4YFJA

Crystal structure of aminoglycoside acetyltransferase aac(3)-ib
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
SIIATVKIGPDEISAMRAVLDLFGKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPRTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminoglycoside acetyltransferase AAC(3)-Ib
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Aminoglycoside 3'-N-acetyltransferase
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yfjA00
2R8VA 2WPXA 3SHPA 4I49A 5HMNA 3EY5A 3R96A 2ZW6A 3I3GA 3KKWA 4B5PB 2EVNA 1YR0A 3T9YA 5J8CA 1VHSA 5C88A 1M4GA 1MK4A 3QB8A 1S3ZA 4KOTA 4MHDA 4OAEA 1GHEA 4KVME 2VZZA 1MJAA 2GANA 1Y9KA 3TOAA 5F48A 4KOWA 2PQ8A 2ZW7A 4R57A 2B58A 3S6HA 3B8GA 3PP9A 2OU2A 1M4IA 3EFAA 3D3SA 3G3SA 2B5GB 2QMLA 4CAVA 3SXOA 2R98A 1U6MA 2H5MA 4MY0A 2F5IA 4KOYA 4KUAA 4KORA 3VWDA 1BOBA 3EC4A 3I9SA 3V8IA 2IL4A 1M4DA 1Y9WA 3T90A 1CJWA 4X5KA 5IV0A 3R9EA 5FVJA 2QIRA 1XE4A 3TE4A 3F8KA 2VBQA 5ISVA 3PZJA 2CNMA 1M44A 1KUYA 1XEBA 2CY2A 3TOBA 1FY7A 1Q2YA 4XNHC 2VXKA 4H6ZA 2JEVA 2OB0A 2B4DA 2CNTA 4XPLA 1IB1E 3TFYA 3IGRA 3ZZIA 2VQYA 2Q7BA 4OADA 1YX0A 5F49A 1SQHA 1QSOA 3G8WA 1S7LA 4K30A 3TO6A 3EO4A 1V0CA 5J8FA 3GY9A 4L8AA 4YFJA 4BMHA 3LODA 2ZW4A 3CXSA 1L0CA 5C82A 2I00A 1J4JA 5GCNA 1N71A 2EUIA 4UWIA 1XMTA 5F47A 1RO5A 4NSQA 3D2PA 4CS0B 1Q2CA 2GIVA 1YVKA 2BUEA 3PGPA 4R3KA 4M3SA 3S6GA 4MBUA 4QBJA 2Q44A 4MI4A 2I79A 5I0CA 2PC1A 2VZYA 1B87A 2AE6A 5JQ4A 1QSNA 1S7NA 1P0HA 1XF8A 3FBUA 5H84A 4NCZA 2B4DB 3W6SA 2FIWA 2HUZA 4XPKA 2R7HA 2D4OA 4PSXA 2ATRA 5DWNA 1I1DA 3FRMA 3SXNA 2PSWA 4QUSA 1M1DA 4II9A 2J8MA 3W91A 1KUXA 2B3UA 3CXPA 2Q4VA 4XPDC 3RYOA 4AVBA 4JXRA 3ZJ0A 4HNYB 1BO4A 1WK4A 2PDOA 1UFHA 3TO7A 2BL1A 2WPWA 2ZW5A 3EXNA 4KZTA 2OZHA 5KTCA 2PR8A 4YRHA 3D8PA 2BEIA 4E0AA 1YVOA 3BJ7A 4RI1A 4NF1A 4UWJA 2R1IA 4KLVA 3WR7A 2P0WA 4H89A 3F5BA 4AG9A 3CXQA 4QB9A 3VWEA 2Q4YA 2G3AA 4KOVA 2P6EA 4JD6A 2PRBA 1RXTA 3C26A 2OH1A 3D2MA 2VI7A 4QC6A 4PK3A 4FD6A 3BLNA 4YGOA 3DR6A 4E2AA 3FIXA 2PR1A 2BSWA 2DXQA 2QECA 2J8RA 3N7ZA 2RC4A 4MJ8A 4L89A 4Y49B 1Y7RA 5KTDA 4KOUA 3OWCA 2C27A 4Y49C 1OZPA 2Y0MA 1S7FA 4KVXA 5EBVA 2FT0A 4ONUA 2Z10A 3TO9A 1IYLA 2Z0ZA 2KCWA 4KOXA 4M85A 2Q0YA 5IB0A 4PK2A 1VKCA 1Q2DA 2A4NA 3S6KA 2HQYA 4KVOE 3JVNA 3K9UA 1KUVA 2J8NA 3R9GA 4B5OA 4FD4A 2CNSA 4J3GA 2B3VA 4F0YA 1B6BA 4PV6A 3S6FA 4U9YA 4XNHB 2B5GA 2REEA 4MY3A 2GE3A 1S7KA 3FXTA 2ZPAA 3R95A 4GS4A 3P2HA 3R9FA 3DR8A 4JWPA 3TTHA 4E8OA 1CM0A 1ON0A 2FE7A 5E96A 4LUAA 5H86A 4U5YA 2ARHA 2JDCA 2OZGA 1QSMA 2G0BA 4XPDB 2HV2A 4CRYB 4UBRA 5IX3A 5CNPA 2NMTA 4CAWA 2X7BA 4UA3A 5EC4A 3GKRA 5KTAA 3H4QA 1LRZA 1YK3A 2FL4A 1I21A 4CRZB 3R1KA 1IYKA 3FB3A 2REFA 2P6FA 1KZFA 1R57A 1S60A 4OLLA 4CAXA 4HNWB 4HKFA 3P2FA 2JLMA 2JDDA 4ORFA 4EVYA 1YGHA 1PU9A 1S5KA 3GYAA 3DSBA 2P6GA 1P4NA 3TT2A 1QSRA 5JPHA 3BJ8A 4IF5A 4JLYA 2OZUA 3QAHA 4AVAA 3NE7A 3DNSA 4U9ZA 4PSWA 4KUBA 3TCVA 2B4BA 3W6XA 2Q04A 5DWMA 3UY5A 1TIQA 4NXYA 4HNXB 1Z9UA 3JUWA 4AB7A 2K5TA 4JJXA 2FS5A 4B5PA 2FSRA 2FCKA 2FXFA 1XIXA 4FD7A 1NSLA 3FNCA 2AJ6A 4H6UA 1Z4RA 2G3TA 4DNCA 2Z11A 3MGDA 4QVTA 1YREA 4R87A 4IUSA 2FIAA 4KOSA 1I12A 1IICA 4KLWA 2O28A 2VEZA 3DDDA 1NMTA 1PUAA 4AG7A 1QSTA 1IIDA 2D4PA 3IWGA 4F6AA 4JXQA 1K4JA 4R3LA 4RS2A 5F46A 1NE9A 4R9MA 3FYNA 4NEXA 1YLEA 4ZBGA 1MJ9A 5HH1A 2ZXVA 3LD2A 4FD5A 1Z4EA 1MJBA 4LX9A 3E0KA 3F0AA 1WWZA 4AVCA
chains in the Genus database with same CATH superfamily
2R8VA 2WPXA 3SHPA 4HPSA 1UWYA 4LQGA 4I49A 5HMNA 3EY5A 4NGMA 3R96A 4YU9A 4UCMA 2F7VA 2ZW6A 4FAIA 4A32A 3I3GA 1TXRA 4MFZA 1PYTB 2BO9A 3KKWA 4B5PB 2EVNA 1YR0A 5LRKA 4Q36A 3T9YA 5J8CA 5HVHA 1VHSA 5AG7A 4A94A 5C88A 1M4GA 2PVVA 1MK4A 3QB8A 1S3ZA 4KOTA 2AFZA 4MHDA 2PJCA 3SI1A 4CGNA 1GHEA 4KVME 4OAEA 2VZZA 1MJAA 2GANA 2IJZA 1Y9KA 1RTQA 2CF4A 4MFPA 3TOAA 4DUKA 2YGWA 2Z3NA 3KHZA 5F48A 4KOWA 3IJ3A 2PQ8A 2ZW7A 3NFZA 4R57A 5G1ZA 3SJXA 2B58A 3S6HA 3B8GA 3B35A 4UFVA 1AUGA 5LYLA 3IIBA 3V38A 3PP9A 2OU2A 4UCNA 2WSAA 1M4IA 3EFAA 3D3SA 4OP4A 3G3SA 5HVFA 1ZLHA 1TKJA 2B5GB 2QMLA 5LRJA 2EK8A 2YNEA 4WWVA 2AFWA 3S9NA 5LYFA 4CAVA 2BOAA 4OIDA 3IWWA 3SXOA 2R98A 4NFRA 1U6MA 2H5MA 3IWEA 4H2KA 1Z8TA 5HXDA 4MY0A 1ARMA 2F5IA 4CGPA 1FT7A 4KOYA 3KGQA 4KUAA 4A33A 4KORA 3VWDA 4PXDA 2PJ4A 2PJ5A 4P4FA 1BOBA 3EC4A 3I9SA 3V8IA 4F0XA 1BAVA 2V8DA 2IL4A 1KWMA 1M4DA 1EE3P 1JQGA 5G22A 1Y9WA 3T90A 3KR5A 1CJWA 4X5KA 4ZI6A 5IV0A 2IQ6A 1ELLP 3I1UA 4UFXA 3D66A 3R9EA 2ZEFA 5FVJA 2QIRA 4BINA 1XE4A 3BHXA 2Q43A 2CTBA 4GM5A 2PJ9A 3TE4A 5CPAA 3F8KA 2Z3OA 3WC5A 4F8ZA 2VBQA 4MCRA 5ISVA 3PZJA 2CNMA 5AG4A 1M44A 1KUYA 1VIXA 1XEBA 2CY2A 3HUVA 1QQ9A 3TOBA 2BCOA 1FY7A 1Q2YA 4XNHC 2VXKA 4FUUA 4KS9A 4H6ZA 4C2XA 2JEVA 5AG5A 3KASA 5F09A 2OB0A 2QJ8A 2B4DA 2CNTA 4XPLA 2V8VA 2ZELA 3BI0A 2WYRA 1IB1E 3TC8A 3TFYA 3IGRA 4GXHA 3ZZIA 2VQYA 2V77A 2Q7BA 2O4HA 3KQZA 4C7HA 4OADA 1YX0A 1BPMA 2AFSA 4JYWA 5LRGA 4X8IA 5F49A 5LYIA 3BXMA 1AMPA 1H8LA 5AGEA 5EMIA 4C68A 4BBHA 5A28A 2XEJA 1SQHA 1QSOA 3H8FA 4MFJA 4CYNA 1R3NA 1XRYA 2PJ8A 2V8HA 3G8WA 4NGPA 4UIBA 2EK9A 1S7LA 4K30A 3TO6A 3RNZA 4UEZA 3D7DA 2JBKA 3B3CA 1CP7A 2OR4A 3EO4A 4A2ZA 1IOIA 2ZEEA 4CPAA 2HB6A 1V0CA 3B3WA 5J8FA 3GY9A 4L8AA 4YFJA 3PB6X 1YW6A 4OC2A 2DF5A 3LODA 4BMHA 2ZW4A 1ZLIA 2ZEHA 3KZWA 4P4DA 3CXSA 3WABA 1L0CA 5C82A 3FH4A 1CG2A 2I00A 4A37A 1J4JA 5GCNA 1Q7LA 4NGQA 4NGRA 3S9MA 3IC1A 1N71A 3NA6A 3VARA 3KR4A 4DYOA 2EUIA 4UWIA 1XMTA 1JWQA 2ZEMA 3N5FA 3DGVA 1RO5A 5F47A 4MCSA 4NSQA 4PPZA 2ANPA 2EBJA 2PJ6A 2Z3KA 3D2PA 2AFXA 1Q2CA 2GIVA 3B2YA 3PFEA 4MMOA 5D8NA 4CS0B 1YVKA 2BUEA 3PGPA 4R3KA 2ZOFA 4M3SA 1A2ZA 3KL9A 1XJOA 4MBUA 3S6GA 1IU8A 4CYQA 4MFLA 4QBJA 1R43A 2Q44A 4MI4A 2I79A 5I0CA 1YLOA 2PC1A 2VZYA 1B87A 2AE6A 5JQ4A 1QSNA 2DPSA 1S7NA 3PBEA 1P0HA 1XF8A 5THWA 1ARLA 3FEEA 3RBUA 3FBUA 5JGFA 5H84A 4KSAA 4NCZA 1X12A 2YNCC 2B4DB 3W6SA 1XOVA 2FIWA 2HUZA 4XPKA 2R7HA 2D4OA 3CPXA 4PSXA 2ATRA 4OC1A 4R8FA 2G9DA 1F57A 5DWNA 3D7GA 1I1DA 3FRMA 4UCPA 3SXNA 2PSWA 1X10A 3MN8A 4M6HA 4QUSA 3RO0A 3SJFA 1M1DA 3LWUA 4MHPA 4II9A 2GREA 2J8MA 4MCPA 3W91A 1KUXA 2WZNA 2B3UA 2RFHA 3CXPA 2Q4VA 4XPDC 3RYOA 4AVBA 4JXRA 3ZJ0A 4HNYB 1BO4A 4UFWA 3TX8A 1WK4A 2PDOA 3FMCA 4P6YA 1UFHA 5K8NA 3TO7A 4X3RA 1NSAA 2BL1A 2WPWA 4W9YA 1BPNA 1GYTA 2PJ1A 4R7MA 2ZW5A 3EXNA 4KZTA 3H8EA 2OZHA 5KTCA 2FVGA 2JEWA 2PR8A 3FECA 5J1QA 3LACA 4YRHA 4ZY1A 3D8PA 2BEIA 4E0AA 1YVOA 4P44A 4RUHA 2CIJA 4OKOA 3BJ7A 4R76A 3H8GA 3IU2A 4RI1A 1HDQA 1YSJA 2GFQA 2JBJA 4NF1A 1Z8LA 3CT9A 4OC0A 2F8HA 2EWBA 4UWJA 4ZY2A 4DJLA 4CYOA 1Z8WA 2R1IA 4A31A 4KLVA 3PEIA 4O23A 4P4EA 3WR7A 3PB9X 2P0WA 4B6ZA 4H89A 1Z8XA 3F5BA 4NGNA 2DEAA 4AG9A 2O53A 3VH9A 3GLJA 1DTDA 3CXQA 4QB9A 3VWEA 2Q4YA 2G3AA 4KOVA 5G21A 2P6EA 4JD6A 5DS0A 2ABZA 2PRBA 3D4UA 1QMUA 1RXTA 3C26A 4B13A 2OH1A 3D2MA 2VI7A 2C1CA 4QC6A 1LCPA 4PK3A 3FVLA 4FD6A 3IEHA 3BLNA 4MHNA 4YGOA 3DR6A 4E2AA 3FIXA 2HC9A 1XMBA 3D68A 2PR1A 2BSWA 3WC7A 2C6CA 2DXQA 2QECA 4NJRA 4P45A 3FEDA 2J8RA 7CPAA 2YNDA 3GUXA 1LAMA 3HLPA 2RC4A 3N7ZA 1Y7EA 4MJ8A 4L89A 2Q4ZA 3T8WA 4Y49B 4B11A 2GLJA 1Y7RA 5KTDA 4KOUA 3OWCA 3SJGA 2C27A 3L2NA 4Y49C 1OZPA 2Z3LA 4TWEA 2Y0MA 1S7FA 2QYVA 4KVXA 2C6PA 4M6IA 3DLJA 5EBVA 2FT0A 1PCAA 4ONUA 4B10A 4B12A 4F9UA 4OC3A 2Z10A 3B3SA 3TO9A 3PB4X 3PBBA 3PB7X 1IYLA 1CX8A 2Z0ZA 4EFDA 5JM6A 2KCWA 1LAPA 3WT4A 4KOXA 2XEIA 4Q38A 4M85A 4OC4A 2Q0YA 5IB0A 3B7IA 5G20A 4PK2A 4M6GA 4TNUA 1VKCA 1Q2DA 2A4NA 3S6KA 5K8MA 2HQYA 2ZEOA 4P4JA 4KVOE 3WC6A 1XBUA 1DE4C 1ZG9A 3JVNA 3K9UA 1KUVA 2RB7A 2J8NA 3R9GA 2I3CA 4ZX8A 2NSMA 2PJ7A 4FD4A 3LMSA 2XEGA 4B5OA 5I4MA 2CNSA 4J3GA 2B3VA 4F0YA 2POKA 1B6BA 4PV6A 3GB0A 4WJBA 1OBRA 4KSFA 3S6FA 5K8PA 4U9YA 4XNHB 4CAEA 4CGOA 5A27A 3ISZA 2B5GA 2IMOA 2REEA 4C2ZA 2V8GA 4CGMA 2ZENA 4OC5A 1YW4A 4MRIA 1TKFA 2YNCA 4MY3A 2GE3A 1S7KA 3FXTA 2ZPAA 1TF8A 3NH4A 3R95A 4Z65A 4PXBA 4GS4A 1YQEA 1BLLE 3P2HA 5JH9A 3QNVA 1FNOA 3R9FA 3DR8A 4JWPA 5LYDA 3TTHA 4CGLA 2Q7SA 4E8OA 1CM0A 4UF4A 2C6GA 4NJQA 3K9TA 1ON0A 2FE7A 2PVWA 5E96A 4LUAA 4A38A 1IOFA 3B3TA 3QAYA 2PJBA 3PFOA 2PJ3A 4A95A 5H86A 4EMEA 1CBXA 4U5YA 2ARHA 1F2OA 2JDCA 3JTKA 2OZGA 1QSMA 2G0BA 3FX6A 2ZEDA 4KSIA 4XPDB 5BWAB 1IY7A 2HV2A 2Z3PA 4CRYB 2PIYA 4UBRA 3FJUA 5IX3A 4UEFA 3IU1A 2NMTA 5CNPA 1HEEA 3CZXA 4CAWA 4Q7AA 4NGTA 2X7BA 4UA3A 4BD9A 1XFOA 1Y0YA 2PE3A 5EC4A 6CPAA 5CBMA 3RAMA 3GIUA 3SI0A 3GKRA 4MXUA 5KTAA 2VL1A 5ELYA 1LFWA 4OIWA 3H4QA 2PRQA 1LRZA 1YK3A 4P4BA 2FL4A 1I21A 4IAVA 4CRZB 4ZX9A 3R1KA 1IYKA 1ZO0A 2REFA 3FB3A 2P6FA 1KZFA 1R57A 1S60A 4JZ0A 4OLLA 3V7ZA 4B14A 4CAXA 4HNWB 2NYQA 4IHMA 4AXVA 4MHYA 4HKFA 8CPAA 2PIZA 3P2FA 2JLMA 4EWTA 2JDDA 4ORFA 4IK2A 1YGHA 4EVYA 1LANA 1PU9A 3D67A 1S5KA 3GYAA 3DSBA 3FF3A 2DPTA 2P6GA 4FBEA 4UIAA 1P4NA 4PQAA 1Z2LA 1IGBA 3IFEA 3MRUA 1LOKA 4PXCA 3TT2A 4P4IA 1AYEA 1QSRA 5JPHA 3BJ8A 4IF5A 4JLYA 4RN7A 1F2PA 2OZUA 3QAHA 4AVAA 2J9AA 3NE7A 3DNSA 2ODFA 4U9ZA 2ZEPA 1HDUA 4PSWA 3NH8A 3A9LA 3PRTA 4KUBA 3TCVA 3SI2A 3K2KA 1Z5RA 2B4BA 5D29A 3W6XA 2Q04A 2ZOGA 5DWMA 3UY5A 5HVGA 5K8OA 1TIQA 3PB8X 4NXYA 3H5ZA 1M4LA 1Z9UA 4HNXB 3JUWA 4A30A 4AB7A 5IB9A 2K5TA 4JJXA 2AFMA 2FS5A 1VGYA 3SJEA 4UEEA 4CYPA 4OMEA 4B5PA 3KI9A 4K3NA 3D7FA 3KQXA 2FSRA 2OOTA 2FCKA 1ZG8A 2FXFA 1XIXA 2WUUA 2PJAA 2ZEGA 4FD7A 1NSLA 1CPSA 3FNCA 4C7IA 2AJ6A 4H6UA 1Z4RA 3BI1A 3JRUA 2G3TA 1ZG7A 4ONWA 4DNCA 2Z11A 3S9LA 3MGDA 2GLFA 4QVTA 1TF9A 3KHXA 2PJ2A 1YREA 2CTCA 2AFUA 4IUSA 4R87A 4MCQA 2FIAA 3NH5A 3IO1A 4KOSA 1CPXA 1TKHA 1I12A 4LQ6A 1IICA 4KLWA 2O28A 2VEZA 4ZY0A 2PCUA 3ISXA 4NGSA 1Y0RA 3DDDA 1NMTA 2Q51A 1PUAA 1QSTA 4AG7A 3CDXA 2GU2A 4G1PA 1IIDA 2D4PA 3IWGA 2QVPA 3D7HA 5AG6A 4C2YA 1ELMP 4F6AA 4R6TA 4JXQA 1K4JA 2CXAA 4R3LA 4RS2A 1NE9A 5F46A 4R9MA 1CP6A 2XEFA 2Z3MA 3FYNA 4MFKA 4NEXA 4F9VA 3RZAA 1YLEA 4ZBGA 4MFQA 4YWYA 4FWUA 1VHEA 1YMEA 4P10A 3VATA 2AFOA 4PXEA 4X2TA 1MJ9A 4ZYQA 5HH1A 2PJ0A 2ZXVA 3LD2A 4FD5A 4ZGYB 1VHOA 1Z4EA 3CPAA 1MJBA 3NE8A 3E0KA 4LX9A 4CAFA 3F0AA 1WWZA 4MHZA 2EO8A 4A39A 4AVCA 3B3VA
chains in the Genus database with same CATH topology
2R8VA 2WPXA 3SHPA 4I49A 5HMNA 3EY5A 3R96A 4UCMA 2ZW6A 4A32A 3I3GA 4MFZA 3KKWA 4B5PB 2EVNA 1YR0A 4Q36A 3T9YA 5J8CA 1VHSA 5AG7A 5C88A 1M4GA 1MK4A 3QB8A 1S3ZA 4KOTA 4MHDA 4CGNA 1GHEA 4KVME 4OAEA 2VZZA 1MJAA 2GANA 1Y9KA 4MFPA 3TOAA 2YGWA 2Z3NA 5F48A 4KOWA 2PQ8A 2ZW7A 4R57A 5G1ZA 2B58A 3S6HA 3B8GA 4UFVA 3PP9A 2OU2A 4UCNA 2WSAA 1M4IA 3EFAA 3D3SA 3G3SA 2B5GB 2QMLA 2YNEA 4CAVA 3SXOA 2R98A 3IWEA 1U6MA 2H5MA 4MY0A 2F5IA 4CGPA 4KOYA 4KUAA 4A33A 4KORA 3VWDA 1BOBA 3EC4A 3I9SA 3V8IA 4F0XA 2IL4A 1M4DA 5G22A 1Y9WA 3T90A 1CJWA 4X5KA 5IV0A 4UFXA 3R9EA 5FVJA 2QIRA 1XE4A 3TE4A 3F8KA 2Z3OA 2VBQA 5ISVA 3PZJA 2CNMA 5AG4A 1M44A 1KUYA 1XEBA 2CY2A 3TOBA 1FY7A 1Q2YA 4XNHC 2VXKA 4KS9A 4H6ZA 4C2XA 2JEVA 5AG5A 2OB0A 2B4DA 2CNTA 4XPLA 1IB1E 3TFYA 3IGRA 3ZZIA 2VQYA 2Q7BA 4C7HA 4OADA 1YX0A 5F49A 5AGEA 4C68A 5A28A 4BBHA 1SQHA 1QSOA 4MFJA 4CYNA 3G8WA 1S7LA 4K30A 3TO6A 3EO4A 4A2ZA 1V0CA 5J8FA 3GY9A 4L8AA 4YFJA 4BMHA 3LODA 2ZW4A 3CXSA 1L0CA 5C82A 2I00A 1J4JA 5GCNA 1N71A 2EUIA 4UWIA 1XMTA 5F47A 1RO5A 4NSQA 2Z3KA 3D2PA 4CS0B 1Q2CA 2GIVA 1YVKA 2BUEA 3PGPA 4R3KA 4M3SA 3S6GA 4MBUA 4CYQA 4MFLA 4QBJA 2Q44A 4MI4A 2I79A 5I0CA 2PC1A 2VZYA 1B87A 2AE6A 5JQ4A 1QSNA 2DPSA 1S7NA 1P0HA 1XF8A 3FBUA 5H84A 4KSAA 4NCZA 2YNCC 2B4DB 3W6SA 2FIWA 2HUZA 4XPKA 2R7HA 2D4OA 4PSXA 2ATRA 5DWNA 1I1DA 3FRMA 4UCPA 3SXNA 2PSWA 4QUSA 1M1DA 4II9A 2J8MA 3W91A 1KUXA 2B3UA 3CXPA 2Q4VA 4XPDC 3RYOA 4AVBA 4JXRA 3ZJ0A 4HNYB 1BO4A 4UFWA 1WK4A 2PDOA 1UFHA 3TO7A 2BL1A 2WPWA 2ZW5A 3EXNA 4KZTA 2OZHA 5KTCA 2PR8A 4YRHA 3D8PA 2BEIA 4E0AA 1YVOA 3BJ7A 3IU2A 4RI1A 4NF1A 4UWJA 4CYOA 2R1IA 4A31A 4KLVA 3WR7A 2P0WA 4H89A 3F5BA 4AG9A 3CXQA 4QB9A 3VWEA 2Q4YA 2G3AA 4KOVA 5G21A 2P6EA 4JD6A 2PRBA 1RXTA 3C26A 4B13A 2OH1A 3D2MA 2VI7A 4QC6A 4PK3A 4FD6A 3BLNA 4YGOA 3DR6A 4E2AA 3FIXA 2PR1A 2BSWA 2DXQA 2QECA 2J8RA 2YNDA 3N7ZA 2RC4A 4MJ8A 4L89A 4Y49B 4B11A 1Y7RA 5KTDA 4KOUA 3OWCA 2C27A 4Y49C 1OZPA 2Z3LA 2Y0MA 1S7FA 4KVXA 5EBVA 2FT0A 4ONUA 4B10A 4B12A 2Z10A 3TO9A 1IYLA 2Z0ZA 2KCWA 4KOXA 4Q38A 4M85A 2Q0YA 5IB0A 5G20A 4PK2A 1VKCA 1Q2DA 2A4NA 3S6KA 2HQYA 4KVOE 3JVNA 3K9UA 1KUVA 2J8NA 3R9GA 4B5OA 4FD4A 2CNSA 4J3GA 2B3VA 4F0YA 1B6BA 4PV6A 4KSFA 3S6FA 4U9YA 4XNHB 4CAEA 4CGOA 5A27A 2B5GA 2REEA 4C2ZA 4CGMA 2YNCA 4MY3A 2GE3A 1S7KA 3FXTA 2ZPAA 3R95A 4GS4A 3P2HA 3R9FA 3DR8A 4JWPA 3TTHA 4CGLA 4E8OA 1CM0A 1ON0A 2FE7A 5E96A 4LUAA 4A95A 5H86A 4U5YA 2ARHA 2JDCA 3JTKA 2OZGA 1QSMA 2G0BA 4XPDB 5BWAB 2HV2A 2Z3PA 4CRYB 4UBRA 5IX3A 5CNPA 3IU1A 2NMTA 4CAWA 2X7BA 4UA3A 5EC4A 3GKRA 5KTAA 3H4QA 1LRZA 1YK3A 2FL4A 1I21A 4CRZB 3R1KA 1IYKA 1ZO0A 2REFA 3FB3A 2P6FA 1KZFA 1R57A 1S60A 4OLLA 4B14A 4CAXA 4HNWB 4HKFA 3P2FA 2JLMA 2JDDA 4ORFA 4EVYA 1YGHA 1PU9A 1S5KA 3GYAA 3DSBA 2DPTA 2P6GA 1P4NA 3TT2A 1QSRA 5JPHA 3BJ8A 4IF5A 4JLYA 2OZUA 3QAHA 4AVAA 3NE7A 3DNSA 4U9ZA 4PSWA 3A9LA 4KUBA 3TCVA 2B4BA 3W6XA 2Q04A 5DWMA 3UY5A 1TIQA 4NXYA 3H5ZA 1Z9UA 4HNXB 4A30A 3JUWA 4AB7A 2K5TA 4JJXA 2FS5A 4CYPA 4B5PA 2FSRA 2FCKA 2WUUA 2FXFA 1XIXA 4FD7A 4C7IA 1NSLA 3FNCA 2AJ6A 4H6UA 1Z4RA 2G3TA 4DNCA 2Z11A 3MGDA 4QVTA 1YREA 4R87A 4IUSA 2FIAA 4KOSA 1I12A 1IICA 4KLWA 2O28A 2VEZA 3DDDA 1NMTA 1PUAA 4AG7A 1QSTA 1IIDA 2D4PA 3IWGA 4C2YA 5AG6A 4F6AA 4JXQA 1K4JA 2CXAA 4R3LA 4RS2A 1NE9A 5F46A 4R9MA 3FYNA 4MFKA 2Z3MA 4NEXA 1YLEA 4ZBGA 4MFQA 1MJ9A 5HH1A 2ZXVA 3LD2A 4FD5A 4ZGYB 1Z4EA 1MJBA 4LX9A 3E0KA 4CAFA 3F0AA 1WWZA 4AVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8V A;  2WPX A;  3SHP A;  4I49 A;  5HMN A;  3EY5 A;  3R96 A;  2ZW6 A;  3I3G A;  3KKW A;  4B5P B;  2EVN A;  1YR0 A;  3T9Y A;  5J8C A;  1VHS A;  5C88 A;  1M4G A;  1MK4 A;  3QB8 A;  1S3Z A;  4KOT A;  4MHD A;  4OAE A;  1GHE A;  4KVM E;  2VZZ A;  1MJA A;  2GAN A;  1Y9K A;  3TOA A;  5F48 A;  4KOW A;  2PQ8 A;  2ZW7 A;  4R57 A;  2B58 A;  3S6H A;  3B8G A;  3PP9 A;  2OU2 A;  1M4I A;  3EFA A;  3D3S A;  3G3S A;  2B5G B;  2QML A;  4CAV A;  3SXO A;  2R98 A;  1U6M A;  2H5M A;  4MY0 A;  2F5I A;  4KOY A;  4KUA A;  4KOR A;  3VWD A;  1BOB A;  3EC4 A;  3I9S A;  3V8I A;  2IL4 A;  1M4D A;  1Y9W A;  3T90 A;  1CJW A;  4X5K A;  5IV0 A;  3R9E A;  5FVJ A;  2QIR A;  1XE4 A;  3TE4 A;  3F8K A;  2VBQ A;  5ISV A;  3PZJ A;  2CNM A;  1M44 A;  1KUY A;  1XEB A;  2CY2 A;  3TOB A;  1FY7 A;  1Q2Y A;  4XNH C;  2VXK A;  4H6Z A;  2JEV A;  2OB0 A;  2B4D A;  2CNT A;  4XPL A;  1IB1 E;  3TFY A;  3IGR A;  3ZZI A;  2VQY A;  2Q7B A;  4OAD A;  1YX0 A;  5F49 A;  1SQH A;  1QSO A;  3G8W A;  1S7L A;  4K30 A;  3TO6 A;  3EO4 A;  1V0C A;  5J8F A;  3GY9 A;  4L8A A;  4YFJ A;  4BMH A;  3LOD A;  2ZW4 A;  3CXS A;  1L0C A;  5C82 A;  2I00 A;  1J4J A;  5GCN A;  1N71 A;  2EUI A;  4UWI A;  1XMT A;  5F47 A;  1RO5 A;  4NSQ A;  3D2P A;  4CS0 B;  1Q2C A;  2GIV A;  1YVK A;  2BUE A;  3PGP A;  4R3K A;  4M3S A;  3S6G A;  4MBU A;  4QBJ A;  2Q44 A;  4MI4 A;  2I79 A;  5I0C A;  2PC1 A;  2VZY A;  1B87 A;  2AE6 A;  5JQ4 A;  1QSN A;  1S7N A;  1P0H A;  1XF8 A;  3FBU A;  5H84 A;  4NCZ A;  2B4D B;  3W6S A;  2FIW A;  2HUZ A;  4XPK A;  2R7H A;  2D4O A;  4PSX A;  2ATR A;  5DWN A;  1I1D A;  3FRM A;  3SXN A;  2PSW A;  4QUS A;  1M1D A;  4II9 A;  2J8M A;  3W91 A;  1KUX A;  2B3U A;  3CXP A;  2Q4V A;  4XPD C;  3RYO A;  4AVB A;  4JXR A;  3ZJ0 A;  4HNY B;  1BO4 A;  1WK4 A;  2PDO A;  1UFH A;  3TO7 A;  2BL1 A;  2WPW A;  2ZW5 A;  3EXN A;  4KZT A;  2OZH A;  5KTC A;  2PR8 A;  4YRH A;  3D8P A;  2BEI A;  4E0A A;  1YVO A;  3BJ7 A;  4RI1 A;  4NF1 A;  4UWJ A;  2R1I A;  4KLV A;  3WR7 A;  2P0W A;  4H89 A;  3F5B A;  4AG9 A;  3CXQ A;  4QB9 A;  3VWE A;  2Q4Y A;  2G3A A;  4KOV A;  2P6E A;  4JD6 A;  2PRB A;  1RXT A;  3C26 A;  2OH1 A;  3D2M A;  2VI7 A;  4QC6 A;  4PK3 A;  4FD6 A;  3BLN A;  4YGO A;  3DR6 A;  4E2A A;  3FIX A;  2PR1 A;  2BSW A;  2DXQ A;  2QEC A;  2J8R A;  3N7Z A;  2RC4 A;  4MJ8 A;  4L89 A;  4Y49 B;  1Y7R A;  5KTD A;  4KOU A;  3OWC A;  2C27 A;  4Y49 C;  1OZP A;  2Y0M A;  1S7F A;  4KVX A;  5EBV A;  2FT0 A;  4ONU A;  2Z10 A;  3TO9 A;  1IYL A;  2Z0Z A;  2KCW A;  4KOX A;  4M85 A;  2Q0Y A;  5IB0 A;  4PK2 A;  1VKC A;  1Q2D A;  2A4N A;  3S6K A;  2HQY A;  4KVO E;  3JVN A;  3K9U A;  1KUV A;  2J8N A;  3R9G A;  4B5O A;  4FD4 A;  2CNS A;  4J3G A;  2B3V A;  4F0Y A;  1B6B A;  4PV6 A;  3S6F A;  4U9Y A;  4XNH B;  2B5G A;  2REE A;  4MY3 A;  2GE3 A;  1S7K A;  3FXT A;  2ZPA A;  3R95 A;  4GS4 A;  3P2H A;  3R9F A;  3DR8 A;  4JWP A;  3TTH A;  4E8O A;  1CM0 A;  1ON0 A;  2FE7 A;  5E96 A;  4LUA A;  5H86 A;  4U5Y A;  2ARH A;  2JDC A;  2OZG A;  1QSM A;  2G0B A;  4XPD B;  2HV2 A;  4CRY B;  4UBR A;  5IX3 A;  5CNP A;  2NMT A;  4CAW A;  2X7B A;  4UA3 A;  5EC4 A;  3GKR A;  5KTA A;  3H4Q A;  1LRZ A;  1YK3 A;  2FL4 A;  1I21 A;  4CRZ B;  3R1K A;  1IYK A;  3FB3 A;  2REF A;  2P6F A;  1KZF A;  1R57 A;  1S60 A;  4OLL A;  4CAX A;  4HNW B;  4HKF A;  3P2F A;  2JLM A;  2JDD A;  4ORF A;  4EVY A;  1YGH A;  1PU9 A;  1S5K A;  3GYA A;  3DSB A;  2P6G A;  1P4N A;  3TT2 A;  1QSR A;  5JPH A;  3BJ8 A;  4IF5 A;  4JLY A;  2OZU A;  3QAH A;  4AVA A;  3NE7 A;  3DNS A;  4U9Z A;  4PSW A;  4KUB A;  3TCV A;  2B4B A;  3W6X A;  2Q04 A;  5DWM A;  3UY5 A;  1TIQ A;  4NXY A;  4HNX B;  1Z9U A;  3JUW A;  4AB7 A;  2K5T A;  4JJX A;  2FS5 A;  4B5P A;  2FSR A;  2FCK A;  2FXF A;  1XIX A;  4FD7 A;  1NSL A;  3FNC A;  2AJ6 A;  4H6U A;  1Z4R A;  2G3T A;  4DNC A;  2Z11 A;  3MGD A;  4QVT A;  1YRE A;  4R87 A;  4IUS A;  2FIA A;  4KOS A;  1I12 A;  1IIC A;  4KLW A;  2O28 A;  2VEZ A;  3DDD A;  1NMT A;  1PUA A;  4AG7 A;  1QST A;  1IID A;  2D4P A;  3IWG A;  4F6A A;  4JXQ A;  1K4J A;  4R3L A;  4RS2 A;  5F46 A;  1NE9 A;  4R9M A;  3FYN A;  4NEX A;  1YLE A;  4ZBG A;  1MJ9 A;  5HH1 A;  2ZXV A;  3LD2 A;  4FD5 A;  1Z4E A;  1MJB A;  4LX9 A;  3E0K A;  3F0A A;  1WWZ A;  4AVC A; 
#chains in the Genus database with same CATH topology
 2R8V A;  2WPX A;  3SHP A;  4HPS A;  1UWY A;  4LQG A;  4I49 A;  5HMN A;  3EY5 A;  4NGM A;  3R96 A;  4YU9 A;  4UCM A;  2F7V A;  2ZW6 A;  4FAI A;  4A32 A;  3I3G A;  1TXR A;  4MFZ A;  1PYT B;  2BO9 A;  3KKW A;  4B5P B;  2EVN A;  1YR0 A;  5LRK A;  4Q36 A;  3T9Y A;  5J8C A;  5HVH A;  1VHS A;  5AG7 A;  4A94 A;  5C88 A;  1M4G A;  2PVV A;  1MK4 A;  3QB8 A;  1S3Z A;  4KOT A;  2AFZ A;  4MHD A;  2PJC A;  3SI1 A;  4CGN A;  1GHE A;  4KVM E;  4OAE A;  2VZZ A;  1MJA A;  2GAN A;  2IJZ A;  1Y9K A;  1RTQ A;  2CF4 A;  4MFP A;  3TOA A;  4DUK A;  2YGW A;  2Z3N A;  3KHZ A;  5F48 A;  4KOW A;  3IJ3 A;  2PQ8 A;  2ZW7 A;  3NFZ A;  4R57 A;  5G1Z A;  3SJX A;  2B58 A;  3S6H A;  3B8G A;  3B35 A;  4UFV A;  1AUG A;  5LYL A;  3IIB A;  3V38 A;  3PP9 A;  2OU2 A;  4UCN A;  2WSA A;  1M4I A;  3EFA A;  3D3S A;  4OP4 A;  3G3S A;  5HVF A;  1ZLH A;  1TKJ A;  2B5G B;  2QML A;  5LRJ A;  2EK8 A;  2YNE A;  4WWV A;  2AFW A;  3S9N A;  5LYF A;  4CAV A;  2BOA A;  4OID A;  3IWW A;  3SXO A;  2R98 A;  4NFR A;  1U6M A;  2H5M A;  3IWE A;  4H2K A;  1Z8T A;  5HXD A;  4MY0 A;  1ARM A;  2F5I A;  4CGP A;  1FT7 A;  4KOY A;  3KGQ A;  4KUA A;  4A33 A;  4KOR A;  3VWD A;  4PXD A;  2PJ4 A;  2PJ5 A;  4P4F A;  1BOB A;  3EC4 A;  3I9S A;  3V8I A;  4F0X A;  1BAV A;  2V8D A;  2IL4 A;  1KWM A;  1M4D A;  1EE3 P;  1JQG A;  5G22 A;  1Y9W A;  3T90 A;  3KR5 A;  1CJW A;  4X5K A;  4ZI6 A;  5IV0 A;  2IQ6 A;  1ELL P;  3I1U A;  4UFX A;  3D66 A;  3R9E A;  2ZEF A;  5FVJ A;  2QIR A;  4BIN A;  1XE4 A;  3BHX A;  2Q43 A;  2CTB A;  4GM5 A;  2PJ9 A;  3TE4 A;  5CPA A;  3F8K A;  2Z3O A;  3WC5 A;  4F8Z A;  2VBQ A;  4MCR A;  5ISV A;  3PZJ A;  2CNM A;  5AG4 A;  1M44 A;  1KUY A;  1VIX A;  1XEB A;  2CY2 A;  3HUV A;  1QQ9 A;  3TOB A;  2BCO A;  1FY7 A;  1Q2Y A;  4XNH C;  2VXK A;  4FUU A;  4KS9 A;  4H6Z A;  4C2X A;  2JEV A;  5AG5 A;  3KAS A;  5F09 A;  2OB0 A;  2QJ8 A;  2B4D A;  2CNT A;  4XPL A;  2V8V A;  2ZEL A;  3BI0 A;  2WYR A;  1IB1 E;  3TC8 A;  3TFY A;  3IGR A;  4GXH A;  3ZZI A;  2VQY A;  2V77 A;  2Q7B A;  2O4H A;  3KQZ A;  4C7H A;  4OAD A;  1YX0 A;  1BPM A;  2AFS A;  4JYW A;  5LRG A;  4X8I A;  5F49 A;  5LYI A;  3BXM A;  1AMP A;  1H8L A;  5AGE A;  5EMI A;  4C68 A;  4BBH A;  5A28 A;  2XEJ A;  1SQH A;  1QSO A;  3H8F A;  4MFJ A;  4CYN A;  1R3N A;  1XRY A;  2PJ8 A;  2V8H A;  3G8W A;  4NGP A;  4UIB A;  2EK9 A;  1S7L A;  4K30 A;  3TO6 A;  3RNZ A;  4UEZ A;  3D7D A;  2JBK A;  3B3C A;  1CP7 A;  2OR4 A;  3EO4 A;  4A2Z A;  1IOI A;  2ZEE A;  4CPA A;  2HB6 A;  1V0C A;  3B3W A;  5J8F A;  3GY9 A;  4L8A A;  4YFJ A;  3PB6 X;  1YW6 A;  4OC2 A;  2DF5 A;  3LOD A;  4BMH A;  2ZW4 A;  1ZLI A;  2ZEH A;  3KZW A;  4P4D A;  3CXS A;  3WAB A;  1L0C A;  5C82 A;  3FH4 A;  1CG2 A;  2I00 A;  4A37 A;  1J4J A;  5GCN A;  1Q7L A;  4NGQ A;  4NGR A;  3S9M A;  3IC1 A;  1N71 A;  3NA6 A;  3VAR A;  3KR4 A;  4DYO A;  2EUI A;  4UWI A;  1XMT A;  1JWQ A;  2ZEM A;  3N5F A;  3DGV A;  1RO5 A;  5F47 A;  4MCS A;  4NSQ A;  4PPZ A;  2ANP A;  2EBJ A;  2PJ6 A;  2Z3K A;  3D2P A;  2AFX A;  1Q2C A;  2GIV A;  3B2Y A;  3PFE A;  4MMO A;  5D8N A;  4CS0 B;  1YVK A;  2BUE A;  3PGP A;  4R3K A;  2ZOF A;  4M3S A;  1A2Z A;  3KL9 A;  1XJO A;  4MBU A;  3S6G A;  1IU8 A;  4CYQ A;  4MFL A;  4QBJ A;  1R43 A;  2Q44 A;  4MI4 A;  2I79 A;  5I0C A;  1YLO A;  2PC1 A;  2VZY A;  1B87 A;  2AE6 A;  5JQ4 A;  1QSN A;  2DPS A;  1S7N A;  3PBE A;  1P0H A;  1XF8 A;  5THW A;  1ARL A;  3FEE A;  3RBU A;  3FBU A;  5JGF A;  5H84 A;  4KSA A;  4NCZ A;  1X12 A;  2YNC C;  2B4D B;  3W6S A;  1XOV A;  2FIW A;  2HUZ A;  4XPK A;  2R7H A;  2D4O A;  3CPX A;  4PSX A;  2ATR A;  4OC1 A;  4R8F A;  2G9D A;  1F57 A;  5DWN A;  3D7G A;  1I1D A;  3FRM A;  4UCP A;  3SXN A;  2PSW A;  1X10 A;  3MN8 A;  4M6H A;  4QUS A;  3RO0 A;  3SJF A;  1M1D A;  3LWU A;  4MHP A;  4II9 A;  2GRE A;  2J8M A;  4MCP A;  3W91 A;  1KUX A;  2WZN A;  2B3U A;  2RFH A;  3CXP A;  2Q4V A;  4XPD C;  3RYO A;  4AVB A;  4JXR A;  3ZJ0 A;  4HNY B;  1BO4 A;  4UFW A;  3TX8 A;  1WK4 A;  2PDO A;  3FMC A;  4P6Y A;  1UFH A;  5K8N A;  3TO7 A;  4X3R A;  1NSA A;  2BL1 A;  2WPW A;  4W9Y A;  1BPN A;  1GYT A;  2PJ1 A;  4R7M A;  2ZW5 A;  3EXN A;  4KZT A;  3H8E A;  2OZH A;  5KTC A;  2FVG A;  2JEW A;  2PR8 A;  3FEC A;  5J1Q A;  3LAC A;  4YRH A;  4ZY1 A;  3D8P A;  2BEI A;  4E0A A;  1YVO A;  4P44 A;  4RUH A;  2CIJ A;  4OKO A;  3BJ7 A;  4R76 A;  3H8G A;  3IU2 A;  4RI1 A;  1HDQ A;  1YSJ A;  2GFQ A;  2JBJ A;  4NF1 A;  1Z8L A;  3CT9 A;  4OC0 A;  2F8H A;  2EWB A;  4UWJ A;  4ZY2 A;  4DJL A;  4CYO A;  1Z8W A;  2R1I A;  4A31 A;  4KLV A;  3PEI A;  4O23 A;  4P4E A;  3WR7 A;  3PB9 X;  2P0W A;  4B6Z A;  4H89 A;  1Z8X A;  3F5B A;  4NGN A;  2DEA A;  4AG9 A;  2O53 A;  3VH9 A;  3GLJ A;  1DTD A;  3CXQ A;  4QB9 A;  3VWE A;  2Q4Y A;  2G3A A;  4KOV A;  5G21 A;  2P6E A;  4JD6 A;  5DS0 A;  2ABZ A;  2PRB A;  3D4U A;  1QMU A;  1RXT A;  3C26 A;  4B13 A;  2OH1 A;  3D2M A;  2VI7 A;  2C1C A;  4QC6 A;  1LCP A;  4PK3 A;  3FVL A;  4FD6 A;  3IEH A;  3BLN A;  4MHN A;  4YGO A;  3DR6 A;  4E2A A;  3FIX A;  2HC9 A;  1XMB A;  3D68 A;  2PR1 A;  2BSW A;  3WC7 A;  2C6C A;  2DXQ A;  2QEC A;  4NJR A;  4P45 A;  3FED A;  2J8R A;  7CPA A;  2YND A;  3GUX A;  1LAM A;  3HLP A;  2RC4 A;  3N7Z A;  1Y7E A;  4MJ8 A;  4L89 A;  2Q4Z A;  3T8W A;  4Y49 B;  4B11 A;  2GLJ A;  1Y7R A;  5KTD A;  4KOU A;  3OWC A;  3SJG A;  2C27 A;  3L2N A;  4Y49 C;  1OZP A;  2Z3L A;  4TWE A;  2Y0M A;  1S7F A;  2QYV A;  4KVX A;  2C6P A;  4M6I A;  3DLJ A;  5EBV A;  2FT0 A;  1PCA A;  4ONU A;  4B10 A;  4B12 A;  4F9U A;  4OC3 A;  2Z10 A;  3B3S A;  3TO9 A;  3PB4 X;  3PBB A;  3PB7 X;  1IYL A;  1CX8 A;  2Z0Z A;  4EFD A;  5JM6 A;  2KCW A;  1LAP A;  3WT4 A;  4KOX A;  2XEI A;  4Q38 A;  4M85 A;  4OC4 A;  2Q0Y A;  5IB0 A;  3B7I A;  5G20 A;  4PK2 A;  4M6G A;  4TNU A;  1VKC A;  1Q2D A;  2A4N A;  3S6K A;  5K8M A;  2HQY A;  2ZEO A;  4P4J A;  4KVO E;  3WC6 A;  1XBU A;  1DE4 C;  1ZG9 A;  3JVN A;  3K9U A;  1KUV A;  2RB7 A;  2J8N A;  3R9G A;  2I3C A;  4ZX8 A;  2NSM A;  2PJ7 A;  4FD4 A;  3LMS A;  2XEG A;  4B5O A;  5I4M A;  2CNS A;  4J3G A;  2B3V A;  4F0Y A;  2POK A;  1B6B A;  4PV6 A;  3GB0 A;  4WJB A;  1OBR A;  4KSF A;  3S6F A;  5K8P A;  4U9Y A;  4XNH B;  4CAE A;  4CGO A;  5A27 A;  3ISZ A;  2B5G A;  2IMO A;  2REE A;  4C2Z A;  2V8G A;  4CGM A;  2ZEN A;  4OC5 A;  1YW4 A;  4MRI A;  1TKF A;  2YNC A;  4MY3 A;  2GE3 A;  1S7K A;  3FXT A;  2ZPA A;  1TF8 A;  3NH4 A;  3R95 A;  4Z65 A;  4PXB A;  4GS4 A;  1YQE A;  1BLL E;  3P2H A;  5JH9 A;  3QNV A;  1FNO A;  3R9F A;  3DR8 A;  4JWP A;  5LYD A;  3TTH A;  4CGL A;  2Q7S A;  4E8O A;  1CM0 A;  4UF4 A;  2C6G A;  4NJQ A;  3K9T A;  1ON0 A;  2FE7 A;  2PVW A;  5E96 A;  4LUA A;  4A38 A;  1IOF A;  3B3T A;  3QAY A;  2PJB A;  3PFO A;  2PJ3 A;  4A95 A;  5H86 A;  4EME A;  1CBX A;  4U5Y A;  2ARH A;  1F2O A;  2JDC A;  3JTK A;  2OZG A;  1QSM A;  2G0B A;  3FX6 A;  2ZED A;  4KSI A;  4XPD B;  5BWA B;  1IY7 A;  2HV2 A;  2Z3P A;  4CRY B;  2PIY A;  4UBR A;  3FJU A;  5IX3 A;  4UEF A;  3IU1 A;  2NMT A;  5CNP A;  1HEE A;  3CZX A;  4CAW A;  4Q7A A;  4NGT A;  2X7B A;  4UA3 A;  4BD9 A;  1XFO A;  1Y0Y A;  2PE3 A;  5EC4 A;  6CPA A;  5CBM A;  3RAM A;  3GIU A;  3SI0 A;  3GKR A;  4MXU A;  5KTA A;  2VL1 A;  5ELY A;  1LFW A;  4OIW A;  3H4Q A;  2PRQ A;  1LRZ A;  1YK3 A;  4P4B A;  2FL4 A;  1I21 A;  4IAV A;  4CRZ B;  4ZX9 A;  3R1K A;  1IYK A;  1ZO0 A;  2REF A;  3FB3 A;  2P6F A;  1KZF A;  1R57 A;  1S60 A;  4JZ0 A;  4OLL A;  3V7Z A;  4B14 A;  4CAX A;  4HNW B;  2NYQ A;  4IHM A;  4AXV A;  4MHY A;  4HKF A;  8CPA A;  2PIZ A;  3P2F A;  2JLM A;  4EWT A;  2JDD A;  4ORF A;  4IK2 A;  1YGH A;  4EVY A;  1LAN A;  1PU9 A;  3D67 A;  1S5K A;  3GYA A;  3DSB A;  3FF3 A;  2DPT A;  2P6G A;  4FBE A;  4UIA A;  1P4N A;  4PQA A;  1Z2L A;  1IGB A;  3IFE A;  3MRU A;  1LOK A;  4PXC A;  3TT2 A;  4P4I A;  1AYE A;  1QSR A;  5JPH A;  3BJ8 A;  4IF5 A;  4JLY A;  4RN7 A;  1F2P A;  2OZU A;  3QAH A;  4AVA A;  2J9A A;  3NE7 A;  3DNS A;  2ODF A;  4U9Z A;  2ZEP A;  1HDU A;  4PSW A;  3NH8 A;  3A9L A;  3PRT A;  4KUB A;  3TCV A;  3SI2 A;  3K2K A;  1Z5R A;  2B4B A;  5D29 A;  3W6X A;  2Q04 A;  2ZOG A;  5DWM A;  3UY5 A;  5HVG A;  5K8O A;  1TIQ A;  3PB8 X;  4NXY A;  3H5Z A;  1M4L A;  1Z9U A;  4HNX B;  3JUW A;  4A30 A;  4AB7 A;  5IB9 A;  2K5T A;  4JJX A;  2AFM A;  2FS5 A;  1VGY A;  3SJE A;  4UEE A;  4CYP A;  4OME A;  4B5P A;  3KI9 A;  4K3N A;  3D7F A;  3KQX A;  2FSR A;  2OOT A;  2FCK A;  1ZG8 A;  2FXF A;  1XIX A;  2WUU A;  2PJA A;  2ZEG A;  4FD7 A;  1NSL A;  1CPS A;  3FNC A;  4C7I A;  2AJ6 A;  4H6U A;  1Z4R A;  3BI1 A;  3JRU A;  2G3T A;  1ZG7 A;  4ONW A;  4DNC A;  2Z11 A;  3S9L A;  3MGD A;  2GLF A;  4QVT A;  1TF9 A;  3KHX A;  2PJ2 A;  1YRE A;  2CTC A;  2AFU A;  4IUS A;  4R87 A;  4MCQ A;  2FIA A;  3NH5 A;  3IO1 A;  4KOS A;  1CPX A;  1TKH A;  1I12 A;  4LQ6 A;  1IIC A;  4KLW A;  2O28 A;  2VEZ A;  4ZY0 A;  2PCU A;  3ISX A;  4NGS A;  1Y0R A;  3DDD A;  1NMT A;  2Q51 A;  1PUA A;  1QST A;  4AG7 A;  3CDX A;  2GU2 A;  4G1P A;  1IID A;  2D4P A;  3IWG A;  2QVP A;  3D7H A;  5AG6 A;  4C2Y A;  1ELM P;  4F6A A;  4R6T A;  4JXQ A;  1K4J A;  2CXA A;  4R3L A;  4RS2 A;  1NE9 A;  5F46 A;  4R9M A;  1CP6 A;  2XEF A;  2Z3M A;  3FYN A;  4MFK A;  4NEX A;  4F9V A;  3RZA A;  1YLE A;  4ZBG A;  4MFQ A;  4YWY A;  4FWU A;  1VHE A;  1YME A;  4P10 A;  3VAT A;  2AFO A;  4PXE A;  4X2T A;  1MJ9 A;  4ZYQ A;  5HH1 A;  2PJ0 A;  2ZXV A;  3LD2 A;  4FD5 A;  4ZGY B;  1VHO A;  1Z4E A;  3CPA A;  1MJB A;  3NE8 A;  3E0K A;  4LX9 A;  4CAF A;  3F0A A;  1WWZ A;  4MHZ A;  2EO8 A;  4A39 A;  4AVC A;  3B3V A; 
#chains in the Genus database with same CATH homology
 2R8V A;  2WPX A;  3SHP A;  4I49 A;  5HMN A;  3EY5 A;  3R96 A;  4UCM A;  2ZW6 A;  4A32 A;  3I3G A;  4MFZ A;  3KKW A;  4B5P B;  2EVN A;  1YR0 A;  4Q36 A;  3T9Y A;  5J8C A;  1VHS A;  5AG7 A;  5C88 A;  1M4G A;  1MK4 A;  3QB8 A;  1S3Z A;  4KOT A;  4MHD A;  4CGN A;  1GHE A;  4KVM E;  4OAE A;  2VZZ A;  1MJA A;  2GAN A;  1Y9K A;  4MFP A;  3TOA A;  2YGW A;  2Z3N A;  5F48 A;  4KOW A;  2PQ8 A;  2ZW7 A;  4R57 A;  5G1Z A;  2B58 A;  3S6H A;  3B8G A;  4UFV A;  3PP9 A;  2OU2 A;  4UCN A;  2WSA A;  1M4I A;  3EFA A;  3D3S A;  3G3S A;  2B5G B;  2QML A;  2YNE A;  4CAV A;  3SXO A;  2R98 A;  3IWE A;  1U6M A;  2H5M A;  4MY0 A;  2F5I A;  4CGP A;  4KOY A;  4KUA A;  4A33 A;  4KOR A;  3VWD A;  1BOB A;  3EC4 A;  3I9S A;  3V8I A;  4F0X A;  2IL4 A;  1M4D A;  5G22 A;  1Y9W A;  3T90 A;  1CJW A;  4X5K A;  5IV0 A;  4UFX A;  3R9E A;  5FVJ A;  2QIR A;  1XE4 A;  3TE4 A;  3F8K A;  2Z3O A;  2VBQ A;  5ISV A;  3PZJ A;  2CNM A;  5AG4 A;  1M44 A;  1KUY A;  1XEB A;  2CY2 A;  3TOB A;  1FY7 A;  1Q2Y A;  4XNH C;  2VXK A;  4KS9 A;  4H6Z A;  4C2X A;  2JEV A;  5AG5 A;  2OB0 A;  2B4D A;  2CNT A;  4XPL A;  1IB1 E;  3TFY A;  3IGR A;  3ZZI A;  2VQY A;  2Q7B A;  4C7H A;  4OAD A;  1YX0 A;  5F49 A;  5AGE A;  4C68 A;  5A28 A;  4BBH A;  1SQH A;  1QSO A;  4MFJ A;  4CYN A;  3G8W A;  1S7L A;  4K30 A;  3TO6 A;  3EO4 A;  4A2Z A;  1V0C A;  5J8F A;  3GY9 A;  4L8A A;  4YFJ A;  4BMH A;  3LOD A;  2ZW4 A;  3CXS A;  1L0C A;  5C82 A;  2I00 A;  1J4J A;  5GCN A;  1N71 A;  2EUI A;  4UWI A;  1XMT A;  5F47 A;  1RO5 A;  4NSQ A;  2Z3K A;  3D2P A;  4CS0 B;  1Q2C A;  2GIV A;  1YVK A;  2BUE A;  3PGP A;  4R3K A;  4M3S A;  3S6G A;  4MBU A;  4CYQ A;  4MFL A;  4QBJ A;  2Q44 A;  4MI4 A;  2I79 A;  5I0C A;  2PC1 A;  2VZY A;  1B87 A;  2AE6 A;  5JQ4 A;  1QSN A;  2DPS A;  1S7N A;  1P0H A;  1XF8 A;  3FBU A;  5H84 A;  4KSA A;  4NCZ A;  2YNC C;  2B4D B;  3W6S A;  2FIW A;  2HUZ A;  4XPK A;  2R7H A;  2D4O A;  4PSX A;  2ATR A;  5DWN A;  1I1D A;  3FRM A;  4UCP A;  3SXN A;  2PSW A;  4QUS A;  1M1D A;  4II9 A;  2J8M A;  3W91 A;  1KUX A;  2B3U A;  3CXP A;  2Q4V A;  4XPD C;  3RYO A;  4AVB A;  4JXR A;  3ZJ0 A;  4HNY B;  1BO4 A;  4UFW A;  1WK4 A;  2PDO A;  1UFH A;  3TO7 A;  2BL1 A;  2WPW A;  2ZW5 A;  3EXN A;  4KZT A;  2OZH A;  5KTC A;  2PR8 A;  4YRH A;  3D8P A;  2BEI A;  4E0A A;  1YVO A;  3BJ7 A;  3IU2 A;  4RI1 A;  4NF1 A;  4UWJ A;  4CYO A;  2R1I A;  4A31 A;  4KLV A;  3WR7 A;  2P0W A;  4H89 A;  3F5B A;  4AG9 A;  3CXQ A;  4QB9 A;  3VWE A;  2Q4Y A;  2G3A A;  4KOV A;  5G21 A;  2P6E A;  4JD6 A;  2PRB A;  1RXT A;  3C26 A;  4B13 A;  2OH1 A;  3D2M A;  2VI7 A;  4QC6 A;  4PK3 A;  4FD6 A;  3BLN A;  4YGO A;  3DR6 A;  4E2A A;  3FIX A;  2PR1 A;  2BSW A;  2DXQ A;  2QEC A;  2J8R A;  2YND A;  3N7Z A;  2RC4 A;  4MJ8 A;  4L89 A;  4Y49 B;  4B11 A;  1Y7R A;  5KTD A;  4KOU A;  3OWC A;  2C27 A;  4Y49 C;  1OZP A;  2Z3L A;  2Y0M A;  1S7F A;  4KVX A;  5EBV A;  2FT0 A;  4ONU A;  4B10 A;  4B12 A;  2Z10 A;  3TO9 A;  1IYL A;  2Z0Z A;  2KCW A;  4KOX A;  4Q38 A;  4M85 A;  2Q0Y A;  5IB0 A;  5G20 A;  4PK2 A;  1VKC A;  1Q2D A;  2A4N A;  3S6K A;  2HQY A;  4KVO E;  3JVN A;  3K9U A;  1KUV A;  2J8N A;  3R9G A;  4B5O A;  4FD4 A;  2CNS A;  4J3G A;  2B3V A;  4F0Y A;  1B6B A;  4PV6 A;  4KSF A;  3S6F A;  4U9Y A;  4XNH B;  4CAE A;  4CGO A;  5A27 A;  2B5G A;  2REE A;  4C2Z A;  4CGM A;  2YNC A;  4MY3 A;  2GE3 A;  1S7K A;  3FXT A;  2ZPA A;  3R95 A;  4GS4 A;  3P2H A;  3R9F A;  3DR8 A;  4JWP A;  3TTH A;  4CGL A;  4E8O A;  1CM0 A;  1ON0 A;  2FE7 A;  5E96 A;  4LUA A;  4A95 A;  5H86 A;  4U5Y A;  2ARH A;  2JDC A;  3JTK A;  2OZG A;  1QSM A;  2G0B A;  4XPD B;  5BWA B;  2HV2 A;  2Z3P A;  4CRY B;  4UBR A;  5IX3 A;  5CNP A;  3IU1 A;  2NMT A;  4CAW A;  2X7B A;  4UA3 A;  5EC4 A;  3GKR A;  5KTA A;  3H4Q A;  1LRZ A;  1YK3 A;  2FL4 A;  1I21 A;  4CRZ B;  3R1K A;  1IYK A;  1ZO0 A;  2REF A;  3FB3 A;  2P6F A;  1KZF A;  1R57 A;  1S60 A;  4OLL A;  4B14 A;  4CAX A;  4HNW B;  4HKF A;  3P2F A;  2JLM A;  2JDD A;  4ORF A;  4EVY A;  1YGH A;  1PU9 A;  1S5K A;  3GYA A;  3DSB A;  2DPT A;  2P6G A;  1P4N A;  3TT2 A;  1QSR A;  5JPH A;  3BJ8 A;  4IF5 A;  4JLY A;  2OZU A;  3QAH A;  4AVA A;  3NE7 A;  3DNS A;  4U9Z A;  4PSW A;  3A9L A;  4KUB A;  3TCV A;  2B4B A;  3W6X A;  2Q04 A;  5DWM A;  3UY5 A;  1TIQ A;  4NXY A;  3H5Z A;  1Z9U A;  4HNX B;  4A30 A;  3JUW A;  4AB7 A;  2K5T A;  4JJX A;  2FS5 A;  4CYP A;  4B5P A;  2FSR A;  2FCK A;  2WUU A;  2FXF A;  1XIX A;  4FD7 A;  4C7I A;  1NSL A;  3FNC A;  2AJ6 A;  4H6U A;  1Z4R A;  2G3T A;  4DNC A;  2Z11 A;  3MGD A;  4QVT A;  1YRE A;  4R87 A;  4IUS A;  2FIA A;  4KOS A;  1I12 A;  1IIC A;  4KLW A;  2O28 A;  2VEZ A;  3DDD A;  1NMT A;  1PUA A;  4AG7 A;  1QST A;  1IID A;  2D4P A;  3IWG A;  4C2Y A;  5AG6 A;  4F6A A;  4JXQ A;  1K4J A;  2CXA A;  4R3L A;  4RS2 A;  1NE9 A;  5F46 A;  4R9M A;  3FYN A;  4MFK A;  2Z3M A;  4NEX A;  1YLE A;  4ZBG A;  4MFQ A;  1MJ9 A;  5HH1 A;  2ZXV A;  3LD2 A;  4FD5 A;  4ZGY B;  1Z4E A;  1MJB A;  4LX9 A;  3E0K A;  4CAF A;  3F0A A;  1WWZ A;  4AVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...