2F5IA

X-ray structure of spermidine/spermine n1-acetyltransferase (sat) from homo sapiens
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
167
structure length
167
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 39
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2f5iA00
2OU2A 4NSQA 3T9YA 3RYOA 2CNTA 3C26A 5FVJA 4CAWA 1BOBA 2HQYA 2CNMA 4KLWA 1YGHA 3GYAA 2I79A 2J8RA 1NMTA 1OZPA 4YFJA 2FIAA 4NEXA 5HMNA 4XPDB 2AE6A 1S7NA 1B6BA 2REFA 2P0WA 3W6SA 3JVNA 3S6FA 1NSLA 4AG7A 3CXQA 5KTDA 3DR6A 2PQ8A 1NE9A 3F5BA 2Q04A 2FE7A 4JWPA 3LODA 3P2FA 4MHDA 3S6HA 5F46A 4B5PB 2VI7A 3CXSA 4LX9A 1IYLA 3EC4A 4JXQA 1LRZA 4U9ZA 1XE4A 5KTCA 3N7ZA 2REEA 3DSBA 1R57A 3W91A 2Z10A 4XPLA 2PRBA 3TO9A 3GY9A 2I00A 3D8PA 2QECA 3TE4A 1MK4A 3D2MA 3EFAA 3G8WA 2VQYA 3QB8A 4XNHB 2B3VA 1I12A 1SQHA 2C27A 2QIRA 4LUAA 2CY2A 3DDDA 2B3UA 1PU9A 1V0CA 3EY5A 4QC6A 3LD2A 3TO6A 2WPWA 3CXPA 3SHPA 2JLMA 5EBVA 1GHEA 2D4OA 1QSTA 5J8FA 1B87A 4KLVA 5GCNA 2VZZA 2OB0A 4AVCA 1I1DA 4FD4A 4OADA 1YK3A 2FIWA 2QMLA 1M1DA 4F6AA 3GKRA 1S7LA 2R7HA 3B8GA 2FXFA 1IIDA 4UWJA 3F0AA 1Z9UA 2Q7BA 3SXOA 4X5KA 3WR7A 2H5MA 2JDDA 1QSNA 2ZW5A 4R87A 4KOXA 2R1IA 1XIXA 4Y49B 4J3GA 3R95A 4MJ8A 4CAXA 4AG9A 2A4NA 3FB3A 4KOYA 2FSRA 3BJ7A 2X7BA 4IUSA 3VWEA 2ZW4A 3FBUA 3R9FA 3D2PA 3FYNA 4AVBA 1WK4A 1S7KA 2ARHA 5EC4A 3R1KA 1MJBA 4ORFA 1VHSA 4XPDC 4U5YA 3S6GA 4AB7A 2O28A 1U6MA 4KVXA 4H89A 1Y9KA 4MY3A 2F5IA 2BUEA 4OAEA 1Y7RA 4KUBA 3I3GA 4CRZB 3S6KA 1N71A 1J4JA 2ZPAA 4QB9A 3T90A 3BLNA 1QSMA 2BL1A 4KOVA 4UWIA 1YR0A 4H6ZA 2OZUA 4JLYA 2ATRA 3EO4A 5HH1A 3FRMA 1Y9WA 2Z11A 4E8OA 3H4QA 3TT2A 2P6FA 3I9SA 2FT0A 1MJ9A 1K4JA 1XEBA 2D4PA 3K9UA 4BMHA 4B5PA 4F0YA 2Q44A 4I49A 2FL4A 1I21A 4AVAA 4CS0B 1KZFA 4XNHC 5J8CA 1YLEA 2P6EA 1IB1E 1RXTA 3FXTA 4RS2A 3PP9A 2IL4A 2CNSA 5KTAA 2Y0MA 4PSXA 2B5GB 4DNCA 1RO5A 4PK2A 3FNCA 3TOAA 3PZJA 3UY5A 1S3ZA 5ISVA 1ON0A 2PR1A 1YX0A 5F47A 5IB0A 4QUSA 1QSRA 5C82A 3EXNA 1VKCA 4HNWB 4UBRA 2FS5A 3MGDA 4PV6A 2DXQA 4R9MA 4M3SA 3TOBA 5F48A 3SXNA 3W6XA 2GIVA 2WPXA 1P0HA 4FD5A 1L0CA 1YVKA 2NMTA 4GS4A 1MJAA 4Y49C 5H84A 1KUXA 2B4DA 2ZXVA 2Q4YA 3ZJ0A 4ONUA 4KVME 4MBUA 3JUWA 2GE3A 3IWGA 3QAHA 4HKFA 1CM0A 2PSWA 1Z4EA 2J8NA 4RI1A 2B58A 2ZW7A 4NF1A 3BJ8A 5JQ4A 2VXKA 4L8AA 1CJWA 4R57A 4KORA 2ZW6A 2R8VA 3F8KA 2PDOA 1IICA 3E0KA 2BSWA 4NXYA 5DWNA 3D3SA 1S5KA 4YRHA 4R3LA 4HNYB 4KOWA 2OH1A 1XMTA 3PGPA 3P2HA 4M85A 3KKWA 5H86A 2BEIA 3TCVA 4KVOE 5IX3A 5JPHA 5F49A 3DNSA 2VBQA 4JJXA 2KCWA 4CAVA 1S60A 1TIQA 3VWDA 1P4NA 4JXRA 1M4IA 2VEZA 4HNXB 1M44A 4E0AA 4H6UA 5CNPA 4II9A 1Z4RA 2P6GA 4NCZA 4MI4A 3ZZIA 2HV2A 4OLLA 1UFHA 1BO4A 2Q4VA 3FIXA 2PR8A 1WWZA 2EVNA 4PSWA 1M4GA 3TFYA 3OWCA 5I0CA 4PK3A 4E2AA 2EUIA 2JEVA 2OZHA 4K30A 3TTHA 3DR8A 4B5OA 4U9YA 3V8IA 3G3SA 2J8MA 2OZGA 3TO7A 5IV0A 2HUZA 1KUYA 4IF5A 1IYKA 1QSOA 4L89A 5DWMA 2K5TA 3R96A 4KOUA 1KUVA 2B5GA 4FD6A 2VZYA 1S7FA 2R98A 3IGRA 1M4DA 2G0BA 2FCKA 1Q2YA 1Q2DA 1FY7A 1PUAA 2B4BA 2Z0ZA 4CRYB 4KUAA 2G3TA 2GANA 4XPKA 2G3AA 5C88A 2JDCA 4KOSA 1Q2CA 5E96A 1YVOA 2PC1A 4R3KA 1XF8A 2RC4A 2B4DB 4KZTA 3NE7A 4YGOA 3R9EA 4UA3A 2AJ6A 2Q0YA 4MY0A 4QVTA 4KOTA 4ZBGA 3R9GA 1YREA 4JD6A 4QBJA 4FD7A 4EVYA
chains in the Genus database with same CATH superfamily
1R43A 2OU2A 2HB6A 2IMOA 2PE3A 5J1QA 4NSQA 4G1PA 4ZX9A 1ZLHA 3T9YA 3RYOA 2C6PA 2JBJA 3SJXA 2CNTA 2YNDA 4PPZA 2ZEPA 4F9VA 3IEHA 3C26A 5FVJA 4CAWA 4NGNA 4C7HA 4UF4A 2EO8A 5D8NA 3I1UA 1BOBA 2Q4ZA 2HQYA 2CNMA 2XEFA 4KLWA 1YGHA 3GYAA 2I79A 3A9LA 5HVGA 1VHOA 2J8RA 1NMTA 1OZPA 3PBBA 4CPAA 2FIAA 2QJ8A 3B2YA 5ELYA 4YFJA 4NEXA 2V8HA 5HMNA 4XPDB 2AE6A 4EMEA 4A94A 3SI0A 1S7NA 1B6BA 2REFA 1BPMA 2ABZA 2P0WA 4GXHA 5AG5A 3W6SA 4CYPA 3JVNA 5LYLA 3S6FA 1NSLA 1YSJA 4AG7A 8CPAA 2PCUA 3CXQA 3K9TA 3JRUA 4MFKA 5KTDA 3DR6A 2PQ8A 1NE9A 2POKA 3H8GA 3F5BA 1TF8A 2Q04A 4B14A 2FE7A 4CGPA 4JWPA 4AXVA 3LODA 3KQZA 3P2FA 4MHDA 5HVHA 3S6HA 5F46A 4MMOA 4UIAA 3KASA 3PRTA 4B5PB 1DE4C 3NH4A 2VI7A 3CXSA 3KGQA 3KR5A 1IYLA 4LX9A 3TX8A 4A39A 6CPAA 3EC4A 2PVVA 4JXQA 1LRZA 4U9ZA 3FMCA 2F8HA 4LQ6A 1XE4A 3B3VA 4MFJA 3N7ZA 4WWVA 4A38A 5KTCA 1IOFA 4F0XA 4JZ0A 2REEA 4Q36A 7CPAA 3DSBA 1R57A 3W91A 1ZLIA 2Z10A 4MCQA 2PRBA 1Y7EA 4P6YA 4XPLA 4X3RA 3TO9A 3GY9A 2ODFA 3S9LA 1CP6A 2I00A 3D8PA 4ZX8A 3V7ZA 3IU2A 4NGMA 2QECA 2BO9A 3TE4A 2Z3OA 4Q7AA 2G9DA 4B11A 1YW6A 1MK4A 3B35A 3D2MA 3EFAA 3G8WA 2AFZA 1Z8LA 3PEIA 2ZEOA 2VQYA 1Y0RA 1TF9A 3DGVA 3HLPA 4P4IA 3QB8A 1ARMA 1HDUA 3FEEA 4XNHB 2B3VA 2PJ9A 4DJLA 1I12A 2DPSA 1F2OA 3PFOA 1SQHA 2C27A 3IFEA 3V38A 2QIRA 4LUAA 2ZOFA 3B7IA 2CY2A 2ZOGA 2B3UA 3DDDA 1PU9A 1V0CA 3EY5A 4QC6A 3LD2A 3TO6A 4MFZA 4UCNA 3TC8A 4PXBA 2WPWA 3CXPA 3SHPA 4CGLA 2JLMA 5EBVA 1DTDA 1GHEA 2D4OA 4DYOA 1LCPA 2PJBA 4B13A 1QSTA 1KWMA 5J8FA 2Q43A 3B3SA 2GLJA 1B87A 4KLVA 1BAVA 5GCNA 2C1CA 2VZZA 1LFWA 1CG2A 2OB0A 4MFPA 3LWUA 4OKOA 1YQEA 1JQGA 4AVCA 1I1DA 5THWA 3FEDA 3CZXA 4FD4A 4OADA 1YK3A 1HEEA 2FIWA 2QMLA 1M1DA 1IGBA 4MCRA 4F6AA 3KZWA 5K8OA 2EBJA 3GKRA 4CAFA 1S7LA 4TNUA 2DPTA 3T8WA 2R7HA 2PRQA 4CYOA 3B8GA 2FXFA 3PB7X 1IIDA 4UWJA 3D4UA 3F0AA 3WABA 1Z9UA 2Q7BA 3SXOA 4X5KA 3WR7A 4R6TA 2H5MA 3ISZA 3BXMA 2JDDA 1QSNA 2ZW5A 4R87A 4KOXA 2R1IA 4EWTA 3H8EA 4LQGA 4UFVA 1ARLA 1XIXA 2AFOA 4Y49B 2ZEFA 2AFXA 4J3GA 3R95A 4MJ8A 4ONWA 4CAXA 4AG9A 2A4NA 3FB3A 4KOYA 4CAEA 4CYNA 2FSRA 3BJ7A 2X7BA 4IUSA 4OP4A 2ZW4A 3FBUA 3R9FA 3D2PA 3VWEA 3FYNA 5IB9A 4C2ZA 4AVBA 1WK4A 1S7KA 3IIBA 2AFSA 4PXDA 1BPNA 4PQAA 4FBEA 2ARHA 5EC4A 2ZEMA 1MJBA 3KR4A 3R1KA 1LAMA 4OMEA 4NJRA 4ORFA 1VHSA 3H8FA 3MN8A 4U5YA 4XPDC 3S6GA 1Z8TA 3NFZA 4AB7A 2O28A 1U6MA 3PB8X 4KVXA 3HUVA 4H89A 3BI1A 2PJ8A 2QYVA 2CIJA 5K8NA 1CX8A 1Y9KA 4MY3A 3D67A 2F5IA 1CP7A 2BUEA 4OAEA 4OIDA 1ZG9A 1Y7RA 4KUBA 4CGMA 1ZG8A 4IK2A 2PJ6A 3I3GA 4PXCA 1RTQA 2V77A 4CRZB 3S6KA 3PFEA 1N71A 1J4JA 2ZPAA 1PYTB 4QB9A 2V8DA 3SI1A 3T90A 3D7HA 3BLNA 1QSMA 2BL1A 4KOVA 4UWIA 1IU8A 1YR0A 4H6ZA 4MRIA 2OZUA 3FH4A 2ATRA 3EO4A 4JLYA 5HH1A 3FRMA 4PXEA 5DS0A 2NSMA 2XEJA 2PIZA 1Y9WA 2Z11A 4E8OA 3H4QA 3FVLA 2Q51A 4P4FA 3TT2A 2P6FA 3I9SA 2FT0A 1MJ9A 5K8MA 1K4JA 1CBXA 1XEBA 4O23A 1YW4A 1F57A 2D4PA 3D68A 5LYIA 1X12A 2CXAA 3K9UA 4IHMA 4F8ZA 3S9MA 3NH5A 4BMHA 1TKHA 4B5PA 4F0YA 2RB7A 3BHXA 3NE8A 2Q44A 4RN7A 4I49A 4P45A 5JH9A 2FL4A 1I21A 2RFHA 4AVAA 5LRKA 4CS0B 1KZFA 4XNHC 2ZEDA 3DLJA 2Z3KA 4B6ZA 5J8CA 1YLEA 3CPAA 4GM5A 5JGFA 1RXTA 1IB1E 2P6EA 3SJFA 3H5ZA 3PB6X 3WC6A 2Z3PA 5AG7A 5G1ZA 3FXTA 4CGNA 2NYQA 4P4JA 3PP9A 4RS2A 1Z8WA 4A37A 2AFWA 1ELLP 2IL4A 2PJ1A 5EMIA 2IJZA 2CNSA 4ZY2A 5I4MA 1Q7LA 3WT4A 4P10A 4ZY0A 5KTAA 2Y0MA 3VH9A 4PSXA 2B5GB 4P4EA 1RO5A 3KQXA 4TWEA 4DNCA 4PK2A 3FNCA 2XEIA 5A28A 3PB4X 3TOAA 4MHYA 3PZJA 3UY5A 1S3ZA 4IAVA 5ISVA 5HXDA 4M6IA 2ZEHA 1ON0A 3FJUA 1EE3P 2PR1A 4KS9A 1YX0A 3KHXA 1YMEA 3B3CA 3GUXA 1YLOA 3IU1A 4UFXA 5F47A 3SJEA 3VATA 3FF3A 5BWAB 4W9YA 3JTKA 5IB0A 2ZEEA 1QSRA 1CPSA 4QUSA 5C82A 3EXNA 1VKCA 4HNWB 4UBRA 1ELMP 2CTBA 1CPXA 3NH8A 1Z5RA 2FS5A 3D7GA 3MGDA 1Z8XA 1XRYA 2V8GA 2WZNA 2Z3NA 2J9AA 1FNOA 4PV6A 2DXQA 3IWEA 4R9MA 3D7FA 4M3SA 3TOBA 1Z2LA 3GB0A 5F48A 3SXNA 3W6XA 2GIVA 3LMSA 2EK9A 4CGOA 5F09A 2V8VA 1P0HA 2WPXA 4FD5A 2VL1A 2IQ6A 4CYQA 2WSAA 4R8FA 4UCPA 4EFDA 1L0CA 1YVKA 1M4LA 2NMTA 2PIYA 4GS4A 4OC0A 1MJAA 4H2KA 4NFRA 4Y49C 5H84A 2YNCC 1AMPA 1KUXA 2B4DA 5K8PA 2ZXVA 2Q4YA 2YGWA 3MRUA 4MXUA 4ONUA 3ZJ0A 3S9NA 4KVME 4MBUA 5JM6A 4C2YA 3JUWA 3QAYA 2GE3A 2GLFA 3IWGA 1HDQA 1QMUA 3QAHA 4HKFA 4NGQA 5AGEA 3IWWA 1CM0A 1H8LA 4YU9A 4X8IA 2PSWA 1Z4EA 2J8NA 3GLJA 2B58A 2ZW7A 4RI1A 4NF1A 3BJ8A 3KI9A 2ZEGA 5JQ4A 2CTCA 5G22A 2VXKA 4L8AA 4MHNA 1CJWA 2ANPA 4R57A 4KORA 4FAIA 2ZW6A 2R8VA 3F8KA 1XFOA 3RZAA 2PDOA 1X10A 1IICA 2GREA 2PJCA 3E0KA 3WC5A 4C7IA 1XOVA 1AYEA 2YNCA 2BSWA 3GIUA 4WJBA 4NXYA 5DWNA 3D3SA 1S5KA 3BI0A 4YRHA 4HPSA 2WUUA 4R3LA 4UEFA 5AG4A 4BBHA 2EK8A 1XJOA 4NGRA 4HNYB 4UIBA 4KOWA 4A33A 4KSFA 4X2TA 2O53A 2HC9A 3SI2A 2OH1A 2ZELA 1XMTA 4A31A 1ZO0A 5LRJA 1FT7A 1BLLE 2PJ2A 4NGPA 3L2NA 3PGPA 4UFWA 4M6GA 3P2HA 4FWUA 4M85A 5AG6A 2OOTA 3KKWA 1LANA 2Z3LA 2I3CA 5H86A 2BEIA 3TCVA 4A30A 1VGYA 2Q7SA 3D7DA 4KVOE 5IX3A 5JPHA 1PCAA 5F49A 3DNSA 2VBQA 4JJXA 3QNVA 2KCWA 2DEAA 2BCOA 4NJQA 4CAVA 1S60A 1TIQA 3VWDA 5D29A 2PJ7A 1P4NA 2F7VA 1VIXA 1M4IA 2VEZA 4JXRA 1QQ9A 1M44A 4HNXB 5CPAA 4F9UA 4Z65A 4E0AA 2PJ4A 4H6UA 3D66A 2CF4A 4JYWA 5CNPA 2EWBA 4II9A 3N5FA 3CPXA 1Z4RA 4MFQA 4BINA 1XMBA 2P6GA 2AFUA 4MHZA 3RBUA 3VARA 4NCZA 4MI4A 3ZZIA 3K2KA 2HV2A 3PBEA 4M6HA 4R76A 4ZI6A 4OLLA 4OC1A 1UFHA 3KL9A 4C2XA 3IC1A 1BO4A 2Q4VA 4NGTA 4MFLA 3FIXA 4OC3A 2PR8A 1LAPA 1NSAA 1WWZA 4UEEA 2EVNA 4PSWA 1M4GA 3TFYA 3OWCA 4K3NA 3B3WA 2PJAA 5I0CA 3PB9X 4PK3A 4E2AA 2EUIA 2JEVA 2OZHA 5LYFA 1XBUA 4K30A 2C6CA 4A32A 3TTHA 3DR8A 2YNEA 1IOIA 4B5OA 2OR4A 1TXRA 4U9YA 3V8IA 2XEGA 2JBKA 4MCSA 3G3SA 3ISXA 5CBMA 4B10A 2J8MA 2OZGA 4A2ZA 2BOAA 3IO1A 3TO7A 5IV0A 2HUZA 1KUYA 3SJGA 4IF5A 1IYKA 3RO0A 1QSOA 1IY7A 4L89A 5DWMA 2K5TA 2WYRA 2Z3MA 3R96A 2PJ5A 4KOUA 1KUVA 4UEZA 4BD9A 4YWYA 2B5GA 1Y0YA 4FD6A 2VZYA 1S7FA 4B12A 2R98A 3IGRA 4ZYQA 1M4DA 2AFMA 2QVPA 2C6GA 2G0BA 5HVFA 2FCKA 1Q2YA 5LRGA 1Q2DA 1FY7A 2PJ0A 1PUAA 2B4BA 4OC4A 2Z0ZA 4CRYB 4KUAA 2G3TA 2GANA 4XPKA 2G3AA 5C88A 2ZENA 1TKFA 3WC7A 4DUKA 4FUUA 2JDCA 3KHZA 4KOSA 4EVYA 3LACA 5A27A 1Q2CA 4P4DA 5E96A 1YVOA 3B3TA 3RNZA 2PC1A 4P4BA 4NGSA 1XF8A 4R3KA 4UCMA 4RUHA 2RC4A 1F2PA 1LOKA 1TKJA 2O4HA 3CT9A 2B4DB 3CDXA 4KZTA 2JEWA 4KSIA 3NE7A 4KSAA 4ZGYB 1GYTA 3NA6A 4YGOA 3R9EA 1JWQA 4ZY1A 4UA3A 2AJ6A 1R3NA 2PJ3A 1ZG7A 3IJ3A 4OC2A 5G21A 3FECA 2Q0YA 1OBRA 4MY0A 4QVTA 3RAMA 2PVWA 1A2ZA 4A95A 4MHPA 1AUGA 4OIWA 1VHEA 4KOTA 4ZBGA 3R9GA 5G20A 4C68A 2FVGA 1UWYA 4P44A 1YREA 3FX6A 2DF5A 2GU2A 4JD6A 4Q38A 5LYDA 4QBJA 4FD7A 4OC5A 2GFQA 4R7MA 4MCPA
chains in the Genus database with same CATH topology
2OU2A 4NSQA 3T9YA 3RYOA 2CNTA 2YNDA 3C26A 5FVJA 4CAWA 4C7HA 1BOBA 2HQYA 2CNMA 4KLWA 1YGHA 3GYAA 2I79A 3A9LA 2J8RA 1NMTA 1OZPA 4YFJA 2FIAA 4NEXA 5HMNA 4XPDB 2AE6A 1S7NA 1B6BA 2REFA 2P0WA 5AG5A 3W6SA 4CYPA 3JVNA 3S6FA 1NSLA 4AG7A 3CXQA 4MFKA 5KTDA 3DR6A 2PQ8A 1NE9A 3F5BA 2Q04A 4B14A 2FE7A 4CGPA 4JWPA 3LODA 3P2FA 4MHDA 3S6HA 5F46A 4B5PB 2VI7A 3CXSA 4LX9A 1IYLA 3EC4A 4JXQA 1LRZA 4U9ZA 1XE4A 4MFJA 5KTCA 3N7ZA 4F0XA 4Q36A 2REEA 3DSBA 1R57A 3W91A 2Z10A 4XPLA 2PRBA 3TO9A 3GY9A 2I00A 3D8PA 3IU2A 2QECA 3TE4A 2Z3OA 4B11A 1MK4A 3D2MA 3EFAA 3G8WA 2VQYA 3QB8A 4XNHB 2B3VA 1I12A 2DPSA 1SQHA 2C27A 2QIRA 4LUAA 2CY2A 3DDDA 2B3UA 1PU9A 1V0CA 3EY5A 4QC6A 3LD2A 3TO6A 4MFZA 4UCNA 4CGLA 2WPWA 3CXPA 3SHPA 2JLMA 5EBVA 1GHEA 2D4OA 4B13A 1QSTA 5J8FA 1B87A 4KLVA 5GCNA 2VZZA 2OB0A 4MFPA 4AVCA 1I1DA 4FD4A 4OADA 1YK3A 2FIWA 2QMLA 1M1DA 4F6AA 3GKRA 4CAFA 1S7LA 2DPTA 2R7HA 4CYOA 3B8GA 2FXFA 1IIDA 4UWJA 3F0AA 1Z9UA 2Q7BA 3SXOA 4X5KA 3WR7A 2H5MA 2JDDA 1QSNA 2ZW5A 4R87A 4KOXA 2R1IA 4UFVA 1XIXA 4Y49B 4J3GA 3R95A 4MJ8A 4CAXA 4AG9A 2A4NA 3FB3A 4KOYA 4CAEA 4CYNA 2FSRA 3BJ7A 2X7BA 4IUSA 3VWEA 2ZW4A 3FBUA 3R9FA 3D2PA 3FYNA 4C2ZA 4AVBA 1WK4A 1S7KA 2ARHA 5EC4A 3R1KA 1MJBA 4ORFA 1VHSA 4XPDC 4U5YA 3S6GA 4AB7A 2O28A 1U6MA 4KVXA 4H89A 1Y9KA 4MY3A 2F5IA 2BUEA 4OAEA 1Y7RA 4KUBA 4CGMA 3I3GA 4CRZB 3S6KA 1N71A 1J4JA 2ZPAA 4QB9A 3T90A 3BLNA 1QSMA 2BL1A 4KOVA 4UWIA 1YR0A 4H6ZA 2OZUA 4JLYA 2ATRA 3EO4A 5HH1A 3FRMA 1Y9WA 2Z11A 4E8OA 3H4QA 3TT2A 2P6FA 3I9SA 2FT0A 1MJ9A 1K4JA 1XEBA 2D4PA 2CXAA 3K9UA 4BMHA 4B5PA 4F0YA 2Q44A 4I49A 2FL4A 1I21A 4AVAA 4CS0B 1KZFA 4XNHC 2Z3KA 5J8CA 1YLEA 2P6EA 1IB1E 1RXTA 3H5ZA 2Z3PA 5AG7A 5G1ZA 3FXTA 4CGNA 4RS2A 3PP9A 2IL4A 2CNSA 5KTAA 2Y0MA 4PSXA 2B5GB 4DNCA 1RO5A 4PK2A 3FNCA 5A28A 3TOAA 3PZJA 3UY5A 1S3ZA 5ISVA 1ON0A 2PR1A 4KS9A 1YX0A 3IU1A 4UFXA 5F47A 5BWAB 3JTKA 5IB0A 4QUSA 1QSRA 5C82A 3EXNA 1VKCA 4HNWB 4UBRA 2FS5A 3MGDA 2Z3NA 4PV6A 2DXQA 3IWEA 4R9MA 4M3SA 3TOBA 5F48A 3SXNA 3W6XA 2GIVA 4CGOA 2WPXA 1P0HA 4FD5A 4CYQA 2WSAA 4UCPA 1L0CA 1YVKA 2NMTA 4GS4A 1MJAA 4Y49C 5H84A 2YNCC 1KUXA 2B4DA 2ZXVA 2Q4YA 2YGWA 3ZJ0A 4ONUA 4KVME 4MBUA 4C2YA 3JUWA 2GE3A 3IWGA 3QAHA 4HKFA 5AGEA 1CM0A 2PSWA 1Z4EA 2J8NA 4RI1A 2B58A 2ZW7A 4NF1A 3BJ8A 5JQ4A 5G22A 2VXKA 4L8AA 1CJWA 4R57A 4KORA 2ZW6A 2R8VA 3F8KA 2PDOA 1IICA 3E0KA 4C7IA 2YNCA 2BSWA 4NXYA 5DWNA 3D3SA 1S5KA 4YRHA 2WUUA 4R3LA 5AG4A 4BBHA 4HNYB 4KOWA 4A33A 4KSFA 2OH1A 1XMTA 4A31A 1ZO0A 3PGPA 4UFWA 3P2HA 4M85A 5AG6A 3KKWA 2Z3LA 5H86A 2BEIA 3TCVA 4A30A 4KVOE 5IX3A 5JPHA 5F49A 3DNSA 2VBQA 4JJXA 2KCWA 4CAVA 1S60A 1TIQA 3VWDA 1P4NA 4JXRA 1M4IA 2VEZA 4HNXB 1M44A 4E0AA 4H6UA 5CNPA 4II9A 1Z4RA 4MFQA 2P6GA 4NCZA 4MI4A 3ZZIA 2HV2A 4OLLA 1UFHA 4C2XA 1BO4A 2Q4VA 4MFLA 3FIXA 2PR8A 1WWZA 2EVNA 4PSWA 1M4GA 3TFYA 3OWCA 5I0CA 4PK3A 4E2AA 2EUIA 2JEVA 2OZHA 4K30A 4A32A 3TTHA 3DR8A 2YNEA 4B5OA 4U9YA 3V8IA 3G3SA 4B10A 2J8MA 2OZGA 4A2ZA 3TO7A 5IV0A 2HUZA 1KUYA 4IF5A 1IYKA 1QSOA 4L89A 5DWMA 2K5TA 2Z3MA 3R96A 4KOUA 1KUVA 2B5GA 4FD6A 2VZYA 1S7FA 4B12A 2R98A 3IGRA 1M4DA 2G0BA 2FCKA 1Q2YA 1Q2DA 1FY7A 1PUAA 2B4BA 2Z0ZA 4CRYB 4KUAA 2G3TA 2GANA 4XPKA 2G3AA 5C88A 2JDCA 4KOSA 5A27A 1Q2CA 5E96A 1YVOA 2PC1A 4R3KA 1XF8A 4UCMA 2RC4A 2B4DB 4KZTA 3NE7A 4KSAA 4ZGYB 4YGOA 3R9EA 4UA3A 2AJ6A 5G21A 2Q0YA 4MY0A 4QVTA 4A95A 4KOTA 4ZBGA 3R9GA 5G20A 4C68A 1YREA 4JD6A 4Q38A 4QBJA 4FD7A 4EVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU2 A;  4NSQ A;  3T9Y A;  3RYO A;  2CNT A;  3C26 A;  5FVJ A;  4CAW A;  1BOB A;  2HQY A;  2CNM A;  4KLW A;  1YGH A;  3GYA A;  2I79 A;  2J8R A;  1NMT A;  1OZP A;  4YFJ A;  2FIA A;  4NEX A;  5HMN A;  4XPD B;  2AE6 A;  1S7N A;  1B6B A;  2REF A;  2P0W A;  3W6S A;  3JVN A;  3S6F A;  1NSL A;  4AG7 A;  3CXQ A;  5KTD A;  3DR6 A;  2PQ8 A;  1NE9 A;  3F5B A;  2Q04 A;  2FE7 A;  4JWP A;  3LOD A;  3P2F A;  4MHD A;  3S6H A;  5F46 A;  4B5P B;  2VI7 A;  3CXS A;  4LX9 A;  1IYL A;  3EC4 A;  4JXQ A;  1LRZ A;  4U9Z A;  1XE4 A;  5KTC A;  3N7Z A;  2REE A;  3DSB A;  1R57 A;  3W91 A;  2Z10 A;  4XPL A;  2PRB A;  3TO9 A;  3GY9 A;  2I00 A;  3D8P A;  2QEC A;  3TE4 A;  1MK4 A;  3D2M A;  3EFA A;  3G8W A;  2VQY A;  3QB8 A;  4XNH B;  2B3V A;  1I12 A;  1SQH A;  2C27 A;  2QIR A;  4LUA A;  2CY2 A;  3DDD A;  2B3U A;  1PU9 A;  1V0C A;  3EY5 A;  4QC6 A;  3LD2 A;  3TO6 A;  2WPW A;  3CXP A;  3SHP A;  2JLM A;  5EBV A;  1GHE A;  2D4O A;  1QST A;  5J8F A;  1B87 A;  4KLV A;  5GCN A;  2VZZ A;  2OB0 A;  4AVC A;  1I1D A;  4FD4 A;  4OAD A;  1YK3 A;  2FIW A;  2QML A;  1M1D A;  4F6A A;  3GKR A;  1S7L A;  2R7H A;  3B8G A;  2FXF A;  1IID A;  4UWJ A;  3F0A A;  1Z9U A;  2Q7B A;  3SXO A;  4X5K A;  3WR7 A;  2H5M A;  2JDD A;  1QSN A;  2ZW5 A;  4R87 A;  4KOX A;  2R1I A;  1XIX A;  4Y49 B;  4J3G A;  3R95 A;  4MJ8 A;  4CAX A;  4AG9 A;  2A4N A;  3FB3 A;  4KOY A;  2FSR A;  3BJ7 A;  2X7B A;  4IUS A;  3VWE A;  2ZW4 A;  3FBU A;  3R9F A;  3D2P A;  3FYN A;  4AVB A;  1WK4 A;  1S7K A;  2ARH A;  5EC4 A;  3R1K A;  1MJB A;  4ORF A;  1VHS A;  4XPD C;  4U5Y A;  3S6G A;  4AB7 A;  2O28 A;  1U6M A;  4KVX A;  4H89 A;  1Y9K A;  4MY3 A;  2F5I A;  2BUE A;  4OAE A;  1Y7R A;  4KUB A;  3I3G A;  4CRZ B;  3S6K A;  1N71 A;  1J4J A;  2ZPA A;  4QB9 A;  3T90 A;  3BLN A;  1QSM A;  2BL1 A;  4KOV A;  4UWI A;  1YR0 A;  4H6Z A;  2OZU A;  4JLY A;  2ATR A;  3EO4 A;  5HH1 A;  3FRM A;  1Y9W A;  2Z11 A;  4E8O A;  3H4Q A;  3TT2 A;  2P6F A;  3I9S A;  2FT0 A;  1MJ9 A;  1K4J A;  1XEB A;  2D4P A;  3K9U A;  4BMH A;  4B5P A;  4F0Y A;  2Q44 A;  4I49 A;  2FL4 A;  1I21 A;  4AVA A;  4CS0 B;  1KZF A;  4XNH C;  5J8C A;  1YLE A;  2P6E A;  1IB1 E;  1RXT A;  3FXT A;  4RS2 A;  3PP9 A;  2IL4 A;  2CNS A;  5KTA A;  2Y0M A;  4PSX A;  2B5G B;  4DNC A;  1RO5 A;  4PK2 A;  3FNC A;  3TOA A;  3PZJ A;  3UY5 A;  1S3Z A;  5ISV A;  1ON0 A;  2PR1 A;  1YX0 A;  5F47 A;  5IB0 A;  4QUS A;  1QSR A;  5C82 A;  3EXN A;  1VKC A;  4HNW B;  4UBR A;  2FS5 A;  3MGD A;  4PV6 A;  2DXQ A;  4R9M A;  4M3S A;  3TOB A;  5F48 A;  3SXN A;  3W6X A;  2GIV A;  2WPX A;  1P0H A;  4FD5 A;  1L0C A;  1YVK A;  2NMT A;  4GS4 A;  1MJA A;  4Y49 C;  5H84 A;  1KUX A;  2B4D A;  2ZXV A;  2Q4Y A;  3ZJ0 A;  4ONU A;  4KVM E;  4MBU A;  3JUW A;  2GE3 A;  3IWG A;  3QAH A;  4HKF A;  1CM0 A;  2PSW A;  1Z4E A;  2J8N A;  4RI1 A;  2B58 A;  2ZW7 A;  4NF1 A;  3BJ8 A;  5JQ4 A;  2VXK A;  4L8A A;  1CJW A;  4R57 A;  4KOR A;  2ZW6 A;  2R8V A;  3F8K A;  2PDO A;  1IIC A;  3E0K A;  2BSW A;  4NXY A;  5DWN A;  3D3S A;  1S5K A;  4YRH A;  4R3L A;  4HNY B;  4KOW A;  2OH1 A;  1XMT A;  3PGP A;  3P2H A;  4M85 A;  3KKW A;  5H86 A;  2BEI A;  3TCV A;  4KVO E;  5IX3 A;  5JPH A;  5F49 A;  3DNS A;  2VBQ A;  4JJX A;  2KCW A;  4CAV A;  1S60 A;  1TIQ A;  3VWD A;  1P4N A;  4JXR A;  1M4I A;  2VEZ A;  4HNX B;  1M44 A;  4E0A A;  4H6U A;  5CNP A;  4II9 A;  1Z4R A;  2P6G A;  4NCZ A;  4MI4 A;  3ZZI A;  2HV2 A;  4OLL A;  1UFH A;  1BO4 A;  2Q4V A;  3FIX A;  2PR8 A;  1WWZ A;  2EVN A;  4PSW A;  1M4G A;  3TFY A;  3OWC A;  5I0C A;  4PK3 A;  4E2A A;  2EUI A;  2JEV A;  2OZH A;  4K30 A;  3TTH A;  3DR8 A;  4B5O A;  4U9Y A;  3V8I A;  3G3S A;  2J8M A;  2OZG A;  3TO7 A;  5IV0 A;  2HUZ A;  1KUY A;  4IF5 A;  1IYK A;  1QSO A;  4L89 A;  5DWM A;  2K5T A;  3R96 A;  4KOU A;  1KUV A;  2B5G A;  4FD6 A;  2VZY A;  1S7F A;  2R98 A;  3IGR A;  1M4D A;  2G0B A;  2FCK A;  1Q2Y A;  1Q2D A;  1FY7 A;  1PUA A;  2B4B A;  2Z0Z A;  4CRY B;  4KUA A;  2G3T A;  2GAN A;  4XPK A;  2G3A A;  5C88 A;  2JDC A;  4KOS A;  1Q2C A;  5E96 A;  1YVO A;  2PC1 A;  4R3K A;  1XF8 A;  2RC4 A;  2B4D B;  4KZT A;  3NE7 A;  4YGO A;  3R9E A;  4UA3 A;  2AJ6 A;  2Q0Y A;  4MY0 A;  4QVT A;  4KOT A;  4ZBG A;  3R9G A;  1YRE A;  4JD6 A;  4QBJ A;  4FD7 A;  4EVY A; 
#chains in the Genus database with same CATH topology
 1R43 A;  2OU2 A;  2HB6 A;  2IMO A;  2PE3 A;  5J1Q A;  4NSQ A;  4G1P A;  4ZX9 A;  1ZLH A;  3T9Y A;  3RYO A;  2C6P A;  2JBJ A;  3SJX A;  2CNT A;  2YND A;  4PPZ A;  2ZEP A;  4F9V A;  3IEH A;  3C26 A;  5FVJ A;  4CAW A;  4NGN A;  4C7H A;  4UF4 A;  2EO8 A;  5D8N A;  3I1U A;  1BOB A;  2Q4Z A;  2HQY A;  2CNM A;  2XEF A;  4KLW A;  1YGH A;  3GYA A;  2I79 A;  3A9L A;  5HVG A;  1VHO A;  2J8R A;  1NMT A;  1OZP A;  3PBB A;  4CPA A;  2FIA A;  2QJ8 A;  3B2Y A;  5ELY A;  4YFJ A;  4NEX A;  2V8H A;  5HMN A;  4XPD B;  2AE6 A;  4EME A;  4A94 A;  3SI0 A;  1S7N A;  1B6B A;  2REF A;  1BPM A;  2ABZ A;  2P0W A;  4GXH A;  5AG5 A;  3W6S A;  4CYP A;  3JVN A;  5LYL A;  3S6F A;  1NSL A;  1YSJ A;  4AG7 A;  8CPA A;  2PCU A;  3CXQ A;  3K9T A;  3JRU A;  4MFK A;  5KTD A;  3DR6 A;  2PQ8 A;  1NE9 A;  2POK A;  3H8G A;  3F5B A;  1TF8 A;  2Q04 A;  4B14 A;  2FE7 A;  4CGP A;  4JWP A;  4AXV A;  3LOD A;  3KQZ A;  3P2F A;  4MHD A;  5HVH A;  3S6H A;  5F46 A;  4MMO A;  4UIA A;  3KAS A;  3PRT A;  4B5P B;  1DE4 C;  3NH4 A;  2VI7 A;  3CXS A;  3KGQ A;  3KR5 A;  1IYL A;  4LX9 A;  3TX8 A;  4A39 A;  6CPA A;  3EC4 A;  2PVV A;  4JXQ A;  1LRZ A;  4U9Z A;  3FMC A;  2F8H A;  4LQ6 A;  1XE4 A;  3B3V A;  4MFJ A;  3N7Z A;  4WWV A;  4A38 A;  5KTC A;  1IOF A;  4F0X A;  4JZ0 A;  2REE A;  4Q36 A;  7CPA A;  3DSB A;  1R57 A;  3W91 A;  1ZLI A;  2Z10 A;  4MCQ A;  2PRB A;  1Y7E A;  4P6Y A;  4XPL A;  4X3R A;  3TO9 A;  3GY9 A;  2ODF A;  3S9L A;  1CP6 A;  2I00 A;  3D8P A;  4ZX8 A;  3V7Z A;  3IU2 A;  4NGM A;  2QEC A;  2BO9 A;  3TE4 A;  2Z3O A;  4Q7A A;  2G9D A;  4B11 A;  1YW6 A;  1MK4 A;  3B35 A;  3D2M A;  3EFA A;  3G8W A;  2AFZ A;  1Z8L A;  3PEI A;  2ZEO A;  2VQY A;  1Y0R A;  1TF9 A;  3DGV A;  3HLP A;  4P4I A;  3QB8 A;  1ARM A;  1HDU A;  3FEE A;  4XNH B;  2B3V A;  2PJ9 A;  4DJL A;  1I12 A;  2DPS A;  1F2O A;  3PFO A;  1SQH A;  2C27 A;  3IFE A;  3V38 A;  2QIR A;  4LUA A;  2ZOF A;  3B7I A;  2CY2 A;  2ZOG A;  2B3U A;  3DDD A;  1PU9 A;  1V0C A;  3EY5 A;  4QC6 A;  3LD2 A;  3TO6 A;  4MFZ A;  4UCN A;  3TC8 A;  4PXB A;  2WPW A;  3CXP A;  3SHP A;  4CGL A;  2JLM A;  5EBV A;  1DTD A;  1GHE A;  2D4O A;  4DYO A;  1LCP A;  2PJB A;  4B13 A;  1QST A;  1KWM A;  5J8F A;  2Q43 A;  3B3S A;  2GLJ A;  1B87 A;  4KLV A;  1BAV A;  5GCN A;  2C1C A;  2VZZ A;  1LFW A;  1CG2 A;  2OB0 A;  4MFP A;  3LWU A;  4OKO A;  1YQE A;  1JQG A;  4AVC A;  1I1D A;  5THW A;  3FED A;  3CZX A;  4FD4 A;  4OAD A;  1YK3 A;  1HEE A;  2FIW A;  2QML A;  1M1D A;  1IGB A;  4MCR A;  4F6A A;  3KZW A;  5K8O A;  2EBJ A;  3GKR A;  4CAF A;  1S7L A;  4TNU A;  2DPT A;  3T8W A;  2R7H A;  2PRQ A;  4CYO A;  3B8G A;  2FXF A;  3PB7 X;  1IID A;  4UWJ A;  3D4U A;  3F0A A;  3WAB A;  1Z9U A;  2Q7B A;  3SXO A;  4X5K A;  3WR7 A;  4R6T A;  2H5M A;  3ISZ A;  3BXM A;  2JDD A;  1QSN A;  2ZW5 A;  4R87 A;  4KOX A;  2R1I A;  4EWT A;  3H8E A;  4LQG A;  4UFV A;  1ARL A;  1XIX A;  2AFO A;  4Y49 B;  2ZEF A;  2AFX A;  4J3G A;  3R95 A;  4MJ8 A;  4ONW A;  4CAX A;  4AG9 A;  2A4N A;  3FB3 A;  4KOY A;  4CAE A;  4CYN A;  2FSR A;  3BJ7 A;  2X7B A;  4IUS A;  4OP4 A;  2ZW4 A;  3FBU A;  3R9F A;  3D2P A;  3VWE A;  3FYN A;  5IB9 A;  4C2Z A;  4AVB A;  1WK4 A;  1S7K A;  3IIB A;  2AFS A;  4PXD A;  1BPN A;  4PQA A;  4FBE A;  2ARH A;  5EC4 A;  2ZEM A;  1MJB A;  3KR4 A;  3R1K A;  1LAM A;  4OME A;  4NJR A;  4ORF A;  1VHS A;  3H8F A;  3MN8 A;  4U5Y A;  4XPD C;  3S6G A;  1Z8T A;  3NFZ A;  4AB7 A;  2O28 A;  1U6M A;  3PB8 X;  4KVX A;  3HUV A;  4H89 A;  3BI1 A;  2PJ8 A;  2QYV A;  2CIJ A;  5K8N A;  1CX8 A;  1Y9K A;  4MY3 A;  3D67 A;  2F5I A;  1CP7 A;  2BUE A;  4OAE A;  4OID A;  1ZG9 A;  1Y7R A;  4KUB A;  4CGM A;  1ZG8 A;  4IK2 A;  2PJ6 A;  3I3G A;  4PXC A;  1RTQ A;  2V77 A;  4CRZ B;  3S6K A;  3PFE A;  1N71 A;  1J4J A;  2ZPA A;  1PYT B;  4QB9 A;  2V8D A;  3SI1 A;  3T90 A;  3D7H A;  3BLN A;  1QSM A;  2BL1 A;  4KOV A;  4UWI A;  1IU8 A;  1YR0 A;  4H6Z A;  4MRI A;  2OZU A;  3FH4 A;  2ATR A;  3EO4 A;  4JLY A;  5HH1 A;  3FRM A;  4PXE A;  5DS0 A;  2NSM A;  2XEJ A;  2PIZ A;  1Y9W A;  2Z11 A;  4E8O A;  3H4Q A;  3FVL A;  2Q51 A;  4P4F A;  3TT2 A;  2P6F A;  3I9S A;  2FT0 A;  1MJ9 A;  5K8M A;  1K4J A;  1CBX A;  1XEB A;  4O23 A;  1YW4 A;  1F57 A;  2D4P A;  3D68 A;  5LYI A;  1X12 A;  2CXA A;  3K9U A;  4IHM A;  4F8Z A;  3S9M A;  3NH5 A;  4BMH A;  1TKH A;  4B5P A;  4F0Y A;  2RB7 A;  3BHX A;  3NE8 A;  2Q44 A;  4RN7 A;  4I49 A;  4P45 A;  5JH9 A;  2FL4 A;  1I21 A;  2RFH A;  4AVA A;  5LRK A;  4CS0 B;  1KZF A;  4XNH C;  2ZED A;  3DLJ A;  2Z3K A;  4B6Z A;  5J8C A;  1YLE A;  3CPA A;  4GM5 A;  5JGF A;  1RXT A;  1IB1 E;  2P6E A;  3SJF A;  3H5Z A;  3PB6 X;  3WC6 A;  2Z3P A;  5AG7 A;  5G1Z A;  3FXT A;  4CGN A;  2NYQ A;  4P4J A;  3PP9 A;  4RS2 A;  1Z8W A;  4A37 A;  2AFW A;  1ELL P;  2IL4 A;  2PJ1 A;  5EMI A;  2IJZ A;  2CNS A;  4ZY2 A;  5I4M A;  1Q7L A;  3WT4 A;  4P10 A;  4ZY0 A;  5KTA A;  2Y0M A;  3VH9 A;  4PSX A;  2B5G B;  4P4E A;  1RO5 A;  3KQX A;  4TWE A;  4DNC A;  4PK2 A;  3FNC A;  2XEI A;  5A28 A;  3PB4 X;  3TOA A;  4MHY A;  3PZJ A;  3UY5 A;  1S3Z A;  4IAV A;  5ISV A;  5HXD A;  4M6I A;  2ZEH A;  1ON0 A;  3FJU A;  1EE3 P;  2PR1 A;  4KS9 A;  1YX0 A;  3KHX A;  1YME A;  3B3C A;  3GUX A;  1YLO A;  3IU1 A;  4UFX A;  5F47 A;  3SJE A;  3VAT A;  3FF3 A;  5BWA B;  4W9Y A;  3JTK A;  5IB0 A;  2ZEE A;  1QSR A;  1CPS A;  4QUS A;  5C82 A;  3EXN A;  1VKC A;  4HNW B;  4UBR A;  1ELM P;  2CTB A;  1CPX A;  3NH8 A;  1Z5R A;  2FS5 A;  3D7G A;  3MGD A;  1Z8X A;  1XRY A;  2V8G A;  2WZN A;  2Z3N A;  2J9A A;  1FNO A;  4PV6 A;  2DXQ A;  3IWE A;  4R9M A;  3D7F A;  4M3S A;  3TOB A;  1Z2L A;  3GB0 A;  5F48 A;  3SXN A;  3W6X A;  2GIV A;  3LMS A;  2EK9 A;  4CGO A;  5F09 A;  2V8V A;  1P0H A;  2WPX A;  4FD5 A;  2VL1 A;  2IQ6 A;  4CYQ A;  2WSA A;  4R8F A;  4UCP A;  4EFD A;  1L0C A;  1YVK A;  1M4L A;  2NMT A;  2PIY A;  4GS4 A;  4OC0 A;  1MJA A;  4H2K A;  4NFR A;  4Y49 C;  5H84 A;  2YNC C;  1AMP A;  1KUX A;  2B4D A;  5K8P A;  2ZXV A;  2Q4Y A;  2YGW A;  3MRU A;  4MXU A;  4ONU A;  3ZJ0 A;  3S9N A;  4KVM E;  4MBU A;  5JM6 A;  4C2Y A;  3JUW A;  3QAY A;  2GE3 A;  2GLF A;  3IWG A;  1HDQ A;  1QMU A;  3QAH A;  4HKF A;  4NGQ A;  5AGE A;  3IWW A;  1CM0 A;  1H8L A;  4YU9 A;  4X8I A;  2PSW A;  1Z4E A;  2J8N A;  3GLJ A;  2B58 A;  2ZW7 A;  4RI1 A;  4NF1 A;  3BJ8 A;  3KI9 A;  2ZEG A;  5JQ4 A;  2CTC A;  5G22 A;  2VXK A;  4L8A A;  4MHN A;  1CJW A;  2ANP A;  4R57 A;  4KOR A;  4FAI A;  2ZW6 A;  2R8V A;  3F8K A;  1XFO A;  3RZA A;  2PDO A;  1X10 A;  1IIC A;  2GRE A;  2PJC A;  3E0K A;  3WC5 A;  4C7I A;  1XOV A;  1AYE A;  2YNC A;  2BSW A;  3GIU A;  4WJB A;  4NXY A;  5DWN A;  3D3S A;  1S5K A;  3BI0 A;  4YRH A;  4HPS A;  2WUU A;  4R3L A;  4UEF A;  5AG4 A;  4BBH A;  2EK8 A;  1XJO A;  4NGR A;  4HNY B;  4UIB A;  4KOW A;  4A33 A;  4KSF A;  4X2T A;  2O53 A;  2HC9 A;  3SI2 A;  2OH1 A;  2ZEL A;  1XMT A;  4A31 A;  1ZO0 A;  5LRJ A;  1FT7 A;  1BLL E;  2PJ2 A;  4NGP A;  3L2N A;  3PGP A;  4UFW A;  4M6G A;  3P2H A;  4FWU A;  4M85 A;  5AG6 A;  2OOT A;  3KKW A;  1LAN A;  2Z3L A;  2I3C A;  5H86 A;  2BEI A;  3TCV A;  4A30 A;  1VGY A;  2Q7S A;  3D7D A;  4KVO E;  5IX3 A;  5JPH A;  1PCA A;  5F49 A;  3DNS A;  2VBQ A;  4JJX A;  3QNV A;  2KCW A;  2DEA A;  2BCO A;  4NJQ A;  4CAV A;  1S60 A;  1TIQ A;  3VWD A;  5D29 A;  2PJ7 A;  1P4N A;  2F7V A;  1VIX A;  1M4I A;  2VEZ A;  4JXR A;  1QQ9 A;  1M44 A;  4HNX B;  5CPA A;  4F9U A;  4Z65 A;  4E0A A;  2PJ4 A;  4H6U A;  3D66 A;  2CF4 A;  4JYW A;  5CNP A;  2EWB A;  4II9 A;  3N5F A;  3CPX A;  1Z4R A;  4MFQ A;  4BIN A;  1XMB A;  2P6G A;  2AFU A;  4MHZ A;  3RBU A;  3VAR A;  4NCZ A;  4MI4 A;  3ZZI A;  3K2K A;  2HV2 A;  3PBE A;  4M6H A;  4R76 A;  4ZI6 A;  4OLL A;  4OC1 A;  1UFH A;  3KL9 A;  4C2X A;  3IC1 A;  1BO4 A;  2Q4V A;  4NGT A;  4MFL A;  3FIX A;  4OC3 A;  2PR8 A;  1LAP A;  1NSA A;  1WWZ A;  4UEE A;  2EVN A;  4PSW A;  1M4G A;  3TFY A;  3OWC A;  4K3N A;  3B3W A;  2PJA A;  5I0C A;  3PB9 X;  4PK3 A;  4E2A A;  2EUI A;  2JEV A;  2OZH A;  5LYF A;  1XBU A;  4K30 A;  2C6C A;  4A32 A;  3TTH A;  3DR8 A;  2YNE A;  1IOI A;  4B5O A;  2OR4 A;  1TXR A;  4U9Y A;  3V8I A;  2XEG A;  2JBK A;  4MCS A;  3G3S A;  3ISX A;  5CBM A;  4B10 A;  2J8M A;  2OZG A;  4A2Z A;  2BOA A;  3IO1 A;  3TO7 A;  5IV0 A;  2HUZ A;  1KUY A;  3SJG A;  4IF5 A;  1IYK A;  3RO0 A;  1QSO A;  1IY7 A;  4L89 A;  5DWM A;  2K5T A;  2WYR A;  2Z3M A;  3R96 A;  2PJ5 A;  4KOU A;  1KUV A;  4UEZ A;  4BD9 A;  4YWY A;  2B5G A;  1Y0Y A;  4FD6 A;  2VZY A;  1S7F A;  4B12 A;  2R98 A;  3IGR A;  4ZYQ A;  1M4D A;  2AFM A;  2QVP A;  2C6G A;  2G0B A;  5HVF A;  2FCK A;  1Q2Y A;  5LRG A;  1Q2D A;  1FY7 A;  2PJ0 A;  1PUA A;  2B4B A;  4OC4 A;  2Z0Z A;  4CRY B;  4KUA A;  2G3T A;  2GAN A;  4XPK A;  2G3A A;  5C88 A;  2ZEN A;  1TKF A;  3WC7 A;  4DUK A;  4FUU A;  2JDC A;  3KHZ A;  4KOS A;  4EVY A;  3LAC A;  5A27 A;  1Q2C A;  4P4D A;  5E96 A;  1YVO A;  3B3T A;  3RNZ A;  2PC1 A;  4P4B A;  4NGS A;  1XF8 A;  4R3K A;  4UCM A;  4RUH A;  2RC4 A;  1F2P A;  1LOK A;  1TKJ A;  2O4H A;  3CT9 A;  2B4D B;  3CDX A;  4KZT A;  2JEW A;  4KSI A;  3NE7 A;  4KSA A;  4ZGY B;  1GYT A;  3NA6 A;  4YGO A;  3R9E A;  1JWQ A;  4ZY1 A;  4UA3 A;  2AJ6 A;  1R3N A;  2PJ3 A;  1ZG7 A;  3IJ3 A;  4OC2 A;  5G21 A;  3FEC A;  2Q0Y A;  1OBR A;  4MY0 A;  4QVT A;  3RAM A;  2PVW A;  1A2Z A;  4A95 A;  4MHP A;  1AUG A;  4OIW A;  1VHE A;  4KOT A;  4ZBG A;  3R9G A;  5G20 A;  4C68 A;  2FVG A;  1UWY A;  4P44 A;  1YRE A;  3FX6 A;  2DF5 A;  2GU2 A;  4JD6 A;  4Q38 A;  5LYD A;  4QBJ A;  4FD7 A;  4OC5 A;  2GFQ A;  4R7M A;  4MCP A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  4NSQ A;  3T9Y A;  3RYO A;  2CNT A;  2YND A;  3C26 A;  5FVJ A;  4CAW A;  4C7H A;  1BOB A;  2HQY A;  2CNM A;  4KLW A;  1YGH A;  3GYA A;  2I79 A;  3A9L A;  2J8R A;  1NMT A;  1OZP A;  4YFJ A;  2FIA A;  4NEX A;  5HMN A;  4XPD B;  2AE6 A;  1S7N A;  1B6B A;  2REF A;  2P0W A;  5AG5 A;  3W6S A;  4CYP A;  3JVN A;  3S6F A;  1NSL A;  4AG7 A;  3CXQ A;  4MFK A;  5KTD A;  3DR6 A;  2PQ8 A;  1NE9 A;  3F5B A;  2Q04 A;  4B14 A;  2FE7 A;  4CGP A;  4JWP A;  3LOD A;  3P2F A;  4MHD A;  3S6H A;  5F46 A;  4B5P B;  2VI7 A;  3CXS A;  4LX9 A;  1IYL A;  3EC4 A;  4JXQ A;  1LRZ A;  4U9Z A;  1XE4 A;  4MFJ A;  5KTC A;  3N7Z A;  4F0X A;  4Q36 A;  2REE A;  3DSB A;  1R57 A;  3W91 A;  2Z10 A;  4XPL A;  2PRB A;  3TO9 A;  3GY9 A;  2I00 A;  3D8P A;  3IU2 A;  2QEC A;  3TE4 A;  2Z3O A;  4B11 A;  1MK4 A;  3D2M A;  3EFA A;  3G8W A;  2VQY A;  3QB8 A;  4XNH B;  2B3V A;  1I12 A;  2DPS A;  1SQH A;  2C27 A;  2QIR A;  4LUA A;  2CY2 A;  3DDD A;  2B3U A;  1PU9 A;  1V0C A;  3EY5 A;  4QC6 A;  3LD2 A;  3TO6 A;  4MFZ A;  4UCN A;  4CGL A;  2WPW A;  3CXP A;  3SHP A;  2JLM A;  5EBV A;  1GHE A;  2D4O A;  4B13 A;  1QST A;  5J8F A;  1B87 A;  4KLV A;  5GCN A;  2VZZ A;  2OB0 A;  4MFP A;  4AVC A;  1I1D A;  4FD4 A;  4OAD A;  1YK3 A;  2FIW A;  2QML A;  1M1D A;  4F6A A;  3GKR A;  4CAF A;  1S7L A;  2DPT A;  2R7H A;  4CYO A;  3B8G A;  2FXF A;  1IID A;  4UWJ A;  3F0A A;  1Z9U A;  2Q7B A;  3SXO A;  4X5K A;  3WR7 A;  2H5M A;  2JDD A;  1QSN A;  2ZW5 A;  4R87 A;  4KOX A;  2R1I A;  4UFV A;  1XIX A;  4Y49 B;  4J3G A;  3R95 A;  4MJ8 A;  4CAX A;  4AG9 A;  2A4N A;  3FB3 A;  4KOY A;  4CAE A;  4CYN A;  2FSR A;  3BJ7 A;  2X7B A;  4IUS A;  3VWE A;  2ZW4 A;  3FBU A;  3R9F A;  3D2P A;  3FYN A;  4C2Z A;  4AVB A;  1WK4 A;  1S7K A;  2ARH A;  5EC4 A;  3R1K A;  1MJB A;  4ORF A;  1VHS A;  4XPD C;  4U5Y A;  3S6G A;  4AB7 A;  2O28 A;  1U6M A;  4KVX A;  4H89 A;  1Y9K A;  4MY3 A;  2F5I A;  2BUE A;  4OAE A;  1Y7R A;  4KUB A;  4CGM A;  3I3G A;  4CRZ B;  3S6K A;  1N71 A;  1J4J A;  2ZPA A;  4QB9 A;  3T90 A;  3BLN A;  1QSM A;  2BL1 A;  4KOV A;  4UWI A;  1YR0 A;  4H6Z A;  2OZU A;  4JLY A;  2ATR A;  3EO4 A;  5HH1 A;  3FRM A;  1Y9W A;  2Z11 A;  4E8O A;  3H4Q A;  3TT2 A;  2P6F A;  3I9S A;  2FT0 A;  1MJ9 A;  1K4J A;  1XEB A;  2D4P A;  2CXA A;  3K9U A;  4BMH A;  4B5P A;  4F0Y A;  2Q44 A;  4I49 A;  2FL4 A;  1I21 A;  4AVA A;  4CS0 B;  1KZF A;  4XNH C;  2Z3K A;  5J8C A;  1YLE A;  2P6E A;  1IB1 E;  1RXT A;  3H5Z A;  2Z3P A;  5AG7 A;  5G1Z A;  3FXT A;  4CGN A;  4RS2 A;  3PP9 A;  2IL4 A;  2CNS A;  5KTA A;  2Y0M A;  4PSX A;  2B5G B;  4DNC A;  1RO5 A;  4PK2 A;  3FNC A;  5A28 A;  3TOA A;  3PZJ A;  3UY5 A;  1S3Z A;  5ISV A;  1ON0 A;  2PR1 A;  4KS9 A;  1YX0 A;  3IU1 A;  4UFX A;  5F47 A;  5BWA B;  3JTK A;  5IB0 A;  4QUS A;  1QSR A;  5C82 A;  3EXN A;  1VKC A;  4HNW B;  4UBR A;  2FS5 A;  3MGD A;  2Z3N A;  4PV6 A;  2DXQ A;  3IWE A;  4R9M A;  4M3S A;  3TOB A;  5F48 A;  3SXN A;  3W6X A;  2GIV A;  4CGO A;  2WPX A;  1P0H A;  4FD5 A;  4CYQ A;  2WSA A;  4UCP A;  1L0C A;  1YVK A;  2NMT A;  4GS4 A;  1MJA A;  4Y49 C;  5H84 A;  2YNC C;  1KUX A;  2B4D A;  2ZXV A;  2Q4Y A;  2YGW A;  3ZJ0 A;  4ONU A;  4KVM E;  4MBU A;  4C2Y A;  3JUW A;  2GE3 A;  3IWG A;  3QAH A;  4HKF A;  5AGE A;  1CM0 A;  2PSW A;  1Z4E A;  2J8N A;  4RI1 A;  2B58 A;  2ZW7 A;  4NF1 A;  3BJ8 A;  5JQ4 A;  5G22 A;  2VXK A;  4L8A A;  1CJW A;  4R57 A;  4KOR A;  2ZW6 A;  2R8V A;  3F8K A;  2PDO A;  1IIC A;  3E0K A;  4C7I A;  2YNC A;  2BSW A;  4NXY A;  5DWN A;  3D3S A;  1S5K A;  4YRH A;  2WUU A;  4R3L A;  5AG4 A;  4BBH A;  4HNY B;  4KOW A;  4A33 A;  4KSF A;  2OH1 A;  1XMT A;  4A31 A;  1ZO0 A;  3PGP A;  4UFW A;  3P2H A;  4M85 A;  5AG6 A;  3KKW A;  2Z3L A;  5H86 A;  2BEI A;  3TCV A;  4A30 A;  4KVO E;  5IX3 A;  5JPH A;  5F49 A;  3DNS A;  2VBQ A;  4JJX A;  2KCW A;  4CAV A;  1S60 A;  1TIQ A;  3VWD A;  1P4N A;  4JXR A;  1M4I A;  2VEZ A;  4HNX B;  1M44 A;  4E0A A;  4H6U A;  5CNP A;  4II9 A;  1Z4R A;  4MFQ A;  2P6G A;  4NCZ A;  4MI4 A;  3ZZI A;  2HV2 A;  4OLL A;  1UFH A;  4C2X A;  1BO4 A;  2Q4V A;  4MFL A;  3FIX A;  2PR8 A;  1WWZ A;  2EVN A;  4PSW A;  1M4G A;  3TFY A;  3OWC A;  5I0C A;  4PK3 A;  4E2A A;  2EUI A;  2JEV A;  2OZH A;  4K30 A;  4A32 A;  3TTH A;  3DR8 A;  2YNE A;  4B5O A;  4U9Y A;  3V8I A;  3G3S A;  4B10 A;  2J8M A;  2OZG A;  4A2Z A;  3TO7 A;  5IV0 A;  2HUZ A;  1KUY A;  4IF5 A;  1IYK A;  1QSO A;  4L89 A;  5DWM A;  2K5T A;  2Z3M A;  3R96 A;  4KOU A;  1KUV A;  2B5G A;  4FD6 A;  2VZY A;  1S7F A;  4B12 A;  2R98 A;  3IGR A;  1M4D A;  2G0B A;  2FCK A;  1Q2Y A;  1Q2D A;  1FY7 A;  1PUA A;  2B4B A;  2Z0Z A;  4CRY B;  4KUA A;  2G3T A;  2GAN A;  4XPK A;  2G3A A;  5C88 A;  2JDC A;  4KOS A;  5A27 A;  1Q2C A;  5E96 A;  1YVO A;  2PC1 A;  4R3K A;  1XF8 A;  4UCM A;  2RC4 A;  2B4D B;  4KZT A;  3NE7 A;  4KSA A;  4ZGY B;  4YGO A;  3R9E A;  4UA3 A;  2AJ6 A;  5G21 A;  2Q0Y A;  4MY0 A;  4QVT A;  4A95 A;  4KOT A;  4ZBG A;  3R9G A;  5G20 A;  4C68 A;  1YRE A;  4JD6 A;  4Q38 A;  4QBJ A;  4FD7 A;  4EVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...