2F5IA

X-ray structure of spermidine/spermine n1-acetyltransferase (sat) from homo sapiens
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
167
structure length
167
Chain Sequence
KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Crystal structure of human spermidine/spermine N1-acetyltransferase (hSSAT): the first structure of a new sequence family of transferase homologous superfamily
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2f5iA00
2Q44A 4Y49B 2VXKA 4KOVA 5KTCA 2J8RA 4XPDB 2R98A 1PU9A 2HUZA 3T9YA 4IUSA 3EFAA 3FNCA 1BO4A 4UWIA 4XNHC 2HV2A 3S6FA 4YFJA 2VQYA 2PDOA 2P6EA 3MGDA 2BEIA 3CXPA 1V0CA 2JDCA 3LODA 1YX0A 3FBUA 5F49A 5IB0A 2DXQA 4AG9A 2REFA 3V8IA 2Q7BA 4AVBA 1VHSA 2WPWA 3D2MA 2G3AA 5IV0A 1R57A 2FIWA 2I79A 1Z4RA 2B58A 2BSWA 4M3SA 2VZYA 1I1DA 1Y9WA 4KVXA 4NCZA 4PV6A 2C27A 1K4JA 2FT0A 4H89A 1QSRA 4IF5A 2QECA 3KKWA 2R8VA 2FIAA 2B5GB 4OLLA 3TT2A 3P2HA 1S7FA 3R9GA 4KVOE 3PP9A 2FSRA 4CRYB 2NMTA 4UA3A 3I9SA 2B5GA 2ZW6A 4KOXA 2GANA 4E0AA 1S7NA 3D3SA 3S6GA 1YGHA 4FD4A 1IICA 1ON0A 4KUAA 1P4NA 2FCKA 2OU2A 3DR6A 2B3VA 4MY0A 3JUWA 1YK3A 2PQ8A 4LX9A 3F8KA 3RYOA 3EO4A 1WWZA 4HNXB 2AE6A 1YVOA 4KVME 2A4NA 1Z9UA 1YLEA 2OZGA 3TCVA 5F47A 1MJAA 1MJ9A 2GE3A 1GHEA 1QSNA 3E0KA 4B5OA 3PGPA 3TTHA 4ZBGA 3G8WA 3R9EA 4X5KA 1NSLA 1B6BA 1P0HA 1Q2DA 3GKRA 4JXQA 4QUSA 2JLMA 2VBQA 1Z4EA 2ZW4A 3EY5A 1S7LA 3B8GA 4Y49C 5J8CA 4U5YA 4KOSA 4XPDC 3S6HA 3SXOA 4GS4A 4U9ZA 2IL4A 2REEA 1YREA 2HQYA 3N7ZA 2ARHA 1Y9KA 4QVTA 2D4PA 4NEXA 4BMHA 2H5MA 2VI7A 4MBUA 4OADA 2FL4A 1YVKA 3TOAA 4XNHB 3DNSA 3TFYA 3R9FA 3IWGA 1U6MA 3D8PA 3K9UA 4E8OA 4PK3A 4DNCA 4HKFA 1L0CA 4XPKA 4ORFA 3W91A 2PRBA 2D4OA 4EVYA 1QSTA 4HNWB 1RXTA 2QMLA 2R7HA 1KZFA 1UFHA 3SHPA 4B5PB 1XEBA 4HNYB 2BUEA 4R9MA 3R1KA 2OZHA 1J4JA 2B3UA 4L89A 1I21A 2Z10A 1TIQA 1YR0A 3PZJA 1PUAA 4B5PA 2PC1A 1QSOA 4AB7A 2ZXVA 5EC4A 4J3GA 3TOBA 1Y7RA 5J8FA 4I49A 1M4GA 5FVJA 4R87A 4H6UA 2RC4A 4K30A 1QSMA 4R57A 2O28A 1M1DA 1Q2YA 4KOUA 1S60A 4CAXA 1VKCA 5I0CA 3T90A 2R1IA 4JXRA 5F46A 2PR1A 2GIVA 2P6FA 3H4QA 4KOWA 4MY3A 3NE7A 2P0WA 3DR8A 4XPLA 3G3SA 3FXTA 5C82A 2CNSA 4FD5A 3ZZIA 1NMTA 3WR7A 4KOTA 2KCWA 1XE4A 2OH1A 1XIXA 1XMTA 2Z0ZA 3UY5A 2F5IA 1Q2CA 4CRZB 3TO7A 4KLVA 4KUBA 4AG7A 2WPXA 5DWNA 4PSXA 2CNTA 4NF1A 2FE7A 3QB8A 4UBRA 2I00A 1CM0A 2ZW5A 2CNMA 3GYAA 4H6ZA 4JJXA 3I3GA 4RS2A 2ZW7A 3W6SA 2VEZA 1IYLA 4CAVA 1S5KA 3R95A 3VWEA 3R96A 4QBJA 1N71A 1S3ZA 2FS5A 2J8NA 3EXNA 4KZTA 3QAHA 2Q04A 2G0BA 4YGOA 1B87A 3BLNA 4JLYA 4QB9A 4LUAA 2BL1A 4U9YA 3SXNA 2P6GA 3TO9A 5KTAA 3FIXA 2Z11A 4MJ8A 2K5TA 4KLWA 3IGRA 1NE9A 4QC6A 2FXFA 2QIRA 2X7BA 1IYKA 4NXYA 2Y0MA 3F5BA 1I12A 5HH1A 3JVNA 5KTDA 5DWMA 4ONUA 1IB1E 4L8AA 3F0AA 3DDDA 5CNPA 3VWDA 1OZPA 3BJ8A 3BJ7A 1KUVA 2OZUA 3S6KA 1XF8A 1S7KA 2OB0A 3ZJ0A 3CXQA 4YRHA 3FRMA 3OWCA 4PSWA 5C88A 4F6AA 5JQ4A 1LRZA 4CAWA 1MJBA 4E2AA 2PR8A 4NSQA 4RI1A 2CY2A 2G3TA 3W6XA 1CJWA 3FYNA 5GCNA 2Q4VA 1SQHA 4F0YA 3C26A 2J8MA 5EBVA 3TE4A 5ISVA 2ATRA 2EUIA 2Q0YA 2VZZA 1MK4A 3LD2A 2B4DB 3CXSA 3P2FA 3TO6A 1KUXA 1RO5A 4JD6A 2B4DA 4R3KA 4JWPA 1M4DA 2ZPAA 3GY9A 4R3LA 2JDDA 4M85A 1WK4A 2JEVA 2B4BA 4OAEA 5F48A 3EC4A 2EVNA 4AVCA 2Q4YA 5HMNA 4KORA 4II9A 5JPHA 1FY7A 3DSBA 4MHDA 1M4IA 4AVAA 1IIDA 3D2PA 2AJ6A 1M44A 4UWJA 4FD7A 3FB3A 4PK2A 2PSWA 4CS0B 4FD6A 5IX3A 5E96A 4MI4A 5H84A 1BOBA 1KUYA 4KOYA 5H86A
chains in the Genus database with same CATH superfamily
2Q44A 4Y49B 2VXKA 4KOVA 1VHEA 5KTCA 1HDQA 3TC8A 1TF9A 2J8RA 1ZLHA 4XPDB 4Z65A 3SI1A 1XOVA 2R98A 1CPXA 1PU9A 2PJ5A 2HUZA 4NGTA 3T9YA 3WT4A 4CYPA 4IUSA 3EFAA 4P4IA 2V8DA 3FNCA 1BO4A 3GUXA 4UWIA 5LYDA 4OC2A 4XNHC 2HV2A 3S6FA 4ONWA 4YFJA 1A2ZA 3I1UA 3IFEA 1XFOA 2ZELA 4B10A 2VQYA 4ZY0A 3DLJA 4PQAA 3WC7A 2PDOA 2AFZA 2P6EA 2Z3KA 2Q7SA 2YNEA 3MGDA 1PYTB 2BEIA 3CXPA 1V0CA 3D67A 2JDCA 3LODA 3SJXA 1YX0A 5G22A 3FBUA 5F49A 4UF4A 5IB0A 2DXQA 4AG9A 4MCSA 3NH5A 2REFA 5EMIA 4A37A 4CGMA 1LAPA 4JZ0A 2RB7A 4NGMA 2ABZA 2WSAA 3V8IA 2AFWA 2Q7BA 3H8GA 4AVBA 4C7HA 1VHSA 2WPWA 4FBEA 3D2MA 2NSMA 4B11A 2G3AA 5IV0A 1KWMA 1R57A 2FIWA 2ODFA 2I79A 1Z4RA 2B58A 3H5ZA 2BSWA 3VARA 1X12A 2BO9A 4M3SA 2PJ7A 2VZYA 4P4EA 1I1DA 1Y9WA 3PB6X 3PB9X 4KVXA 4MHYA 4NCZA 4CYNA 4PV6A 2C27A 1K4JA 2FT0A 2PJCA 2XEJA 1LANA 4H89A 1QSRA 3GB0A 2JBJA 4IF5A 3VATA 4BINA 2PJAA 2QECA 4K3NA 3KKWA 4MCQA 5LRJA 2R8VA 2ANPA 2FIAA 1UWYA 1YMEA 2B5GB 3H8FA 4OLLA 4P4FA 3TT2A 3P2HA 2V77A 3RNZA 1S7FA 3R9GA 3PP9A 4KVOE 2FSRA 4B6ZA 4CRYB 2NMTA 2PCUA 1ELMP 4UA3A 3I9SA 2B5GA 4FAIA 2PVWA 2ZW6A 3IIBA 1BPMA 2AFSA 2GANA 4KOXA 1HEEA 4E0AA 1DTDA 2YNDA 3L2NA 1S7NA 4ZGYB 1YW4A 3PB4X 2I3CA 1AMPA 3D3SA 3PEIA 4R76A 3A9LA 1YGHA 4UCMA 2Z3PA 3S6GA 4A31A 3KGQA 4A33A 4FD4A 3D7DA 1IICA 4ZX8A 3FVLA 4YWYA 1ON0A 4RN7A 1PCAA 1OBRA 1TKJA 2ZOFA 3SI0A 3KZWA 2JEWA 4KUAA 1H8LA 3H8EA 1LOKA 1P4NA 2FCKA 4MCRA 2OU2A 4R8FA 5G1ZA 2ZEPA 3KI9A 5G21A 3DR6A 2DPSA 2PIZA 3NH4A 2B3VA 4LQ6A 4G1PA 2C6GA 4TWEA 1ARLA 4MY0A 4CAEA 3JUWA 1YK3A 5F09A 2PQ8A 4P45A 4LX9A 5LYLA 1JQGA 4KSFA 3F8KA 3RYOA 3EO4A 1CG2A 1WWZA 1CP6A 3D66A 1AUGA 2AE6A 2IMOA 3B35A 4HNXB 3BXMA 1YVOA 3RAMA 4KVME 2CTBA 2YNCA 1VHOA 2OR4A 3PFEA 4YU9A 2IQ6A 2DEAA 2A4NA 4NGSA 1Z9UA 1CBXA 1YLEA 2EK8A 2OZGA 2Z3LA 5K8PA 2ZEDA 3TCVA 5F47A 4C2XA 1MJAA 1MJ9A 2GE3A 4GM5A 5LRKA 1GHEA 1HDUA 2GFQA 1QSNA 3NA6A 4MFQA 4A32A 3E0KA 3PRTA 4B5OA 3PGPA 4B12A 3TTHA 3B3SA 4ZBGA 3G8WA 2GU2A 4X5KA 3R9EA 8CPAA 4JYWA 1NSLA 5I4MA 1BLLE 1B6BA 1P0HA 1XJOA 3KQZA 1Q2DA 3B7IA 3GKRA 4DUKA 4JXQA 4QUSA 2JLMA 1XBUA 2VBQA 1Z4EA 4UCPA 2V8GA 2ZW4A 3EY5A 1Z2LA 3N5FA 5HXDA 5HVHA 3GIUA 1S7LA 3B8GA 2C1CA 2Z3NA 1XRYA 4Y49C 3S9LA 2Q4ZA 3WC5A 5J8CA 3K9TA 4U5YA 3GLJA 4KOSA 2V8HA 1QQ9A 4XPDC 3IEHA 3IWEA 3S6HA 3SXOA 3B3TA 4GS4A 3BHXA 4MFZA 1YLOA 2PJ1A 3D4UA 4U9ZA 1CX8A 2IL4A 4R6TA 2REEA 3PB7X 1BAVA 4M6IA 4UEFA 1YREA 2HQYA 5LRGA 2O53A 4OKOA 3N7ZA 4R7MA 5THWA 2ARHA 1Y9KA 2G9DA 2ZEFA 4QVTA 4UCNA 1F2PA 2D4PA 4PXEA 3SJEA 4DJLA 5LYFA 4NEXA 1GYTA 2VL1A 2AFXA 2ZEHA 2H5MA 2VI7A 4BMHA 4MBUA 4CGNA 4OADA 5A28A 4MFLA 4B13A 4NJRA 4CGLA 2FL4A 1YVKA 3V38A 3TOAA 3JTKA 4XNHB 3DNSA 3TFYA 6CPAA 3R9FA 3IWGA 3V7ZA 3KR5A 1U6MA 1BPNA 3D8PA 3K9UA 4E8OA 7CPAA 4PK3A 3SJFA 4DNCA 4HKFA 1L0CA 4XPKA 4ORFA 4BD9A 3W91A 2PRBA 2D4OA 2ZEGA 2QJ8A 4EVYA 3ISXA 1QSTA 3DGVA 1RXTA 4HNWB 4F9VA 2QMLA 5AG6A 4PXDA 2R7HA 4PXBA 1KZFA 4ZY2A 1UFHA 3SHPA 4B5PB 1XEBA 4HNYB 2PJ4A 2BUEA 4R9MA 3R1KA 2OZHA 1J4JA 2B3UA 4MFKA 4L89A 1IU8A 1I21A 1TIQA 1YR0A 1F2OA 2Z10A 3PZJA 4F0XA 1NSAA 3K2KA 1PUAA 3FF3A 3NFZA 4KSIA 2PC1A 4MFJA 4B5PA 1QSOA 4AB7A 4RUHA 3JRUA 3KQXA 1TKFA 2ZXVA 3B3VA 3CT9A 5EC4A 4J3GA 3TOBA 1QMUA 4MCPA 3FMCA 1Y7RA 2HC9A 3IJ3A 4LQGA 5J8FA 4O23A 4I49A 2C6PA 1M4GA 2GLJA 5FVJA 5AGEA 2CTCA 3T8WA 4R87A 4W9YA 4H6UA 3D68A 5AG5A 2RC4A 4K30A 1QSMA 2PJBA 4R57A 2O28A 1M1DA 1Q2YA 3RO0A 4KOUA 1S60A 3FX6A 4OIDA 1VKCA 4A38A 4CAXA 1R43A 4CGPA 5I0CA 3T90A 3NH8A 2R1IA 4JXRA 1Y7EA 5F46A 2PR1A 1TXRA 2GIVA 2RFHA 2F8HA 1IOFA 1Y0RA 2P6FA 3H4QA 4HPSA 1IOIA 4KOWA 3KR4A 4MY3A 4M6HA 3NE7A 2P0WA 3DR8A 3QNVA 4XPLA 3G3SA 2PJ0A 3UY5A 3FXTA 5C82A 2CNSA 2F7VA 4FD5A 3ZZIA 2Z3OA 1NMTA 3WR7A 4CYOA 5CBMA 1R3NA 1ZG8A 4OMEA 3IO1A 4UFWA 2YNCC 4KOTA 2KCWA 1Z5RA 4PXCA 1XE4A 2OH1A 1XIXA 1CP7A 1XMTA 2IJZA 2Q43A 2Z0ZA 4OP4A 3CPXA 4P10A 4UEEA 4Q36A 2JBKA 2F5IA 4IAVA 1Q2CA 3SJGA 1ZG7A 4CGOA 3TO7A 4CRZB 4A30A 1YW6A 3B3WA 1FNOA 3IWWA 4KLVA 4PPZA 4CYQA 4MMOA 4UIAA 4KUBA 4IK2A 4AG7A 2WPXA 5DWNA 4PSXA 2CNTA 4KSAA 4NF1A 5HVGA 4C7IA 1ZLIA 2DF5A 2XEGA 4FWUA 1CPSA 2FE7A 2QYVA 3QB8A 4GXHA 2I00A 4UBRA 1CM0A 2ZW5A 5LYIA 1XMBA 4NGQA 2CNMA 3GYAA 3HUVA 4H6ZA 1M4LA 3FH4A 4JJXA 2WZNA 4MFPA 3I3GA 3WC6A 1Z8WA 4RS2A 4F8ZA 3ISZA 2FVGA 4MHZA 2ZW7A 4WWVA 5CPAA 3W6SA 2PJ6A 2XEIA 2VEZA 3S9NA 3BI0A 3IU1A 1IGBA 1IYLA 4NGNA 4CAVA 3CPAA 5J1QA 1S5KA 3R95A 4OC1A 4UFXA 3VWEA 3R96A 4P4JA 4QBJA 3FEEA 5K8MA 3TX8A 4X8IA 1N71A 3PBEA 4TNUA 1S3ZA 4MXUA 2FS5A 2J8NA 2QVPA 3EXNA 4KZTA 4P6YA 5JH9A 3QAHA 2CXAA 2Q04A 3VH9A 4A39A 2G0BA 4YGOA 2WUUA 4DYOA 4ZX9A 1B87A 4EWTA 4P44A 1ZO0A 5G20A 2EWBA 3FEDA 3NE8A 4OC5A 2PRQA 2PJ9A 3BLNA 4JLYA 4QB9A 4LUAA 2BL1A 5K8NA 4U9YA 3SXNA 2P6GA 3TO9A 2O4HA 5KTAA 2CF4A 4P4BA 1LCPA 5IB9A 3FIXA 2Z11A 4MHNA 4MJ8A 2ZENA 4ZYQA 2POKA 2K5TA 2DPTA 4KLWA 4CPAA 3SI2A 3IGRA 2ZEOA 1NE9A 3PB8X 4QC6A 2GREA 4OIWA 4M6GA 4CAFA 3BI1A 1F57A 2PJ2A 1ELLP 5A27A 2FXFA 2QIRA 1ARMA 2X7BA 5HVFA 5D29A 1IYKA 4MRIA 4NXYA 2Y0MA 3F5BA 1LFWA 5AG7A 5JGFA 1I12A 5HH1A 3S9MA 4KS9A 3JVNA 5KTDA 5DWMA 4B14A 4X2TA 3LWUA 4ONUA 4P4DA 1IB1E 3CDXA 4L8AA 3F0AA 3DDDA 5CNPA 1YQEA 3VWDA 2BOAA 4UFVA 5D8NA 1OZPA 3BJ8A 1YSJA 1Z8XA 1KUVA 2OZUA 3BJ7A 3S6KA 2OOTA 1XF8A 1S7KA 3MRUA 2OB0A 3ZJ0A 1X10A 2GLFA 3CXQA 4ZI6A 4YRHA 3FRMA 2YGWA 3OWCA 4PSWA 4NGPA 4H2KA 5C88A 1TKHA 4F9UA 1VIXA 4F6AA 5JQ4A 5AG4A 3KL9A 1LAMA 1Q7LA 2EO8A 1LRZA 1VGYA 4CAWA 1MJBA 4E2AA 2PR8A 4NSQA 4EFDA 4FUUA 4C2YA 2PJ8A 3B3CA 2CY2A 2G3TA 4RI1A 4UIBA 3QAYA 3W6XA 1CJWA 4NFRA 4Q7AA 4NJQA 3FYNA 3IU2A 3HLPA 5GCNA 3WABA 4A2ZA 2ZEEA 1Y0YA 2Q4VA 3FECA 4IHMA 1SQHA 4AXVA 4F0YA 2EBJA 2J9AA 1JWQA 3IC1A 3KASA 4A94A 5BWAB 4C2ZA 1ZG9A 3B2YA 3C26A 4BBHA 2J8MA 5EBVA 3TE4A 5JM6A 5ELYA 5ISVA 2Q51A 2ATRA 2EUIA 4OC4A 1DE4C 2Q0YA 2VZZA 1MK4A 3LD2A 5K8OA 3PFOA 2AFUA 1EE3P 2B4DB 3CXSA 3P2FA 4Q38A 3TO6A 3CZXA 4OC0A 2PJ3A 2C6CA 4EMEA 1KUXA 1RO5A 3D7HA 3RBUA 4JD6A 2CIJA 2B4DA 3FJUA 4R3KA 4JWPA 1M4DA 2BCOA 2Z3MA 2ZPAA 3GY9A 4R3LA 2JDDA 4M85A 3KHXA 5DS0A 1FT7A 1WK4A 2NYQA 4WJBA 2JEVA 1Z8LA 4C68A 2B4BA 2WYRA 4OAEA 2HB6A 4ZY1A 2PE3A 5F48A 4NGRA 3EC4A 2EVNA 4AVCA 2Q4YA 5HMNA 4KORA 3D7FA 4II9A 2PVVA 2AFMA 1AYEA 3KHZA 1FY7A 3DSBA 5JPHA 4MHDA 1M4IA 4AVAA 1TF8A 2AFOA 1IIDA 4A95A 3D2PA 3MN8A 3RZAA 2AJ6A 2V8VA 4X3RA 1M44A 3LACA 1RTQA 4OC3A 4FD7A 3PBBA 3FB3A 4UWJA 4MHPA 4PK2A 4UEZA 2PSWA 2ZEMA 2EK9A 4CS0B 2XEFA 2PIYA 4FD6A 5IX3A 3D7GA 1IY7A 1Z8TA 4MI4A 5E96A 5H84A 1BOBA 1KUYA 3LMSA 4KOYA 5H86A 2ZOGA
chains in the Genus database with same CATH topology
2Q44A 4Y49B 2VXKA 4KOVA 5KTCA 2J8RA 4XPDB 2R98A 1PU9A 2HUZA 3T9YA 4CYPA 4IUSA 3EFAA 3FNCA 1BO4A 4UWIA 4XNHC 2HV2A 3S6FA 4YFJA 4B10A 2VQYA 2PDOA 2P6EA 2Z3KA 3MGDA 2YNEA 2BEIA 3CXPA 1V0CA 2JDCA 3LODA 1YX0A 5G22A 3FBUA 5F49A 5IB0A 2DXQA 4AG9A 2REFA 4CGMA 2WSAA 3V8IA 2Q7BA 4AVBA 4C7HA 1VHSA 2WPWA 3D2MA 4B11A 2G3AA 5IV0A 1R57A 2FIWA 2I79A 1Z4RA 2B58A 3H5ZA 2BSWA 4M3SA 2VZYA 1I1DA 1Y9WA 4CYNA 4KVXA 4NCZA 4PV6A 2C27A 1K4JA 2FT0A 4H89A 1QSRA 4IF5A 2QECA 3KKWA 2R8VA 2FIAA 2B5GB 4OLLA 3TT2A 3P2HA 1S7FA 3R9GA 3PP9A 4KVOE 2FSRA 4CRYB 2NMTA 4UA3A 3I9SA 2B5GA 2ZW6A 4KOXA 2GANA 4E0AA 2YNDA 1S7NA 4ZGYB 4UCMA 3D3SA 3S6GA 3A9LA 1YGHA 2Z3PA 4A31A 4A33A 4FD4A 1IICA 1ON0A 4KUAA 1P4NA 2FCKA 2OU2A 5G1ZA 5G21A 3DR6A 2DPSA 2B3VA 4CAEA 4MY0A 3JUWA 1YK3A 2PQ8A 4LX9A 4KSFA 3F8KA 3RYOA 3EO4A 1WWZA 4HNXB 2AE6A 1YVOA 4KVME 2YNCA 2A4NA 1Z9UA 1YLEA 2OZGA 2Z3LA 3TCVA 5F47A 4C2XA 1MJAA 1MJ9A 2GE3A 1GHEA 1QSNA 4MFQA 4A32A 3E0KA 4B5OA 3PGPA 4B12A 3TTHA 4ZBGA 3G8WA 3R9EA 4X5KA 1NSLA 1B6BA 1P0HA 1Q2DA 3GKRA 4JXQA 4QUSA 2JLMA 2VBQA 1Z4EA 4UCPA 2ZW4A 3EY5A 1S7LA 3B8GA 2Z3NA 4Y49C 5J8CA 4U5YA 4KOSA 4XPDC 3IWEA 3S6HA 3SXOA 4GS4A 4MFZA 4U9ZA 2IL4A 2REEA 1YREA 2HQYA 3N7ZA 2ARHA 1Y9KA 4QVTA 4UCNA 2D4PA 4NEXA 4BMHA 2H5MA 2VI7A 4CGNA 4MBUA 4OADA 5A28A 4MFLA 4B13A 4CGLA 2FL4A 1YVKA 3TOAA 3JTKA 4XNHB 3DNSA 3TFYA 3R9FA 3IWGA 1U6MA 3D8PA 3K9UA 4E8OA 4PK3A 4DNCA 4HKFA 1L0CA 4XPKA 4ORFA 3W91A 2PRBA 2D4OA 4EVYA 1QSTA 4HNWB 1RXTA 2QMLA 5AG6A 2R7HA 1KZFA 1UFHA 3SHPA 4B5PB 1XEBA 4HNYB 2BUEA 4R9MA 3R1KA 2OZHA 1J4JA 2B3UA 4MFKA 4L89A 1I21A 2Z10A 1TIQA 1YR0A 3PZJA 4F0XA 1PUAA 4B5PA 4MFJA 2PC1A 1QSOA 4AB7A 2ZXVA 5EC4A 4J3GA 3TOBA 1Y7RA 5J8FA 4I49A 1M4GA 5FVJA 5AGEA 4R87A 4H6UA 5AG5A 2RC4A 4K30A 1QSMA 4R57A 2O28A 1M1DA 1Q2YA 4KOUA 1S60A 4CAXA 1VKCA 4CGPA 5I0CA 3T90A 2R1IA 4JXRA 5F46A 2PR1A 2GIVA 2P6FA 3H4QA 4KOWA 4MY3A 3NE7A 2P0WA 3DR8A 4XPLA 3G3SA 3FXTA 5C82A 2CNSA 4FD5A 3ZZIA 2Z3OA 1NMTA 3WR7A 4CYOA 4UFWA 2YNCC 4KOTA 2KCWA 1XE4A 2OH1A 1XIXA 1XMTA 2Z0ZA 3UY5A 4Q36A 2F5IA 1Q2CA 4CGOA 4CRZB 3TO7A 4A30A 4KLVA 4CYQA 4KUBA 4AG7A 2WPXA 5DWNA 4PSXA 2CNTA 4KSAA 4NF1A 4C7IA 2FE7A 3QB8A 4UBRA 2I00A 1CM0A 2ZW5A 2CNMA 3GYAA 4H6ZA 4JJXA 4MFPA 3I3GA 4RS2A 2ZW7A 3W6SA 2VEZA 3IU1A 1IYLA 4CAVA 1S5KA 3R95A 3VWEA 4UFXA 3R96A 4QBJA 1N71A 1S3ZA 2FS5A 2J8NA 3EXNA 4KZTA 3QAHA 2CXAA 2Q04A 2G0BA 4YGOA 2WUUA 1B87A 1ZO0A 5G20A 3BLNA 4JLYA 4QB9A 4LUAA 2BL1A 4U9YA 3SXNA 2P6GA 3TO9A 5KTAA 3FIXA 2Z11A 4MJ8A 2K5TA 2DPTA 4KLWA 3IGRA 1NE9A 4QC6A 4CAFA 5A27A 2FXFA 2QIRA 2X7BA 1IYKA 4NXYA 2Y0MA 3F5BA 5AG7A 1I12A 5HH1A 4KS9A 3JVNA 5KTDA 5DWMA 4B14A 4ONUA 1IB1E 4L8AA 3F0AA 3DDDA 5CNPA 3VWDA 4UFVA 1OZPA 3BJ8A 3BJ7A 1KUVA 2OZUA 3S6KA 1XF8A 1S7KA 2OB0A 3ZJ0A 3CXQA 4YRHA 3FRMA 2YGWA 3OWCA 4PSWA 5C88A 4F6AA 5JQ4A 5AG4A 1LRZA 4CAWA 1MJBA 4E2AA 2PR8A 4NSQA 4C2YA 4RI1A 2CY2A 2G3TA 3W6XA 1CJWA 3FYNA 3IU2A 5GCNA 4A2ZA 2Q4VA 1SQHA 4F0YA 5BWAB 4C2ZA 3C26A 4BBHA 2J8MA 5EBVA 3TE4A 5ISVA 2ATRA 2EUIA 2Q0YA 2VZZA 1MK4A 3LD2A 2B4DB 3CXSA 3P2FA 4Q38A 3TO6A 1KUXA 1RO5A 4JD6A 2B4DA 4R3KA 4JWPA 1M4DA 2Z3MA 2ZPAA 3GY9A 4R3LA 2JDDA 4M85A 1WK4A 2JEVA 4C68A 2B4BA 4OAEA 5F48A 3EC4A 2EVNA 4AVCA 2Q4YA 5HMNA 4KORA 4II9A 5JPHA 1FY7A 3DSBA 4MHDA 1M4IA 4AVAA 1IIDA 4A95A 3D2PA 2AJ6A 1M44A 4UWJA 4FD7A 3FB3A 4PK2A 2PSWA 4CS0B 4FD6A 5IX3A 5E96A 4MI4A 5H84A 1BOBA 1KUYA 4KOYA 5H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q44 A;  4Y49 B;  2VXK A;  4KOV A;  5KTC A;  2J8R A;  4XPD B;  2R98 A;  1PU9 A;  2HUZ A;  3T9Y A;  4IUS A;  3EFA A;  3FNC A;  1BO4 A;  4UWI A;  4XNH C;  2HV2 A;  3S6F A;  4YFJ A;  2VQY A;  2PDO A;  2P6E A;  3MGD A;  2BEI A;  3CXP A;  1V0C A;  2JDC A;  3LOD A;  1YX0 A;  3FBU A;  5F49 A;  5IB0 A;  2DXQ A;  4AG9 A;  2REF A;  3V8I A;  2Q7B A;  4AVB A;  1VHS A;  2WPW A;  3D2M A;  2G3A A;  5IV0 A;  1R57 A;  2FIW A;  2I79 A;  1Z4R A;  2B58 A;  2BSW A;  4M3S A;  2VZY A;  1I1D A;  1Y9W A;  4KVX A;  4NCZ A;  4PV6 A;  2C27 A;  1K4J A;  2FT0 A;  4H89 A;  1QSR A;  4IF5 A;  2QEC A;  3KKW A;  2R8V A;  2FIA A;  2B5G B;  4OLL A;  3TT2 A;  3P2H A;  1S7F A;  3R9G A;  4KVO E;  3PP9 A;  2FSR A;  4CRY B;  2NMT A;  4UA3 A;  3I9S A;  2B5G A;  2ZW6 A;  4KOX A;  2GAN A;  4E0A A;  1S7N A;  3D3S A;  3S6G A;  1YGH A;  4FD4 A;  1IIC A;  1ON0 A;  4KUA A;  1P4N A;  2FCK A;  2OU2 A;  3DR6 A;  2B3V A;  4MY0 A;  3JUW A;  1YK3 A;  2PQ8 A;  4LX9 A;  3F8K A;  3RYO A;  3EO4 A;  1WWZ A;  4HNX B;  2AE6 A;  1YVO A;  4KVM E;  2A4N A;  1Z9U A;  1YLE A;  2OZG A;  3TCV A;  5F47 A;  1MJA A;  1MJ9 A;  2GE3 A;  1GHE A;  1QSN A;  3E0K A;  4B5O A;  3PGP A;  3TTH A;  4ZBG A;  3G8W A;  3R9E A;  4X5K A;  1NSL A;  1B6B A;  1P0H A;  1Q2D A;  3GKR A;  4JXQ A;  4QUS A;  2JLM A;  2VBQ A;  1Z4E A;  2ZW4 A;  3EY5 A;  1S7L A;  3B8G A;  4Y49 C;  5J8C A;  4U5Y A;  4KOS A;  4XPD C;  3S6H A;  3SXO A;  4GS4 A;  4U9Z A;  2IL4 A;  2REE A;  1YRE A;  2HQY A;  3N7Z A;  2ARH A;  1Y9K A;  4QVT A;  2D4P A;  4NEX A;  4BMH A;  2H5M A;  2VI7 A;  4MBU A;  4OAD A;  2FL4 A;  1YVK A;  3TOA A;  4XNH B;  3DNS A;  3TFY A;  3R9F A;  3IWG A;  1U6M A;  3D8P A;  3K9U A;  4E8O A;  4PK3 A;  4DNC A;  4HKF A;  1L0C A;  4XPK A;  4ORF A;  3W91 A;  2PRB A;  2D4O A;  4EVY A;  1QST A;  4HNW B;  1RXT A;  2QML A;  2R7H A;  1KZF A;  1UFH A;  3SHP A;  4B5P B;  1XEB A;  4HNY B;  2BUE A;  4R9M A;  3R1K A;  2OZH A;  1J4J A;  2B3U A;  4L89 A;  1I21 A;  2Z10 A;  1TIQ A;  1YR0 A;  3PZJ A;  1PUA A;  4B5P A;  2PC1 A;  1QSO A;  4AB7 A;  2ZXV A;  5EC4 A;  4J3G A;  3TOB A;  1Y7R A;  5J8F A;  4I49 A;  1M4G A;  5FVJ A;  4R87 A;  4H6U A;  2RC4 A;  4K30 A;  1QSM A;  4R57 A;  2O28 A;  1M1D A;  1Q2Y A;  4KOU A;  1S60 A;  4CAX A;  1VKC A;  5I0C A;  3T90 A;  2R1I A;  4JXR A;  5F46 A;  2PR1 A;  2GIV A;  2P6F A;  3H4Q A;  4KOW A;  4MY3 A;  3NE7 A;  2P0W A;  3DR8 A;  4XPL A;  3G3S A;  3FXT A;  5C82 A;  2CNS A;  4FD5 A;  3ZZI A;  1NMT A;  3WR7 A;  4KOT A;  2KCW A;  1XE4 A;  2OH1 A;  1XIX A;  1XMT A;  2Z0Z A;  3UY5 A;  2F5I A;  1Q2C A;  4CRZ B;  3TO7 A;  4KLV A;  4KUB A;  4AG7 A;  2WPX A;  5DWN A;  4PSX A;  2CNT A;  4NF1 A;  2FE7 A;  3QB8 A;  4UBR A;  2I00 A;  1CM0 A;  2ZW5 A;  2CNM A;  3GYA A;  4H6Z A;  4JJX A;  3I3G A;  4RS2 A;  2ZW7 A;  3W6S A;  2VEZ A;  1IYL A;  4CAV A;  1S5K A;  3R95 A;  3VWE A;  3R96 A;  4QBJ A;  1N71 A;  1S3Z A;  2FS5 A;  2J8N A;  3EXN A;  4KZT A;  3QAH A;  2Q04 A;  2G0B A;  4YGO A;  1B87 A;  3BLN A;  4JLY A;  4QB9 A;  4LUA A;  2BL1 A;  4U9Y A;  3SXN A;  2P6G A;  3TO9 A;  5KTA A;  3FIX A;  2Z11 A;  4MJ8 A;  2K5T A;  4KLW A;  3IGR A;  1NE9 A;  4QC6 A;  2FXF A;  2QIR A;  2X7B A;  1IYK A;  4NXY A;  2Y0M A;  3F5B A;  1I12 A;  5HH1 A;  3JVN A;  5KTD A;  5DWM A;  4ONU A;  1IB1 E;  4L8A A;  3F0A A;  3DDD A;  5CNP A;  3VWD A;  1OZP A;  3BJ8 A;  3BJ7 A;  1KUV A;  2OZU A;  3S6K A;  1XF8 A;  1S7K A;  2OB0 A;  3ZJ0 A;  3CXQ A;  4YRH A;  3FRM A;  3OWC A;  4PSW A;  5C88 A;  4F6A A;  5JQ4 A;  1LRZ A;  4CAW A;  1MJB A;  4E2A A;  2PR8 A;  4NSQ A;  4RI1 A;  2CY2 A;  2G3T A;  3W6X A;  1CJW A;  3FYN A;  5GCN A;  2Q4V A;  1SQH A;  4F0Y A;  3C26 A;  2J8M A;  5EBV A;  3TE4 A;  5ISV A;  2ATR A;  2EUI A;  2Q0Y A;  2VZZ A;  1MK4 A;  3LD2 A;  2B4D B;  3CXS A;  3P2F A;  3TO6 A;  1KUX A;  1RO5 A;  4JD6 A;  2B4D A;  4R3K A;  4JWP A;  1M4D A;  2ZPA A;  3GY9 A;  4R3L A;  2JDD A;  4M85 A;  1WK4 A;  2JEV A;  2B4B A;  4OAE A;  5F48 A;  3EC4 A;  2EVN A;  4AVC A;  2Q4Y A;  5HMN A;  4KOR A;  4II9 A;  5JPH A;  1FY7 A;  3DSB A;  4MHD A;  1M4I A;  4AVA A;  1IID A;  3D2P A;  2AJ6 A;  1M44 A;  4UWJ A;  4FD7 A;  3FB3 A;  4PK2 A;  2PSW A;  4CS0 B;  4FD6 A;  5IX3 A;  5E96 A;  4MI4 A;  5H84 A;  1BOB A;  1KUY A;  4KOY A;  5H86 A; 
#chains in the Genus database with same CATH topology
 2Q44 A;  4Y49 B;  2VXK A;  4KOV A;  1VHE A;  5KTC A;  1HDQ A;  3TC8 A;  1TF9 A;  2J8R A;  1ZLH A;  4XPD B;  4Z65 A;  3SI1 A;  1XOV A;  2R98 A;  1CPX A;  1PU9 A;  2PJ5 A;  2HUZ A;  4NGT A;  3T9Y A;  3WT4 A;  4CYP A;  4IUS A;  3EFA A;  4P4I A;  2V8D A;  3FNC A;  1BO4 A;  3GUX A;  4UWI A;  5LYD A;  4OC2 A;  4XNH C;  2HV2 A;  3S6F A;  4ONW A;  4YFJ A;  1A2Z A;  3I1U A;  3IFE A;  1XFO A;  2ZEL A;  4B10 A;  2VQY A;  4ZY0 A;  3DLJ A;  4PQA A;  3WC7 A;  2PDO A;  2AFZ A;  2P6E A;  2Z3K A;  2Q7S A;  2YNE A;  3MGD A;  1PYT B;  2BEI A;  3CXP A;  1V0C A;  3D67 A;  2JDC A;  3LOD A;  3SJX A;  1YX0 A;  5G22 A;  3FBU A;  5F49 A;  4UF4 A;  5IB0 A;  2DXQ A;  4AG9 A;  4MCS A;  3NH5 A;  2REF A;  5EMI A;  4A37 A;  4CGM A;  1LAP A;  4JZ0 A;  2RB7 A;  4NGM A;  2ABZ A;  2WSA A;  3V8I A;  2AFW A;  2Q7B A;  3H8G A;  4AVB A;  4C7H A;  1VHS A;  2WPW A;  4FBE A;  3D2M A;  2NSM A;  4B11 A;  2G3A A;  5IV0 A;  1KWM A;  1R57 A;  2FIW A;  2ODF A;  2I79 A;  1Z4R A;  2B58 A;  3H5Z A;  2BSW A;  3VAR A;  1X12 A;  2BO9 A;  4M3S A;  2PJ7 A;  2VZY A;  4P4E A;  1I1D A;  1Y9W A;  3PB6 X;  3PB9 X;  4KVX A;  4MHY A;  4NCZ A;  4CYN A;  4PV6 A;  2C27 A;  1K4J A;  2FT0 A;  2PJC A;  2XEJ A;  1LAN A;  4H89 A;  1QSR A;  3GB0 A;  2JBJ A;  4IF5 A;  3VAT A;  4BIN A;  2PJA A;  2QEC A;  4K3N A;  3KKW A;  4MCQ A;  5LRJ A;  2R8V A;  2ANP A;  2FIA A;  1UWY A;  1YME A;  2B5G B;  3H8F A;  4OLL A;  4P4F A;  3TT2 A;  3P2H A;  2V77 A;  3RNZ A;  1S7F A;  3R9G A;  3PP9 A;  4KVO E;  2FSR A;  4B6Z A;  4CRY B;  2NMT A;  2PCU A;  1ELM P;  4UA3 A;  3I9S A;  2B5G A;  4FAI A;  2PVW A;  2ZW6 A;  3IIB A;  1BPM A;  2AFS A;  2GAN A;  4KOX A;  1HEE A;  4E0A A;  1DTD A;  2YND A;  3L2N A;  1S7N A;  4ZGY B;  1YW4 A;  3PB4 X;  2I3C A;  1AMP A;  3D3S A;  3PEI A;  4R76 A;  3A9L A;  1YGH A;  4UCM A;  2Z3P A;  3S6G A;  4A31 A;  3KGQ A;  4A33 A;  4FD4 A;  3D7D A;  1IIC A;  4ZX8 A;  3FVL A;  4YWY A;  1ON0 A;  4RN7 A;  1PCA A;  1OBR A;  1TKJ A;  2ZOF A;  3SI0 A;  3KZW A;  2JEW A;  4KUA A;  1H8L A;  3H8E A;  1LOK A;  1P4N A;  2FCK A;  4MCR A;  2OU2 A;  4R8F A;  5G1Z A;  2ZEP A;  3KI9 A;  5G21 A;  3DR6 A;  2DPS A;  2PIZ A;  3NH4 A;  2B3V A;  4LQ6 A;  4G1P A;  2C6G A;  4TWE A;  1ARL A;  4MY0 A;  4CAE A;  3JUW A;  1YK3 A;  5F09 A;  2PQ8 A;  4P45 A;  4LX9 A;  5LYL A;  1JQG A;  4KSF A;  3F8K A;  3RYO A;  3EO4 A;  1CG2 A;  1WWZ A;  1CP6 A;  3D66 A;  1AUG A;  2AE6 A;  2IMO A;  3B35 A;  4HNX B;  3BXM A;  1YVO A;  3RAM A;  4KVM E;  2CTB A;  2YNC A;  1VHO A;  2OR4 A;  3PFE A;  4YU9 A;  2IQ6 A;  2DEA A;  2A4N A;  4NGS A;  1Z9U A;  1CBX A;  1YLE A;  2EK8 A;  2OZG A;  2Z3L A;  5K8P A;  2ZED A;  3TCV A;  5F47 A;  4C2X A;  1MJA A;  1MJ9 A;  2GE3 A;  4GM5 A;  5LRK A;  1GHE A;  1HDU A;  2GFQ A;  1QSN A;  3NA6 A;  4MFQ A;  4A32 A;  3E0K A;  3PRT A;  4B5O A;  3PGP A;  4B12 A;  3TTH A;  3B3S A;  4ZBG A;  3G8W A;  2GU2 A;  4X5K A;  3R9E A;  8CPA A;  4JYW A;  1NSL A;  5I4M A;  1BLL E;  1B6B A;  1P0H A;  1XJO A;  3KQZ A;  1Q2D A;  3B7I A;  3GKR A;  4DUK A;  4JXQ A;  4QUS A;  2JLM A;  1XBU A;  2VBQ A;  1Z4E A;  4UCP A;  2V8G A;  2ZW4 A;  3EY5 A;  1Z2L A;  3N5F A;  5HXD A;  5HVH A;  3GIU A;  1S7L A;  3B8G A;  2C1C A;  2Z3N A;  1XRY A;  4Y49 C;  3S9L A;  2Q4Z A;  3WC5 A;  5J8C A;  3K9T A;  4U5Y A;  3GLJ A;  4KOS A;  2V8H A;  1QQ9 A;  4XPD C;  3IEH A;  3IWE A;  3S6H A;  3SXO A;  3B3T A;  4GS4 A;  3BHX A;  4MFZ A;  1YLO A;  2PJ1 A;  3D4U A;  4U9Z A;  1CX8 A;  2IL4 A;  4R6T A;  2REE A;  3PB7 X;  1BAV A;  4M6I A;  4UEF A;  1YRE A;  2HQY A;  5LRG A;  2O53 A;  4OKO A;  3N7Z A;  4R7M A;  5THW A;  2ARH A;  1Y9K A;  2G9D A;  2ZEF A;  4QVT A;  4UCN A;  1F2P A;  2D4P A;  4PXE A;  3SJE A;  4DJL A;  5LYF A;  4NEX A;  1GYT A;  2VL1 A;  2AFX A;  2ZEH A;  2H5M A;  2VI7 A;  4BMH A;  4MBU A;  4CGN A;  4OAD A;  5A28 A;  4MFL A;  4B13 A;  4NJR A;  4CGL A;  2FL4 A;  1YVK A;  3V38 A;  3TOA A;  3JTK A;  4XNH B;  3DNS A;  3TFY A;  6CPA A;  3R9F A;  3IWG A;  3V7Z A;  3KR5 A;  1U6M A;  1BPN A;  3D8P A;  3K9U A;  4E8O A;  7CPA A;  4PK3 A;  3SJF A;  4DNC A;  4HKF A;  1L0C A;  4XPK A;  4ORF A;  4BD9 A;  3W91 A;  2PRB A;  2D4O A;  2ZEG A;  2QJ8 A;  4EVY A;  3ISX A;  1QST A;  3DGV A;  1RXT A;  4HNW B;  4F9V A;  2QML A;  5AG6 A;  4PXD A;  2R7H A;  4PXB A;  1KZF A;  4ZY2 A;  1UFH A;  3SHP A;  4B5P B;  1XEB A;  4HNY B;  2PJ4 A;  2BUE A;  4R9M A;  3R1K A;  2OZH A;  1J4J A;  2B3U A;  4MFK A;  4L89 A;  1IU8 A;  1I21 A;  1TIQ A;  1YR0 A;  1F2O A;  2Z10 A;  3PZJ A;  4F0X A;  1NSA A;  3K2K A;  1PUA A;  3FF3 A;  3NFZ A;  4KSI A;  2PC1 A;  4MFJ A;  4B5P A;  1QSO A;  4AB7 A;  4RUH A;  3JRU A;  3KQX A;  1TKF A;  2ZXV A;  3B3V A;  3CT9 A;  5EC4 A;  4J3G A;  3TOB A;  1QMU A;  4MCP A;  3FMC A;  1Y7R A;  2HC9 A;  3IJ3 A;  4LQG A;  5J8F A;  4O23 A;  4I49 A;  2C6P A;  1M4G A;  2GLJ A;  5FVJ A;  5AGE A;  2CTC A;  3T8W A;  4R87 A;  4W9Y A;  4H6U A;  3D68 A;  5AG5 A;  2RC4 A;  4K30 A;  1QSM A;  2PJB A;  4R57 A;  2O28 A;  1M1D A;  1Q2Y A;  3RO0 A;  4KOU A;  1S60 A;  3FX6 A;  4OID A;  1VKC A;  4A38 A;  4CAX A;  1R43 A;  4CGP A;  5I0C A;  3T90 A;  3NH8 A;  2R1I A;  4JXR A;  1Y7E A;  5F46 A;  2PR1 A;  1TXR A;  2GIV A;  2RFH A;  2F8H A;  1IOF A;  1Y0R A;  2P6F A;  3H4Q A;  4HPS A;  1IOI A;  4KOW A;  3KR4 A;  4MY3 A;  4M6H A;  3NE7 A;  2P0W A;  3DR8 A;  3QNV A;  4XPL A;  3G3S A;  2PJ0 A;  3UY5 A;  3FXT A;  5C82 A;  2CNS A;  2F7V A;  4FD5 A;  3ZZI A;  2Z3O A;  1NMT A;  3WR7 A;  4CYO A;  5CBM A;  1R3N A;  1ZG8 A;  4OME A;  3IO1 A;  4UFW A;  2YNC C;  4KOT A;  2KCW A;  1Z5R A;  4PXC A;  1XE4 A;  2OH1 A;  1XIX A;  1CP7 A;  1XMT A;  2IJZ A;  2Q43 A;  2Z0Z A;  4OP4 A;  3CPX A;  4P10 A;  4UEE A;  4Q36 A;  2JBK A;  2F5I A;  4IAV A;  1Q2C A;  3SJG A;  1ZG7 A;  4CGO A;  3TO7 A;  4CRZ B;  4A30 A;  1YW6 A;  3B3W A;  1FNO A;  3IWW A;  4KLV A;  4PPZ A;  4CYQ A;  4MMO A;  4UIA A;  4KUB A;  4IK2 A;  4AG7 A;  2WPX A;  5DWN A;  4PSX A;  2CNT A;  4KSA A;  4NF1 A;  5HVG A;  4C7I A;  1ZLI A;  2DF5 A;  2XEG A;  4FWU A;  1CPS A;  2FE7 A;  2QYV A;  3QB8 A;  4GXH A;  2I00 A;  4UBR A;  1CM0 A;  2ZW5 A;  5LYI A;  1XMB A;  4NGQ A;  2CNM A;  3GYA A;  3HUV A;  4H6Z A;  1M4L A;  3FH4 A;  4JJX A;  2WZN A;  4MFP A;  3I3G A;  3WC6 A;  1Z8W A;  4RS2 A;  4F8Z A;  3ISZ A;  2FVG A;  4MHZ A;  2ZW7 A;  4WWV A;  5CPA A;  3W6S A;  2PJ6 A;  2XEI A;  2VEZ A;  3S9N A;  3BI0 A;  3IU1 A;  1IGB A;  1IYL A;  4NGN A;  4CAV A;  3CPA A;  5J1Q A;  1S5K A;  3R95 A;  4OC1 A;  4UFX A;  3VWE A;  3R96 A;  4P4J A;  4QBJ A;  3FEE A;  5K8M A;  3TX8 A;  4X8I A;  1N71 A;  3PBE A;  4TNU A;  1S3Z A;  4MXU A;  2FS5 A;  2J8N A;  2QVP A;  3EXN A;  4KZT A;  4P6Y A;  5JH9 A;  3QAH A;  2CXA A;  2Q04 A;  3VH9 A;  4A39 A;  2G0B A;  4YGO A;  2WUU A;  4DYO A;  4ZX9 A;  1B87 A;  4EWT A;  4P44 A;  1ZO0 A;  5G20 A;  2EWB A;  3FED A;  3NE8 A;  4OC5 A;  2PRQ A;  2PJ9 A;  3BLN A;  4JLY A;  4QB9 A;  4LUA A;  2BL1 A;  5K8N A;  4U9Y A;  3SXN A;  2P6G A;  3TO9 A;  2O4H A;  5KTA A;  2CF4 A;  4P4B A;  1LCP A;  5IB9 A;  3FIX A;  2Z11 A;  4MHN A;  4MJ8 A;  2ZEN A;  4ZYQ A;  2POK A;  2K5T A;  2DPT A;  4KLW A;  4CPA A;  3SI2 A;  3IGR A;  2ZEO A;  1NE9 A;  3PB8 X;  4QC6 A;  2GRE A;  4OIW A;  4M6G A;  4CAF A;  3BI1 A;  1F57 A;  2PJ2 A;  1ELL P;  5A27 A;  2FXF A;  2QIR A;  1ARM A;  2X7B A;  5HVF A;  5D29 A;  1IYK A;  4MRI A;  4NXY A;  2Y0M A;  3F5B A;  1LFW A;  5AG7 A;  5JGF A;  1I12 A;  5HH1 A;  3S9M A;  4KS9 A;  3JVN A;  5KTD A;  5DWM A;  4B14 A;  4X2T A;  3LWU A;  4ONU A;  4P4D A;  1IB1 E;  3CDX A;  4L8A A;  3F0A A;  3DDD A;  5CNP A;  1YQE A;  3VWD A;  2BOA A;  4UFV A;  5D8N A;  1OZP A;  3BJ8 A;  1YSJ A;  1Z8X A;  1KUV A;  2OZU A;  3BJ7 A;  3S6K A;  2OOT A;  1XF8 A;  1S7K A;  3MRU A;  2OB0 A;  3ZJ0 A;  1X10 A;  2GLF A;  3CXQ A;  4ZI6 A;  4YRH A;  3FRM A;  2YGW A;  3OWC A;  4PSW A;  4NGP A;  4H2K A;  5C88 A;  1TKH A;  4F9U A;  1VIX A;  4F6A A;  5JQ4 A;  5AG4 A;  3KL9 A;  1LAM A;  1Q7L A;  2EO8 A;  1LRZ A;  1VGY A;  4CAW A;  1MJB A;  4E2A A;  2PR8 A;  4NSQ A;  4EFD A;  4FUU A;  4C2Y A;  2PJ8 A;  3B3C A;  2CY2 A;  2G3T A;  4RI1 A;  4UIB A;  3QAY A;  3W6X A;  1CJW A;  4NFR A;  4Q7A A;  4NJQ A;  3FYN A;  3IU2 A;  3HLP A;  5GCN A;  3WAB A;  4A2Z A;  2ZEE A;  1Y0Y A;  2Q4V A;  3FEC A;  4IHM A;  1SQH A;  4AXV A;  4F0Y A;  2EBJ A;  2J9A A;  1JWQ A;  3IC1 A;  3KAS A;  4A94 A;  5BWA B;  4C2Z A;  1ZG9 A;  3B2Y A;  3C26 A;  4BBH A;  2J8M A;  5EBV A;  3TE4 A;  5JM6 A;  5ELY A;  5ISV A;  2Q51 A;  2ATR A;  2EUI A;  4OC4 A;  1DE4 C;  2Q0Y A;  2VZZ A;  1MK4 A;  3LD2 A;  5K8O A;  3PFO A;  2AFU A;  1EE3 P;  2B4D B;  3CXS A;  3P2F A;  4Q38 A;  3TO6 A;  3CZX A;  4OC0 A;  2PJ3 A;  2C6C A;  4EME A;  1KUX A;  1RO5 A;  3D7H A;  3RBU A;  4JD6 A;  2CIJ A;  2B4D A;  3FJU A;  4R3K A;  4JWP A;  1M4D A;  2BCO A;  2Z3M A;  2ZPA A;  3GY9 A;  4R3L A;  2JDD A;  4M85 A;  3KHX A;  5DS0 A;  1FT7 A;  1WK4 A;  2NYQ A;  4WJB A;  2JEV A;  1Z8L A;  4C68 A;  2B4B A;  2WYR A;  4OAE A;  2HB6 A;  4ZY1 A;  2PE3 A;  5F48 A;  4NGR A;  3EC4 A;  2EVN A;  4AVC A;  2Q4Y A;  5HMN A;  4KOR A;  3D7F A;  4II9 A;  2PVV A;  2AFM A;  1AYE A;  3KHZ A;  1FY7 A;  3DSB A;  5JPH A;  4MHD A;  1M4I A;  4AVA A;  1TF8 A;  2AFO A;  1IID A;  4A95 A;  3D2P A;  3MN8 A;  3RZA A;  2AJ6 A;  2V8V A;  4X3R A;  1M44 A;  3LAC A;  1RTQ A;  4OC3 A;  4FD7 A;  3PBB A;  3FB3 A;  4UWJ A;  4MHP A;  4PK2 A;  4UEZ A;  2PSW A;  2ZEM A;  2EK9 A;  4CS0 B;  2XEF A;  2PIY A;  4FD6 A;  5IX3 A;  3D7G A;  1IY7 A;  1Z8T A;  4MI4 A;  5E96 A;  5H84 A;  1BOB A;  1KUY A;  3LMS A;  4KOY A;  5H86 A;  2ZOG A; 
#chains in the Genus database with same CATH homology
 2Q44 A;  4Y49 B;  2VXK A;  4KOV A;  5KTC A;  2J8R A;  4XPD B;  2R98 A;  1PU9 A;  2HUZ A;  3T9Y A;  4CYP A;  4IUS A;  3EFA A;  3FNC A;  1BO4 A;  4UWI A;  4XNH C;  2HV2 A;  3S6F A;  4YFJ A;  4B10 A;  2VQY A;  2PDO A;  2P6E A;  2Z3K A;  3MGD A;  2YNE A;  2BEI A;  3CXP A;  1V0C A;  2JDC A;  3LOD A;  1YX0 A;  5G22 A;  3FBU A;  5F49 A;  5IB0 A;  2DXQ A;  4AG9 A;  2REF A;  4CGM A;  2WSA A;  3V8I A;  2Q7B A;  4AVB A;  4C7H A;  1VHS A;  2WPW A;  3D2M A;  4B11 A;  2G3A A;  5IV0 A;  1R57 A;  2FIW A;  2I79 A;  1Z4R A;  2B58 A;  3H5Z A;  2BSW A;  4M3S A;  2VZY A;  1I1D A;  1Y9W A;  4CYN A;  4KVX A;  4NCZ A;  4PV6 A;  2C27 A;  1K4J A;  2FT0 A;  4H89 A;  1QSR A;  4IF5 A;  2QEC A;  3KKW A;  2R8V A;  2FIA A;  2B5G B;  4OLL A;  3TT2 A;  3P2H A;  1S7F A;  3R9G A;  3PP9 A;  4KVO E;  2FSR A;  4CRY B;  2NMT A;  4UA3 A;  3I9S A;  2B5G A;  2ZW6 A;  4KOX A;  2GAN A;  4E0A A;  2YND A;  1S7N A;  4ZGY B;  4UCM A;  3D3S A;  3S6G A;  3A9L A;  1YGH A;  2Z3P A;  4A31 A;  4A33 A;  4FD4 A;  1IIC A;  1ON0 A;  4KUA A;  1P4N A;  2FCK A;  2OU2 A;  5G1Z A;  5G21 A;  3DR6 A;  2DPS A;  2B3V A;  4CAE A;  4MY0 A;  3JUW A;  1YK3 A;  2PQ8 A;  4LX9 A;  4KSF A;  3F8K A;  3RYO A;  3EO4 A;  1WWZ A;  4HNX B;  2AE6 A;  1YVO A;  4KVM E;  2YNC A;  2A4N A;  1Z9U A;  1YLE A;  2OZG A;  2Z3L A;  3TCV A;  5F47 A;  4C2X A;  1MJA A;  1MJ9 A;  2GE3 A;  1GHE A;  1QSN A;  4MFQ A;  4A32 A;  3E0K A;  4B5O A;  3PGP A;  4B12 A;  3TTH A;  4ZBG A;  3G8W A;  3R9E A;  4X5K A;  1NSL A;  1B6B A;  1P0H A;  1Q2D A;  3GKR A;  4JXQ A;  4QUS A;  2JLM A;  2VBQ A;  1Z4E A;  4UCP A;  2ZW4 A;  3EY5 A;  1S7L A;  3B8G A;  2Z3N A;  4Y49 C;  5J8C A;  4U5Y A;  4KOS A;  4XPD C;  3IWE A;  3S6H A;  3SXO A;  4GS4 A;  4MFZ A;  4U9Z A;  2IL4 A;  2REE A;  1YRE A;  2HQY A;  3N7Z A;  2ARH A;  1Y9K A;  4QVT A;  4UCN A;  2D4P A;  4NEX A;  4BMH A;  2H5M A;  2VI7 A;  4CGN A;  4MBU A;  4OAD A;  5A28 A;  4MFL A;  4B13 A;  4CGL A;  2FL4 A;  1YVK A;  3TOA A;  3JTK A;  4XNH B;  3DNS A;  3TFY A;  3R9F A;  3IWG A;  1U6M A;  3D8P A;  3K9U A;  4E8O A;  4PK3 A;  4DNC A;  4HKF A;  1L0C A;  4XPK A;  4ORF A;  3W91 A;  2PRB A;  2D4O A;  4EVY A;  1QST A;  4HNW B;  1RXT A;  2QML A;  5AG6 A;  2R7H A;  1KZF A;  1UFH A;  3SHP A;  4B5P B;  1XEB A;  4HNY B;  2BUE A;  4R9M A;  3R1K A;  2OZH A;  1J4J A;  2B3U A;  4MFK A;  4L89 A;  1I21 A;  2Z10 A;  1TIQ A;  1YR0 A;  3PZJ A;  4F0X A;  1PUA A;  4B5P A;  4MFJ A;  2PC1 A;  1QSO A;  4AB7 A;  2ZXV A;  5EC4 A;  4J3G A;  3TOB A;  1Y7R A;  5J8F A;  4I49 A;  1M4G A;  5FVJ A;  5AGE A;  4R87 A;  4H6U A;  5AG5 A;  2RC4 A;  4K30 A;  1QSM A;  4R57 A;  2O28 A;  1M1D A;  1Q2Y A;  4KOU A;  1S60 A;  4CAX A;  1VKC A;  4CGP A;  5I0C A;  3T90 A;  2R1I A;  4JXR A;  5F46 A;  2PR1 A;  2GIV A;  2P6F A;  3H4Q A;  4KOW A;  4MY3 A;  3NE7 A;  2P0W A;  3DR8 A;  4XPL A;  3G3S A;  3FXT A;  5C82 A;  2CNS A;  4FD5 A;  3ZZI A;  2Z3O A;  1NMT A;  3WR7 A;  4CYO A;  4UFW A;  2YNC C;  4KOT A;  2KCW A;  1XE4 A;  2OH1 A;  1XIX A;  1XMT A;  2Z0Z A;  3UY5 A;  4Q36 A;  2F5I A;  1Q2C A;  4CGO A;  4CRZ B;  3TO7 A;  4A30 A;  4KLV A;  4CYQ A;  4KUB A;  4AG7 A;  2WPX A;  5DWN A;  4PSX A;  2CNT A;  4KSA A;  4NF1 A;  4C7I A;  2FE7 A;  3QB8 A;  4UBR A;  2I00 A;  1CM0 A;  2ZW5 A;  2CNM A;  3GYA A;  4H6Z A;  4JJX A;  4MFP A;  3I3G A;  4RS2 A;  2ZW7 A;  3W6S A;  2VEZ A;  3IU1 A;  1IYL A;  4CAV A;  1S5K A;  3R95 A;  3VWE A;  4UFX A;  3R96 A;  4QBJ A;  1N71 A;  1S3Z A;  2FS5 A;  2J8N A;  3EXN A;  4KZT A;  3QAH A;  2CXA A;  2Q04 A;  2G0B A;  4YGO A;  2WUU A;  1B87 A;  1ZO0 A;  5G20 A;  3BLN A;  4JLY A;  4QB9 A;  4LUA A;  2BL1 A;  4U9Y A;  3SXN A;  2P6G A;  3TO9 A;  5KTA A;  3FIX A;  2Z11 A;  4MJ8 A;  2K5T A;  2DPT A;  4KLW A;  3IGR A;  1NE9 A;  4QC6 A;  4CAF A;  5A27 A;  2FXF A;  2QIR A;  2X7B A;  1IYK A;  4NXY A;  2Y0M A;  3F5B A;  5AG7 A;  1I12 A;  5HH1 A;  4KS9 A;  3JVN A;  5KTD A;  5DWM A;  4B14 A;  4ONU A;  1IB1 E;  4L8A A;  3F0A A;  3DDD A;  5CNP A;  3VWD A;  4UFV A;  1OZP A;  3BJ8 A;  3BJ7 A;  1KUV A;  2OZU A;  3S6K A;  1XF8 A;  1S7K A;  2OB0 A;  3ZJ0 A;  3CXQ A;  4YRH A;  3FRM A;  2YGW A;  3OWC A;  4PSW A;  5C88 A;  4F6A A;  5JQ4 A;  5AG4 A;  1LRZ A;  4CAW A;  1MJB A;  4E2A A;  2PR8 A;  4NSQ A;  4C2Y A;  4RI1 A;  2CY2 A;  2G3T A;  3W6X A;  1CJW A;  3FYN A;  3IU2 A;  5GCN A;  4A2Z A;  2Q4V A;  1SQH A;  4F0Y A;  5BWA B;  4C2Z A;  3C26 A;  4BBH A;  2J8M A;  5EBV A;  3TE4 A;  5ISV A;  2ATR A;  2EUI A;  2Q0Y A;  2VZZ A;  1MK4 A;  3LD2 A;  2B4D B;  3CXS A;  3P2F A;  4Q38 A;  3TO6 A;  1KUX A;  1RO5 A;  4JD6 A;  2B4D A;  4R3K A;  4JWP A;  1M4D A;  2Z3M A;  2ZPA A;  3GY9 A;  4R3L A;  2JDD A;  4M85 A;  1WK4 A;  2JEV A;  4C68 A;  2B4B A;  4OAE A;  5F48 A;  3EC4 A;  2EVN A;  4AVC A;  2Q4Y A;  5HMN A;  4KOR A;  4II9 A;  5JPH A;  1FY7 A;  3DSB A;  4MHD A;  1M4I A;  4AVA A;  1IID A;  4A95 A;  3D2P A;  2AJ6 A;  1M44 A;  4UWJ A;  4FD7 A;  3FB3 A;  4PK2 A;  2PSW A;  4CS0 B;  4FD6 A;  5IX3 A;  5E96 A;  4MI4 A;  5H84 A;  1BOB A;  1KUY A;  4KOY A;  5H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...