB0 A;  4OME A;  3QAY A;  2QYV A;  4U9Z A;  2AFX A;  2AE6 A;  4KOY A;  2J8R A;  4AVC A;  3RZA A;  5IB9 A;  2B4B A;  2PJ7 A;  4MRI A;  3TE4 A;  2HUZ A;  3D4U A;  3KZW A;  4LUA A;  4E0A A;  5JQ4 A;  2IJZ A;  4F0Y A;  1EE3 P;  3GY9 A;  4MMO A;  3B2Y A;  4RUH A;  1IY7 A;  1I12 A;  3TTH A;  4CGO A;  5KTC A;  3S6G A;  1YLE A;  4Y49 C;  1NMT A;  3EFA A;  3FVL A;  4NEX A;  2PR8 A;  3CDX A;  4IHM A;  5LRJ A;  4CRZ B;  4B5O A;  2I00 A;  4MFP A;  2EK8 A;  1KZF A;  3DDD A;  2KCW A;  2WZN A;  4R87 A;  4A2Z A;  1CX8 A;  2VZZ A;  2GRE A;  4NJR A;  4X3R A;  3TFY A;  3GYA A;  3K9T A;  5A27 A;  2X7B A;  1VHS A;  2I3C A;  3LMS A;  4KUA A;  1LCP A;  4ONW A;  4AG9 A;  4A94 A;  2PJ6 A;  4JD6 A;  4JJX A;  3VAT A;  3V38 A;  3PB8 X;  3D8P A;  3TOA A;  2ZEL A;  2JBK A;  1A2Z A;  3KR4 A;  4DYO A;  3R1K A;  3DNS A;  3LWU A;  1S7N A;  4JXQ A;  4MCQ A;  4PK3 A;  3S6H A;  3A9L A;  5F46 A;  2CXA A;  1IIC A;  1ZLI A;  3FRM A;  3H5Z A;  3B3S A;  5J8C A;  4KOW A;  1AMP A;  2P6G A;  2Q4Y A;  8CPA A;  3ISZ A;  3KL9 A;  1Q2C A;  4QUS A;  2PSW A;  2PC1 A;  3KI9 A;  2ZXV A;  2IQ6 A;  2PJ8 A;  2RB7 A;  1R3N A;  3G8W A;  4KSF A;  5K8O A;  3FNC A;  3PBE A;  3NH8 A;  1XEB A;  2ZEM A;  3IWG A;  1PUA A;  4L8A A;  4YU9 A;  2CNS A;  3B35 A;  4UWJ A;  3PBB A;  4GM5 A;  5H86 A;  2ZEP A;  3TX8 A;  4AB7 A;  3K2K A;  1S7L A;  3D7G A;  1KUY A;  3BJ8 A;  4MBU A;  4UCM A;  2ZEO A;  1YQE A;  1NSA A;  1LOK A;  4P45 A;  1J4J A;  1Q2Y A;  3W91 A;  5J8F A;  2ZW6 A;  4G1P A;  2D4O A;  1Y0Y A;  4IAV A;  2OU2 A;  2I79 A;  5DS0 A;  1BLL E;  1LAN A;  2PJ2 A;  2WUU A;  3SI0 A;  2Q51 A;  3BLN A;  4R3L A;  2Q43 A;  3LOD A;  4M6G A;  3H8E A;  3EO4 A;  1OZP A;  4ORF A;  1XRY A;  3I1U A;  2PQ8 A;  2Z11 A;  2FS5 A;  3SHP A;  2QEC A;  3BI0 A;  4M3S A;  2C27 A;  4H2K A;  4P44 A;  4WJB A;  2FXF A;  4DNC A;  5HH1 A;  4GS4 A;  2WSA A;  2HV2 A;  4ZGY B;  3SJX A;  2PIY A;  2B58 A;  1XIX A;  4UIA A;  2ATR A;  1XF8 A;  4MHP A;  4XPK A;  3OWC A;  3CXP A;  4CGL A;  1BOB A;  1M44 A;  1MJ9 A;  2DPT A;  3KR5 A;  2B5G A;  3PP9 A;  1ARL A;  2B3V A;  2PIZ A;  4NFR A;  2F5I A;  2PJ4 A;  2Q0Y A;  2VBQ A;  3WC6 A;  1MK4 A;  1XOV A;  4CAE A;  4RI1 A;  4AVB A;  1CP7 A;  3NFZ A;  4OAD A;  4LQG A;  3IFE A;  4PPZ A;  3ZZI A;  3H8F A;  1H8L A;  1RXT A;  3IU2 A;  4ZX8 A;  1JWQ A;  4MI4 A;  3BHX A;  2EK9 A;  1Z8T A;  3I9S A;  1YVK A;  4P4B A;  1YX0 A;  2WYR A;  3SXO A;  5JPH A;  2Q4Z A;  3ISX A;  4KOR A;  1OBR A;  4PQA A;  4TNU A;  4F0X A;  2HB6 A;  2GAN A;  1TKJ A;  3V7Z A;  2G0B A;  4CYQ A;  4RS2 A;  5IV0 A;  4R3K A;  1S60 A;  3NE8 A;  2GLJ A;  2Q7S A;  3FED A;  2QIR A;  1KUV A;  1ZG7 A;  4KOU A;  1MJB A;  2B4D A;  3H4Q A;  4Y49 B;  4OIW A;  2BL1 A;  4NGP A;  3G3S A;  1VHO A;  1Y7E A;  2JEV A;  1TXR A;  3PEI A;  4LQ6 A;  4QVT A;  2ZOF A;  3BXM A;  2F7V A;  3V8I A;  4U5Y A;  4A95 A;  2Q4V A;  3PB4 X;  2PRQ A;  1YR0 A;  1S3Z A;  2GU2 A;  2P6E A;  4JYW A;  3FMC A;  3N5F A;  2PVV A;  3RYO A;  5HVH A;  4CAF A;  5AG4 A;  3I3G A;  5AG7 A;  3BJ7 A;  4NGR A;  2PJ9 A;  3D2P A;  5G20 A;  1PU9 A;  2BUE A;  2YNC C;  1XFO A;  3D67 A;  1AUG A;  1YK3 A;  3NE7 A;  5G21 A;  4P4E A;  1LFW A;  4B5P B;  4BD9 A;  4MCS A;  1IOI A;  5D8N A;  3TT2 A;  2FSR A;  2JDD A;  2AFZ A;  2OZU A;  2PJC A;  3VAR A;  3R9F A;  2ANP A;  2NYQ A;  3W6X A;  2C6G A;  4A30 A;  3IIB A;  3DGV A;  4FBE A;  2VZY A;  4J3G A;  3CXQ A;  3EC4 A;  4OC3 A;  2Z3M A;  4Q38 A;  1FY7 A;  2QML A;  2Z0Z A;  4NGT A;  1ZG8 A;  2J9A A;  4P4I A;  4KZT A;  2XEG A;  1XE4 A;  3IO1 A;  3PB6 X;  2EBJ A;  4F8Z A;  1CM0 A;  2Z3O A;  4CYN A;  2PJA A;  3P2F A;  2FE7 A;  4QC6 A;  4BBH A;  5BWA B;  4UF4 A;  3LD2 A;  5KTD A;  3PGP A;  1L0C A;  3GIU A;  1QST A;  3SJG A;  1QSN A;  3RO0 A;  2OOT A;  4UCP A;  2Z10 A;  3KQX A;  1TIQ A;  3FH4 A;  3P2H A;  4PV6 A;  2AFU A;  2OB0 A;  1B6B A;  1S7F A;  2CNM A;  3FIX A;  2FL4 A;  3GKR A;  1XJO A;  2ZW7 A;  4UWI A;  3HUV A;  4R76 A;  4AG7 A;  4XPL A;  4H6U A;  4MCR A;  4ONU A;  1NSL A;  3B3V A;  4KSA A;  1Y9K A;  3D3S A;  2JBJ A;  1PCA A;  4QB9 A;  4UBR A;  1Z2L A;  5K8N A;  4EWT A; 
#chains in the Genus database with same CATH homology
 5EBV A;  3IWE A;  1R57 A;  2IL4 A;  1QSR A;  2Q44 A;  4C2X A;  4C7H A;  5AG6 A;  4HKF A;  4C68 A;  2FT0 A;  2ZW5 A;  3F8K A;  4UFW A;  3K9U A;  2FIW A;  3VWD A;  2RC4 A;  2PR1 A;  2PDO A;  4KOT A;  4MFQ A;  4B11 A;  5IX3 A;  4BMH A;  3EXN A;  4CRY B;  5DWM A;  2YNE A;  1Z4E A;  1QSO A;  5AG5 A;  4EVY A;  5ISV A;  1IYL A;  4YFJ A;  2O28 A;  4YGO A;  4K30 A;  4XPD C;  5F48 A;  4CS0 B;  1P4N A;  4PSX A;  1M1D A;  3S6F A;  3T90 A;  5KTA A;  3N7Z A;  4FD5 A;  3PZJ A;  4KUB A;  2VQY A;  4H89 A;  4CGM A;  1KUX A;  3UY5 A;  5DWN A;  1UFH A;  4KVX A;  3W6S A;  4B10 A;  4KS9 A;  4ZBG A;  3E0K A;  2GIV A;  3TO9 A;  1I21 A;  1QSM A;  3R9G A;  4MHD A;  4NSQ A;  2ARH A;  2B4D B;  1IB1 E;  5HMN A;  1P0H A;  2ZW4 A;  2ZPA A;  3R96 A;  4CGN A;  4KLV A;  4C7I A;  2Z3L A;  2FCK A;  1WK4 A;  3DR6 A;  5I0C A;  3IU1 A;  5GCN A;  5G1Z A;  2JDC A;  4KOX A;  3QAH A;  2G3T A;  4C2Y A;  3B8G A;  1Z9U A;  1S7K A;  4NF1 A;  4UFX A;  4U9Y A;  4FD4 A;  5AGE A;  1MJA A;  4CGP A;  2G3A A;  3F5B A;  4PK2 A;  1B87 A;  4I49 A;  4KOV A;  1IYK A;  2NMT A;  3CXS A;  4UCN A;  4KVM E;  3FB3 A;  2P0W A;  4KVO E;  1Q2D A;  2CNT A;  3S6K A;  2CY2 A;  4QBJ A;  1V0C A;  1VKC A;  2VXK A;  4UA3 A;  2BEI A;  1M4D A;  4R57 A;  4F6A A;  1NE9 A;  2Z3K A;  5EC4 A;  5FVJ A;  1GHE A;  1IID A;  4E2A A;  2J8M A;  4XNH C;  3QB8 A;  4B5P A;  4LX9 A;  2WPX A;  1CJW A;  3DSB A;  4UFV A;  4HNW B;  1S5K A;  4HNX B;  4R9M A;  2K5T A;  2EVN A;  4H6Z A;  1RO5 A;  2YGW A;  4MFL A;  2H5M A;  4XPD B;  4A32 A;  3T9Y A;  3DR8 A;  3F0A A;  4CAX A;  3WR7 A;  3R9E A;  2DXQ A;  2J8N A;  4CYP A;  4IUS A;  2Q7B A;  3JTK A;  3TO7 A;  4II9 A;  2GE3 A;  2AJ6 A;  2BSW A;  3TCV A;  5F49 A;  2REE A;  1N71 A;  3C26 A;  2OZH A;  3FYN A;  4A33 A;  2WPW A;  3IGR A;  4NCZ A;  1XMT A;  3FXT A;  4FD7 A;  4JXR A;  2P6F A;  4JWP A;  1ON0 A;  5E96 A;  4MY3 A;  1YVO A;  3TO6 A;  4YRH A;  4C2Z A;  4E8O A;  5F46 A;  3R95 A;  1I1D A;  5A28 A;  4B14 A;  4A31 A;  2B5G B;  3ZJ0 A;  2D4P A;  2VEZ A;  2FIA A;  4B12 A;  2OZG A;  4CAW A;  1YRE A;  3D2M A;  2R98 A;  1U6M A;  2YND A;  2VI7 A;  2R7H A;  2Q04 A;  2REF A;  2JLM A;  2PRB A;  5CNP A;  1M4G A;  4L89 A;  2B3U A;  5C88 A;  5G22 A;  1ZO0 A;  4M85 A;  3SXN A;  4JLY A;  2Z3P A;  4AVA A;  3JVN A;  4FD6 A;  4MY0 A;  4CAV A;  1Y9W A;  5H84 A;  2EUI A;  2R1I A;  4MFZ A;  3FBU A;  4X5K A;  4MFK A;  4CYO A;  3TOB A;  2Z3N A;  1M4I A;  2DPS A;  3JUW A;  1LRZ A;  2Y0M A;  4KLW A;  1K4J A;  2R8V A;  4KOS A;  2A4N A;  1WWZ A;  1Z4R A;  1BO4 A;  2YNC A;  1YGH A;  3EY5 A;  4OLL A;  1SQH A;  4XNH B;  1Y7R A;  4MJ8 A;  3MGD A;  4HNY B;  4PSW A;  2OH1 A;  4OAE A;  4NXY A;  2HQY A;  4Q36 A;  4IF5 A;  4MFJ A;  5F47 A;  3VWE A;  4B13 A;  3KKW A;  5IB0 A;  4U9Z A;  2AE6 A;  4KOY A;  2J8R A;  4AVC A;  3TE4 A;  2B4B A;  2HUZ A;  4E0A A;  4LUA A;  5JQ4 A;  4F0Y A;  5KTC A;  3GY9 A;  3TTH A;  1I12 A;  4CGO A;  3S6G A;  1YLE A;  4Y49 C;  1NMT A;  3EFA A;  4NEX A;  2PR8 A;  4CRZ B;  4B5O A;  2I00 A;  4MFP A;  3DDD A;  1KZF A;  2KCW A;  4R87 A;  4A2Z A;  2VZZ A;  3TFY A;  3GYA A;  5A27 A;  2X7B A;  1VHS A;  4KUA A;  4AG9 A;  4JD6 A;  4JJX A;  3D8P A;  3TOA A;  3R1K A;  3DNS A;  4JXQ A;  1S7N A;  4PK3 A;  3S6H A;  3A9L A;  2CXA A;  1IIC A;  3FRM A;  3H5Z A;  5J8C A;  4KOW A;  2P6G A;  2Q4Y A;  1Q2C A;  4QUS A;  2PSW A;  2PC1 A;  2ZXV A;  3G8W A;  4KSF A;  3FNC A;  1XEB A;  3IWG A;  4L8A A;  1PUA A;  2CNS A;  4UWJ A;  5H86 A;  4AB7 A;  1S7L A;  1KUY A;  3BJ8 A;  4MBU A;  4UCM A;  1J4J A;  1Q2Y A;  3W91 A;  5J8F A;  2ZW6 A;  2D4O A;  2OU2 A;  2I79 A;  2WUU A;  4R3L A;  3BLN A;  3LOD A;  3EO4 A;  1OZP A;  4ORF A;  3SHP A;  2PQ8 A;  2Z11 A;  2FS5 A;  2QEC A;  4M3S A;  2C27 A;  2FXF A;  4DNC A;  5HH1 A;  4GS4 A;  2WSA A;  2HV2 A;  4ZGY B;  2B58 A;  1XIX A;  2ATR A;  1XF8 A;  4XPK A;  3OWC A;  3CXP A;  4CGL A;  1BOB A;  1M44 A;  1MJ9 A;  2DPT A;  2B5G A;  3PP9 A;  2B3V A;  2F5I A;  2Q0Y A;  2VBQ A;  1MK4 A;  4CAE A;  4RI1 A;  4AVB A;  4OAD A;  3ZZI A;  3IU2 A;  1RXT A;  4MI4 A;  3I9S A;  1YVK A;  1YX0 A;  3SXO A;  5JPH A;  4KOR A;  4F0X A;  2GAN A;  2G0B A;  4CYQ A;  4RS2 A;  5IV0 A;  4R3K A;  1S60 A;  2QIR A;  1KUV A;  4KOU A;  1MJB A;  2B4D A;  3H4Q A;  4Y49 B;  2BL1 A;  3G3S A;  2JEV A;  4QVT A;  3V8I A;  4U5Y A;  4A95 A;  2Q4V A;  1YR0 A;  1S3Z A;  2P6E A;  3RYO A;  4CAF A;  5AG4 A;  3I3G A;  5AG7 A;  3BJ7 A;  3D2P A;  5G20 A;  1PU9 A;  2BUE A;  2YNC C;  1YK3 A;  3NE7 A;  5G21 A;  4B5P B;  3TT2 A;  2FSR A;  2JDD A;  2OZU A;  3R9F A;  3W6X A;  4A30 A;  2VZY A;  4J3G A;  3CXQ A;  3EC4 A;  2Z3M A;  4Q38 A;  1FY7 A;  2QML A;  2Z0Z A;  4KZT A;  1XE4 A;  1CM0 A;  2Z3O A;  4CYN A;  5C82 A;  3P2F A;  2FE7 A;  4QC6 A;  4BBH A;  5BWA B;  3LD2 A;  5KTD A;  3PGP A;  1L0C A;  1QST A;  1QSN A;  4UCP A;  2Z10 A;  1TIQ A;  3P2H A;  4PV6 A;  2CNM A;  2OB0 A;  1B6B A;  1S7F A;  3FIX A;  2FL4 A;  3GKR A;  4AG7 A;  2ZW7 A;  4UWI A;  4XPL A;  4H6U A;  4ONU A;  1NSL A;  4KSA A;  1Y9K A;  3D3S A;  4QB9 A;  4UBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...