3FXTA

Crystal structure of the n-terminal domain of human nudt6
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
90
structure length
90
Chain Sequence
b'QSMDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate-linked moiety X motif 6
molecule tags Gene regulation
source organism Homo sapiens
publication title Crystal structure of the N-terminal domain of human NUDT6
rcsb
total genus 27
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18290 Nudix_hydro Nudix hydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fxtA00
2ZPAA 1KUYA 4PSWA 3I9SA 4QB9A 1FY7A 4KOVA 3JVNA 1Z4EA 5KTCA 4BMHA 2FT0A 3TO6A 3R9GA 4IUSA 5H84A 4J3GA 2FIWA 1J4JA 3NE7A 1K4JA 3CXPA 5KTDA 2REFA 2H5MA 2OZUA 4Y49B 4MHDA 4CS0B 4LX9A 3FNCA 2CNSA 4E8OA 1YX0A 3VWEA 2O28A 2B5GA 4Y49C 4JD6A 3SXNA 4KOUA 4L8AA 1YK3A 3C26A 3ZJ0A 2Q4YA 3CXQA 4B5PB 1QSNA 4HNXB 1YVOA 1MK4A 4RI1A 1V0CA 3DDDA 3OWCA 2J8MA 3ZZIA 3BJ7A 2PQ8A 4NXYA 1S7KA 4YGOA 3S6HA 4MBUA 1N71A 1S7NA 3FIXA 1M4IA 3SHPA 2HV2A 5CNPA 1BOBA 2QECA 3DNSA 5J8CA 3DR6A 2GIVA 3G8WA 3K9UA 4LUAA 4F6AA 2CNMA 4KOYA 4QUSA 5GCNA 2FCKA 1U6MA 5F47A 5IB0A 2BEIA 1YLEA 3WR7A 3TT2A 5EC4A 2ZW7A 4AVBA 3GY9A 4H6UA 4JXRA 4U9YA 5EBVA 4OLLA 4CAWA 2D4PA 2PSWA 1KUXA 5HMNA 2IL4A 2PRBA 3DSBA 5FVJA 4HNWB 1PU9A 2R1IA 4KLVA 3PZJA 2VI7A 4UWIA 1QSOA 1Y7RA 2A4NA 2OB0A 4FD4A 5F49A 1R57A 1P4NA 1S7FA 1QSRA 2I79A 3EFAA 2REEA 3FYNA 4XPDC 2Z10A 4PV6A 5JPHA 2K5TA 4R87A 3W6SA 1VKCA 1L0CA 2PR8A 1M4DA 2GANA 4MY3A 5ISVA 2Z11A 4JLYA 1QSTA 2Q0YA 4E2AA 4XPKA 4YFJA 2CNTA 5KTAA 4R3LA 3TOAA 4GS4A 5F48A 2OZHA 5HH1A 2F5IA 4NSQA 2R7HA 3BJ8A 4JXQA 4OAEA 4JWPA 2EUIA 4B5PA 3RYOA 4KOXA 1I12A 1BO4A 1PUAA 5I0CA 2R8VA 2VEZA 3TCVA 4L89A 3T9YA 3FRMA 2ATRA 1RXTA 3D3SA 4EVYA 2FL4A 3P2FA 4KOSA 3MGDA 2DXQA 3JUWA 2CY2A 4YRHA 3I3GA 4NEXA 1I1DA 5IV0A 2JDCA 3SXOA 2B3VA 4R3KA 3F8KA 2Z0ZA 1M4GA 4PK3A 3GKRA 2ZW4A 2G3AA 3D2PA 4IF5A 5E96A 4RS2A 3DR8A 2P6FA 3LD2A 4QBJA 4KUBA 3BLNA 2B4DA 4AVCA 2X7BA 1S7LA 1IYLA 4KZTA 3PGPA 3F5BA 3T90A 2OH1A 1GHEA 1CJWA 3VWDA 4PK2A 2B4DB 2FE7A 4CAXA 4CAVA 4F0YA 2ARHA 4AB7A 3LODA 2FIAA 2JEVA 2BSWA 5J8FA 1WK4A 2PDOA 2HQYA 3R1KA 2Q4VA 4KOWA 3H4QA 2C27A 3TFYA 4R9MA 2D4OA 4K30A 2I00A 1YVKA 1Z9UA 4M85A 2VBQA 4XNHC 2HUZA 1IYKA 3R95A 3EC4A 3EO4A 2EVNA 2Q04A 2KCWA 2RC4A 3D2MA 2J8NA 1XEBA 3G3SA 4AVAA 4X5KA 1NMTA 2B4BA 3EXNA 1Q2YA 4XPDB 1OZPA 2WPWA 3W6XA 2VXKA 5JQ4A 1YGHA 3R96A 4NCZA 1B87A 3FBUA 1YR0A 2B58A 1XMTA 4XPLA 1S5KA 4R57A 2JLMA 4KLWA 3UY5A 5C88A 3TO9A 2BUEA 3V8IA 4AG9A 4OADA 1M44A 3D8PA 1M1DA 1XE4A 2ZW6A 1MJ9A 2QMLA 3IGRA 4FD6A 1MJBA 1TIQA 1MJAA 1CM0A 3N7ZA 4UA3A 3TE4A 2PR1A 1IB1E 2QIRA 4UBRA 4AG7A 3GYAA 1B6BA 2FS5A 4I49A 4FD5A 4XNHB 2FXFA 2G3TA 4NF1A 4CRYB 4PSXA 2B3UA 4M3SA 1ON0A 2B5GB 4KUAA 4MY0A 1YREA 4U9ZA 3TTHA 2Q44A 1NE9A 3P2HA 1NSLA 1Z4RA 3FB3A 4QVTA 1I21A 2OZGA 3IWGA 1XIXA 2AJ6A 3E0KA 2VZZA 2NMTA 4KVOE 4KVXA 2R98A 4HNYB 2OU2A 4ONUA 1Q2DA 2WPXA 4MI4A 2GE3A 1P0HA 1LRZA 4UWJA 4ORFA 2P6GA 3B8GA 1IICA 4CRZB 1XF8A 4H6ZA 3CXSA 4E0AA 5DWNA 3FXTA 3PP9A 3EY5A 3S6FA 4U5YA 3S6GA 5F46A 3S6KA 2VZYA 4QC6A 3QB8A 4B5OA 4FD7A 3KKWA 4HKFA 3F0AA 4JJXA 1S3ZA 3TOBA 2BL1A 3R9EA 4KVME 3R9FA 1RO5A 4H89A 4KOTA 4MJ8A 1SQHA 3TO7A 2PC1A 2Q7BA 1IIDA 1WWZA 1S60A 5H86A 5C82A 1QSMA 4II9A 3W91A 1Y9WA 2Y0MA 4DNCA 2G0BA 3QAHA 5IX3A 1UFHA 2JDDA 2FSRA 1KZFA 2P0WA 2VQYA 4KORA 5DWMA 2AE6A 2P6EA 4ZBGA 2J8RA 1KUVA 2ZW5A 2ZXVA 1VHSA 1Q2CA 1Y9KA
chains in the Genus database with same CATH superfamily
4A32A 2ZPAA 1KUYA 4PSWA 3I9SA 4QB9A 1FY7A 4KOVA 3JVNA 1Z4EA 4F9VA 1YW6A 4GM5A 4K3NA 4UFXA 2PRQA 2FT0A 3JRUA 4NGNA 3H8EA 3TO6A 4BMHA 3R9GA 2CF4A 4OC5A 4NFRA 1Z8XA 4IUSA 1NSAA 1VHOA 3ISZA 5H84A 4J3GA 4C7IA 2CTCA 2FIWA 5J1QA 1J4JA 2Z3LA 3FMCA 3NE7A 1K4JA 2RFHA 4X3RA 5JGFA 3CXPA 5KTDA 2REFA 2H5MA 2OZUA 4PXDA 4Y49B 2DEAA 1XOVA 4MHDA 4ZI6A 4DJLA 1Y0YA 4CS0B 2JBKA 4LX9A 3PB8X 3FNCA 2CNSA 4E8OA 1AYEA 1YX0A 3VWEA 2O28A 2B5GA 4DYOA 5IB9A 3IU1A 4Q38A 3CZXA 4Y49C 4PXEA 4JD6A 3SXNA 4KOUA 3FJUA 4L8AA 1YK3A 4A94A 4A37A 2ZOFA 3BHXA 1ZLIA 3C26A 3ZJ0A 2YNDA 4EFDA 1XBUA 1YW4A 2EO8A 4MFQA 1Z8TA 2PIYA 2Q4YA 3CXQA 2F8HA 1TKHA 4B5PB 1QSNA 4HNXB 2C6PA 1YVOA 3RNZA 5HXDA 1MK4A 1V0CA 3DDDA 4RI1A 3OWCA 2J8MA 2NSMA 3ZZIA 3BJ7A 3D68A 2PQ8A 4NXYA 4OC1A 1S7KA 1FNOA 4YGOA 3RZAA 3S6HA 4MBUA 4MFPA 1N71A 1S7NA 3FIXA 1M4IA 4NGPA 3SHPA 2HV2A 3PBEA 4P4JA 5CNPA 3WABA 1BOBA 4EWTA 2QECA 3DNSA 5J8CA 3DR6A 4FUUA 2DF5A 4R76A 2GIVA 2ZEMA 4YWYA 1KWMA 3NH5A 1CP7A 3G8WA 3GIUA 2PJBA 3K9UA 4LUAA 1BPMA 3TC8A 3TX8A 1IU8A 2ZOGA 6CPAA 3KQZA 2EWBA 4M6GA 4F6AA 2CNMA 3CPAA 2ZEDA 4ZX9A 2QJ8A 2IQ6A 4NGSA 4KOYA 4QUSA 1ARMA 5BWAB 5LYFA 4O23A 3LWUA 5GCNA 5LRJA 4DUKA 2ZEFA 2FCKA 2PJ5A 2V8VA 1U6MA 2ABZA 3IC1A 5F47A 4RUHA 2ZEOA 5IB0A 2BEIA 4CGMA 1Y0RA 1YLEA 4ZY2A 4B14A 3WR7A 5G22A 3TT2A 5EC4A 2ZW7A 3QNVA 1EE3P 5CBMA 2OR4A 4AVBA 4B6ZA 2PJAA 3GY9A 8CPAA 2WYRA 1IGBA 4H6UA 4JXRA 4U9YA 5EBVA 4OLLA 4A2ZA 2FVGA 1LANA 4CAWA 2D4PA 2PSWA 1KUXA 4CGLA 5HMNA 2IL4A 7CPAA 2Z3OA 3B3TA 1ZO0A 3PFEA 2AFSA 2PRBA 3DSBA 5FVJA 2RB7A 4HNWB 4CPAA 1PU9A 2R1IA 4KLVA 1A2ZA 1LOKA 5AG6A 3KI9A 3PZJA 5AG5A 4W9YA 2WSAA 2VI7A 1CPXA 1Y7EA 4UWIA 1QSOA 4MHYA 1Y7RA 4A39A 2WUUA 2A4NA 2OB0A 2ZEHA 2Z3NA 1HDQA 4FD4A 4F9UA 5F49A 1R57A 4BINA 1P4NA 2PCUA 1S7FA 4TWEA 4GXHA 4MHNA 1ZG8A 2ZENA 1QSRA 3RAMA 2I79A 4ZYQA 3EFAA 2REEA 4UCMA 3FYNA 4CAFA 3LMSA 4XPDC 2Z10A 4PV6A 5JPHA 4OIWA 1PCAA 3KHXA 2K5TA 4OMEA 4R87A 1YMEA 1VKCA 2F7VA 1L0CA 2GLFA 3W6SA 4ZY1A 4NJRA 3H8FA 3SI0A 2V77A 3D66A 3RBUA 4IK2A 3IWWA 2PR8A 1M4DA 2GANA 4MY3A 5ISVA 5D29A 2Z11A 1R3NA 2POKA 4JLYA 1QSTA 3K2KA 2AFUA 2Q0YA 4E2AA 3IU2A 1YQEA 2GREA 4XPKA 4UF4A 4YFJA 2CNTA 3IO1A 1CG2A 4JZ0A 5KTAA 2PJ0A 5HVGA 2DPSA 4R3LA 3TOAA 3GUXA 4WWVA 4GS4A 3D7DA 5F48A 3B3VA 1VGYA 2OZHA 5LRKA 4F8ZA 5HH1A 2PJ7A 3H5ZA 1X10A 2F5IA 3NH4A 4A31A 2AFZA 5AG4A 4NSQA 2R7HA 3BJ8A 4JXQA 2CXAA 4JYWA 4OAEA 4MMOA 5C82A 4JWPA 4P4DA 3SJGA 2EUIA 3N5FA 4B5PA 3RYOA 2YNEA 2PJ2A 4KOXA 5LYDA 1I12A 4Q36A 3FEEA 4H2KA 1BO4A 3SI1A 1PUAA 5A27A 4KSIA 5I0CA 2R8VA 2VEZA 1GYTA 3PB4X 1TKJA 5CPAA 5LYLA 3TCVA 2BOAA 2XEIA 2ANPA 4L89A 5EMIA 1TXRA 3SJXA 3FRMA 4MCRA 3T9YA 1CPSA 2ATRA 3QAYA 1RXTA 3D3SA 2YGWA 4A30A 4EVYA 2XEGA 4OC3A 4P4EA 1F2PA 5THWA 2FL4A 3P2FA 3PEIA 4LQ6A 3FF3A 2PJ3A 4CGOA 1F2OA 2BCOA 4C68A 2O4HA 4MFKA 1Z5RA 3S9MA 4KOSA 1Q7LA 3MGDA 1BPNA 1HDUA 2CY2A 2DXQA 3JUWA 4NGQA 4OKOA 2PJ6A 3DLJA 4PXBA 3I3GA 4YRHA 2PIZA 4NEXA 1I1DA 5IV0A 4M6IA 2JDCA 4P4IA 4P10A 3SXOA 2B3VA 4R3KA 2ODFA 3F8KA 2Z0ZA 4IAVA 1M4GA 4PK3A 2ZEGA 3GKRA 2ZW4A 2G3AA 2BO9A 3D2PA 4IF5A 5E96A 4CYOA 4RS2A 1IY7A 2Z3MA 1PYTB 2V8GA 3B3WA 5K8OA 1UWYA 3PRTA 3DR8A 1XRYA 2P6FA 3LD2A 4OC0A 4B13A 4MHPA 4QBJA 4KUBA 3D7FA 4OIDA 5JH9A 3BLNA 3FX6A 3VATA 2B4DA 4MRIA 1TF9A 2XEFA 4UFWA 2ZELA 4AVCA 2X7BA 1S7LA 1IYLA 3IIBA 3RO0A 5D8NA 4P45A 3B7IA 4KZTA 2Q43A 3PGPA 1F57A 3F5BA 2V8HA 2OH1A 4KSAA 3T90A 4B12A 4M6HA 1AMPA 1GHEA 1CJWA 3K9TA 1JWQA 3D7HA 1Z8WA 2Q4ZA 4PK2A 4X8IA 2V8DA 3VWDA 1AUGA 1XJOA 2PJ9A 2B4DB 2FE7A 4CAXA 4IHMA 4CAEA 4CAVA 3PB6X 4UFVA 4NGMA 4F0YA 3A9LA 4OC2A 2AFMA 3PB7X 2Z3KA 5F09A 3KR4A 2ARHA 4UEFA 4UIBA 4AB7A 3LODA 3L2NA 2FIAA 1IOIA 2JEVA 2BSWA 5J8FA 1WK4A 2PDOA 4CYNA 1Z2LA 2HQYA 3D67A 2Z3PA 2Q4VA 3R1KA 4FBEA 4KOWA 3H4QA 2C27A 3TFYA 4R9MA 3SJFA 2D4OA 4K30A 1ZLHA 2I00A 1YVKA 1Z9UA 4M85A 1YSJA 2VBQA 4XNHC 1ELMP 3HUVA 2PJ4A 3ISXA 1LFWA 2HUZA 3KASA 2IMOA 5LRGA 1IYKA 4ZY0A 1ARLA 3T8WA 3WT4A 4CYQA 3R95A 3EC4A 3EO4A 5A28A 3PB9X 1Z8LA 2EVNA 2Q04A 2KCWA 4R8FA 1VIXA 2RC4A 2Q7SA 3DGVA 4HPSA 4C7HA 3D2MA 2J8NA 4AXVA 1XEBA 3G3SA 4AVAA 4X5KA 4A95A 1NMTA 2B4BA 4MFLA 4RN7A 3CPXA 3EXNA 2JEWA 1Q2YA 4P4BA 2DPTA 3S9NA 2AFOA 3FEDA 1H8LA 4MCQA 4XPDB 1OZPA 2WPWA 3W6XA 2VXKA 5JQ4A 1YGHA 3R96A 4NCZA 4A38A 1B87A 3FBUA 4G1PA 3CT9A 1YR0A 3H8GA 4UCPA 2JBJA 2B58A 1XMTA 1QQ9A 4YU9A 4XPLA 5K8NA 4MCSA 5HVHA 1S5KA 4R57A 3B2YA 2JLMA 3KQXA 4KLWA 3UY5A 3BXMA 1VHEA 4CGPA 1BAVA 5C88A 4Q7AA 3TO9A 1LAMA 4ZX8A 1BLLE 4X2TA 1IOFA 2BUEA 2EK8A 2PJ1A 3NE8A 5G21A 1ELLP 3V8IA 4NJQA 4OADA 2GU2A 5AG7A 4AG9A 3S9LA 1M44A 3FVLA 1M1DA 1XE4A 2QYVA 2ZW6A 1MJ9A 2EK9A 2QMLA 2ZEPA 3D8PA 1MJBA 3IGRA 4FWUA 1TIQA 4MCPA 1MJAA 1CM0A 3N7ZA 4UA3A 3TE4A 2PR1A 1IB1E 3KGQA 2QIRA 2I3CA 5HVFA 2GLJA 4P4FA 4EMEA 3BI1A 4UBRA 4AG7A 3GYAA 4B10A 2PJ8A 4NGRA 2Q51A 1B6BA 4P6YA 4MHZA 3WC7A 2FS5A 4I49A 2J9AA 1HEEA 2WZNA 4KSFA 4FD5A 4XNHB 4FAIA 2FXFA 3I1UA 3KR5A 2G3TA 4NGTA 2ZEEA 4NF1A 4CGNA 1DE4C 4PSXA 4CRYB 4MFJA 3IEHA 4B11A 2B3UA 1CBXA 2IJZA 1ZG7A 1QMUA 1ON0A 4M3SA 2B5GB 4KUAA 4MY0A 4F0XA 3IFEA 5K8PA 3D4UA 1YREA 2QVPA 4U9ZA 3TTHA 3BI0A 1ZG9A 2Q44A 1NE9A 4UIAA 3B3CA 3P2HA 1NSLA 3V38A 3B3SA 3VARA 3KHZA 1Z4RA 3FB3A 4QVTA 4UCNA 1I21A 2OZGA 2O53A 2PJCA 2XEJA 3IWGA 1XIXA 4BD9A 3FH4A 1XFOA 3FECA 3KL9A 4UEEA 2AJ6A 2C6CA 3E0KA 2CTBA 2VZZA 2HC9A 2NMTA 1OBRA 4ONWA 4A33A 4KVOE 4KVXA 4C2ZA 2R98A 4HNYB 2PE3A 2OU2A 4ONUA 1YLOA 1Q2DA 2WPXA 4MI4A 2GE3A 2HB6A 1P0HA 3PFOA 1LRZA 4UWJA 3NA6A 4ORFA 1X12A 1JQGA 2P6GA 3B8GA 1IICA 3B35A 4C2YA 4CRZB 1XF8A 3NFZA 4H6ZA 4KS9A 3CXSA 4MFZA 4WJBA 3FXTA 5DWNA 4C2XA 4E0AA 2EBJA 3PP9A 3EY5A 3VH9A 3S6FA 3KZWA 3MRUA 4U5YA 3LACA 1CX8A 1FT7A 4P44A 2PVVA 4R7MA 3S6GA 3SJEA 5F46A 4PQAA 2VZYA 3S6KA 5I4MA 2C6GA 2G9DA 3QB8A 3MN8A 4QC6A 5LYIA 4B5OA 3JTKA 4FD7A 3PBBA 3KKWA 4HKFA 4OC4A 3F0AA 2NYQA 4JJXA 4MXUA 2PVWA 2VL1A 5K8MA 1S3ZA 3TOBA 2BL1A 3R9EA 4KVME 1RTQA 3R9FA 1RO5A 3SI2A 4H89A 1CP6A 5AGEA 4KOTA 4PPZA 2AFXA 4UEZA 4MJ8A 1SQHA 1TF8A 3TO7A 5KTCA 2PC1A 2Q7BA 3V7ZA 1IIDA 1WWZA 1LCPA 1S60A 5H86A 1QSMA 3WC5A 2YNCC 2C1CA 3D7GA 2GFQA 1TKFA 1XMBA 4II9A 3W91A 3CDXA 4BBHA 1DTDA 1Y9WA 3IWEA 3GB0A 4LQGA 2Y0MA 4DNCA 3GLJA 2G0BA 3QAHA 4Z65A 4OP4A 1UFHA 2AFWA 5IX3A 2JDDA 2FSRA 4PXCA 2YNCA 3WC6A 1KZFA 2P0WA 2VQYA 3IJ3A 5G1ZA 4KORA 5DS0A 5DWMA 1R43A 2AE6A 4R6TA 2P6EA 4ZBGA 2J8RA 4ZGYB 1KUVA 4FD6A 4CYPA 5G20A 2ZW5A 2CIJA 2ZXVA 1VHSA 1Q2CA 3NH8A 5ELYA 1Y9KA 1M4LA 5JM6A 3HLPA 4TNUA 1LAPA 2OOTA
chains in the Genus database with same CATH topology
4A32A 2ZPAA 1KUYA 4PSWA 3I9SA 4QB9A 1FY7A 4KOVA 3JVNA 1Z4EA 5KTCA 4BMHA 4UFXA 2FT0A 3TO6A 3R9GA 4IUSA 5H84A 4J3GA 4C7IA 2FIWA 1J4JA 2Z3LA 3NE7A 1K4JA 3CXPA 5KTDA 2REFA 2H5MA 2OZUA 4Y49B 4MHDA 4CS0B 4LX9A 3FNCA 2CNSA 4E8OA 1YX0A 3VWEA 2O28A 2B5GA 3IU1A 4Q38A 4Y49C 4JD6A 3SXNA 4KOUA 4L8AA 1YK3A 3C26A 3ZJ0A 2YNDA 4MFQA 2Q4YA 3CXQA 4B5PB 1QSNA 4HNXB 1YVOA 1MK4A 1V0CA 3DDDA 4RI1A 3OWCA 2J8MA 3ZZIA 4CGMA 3BJ7A 2PQ8A 4NXYA 1S7KA 4YGOA 3S6HA 4MBUA 4MFPA 1N71A 1S7NA 3FIXA 1M4IA 3SHPA 2HV2A 5CNPA 1BOBA 2QECA 3DNSA 5J8CA 3DR6A 2GIVA 3G8WA 3K9UA 4LUAA 4F6AA 2CNMA 4KOYA 4QUSA 5BWAB 5GCNA 2FCKA 1U6MA 5F47A 5IB0A 2BEIA 1YLEA 4B14A 3WR7A 5G22A 3TT2A 5EC4A 2ZW7A 4AVBA 3GY9A 4H6UA 4JXRA 4U9YA 5EBVA 4OLLA 4A2ZA 4CAWA 2D4PA 2PSWA 1KUXA 4CGLA 5HMNA 2IL4A 2Z3OA 1ZO0A 2PRBA 3DSBA 5FVJA 4HNWB 1PU9A 2R1IA 4KLVA 5AG5A 5AG6A 3PZJA 2WSAA 2VI7A 4UWIA 1QSOA 1Y7RA 2WUUA 2A4NA 2OB0A 2Z3NA 4FD4A 5F49A 1R57A 1P4NA 1S7FA 1QSRA 2I79A 3EFAA 2REEA 4UCMA 3FYNA 4CAFA 4XPDC 2Z10A 4PV6A 5JPHA 2K5TA 4R87A 3W6SA 1VKCA 1L0CA 2PR8A 1M4DA 2GANA 4MY3A 5ISVA 2Z11A 4JLYA 1QSTA 2Q0YA 4E2AA 3IU2A 4XPKA 4YFJA 2CNTA 5KTAA 2DPSA 4R3LA 3TOAA 4GS4A 5F48A 2OZHA 5HH1A 3H5ZA 2F5IA 4A31A 5AG4A 4NSQA 2R7HA 3BJ8A 4JXQA 2CXAA 4OAEA 4JWPA 2EUIA 4B5PA 3RYOA 2YNEA 4KOXA 1I12A 4Q36A 1BO4A 1PUAA 5A27A 5I0CA 2R8VA 2VEZA 3TCVA 4L89A 5A28A 3T9YA 3FRMA 2ATRA 1RXTA 3D3SA 2YGWA 4A30A 4EVYA 2FL4A 3P2FA 4CGOA 4C68A 4MFKA 4KOSA 3MGDA 2DXQA 3JUWA 2CY2A 4YRHA 3I3GA 4NEXA 1I1DA 5IV0A 2JDCA 3SXOA 2B3VA 4R3KA 3F8KA 2Z0ZA 1M4GA 4PK3A 3GKRA 2ZW4A 2G3AA 3D2PA 4IF5A 5E96A 4CYOA 4RS2A 2Z3MA 3DR8A 2P6FA 3LD2A 4B13A 4QBJA 4KUBA 3BLNA 2B4DA 4AVCA 4UFWA 2X7BA 1S7LA 1IYLA 4KZTA 3PGPA 3F5BA 4KSAA 2OH1A 3T90A 4B12A 1GHEA 1CJWA 3VWDA 4PK2A 2B4DB 2FE7A 4CAXA 4CAEA 4CAVA 4F0YA 4UFVA 3A9LA 2Z3KA 2ARHA 4AB7A 3LODA 2FIAA 2JEVA 2BSWA 5J8FA 1WK4A 2PDOA 4CYNA 2HQYA 3R1KA 2Z3PA 2Q4VA 4KOWA 3H4QA 2C27A 3TFYA 4R9MA 2D4OA 4K30A 2I00A 1YVKA 1Z9UA 4M85A 2VBQA 4XNHC 2HUZA 1IYKA 4CYQA 3R95A 3EC4A 3EO4A 2EVNA 2Q04A 2KCWA 4C7HA 2RC4A 3D2MA 2J8NA 1XEBA 3G3SA 4AVAA 4X5KA 4A95A 1NMTA 2B4BA 4MFLA 3EXNA 1Q2YA 2DPTA 4XPDB 1OZPA 2WPWA 3W6XA 2VXKA 5JQ4A 1YGHA 3R96A 4NCZA 1B87A 3FBUA 1YR0A 4UCPA 2B58A 1XMTA 4XPLA 1S5KA 4R57A 2JLMA 4KLWA 3UY5A 4CGPA 5C88A 3TO9A 2BUEA 5G21A 3V8IA 4AG9A 4OADA 5AG7A 1M44A 4FD6A 3D8PA 1M1DA 1XE4A 1MJ9A 2QMLA 2ZW6A 3IGRA 1MJBA 1TIQA 1MJAA 1CM0A 3N7ZA 4UA3A 3TE4A 2PR1A 1IB1E 2QIRA 4UBRA 4AG7A 3GYAA 4B10A 1B6BA 2FS5A 4I49A 4KSFA 4FD5A 4XNHB 2FXFA 2G3TA 4NF1A 4CGNA 4CRYB 4PSXA 4MFJA 4B11A 2B3UA 4M3SA 1ON0A 2B5GB 4KUAA 4MY0A 4F0XA 1YREA 4U9ZA 3TTHA 2Q44A 1NE9A 3P2HA 1NSLA 1Z4RA 3FB3A 4QVTA 4UCNA 1I21A 2OZGA 3IWGA 1XIXA 2AJ6A 3E0KA 2VZZA 2NMTA 4A33A 4KVOE 4KVXA 4C2ZA 2R98A 4HNYB 2OU2A 4ONUA 1Q2DA 2WPXA 4MI4A 2GE3A 1P0HA 1LRZA 4UWJA 4ORFA 2P6GA 3B8GA 1IICA 4C2YA 4CRZB 1XF8A 4H6ZA 4KS9A 3CXSA 4MFZA 5DWNA 3FXTA 4C2XA 4E0AA 3PP9A 3EY5A 3S6FA 4U5YA 3S6GA 5F46A 3S6KA 2VZYA 4QC6A 3QB8A 4B5OA 3JTKA 4FD7A 3KKWA 4HKFA 3F0AA 4JJXA 1S3ZA 3TOBA 2BL1A 3R9EA 4KVME 3R9FA 1RO5A 4H89A 5AGEA 4KOTA 4MJ8A 1SQHA 3TO7A 2PC1A 2Q7BA 1IIDA 1WWZA 1S60A 5H86A 5C82A 1QSMA 2YNCC 4II9A 3W91A 4BBHA 1Y9WA 3IWEA 2Y0MA 4DNCA 2G0BA 3QAHA 5IX3A 1UFHA 2JDDA 2FSRA 2YNCA 1KZFA 2P0WA 2VQYA 5G1ZA 4KORA 5DWMA 2AE6A 2P6EA 4ZBGA 2J8RA 4ZGYB 1KUVA 4CYPA 5G20A 2ZW5A 2ZXVA 1VHSA 1Q2CA 1Y9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPA A;  1KUY A;  4PSW A;  3I9S A;  4QB9 A;  1FY7 A;  4KOV A;  3JVN A;  1Z4E A;  5KTC A;  4BMH A;  2FT0 A;  3TO6 A;  3R9G A;  4IUS A;  5H84 A;  4J3G A;  2FIW A;  1J4J A;  3NE7 A;  1K4J A;  3CXP A;  5KTD A;  2REF A;  2H5M A;  2OZU A;  4Y49 B;  4MHD A;  4CS0 B;  4LX9 A;  3FNC A;  2CNS A;  4E8O A;  1YX0 A;  3VWE A;  2O28 A;  2B5G A;  4Y49 C;  4JD6 A;  3SXN A;  4KOU A;  4L8A A;  1YK3 A;  3C26 A;  3ZJ0 A;  2Q4Y A;  3CXQ A;  4B5P B;  1QSN A;  4HNX B;  1YVO A;  1MK4 A;  4RI1 A;  1V0C A;  3DDD A;  3OWC A;  2J8M A;  3ZZI A;  3BJ7 A;  2PQ8 A;  4NXY A;  1S7K A;  4YGO A;  3S6H A;  4MBU A;  1N71 A;  1S7N A;  3FIX A;  1M4I A;  3SHP A;  2HV2 A;  5CNP A;  1BOB A;  2QEC A;  3DNS A;  5J8C A;  3DR6 A;  2GIV A;  3G8W A;  3K9U A;  4LUA A;  4F6A A;  2CNM A;  4KOY A;  4QUS A;  5GCN A;  2FCK A;  1U6M A;  5F47 A;  5IB0 A;  2BEI A;  1YLE A;  3WR7 A;  3TT2 A;  5EC4 A;  2ZW7 A;  4AVB A;  3GY9 A;  4H6U A;  4JXR A;  4U9Y A;  5EBV A;  4OLL A;  4CAW A;  2D4P A;  2PSW A;  1KUX A;  5HMN A;  2IL4 A;  2PRB A;  3DSB A;  5FVJ A;  4HNW B;  1PU9 A;  2R1I A;  4KLV A;  3PZJ A;  2VI7 A;  4UWI A;  1QSO A;  1Y7R A;  2A4N A;  2OB0 A;  4FD4 A;  5F49 A;  1R57 A;  1P4N A;  1S7F A;  1QSR A;  2I79 A;  3EFA A;  2REE A;  3FYN A;  4XPD C;  2Z10 A;  4PV6 A;  5JPH A;  2K5T A;  4R87 A;  3W6S A;  1VKC A;  1L0C A;  2PR8 A;  1M4D A;  2GAN A;  4MY3 A;  5ISV A;  2Z11 A;  4JLY A;  1QST A;  2Q0Y A;  4E2A A;  4XPK A;  4YFJ A;  2CNT A;  5KTA A;  4R3L A;  3TOA A;  4GS4 A;  5F48 A;  2OZH A;  5HH1 A;  2F5I A;  4NSQ A;  2R7H A;  3BJ8 A;  4JXQ A;  4OAE A;  4JWP A;  2EUI A;  4B5P A;  3RYO A;  4KOX A;  1I12 A;  1BO4 A;  1PUA A;  5I0C A;  2R8V A;  2VEZ A;  3TCV A;  4L89 A;  3T9Y A;  3FRM A;  2ATR A;  1RXT A;  3D3S A;  4EVY A;  2FL4 A;  3P2F A;  4KOS A;  3MGD A;  2DXQ A;  3JUW A;  2CY2 A;  4YRH A;  3I3G A;  4NEX A;  1I1D A;  5IV0 A;  2JDC A;  3SXO A;  2B3V A;  4R3K A;  3F8K A;  2Z0Z A;  1M4G A;  4PK3 A;  3GKR A;  2ZW4 A;  2G3A A;  3D2P A;  4IF5 A;  5E96 A;  4RS2 A;  3DR8 A;  2P6F A;  3LD2 A;  4QBJ A;  4KUB A;  3BLN A;  2B4D A;  4AVC A;  2X7B A;  1S7L A;  1IYL A;  4KZT A;  3PGP A;  3F5B A;  3T90 A;  2OH1 A;  1GHE A;  1CJW A;  3VWD A;  4PK2 A;  2B4D B;  2FE7 A;  4CAX A;  4CAV A;  4F0Y A;  2ARH A;  4AB7 A;  3LOD A;  2FIA A;  2JEV A;  2BSW A;  5J8F A;  1WK4 A;  2PDO A;  2HQY A;  3R1K A;  2Q4V A;  4KOW A;  3H4Q A;  2C27 A;  3TFY A;  4R9M A;  2D4O A;  4K30 A;  2I00 A;  1YVK A;  1Z9U A;  4M85 A;  2VBQ A;  4XNH C;  2HUZ A;  1IYK A;  3R95 A;  3EC4 A;  3EO4 A;  2EVN A;  2Q04 A;  2KCW A;  2RC4 A;  3D2M A;  2J8N A;  1XEB A;  3G3S A;  4AVA A;  4X5K A;  1NMT A;  2B4B A;  3EXN A;  1Q2Y A;  4XPD B;  1OZP A;  2WPW A;  3W6X A;  2VXK A;  5JQ4 A;  1YGH A;  3R96 A;  4NCZ A;  1B87 A;  3FBU A;  1YR0 A;  2B58 A;  1XMT A;  4XPL A;  1S5K A;  4R57 A;  2JLM A;  4KLW A;  3UY5 A;  5C88 A;  3TO9 A;  2BUE A;  3V8I A;  4AG9 A;  4OAD A;  1M44 A;  3D8P A;  1M1D A;  1XE4 A;  2ZW6 A;  1MJ9 A;  2QML A;  3IGR A;  4FD6 A;  1MJB A;  1TIQ A;  1MJA A;  1CM0 A;  3N7Z A;  4UA3 A;  3TE4 A;  2PR1 A;  1IB1 E;  2QIR A;  4UBR A;  4AG7 A;  3GYA A;  1B6B A;  2FS5 A;  4I49 A;  4FD5 A;  4XNH B;  2FXF A;  2G3T A;  4NF1 A;  4CRY B;  4PSX A;  2B3U A;  4M3S A;  1ON0 A;  2B5G B;  4KUA A;  4MY0 A;  1YRE A;  4U9Z A;  3TTH A;  2Q44 A;  1NE9 A;  3P2H A;  1NSL A;  1Z4R A;  3FB3 A;  4QVT A;  1I21 A;  2OZG A;  3IWG A;  1XIX A;  2AJ6 A;  3E0K A;  2VZZ A;  2NMT A;  4KVO E;  4KVX A;  2R98 A;  4HNY B;  2OU2 A;  4ONU A;  1Q2D A;  2WPX A;  4MI4 A;  2GE3 A;  1P0H A;  1LRZ A;  4UWJ A;  4ORF A;  2P6G A;  3B8G A;  1IIC A;  4CRZ B;  1XF8 A;  4H6Z A;  3CXS A;  4E0A A;  5DWN A;  3FXT A;  3PP9 A;  3EY5 A;  3S6F A;  4U5Y A;  3S6G A;  5F46 A;  3S6K A;  2VZY A;  4QC6 A;  3QB8 A;  4B5O A;  4FD7 A;  3KKW A;  4HKF A;  3F0A A;  4JJX A;  1S3Z A;  3TOB A;  2BL1 A;  3R9E A;  4KVM E;  3R9F A;  1RO5 A;  4H89 A;  4KOT A;  4MJ8 A;  1SQH A;  3TO7 A;  2PC1 A;  2Q7B A;  1IID A;  1WWZ A;  1S60 A;  5H86 A;  5C82 A;  1QSM A;  4II9 A;  3W91 A;  1Y9W A;  2Y0M A;  4DNC A;  2G0B A;  3QAH A;  5IX3 A;  1UFH A;  2JDD A;  2FSR A;  1KZF A;  2P0W A;  2VQY A;  4KOR A;  5DWM A;  2AE6 A;  2P6E A;  4ZBG A;  2J8R A;  1KUV A;  2ZW5 A;  2ZXV A;  1VHS A;  1Q2C A;  1Y9K A; 
#chains in the Genus database with same CATH topology
 4A32 A;  2ZPA A;  1KUY A;  4PSW A;  3I9S A;  4QB9 A;  1FY7 A;  4KOV A;  3JVN A;  1Z4E A;  4F9V A;  1YW6 A;  4GM5 A;  4K3N A;  4UFX A;  2PRQ A;  2FT0 A;  3JRU A;  4NGN A;  3H8E A;  3TO6 A;  4BMH A;  3R9G A;  2CF4 A;  4OC5 A;  4NFR A;  1Z8X A;  4IUS A;  1NSA A;  1VHO A;  3ISZ A;  5H84 A;  4J3G A;  4C7I A;  2CTC A;  2FIW A;  5J1Q A;  1J4J A;  2Z3L A;  3FMC A;  3NE7 A;  1K4J A;  2RFH A;  4X3R A;  5JGF A;  3CXP A;  5KTD A;  2REF A;  2H5M A;  2OZU A;  4PXD A;  4Y49 B;  2DEA A;  1XOV A;  4MHD A;  4ZI6 A;  4DJL A;  1Y0Y A;  4CS0 B;  2JBK A;  4LX9 A;  3PB8 X;  3FNC A;  2CNS A;  4E8O A;  1AYE A;  1YX0 A;  3VWE A;  2O28 A;  2B5G A;  4DYO A;  5IB9 A;  3IU1 A;  4Q38 A;  3CZX A;  4Y49 C;  4PXE A;  4JD6 A;  3SXN A;  4KOU A;  3FJU A;  4L8A A;  1YK3 A;  4A94 A;  4A37 A;  2ZOF A;  3BHX A;  1ZLI A;  3C26 A;  3ZJ0 A;  2YND A;  4EFD A;  1XBU A;  1YW4 A;  2EO8 A;  4MFQ A;  1Z8T A;  2PIY A;  2Q4Y A;  3CXQ A;  2F8H A;  1TKH A;  4B5P B;  1QSN A;  4HNX B;  2C6P A;  1YVO A;  3RNZ A;  5HXD A;  1MK4 A;  1V0C A;  3DDD A;  4RI1 A;  3OWC A;  2J8M A;  2NSM A;  3ZZI A;  3BJ7 A;  3D68 A;  2PQ8 A;  4NXY A;  4OC1 A;  1S7K A;  1FNO A;  4YGO A;  3RZA A;  3S6H A;  4MBU A;  4MFP A;  1N71 A;  1S7N A;  3FIX A;  1M4I A;  4NGP A;  3SHP A;  2HV2 A;  3PBE A;  4P4J A;  5CNP A;  3WAB A;  1BOB A;  4EWT A;  2QEC A;  3DNS A;  5J8C A;  3DR6 A;  4FUU A;  2DF5 A;  4R76 A;  2GIV A;  2ZEM A;  4YWY A;  1KWM A;  3NH5 A;  1CP7 A;  3G8W A;  3GIU A;  2PJB A;  3K9U A;  4LUA A;  1BPM A;  3TC8 A;  3TX8 A;  1IU8 A;  2ZOG A;  6CPA A;  3KQZ A;  2EWB A;  4M6G A;  4F6A A;  2CNM A;  3CPA A;  2ZED A;  4ZX9 A;  2QJ8 A;  2IQ6 A;  4NGS A;  4KOY A;  4QUS A;  1ARM A;  5BWA B;  5LYF A;  4O23 A;  3LWU A;  5GCN A;  5LRJ A;  4DUK A;  2ZEF A;  2FCK A;  2PJ5 A;  2V8V A;  1U6M A;  2ABZ A;  3IC1 A;  5F47 A;  4RUH A;  2ZEO A;  5IB0 A;  2BEI A;  4CGM A;  1Y0R A;  1YLE A;  4ZY2 A;  4B14 A;  3WR7 A;  5G22 A;  3TT2 A;  5EC4 A;  2ZW7 A;  3QNV A;  1EE3 P;  5CBM A;  2OR4 A;  4AVB A;  4B6Z A;  2PJA A;  3GY9 A;  8CPA A;  2WYR A;  1IGB A;  4H6U A;  4JXR A;  4U9Y A;  5EBV A;  4OLL A;  4A2Z A;  2FVG A;  1LAN A;  4CAW A;  2D4P A;  2PSW A;  1KUX A;  4CGL A;  5HMN A;  2IL4 A;  7CPA A;  2Z3O A;  3B3T A;  1ZO0 A;  3PFE A;  2AFS A;  2PRB A;  3DSB A;  5FVJ A;  2RB7 A;  4HNW B;  4CPA A;  1PU9 A;  2R1I A;  4KLV A;  1A2Z A;  1LOK A;  5AG6 A;  3KI9 A;  3PZJ A;  5AG5 A;  4W9Y A;  2WSA A;  2VI7 A;  1CPX A;  1Y7E A;  4UWI A;  1QSO A;  4MHY A;  1Y7R A;  4A39 A;  2WUU A;  2A4N A;  2OB0 A;  2ZEH A;  2Z3N A;  1HDQ A;  4FD4 A;  4F9U A;  5F49 A;  1R57 A;  4BIN A;  1P4N A;  2PCU A;  1S7F A;  4TWE A;  4GXH A;  4MHN A;  1ZG8 A;  2ZEN A;  1QSR A;  3RAM A;  2I79 A;  4ZYQ A;  3EFA A;  2REE A;  4UCM A;  3FYN A;  4CAF A;  3LMS A;  4XPD C;  2Z10 A;  4PV6 A;  5JPH A;  4OIW A;  1PCA A;  3KHX A;  2K5T A;  4OME A;  4R87 A;  1YME A;  1VKC A;  2F7V A;  1L0C A;  2GLF A;  3W6S A;  4ZY1 A;  4NJR A;  3H8F A;  3SI0 A;  2V77 A;  3D66 A;  3RBU A;  4IK2 A;  3IWW A;  2PR8 A;  1M4D A;  2GAN A;  4MY3 A;  5ISV A;  5D29 A;  2Z11 A;  1R3N A;  2POK A;  4JLY A;  1QST A;  3K2K A;  2AFU A;  2Q0Y A;  4E2A A;  3IU2 A;  1YQE A;  2GRE A;  4XPK A;  4UF4 A;  4YFJ A;  2CNT A;  3IO1 A;  1CG2 A;  4JZ0 A;  5KTA A;  2PJ0 A;  5HVG A;  2DPS A;  4R3L A;  3TOA A;  3GUX A;  4WWV A;  4GS4 A;  3D7D A;  5F48 A;  3B3V A;  1VGY A;  2OZH A;  5LRK A;  4F8Z A;  5HH1 A;  2PJ7 A;  3H5Z A;  1X10 A;  2F5I A;  3NH4 A;  4A31 A;  2AFZ A;  5AG4 A;  4NSQ A;  2R7H A;  3BJ8 A;  4JXQ A;  2CXA A;  4JYW A;  4OAE A;  4MMO A;  5C82 A;  4JWP A;  4P4D A;  3SJG A;  2EUI A;  3N5F A;  4B5P A;  3RYO A;  2YNE A;  2PJ2 A;  4KOX A;  5LYD A;  1I12 A;  4Q36 A;  3FEE A;  4H2K A;  1BO4 A;  3SI1 A;  1PUA A;  5A27 A;  4KSI A;  5I0C A;  2R8V A;  2VEZ A;  1GYT A;  3PB4 X;  1TKJ A;  5CPA A;  5LYL A;  3TCV A;  2BOA A;  2XEI A;  2ANP A;  4L89 A;  5EMI A;  1TXR A;  3SJX A;  3FRM A;  4MCR A;  3T9Y A;  1CPS A;  2ATR A;  3QAY A;  1RXT A;  3D3S A;  2YGW A;  4A30 A;  4EVY A;  2XEG A;  4OC3 A;  4P4E A;  1F2P A;  5THW A;  2FL4 A;  3P2F A;  3PEI A;  4LQ6 A;  3FF3 A;  2PJ3 A;  4CGO A;  1F2O A;  2BCO A;  4C68 A;  2O4H A;  4MFK A;  1Z5R A;  3S9M A;  4KOS A;  1Q7L A;  3MGD A;  1BPN A;  1HDU A;  2CY2 A;  2DXQ A;  3JUW A;  4NGQ A;  4OKO A;  2PJ6 A;  3DLJ A;  4PXB A;  3I3G A;  4YRH A;  2PIZ A;  4NEX A;  1I1D A;  5IV0 A;  4M6I A;  2JDC A;  4P4I A;  4P10 A;  3SXO A;  2B3V A;  4R3K A;  2ODF A;  3F8K A;  2Z0Z A;  4IAV A;  1M4G A;  4PK3 A;  2ZEG A;  3GKR A;  2ZW4 A;  2G3A A;  2BO9 A;  3D2P A;  4IF5 A;  5E96 A;  4CYO A;  4RS2 A;  1IY7 A;  2Z3M A;  1PYT B;  2V8G A;  3B3W A;  5K8O A;  1UWY A;  3PRT A;  3DR8 A;  1XRY A;  2P6F A;  3LD2 A;  4OC0 A;  4B13 A;  4MHP A;  4QBJ A;  4KUB A;  3D7F A;  4OID A;  5JH9 A;  3BLN A;  3FX6 A;  3VAT A;  2B4D A;  4MRI A;  1TF9 A;  2XEF A;  4UFW A;  2ZEL A;  4AVC A;  2X7B A;  1S7L A;  1IYL A;  3IIB A;  3RO0 A;  5D8N A;  4P45 A;  3B7I A;  4KZT A;  2Q43 A;  3PGP A;  1F57 A;  3F5B A;  2V8H A;  2OH1 A;  4KSA A;  3T90 A;  4B12 A;  4M6H A;  1AMP A;  1GHE A;  1CJW A;  3K9T A;  1JWQ A;  3D7H A;  1Z8W A;  2Q4Z A;  4PK2 A;  4X8I A;  2V8D A;  3VWD A;  1AUG A;  1XJO A;  2PJ9 A;  2B4D B;  2FE7 A;  4CAX A;  4IHM A;  4CAE A;  4CAV A;  3PB6 X;  4UFV A;  4NGM A;  4F0Y A;  3A9L A;  4OC2 A;  2AFM A;  3PB7 X;  2Z3K A;  5F09 A;  3KR4 A;  2ARH A;  4UEF A;  4UIB A;  4AB7 A;  3LOD A;  3L2N A;  2FIA A;  1IOI A;  2JEV A;  2BSW A;  5J8F A;  1WK4 A;  2PDO A;  4CYN A;  1Z2L A;  2HQY A;  3D67 A;  2Z3P A;  2Q4V A;  3R1K A;  4FBE A;  4KOW A;  3H4Q A;  2C27 A;  3TFY A;  4R9M A;  3SJF A;  2D4O A;  4K30 A;  1ZLH A;  2I00 A;  1YVK A;  1Z9U A;  4M85 A;  1YSJ A;  2VBQ A;  4XNH C;  1ELM P;  3HUV A;  2PJ4 A;  3ISX A;  1LFW A;  2HUZ A;  3KAS A;  2IMO A;  5LRG A;  1IYK A;  4ZY0 A;  1ARL A;  3T8W A;  3WT4 A;  4CYQ A;  3R95 A;  3EC4 A;  3EO4 A;  5A28 A;  3PB9 X;  1Z8L A;  2EVN A;  2Q04 A;  2KCW A;  4R8F A;  1VIX A;  2RC4 A;  2Q7S A;  3DGV A;  4HPS A;  4C7H A;  3D2M A;  2J8N A;  4AXV A;  1XEB A;  3G3S A;  4AVA A;  4X5K A;  4A95 A;  1NMT A;  2B4B A;  4MFL A;  4RN7 A;  3CPX A;  3EXN A;  2JEW A;  1Q2Y A;  4P4B A;  2DPT A;  3S9N A;  2AFO A;  3FED A;  1H8L A;  4MCQ A;  4XPD B;  1OZP A;  2WPW A;  3W6X A;  2VXK A;  5JQ4 A;  1YGH A;  3R96 A;  4NCZ A;  4A38 A;  1B87 A;  3FBU A;  4G1P A;  3CT9 A;  1YR0 A;  3H8G A;  4UCP A;  2JBJ A;  2B58 A;  1XMT A;  1QQ9 A;  4YU9 A;  4XPL A;  5K8N A;  4MCS A;  5HVH A;  1S5K A;  4R57 A;  3B2Y A;  2JLM A;  3KQX A;  4KLW A;  3UY5 A;  3BXM A;  1VHE A;  4CGP A;  1BAV A;  5C88 A;  4Q7A A;  3TO9 A;  1LAM A;  4ZX8 A;  1BLL E;  4X2T A;  1IOF A;  2BUE A;  2EK8 A;  2PJ1 A;  3NE8 A;  5G21 A;  1ELL P;  3V8I A;  4NJQ A;  4OAD A;  2GU2 A;  5AG7 A;  4AG9 A;  3S9L A;  1M44 A;  3FVL A;  1M1D A;  1XE4 A;  2QYV A;  2ZW6 A;  1MJ9 A;  2EK9 A;  2QML A;  2ZEP A;  3D8P A;  1MJB A;  3IGR A;  4FWU A;  1TIQ A;  4MCP A;  1MJA A;  1CM0 A;  3N7Z A;  4UA3 A;  3TE4 A;  2PR1 A;  1IB1 E;  3KGQ A;  2QIR A;  2I3C A;  5HVF A;  2GLJ A;  4P4F A;  4EME A;  3BI1 A;  4UBR A;  4AG7 A;  3GYA A;  4B10 A;  2PJ8 A;  4NGR A;  2Q51 A;  1B6B A;  4P6Y A;  4MHZ A;  3WC7 A;  2FS5 A;  4I49 A;  2J9A A;  1HEE A;  2WZN A;  4KSF A;  4FD5 A;  4XNH B;  4FAI A;  2FXF A;  3I1U A;  3KR5 A;  2G3T A;  4NGT A;  2ZEE A;  4NF1 A;  4CGN A;  1DE4 C;  4PSX A;  4CRY B;  4MFJ A;  3IEH A;  4B11 A;  2B3U A;  1CBX A;  2IJZ A;  1ZG7 A;  1QMU A;  1ON0 A;  4M3S A;  2B5G B;  4KUA A;  4MY0 A;  4F0X A;  3IFE A;  5K8P A;  3D4U A;  1YRE A;  2QVP A;  4U9Z A;  3TTH A;  3BI0 A;  1ZG9 A;  2Q44 A;  1NE9 A;  4UIA A;  3B3C A;  3P2H A;  1NSL A;  3V38 A;  3B3S A;  3VAR A;  3KHZ A;  1Z4R A;  3FB3 A;  4QVT A;  4UCN A;  1I21 A;  2OZG A;  2O53 A;  2PJC A;  2XEJ A;  3IWG A;  1XIX A;  4BD9 A;  3FH4 A;  1XFO A;  3FEC A;  3KL9 A;  4UEE A;  2AJ6 A;  2C6C A;  3E0K A;  2CTB A;  2VZZ A;  2HC9 A;  2NMT A;  1OBR A;  4ONW A;  4A33 A;  4KVO E;  4KVX A;  4C2Z A;  2R98 A;  4HNY B;  2PE3 A;  2OU2 A;  4ONU A;  1YLO A;  1Q2D A;  2WPX A;  4MI4 A;  2GE3 A;  2HB6 A;  1P0H A;  3PFO A;  1LRZ A;  4UWJ A;  3NA6 A;  4ORF A;  1X12 A;  1JQG A;  2P6G A;  3B8G A;  1IIC A;  3B35 A;  4C2Y A;  4CRZ B;  1XF8 A;  3NFZ A;  4H6Z A;  4KS9 A;  3CXS A;  4MFZ A;  4WJB A;  3FXT A;  5DWN A;  4C2X A;  4E0A A;  2EBJ A;  3PP9 A;  3EY5 A;  3VH9 A;  3S6F A;  3KZW A;  3MRU A;  4U5Y A;  3LAC A;  1CX8 A;  1FT7 A;  4P44 A;  2PVV A;  4R7M A;  3S6G A;  3SJE A;  5F46 A;  4PQA A;  2VZY A;  3S6K A;  5I4M A;  2C6G A;  2G9D A;  3QB8 A;  3MN8 A;  4QC6 A;  5LYI A;  4B5O A;  3JTK A;  4FD7 A;  3PBB A;  3KKW A;  4HKF A;  4OC4 A;  3F0A A;  2NYQ A;  4JJX A;  4MXU A;  2PVW A;  2VL1 A;  5K8M A;  1S3Z A;  3TOB A;  2BL1 A;  3R9E A;  4KVM E;  1RTQ A;  3R9F A;  1RO5 A;  3SI2 A;  4H89 A;  1CP6 A;  5AGE A;  4KOT A;  4PPZ A;  2AFX A;  4UEZ A;  4MJ8 A;  1SQH A;  1TF8 A;  3TO7 A;  5KTC A;  2PC1 A;  2Q7B A;  3V7Z A;  1IID A;  1WWZ A;  1LCP A;  1S60 A;  5H86 A;  1QSM A;  3WC5 A;  2YNC C;  2C1C A;  3D7G A;  2GFQ A;  1TKF A;  1XMB A;  4II9 A;  3W91 A;  3CDX A;  4BBH A;  1DTD A;  1Y9W A;  3IWE A;  3GB0 A;  4LQG A;  2Y0M A;  4DNC A;  3GLJ A;  2G0B A;  3QAH A;  4Z65 A;  4OP4 A;  1UFH A;  2AFW A;  5IX3 A;  2JDD A;  2FSR A;  4PXC A;  2YNC A;  3WC6 A;  1KZF A;  2P0W A;  2VQY A;  3IJ3 A;  5G1Z A;  4KOR A;  5DS0 A;  5DWM A;  1R43 A;  2AE6 A;  4R6T A;  2P6E A;  4ZBG A;  2J8R A;  4ZGY B;  1KUV A;  4FD6 A;  4CYP A;  5G20 A;  2ZW5 A;  2CIJ A;  2ZXV A;  1VHS A;  1Q2C A;  3NH8 A;  5ELY A;  1Y9K A;  1M4L A;  5JM6 A;  3HLP A;  4TNU A;  1LAP A;  2OOT A; 
#chains in the Genus database with same CATH homology
 4A32 A;  2ZPA A;  1KUY A;  4PSW A;  3I9S A;  4QB9 A;  1FY7 A;  4KOV A;  3JVN A;  1Z4E A;  5KTC A;  4BMH A;  4UFX A;  2FT0 A;  3TO6 A;  3R9G A;  4IUS A;  5H84 A;  4J3G A;  4C7I A;  2FIW A;  1J4J A;  2Z3L A;  3NE7 A;  1K4J A;  3CXP A;  5KTD A;  2REF A;  2H5M A;  2OZU A;  4Y49 B;  4MHD A;  4CS0 B;  4LX9 A;  3FNC A;  2CNS A;  4E8O A;  1YX0 A;  3VWE A;  2O28 A;  2B5G A;  3IU1 A;  4Q38 A;  4Y49 C;  4JD6 A;  3SXN A;  4KOU A;  4L8A A;  1YK3 A;  3C26 A;  3ZJ0 A;  2YND A;  4MFQ A;  2Q4Y A;  3CXQ A;  4B5P B;  1QSN A;  4HNX B;  1YVO A;  1MK4 A;  1V0C A;  3DDD A;  4RI1 A;  3OWC A;  2J8M A;  3ZZI A;  4CGM A;  3BJ7 A;  2PQ8 A;  4NXY A;  1S7K A;  4YGO A;  3S6H A;  4MBU A;  4MFP A;  1N71 A;  1S7N A;  3FIX A;  1M4I A;  3SHP A;  2HV2 A;  5CNP A;  1BOB A;  2QEC A;  3DNS A;  5J8C A;  3DR6 A;  2GIV A;  3G8W A;  3K9U A;  4LUA A;  4F6A A;  2CNM A;  4KOY A;  4QUS A;  5BWA B;  5GCN A;  2FCK A;  1U6M A;  5F47 A;  5IB0 A;  2BEI A;  1YLE A;  4B14 A;  3WR7 A;  5G22 A;  3TT2 A;  5EC4 A;  2ZW7 A;  4AVB A;  3GY9 A;  4H6U A;  4JXR A;  4U9Y A;  5EBV A;  4OLL A;  4A2Z A;  4CAW A;  2D4P A;  2PSW A;  1KUX A;  4CGL A;  5HMN A;  2IL4 A;  2Z3O A;  1ZO0 A;  2PRB A;  3DSB A;  5FVJ A;  4HNW B;  1PU9 A;  2R1I A;  4KLV A;  5AG5 A;  5AG6 A;  3PZJ A;  2WSA A;  2VI7 A;  4UWI A;  1QSO A;  1Y7R A;  2WUU A;  2A4N A;  2OB0 A;  2Z3N A;  4FD4 A;  5F49 A;  1R57 A;  1P4N A;  1S7F A;  1QSR A;  2I79 A;  3EFA A;  2REE A;  4UCM A;  3FYN A;  4CAF A;  4XPD C;  2Z10 A;  4PV6 A;  5JPH A;  2K5T A;  4R87 A;  3W6S A;  1VKC A;  1L0C A;  2PR8 A;  1M4D A;  2GAN A;  4MY3 A;  5ISV A;  2Z11 A;  4JLY A;  1QST A;  2Q0Y A;  4E2A A;  3IU2 A;  4XPK A;  4YFJ A;  2CNT A;  5KTA A;  2DPS A;  4R3L A;  3TOA A;  4GS4 A;  5F48 A;  2OZH A;  5HH1 A;  3H5Z A;  2F5I A;  4A31 A;  5AG4 A;  4NSQ A;  2R7H A;  3BJ8 A;  4JXQ A;  2CXA A;  4OAE A;  4JWP A;  2EUI A;  4B5P A;  3RYO A;  2YNE A;  4KOX A;  1I12 A;  4Q36 A;  1BO4 A;  1PUA A;  5A27 A;  5I0C A;  2R8V A;  2VEZ A;  3TCV A;  4L89 A;  5A28 A;  3T9Y A;  3FRM A;  2ATR A;  1RXT A;  3D3S A;  2YGW A;  4A30 A;  4EVY A;  2FL4 A;  3P2F A;  4CGO A;  4C68 A;  4MFK A;  4KOS A;  3MGD A;  2DXQ A;  3JUW A;  2CY2 A;  4YRH A;  3I3G A;  4NEX A;  1I1D A;  5IV0 A;  2JDC A;  3SXO A;  2B3V A;  4R3K A;  3F8K A;  2Z0Z A;  1M4G A;  4PK3 A;  3GKR A;  2ZW4 A;  2G3A A;  3D2P A;  4IF5 A;  5E96 A;  4CYO A;  4RS2 A;  2Z3M A;  3DR8 A;  2P6F A;  3LD2 A;  4B13 A;  4QBJ A;  4KUB A;  3BLN A;  2B4D A;  4AVC A;  4UFW A;  2X7B A;  1S7L A;  1IYL A;  4KZT A;  3PGP A;  3F5B A;  4KSA A;  2OH1 A;  3T90 A;  4B12 A;  1GHE A;  1CJW A;  3VWD A;  4PK2 A;  2B4D B;  2FE7 A;  4CAX A;  4CAE A;  4CAV A;  4F0Y A;  4UFV A;  3A9L A;  2Z3K A;  2ARH A;  4AB7 A;  3LOD A;  2FIA A;  2JEV A;  2BSW A;  5J8F A;  1WK4 A;  2PDO A;  4CYN A;  2HQY A;  3R1K A;  2Z3P A;  2Q4V A;  4KOW A;  3H4Q A;  2C27 A;  3TFY A;  4R9M A;  2D4O A;  4K30 A;  2I00 A;  1YVK A;  1Z9U A;  4M85 A;  2VBQ A;  4XNH C;  2HUZ A;  1IYK A;  4CYQ A;  3R95 A;  3EC4 A;  3EO4 A;  2EVN A;  2Q04 A;  2KCW A;  4C7H A;  2RC4 A;  3D2M A;  2J8N A;  1XEB A;  3G3S A;  4AVA A;  4X5K A;  4A95 A;  1NMT A;  2B4B A;  4MFL A;  3EXN A;  1Q2Y A;  2DPT A;  4XPD B;  1OZP A;  2WPW A;  3W6X A;  2VXK A;  5JQ4 A;  1YGH A;  3R96 A;  4NCZ A;  1B87 A;  3FBU A;  1YR0 A;  4UCP A;  2B58 A;  1XMT A;  4XPL A;  1S5K A;  4R57 A;  2JLM A;  4KLW A;  3UY5 A;  4CGP A;  5C88 A;  3TO9 A;  2BUE A;  5G21 A;  3V8I A;  4AG9 A;  4OAD A;  5AG7 A;  1M44 A;  4FD6 A;  3D8P A;  1M1D A;  1XE4 A;  1MJ9 A;  2QML A;  2ZW6 A;  3IGR A;  1MJB A;  1TIQ A;  1MJA A;  1CM0 A;  3N7Z A;  4UA3 A;  3TE4 A;  2PR1 A;  1IB1 E;  2QIR A;  4UBR A;  4AG7 A;  3GYA A;  4B10 A;  1B6B A;  2FS5 A;  4I49 A;  4KSF A;  4FD5 A;  4XNH B;  2FXF A;  2G3T A;  4NF1 A;  4CGN A;  4CRY B;  4PSX A;  4MFJ A;  4B11 A;  2B3U A;  4M3S A;  1ON0 A;  2B5G B;  4KUA A;  4MY0 A;  4F0X A;  1YRE A;  4U9Z A;  3TTH A;  2Q44 A;  1NE9 A;  3P2H A;  1NSL A;  1Z4R A;  3FB3 A;  4QVT A;  4UCN A;  1I21 A;  2OZG A;  3IWG A;  1XIX A;  2AJ6 A;  3E0K A;  2VZZ A;  2NMT A;  4A33 A;  4KVO E;  4KVX A;  4C2Z A;  2R98 A;  4HNY B;  2OU2 A;  4ONU A;  1Q2D A;  2WPX A;  4MI4 A;  2GE3 A;  1P0H A;  1LRZ A;  4UWJ A;  4ORF A;  2P6G A;  3B8G A;  1IIC A;  4C2Y A;  4CRZ B;  1XF8 A;  4H6Z A;  4KS9 A;  3CXS A;  4MFZ A;  5DWN A;  3FXT A;  4C2X A;  4E0A A;  3PP9 A;  3EY5 A;  3S6F A;  4U5Y A;  3S6G A;  5F46 A;  3S6K A;  2VZY A;  4QC6 A;  3QB8 A;  4B5O A;  3JTK A;  4FD7 A;  3KKW A;  4HKF A;  3F0A A;  4JJX A;  1S3Z A;  3TOB A;  2BL1 A;  3R9E A;  4KVM E;  3R9F A;  1RO5 A;  4H89 A;  5AGE A;  4KOT A;  4MJ8 A;  1SQH A;  3TO7 A;  2PC1 A;  2Q7B A;  1IID A;  1WWZ A;  1S60 A;  5H86 A;  5C82 A;  1QSM A;  2YNC C;  4II9 A;  3W91 A;  4BBH A;  1Y9W A;  3IWE A;  2Y0M A;  4DNC A;  2G0B A;  3QAH A;  5IX3 A;  1UFH A;  2JDD A;  2FSR A;  2YNC A;  1KZF A;  2P0W A;  2VQY A;  5G1Z A;  4KOR A;  5DWM A;  2AE6 A;  2P6E A;  4ZBG A;  2J8R A;  4ZGY B;  1KUV A;  4CYP A;  5G20 A;  2ZW5 A;  2ZXV A;  1VHS A;  1Q2C A;  1Y9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...