4YFJA

Crystal structure of aminoglycoside acetyltransferase aac(3)-ib
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
SIIATVKIGPDEISAMRAVLDLFGKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPRTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminoglycoside acetyltransferase AAC(3)-Ib
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Aminoglycoside 3'-N-acetyltransferase
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yfjA00
4R3KA 2CNMA 2PQ8A 3TO9A 3FB3A 2C27A 4JWPA 2Y0MA 2P6FA 2Z11A 2CNSA 2R7HA 3G8WA 4QC6A 5H86A 2OB0A 3FYNA 5F49A 4OAEA 4Y49C 3LODA 2Z0ZA 4CAXA 3T90A 1KUYA 1V0CA 1IB1E 4H6ZA 2F5IA 5DWNA 4ORFA 1Y9WA 3BJ8A 3TOAA 4CAVA 3DSBA 2AE6A 2NMTA 3D8PA 2Q7BA 2GE3A 2KCWA 4L89A 1IYKA 2EVNA 5HMNA 3PP9A 1XF8A 3PGPA 3BJ7A 4R9MA 1Z4EA 5EBVA 3R96A 3K9UA 3DNSA 4FD4A 1YK3A 4CAWA 5C82A 3VWEA 2B4DA 1M4IA 4JXQA 2ZW4A 2VEZA 4RI1A 4R3LA 5IB0A 4H6UA 4U5YA 2HQYA 2Q04A 3CXSA 5JPHA 2H5MA 2K5TA 2FSRA 5FVJA 3W6SA 3NE7A 1QSRA 4B5PA 4UA3A 1S7NA 3R9FA 3PZJA 3ZZIA 2QMLA 3H4QA 2B5GB 4II9A 1I1DA 1VHSA 2Q4YA 2FL4A 3E0KA 4FD6A 2BL1A 4MHDA 2ZW6A 2B3VA 4JD6A 1YLEA 3CXQA 1KZFA 4KOVA 3TT2A 2FXFA 3EO4A 3FXTA 2B4BA 4E2AA 1YX0A 1CJWA 1K4JA 2FCKA 1M1DA 4QUSA 3S6KA 5E96A 3QAHA 2B58A 4MY3A 4GS4A 1MJ9A 4QB9A 1TIQA 4F6AA 1IIDA 1CM0A 3W6XA 3EC4A 2J8MA 3JVNA 1WWZA 2FE7A 4H89A 5IV0A 2IL4A 4M85A 3B8GA 4KLVA 1M4DA 4MBUA 4K30A 3LD2A 2PRBA 4KOSA 4F0YA 1B6BA 5I0CA 1M4GA 3EFAA 1XE4A 4KVOE 1S60A 1PUAA 2OZHA 3D2PA 4MY0A 2ARHA 4R87A 5KTAA 3ZJ0A 4EVYA 1BOBA 2OZUA 1XIXA 3WR7A 1Z9UA 1KUVA 5HH1A 4KVXA 4PK2A 2P0WA 2B3UA 3TFYA 3BLNA 1S7KA 2VI7A 1J4JA 4KOYA 2FIAA 5KTCA 3I3GA 4U9ZA 4IF5A 3JUWA 4KZTA 4AG7A 3OWCA 4KUBA 3RYOA 3D2MA 4AG9A 3TO7A 4I49A 2O28A 1QSTA 2B5GA 4CS0B 1QSOA 2OZGA 4YGOA 3TOBA 5ISVA 4PSXA 1LRZA 2VZYA 1QSMA 5DWMA 4NEXA 5GCNA 4RS2A 1GHEA 3TE4A 2PSWA 2R98A 1YVKA 4PK3A 1FY7A 2WPWA 1VKCA 4NXYA 2Q4VA 2OU2A 3SXNA 3S6HA 4E0AA 1U6MA 3FIXA 4L8AA 4E8OA 3CXPA 2PR8A 4YRHA 3TO6A 4AB7A 2R1IA 3KKWA 5J8FA 2P6EA 3UY5A 3SXOA 2ZXVA 2P6GA 4LX9A 4ZBGA 2VBQA 2ZW7A 2G0BA 1RXTA 3QB8A 4KUAA 3GKRA 4AVBA 4B5PB 2REFA 4YFJA 4J3GA 1Q2YA 1Q2CA 5JQ4A 4ONUA 1PU9A 5F47A 5IX3A 5EC4A 4CRZB 4UWIA 4AVCA 2FT0A 2HUZA 4XPDC 4HKFA 2X7BA 1MK4A 2G3AA 3R1KA 2REEA 4UWJA 4KORA 3SHPA 2QECA 4UBRA 3R95A 3TTHA 1Y7RA 2WPXA 3FNCA 3N7ZA 2ZW5A 4FD7A 1Y9KA 3GY9A 4QBJA 3F5BA 2JDDA 1N71A 1QSNA 4PSWA 2D4OA 2BSWA 2G3TA 4MJ8A 1WK4A 2EUIA 2J8NA 4BMHA 4HNYB 4LUAA 4CRYB 4XNHB 4KOUA 3T9YA 2JEVA 4DNCA 4M3SA 1KUXA 4KVME 3TCVA 2OH1A 3D3SA 5J8CA 3IGRA 5H84A 3C26A 2PDOA 4Y49B 3FBUA 2Z10A 5KTDA 1I12A 4QVTA 1OZPA 1L0CA 3EY5A 3S6FA 2CNTA 2GIVA 2PR1A 3DR6A 1I21A 3I9SA 1B87A 2VQYA 3MGDA 4XNHC 2JLMA 1NMTA 1S3ZA 1Q2DA 2Q44A 1S5KA 1UFHA 1MJBA 4KOXA 4X5KA 1BO4A 3G3SA 2D4PA 2I00A 2FIWA 4XPDB 3V8IA 4OADA 4JJXA 1R57A 2CY2A 3P2FA 3VWDA 1S7FA 4R57A 1IYLA 4XPKA 1RO5A 2BEIA 2QIRA 1Z4RA 2I79A 4B5OA 4NF1A 2VXKA 1XEBA 2J8RA 4JXRA 1M44A 2DXQA 4JLYA 3S6GA 2ATRA 2VZZA 3IWGA 2HV2A 4HNXB 4AVAA 1P0HA 4OLLA 3GYAA 3DR8A 5F48A 2BUEA 4U9YA 1NE9A 4KOTA 3W91A 4KOWA 4MI4A 1YGHA 1ON0A 3DDDA 3FRMA 2Q0YA 2RC4A 4FD5A 2PC1A 3P2HA 1YR0A 3EXNA 4HNWB 2R8VA 4PV6A 5CNPA 2AJ6A 4NCZA 1NSLA 2A4NA 3R9EA 1SQHA 2JDCA 4IUSA 3F0AA 2FS5A 1S7LA 2B4DB 1MJAA 1P4NA 3F8KA 1IICA 4KLWA 4NSQA 1XMTA 5F46A 3R9GA 1YVOA 2GANA 1YREA 5C88A 4XPLA 2ZPAA
chains in the Genus database with same CATH superfamily
3FJUA 4R3KA 2CNMA 1BPMA 2PQ8A 4UFWA 3TO9A 3FB3A 4A31A 3PB8X 2C27A 4FBEA 4JWPA 2Y0MA 2P6FA 2Z11A 4PXDA 2DF5A 2CNSA 2R7HA 4F0XA 3G8WA 4PQAA 4QC6A 2Z3MA 5H86A 2OB0A 3FYNA 5F49A 3B2YA 4C7HA 4OKOA 3PB7X 4BD9A 1AYEA 4UEEA 1Z2LA 3V38A 4OAEA 3NE8A 2OOTA 4FAIA 3SJFA 2ZEHA 5BWAB 4Y49C 3LODA 4GXHA 2Z0ZA 4ZYQA 1CX8A 4CAXA 3T90A 1KUYA 1V0CA 5LYLA 1IB1E 4H6ZA 4M6GA 3QAYA 2F5IA 4P4EA 5DWNA 4UFXA 5LRJA 4ORFA 1Y9WA 3BJ8A 3D7DA 3IEHA 3KZWA 3PB9X 3TOAA 4NJQA 4CAVA 5A28A 1YW4A 3DSBA 2AE6A 2NMTA 5HVFA 3IWEA 3D8PA 3CT9A 2Q7BA 4RUHA 2GE3A 2KCWA 7CPAA 3H5ZA 2Q51A 1IYKA 2EVNA 3GIUA 4L89A 3D7HA 1R43A 1HDUA 2XEIA 5HMNA 3PP9A 1XF8A 1TXRA 2ZEMA 3B3TA 3PGPA 4FUUA 4A2ZA 3B3WA 4A32A 4F8ZA 3BJ7A 4R9MA 1ZG7A 4C68A 4B10A 1Z4EA 3H8FA 3BI0A 5EBVA 4UEFA 3R96A 3FH4A 3DNSA 3K9UA 4FD4A 4TNUA 1YK3A 4CAWA 4R6TA 3VWEA 2B4DA 4UFVA 5D29A 5C82A 2XEJA 1M4IA 4JXQA 4MMOA 2ZW4A 2VEZA 4RI1A 4R3LA 5IB0A 4H6UA 4U5YA 4FWUA 4OIDA 2HQYA 5EMIA 2Q04A 3CXSA 5JPHA 2V8GA 2H5MA 2K5TA 3PBBA 2FSRA 1F2PA 3D67A 4OC3A 5FVJA 4P45A 4MHPA 3W6SA 3NE7A 2V8VA 4NGPA 4NFRA 4OC5A 1QSRA 4JZ0A 4UF4A 4B5PA 3RZAA 3IO1A 4UA3A 3RBUA 1S7NA 2FVGA 3IJ3A 3R9FA 3PZJA 3ZZIA 3BXMA 3SJGA 4ZX9A 5IB9A 4YWYA 2QMLA 3BI1A 4MHZA 1XMBA 4ZY1A 5K8OA 3H4QA 2PRQA 2B5GB 4CGOA 4II9A 3GUXA 1I1DA 1VHSA 2Q4YA 2FL4A 3CDXA 3E0KA 4FD6A 4UIBA 4OC4A 2BL1A 4MHDA 1TKHA 2EK8A 2GLJA 2ZW6A 1YQEA 2AFOA 2B3VA 3FVLA 3MRUA 1VHEA 4JD6A 4OC1A 1YLEA 3CXQA 1KZFA 4KOVA 3TT2A 2FXFA 3KQZA 2PJ2A 3EO4A 4M6HA 4CAFA 2YGWA 2EBJA 2B4BA 2PE3A 3FXTA 4E2AA 1YX0A 1CJWA 1K4JA 2FCKA 1M1DA 4QUSA 2PJ8A 3S6KA 5E96A 3QAHA 2B58A 4MY3A 2GREA 2YNCA 2PVVA 1MJ9A 4GS4A 4QB9A 4EMEA 3FX6A 4AXVA 1TIQA 3WC7A 4F6AA 1IIDA 4DJLA 5K8NA 3S9NA 1CM0A 2EWBA 3W6XA 5LRKA 3EC4A 5JM6A 2J8MA 2ABZA 2HC9A 3N5FA 1LCPA 3RNZA 1ZLIA 3KASA 3DLJA 1WWZA 3JVNA 2FE7A 4H89A 2Z3NA 3QNVA 5IV0A 4MRIA 2IL4A 1EE3P 2PJCA 1FT7A 5CBMA 1Z8XA 4M85A 3SJEA 4ONWA 1JWQA 2O53A 2WSAA 3B8GA 3RAMA 4KLVA 4EFDA 3K2KA 1M4DA 6CPAA 4MFPA 4MBUA 4O23A 4PXBA 4K30A 2ZEDA 3LD2A 1Z8WA 1CP7A 1F57A 2PRBA 4KOSA 4F0YA 1B6BA 5I0CA 1M4GA 1IY7A 1ZO0A 2CF4A 3EFAA 1XE4A 4DUKA 4KVOE 4H2KA 4OMEA 5LYIA 1S60A 4UEZA 1PUAA 1F2OA 2OZHA 2XEGA 3D2PA 3FMCA 4MY0A 5AG7A 1R3NA 4MCRA 2ARHA 1CPXA 5LYFA 4R87A 4A94A 5KTAA 4G1PA 4K3NA 3ZJ0A 4EVYA 1BOBA 1LFWA 2OZUA 1XIXA 4B12A 3WR7A 1Z9UA 1IU8A 1DE4C 1KUVA 2AFZA 5HH1A 3LWUA 4KVXA 3D4UA 4PK2A 1XRYA 2P0WA 1HEEA 2B3UA 3VARA 3TFYA 3BLNA 1S7KA 1X10A 5JH9A 2EK9A 3B35A 2VI7A 3L2NA 1J4JA 4KOYA 2FIAA 5KTCA 3KL9A 1ARMA 1AMPA 2PCUA 3I3GA 4U9ZA 4C2ZA 4IF5A 3JUWA 4KZTA 4X8IA 3NH4A 3OWCA 4KUBA 3RYOA 3D2MA 4AG7A 4F9UA 1Q7LA 2QYVA 4AG9A 3TX8A 1TF9A 3TO7A 2ZEOA 2YNDA 2PIYA 4I49A 5LRGA 4CGNA 2O28A 4NGMA 1QSTA 2B5GA 2CIJA 4WWVA 1QSOA 1CBXA 2Q7SA 4X2TA 2BOAA 1CPSA 2OZGA 3IU2A 4NGTA 4F9VA 4MHNA 4YGOA 1UWYA 1ZG9A 2AFMA 1GYTA 3TOBA 4C2XA 5K8PA 5ISVA 3BHXA 4MHYA 4A30A 1X12A 4PSXA 1LRZA 1OBRA 2VZYA 3DGVA 3NH5A 4TWEA 1QSMA 2YNEA 5DWMA 3S9MA 4NEXA 5AG5A 3WT4A 5GCNA 2I3CA 2BO9A 4RS2A 3SJXA 4PXCA 4CS0B 1GHEA 3H8GA 4LQ6A 2PJ6A 5HVGA 3TE4A 3K9TA 2PSWA 2NSMA 3FF3A 3D66A 4KSAA 5G22A 3ISZA 4CYNA 2R98A 1YVKA 3T8WA 4MCPA 1PCAA 1FY7A 4MCQA 4PK3A 2WPWA 1VKCA 4NXYA 3WABA 1NSAA 5DS0A 1Z5RA 2Q4VA 2OU2A 3SXNA 3S6HA 4M6IA 2ZEFA 4MFQA 4B6ZA 2PJ4A 2AFUA 5HVHA 4E0AA 1U6MA 3KGQA 3PRTA 3FIXA 3B3SA 2EO8A 1XBUA 2CTBA 2ZENA 4L8AA 4CYPA 1Z8LA 4E8OA 4C7IA 1KWMA 4P44A 3CXPA 3WC5A 2PR8A 4YRHA 3I1UA 3TO6A 4AB7A 1Y0YA 2R1IA 5D8NA 4B14A 3KKWA 2V77A 4MXUA 5G21A 2C1CA 3NA6A 4PPZA 4P4FA 1PYTB 4R76A 5J8FA 2P6EA 3UY5A 3SXOA 2ZXVA 4WJBA 1QQ9A 2P6GA 2Z3KA 4LX9A 4OP4A 4ZBGA 2VBQA 2ZW7A 3IIBA 1YLOA 2G0BA 3GB0A 4A33A 1RXTA 4A37A 3CZXA 3QB8A 4BINA 2CXAA 4ZX8A 4CGMA 4CPAA 3VATA 4KUAA 3NH8A 1BAVA 1LAMA 3GKRA 4LQGA 4AVBA 2O4HA 3ISXA 4B5PB 2REFA 3HLPA 4YFJA 4UCPA 1LAPA 4J3GA 3GLJA 1Q2YA 3S9LA 1Q2CA 5JQ4A 4ONUA 4Q38A 1PU9A 4MFZA 4RN7A 2PJ7A 1CG2A 5F47A 3IWWA 5IX3A 5EC4A 4CRZB 4UIAA 3IU1A 4UWIA 4AVCA 1LANA 2FT0A 2HUZA 4HPSA 2WUUA 2ZELA 1YMEA 4MFKA 4KSFA 4HKFA 4UCMA 4XPDC 2QVPA 2X7BA 1MK4A 4X3RA 2G3AA 4JYWA 2DPTA 2ANPA 2REEA 3R1KA 4UWJA 4NGNA 4KORA 3SHPA 2QECA 2PJBA 4UBRA 8CPAA 3R95A 4NJRA 3TTHA 3D7GA 4CAEA 1XFOA 1Y7RA 3PBEA 3PFEA 2ODFA 1Y7EA 2WPXA 2YNCC 3FNCA 4NGRA 3N7ZA 4UCNA 1YSJA 2ZW5A 1Y9KA 3GY9A 4FD7A 4QBJA 3H8EA 3F5BA 2JDDA 2BCOA 1N71A 1VHOA 1QSNA 3IC1A 4PSWA 2D4OA 1JQGA 2CTCA 3PB4X 2PVWA 4KS9A 2BSWA 2G3TA 4MJ8A 2PJAA 5HXDA 1WK4A 2EUIA 2DEAA 2F7VA 1A2ZA 1IOIA 2J8NA 2NYQA 4BMHA 4HNYB 4LUAA 4CRYB 4XNHB 4A38A 1TF8A 2ZEGA 4KOUA 3SI0A 3B3VA 3T9YA 2JEVA 2RB7A 4DNCA 1BPNA 2PJ1A 4A95A 2C6CA 4BBHA 4M3SA 1KUXA 2GFQA 3NFZA 3SI2A 4GM5A 3PEIA 4ZY2A 2J9AA 4A39A 2C6PA 4KVME 1BLLE 2JBJA 4CYOA 1H8LA 3TCVA 2OH1A 3D3SA 2QJ8A 5J8CA 4B13A 3IGRA 5H84A 3C26A 2PDOA 4Y49B 4NGQA 1ELMP 1AUGA 5I4MA 1IGBA 2Z3OA 3FBUA 3FEDA 2Z10A 4P4IA 5KTDA 1I12A 4QVTA 5G1ZA 4CYQA 3D68A 2Z3PA 1Z8TA 1OZPA 1L0CA 5A27A 2F8HA 3EY5A 3S6FA 2CNTA 2GIVA 2PR1A 3D7FA 1I21A 3DR6A 1B87A 2VQYA 3I9SA 3MGDA 4XNHC 4OC0A 1YW6A 2PIZA 3VH9A 1IOFA 4MFJA 2JLMA 1NMTA 1S3ZA 1Q2DA 1VGYA 1S5KA 1UFHA 2Q44A 1MJBA 3KQXA 4KOXA 4X5KA 1BO4A 4R7MA 2V8DA 5AGEA 3CPAA 2D4PA 3G3SA 5THWA 2I00A 2JBKA 2FIWA 2PJ3A 4XPDB 4MFLA 3V8IA 4CGLA 2DPSA 4Q36A 2XEFA 2HB6A 3B7IA 4OADA 5LYDA 2PJ0A 4JJXA 5AG6A 1HDQA 1M4LA 1R57A 2CY2A 2Q43A 3P2FA 2AFSA 3VWDA 1S7FA 4ZGYB 3HUVA 3WC6A 4R57A 1IYLA 2JEWA 4YU9A 2GU2A 4IAVA 2G9DA 2RFHA 4W9YA 1TKJA 2WYRA 3LACA 4C2YA 1ZG8A 1ZLHA 2Z3LA 1DTDA 2ZEPA 4XPKA 5K8MA 1RO5A 4IHMA 2BEIA 2QIRA 1Z4RA 2I79A 5F09A 3KI9A 3TC8A 4NGSA 1FNOA 2AFXA 4B5OA 4NF1A 2VXKA 1XEBA 3RO0A 2IJZA 2J8RA 4JXRA 4P4DA 1M44A 2DXQA 1Y0RA 5J1QA 4JLYA 4Q7AA 4EWTA 3FECA 3S6GA 2ZOFA 2ATRA 2VZZA 3IWGA 1XJOA 2HV2A 2VL1A 4HNXB 4OC2A 4AVAA 1P0HA 2OR4A 4OLLA 3GYAA 2ZEEA 3DR8A 4IK2A 2BUEA 4OIWA 4U9YA 5F48A 3SI1A 4ZY0A 2Q4ZA 2ZOGA 1NE9A 3A9LA 3JTKA 4R8FA 4KOTA 3KHXA 3V7ZA 3W91A 4KOWA 4MI4A 2POKA 2WZNA 1YGHA 1ON0A 3DDDA 3KR5A 3PFOA 1TKFA 3FRMA 2Q0YA 3MN8A 2RC4A 4FD5A 2V8HA 2PC1A 3PB6X 1QMUA 4P4BA 3P2HA 1LOKA 5JGFA 1XOVA 3IFEA 2IMOA 1YR0A 3EXNA 2C6GA 2GLFA 5G20A 4HNWB 1ELLP 2R8VA 3FEEA 4PV6A 5CNPA 2AJ6A 4NCZA 3B3CA 1VIXA 1NSLA 4CGPA 3KHZA 2A4NA 4B11A 3R9EA 1SQHA 2JDCA 1RTQA 4IUSA 5AG4A 3F0AA 2FS5A 1S7LA 2B4DB 5ELYA 1MJAA 1P4NA 3F8KA 4KSIA 4PXEA 3KR4A 1IICA 4P4JA 4KLWA 3CPXA 4MCSA 5CPAA 2AFWA 4NSQA 4Z65A 1XMTA 4ZI6A 1CP6A 5F46A 3LMSA 3R9GA 2PJ5A 1YVOA 2GANA 1ARLA 4P6YA 2IQ6A 1YREA 5C88A 4XPLA 4P10A 4DYOA 2PJ9A 2ZPAA 3JRUA
chains in the Genus database with same CATH topology
4R3KA 2CNMA 2PQ8A 3TO9A 4UFWA 4A31A 3FB3A 2C27A 4JWPA 2Y0MA 2P6FA 2Z11A 2CNSA 2R7HA 4F0XA 3G8WA 4QC6A 2Z3MA 5H86A 2OB0A 3FYNA 5F49A 4C7HA 4OAEA 5BWAB 4Y49C 3LODA 2Z0ZA 4CAXA 3T90A 1KUYA 1V0CA 1IB1E 4H6ZA 2F5IA 5DWNA 4UFXA 4ORFA 1Y9WA 3BJ8A 3TOAA 4CAVA 5A28A 3DSBA 2AE6A 2NMTA 3IWEA 3D8PA 2Q7BA 2GE3A 2KCWA 4L89A 1IYKA 2EVNA 5HMNA 3PP9A 1XF8A 3PGPA 4A2ZA 4A32A 3BJ7A 4R9MA 4C68A 4B10A 1Z4EA 5EBVA 3R96A 3K9UA 3DNSA 4FD4A 1YK3A 4CAWA 5C82A 3VWEA 2B4DA 4UFVA 1M4IA 4JXQA 2ZW4A 2VEZA 4RI1A 4R3LA 5IB0A 4H6UA 4U5YA 2HQYA 2Q04A 3CXSA 5JPHA 2H5MA 2K5TA 2FSRA 5FVJA 3W6SA 3NE7A 1QSRA 4B5PA 4UA3A 1S7NA 3R9FA 3PZJA 3ZZIA 2QMLA 3H4QA 2B5GB 4CGOA 4II9A 1I1DA 1VHSA 2Q4YA 2FL4A 3E0KA 4FD6A 2BL1A 4MHDA 2ZW6A 2B3VA 4JD6A 1YLEA 3CXQA 1KZFA 4KOVA 3TT2A 2FXFA 3EO4A 4CAFA 2YGWA 3FXTA 2B4BA 4E2AA 1YX0A 1CJWA 1K4JA 2FCKA 1M1DA 4QUSA 3S6KA 5E96A 3QAHA 2B58A 4MY3A 2YNCA 4GS4A 1MJ9A 4QB9A 1TIQA 4F6AA 1IIDA 1CM0A 3W6XA 3EC4A 2J8MA 3JVNA 1WWZA 2FE7A 4H89A 2Z3NA 5IV0A 2IL4A 4M85A 3B8GA 2WSAA 4KLVA 1M4DA 4MFPA 4MBUA 4K30A 3LD2A 2PRBA 4KOSA 4F0YA 1B6BA 5I0CA 1M4GA 1ZO0A 3EFAA 1XE4A 4KVOE 1S60A 1PUAA 2OZHA 3D2PA 4MY0A 5AG7A 2ARHA 4R87A 5KTAA 3ZJ0A 4EVYA 1BOBA 2OZUA 1XIXA 4B12A 3WR7A 1Z9UA 1KUVA 5HH1A 4KVXA 4PK2A 2P0WA 2B3UA 3TFYA 3BLNA 1S7KA 2VI7A 1J4JA 4KOYA 2FIAA 5KTCA 4C2ZA 3I3GA 4U9ZA 4IF5A 3JUWA 4KZTA 4AG7A 3OWCA 4KUBA 3RYOA 3D2MA 4AG9A 4CGNA 3TO7A 4I49A 2YNDA 2O28A 1QSTA 2B5GA 4CS0B 1QSOA 3IU2A 2OZGA 4YGOA 3TOBA 4C2XA 5ISVA 4A30A 4PSXA 1LRZA 2VZYA 1QSMA 2YNEA 5DWMA 4NEXA 5AG5A 5GCNA 4RS2A 1GHEA 3TE4A 2PSWA 4KSAA 5G22A 4CYNA 2R98A 1YVKA 4PK3A 1FY7A 2WPWA 1VKCA 4NXYA 2Q4VA 2OU2A 3SXNA 3S6HA 4MFQA 4E0AA 1U6MA 3FIXA 4L8AA 4CYPA 4E8OA 4C7IA 3CXPA 2PR8A 4YRHA 3TO6A 4AB7A 2R1IA 4B14A 3KKWA 5G21A 2ZPAA 5J8FA 2P6EA 3UY5A 3SXOA 2ZXVA 2P6GA 2Z3KA 4LX9A 4ZBGA 2VBQA 2ZW7A 2G0BA 4A33A 1RXTA 3QB8A 2CXAA 4CGMA 4KUAA 3GKRA 4AVBA 4B5PB 2REFA 4YFJA 4UCPA 4J3GA 1Q2YA 1Q2CA 5JQ4A 4ONUA 4Q38A 1PU9A 4MFZA 5F47A 5IX3A 5EC4A 4CRZB 3IU1A 4UWIA 4AVCA 2FT0A 2HUZA 2WUUA 4UCMA 4MFKA 4XPDC 4KSFA 4HKFA 2X7BA 1MK4A 2G3AA 2DPTA 3R1KA 2REEA 4UWJA 4KORA 3SHPA 2QECA 4UBRA 3R95A 3TTHA 4CAEA 1Y7RA 2WPXA 3FNCA 2YNCC 3N7ZA 4UCNA 2ZW5A 4FD7A 1Y9KA 3GY9A 4QBJA 3F5BA 2JDDA 1N71A 1QSNA 4PSWA 2D4OA 4KS9A 2BSWA 2G3TA 4MJ8A 1WK4A 2EUIA 2J8NA 4BMHA 4HNYB 4LUAA 4CRYB 4XNHB 4KOUA 3T9YA 2JEVA 4DNCA 4A95A 4BBHA 4M3SA 1KUXA 4KVME 4CYOA 3TCVA 2OH1A 3D3SA 5J8CA 4B13A 3IGRA 5H84A 3C26A 2PDOA 4Y49B 2Z3OA 3FBUA 2Z10A 5KTDA 1I12A 4QVTA 5G1ZA 4CYQA 2Z3PA 1OZPA 1L0CA 5A27A 3EY5A 3S6FA 2CNTA 2GIVA 2PR1A 3DR6A 1I21A 3I9SA 1B87A 2VQYA 3MGDA 4XNHC 4MFJA 2JLMA 1NMTA 1S3ZA 1Q2DA 2Q44A 1S5KA 1UFHA 1MJBA 4KOXA 4X5KA 1BO4A 5AGEA 3G3SA 2D4PA 2I00A 2FIWA 4XPDB 4MFLA 3V8IA 4CGLA 2DPSA 4Q36A 4OADA 4JJXA 5AG6A 1R57A 2CY2A 3P2FA 3VWDA 1S7FA 4ZGYB 4R57A 1IYLA 4C2YA 2Z3LA 4XPKA 1RO5A 2BEIA 2QIRA 1Z4RA 2I79A 4B5OA 4NF1A 2VXKA 1XEBA 2J8RA 4JXRA 1M44A 2DXQA 4JLYA 3S6GA 2ATRA 2VZZA 3IWGA 2HV2A 4HNXB 4AVAA 1P0HA 4OLLA 3GYAA 3DR8A 5F48A 2BUEA 4U9YA 3JTKA 1NE9A 3A9LA 4KOTA 3W91A 4KOWA 4MI4A 1YGHA 1ON0A 3DDDA 3FRMA 2Q0YA 2RC4A 4FD5A 2PC1A 3P2HA 1YR0A 3EXNA 5G20A 4HNWB 2R8VA 4PV6A 5CNPA 2AJ6A 4NCZA 1NSLA 4CGPA 2A4NA 4B11A 3R9EA 1SQHA 2JDCA 4IUSA 5AG4A 3F0AA 2FS5A 1S7LA 2B4DB 1MJAA 1P4NA 3F8KA 1IICA 4KLWA 4NSQA 1XMTA 5F46A 3R9GA 1YVOA 2GANA 1YREA 5C88A 4XPLA 3H5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3K A;  2CNM A;  2PQ8 A;  3TO9 A;  3FB3 A;  2C27 A;  4JWP A;  2Y0M A;  2P6F A;  2Z11 A;  2CNS A;  2R7H A;  3G8W A;  4QC6 A;  5H86 A;  2OB0 A;  3FYN A;  5F49 A;  4OAE A;  4Y49 C;  3LOD A;  2Z0Z A;  4CAX A;  3T90 A;  1KUY A;  1V0C A;  1IB1 E;  4H6Z A;  2F5I A;  5DWN A;  4ORF A;  1Y9W A;  3BJ8 A;  3TOA A;  4CAV A;  3DSB A;  2AE6 A;  2NMT A;  3D8P A;  2Q7B A;  2GE3 A;  2KCW A;  4L89 A;  1IYK A;  2EVN A;  5HMN A;  3PP9 A;  1XF8 A;  3PGP A;  3BJ7 A;  4R9M A;  1Z4E A;  5EBV A;  3R96 A;  3K9U A;  3DNS A;  4FD4 A;  1YK3 A;  4CAW A;  5C82 A;  3VWE A;  2B4D A;  1M4I A;  4JXQ A;  2ZW4 A;  2VEZ A;  4RI1 A;  4R3L A;  5IB0 A;  4H6U A;  4U5Y A;  2HQY A;  2Q04 A;  3CXS A;  5JPH A;  2H5M A;  2K5T A;  2FSR A;  5FVJ A;  3W6S A;  3NE7 A;  1QSR A;  4B5P A;  4UA3 A;  1S7N A;  3R9F A;  3PZJ A;  3ZZI A;  2QML A;  3H4Q A;  2B5G B;  4II9 A;  1I1D A;  1VHS A;  2Q4Y A;  2FL4 A;  3E0K A;  4FD6 A;  2BL1 A;  4MHD A;  2ZW6 A;  2B3V A;  4JD6 A;  1YLE A;  3CXQ A;  1KZF A;  4KOV A;  3TT2 A;  2FXF A;  3EO4 A;  3FXT A;  2B4B A;  4E2A A;  1YX0 A;  1CJW A;  1K4J A;  2FCK A;  1M1D A;  4QUS A;  3S6K A;  5E96 A;  3QAH A;  2B58 A;  4MY3 A;  4GS4 A;  1MJ9 A;  4QB9 A;  1TIQ A;  4F6A A;  1IID A;  1CM0 A;  3W6X A;  3EC4 A;  2J8M A;  3JVN A;  1WWZ A;  2FE7 A;  4H89 A;  5IV0 A;  2IL4 A;  4M85 A;  3B8G A;  4KLV A;  1M4D A;  4MBU A;  4K30 A;  3LD2 A;  2PRB A;  4KOS A;  4F0Y A;  1B6B A;  5I0C A;  1M4G A;  3EFA A;  1XE4 A;  4KVO E;  1S60 A;  1PUA A;  2OZH A;  3D2P A;  4MY0 A;  2ARH A;  4R87 A;  5KTA A;  3ZJ0 A;  4EVY A;  1BOB A;  2OZU A;  1XIX A;  3WR7 A;  1Z9U A;  1KUV A;  5HH1 A;  4KVX A;  4PK2 A;  2P0W A;  2B3U A;  3TFY A;  3BLN A;  1S7K A;  2VI7 A;  1J4J A;  4KOY A;  2FIA A;  5KTC A;  3I3G A;  4U9Z A;  4IF5 A;  3JUW A;  4KZT A;  4AG7 A;  3OWC A;  4KUB A;  3RYO A;  3D2M A;  4AG9 A;  3TO7 A;  4I49 A;  2O28 A;  1QST A;  2B5G A;  4CS0 B;  1QSO A;  2OZG A;  4YGO A;  3TOB A;  5ISV A;  4PSX A;  1LRZ A;  2VZY A;  1QSM A;  5DWM A;  4NEX A;  5GCN A;  4RS2 A;  1GHE A;  3TE4 A;  2PSW A;  2R98 A;  1YVK A;  4PK3 A;  1FY7 A;  2WPW A;  1VKC A;  4NXY A;  2Q4V A;  2OU2 A;  3SXN A;  3S6H A;  4E0A A;  1U6M A;  3FIX A;  4L8A A;  4E8O A;  3CXP A;  2PR8 A;  4YRH A;  3TO6 A;  4AB7 A;  2R1I A;  3KKW A;  5J8F A;  2P6E A;  3UY5 A;  3SXO A;  2ZXV A;  2P6G A;  4LX9 A;  4ZBG A;  2VBQ A;  2ZW7 A;  2G0B A;  1RXT A;  3QB8 A;  4KUA A;  3GKR A;  4AVB A;  4B5P B;  2REF A;  4YFJ A;  4J3G A;  1Q2Y A;  1Q2C A;  5JQ4 A;  4ONU A;  1PU9 A;  5F47 A;  5IX3 A;  5EC4 A;  4CRZ B;  4UWI A;  4AVC A;  2FT0 A;  2HUZ A;  4XPD C;  4HKF A;  2X7B A;  1MK4 A;  2G3A A;  3R1K A;  2REE A;  4UWJ A;  4KOR A;  3SHP A;  2QEC A;  4UBR A;  3R95 A;  3TTH A;  1Y7R A;  2WPX A;  3FNC A;  3N7Z A;  2ZW5 A;  4FD7 A;  1Y9K A;  3GY9 A;  4QBJ A;  3F5B A;  2JDD A;  1N71 A;  1QSN A;  4PSW A;  2D4O A;  2BSW A;  2G3T A;  4MJ8 A;  1WK4 A;  2EUI A;  2J8N A;  4BMH A;  4HNY B;  4LUA A;  4CRY B;  4XNH B;  4KOU A;  3T9Y A;  2JEV A;  4DNC A;  4M3S A;  1KUX A;  4KVM E;  3TCV A;  2OH1 A;  3D3S A;  5J8C A;  3IGR A;  5H84 A;  3C26 A;  2PDO A;  4Y49 B;  3FBU A;  2Z10 A;  5KTD A;  1I12 A;  4QVT A;  1OZP A;  1L0C A;  3EY5 A;  3S6F A;  2CNT A;  2GIV A;  2PR1 A;  3DR6 A;  1I21 A;  3I9S A;  1B87 A;  2VQY A;  3MGD A;  4XNH C;  2JLM A;  1NMT A;  1S3Z A;  1Q2D A;  2Q44 A;  1S5K A;  1UFH A;  1MJB A;  4KOX A;  4X5K A;  1BO4 A;  3G3S A;  2D4P A;  2I00 A;  2FIW A;  4XPD B;  3V8I A;  4OAD A;  4JJX A;  1R57 A;  2CY2 A;  3P2F A;  3VWD A;  1S7F A;  4R57 A;  1IYL A;  4XPK A;  1RO5 A;  2BEI A;  2QIR A;  1Z4R A;  2I79 A;  4B5O A;  4NF1 A;  2VXK A;  1XEB A;  2J8R A;  4JXR A;  1M44 A;  2DXQ A;  4JLY A;  3S6G A;  2ATR A;  2VZZ A;  3IWG A;  2HV2 A;  4HNX B;  4AVA A;  1P0H A;  4OLL A;  3GYA A;  3DR8 A;  5F48 A;  2BUE A;  4U9Y A;  1NE9 A;  4KOT A;  3W91 A;  4KOW A;  4MI4 A;  1YGH A;  1ON0 A;  3DDD A;  3FRM A;  2Q0Y A;  2RC4 A;  4FD5 A;  2PC1 A;  3P2H A;  1YR0 A;  3EXN A;  4HNW B;  2R8V A;  4PV6 A;  5CNP A;  2AJ6 A;  4NCZ A;  1NSL A;  2A4N A;  3R9E A;  1SQH A;  2JDC A;  4IUS A;  3F0A A;  2FS5 A;  1S7L A;  2B4D B;  1MJA A;  1P4N A;  3F8K A;  1IIC A;  4KLW A;  4NSQ A;  1XMT A;  5F46 A;  3R9G A;  1YVO A;  2GAN A;  1YRE A;  5C88 A;  4XPL A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 3FJU A;  4R3K A;  2CNM A;  1BPM A;  2PQ8 A;  4UFW A;  3TO9 A;  3FB3 A;  4A31 A;  3PB8 X;  2C27 A;  4FBE A;  4JWP A;  2Y0M A;  2P6F A;  2Z11 A;  4PXD A;  2DF5 A;  2CNS A;  2R7H A;  4F0X A;  3G8W A;  4PQA A;  4QC6 A;  2Z3M A;  5H86 A;  2OB0 A;  3FYN A;  5F49 A;  3B2Y A;  4C7H A;  4OKO A;  3PB7 X;  4BD9 A;  1AYE A;  4UEE A;  1Z2L A;  3V38 A;  4OAE A;  3NE8 A;  2OOT A;  4FAI A;  3SJF A;  2ZEH A;  5BWA B;  4Y49 C;  3LOD A;  4GXH A;  2Z0Z A;  4ZYQ A;  1CX8 A;  4CAX A;  3T90 A;  1KUY A;  1V0C A;  5LYL A;  1IB1 E;  4H6Z A;  4M6G A;  3QAY A;  2F5I A;  4P4E A;  5DWN A;  4UFX A;  5LRJ A;  4ORF A;  1Y9W A;  3BJ8 A;  3D7D A;  3IEH A;  3KZW A;  3PB9 X;  3TOA A;  4NJQ A;  4CAV A;  5A28 A;  1YW4 A;  3DSB A;  2AE6 A;  2NMT A;  5HVF A;  3IWE A;  3D8P A;  3CT9 A;  2Q7B A;  4RUH A;  2GE3 A;  2KCW A;  7CPA A;  3H5Z A;  2Q51 A;  1IYK A;  2EVN A;  3GIU A;  4L89 A;  3D7H A;  1R43 A;  1HDU A;  2XEI A;  5HMN A;  3PP9 A;  1XF8 A;  1TXR A;  2ZEM A;  3B3T A;  3PGP A;  4FUU A;  4A2Z A;  3B3W A;  4A32 A;  4F8Z A;  3BJ7 A;  4R9M A;  1ZG7 A;  4C68 A;  4B10 A;  1Z4E A;  3H8F A;  3BI0 A;  5EBV A;  4UEF A;  3R96 A;  3FH4 A;  3DNS A;  3K9U A;  4FD4 A;  4TNU A;  1YK3 A;  4CAW A;  4R6T A;  3VWE A;  2B4D A;  4UFV A;  5D29 A;  5C82 A;  2XEJ A;  1M4I A;  4JXQ A;  4MMO A;  2ZW4 A;  2VEZ A;  4RI1 A;  4R3L A;  5IB0 A;  4H6U A;  4U5Y A;  4FWU A;  4OID A;  2HQY A;  5EMI A;  2Q04 A;  3CXS A;  5JPH A;  2V8G A;  2H5M A;  2K5T A;  3PBB A;  2FSR A;  1F2P A;  3D67 A;  4OC3 A;  5FVJ A;  4P45 A;  4MHP A;  3W6S A;  3NE7 A;  2V8V A;  4NGP A;  4NFR A;  4OC5 A;  1QSR A;  4JZ0 A;  4UF4 A;  4B5P A;  3RZA A;  3IO1 A;  4UA3 A;  3RBU A;  1S7N A;  2FVG A;  3IJ3 A;  3R9F A;  3PZJ A;  3ZZI A;  3BXM A;  3SJG A;  4ZX9 A;  5IB9 A;  4YWY A;  2QML A;  3BI1 A;  4MHZ A;  1XMB A;  4ZY1 A;  5K8O A;  3H4Q A;  2PRQ A;  2B5G B;  4CGO A;  4II9 A;  3GUX A;  1I1D A;  1VHS A;  2Q4Y A;  2FL4 A;  3CDX A;  3E0K A;  4FD6 A;  4UIB A;  4OC4 A;  2BL1 A;  4MHD A;  1TKH A;  2EK8 A;  2GLJ A;  2ZW6 A;  1YQE A;  2AFO A;  2B3V A;  3FVL A;  3MRU A;  1VHE A;  4JD6 A;  4OC1 A;  1YLE A;  3CXQ A;  1KZF A;  4KOV A;  3TT2 A;  2FXF A;  3KQZ A;  2PJ2 A;  3EO4 A;  4M6H A;  4CAF A;  2YGW A;  2EBJ A;  2B4B A;  2PE3 A;  3FXT A;  4E2A A;  1YX0 A;  1CJW A;  1K4J A;  2FCK A;  1M1D A;  4QUS A;  2PJ8 A;  3S6K A;  5E96 A;  3QAH A;  2B58 A;  4MY3 A;  2GRE A;  2YNC A;  2PVV A;  1MJ9 A;  4GS4 A;  4QB9 A;  4EME A;  3FX6 A;  4AXV A;  1TIQ A;  3WC7 A;  4F6A A;  1IID A;  4DJL A;  5K8N A;  3S9N A;  1CM0 A;  2EWB A;  3W6X A;  5LRK A;  3EC4 A;  5JM6 A;  2J8M A;  2ABZ A;  2HC9 A;  3N5F A;  1LCP A;  3RNZ A;  1ZLI A;  3KAS A;  3DLJ A;  1WWZ A;  3JVN A;  2FE7 A;  4H89 A;  2Z3N A;  3QNV A;  5IV0 A;  4MRI A;  2IL4 A;  1EE3 P;  2PJC A;  1FT7 A;  5CBM A;  1Z8X A;  4M85 A;  3SJE A;  4ONW A;  1JWQ A;  2O53 A;  2WSA A;  3B8G A;  3RAM A;  4KLV A;  4EFD A;  3K2K A;  1M4D A;  6CPA A;  4MFP A;  4MBU A;  4O23 A;  4PXB A;  4K30 A;  2ZED A;  3LD2 A;  1Z8W A;  1CP7 A;  1F57 A;  2PRB A;  4KOS A;  4F0Y A;  1B6B A;  5I0C A;  1M4G A;  1IY7 A;  1ZO0 A;  2CF4 A;  3EFA A;  1XE4 A;  4DUK A;  4KVO E;  4H2K A;  4OME A;  5LYI A;  1S60 A;  4UEZ A;  1PUA A;  1F2O A;  2OZH A;  2XEG A;  3D2P A;  3FMC A;  4MY0 A;  5AG7 A;  1R3N A;  4MCR A;  2ARH A;  1CPX A;  5LYF A;  4R87 A;  4A94 A;  5KTA A;  4G1P A;  4K3N A;  3ZJ0 A;  4EVY A;  1BOB A;  1LFW A;  2OZU A;  1XIX A;  4B12 A;  3WR7 A;  1Z9U A;  1IU8 A;  1DE4 C;  1KUV A;  2AFZ A;  5HH1 A;  3LWU A;  4KVX A;  3D4U A;  4PK2 A;  1XRY A;  2P0W A;  1HEE A;  2B3U A;  3VAR A;  3TFY A;  3BLN A;  1S7K A;  1X10 A;  5JH9 A;  2EK9 A;  3B35 A;  2VI7 A;  3L2N A;  1J4J A;  4KOY A;  2FIA A;  5KTC A;  3KL9 A;  1ARM A;  1AMP A;  2PCU A;  3I3G A;  4U9Z A;  4C2Z A;  4IF5 A;  3JUW A;  4KZT A;  4X8I A;  3NH4 A;  3OWC A;  4KUB A;  3RYO A;  3D2M A;  4AG7 A;  4F9U A;  1Q7L A;  2QYV A;  4AG9 A;  3TX8 A;  1TF9 A;  3TO7 A;  2ZEO A;  2YND A;  2PIY A;  4I49 A;  5LRG A;  4CGN A;  2O28 A;  4NGM A;  1QST A;  2B5G A;  2CIJ A;  4WWV A;  1QSO A;  1CBX A;  2Q7S A;  4X2T A;  2BOA A;  1CPS A;  2OZG A;  3IU2 A;  4NGT A;  4F9V A;  4MHN A;  4YGO A;  1UWY A;  1ZG9 A;  2AFM A;  1GYT A;  3TOB A;  4C2X A;  5K8P A;  5ISV A;  3BHX A;  4MHY A;  4A30 A;  1X12 A;  4PSX A;  1LRZ A;  1OBR A;  2VZY A;  3DGV A;  3NH5 A;  4TWE A;  1QSM A;  2YNE A;  5DWM A;  3S9M A;  4NEX A;  5AG5 A;  3WT4 A;  5GCN A;  2I3C A;  2BO9 A;  4RS2 A;  3SJX A;  4PXC A;  4CS0 B;  1GHE A;  3H8G A;  4LQ6 A;  2PJ6 A;  5HVG A;  3TE4 A;  3K9T A;  2PSW A;  2NSM A;  3FF3 A;  3D66 A;  4KSA A;  5G22 A;  3ISZ A;  4CYN A;  2R98 A;  1YVK A;  3T8W A;  4MCP A;  1PCA A;  1FY7 A;  4MCQ A;  4PK3 A;  2WPW A;  1VKC A;  4NXY A;  3WAB A;  1NSA A;  5DS0 A;  1Z5R A;  2Q4V A;  2OU2 A;  3SXN A;  3S6H A;  4M6I A;  2ZEF A;  4MFQ A;  4B6Z A;  2PJ4 A;  2AFU A;  5HVH A;  4E0A A;  1U6M A;  3KGQ A;  3PRT A;  3FIX A;  3B3S A;  2EO8 A;  1XBU A;  2CTB A;  2ZEN A;  4L8A A;  4CYP A;  1Z8L A;  4E8O A;  4C7I A;  1KWM A;  4P44 A;  3CXP A;  3WC5 A;  2PR8 A;  4YRH A;  3I1U A;  3TO6 A;  4AB7 A;  1Y0Y A;  2R1I A;  5D8N A;  4B14 A;  3KKW A;  2V77 A;  4MXU A;  5G21 A;  2C1C A;  3NA6 A;  4PPZ A;  4P4F A;  1PYT B;  4R76 A;  5J8F A;  2P6E A;  3UY5 A;  3SXO A;  2ZXV A;  4WJB A;  1QQ9 A;  2P6G A;  2Z3K A;  4LX9 A;  4OP4 A;  4ZBG A;  2VBQ A;  2ZW7 A;  3IIB A;  1YLO A;  2G0B A;  3GB0 A;  4A33 A;  1RXT A;  4A37 A;  3CZX A;  3QB8 A;  4BIN A;  2CXA A;  4ZX8 A;  4CGM A;  4CPA A;  3VAT A;  4KUA A;  3NH8 A;  1BAV A;  1LAM A;  3GKR A;  4LQG A;  4AVB A;  2O4H A;  3ISX A;  4B5P B;  2REF A;  3HLP A;  4YFJ A;  4UCP A;  1LAP A;  4J3G A;  3GLJ A;  1Q2Y A;  3S9L A;  1Q2C A;  5JQ4 A;  4ONU A;  4Q38 A;  1PU9 A;  4MFZ A;  4RN7 A;  2PJ7 A;  1CG2 A;  5F47 A;  3IWW A;  5IX3 A;  5EC4 A;  4CRZ B;  4UIA A;  3IU1 A;  4UWI A;  4AVC A;  1LAN A;  2FT0 A;  2HUZ A;  4HPS A;  2WUU A;  2ZEL A;  1YME A;  4MFK A;  4KSF A;  4HKF A;  4UCM A;  4XPD C;  2QVP A;  2X7B A;  1MK4 A;  4X3R A;  2G3A A;  4JYW A;  2DPT A;  2ANP A;  2REE A;  3R1K A;  4UWJ A;  4NGN A;  4KOR A;  3SHP A;  2QEC A;  2PJB A;  4UBR A;  8CPA A;  3R95 A;  4NJR A;  3TTH A;  3D7G A;  4CAE A;  1XFO A;  1Y7R A;  3PBE A;  3PFE A;  2ODF A;  1Y7E A;  2WPX A;  2YNC C;  3FNC A;  4NGR A;  3N7Z A;  4UCN A;  1YSJ A;  2ZW5 A;  1Y9K A;  3GY9 A;  4FD7 A;  4QBJ A;  3H8E A;  3F5B A;  2JDD A;  2BCO A;  1N71 A;  1VHO A;  1QSN A;  3IC1 A;  4PSW A;  2D4O A;  1JQG A;  2CTC A;  3PB4 X;  2PVW A;  4KS9 A;  2BSW A;  2G3T A;  4MJ8 A;  2PJA A;  5HXD A;  1WK4 A;  2EUI A;  2DEA A;  2F7V A;  1A2Z A;  1IOI A;  2J8N A;  2NYQ A;  4BMH A;  4HNY B;  4LUA A;  4CRY B;  4XNH B;  4A38 A;  1TF8 A;  2ZEG A;  4KOU A;  3SI0 A;  3B3V A;  3T9Y A;  2JEV A;  2RB7 A;  4DNC A;  1BPN A;  2PJ1 A;  4A95 A;  2C6C A;  4BBH A;  4M3S A;  1KUX A;  2GFQ A;  3NFZ A;  3SI2 A;  4GM5 A;  3PEI A;  4ZY2 A;  2J9A A;  4A39 A;  2C6P A;  4KVM E;  1BLL E;  2JBJ A;  4CYO A;  1H8L A;  3TCV A;  2OH1 A;  3D3S A;  2QJ8 A;  5J8C A;  4B13 A;  3IGR A;  5H84 A;  3C26 A;  2PDO A;  4Y49 B;  4NGQ A;  1ELM P;  1AUG A;  5I4M A;  1IGB A;  2Z3O A;  3FBU A;  3FED A;  2Z10 A;  4P4I A;  5KTD A;  1I12 A;  4QVT A;  5G1Z A;  4CYQ A;  3D68 A;  2Z3P A;  1Z8T A;  1OZP A;  1L0C A;  5A27 A;  2F8H A;  3EY5 A;  3S6F A;  2CNT A;  2GIV A;  2PR1 A;  3D7F A;  1I21 A;  3DR6 A;  1B87 A;  2VQY A;  3I9S A;  3MGD A;  4XNH C;  4OC0 A;  1YW6 A;  2PIZ A;  3VH9 A;  1IOF A;  4MFJ A;  2JLM A;  1NMT A;  1S3Z A;  1Q2D A;  1VGY A;  1S5K A;  1UFH A;  2Q44 A;  1MJB A;  3KQX A;  4KOX A;  4X5K A;  1BO4 A;  4R7M A;  2V8D A;  5AGE A;  3CPA A;  2D4P A;  3G3S A;  5THW A;  2I00 A;  2JBK A;  2FIW A;  2PJ3 A;  4XPD B;  4MFL A;  3V8I A;  4CGL A;  2DPS A;  4Q36 A;  2XEF A;  2HB6 A;  3B7I A;  4OAD A;  5LYD A;  2PJ0 A;  4JJX A;  5AG6 A;  1HDQ A;  1M4L A;  1R57 A;  2CY2 A;  2Q43 A;  3P2F A;  2AFS A;  3VWD A;  1S7F A;  4ZGY B;  3HUV A;  3WC6 A;  4R57 A;  1IYL A;  2JEW A;  4YU9 A;  2GU2 A;  4IAV A;  2G9D A;  2RFH A;  4W9Y A;  1TKJ A;  2WYR A;  3LAC A;  4C2Y A;  1ZG8 A;  1ZLH A;  2Z3L A;  1DTD A;  2ZEP A;  4XPK A;  5K8M A;  1RO5 A;  4IHM A;  2BEI A;  2QIR A;  1Z4R A;  2I79 A;  5F09 A;  3KI9 A;  3TC8 A;  4NGS A;  1FNO A;  2AFX A;  4B5O A;  4NF1 A;  2VXK A;  1XEB A;  3RO0 A;  2IJZ A;  2J8R A;  4JXR A;  4P4D A;  1M44 A;  2DXQ A;  1Y0R A;  5J1Q A;  4JLY A;  4Q7A A;  4EWT A;  3FEC A;  3S6G A;  2ZOF A;  2ATR A;  2VZZ A;  3IWG A;  1XJO A;  2HV2 A;  2VL1 A;  4HNX B;  4OC2 A;  4AVA A;  1P0H A;  2OR4 A;  4OLL A;  3GYA A;  2ZEE A;  3DR8 A;  4IK2 A;  2BUE A;  4OIW A;  4U9Y A;  5F48 A;  3SI1 A;  4ZY0 A;  2Q4Z A;  2ZOG A;  1NE9 A;  3A9L A;  3JTK A;  4R8F A;  4KOT A;  3KHX A;  3V7Z A;  3W91 A;  4KOW A;  4MI4 A;  2POK A;  2WZN A;  1YGH A;  1ON0 A;  3DDD A;  3KR5 A;  3PFO A;  1TKF A;  3FRM A;  2Q0Y A;  3MN8 A;  2RC4 A;  4FD5 A;  2V8H A;  2PC1 A;  3PB6 X;  1QMU A;  4P4B A;  3P2H A;  1LOK A;  5JGF A;  1XOV A;  3IFE A;  2IMO A;  1YR0 A;  3EXN A;  2C6G A;  2GLF A;  5G20 A;  4HNW B;  1ELL P;  2R8V A;  3FEE A;  4PV6 A;  5CNP A;  2AJ6 A;  4NCZ A;  3B3C A;  1VIX A;  1NSL A;  4CGP A;  3KHZ A;  2A4N A;  4B11 A;  3R9E A;  1SQH A;  2JDC A;  1RTQ A;  4IUS A;  5AG4 A;  3F0A A;  2FS5 A;  1S7L A;  2B4D B;  5ELY A;  1MJA A;  1P4N A;  3F8K A;  4KSI A;  4PXE A;  3KR4 A;  1IIC A;  4P4J A;  4KLW A;  3CPX A;  4MCS A;  5CPA A;  2AFW A;  4NSQ A;  4Z65 A;  1XMT A;  4ZI6 A;  1CP6 A;  5F46 A;  3LMS A;  3R9G A;  2PJ5 A;  1YVO A;  2GAN A;  1ARL A;  4P6Y A;  2IQ6 A;  1YRE A;  5C88 A;  4XPL A;  4P10 A;  4DYO A;  2PJ9 A;  2ZPA A;  3JRU A; 
#chains in the Genus database with same CATH homology
 4R3K A;  2CNM A;  2PQ8 A;  3TO9 A;  4UFW A;  4A31 A;  3FB3 A;  2C27 A;  4JWP A;  2Y0M A;  2P6F A;  2Z11 A;  2CNS A;  2R7H A;  4F0X A;  3G8W A;  4QC6 A;  2Z3M A;  5H86 A;  2OB0 A;  3FYN A;  5F49 A;  4C7H A;  4OAE A;  5BWA B;  4Y49 C;  3LOD A;  2Z0Z A;  4CAX A;  3T90 A;  1KUY A;  1V0C A;  1IB1 E;  4H6Z A;  2F5I A;  5DWN A;  4UFX A;  4ORF A;  1Y9W A;  3BJ8 A;  3TOA A;  4CAV A;  5A28 A;  3DSB A;  2AE6 A;  2NMT A;  3IWE A;  3D8P A;  2Q7B A;  2GE3 A;  2KCW A;  4L89 A;  1IYK A;  2EVN A;  5HMN A;  3PP9 A;  1XF8 A;  3PGP A;  4A2Z A;  4A32 A;  3BJ7 A;  4R9M A;  4C68 A;  4B10 A;  1Z4E A;  5EBV A;  3R96 A;  3K9U A;  3DNS A;  4FD4 A;  1YK3 A;  4CAW A;  5C82 A;  3VWE A;  2B4D A;  4UFV A;  1M4I A;  4JXQ A;  2ZW4 A;  2VEZ A;  4RI1 A;  4R3L A;  5IB0 A;  4H6U A;  4U5Y A;  2HQY A;  2Q04 A;  3CXS A;  5JPH A;  2H5M A;  2K5T A;  2FSR A;  5FVJ A;  3W6S A;  3NE7 A;  1QSR A;  4B5P A;  4UA3 A;  1S7N A;  3R9F A;  3PZJ A;  3ZZI A;  2QML A;  3H4Q A;  2B5G B;  4CGO A;  4II9 A;  1I1D A;  1VHS A;  2Q4Y A;  2FL4 A;  3E0K A;  4FD6 A;  2BL1 A;  4MHD A;  2ZW6 A;  2B3V A;  4JD6 A;  1YLE A;  3CXQ A;  1KZF A;  4KOV A;  3TT2 A;  2FXF A;  3EO4 A;  4CAF A;  2YGW A;  3FXT A;  2B4B A;  4E2A A;  1YX0 A;  1CJW A;  1K4J A;  2FCK A;  1M1D A;  4QUS A;  3S6K A;  5E96 A;  3QAH A;  2B58 A;  4MY3 A;  2YNC A;  4GS4 A;  1MJ9 A;  4QB9 A;  1TIQ A;  4F6A A;  1IID A;  1CM0 A;  3W6X A;  3EC4 A;  2J8M A;  3JVN A;  1WWZ A;  2FE7 A;  4H89 A;  2Z3N A;  5IV0 A;  2IL4 A;  4M85 A;  3B8G A;  2WSA A;  4KLV A;  1M4D A;  4MFP A;  4MBU A;  4K30 A;  3LD2 A;  2PRB A;  4KOS A;  4F0Y A;  1B6B A;  5I0C A;  1M4G A;  1ZO0 A;  3EFA A;  1XE4 A;  4KVO E;  1S60 A;  1PUA A;  2OZH A;  3D2P A;  4MY0 A;  5AG7 A;  2ARH A;  4R87 A;  5KTA A;  3ZJ0 A;  4EVY A;  1BOB A;  2OZU A;  1XIX A;  4B12 A;  3WR7 A;  1Z9U A;  1KUV A;  5HH1 A;  4KVX A;  4PK2 A;  2P0W A;  2B3U A;  3TFY A;  3BLN A;  1S7K A;  2VI7 A;  1J4J A;  4KOY A;  2FIA A;  5KTC A;  4C2Z A;  3I3G A;  4U9Z A;  4IF5 A;  3JUW A;  4KZT A;  4AG7 A;  3OWC A;  4KUB A;  3RYO A;  3D2M A;  4AG9 A;  4CGN A;  3TO7 A;  4I49 A;  2YND A;  2O28 A;  1QST A;  2B5G A;  4CS0 B;  1QSO A;  3IU2 A;  2OZG A;  4YGO A;  3TOB A;  4C2X A;  5ISV A;  4A30 A;  4PSX A;  1LRZ A;  2VZY A;  1QSM A;  2YNE A;  5DWM A;  4NEX A;  5AG5 A;  5GCN A;  4RS2 A;  1GHE A;  3TE4 A;  2PSW A;  4KSA A;  5G22 A;  4CYN A;  2R98 A;  1YVK A;  4PK3 A;  1FY7 A;  2WPW A;  1VKC A;  4NXY A;  2Q4V A;  2OU2 A;  3SXN A;  3S6H A;  4MFQ A;  4E0A A;  1U6M A;  3FIX A;  4L8A A;  4CYP A;  4E8O A;  4C7I A;  3CXP A;  2PR8 A;  4YRH A;  3TO6 A;  4AB7 A;  2R1I A;  4B14 A;  3KKW A;  5G21 A;  2ZPA A;  5J8F A;  2P6E A;  3UY5 A;  3SXO A;  2ZXV A;  2P6G A;  2Z3K A;  4LX9 A;  4ZBG A;  2VBQ A;  2ZW7 A;  2G0B A;  4A33 A;  1RXT A;  3QB8 A;  2CXA A;  4CGM A;  4KUA A;  3GKR A;  4AVB A;  4B5P B;  2REF A;  4YFJ A;  4UCP A;  4J3G A;  1Q2Y A;  1Q2C A;  5JQ4 A;  4ONU A;  4Q38 A;  1PU9 A;  4MFZ A;  5F47 A;  5IX3 A;  5EC4 A;  4CRZ B;  3IU1 A;  4UWI A;  4AVC A;  2FT0 A;  2HUZ A;  2WUU A;  4UCM A;  4MFK A;  4XPD C;  4KSF A;  4HKF A;  2X7B A;  1MK4 A;  2G3A A;  2DPT A;  3R1K A;  2REE A;  4UWJ A;  4KOR A;  3SHP A;  2QEC A;  4UBR A;  3R95 A;  3TTH A;  4CAE A;  1Y7R A;  2WPX A;  3FNC A;  2YNC C;  3N7Z A;  4UCN A;  2ZW5 A;  4FD7 A;  1Y9K A;  3GY9 A;  4QBJ A;  3F5B A;  2JDD A;  1N71 A;  1QSN A;  4PSW A;  2D4O A;  4KS9 A;  2BSW A;  2G3T A;  4MJ8 A;  1WK4 A;  2EUI A;  2J8N A;  4BMH A;  4HNY B;  4LUA A;  4CRY B;  4XNH B;  4KOU A;  3T9Y A;  2JEV A;  4DNC A;  4A95 A;  4BBH A;  4M3S A;  1KUX A;  4KVM E;  4CYO A;  3TCV A;  2OH1 A;  3D3S A;  5J8C A;  4B13 A;  3IGR A;  5H84 A;  3C26 A;  2PDO A;  4Y49 B;  2Z3O A;  3FBU A;  2Z10 A;  5KTD A;  1I12 A;  4QVT A;  5G1Z A;  4CYQ A;  2Z3P A;  1OZP A;  1L0C A;  5A27 A;  3EY5 A;  3S6F A;  2CNT A;  2GIV A;  2PR1 A;  3DR6 A;  1I21 A;  3I9S A;  1B87 A;  2VQY A;  3MGD A;  4XNH C;  4MFJ A;  2JLM A;  1NMT A;  1S3Z A;  1Q2D A;  2Q44 A;  1S5K A;  1UFH A;  1MJB A;  4KOX A;  4X5K A;  1BO4 A;  5AGE A;  3G3S A;  2D4P A;  2I00 A;  2FIW A;  4XPD B;  4MFL A;  3V8I A;  4CGL A;  2DPS A;  4Q36 A;  4OAD A;  4JJX A;  5AG6 A;  1R57 A;  2CY2 A;  3P2F A;  3VWD A;  1S7F A;  4ZGY B;  4R57 A;  1IYL A;  4C2Y A;  2Z3L A;  4XPK A;  1RO5 A;  2BEI A;  2QIR A;  1Z4R A;  2I79 A;  4B5O A;  4NF1 A;  2VXK A;  1XEB A;  2J8R A;  4JXR A;  1M44 A;  2DXQ A;  4JLY A;  3S6G A;  2ATR A;  2VZZ A;  3IWG A;  2HV2 A;  4HNX B;  4AVA A;  1P0H A;  4OLL A;  3GYA A;  3DR8 A;  5F48 A;  2BUE A;  4U9Y A;  3JTK A;  1NE9 A;  3A9L A;  4KOT A;  3W91 A;  4KOW A;  4MI4 A;  1YGH A;  1ON0 A;  3DDD A;  3FRM A;  2Q0Y A;  2RC4 A;  4FD5 A;  2PC1 A;  3P2H A;  1YR0 A;  3EXN A;  5G20 A;  4HNW B;  2R8V A;  4PV6 A;  5CNP A;  2AJ6 A;  4NCZ A;  1NSL A;  4CGP A;  2A4N A;  4B11 A;  3R9E A;  1SQH A;  2JDC A;  4IUS A;  5AG4 A;  3F0A A;  2FS5 A;  1S7L A;  2B4D B;  1MJA A;  1P4N A;  3F8K A;  1IIC A;  4KLW A;  4NSQ A;  1XMT A;  5F46 A;  3R9G A;  1YVO A;  2GAN A;  1YRE A;  5C88 A;  4XPL A;  3H5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...