2F5IA

X-ray structure of spermidine/spermine n1-acetyltransferase (sat) from homo sapiens
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
167
structure length
167
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 39
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2f5iA00
4PV6A 2OZHA 4R9MA 5F49A 3R1KA 4DNCA 4KOWA 3QB8A 5CNPA 1MJ9A 2ZXVA 4R87A 4U5YA 2B4BA 4AG7A 3JVNA 2Q0YA 3LODA 4PK2A 2I79A 1U6MA 4AVAA 4ORFA 2PR8A 4X5KA 2OU2A 1PUAA 2F5IA 2B3UA 1J4JA 1CJWA 1M1DA 3I3GA 4KVOE 4Y49C 3B8GA 1Y7RA 5J8CA 1K4JA 4MJ8A 3DR6A 4NSQA 2REEA 1P4NA 2WPWA 4KOYA 2FT0A 3FBUA 1MJAA 4RS2A 4XPKA 2JDCA 2P6FA 4JLYA 1YK3A 4HNXB 2ZW4A 3E0KA 2C27A 3GKRA 4CRZB 1XIXA 1IYKA 4Y49B 1GHEA 4H6ZA 3DNSA 1PU9A 3RYOA 4PK3A 4QVTA 3VWEA 4KUAA 2PQ8A 3PZJA 3W6XA 3TTHA 4LX9A 3UY5A 1S3ZA 2D4PA 1BOBA 1QSMA 1YLEA 2Q04A 3S6GA 2VXKA 1S7FA 4UA3A 5DWNA 3ZZIA 5GCNA 4K30A 4XPDB 5JPHA 4QBJA 3K9UA 5EC4A 2CNMA 3IGRA 4JD6A 5HH1A 1XEBA 4XPLA 5JQ4A 1KUYA 2ATRA 3GY9A 1YREA 4XNHB 2R1IA 3D3SA 5HMNA 4UWIA 2PC1A 4F0YA 3CXPA 2ZW5A 1IYLA 2JDDA 2ZPAA 3BJ7A 4OADA 2HV2A 2FE7A 5J8FA 1CM0A 2R7HA 4FD6A 2B5GA 3EC4A 2AE6A 4IF5A 5C82A 4NXYA 3TO9A 2HUZA 5DWMA 4I49A 3LD2A 2OB0A 4B5OA 3TO7A 3TE4A 4OAEA 2JLMA 3DDDA 2GE3A 3FNCA 3TOAA 2PSWA 1KZFA 1RO5A 2JEVA 4CAWA 1B87A 3EY5A 1BO4A 3FYNA 5KTCA 4H89A 4KZTA 1Z9UA 2J8NA 3EXNA 2Q4YA 3W6SA 1M44A 3F8KA 2VBQA 2P6GA 1I21A 3P2FA 4L8AA 2R98A 1LRZA 4FD5A 3V8IA 1YVKA 2B58A 4KOUA 1M4IA 2FL4A 4KLWA 4KUBA 1Z4EA 1Q2DA 5ISVA 3FRMA 4AB7A 1IB1E 2EUIA 2PR1A 3F5BA 2CNSA 1NMTA 3R96A 4KOVA 2B4DB 5KTAA 3FXTA 3SHPA 5EBVA 2X7BA 4MY3A 2Z11A 3BJ8A 2FCKA 2EVNA 2D4OA 3KKWA 3F0AA 4ZBGA 2I00A 2QIRA 3CXQA 5FVJA 4KVXA 2ZW7A 4KORA 1Q2YA 3TOBA 4MI4A 2P6EA 1S7LA 3TO6A 2G3AA 4LUAA 3PGPA 1TIQA 2J8MA 3WR7A 4U9YA 2Q7BA 3G3SA 2BUEA 1WK4A 4KOTA 1FY7A 1P0HA 5IX3A 3SXOA 3EO4A 2H5MA 1UFHA 4CRYB 4EVYA 2VZZA 4H6UA 1Y9WA 2FXFA 4UBRA 2BEIA 3VWDA 2VI7A 1XMTA 4AG9A 4YRHA 4NEXA 2VQYA 2PRBA 2VEZA 3DSBA 3R9GA 5C88A 3I9SA 2BL1A 2VZYA 2WPXA 1L0CA 1SQHA 4CAVA 2OZUA 2REFA 4M85A 4AVCA 4JWPA 1S5KA 2B4DA 4QC6A 1NE9A 2QECA 5IB0A 2QMLA 5IV0A 3S6KA 1S60A 2HQYA 3NE7A 4QUSA 4PSWA 1MK4A 3G8WA 4QB9A 3QAHA 5F47A 1WWZA 2R8VA 2GIVA 4E2AA 2NMTA 4HNYB 1KUXA 1I12A 2OZGA 2BSWA 2A4NA 4NF1A 1RXTA 2KCWA 3FIXA 1QSRA 4R3LA 2ARHA 3JUWA 4UWJA 4FD4A 2RC4A 3R9EA 5I0CA 3FB3A 4B5PA 3C26A 1NSLA 3R95A 4YFJA 3T9YA 4R3KA 2Z0ZA 2Y0MA 4MY0A 4MBUA 1YR0A 4J3GA 4KOSA 4XNHC 3R9FA 4BMHA 4MHDA 3S6FA 1VKCA 5H86A 4II9A 4B5PB 4R57A 1OZPA 1XE4A 4RI1A 3GYAA 2FIAA 3OWCA 4HNWB 4HKFA 3ZJ0A 4JXQA 5F48A 4XPDC 2ZW6A 3N7ZA 5F46A 2J8RA 1V0CA 1Y9KA 4F6AA 2GANA 3CXSA 4KLVA 4ONUA 5E96A 1MJBA 1IICA 4YGOA 1QSNA 1ON0A 3SXNA 2FSRA 4IUSA 1QSOA 1IIDA 3EFAA 3IWGA 3W91A 2P0WA 3T90A 1S7NA 3S6HA 4CAXA 4FD7A 4E0AA 2Q4VA 3PP9A 1S7KA 2CNTA 4NCZA 2Z10A 4KVME 4PSXA 3TCVA 1YVOA 1QSTA 3P2HA 2FS5A 4L89A 2DXQA 2CY2A 1YGHA 3D2MA 3D8PA 1M4DA 4JXRA 4U9ZA 3TT2A 2K5TA 1VHSA 2AJ6A 4E8OA 1YX0A 2G0BA 4M3SA 5KTDA 4OLLA 1I1DA 3DR8A 2B3VA 2G3TA 1N71A 2B5GB 2Q44A 4KOXA 1Q2CA 2PDOA 3TFYA 5H84A 3D2PA 1M4GA 2O28A 3BLNA 1R57A 4CS0B 4GS4A 3H4QA 1Z4RA 2IL4A 2OH1A 2FIWA 4AVBA 3MGDA 1KUVA 4JJXA 1XF8A 1B6BA
chains in the Genus database with same CATH superfamily
4PV6A 2OZHA 4R9MA 5F49A 3KQZA 2IQ6A 3R1KA 3D7DA 3S9MA 4DNCA 4F8ZA 1CX8A 4KOWA 4UEZA 2DPTA 3CZXA 2NSMA 3QB8A 3NH5A 3CDXA 5CNPA 1MJ9A 1IOIA 2ZXVA 4R87A 4OMEA 4U5YA 2B4BA 4AG7A 4A2ZA 2NYQA 4ZY0A 3JVNA 4UEEA 2Q0YA 3SI2A 3LODA 4PK2A 4RN7A 2I79A 4X2TA 5K8PA 4P44A 1U6MA 4AVAA 4ORFA 2CXAA 2PR8A 4X5KA 5AG4A 4MXUA 2OU2A 4TNUA 4A31A 1PUAA 4C2XA 4MRIA 5BWAB 2F5IA 4CPAA 5J1QA 2B3UA 1J4JA 2EK9A 3RZAA 1LFWA 1CJWA 1M1DA 3LMSA 3I3GA 4KVOE 4CGNA 4Y49C 3B8GA 1Y7RA 3I1UA 5J8CA 5LRJA 4KSIA 1K4JA 4MJ8A 4CAEA 3DR6A 1LANA 4NSQA 2REEA 4NGSA 1P4NA 4C2ZA 2GLJA 2WPWA 2Z3OA 1H8LA 1PYTB 5AG5A 4KOYA 2FT0A 3PFOA 1Z8LA 4GM5A 3SI0A 3FBUA 1MJAA 7CPAA 4RS2A 3B3VA 1JQGA 4CYNA 4XPKA 4EMEA 1CPSA 4NGTA 2JDCA 2P6FA 1HEEA 2I3CA 4HPSA 4JLYA 5DS0A 1YK3A 4NGQA 1TKFA 4HNXB 4MHZA 1FT7A 2ZW4A 3E0KA 4P4BA 4CAFA 4LQ6A 1Y0RA 2V8HA 2C27A 4YU9A 3GKRA 1LAMA 1YW6A 4CRZB 1XIXA 4B6ZA 1IYKA 2PJBA 3PB7X 1VHEA 2OR4A 4P10A 4Y49B 1GHEA 4H6ZA 1Y7EA 1IY7A 3HUVA 4MCSA 3DNSA 1PU9A 3RYOA 4PK3A 4QVTA 4NGPA 4KUAA 3VWEA 2PQ8A 4ONWA 3PZJA 3IC1A 2PJ2A 3MN8A 2YNCC 3TTHA 3W6XA 2DEAA 4BINA 5LYFA 2IJZA 4LX9A 4ZY2A 3UY5A 2WSAA 1S3ZA 2D4PA 4PQAA 4UEFA 4B10A 3IFEA 1BOBA 2PJ6A 5K8OA 2C6CA 4EFDA 4P4FA 3RO0A 1QSMA 1YLEA 2Q04A 3S6GA 2VXKA 1S7FA 2XEJA 1BLLE 2XEFA 3IIBA 3CT9A 4UA3A 5HVGA 2EO8A 2Q43A 1YW4A 5DWNA 3ZZIA 2HC9A 5GCNA 3NH4A 2QYVA 1F57A 3WT4A 4K30A 4R7MA 4XPDB 3QNVA 5JPHA 4LQGA 1DTDA 3IU2A 4P45A 3CPAA 3IU1A 4QBJA 2PJ9A 3K9UA 4UCPA 5EC4A 2CIJA 5F09A 3LWUA 2CNMA 3IGRA 2C6GA 4JD6A 5A28A 5HH1A 1XEBA 4XPLA 5JQ4A 3BXMA 4WJBA 1EE3P 1KUYA 2ATRA 3GY9A 1YREA 4XNHB 2V77A 6CPAA 2ZELA 2PJ1A 3VARA 2ZEPA 2R1IA 1ELMP 3D3SA 5A27A 4MCRA 4A30A 5HMNA 4UWIA 2PC1A 5AGEA 4F0YA 2ZEEA 3CXPA 2ZW5A 3PFEA 5G20A 1IYLA 2JDDA 2ZPAA 4OC3A 5G21A 1CP6A 3BJ7A 4OADA 1BAVA 3B7IA 3KR4A 4MCQA 1Z8XA 2HV2A 2FE7A 1Z5RA 4TWEA 5J8FA 2PJ0A 1Y0YA 1CM0A 2R7HA 4FD6A 1Q7LA 2B5GA 3S9LA 3EC4A 2AE6A 2PJAA 4IF5A 5C82A 4NXYA 1ELLP 2J9AA 3TO9A 1CPXA 4F9VA 2O53A 2HUZA 3IEHA 2YGWA 4M6GA 2OOTA 5DWMA 4I49A 4ZX8A 5LYIA 2PE3A 1Z8WA 2ANPA 3LD2A 2XEGA 3SI1A 3BHXA 2OB0A 4B5OA 1ARMA 3TO7A 3TE4A 5I4MA 1AYEA 4OAEA 5CBMA 2Q51A 4EWTA 2JLMA 3FH4A 3DDDA 2GE3A 3FNCA 1XFOA 3TOAA 4A94A 1CP7A 3NA6A 2WZNA 3KI9A 4ZYQA 2PSWA 1KZFA 1RO5A 4K3NA 2JEVA 2PJCA 4CAWA 1B87A 3EY5A 1BO4A 3FYNA 5G22A 5KTCA 4PXEA 4H89A 3KASA 4KZTA 1Z9UA 2J8NA 3B3CA 4FAIA 4PPZA 3EXNA 5JH9A 2Q4YA 3W6SA 4B13A 1M44A 3F8KA 2VBQA 2P6GA 1I21A 3WC5A 4M6IA 3P2FA 1R3NA 4L8AA 3IWWA 2R98A 1LRZA 4FD5A 4JZ0A 4ZY1A 4MFJA 3DGVA 3V8IA 1YVKA 1ZG9A 2B58A 4KOUA 1M4IA 1HDQA 2FL4A 4KLWA 4KUBA 3SJFA 2CTBA 4MCPA 5THWA 1Z4EA 1Q2DA 4A39A 4C7HA 5ISVA 3FRMA 4AB7A 3PB4X 4MFLA 1IB1E 2EUIA 2ZEGA 4NGRA 2PJ8A 2PR1A 3F5BA 2CNSA 1NMTA 3R96A 1NSAA 4KOVA 2B4DB 5HVFA 5D29A 5KTAA 3FXTA 4P4EA 3SHPA 4PXDA 2YNEA 5EBVA 2X7BA 1ZLHA 1HDUA 5LRKA 4MY3A 3FEEA 2F8HA 2Z11A 3BJ8A 1VGYA 2Z3LA 2FCKA 2EVNA 2D4OA 3KKWA 3F0AA 4ZBGA 4IK2A 2I00A 3DLJA 2EK8A 4DJLA 2JEWA 4A38A 2AFWA 2QIRA 3CXQA 4PXBA 3D7GA 5FVJA 4KVXA 2ZW7A 4JYWA 2BCOA 1Q2YA 1YLOA 4KORA 4GXHA 4CGPA 3TOBA 4R8FA 2Z3NA 2P6EA 2XEIA 4MI4A 1S7LA 4OC1A 1UWYA 2POKA 3RBUA 3TO6A 4KSFA 4C2YA 4RUHA 4UCMA 1F2PA 1R43A 2G3AA 4LUAA 2ODFA 4A95A 4NJRA 4DUKA 4F0XA 3PGPA 1M4LA 1TIQA 3JRUA 1TKHA 2Q4ZA 2Z3PA 2J8MA 5ELYA 2JBKA 4NGMA 3WR7A 4YWYA 1KWMA 4U9YA 2V8DA 4UFVA 3G3SA 2G9DA 3H8FA 1JWQA 2BUEA 2Q7BA 3VATA 1WK4A 4KOTA 2PVWA 1FY7A 1ZO0A 3K2KA 1P0HA 4C68A 5IX3A 2GU2A 3SXOA 3NH8A 1LAPA 3EO4A 2AFSA 2H5MA 1UFHA 4OIWA 4CRYB 4EVYA 3GB0A 2VZZA 3SJXA 4H6UA 3MRUA 3N5FA 2HB6A 4X8IA 1Y9WA 2ZEOA 2FXFA 4NGNA 4ZI6A 4UBRA 2BEIA 3QAYA 2VI7A 1XMTA 3VWDA 4AG9A 1F2OA 3H5ZA 4YRHA 4NEXA 2VQYA 2PRBA 2VEZA 3DSBA 3R9GA 3B35A 5C88A 2PJ7A 2IMOA 3B3TA 3I9SA 2BL1A 4MFPA 2VZYA 1FNOA 2WPXA 1L0CA 1SQHA 2C6PA 4CAVA 2OZUA 3JTKA 4FBEA 2REFA 4FWUA 3KHZA 4M85A 4AVCA 4F9UA 4JWPA 4FUUA 1S5KA 2B4DA 1Z8TA 4DYOA 4UIAA 4QC6A 4R6TA 3GUXA 1YQEA 1NE9A 4P6YA 2PRQA 2QECA 2ZEHA 4OP4A 5IB0A 2QMLA 2DPSA 3S6KA 5IV0A 1AUGA 3SJGA 4Z65A 2YNCA 3FVLA 3KL9A 1S60A 1TF9A 3B2YA 5LYLA 2Z3KA 2HQYA 3KR5A 3NE7A 3PRTA 4QUSA 3L2NA 2PJ5A 4PSWA 2ZEMA 1PCAA 1MK4A 3G8WA 4QB9A 3QAHA 5F47A 1WWZA 4IHMA 2R8VA 1X10A 2GIVA 3FF3A 4E2AA 2NMTA 4HNYB 2FVGA 1KUXA 4CGLA 1DE4C 1I12A 2CTCA 2OZGA 2BSWA 4M6HA 4MFKA 2A4NA 3WABA 4NF1A 1RXTA 2C1CA 2KCWA 3FIXA 1QSRA 4Q36A 4R3LA 5JGFA 2AFXA 4CGOA 2ARHA 3JUWA 4B11A 5CPAA 2ZOFA 3TC8A 4UWJA 4FD4A 3HLPA 2RC4A 3R9EA 5I0CA 3D7FA 1QQ9A 2PJ3A 3FB3A 2ZOGA 4UCNA 1VHOA 3BI0A 3NE8A 4B5PA 1TKJA 1LOKA 4NFRA 3FX6A 3C26A 4P4IA 1NSLA 2CF4A 3R95A 2ZEFA 2V8GA 4YFJA 3T9YA 1TXRA 1XMBA 4R3KA 2Z0ZA 2Y0MA 3K9TA 4MY0A 4MBUA 2BO9A 1YR0A 4J3GA 3H8GA 4UIBA 8CPAA 2AFZA 4KOSA 3D66A 4G1PA 4XNHC 3R9FA 4BMHA 3PBEA 4MHDA 3S6FA 1VKCA 5HXDA 5H86A 4II9A 4B12A 5IB9A 1IU8A 4B5PB 4R57A 1OZPA 1XE4A 4RI1A 3GYAA 3BI1A 2FIAA 1LCPA 1OBRA 2PIZA 3OWCA 4HNWB 5K8MA 4HKFA 3ZJ0A 4JXQA 2EWBA 5F48A 2VL1A 3GIUA 1XBUA 4XPDC 3ISXA 3VH9A 4PXCA 2ZW6A 3N7ZA 4OC2A 3T8WA 5F46A 2J8RA 4W9YA 1V0CA 2GLFA 3V7ZA 3NFZA 4MMOA 1X12A 1ZLIA 3IWEA 5AG6A 2O4HA 2AFUA 3KHXA 4MHPA 3ISZA 2GREA 1Y9KA 4F6AA 2GANA 3CXSA 4KLVA 4MFQA 3CPXA 4OC0A 4KSAA 3D68A 4ONUA 3D67A 5E96A 5LRGA 3WC6A 1MJBA 1ARLA 1IICA 4WWVA 4YGOA 1QSNA 1AMPA 2ZEDA 3B3SA 4Q7AA 1ON0A 2PJ4A 3SXNA 3FECA 4B14A 4OC4A 1IGBA 2FSRA 2YNDA 4OKOA 4IUSA 3SJEA 2QJ8A 2QVPA 2ABZA 1QSOA 1IIDA 2PIYA 3EFAA 3IWGA 3IJ3A 2F7VA 3W91A 1BPMA 2WYRA 2P0WA 3T90A 1S7NA 2EBJA 3S6HA 4CAXA 1IOFA 3PEIA 4FD7A 2Q4VA 3PB8X 3PP9A 3RNZA 4E0AA 2Z3MA 1ZG8A 5EMIA 1S7KA 2CNTA 4NCZA 2Z10A 2AFOA 4KVME 4PSXA 4MFZA 1YVOA 3D4UA 5D8NA 3TCVA 1QSTA 4BD9A 4ZX9A 3P2HA 4AXVA 4MHNA 3KQXA 2AFMA 1ZG7A 2FS5A 4OIDA 4CGMA 4UFXA 4A37A 4L89A 1YSJA 2DXQA 4BBHA 1CBXA 4C7IA 2CY2A 1CG2A 1VIXA 1BPNA 1YGHA 4UFWA 1A2ZA 4P4DA 2Q7SA 3D2MA 3D8PA 1M4DA 3KZWA 5AG7A 2GFQA 4JXRA 4U9ZA 3RAMA 3TT2A 4H2KA 2K5TA 3A9LA 1VHSA 2AJ6A 4E8OA 4O23A 1YX0A 2G0BA 3PBBA 4M3SA 3TX8A 5KTDA 4OLLA 3D7HA 3GLJA 1RTQA 1I1DA 2DF5A 3LACA 3DR8A 2B3VA 2G3TA 1N71A 3V38A 2B5GB 3B3WA 2WUUA 3FMCA 4X3RA 2Q44A 4IAVA 4CYQA 1XOVA 5G1ZA 5JM6A 2V8VA 3S9NA 3PB6X 4P4JA 4KOXA 4Q38A 4NJQA 1Q2CA 2RB7A 4CYPA 4A33A 2PDOA 3TFYA 4CYOA 1QMUA 1YMEA 5H84A 2PCUA 1GYTA 1Z2LA 3D2PA 5LYDA 2ZENA 2PVVA 2BOAA 4ZGYB 1M4GA 2O28A 3BLNA 3WC7A 2RFHA 1XJOA 3KGQA 3FJUA 1TF8A 1XRYA 4OC5A 1R57A 4CS0B 5HVHA 4GS4A 3IO1A 5K8NA 4A32A 3H4QA 1Z4RA 2IL4A 2OH1A 2FIWA 3PB9X 4AVBA 4UF4A 3MGDA 1KUVA 4JJXA 1XF8A 2JBJA 4KS9A 3H8EA 1B6BA 4R76A 3FEDA 4MHYA
chains in the Genus database with same CATH topology
4PV6A 2OZHA 4R9MA 5F49A 3R1KA 4DNCA 4KOWA 2DPTA 3QB8A 5CNPA 1MJ9A 2ZXVA 4R87A 4U5YA 2B4BA 4AG7A 4A2ZA 3JVNA 2Q0YA 3LODA 4PK2A 2I79A 1U6MA 4AVAA 4ORFA 2CXAA 2PR8A 4X5KA 5AG4A 2OU2A 4A31A 4C2XA 1PUAA 5BWAB 2F5IA 2B3UA 1J4JA 1CJWA 1M1DA 3I3GA 4KVOE 4CGNA 4Y49C 3B8GA 1Y7RA 5J8CA 1K4JA 4MJ8A 4CAEA 3DR6A 4NSQA 2REEA 4C2ZA 1P4NA 2WPWA 2Z3OA 5AG5A 4KOYA 2FT0A 3FBUA 1MJAA 4RS2A 4CYNA 4XPKA 2JDCA 2P6FA 4JLYA 1YK3A 4HNXB 2ZW4A 3E0KA 4CAFA 2C27A 3GKRA 4CRZB 1XIXA 1IYKA 4Y49B 1GHEA 4H6ZA 3DNSA 1PU9A 3RYOA 4PK3A 4QVTA 3VWEA 4KUAA 2PQ8A 3PZJA 3W6XA 2YNCC 3TTHA 4LX9A 3UY5A 2WSAA 1S3ZA 2D4PA 4B10A 1BOBA 1QSMA 1YLEA 2Q04A 3S6GA 2VXKA 1S7FA 4UA3A 5DWNA 3ZZIA 5GCNA 4K30A 4XPDB 5JPHA 3IU2A 3IU1A 4QBJA 3K9UA 4UCPA 5EC4A 2CNMA 3IGRA 5A28A 4JD6A 5HH1A 1XEBA 4XPLA 5JQ4A 1KUYA 2ATRA 3GY9A 1YREA 4XNHB 2R1IA 3D3SA 5A27A 5HMNA 4A30A 4UWIA 2PC1A 5AGEA 4F0YA 3CXPA 2ZW5A 5G20A 1IYLA 2JDDA 2ZPAA 5G21A 3BJ7A 4OADA 2HV2A 2FE7A 5J8FA 1CM0A 2R7HA 4FD6A 2B5GA 3EC4A 2AE6A 4IF5A 5C82A 4NXYA 3TO9A 2HUZA 2YGWA 5DWMA 4I49A 3LD2A 2OB0A 4B5OA 3TO7A 3TE4A 4OAEA 2JLMA 3DDDA 2GE3A 3FNCA 3TOAA 2PSWA 1KZFA 1RO5A 2JEVA 4CAWA 1B87A 3EY5A 1BO4A 3FYNA 5G22A 5KTCA 4H89A 4KZTA 1Z9UA 2J8NA 3EXNA 2Q4YA 3W6SA 4B13A 1M44A 3F8KA 2VBQA 2P6GA 1I21A 3P2FA 4L8AA 2R98A 1LRZA 4FD5A 4MFJA 3V8IA 1YVKA 2B58A 4KOUA 1M4IA 2FL4A 4KLWA 4KUBA 1Z4EA 1Q2DA 4C7HA 5ISVA 3FRMA 4AB7A 4MFLA 1IB1E 2EUIA 2PR1A 3F5BA 2CNSA 1NMTA 3R96A 4KOVA 2B4DB 5KTAA 3FXTA 3SHPA 2YNEA 5EBVA 2X7BA 4MY3A 2Z11A 3BJ8A 2Z3LA 2FCKA 2EVNA 2D4OA 3KKWA 3F0AA 4ZBGA 2I00A 2QIRA 3CXQA 5FVJA 4KVXA 2ZW7A 4KORA 1Q2YA 4CGPA 3TOBA 2Z3NA 2P6EA 4MI4A 1S7LA 4C2YA 3TO6A 4KSFA 4UCMA 2G3AA 4LUAA 4A95A 4F0XA 3PGPA 1TIQA 2Z3PA 2J8MA 3WR7A 4U9YA 4UFVA 3G3SA 2Q7BA 2BUEA 1WK4A 4KOTA 1FY7A 1ZO0A 1P0HA 4C68A 5IX3A 3SXOA 3EO4A 2H5MA 1UFHA 4CRYB 4EVYA 2VZZA 4H6UA 1Y9WA 2FXFA 4UBRA 2BEIA 3VWDA 2VI7A 1XMTA 4AG9A 3H5ZA 4YRHA 4NEXA 2VQYA 2PRBA 2VEZA 3DSBA 3R9GA 5C88A 3I9SA 2BL1A 4MFPA 2VZYA 2WPXA 1L0CA 1SQHA 4CAVA 2OZUA 3JTKA 2REFA 4M85A 4AVCA 4JWPA 1S5KA 2B4DA 4QC6A 1NE9A 2QECA 5IB0A 2QMLA 2DPSA 3S6KA 5IV0A 2YNCA 1S60A 2Z3KA 2HQYA 3NE7A 4QUSA 4PSWA 1MK4A 3G8WA 4QB9A 3QAHA 5F47A 1WWZA 2R8VA 2GIVA 4E2AA 2NMTA 4HNYB 4CGLA 1KUXA 1I12A 2OZGA 2BSWA 4MFKA 2A4NA 4NF1A 1RXTA 2KCWA 3FIXA 1QSRA 4Q36A 4R3LA 4CGOA 2ARHA 3JUWA 4B11A 4UWJA 4FD4A 2RC4A 3R9EA 5I0CA 3FB3A 4UCNA 4B5PA 3C26A 1NSLA 3R95A 4YFJA 3T9YA 4R3KA 2Z0ZA 2Y0MA 4MY0A 4MBUA 1YR0A 4J3GA 4KOSA 4XNHC 3R9FA 4BMHA 4MHDA 3S6FA 1VKCA 5H86A 4II9A 4B12A 4B5PB 4R57A 1OZPA 1XE4A 4RI1A 3GYAA 2FIAA 3OWCA 4HNWB 4HKFA 3ZJ0A 4JXQA 5F48A 4XPDC 2ZW6A 3N7ZA 5F46A 2J8RA 1V0CA 3IWEA 5AG6A 1Y9KA 4F6AA 2GANA 3CXSA 4KLVA 4MFQA 4KSAA 4ONUA 5E96A 1MJBA 1IICA 4YGOA 1QSNA 1ON0A 3SXNA 4B14A 2FSRA 2YNDA 4IUSA 1QSOA 1IIDA 3EFAA 3IWGA 3W91A 2P0WA 3T90A 1S7NA 3S6HA 4CAXA 4FD7A 4E0AA 2Q4VA 3PP9A 2Z3MA 1S7KA 2CNTA 4NCZA 2Z10A 4KVME 4PSXA 3TCVA 4MFZA 1YVOA 1QSTA 3P2HA 2FS5A 4CGMA 4UFXA 4L89A 2DXQA 4BBHA 4C7IA 2CY2A 1YGHA 4UFWA 3D2MA 3D8PA 5AG7A 1M4DA 4JXRA 4U9ZA 3TT2A 2K5TA 3A9LA 1VHSA 2AJ6A 4E8OA 1YX0A 2G0BA 4M3SA 5KTDA 4OLLA 1I1DA 3DR8A 2B3VA 2G3TA 1N71A 2B5GB 2WUUA 2Q44A 4CYQA 5G1ZA 4KOXA 4Q38A 1Q2CA 4CYPA 4A33A 2PDOA 3TFYA 4CYOA 5H84A 3D2PA 4ZGYB 1M4GA 2O28A 3BLNA 1R57A 4CS0B 4GS4A 4A32A 3H4QA 1Z4RA 2IL4A 2OH1A 2FIWA 4AVBA 3MGDA 1KUVA 4JJXA 1XF8A 4KS9A 1B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PV6 A;  2OZH A;  4R9M A;  5F49 A;  3R1K A;  4DNC A;  4KOW A;  3QB8 A;  5CNP A;  1MJ9 A;  2ZXV A;  4R87 A;  4U5Y A;  2B4B A;  4AG7 A;  3JVN A;  2Q0Y A;  3LOD A;  4PK2 A;  2I79 A;  1U6M A;  4AVA A;  4ORF A;  2PR8 A;  4X5K A;  2OU2 A;  1PUA A;  2F5I A;  2B3U A;  1J4J A;  1CJW A;  1M1D A;  3I3G A;  4KVO E;  4Y49 C;  3B8G A;  1Y7R A;  5J8C A;  1K4J A;  4MJ8 A;  3DR6 A;  4NSQ A;  2REE A;  1P4N A;  2WPW A;  4KOY A;  2FT0 A;  3FBU A;  1MJA A;  4RS2 A;  4XPK A;  2JDC A;  2P6F A;  4JLY A;  1YK3 A;  4HNX B;  2ZW4 A;  3E0K A;  2C27 A;  3GKR A;  4CRZ B;  1XIX A;  1IYK A;  4Y49 B;  1GHE A;  4H6Z A;  3DNS A;  1PU9 A;  3RYO A;  4PK3 A;  4QVT A;  3VWE A;  4KUA A;  2PQ8 A;  3PZJ A;  3W6X A;  3TTH A;  4LX9 A;  3UY5 A;  1S3Z A;  2D4P A;  1BOB A;  1QSM A;  1YLE A;  2Q04 A;  3S6G A;  2VXK A;  1S7F A;  4UA3 A;  5DWN A;  3ZZI A;  5GCN A;  4K30 A;  4XPD B;  5JPH A;  4QBJ A;  3K9U A;  5EC4 A;  2CNM A;  3IGR A;  4JD6 A;  5HH1 A;  1XEB A;  4XPL A;  5JQ4 A;  1KUY A;  2ATR A;  3GY9 A;  1YRE A;  4XNH B;  2R1I A;  3D3S A;  5HMN A;  4UWI A;  2PC1 A;  4F0Y A;  3CXP A;  2ZW5 A;  1IYL A;  2JDD A;  2ZPA A;  3BJ7 A;  4OAD A;  2HV2 A;  2FE7 A;  5J8F A;  1CM0 A;  2R7H A;  4FD6 A;  2B5G A;  3EC4 A;  2AE6 A;  4IF5 A;  5C82 A;  4NXY A;  3TO9 A;  2HUZ A;  5DWM A;  4I49 A;  3LD2 A;  2OB0 A;  4B5O A;  3TO7 A;  3TE4 A;  4OAE A;  2JLM A;  3DDD A;  2GE3 A;  3FNC A;  3TOA A;  2PSW A;  1KZF A;  1RO5 A;  2JEV A;  4CAW A;  1B87 A;  3EY5 A;  1BO4 A;  3FYN A;  5KTC A;  4H89 A;  4KZT A;  1Z9U A;  2J8N A;  3EXN A;  2Q4Y A;  3W6S A;  1M44 A;  3F8K A;  2VBQ A;  2P6G A;  1I21 A;  3P2F A;  4L8A A;  2R98 A;  1LRZ A;  4FD5 A;  3V8I A;  1YVK A;  2B58 A;  4KOU A;  1M4I A;  2FL4 A;  4KLW A;  4KUB A;  1Z4E A;  1Q2D A;  5ISV A;  3FRM A;  4AB7 A;  1IB1 E;  2EUI A;  2PR1 A;  3F5B A;  2CNS A;  1NMT A;  3R96 A;  4KOV A;  2B4D B;  5KTA A;  3FXT A;  3SHP A;  5EBV A;  2X7B A;  4MY3 A;  2Z11 A;  3BJ8 A;  2FCK A;  2EVN A;  2D4O A;  3KKW A;  3F0A A;  4ZBG A;  2I00 A;  2QIR A;  3CXQ A;  5FVJ A;  4KVX A;  2ZW7 A;  4KOR A;  1Q2Y A;  3TOB A;  4MI4 A;  2P6E A;  1S7L A;  3TO6 A;  2G3A A;  4LUA A;  3PGP A;  1TIQ A;  2J8M A;  3WR7 A;  4U9Y A;  2Q7B A;  3G3S A;  2BUE A;  1WK4 A;  4KOT A;  1FY7 A;  1P0H A;  5IX3 A;  3SXO A;  3EO4 A;  2H5M A;  1UFH A;  4CRY B;  4EVY A;  2VZZ A;  4H6U A;  1Y9W A;  2FXF A;  4UBR A;  2BEI A;  3VWD A;  2VI7 A;  1XMT A;  4AG9 A;  4YRH A;  4NEX A;  2VQY A;  2PRB A;  2VEZ A;  3DSB A;  3R9G A;  5C88 A;  3I9S A;  2BL1 A;  2VZY A;  2WPX A;  1L0C A;  1SQH A;  4CAV A;  2OZU A;  2REF A;  4M85 A;  4AVC A;  4JWP A;  1S5K A;  2B4D A;  4QC6 A;  1NE9 A;  2QEC A;  5IB0 A;  2QML A;  5IV0 A;  3S6K A;  1S60 A;  2HQY A;  3NE7 A;  4QUS A;  4PSW A;  1MK4 A;  3G8W A;  4QB9 A;  3QAH A;  5F47 A;  1WWZ A;  2R8V A;  2GIV A;  4E2A A;  2NMT A;  4HNY B;  1KUX A;  1I12 A;  2OZG A;  2BSW A;  2A4N A;  4NF1 A;  1RXT A;  2KCW A;  3FIX A;  1QSR A;  4R3L A;  2ARH A;  3JUW A;  4UWJ A;  4FD4 A;  2RC4 A;  3R9E A;  5I0C A;  3FB3 A;  4B5P A;  3C26 A;  1NSL A;  3R95 A;  4YFJ A;  3T9Y A;  4R3K A;  2Z0Z A;  2Y0M A;  4MY0 A;  4MBU A;  1YR0 A;  4J3G A;  4KOS A;  4XNH C;  3R9F A;  4BMH A;  4MHD A;  3S6F A;  1VKC A;  5H86 A;  4II9 A;  4B5P B;  4R57 A;  1OZP A;  1XE4 A;  4RI1 A;  3GYA A;  2FIA A;  3OWC A;  4HNW B;  4HKF A;  3ZJ0 A;  4JXQ A;  5F48 A;  4XPD C;  2ZW6 A;  3N7Z A;  5F46 A;  2J8R A;  1V0C A;  1Y9K A;  4F6A A;  2GAN A;  3CXS A;  4KLV A;  4ONU A;  5E96 A;  1MJB A;  1IIC A;  4YGO A;  1QSN A;  1ON0 A;  3SXN A;  2FSR A;  4IUS A;  1QSO A;  1IID A;  3EFA A;  3IWG A;  3W91 A;  2P0W A;  3T90 A;  1S7N A;  3S6H A;  4CAX A;  4FD7 A;  4E0A A;  2Q4V A;  3PP9 A;  1S7K A;  2CNT A;  4NCZ A;  2Z10 A;  4KVM E;  4PSX A;  3TCV A;  1YVO A;  1QST A;  3P2H A;  2FS5 A;  4L89 A;  2DXQ A;  2CY2 A;  1YGH A;  3D2M A;  3D8P A;  1M4D A;  4JXR A;  4U9Z A;  3TT2 A;  2K5T A;  1VHS A;  2AJ6 A;  4E8O A;  1YX0 A;  2G0B A;  4M3S A;  5KTD A;  4OLL A;  1I1D A;  3DR8 A;  2B3V A;  2G3T A;  1N71 A;  2B5G B;  2Q44 A;  4KOX A;  1Q2C A;  2PDO A;  3TFY A;  5H84 A;  3D2P A;  1M4G A;  2O28 A;  3BLN A;  1R57 A;  4CS0 B;  4GS4 A;  3H4Q A;  1Z4R A;  2IL4 A;  2OH1 A;  2FIW A;  4AVB A;  3MGD A;  1KUV A;  4JJX A;  1XF8 A;  1B6B A; 
#chains in the Genus database with same CATH topology
 4PV6 A;  2OZH A;  4R9M A;  5F49 A;  3KQZ A;  2IQ6 A;  3R1K A;  3D7D A;  3S9M A;  4DNC A;  4F8Z A;  1CX8 A;  4KOW A;  4UEZ A;  2DPT A;  3CZX A;  2NSM A;  3QB8 A;  3NH5 A;  3CDX A;  5CNP A;  1MJ9 A;  1IOI A;  2ZXV A;  4R87 A;  4OME A;  4U5Y A;  2B4B A;  4AG7 A;  4A2Z A;  2NYQ A;  4ZY0 A;  3JVN A;  4UEE A;  2Q0Y A;  3SI2 A;  3LOD A;  4PK2 A;  4RN7 A;  2I79 A;  4X2T A;  5K8P A;  4P44 A;  1U6M A;  4AVA A;  4ORF A;  2CXA A;  2PR8 A;  4X5K A;  5AG4 A;  4MXU A;  2OU2 A;  4TNU A;  4A31 A;  1PUA A;  4C2X A;  4MRI A;  5BWA B;  2F5I A;  4CPA A;  5J1Q A;  2B3U A;  1J4J A;  2EK9 A;  3RZA A;  1LFW A;  1CJW A;  1M1D A;  3LMS A;  3I3G A;  4KVO E;  4CGN A;  4Y49 C;  3B8G A;  1Y7R A;  3I1U A;  5J8C A;  5LRJ A;  4KSI A;  1K4J A;  4MJ8 A;  4CAE A;  3DR6 A;  1LAN A;  4NSQ A;  2REE A;  4NGS A;  1P4N A;  4C2Z A;  2GLJ A;  2WPW A;  2Z3O A;  1H8L A;  1PYT B;  5AG5 A;  4KOY A;  2FT0 A;  3PFO A;  1Z8L A;  4GM5 A;  3SI0 A;  3FBU A;  1MJA A;  7CPA A;  4RS2 A;  3B3V A;  1JQG A;  4CYN A;  4XPK A;  4EME A;  1CPS A;  4NGT A;  2JDC A;  2P6F A;  1HEE A;  2I3C A;  4HPS A;  4JLY A;  5DS0 A;  1YK3 A;  4NGQ A;  1TKF A;  4HNX B;  4MHZ A;  1FT7 A;  2ZW4 A;  3E0K A;  4P4B A;  4CAF A;  4LQ6 A;  1Y0R A;  2V8H A;  2C27 A;  4YU9 A;  3GKR A;  1LAM A;  1YW6 A;  4CRZ B;  1XIX A;  4B6Z A;  1IYK A;  2PJB A;  3PB7 X;  1VHE A;  2OR4 A;  4P10 A;  4Y49 B;  1GHE A;  4H6Z A;  1Y7E A;  1IY7 A;  3HUV A;  4MCS A;  3DNS A;  1PU9 A;  3RYO A;  4PK3 A;  4QVT A;  4NGP A;  4KUA A;  3VWE A;  2PQ8 A;  4ONW A;  3PZJ A;  3IC1 A;  2PJ2 A;  3MN8 A;  2YNC C;  3TTH A;  3W6X A;  2DEA A;  4BIN A;  5LYF A;  2IJZ A;  4LX9 A;  4ZY2 A;  3UY5 A;  2WSA A;  1S3Z A;  2D4P A;  4PQA A;  4UEF A;  4B10 A;  3IFE A;  1BOB A;  2PJ6 A;  5K8O A;  2C6C A;  4EFD A;  4P4F A;  3RO0 A;  1QSM A;  1YLE A;  2Q04 A;  3S6G A;  2VXK A;  1S7F A;  2XEJ A;  1BLL E;  2XEF A;  3IIB A;  3CT9 A;  4UA3 A;  5HVG A;  2EO8 A;  2Q43 A;  1YW4 A;  5DWN A;  3ZZI A;  2HC9 A;  5GCN A;  3NH4 A;  2QYV A;  1F57 A;  3WT4 A;  4K30 A;  4R7M A;  4XPD B;  3QNV A;  5JPH A;  4LQG A;  1DTD A;  3IU2 A;  4P45 A;  3CPA A;  3IU1 A;  4QBJ A;  2PJ9 A;  3K9U A;  4UCP A;  5EC4 A;  2CIJ A;  5F09 A;  3LWU A;  2CNM A;  3IGR A;  2C6G A;  4JD6 A;  5A28 A;  5HH1 A;  1XEB A;  4XPL A;  5JQ4 A;  3BXM A;  4WJB A;  1EE3 P;  1KUY A;  2ATR A;  3GY9 A;  1YRE A;  4XNH B;  2V77 A;  6CPA A;  2ZEL A;  2PJ1 A;  3VAR A;  2ZEP A;  2R1I A;  1ELM P;  3D3S A;  5A27 A;  4MCR A;  4A30 A;  5HMN A;  4UWI A;  2PC1 A;  5AGE A;  4F0Y A;  2ZEE A;  3CXP A;  2ZW5 A;  3PFE A;  5G20 A;  1IYL A;  2JDD A;  2ZPA A;  4OC3 A;  5G21 A;  1CP6 A;  3BJ7 A;  4OAD A;  1BAV A;  3B7I A;  3KR4 A;  4MCQ A;  1Z8X A;  2HV2 A;  2FE7 A;  1Z5R A;  4TWE A;  5J8F A;  2PJ0 A;  1Y0Y A;  1CM0 A;  2R7H A;  4FD6 A;  1Q7L A;  2B5G A;  3S9L A;  3EC4 A;  2AE6 A;  2PJA A;  4IF5 A;  5C82 A;  4NXY A;  1ELL P;  2J9A A;  3TO9 A;  1CPX A;  4F9V A;  2O53 A;  2HUZ A;  3IEH A;  2YGW A;  4M6G A;  2OOT A;  5DWM A;  4I49 A;  4ZX8 A;  5LYI A;  2PE3 A;  1Z8W A;  2ANP A;  3LD2 A;  2XEG A;  3SI1 A;  3BHX A;  2OB0 A;  4B5O A;  1ARM A;  3TO7 A;  3TE4 A;  5I4M A;  1AYE A;  4OAE A;  5CBM A;  2Q51 A;  4EWT A;  2JLM A;  3FH4 A;  3DDD A;  2GE3 A;  3FNC A;  1XFO A;  3TOA A;  4A94 A;  1CP7 A;  3NA6 A;  2WZN A;  3KI9 A;  4ZYQ A;  2PSW A;  1KZF A;  1RO5 A;  4K3N A;  2JEV A;  2PJC A;  4CAW A;  1B87 A;  3EY5 A;  1BO4 A;  3FYN A;  5G22 A;  5KTC A;  4PXE A;  4H89 A;  3KAS A;  4KZT A;  1Z9U A;  2J8N A;  3B3C A;  4FAI A;  4PPZ A;  3EXN A;  5JH9 A;  2Q4Y A;  3W6S A;  4B13 A;  1M44 A;  3F8K A;  2VBQ A;  2P6G A;  1I21 A;  3WC5 A;  4M6I A;  3P2F A;  1R3N A;  4L8A A;  3IWW A;  2R98 A;  1LRZ A;  4FD5 A;  4JZ0 A;  4ZY1 A;  4MFJ A;  3DGV A;  3V8I A;  1YVK A;  1ZG9 A;  2B58 A;  4KOU A;  1M4I A;  1HDQ A;  2FL4 A;  4KLW A;  4KUB A;  3SJF A;  2CTB A;  4MCP A;  5THW A;  1Z4E A;  1Q2D A;  4A39 A;  4C7H A;  5ISV A;  3FRM A;  4AB7 A;  3PB4 X;  4MFL A;  1IB1 E;  2EUI A;  2ZEG A;  4NGR A;  2PJ8 A;  2PR1 A;  3F5B A;  2CNS A;  1NMT A;  3R96 A;  1NSA A;  4KOV A;  2B4D B;  5HVF A;  5D29 A;  5KTA A;  3FXT A;  4P4E A;  3SHP A;  4PXD A;  2YNE A;  5EBV A;  2X7B A;  1ZLH A;  1HDU A;  5LRK A;  4MY3 A;  3FEE A;  2F8H A;  2Z11 A;  3BJ8 A;  1VGY A;  2Z3L A;  2FCK A;  2EVN A;  2D4O A;  3KKW A;  3F0A A;  4ZBG A;  4IK2 A;  2I00 A;  3DLJ A;  2EK8 A;  4DJL A;  2JEW A;  4A38 A;  2AFW A;  2QIR A;  3CXQ A;  4PXB A;  3D7G A;  5FVJ A;  4KVX A;  2ZW7 A;  4JYW A;  2BCO A;  1Q2Y A;  1YLO A;  4KOR A;  4GXH A;  4CGP A;  3TOB A;  4R8F A;  2Z3N A;  2P6E A;  2XEI A;  4MI4 A;  1S7L A;  4OC1 A;  1UWY A;  2POK A;  3RBU A;  3TO6 A;  4KSF A;  4C2Y A;  4RUH A;  4UCM A;  1F2P A;  1R43 A;  2G3A A;  4LUA A;  2ODF A;  4A95 A;  4NJR A;  4DUK A;  4F0X A;  3PGP A;  1M4L A;  1TIQ A;  3JRU A;  1TKH A;  2Q4Z A;  2Z3P A;  2J8M A;  5ELY A;  2JBK A;  4NGM A;  3WR7 A;  4YWY A;  1KWM A;  4U9Y A;  2V8D A;  4UFV A;  3G3S A;  2G9D A;  3H8F A;  1JWQ A;  2BUE A;  2Q7B A;  3VAT A;  1WK4 A;  4KOT A;  2PVW A;  1FY7 A;  1ZO0 A;  3K2K A;  1P0H A;  4C68 A;  5IX3 A;  2GU2 A;  3SXO A;  3NH8 A;  1LAP A;  3EO4 A;  2AFS A;  2H5M A;  1UFH A;  4OIW A;  4CRY B;  4EVY A;  3GB0 A;  2VZZ A;  3SJX A;  4H6U A;  3MRU A;  3N5F A;  2HB6 A;  4X8I A;  1Y9W A;  2ZEO A;  2FXF A;  4NGN A;  4ZI6 A;  4UBR A;  2BEI A;  3QAY A;  2VI7 A;  1XMT A;  3VWD A;  4AG9 A;  1F2O A;  3H5Z A;  4YRH A;  4NEX A;  2VQY A;  2PRB A;  2VEZ A;  3DSB A;  3R9G A;  3B35 A;  5C88 A;  2PJ7 A;  2IMO A;  3B3T A;  3I9S A;  2BL1 A;  4MFP A;  2VZY A;  1FNO A;  2WPX A;  1L0C A;  1SQH A;  2C6P A;  4CAV A;  2OZU A;  3JTK A;  4FBE A;  2REF A;  4FWU A;  3KHZ A;  4M85 A;  4AVC A;  4F9U A;  4JWP A;  4FUU A;  1S5K A;  2B4D A;  1Z8T A;  4DYO A;  4UIA A;  4QC6 A;  4R6T A;  3GUX A;  1YQE A;  1NE9 A;  4P6Y A;  2PRQ A;  2QEC A;  2ZEH A;  4OP4 A;  5IB0 A;  2QML A;  2DPS A;  3S6K A;  5IV0 A;  1AUG A;  3SJG A;  4Z65 A;  2YNC A;  3FVL A;  3KL9 A;  1S60 A;  1TF9 A;  3B2Y A;  5LYL A;  2Z3K A;  2HQY A;  3KR5 A;  3NE7 A;  3PRT A;  4QUS A;  3L2N A;  2PJ5 A;  4PSW A;  2ZEM A;  1PCA A;  1MK4 A;  3G8W A;  4QB9 A;  3QAH A;  5F47 A;  1WWZ A;  4IHM A;  2R8V A;  1X10 A;  2GIV A;  3FF3 A;  4E2A A;  2NMT A;  4HNY B;  2FVG A;  1KUX A;  4CGL A;  1DE4 C;  1I12 A;  2CTC A;  2OZG A;  2BSW A;  4M6H A;  4MFK A;  2A4N A;  3WAB A;  4NF1 A;  1RXT A;  2C1C A;  2KCW A;  3FIX A;  1QSR A;  4Q36 A;  4R3L A;  5JGF A;  2AFX A;  4CGO A;  2ARH A;  3JUW A;  4B11 A;  5CPA A;  2ZOF A;  3TC8 A;  4UWJ A;  4FD4 A;  3HLP A;  2RC4 A;  3R9E A;  5I0C A;  3D7F A;  1QQ9 A;  2PJ3 A;  3FB3 A;  2ZOG A;  4UCN A;  1VHO A;  3BI0 A;  3NE8 A;  4B5P A;  1TKJ A;  1LOK A;  4NFR A;  3FX6 A;  3C26 A;  4P4I A;  1NSL A;  2CF4 A;  3R95 A;  2ZEF A;  2V8G A;  4YFJ A;  3T9Y A;  1TXR A;  1XMB A;  4R3K A;  2Z0Z A;  2Y0M A;  3K9T A;  4MY0 A;  4MBU A;  2BO9 A;  1YR0 A;  4J3G A;  3H8G A;  4UIB A;  8CPA A;  2AFZ A;  4KOS A;  3D66 A;  4G1P A;  4XNH C;  3R9F A;  4BMH A;  3PBE A;  4MHD A;  3S6F A;  1VKC A;  5HXD A;  5H86 A;  4II9 A;  4B12 A;  5IB9 A;  1IU8 A;  4B5P B;  4R57 A;  1OZP A;  1XE4 A;  4RI1 A;  3GYA A;  3BI1 A;  2FIA A;  1LCP A;  1OBR A;  2PIZ A;  3OWC A;  4HNW B;  5K8M A;  4HKF A;  3ZJ0 A;  4JXQ A;  2EWB A;  5F48 A;  2VL1 A;  3GIU A;  1XBU A;  4XPD C;  3ISX A;  3VH9 A;  4PXC A;  2ZW6 A;  3N7Z A;  4OC2 A;  3T8W A;  5F46 A;  2J8R A;  4W9Y A;  1V0C A;  2GLF A;  3V7Z A;  3NFZ A;  4MMO A;  1X12 A;  1ZLI A;  3IWE A;  5AG6 A;  2O4H A;  2AFU A;  3KHX A;  4MHP A;  3ISZ A;  2GRE A;  1Y9K A;  4F6A A;  2GAN A;  3CXS A;  4KLV A;  4MFQ A;  3CPX A;  4OC0 A;  4KSA A;  3D68 A;  4ONU A;  3D67 A;  5E96 A;  5LRG A;  3WC6 A;  1MJB A;  1ARL A;  1IIC A;  4WWV A;  4YGO A;  1QSN A;  1AMP A;  2ZED A;  3B3S A;  4Q7A A;  1ON0 A;  2PJ4 A;  3SXN A;  3FEC A;  4B14 A;  4OC4 A;  1IGB A;  2FSR A;  2YND A;  4OKO A;  4IUS A;  3SJE A;  2QJ8 A;  2QVP A;  2ABZ A;  1QSO A;  1IID A;  2PIY A;  3EFA A;  3IWG A;  3IJ3 A;  2F7V A;  3W91 A;  1BPM A;  2WYR A;  2P0W A;  3T90 A;  1S7N A;  2EBJ A;  3S6H A;  4CAX A;  1IOF A;  3PEI A;  4FD7 A;  2Q4V A;  3PB8 X;  3PP9 A;  3RNZ A;  4E0A A;  2Z3M A;  1ZG8 A;  5EMI A;  1S7K A;  2CNT A;  4NCZ A;  2Z10 A;  2AFO A;  4KVM E;  4PSX A;  4MFZ A;  1YVO A;  3D4U A;  5D8N A;  3TCV A;  1QST A;  4BD9 A;  4ZX9 A;  3P2H A;  4AXV A;  4MHN A;  3KQX A;  2AFM A;  1ZG7 A;  2FS5 A;  4OID A;  4CGM A;  4UFX A;  4A37 A;  4L89 A;  1YSJ A;  2DXQ A;  4BBH A;  1CBX A;  4C7I A;  2CY2 A;  1CG2 A;  1VIX A;  1BPN A;  1YGH A;  4UFW A;  1A2Z A;  4P4D A;  2Q7S A;  3D2M A;  3D8P A;  1M4D A;  3KZW A;  5AG7 A;  2GFQ A;  4JXR A;  4U9Z A;  3RAM A;  3TT2 A;  4H2K A;  2K5T A;  3A9L A;  1VHS A;  2AJ6 A;  4E8O A;  4O23 A;  1YX0 A;  2G0B A;  3PBB A;  4M3S A;  3TX8 A;  5KTD A;  4OLL A;  3D7H A;  3GLJ A;  1RTQ A;  1I1D A;  2DF5 A;  3LAC A;  3DR8 A;  2B3V A;  2G3T A;  1N71 A;  3V38 A;  2B5G B;  3B3W A;  2WUU A;  3FMC A;  4X3R A;  2Q44 A;  4IAV A;  4CYQ A;  1XOV A;  5G1Z A;  5JM6 A;  2V8V A;  3S9N A;  3PB6 X;  4P4J A;  4KOX A;  4Q38 A;  4NJQ A;  1Q2C A;  2RB7 A;  4CYP A;  4A33 A;  2PDO A;  3TFY A;  4CYO A;  1QMU A;  1YME A;  5H84 A;  2PCU A;  1GYT A;  1Z2L A;  3D2P A;  5LYD A;  2ZEN A;  2PVV A;  2BOA A;  4ZGY B;  1M4G A;  2O28 A;  3BLN A;  3WC7 A;  2RFH A;  1XJO A;  3KGQ A;  3FJU A;  1TF8 A;  1XRY A;  4OC5 A;  1R57 A;  4CS0 B;  5HVH A;  4GS4 A;  3IO1 A;  5K8N A;  4A32 A;  3H4Q A;  1Z4R A;  2IL4 A;  2OH1 A;  2FIW A;  3PB9 X;  4AVB A;  4UF4 A;  3MGD A;  1KUV A;  4JJX A;  1XF8 A;  2JBJ A;  4KS9 A;  3H8E A;  1B6B A;  4R76 A;  3FED A;  4MHY A; 
#chains in the Genus database with same CATH homology
 4PV6 A;  2OZH A;  4R9M A;  5F49 A;  3R1K A;  4DNC A;  4KOW A;  2DPT A;  3QB8 A;  5CNP A;  1MJ9 A;  2ZXV A;  4R87 A;  4U5Y A;  2B4B A;  4AG7 A;  4A2Z A;  3JVN A;  2Q0Y A;  3LOD A;  4PK2 A;  2I79 A;  1U6M A;  4AVA A;  4ORF A;  2CXA A;  2PR8 A;  4X5K A;  5AG4 A;  2OU2 A;  4A31 A;  4C2X A;  1PUA A;  5BWA B;  2F5I A;  2B3U A;  1J4J A;  1CJW A;  1M1D A;  3I3G A;  4KVO E;  4CGN A;  4Y49 C;  3B8G A;  1Y7R A;  5J8C A;  1K4J A;  4MJ8 A;  4CAE A;  3DR6 A;  4NSQ A;  2REE A;  4C2Z A;  1P4N A;  2WPW A;  2Z3O A;  5AG5 A;  4KOY A;  2FT0 A;  3FBU A;  1MJA A;  4RS2 A;  4CYN A;  4XPK A;  2JDC A;  2P6F A;  4JLY A;  1YK3 A;  4HNX B;  2ZW4 A;  3E0K A;  4CAF A;  2C27 A;  3GKR A;  4CRZ B;  1XIX A;  1IYK A;  4Y49 B;  1GHE A;  4H6Z A;  3DNS A;  1PU9 A;  3RYO A;  4PK3 A;  4QVT A;  3VWE A;  4KUA A;  2PQ8 A;  3PZJ A;  3W6X A;  2YNC C;  3TTH A;  4LX9 A;  3UY5 A;  2WSA A;  1S3Z A;  2D4P A;  4B10 A;  1BOB A;  1QSM A;  1YLE A;  2Q04 A;  3S6G A;  2VXK A;  1S7F A;  4UA3 A;  5DWN A;  3ZZI A;  5GCN A;  4K30 A;  4XPD B;  5JPH A;  3IU2 A;  3IU1 A;  4QBJ A;  3K9U A;  4UCP A;  5EC4 A;  2CNM A;  3IGR A;  5A28 A;  4JD6 A;  5HH1 A;  1XEB A;  4XPL A;  5JQ4 A;  1KUY A;  2ATR A;  3GY9 A;  1YRE A;  4XNH B;  2R1I A;  3D3S A;  5A27 A;  5HMN A;  4A30 A;  4UWI A;  2PC1 A;  5AGE A;  4F0Y A;  3CXP A;  2ZW5 A;  5G20 A;  1IYL A;  2JDD A;  2ZPA A;  5G21 A;  3BJ7 A;  4OAD A;  2HV2 A;  2FE7 A;  5J8F A;  1CM0 A;  2R7H A;  4FD6 A;  2B5G A;  3EC4 A;  2AE6 A;  4IF5 A;  5C82 A;  4NXY A;  3TO9 A;  2HUZ A;  2YGW A;  5DWM A;  4I49 A;  3LD2 A;  2OB0 A;  4B5O A;  3TO7 A;  3TE4 A;  4OAE A;  2JLM A;  3DDD A;  2GE3 A;  3FNC A;  3TOA A;  2PSW A;  1KZF A;  1RO5 A;  2JEV A;  4CAW A;  1B87 A;  3EY5 A;  1BO4 A;  3FYN A;  5G22 A;  5KTC A;  4H89 A;  4KZT A;  1Z9U A;  2J8N A;  3EXN A;  2Q4Y A;  3W6S A;  4B13 A;  1M44 A;  3F8K A;  2VBQ A;  2P6G A;  1I21 A;  3P2F A;  4L8A A;  2R98 A;  1LRZ A;  4FD5 A;  4MFJ A;  3V8I A;  1YVK A;  2B58 A;  4KOU A;  1M4I A;  2FL4 A;  4KLW A;  4KUB A;  1Z4E A;  1Q2D A;  4C7H A;  5ISV A;  3FRM A;  4AB7 A;  4MFL A;  1IB1 E;  2EUI A;  2PR1 A;  3F5B A;  2CNS A;  1NMT A;  3R96 A;  4KOV A;  2B4D B;  5KTA A;  3FXT A;  3SHP A;  2YNE A;  5EBV A;  2X7B A;  4MY3 A;  2Z11 A;  3BJ8 A;  2Z3L A;  2FCK A;  2EVN A;  2D4O A;  3KKW A;  3F0A A;  4ZBG A;  2I00 A;  2QIR A;  3CXQ A;  5FVJ A;  4KVX A;  2ZW7 A;  4KOR A;  1Q2Y A;  4CGP A;  3TOB A;  2Z3N A;  2P6E A;  4MI4 A;  1S7L A;  4C2Y A;  3TO6 A;  4KSF A;  4UCM A;  2G3A A;  4LUA A;  4A95 A;  4F0X A;  3PGP A;  1TIQ A;  2Z3P A;  2J8M A;  3WR7 A;  4U9Y A;  4UFV A;  3G3S A;  2Q7B A;  2BUE A;  1WK4 A;  4KOT A;  1FY7 A;  1ZO0 A;  1P0H A;  4C68 A;  5IX3 A;  3SXO A;  3EO4 A;  2H5M A;  1UFH A;  4CRY B;  4EVY A;  2VZZ A;  4H6U A;  1Y9W A;  2FXF A;  4UBR A;  2BEI A;  3VWD A;  2VI7 A;  1XMT A;  4AG9 A;  3H5Z A;  4YRH A;  4NEX A;  2VQY A;  2PRB A;  2VEZ A;  3DSB A;  3R9G A;  5C88 A;  3I9S A;  2BL1 A;  4MFP A;  2VZY A;  2WPX A;  1L0C A;  1SQH A;  4CAV A;  2OZU A;  3JTK A;  2REF A;  4M85 A;  4AVC A;  4JWP A;  1S5K A;  2B4D A;  4QC6 A;  1NE9 A;  2QEC A;  5IB0 A;  2QML A;  2DPS A;  3S6K A;  5IV0 A;  2YNC A;  1S60 A;  2Z3K A;  2HQY A;  3NE7 A;  4QUS A;  4PSW A;  1MK4 A;  3G8W A;  4QB9 A;  3QAH A;  5F47 A;  1WWZ A;  2R8V A;  2GIV A;  4E2A A;  2NMT A;  4HNY B;  4CGL A;  1KUX A;  1I12 A;  2OZG A;  2BSW A;  4MFK A;  2A4N A;  4NF1 A;  1RXT A;  2KCW A;  3FIX A;  1QSR A;  4Q36 A;  4R3L A;  4CGO A;  2ARH A;  3JUW A;  4B11 A;  4UWJ A;  4FD4 A;  2RC4 A;  3R9E A;  5I0C A;  3FB3 A;  4UCN A;  4B5P A;  3C26 A;  1NSL A;  3R95 A;  4YFJ A;  3T9Y A;  4R3K A;  2Z0Z A;  2Y0M A;  4MY0 A;  4MBU A;  1YR0 A;  4J3G A;  4KOS A;  4XNH C;  3R9F A;  4BMH A;  4MHD A;  3S6F A;  1VKC A;  5H86 A;  4II9 A;  4B12 A;  4B5P B;  4R57 A;  1OZP A;  1XE4 A;  4RI1 A;  3GYA A;  2FIA A;  3OWC A;  4HNW B;  4HKF A;  3ZJ0 A;  4JXQ A;  5F48 A;  4XPD C;  2ZW6 A;  3N7Z A;  5F46 A;  2J8R A;  1V0C A;  3IWE A;  5AG6 A;  1Y9K A;  4F6A A;  2GAN A;  3CXS A;  4KLV A;  4MFQ A;  4KSA A;  4ONU A;  5E96 A;  1MJB A;  1IIC A;  4YGO A;  1QSN A;  1ON0 A;  3SXN A;  4B14 A;  2FSR A;  2YND A;  4IUS A;  1QSO A;  1IID A;  3EFA A;  3IWG A;  3W91 A;  2P0W A;  3T90 A;  1S7N A;  3S6H A;  4CAX A;  4FD7 A;  4E0A A;  2Q4V A;  3PP9 A;  2Z3M A;  1S7K A;  2CNT A;  4NCZ A;  2Z10 A;  4KVM E;  4PSX A;  3TCV A;  4MFZ A;  1YVO A;  1QST A;  3P2H A;  2FS5 A;  4CGM A;  4UFX A;  4L89 A;  2DXQ A;  4BBH A;  4C7I A;  2CY2 A;  1YGH A;  4UFW A;  3D2M A;  3D8P A;  5AG7 A;  1M4D A;  4JXR A;  4U9Z A;  3TT2 A;  2K5T A;  3A9L A;  1VHS A;  2AJ6 A;  4E8O A;  1YX0 A;  2G0B A;  4M3S A;  5KTD A;  4OLL A;  1I1D A;  3DR8 A;  2B3V A;  2G3T A;  1N71 A;  2B5G B;  2WUU A;  2Q44 A;  4CYQ A;  5G1Z A;  4KOX A;  4Q38 A;  1Q2C A;  4CYP A;  4A33 A;  2PDO A;  3TFY A;  4CYO A;  5H84 A;  3D2P A;  4ZGY B;  1M4G A;  2O28 A;  3BLN A;  1R57 A;  4CS0 B;  4GS4 A;  4A32 A;  3H4Q A;  1Z4R A;  2IL4 A;  2OH1 A;  2FIW A;  4AVB A;  3MGD A;  1KUV A;  4JJX A;  1XF8 A;  4KS9 A;  1B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...