4YFJA

Crystal structure of aminoglycoside acetyltransferase aac(3)-ib
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
SIIATVKIGPDEISAMRAVLDLFGKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPRTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 3'-N-acetyltransferase
publication title Crystal structure of aminoglycoside acetyltransferase AAC(3)-Ib
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yfjA00
4KVXA 1U6MA 1XE4A 1IICA 1I21A 1WWZA 4KUBA 4KLVA 3C26A 4OLLA 3DNSA 1QSTA 2OZHA 1YR0A 4KOSA 2Z11A 3FIXA 4MY0A 2PR8A 3T90A 3DR6A 4E2AA 4EVYA 2JEVA 3PGPA 2ZPAA 3WR7A 1B6BA 3EFAA 3T9YA 4LUAA 4Y49C 1S60A 5JPHA 1SQHA 3DDDA 2FS5A 1Z4RA 5KTCA 2G0BA 4OAEA 4B5PA 4MJ8A 2G3AA 4B5PB 2FT0A 1MJ9A 2PC1A 3GY9A 4AVAA 4UBRA 1Y7RA 2K5TA 1M1DA 2HV2A 1Q2DA 1PUAA 2PQ8A 2O28A 2CNSA 2JDCA 1OZPA 1P0HA 4M3SA 2AJ6A 3B8GA 3OWCA 4MHDA 1Y9WA 3S6FA 4R9MA 4QUSA 1XIXA 1Z4EA 4RS2A 4DNCA 3W6SA 4NXYA 4YGOA 2FIAA 4JJXA 5C88A 5J8CA 2DXQA 4UWIA 1BOBA 4XPLA 1KUXA 4II9A 2OZUA 1XEBA 3S6GA 1KZFA 4ONUA 4U9ZA 2P0WA 2VEZA 3IGRA 3D2MA 3V8IA 2A4NA 4BMHA 5KTDA 3TOAA 3F0AA 5IB0A 3TTHA 4E0AA 4KLWA 5F47A 1M44A 1TIQA 2PRBA 1PU9A 3VWDA 2OU2A 3MGDA 2J8NA 4XNHB 2Q0YA 3CXSA 2VZYA 2GANA 2P6EA 4XPDB 4AB7A 3QB8A 1B87A 4PV6A 1J4JA 3TO9A 1S5KA 2HQYA 4X5KA 2Q4YA 5JQ4A 2FXFA 1VHSA 4MBUA 4M85A 3R9FA 2P6GA 2FE7A 4KUAA 5H84A 2X7BA 3FB3A 5DWMA 3PZJA 3BJ7A 2J8RA 2ZXVA 2PR1A 4HNYB 2OB0A 5H86A 1QSNA 2Q04A 2H5MA 3G3SA 4KORA 2CNTA 2PSWA 1V0CA 4UWJA 3UY5A 3H4QA 1XF8A 1Y9KA 1QSOA 2BUEA 2B58A 5E96A 5F49A 4L8AA 1S7NA 4FD7A 3F8KA 2QECA 2ZW6A 3TFYA 4KOVA 1YVOA 4PSWA 4PK3A 4XNHC 2G3TA 1Q2YA 5FVJA 4I49A 2RC4A 4XPDC 3I3GA 3W91A 1M4IA 1S7LA 3EXNA 3TE4A 2AE6A 2D4PA 2WPXA 4JXQA 3JVNA 3R9GA 4F0YA 3SXOA 1IYLA 2EVNA 4JXRA 4JD6A 3LODA 3ZZIA 2VXKA 4K30A 3EC4A 4HNWB 4H6UA 3S6HA 2ZW5A 1YLEA 1P4NA 1YK3A 3LD2A 4ORFA 4HKFA 5HH1A 3G8WA 3JUWA 1GHEA 1LRZA 1CJWA 3FNCA 5KTAA 1MJBA 3FYNA 3D8PA 2GIVA 1QSMA 2ARHA 2Q44A 1RO5A 1WK4A 1MJAA 2NMTA 2OH1A 3E0KA 4JLYA 4CS0B 2ZW7A 4OADA 3P2FA 1M4DA 3P2HA 2R98A 4E8OA 4J3GA 1ON0A 2ZW4A 4NCZA 2R1IA 3BJ8A 2Z0ZA 2IL4A 3TT2A 3CXQA 3GKRA 1S3ZA 4KOWA 4FD6A 4KOTA 3PP9A 4CAWA 4QVTA 4KZTA 5IV0A 1K4JA 2ATRA 1IB1E 2BSWA 5EC4A 4AG9A 1CM0A 3FRMA 4R3LA 2Z10A 4F6AA 4KVME 5GCNA 5DWNA 1KUYA 2CNMA 4FD5A 2B5GA 4QBJA 4NEXA 4KOYA 2B5GB 4U9YA 5I0CA 1M4GA 2D4OA 3R9EA 4R87A 1MK4A 3CXPA 2C27A 3IWGA 1KUVA 3TCVA 4B5OA 1Q2CA 2EUIA 4JWPA 3EO4A 3RYOA 2J8MA 1I1DA 1YX0A 1S7KA 3BLNA 4IF5A 4NSQA 2Q4VA 4MY3A 3ZJ0A 5EBVA 1RXTA 4XPKA 3NE7A 3SHPA 4IUSA 2QMLA 1Z9UA 3GYAA 3R96A 2B3VA 3W6XA 2REFA 4R3KA 2OZGA 2Q7BA 2R8VA 3EY5A 2FL4A 5F46A 3DR8A 3S6KA 2FSRA 2VQYA 3TO7A 4H89A 4U5YA 1NMTA 4YFJA 4UA3A 5HMNA 1NE9A 4AG7A 3VWEA 2KCWA 3N7ZA 4RI1A 4ZBGA 2P6FA 3TO6A 1S7FA 4KVOE 2CY2A 2JLMA 4HNXB 2VI7A 1UFHA 1R57A 2VBQA 4CAVA 3K9UA 5J8FA 3QAHA 4R57A 1IYKA 1VKCA 4FD4A 3F5BA 4CRZB 3R95A 3KKWA 2WPWA 4AVCA 3FBUA 3SXNA 3DSBA 3I9SA 2I79A 2I00A 1YGHA 1QSRA 2Y0MA 4KOUA 4PSXA 4GS4A 1XMTA 3FXTA 4AVBA 3TOBA 5IX3A 2F5IA 5C82A 4NF1A 4KOXA 4LX9A 2B4DA 2B4BA 2QIRA 4YRHA 4L89A 5ISVA 2B4DB 1I12A 2R7HA 2FIWA 4MI4A 2GE3A 4CAXA 3D2PA 2VZZA 3R1KA 1IIDA 4Y49B 4PK2A 4QC6A 1L0CA 1BO4A 1FY7A 2JDDA 5CNPA 4QB9A 2HUZA 5F48A 2BL1A 2REEA 2B3UA 1NSLA 4CRYB 1N71A 4H6ZA 1YREA 2BEIA 2FCKA 3D3SA 2PDOA 1YVKA
chains in the Genus database with same CATH superfamily
4KVXA 3VATA 4A33A 5IB9A 3FMCA 3PFOA 5HVFA 1U6MA 1XE4A 1XFOA 1IICA 4KS9A 1I21A 4IHMA 1WWZA 4HPSA 3T8WA 4KUBA 3CZXA 5K8NA 4KLVA 2BCOA 2ABZA 3C26A 1LCPA 4OLLA 2XEFA 1QSTA 3DNSA 2OZHA 1IU8A 1BPMA 1YR0A 3K9TA 4A31A 4KOSA 2Z11A 3IU1A 3FIXA 4MY0A 3FEDA 1LFWA 4OC4A 3KI9A 2NSMA 2PR8A 5G1ZA 3B7IA 3T90A 3DR6A 4E2AA 4UEZA 2Q51A 4EVYA 3D66A 2JEVA 3PBEA 2ZPAA 3PGPA 2WSAA 3WR7A 1B6BA 1JQGA 1H8LA 3EFAA 4MCRA 3T9YA 4LUAA 4Y49C 2XEGA 1S60A 5JPHA 1SQHA 2ZEEA 3DDDA 3FH4A 4B10A 2FS5A 4CYQA 1KWMA 1Z4RA 3FF3A 1XJOA 3D68A 2PIYA 2PJ4A 4R7MA 4A39A 4EWTA 5KTCA 2G0BA 4NFRA 4NJQA 4OAEA 4F8ZA 1TKHA 1YLOA 2C6PA 4LQ6A 4MJ8A 2G3AA 3B3WA 4B5PA 3D7DA 4CPAA 1YW6A 2C1CA 1AYEA 3B3CA 4P4JA 4H2KA 4B5PB 2FT0A 2WZNA 1Y0YA 3SJGA 4NGMA 1MJ9A 2PC1A 3GY9A 4AVAA 4UBRA 5I4MA 3LACA 4O23A 4MHPA 4G1PA 1X12A 1Y7RA 2K5TA 5AGEA 2HC9A 3ISXA 1M1DA 1Y7EA 5CBMA 2ZENA 4DYOA 2HV2A 3KASA 1ZG9A 1Q2DA 2ZEPA 2EBJA 4PXDA 1VHEA 1PUAA 4KSIA 2PQ8A 2O28A 2CNSA 2JDCA 1OZPA 1P0HA 4M3SA 2AJ6A 3B8GA 4UIAA 1F2OA 2Z3NA 3OWCA 4MHDA 4GXHA 1Y9WA 3S6FA 4R9MA 4QUSA 1XIXA 1Z4EA 4RS2A 5D29A 1ZLHA 3W6SA 4B13A 4DNCA 4NXYA 4YGOA 2FIAA 4JJXA 5C88A 4C7HA 5J8CA 2PVVA 2DXQA 1AUGA 4UWIA 4C2YA 4CGLA 1BOBA 2J9AA 3SJFA 4MCQA 2CF4A 4XPLA 4MHYA 1KUXA 2POKA 4KSAA 3WABA 5LRKA 2PJ5A 4II9A 2OZUA 1XEBA 5JGFA 1TF9A 3BI1A 3S6GA 3SI2A 1DTDA 1VGYA 1KZFA 1LAMA 2WUUA 4ONUA 2F8HA 4U9ZA 2I3CA 2PCUA 4M6GA 4F0XA 2YNEA 2BO9A 1Z8XA 2P0WA 2VEZA 2EO8A 1Q7LA 2JBJA 3GUXA 3IGRA 5LRGA 2C6CA 3D2MA 3V8IA 4B11A 4DJLA 2A4NA 3IO1A 4BMHA 4MCPA 1YQEA 5KTDA 3TOAA 3F0AA 1XMBA 2YGWA 4UFWA 5IB0A 3FJUA 3TTHA 4E0AA 4KLWA 5F47A 1M44A 3A9LA 1TIQA 1BPNA 2PRBA 3S9LA 4LQGA 4ZY1A 3SJXA 4EFDA 2EK9A 2PJ0A 1PU9A 3VWDA 2EK8A 3KHXA 2Z3KA 2OU2A 3B3TA 3MGDA 2J8NA 5A28A 4XNHB 1YSJA 4MMOA 3KL9A 2Q0YA 3GB0A 2YNCA 3CXSA 2VZYA 2GANA 2DF5A 2P6EA 4ZY2A 5LYDA 2Z3LA 3MRUA 4MCSA 1XRYA 3S9MA 4OC1A 4XPDB 2FVGA 4AB7A 3QB8A 1B87A 4R8FA 4CGNA 3KR5A 4PV6A 1J4JA 3CDXA 3TO9A 7CPAA 1S5KA 2Q43A 2HQYA 4P10A 4X5KA 2Q4YA 4A32A 5JQ4A 1CBXA 3QAYA 2FXFA 1VHSA 4X2TA 4MBUA 4M85A 1IGBA 5LYLA 4IK2A 3H8FA 3R9FA 4B6ZA 3IFEA 2P6GA 2FE7A 3DLJA 4KUAA 5H84A 2DEAA 4C2XA 2GFQA 2X7BA 3FB3A 4A94A 2IJZA 4OC3A 4UFVA 5DWMA 4NGNA 3PZJA 5D8NA 3BJ7A 2G9DA 2J8RA 3FX6A 2JBKA 3RBUA 4NGTA 4P4IA 2ZXVA 2PR1A 1IY7A 4ZX8A 2PJ8A 1M4LA 2OB0A 4HNYB 5H86A 4A37A 1QSNA 4UCNA 2Q04A 2H5MA 2PE3A 3G3SA 2ZEDA 4Q36A 4KORA 2V8VA 2CNTA 2F7VA 2PSWA 1V0CA 4UWJA 4Q7AA 3UY5A 3H4QA 4B12A 3PRTA 5LRJA 1X10A 1XF8A 1Y9KA 2QVPA 1Z8WA 1CPXA 1QSOA 4CGOA 2BUEA 5LYFA 2B58A 3D7GA 4MXUA 5BWAB 5E96A 5F49A 3BHXA 4L8AA 2XEIA 2CTCA 1S7NA 2WYRA 4UEEA 4JYWA 1CP6A 3PB4X 4FD7A 2CIJA 2O53A 3F8KA 1ELLP 3BXMA 2QECA 1XOVA 3RO0A 1CP7A 2ZW6A 3TFYA 4KOVA 1YVOA 4PSWA 4PK3A 3KGQA 2Q7SA 4UCPA 3V7ZA 4XNHC 3IU2A 2G3TA 2IQ6A 1BLLE 1Q2YA 3NH8A 4P6YA 2PJ9A 4CAEA 5FVJA 4I49A 4CYPA 2RC4A 4XPDC 3L2NA 3I3GA 3W91A 5HVGA 5K8PA 1M4IA 1S7LA 1ZG7A 3EXNA 3SI0A 3TE4A 2AE6A 2D4PA 4CYNA 1R43A 5THWA 2WPXA 2O4HA 2AFOA 3JVNA 4JXQA 4OC0A 3GLJA 3R9GA 3B35A 1TKFA 3SXOA 4PXBA 4WWVA 4DUKA 4F0YA 3WC6A 3JTKA 3H5ZA 3PB7X 1IYLA 1ZO0A 3B3SA 1NSAA 2EVNA 4JXRA 3DGVA 4JD6A 3LODA 1IOFA 3ZZIA 4BBHA 2OR4A 3FVLA 2VXKA 1LOKA 3GIUA 4K30A 3EC4A 4YU9A 4GM5A 4HNWB 4H6UA 3S6HA 2ZW5A 2QJ8A 2DPTA 1XBUA 3I1UA 3IWWA 1YLEA 1P4NA 1YK3A 3KZWA 5AG7A 1UWYA 3LD2A 4ORFA 4HKFA 3WC7A 5HVHA 5HH1A 3G8WA 3JUWA 2ZOFA 4A30A 3CPXA 3PBBA 2GLFA 1GHEA 1LRZA 1FT7A 1JWQA 3S9NA 1CJWA 3FNCA 4R6TA 5KTAA 4CAFA 1DE4C 1MJBA 3FYNA 1LAPA 2PJ1A 4OC5A 4ZYQA 3D8PA 2AFSA 6CPAA 2GIVA 3K2KA 1CX8A 1QSMA 2ZOGA 2ZEOA 2ARHA 5K8OA 1QQ9A 2Q44A 4UCMA 1RO5A 3NFZA 2RFHA 2V77A 5AG4A 1WK4A 1MJAA 2NMTA 3ISZA 3PFEA 4MFKA 2OH1A 1CPSA 3E0KA 4JZ0A 5DS0A 4JLYA 3KQXA 1R3NA 4CS0B 4A95A 3BI0A 1Z2LA 2PIZA 5HXDA 2ZW7A 1QMUA 4OADA 5AG6A 3P2FA 1ELMP 1M4DA 3P2HA 2ZEFA 4MRIA 2R98A 4E8OA 2Z3OA 4B14A 5G21A 4J3GA 1ON0A 2ZW4A 4FWUA 1HEEA 4NCZA 2ZELA 2R1IA 1Y0RA 3BJ8A 3D7HA 2Z0ZA 2IL4A 5K8MA 2NYQA 3D4UA 1OBRA 3TT2A 2GU2A 2PJAA 4F9VA 1FNOA 4NGRA 4OP4A 4UF4A 2V8HA 3CXQA 3GKRA 3KQZA 1S3ZA 4KOWA 3RZAA 1ARMA 4FD6A 4NGSA 1F57A 4KOTA 3PP9A 1LANA 4QVTA 4CAWA 4KZTA 1TF8A 4C2ZA 5IV0A 1K4JA 2ATRA 2Z3MA 1IB1E 2BSWA 3SI1A 5EC4A 1VHOA 2VL1A 3PB6X 4AG9A 1CM0A 3FRMA 4MHZA 4R3LA 2Z10A 3D7FA 4MFPA 4KSFA 4F6AA 2PJ3A 1IOIA 3HLPA 4KVME 5GCNA 5DWNA 1VIXA 5CPAA 4F9UA 1KUYA 2CNMA 4FD5A 2B5GA 3MN8A 4FAIA 4QBJA 4NEXA 4KOYA 4MHNA 2B5GB 4U9YA 5I0CA 1M4GA 4FBEA 1HDUA 2D4OA 3R9EA 4R87A 4PQAA 4PPZA 1MK4A 2ZEHA 3CXPA 3H8EA 1HDQA 2C27A 2ODFA 3IJ3A 3IWGA 1KUVA 2OOTA 3TCVA 1Q2CA 4B5OA 2EUIA 8CPAA 2AFZA 2XEJA 1F2PA 4JWPA 4OIDA 3EO4A 2HB6A 1Z5RA 3D67A 2J8MA 1I1DA 3RYOA 1YX0A 4CYOA 1S7KA 3BLNA 4IF5A 4NSQA 4RN7A 5AG5A 2Q4VA 4MY3A 1EE3P 3ZJ0A 2IMOA 4Q38A 4P4EA 4YWYA 3KHZA 5EBVA 3PEIA 3FEEA 4P4BA 3IC1A 2YNCC 3TX8A 4Z65A 1RXTA 5G20A 4XPKA 3NE7A 3SHPA 4A38A 4IUSA 2QMLA 1Z8LA 1Z9UA 3GYAA 3R96A 2B3VA 4FUUA 2GREA 3W6XA 2REFA 4R3KA 5JM6A 2OZGA 2Q7BA 2R8VA 3EY5A 2FL4A 4PXEA 4C7IA 5F46A 3DR8A 2BOAA 2RB7A 3RNZA 3S6KA 4EMEA 2AFMA 2FSRA 4TNUA 2ANPA 2VQYA 3PB8X 4NJRA 3TO7A 4H89A 4U5YA 1NMTA 4YFJA 4MFQA 4UA3A 5HMNA 4NGQA 4BINA 1NE9A 4P4DA 3FECA 3HUVA 3VWEA 2KCWA 2V8DA 3N7ZA 4AG7A 4RUHA 3N5FA 2PRQA 3CT9A 4RI1A 2AFXA 4MFZA 4ZBGA 2P6FA 3TO6A 2QYVA 1ZLIA 2GLJA 1S7FA 4ZGYB 4KVOE 2C6GA 1RTQA 3NH5A 2CY2A 2JLMA 4ZI6A 3H8GA 1TXRA 4HNXB 2VI7A 1UFHA 3TC8A 1Z8TA 1R57A 3LMSA 3PB9X 2VBQA 4CAVA 1AMPA 1ARLA 4BD9A 3K9UA 4OIWA 5J8FA 2EWBA 3QAHA 4R57A 1IYKA 1VKCA 4FD4A 3F5BA 5LYIA 2PJ2A 2PVWA 4CRZB 2V8GA 3R95A 1CG2A 5F09A 3KKWA 2WPWA 4AVCA 3IWEA 4K3NA 3FBUA 3B3VA 3SXNA 3DSBA 3I9SA 2AFWA 4X3RA 1TKJA 2I79A 3IEHA 2PJ7A 4M6IA 1YW4A 3RAMA 2I00A 3LWUA 1YGHA 4OC2A 1QSRA 2Y0MA 4KOUA 4PSXA 4GS4A 3WC5A 2YNDA 1XMTA 1GYTA 5ELYA 2CXAA 1A2ZA 3FXTA 4MFLA 3TOBA 4IAVA 4AVBA 4ZY0A 2DPSA 5IX3A 1PYTB 3NH4A 2F5IA 5JH9A 4NGPA 3VARA 5C82A 4CGPA 4NF1A 3NA6A 3QNVA 2PJ6A 4UFXA 1PCAA 4ONWA 4KOXA 4CGMA 2JEWA 4M6HA 4OKOA 4LX9A 2B4DA 2Q4ZA 5EMIA 3CPAA 2B4BA 2PJBA 3V38A 2QIRA 4YRHA 4L89A 5ISVA 4P4FA 5A27A 2B4DB 1I12A 2R7HA 4AXVA 2FIWA 3IIBA 4MI4A 4OMEA 5G22A 2GE3A 3SJEA 4WJBA 4CAXA 3D2PA 4TWEA 2VZZA 3R1KA 1IIDA 4X8IA 4Y49B 4C68A 4P44A 4W9YA 4PK2A 3NE8A 4QC6A 2ZEGA 3WT4A 2ZEMA 1L0CA 1BAVA 2AFUA 1BO4A 3KR4A 4MFJA 4UIBA 2PJCA 1FY7A 3B2YA 2JDDA 4P45A 5CNPA 3JRUA 5J1QA 4QB9A 2HUZA 3VH9A 4A2ZA 5F48A 4UEFA 1ZG8A 2BL1A 2B3UA 1YMEA 2REEA 4PXCA 1NSLA 4CRYB 1N71A 4H6ZA 2CTBA 4R76A 1YREA 2BEIA 2FCKA 3D3SA 2PDOA 4ZX9A 2Z3PA 1YVKA
chains in the Genus database with same CATH topology
4KVXA 4A33A 1U6MA 1XE4A 1IICA 4KS9A 1I21A 1WWZA 4KUBA 4KLVA 3C26A 4OLLA 3DNSA 1QSTA 2OZHA 1YR0A 4A31A 4KOSA 2Z11A 3IU1A 3FIXA 4MY0A 2PR8A 5G1ZA 3T90A 3DR6A 4E2AA 4EVYA 2JEVA 3PGPA 2ZPAA 2WSAA 3WR7A 1B6BA 3EFAA 3T9YA 4LUAA 4Y49C 1S60A 5JPHA 1SQHA 4B10A 3DDDA 2FS5A 4CYQA 1Z4RA 5KTCA 2G0BA 4OAEA 4B5PA 4MJ8A 2G3AA 4B5PB 2FT0A 1MJ9A 2PC1A 3GY9A 4AVAA 4UBRA 1Y7RA 2K5TA 5AGEA 1M1DA 2HV2A 1Q2DA 1PUAA 2PQ8A 2O28A 2CNSA 2JDCA 1OZPA 1P0HA 4M3SA 2AJ6A 3B8GA 2Z3NA 3OWCA 4MHDA 1Y9WA 3S6FA 4R9MA 4QUSA 1XIXA 1Z4EA 4RS2A 4DNCA 3W6SA 4B13A 4NXYA 4YGOA 2FIAA 4JJXA 5C88A 4C7HA 5J8CA 2DXQA 4UWIA 4C2YA 4CGLA 1BOBA 4XPLA 1KUXA 4KSAA 4II9A 2OZUA 1XEBA 3S6GA 1KZFA 2WUUA 4ONUA 4U9ZA 4F0XA 2YNEA 2P0WA 2VEZA 3IGRA 4B11A 3D2MA 3V8IA 2A4NA 4BMHA 5KTDA 3TOAA 3F0AA 2YGWA 4UFWA 5IB0A 3TTHA 4E0AA 4KLWA 5F47A 1M44A 3A9LA 1TIQA 2PRBA 1PU9A 3VWDA 2Z3KA 2OU2A 3MGDA 2J8NA 5A28A 4XNHB 2Q0YA 2YNCA 3CXSA 2VZYA 2GANA 2P6EA 2Z3LA 4XPDB 4AB7A 3QB8A 1B87A 4CGNA 4PV6A 1J4JA 3TO9A 1S5KA 2HQYA 4X5KA 2Q4YA 4A32A 5JQ4A 2FXFA 1VHSA 4MBUA 4M85A 3R9FA 4C2XA 2P6GA 2FE7A 4KUAA 5H84A 2X7BA 3FB3A 5DWMA 4UFVA 3PZJA 3BJ7A 2J8RA 2ZXVA 2PR1A 4HNYB 2OB0A 5H86A 1QSNA 4UCNA 2Q04A 2H5MA 3G3SA 4Q36A 4KORA 2CNTA 2PSWA 1V0CA 4UWJA 3UY5A 4B12A 3H4QA 1XF8A 1Y9KA 1QSOA 4CGOA 2BUEA 2B58A 5BWAB 5E96A 5F49A 4L8AA 1S7NA 4FD7A 3F8KA 2QECA 2ZW6A 3TFYA 4KOVA 1YVOA 4PSWA 4PK3A 4UCPA 4XNHC 3IU2A 2G3TA 1Q2YA 4CAEA 5FVJA 4I49A 4CYPA 2RC4A 4XPDC 3I3GA 3W91A 1M4IA 1S7LA 3EXNA 3TE4A 2AE6A 2D4PA 4CYNA 2WPXA 4JXQA 3JVNA 3R9GA 4F0YA 3SXOA 3JTKA 3H5ZA 1IYLA 1ZO0A 2EVNA 4JXRA 4JD6A 3LODA 3ZZIA 4BBHA 2VXKA 4K30A 3EC4A 4HNWB 4H6UA 3S6HA 2ZW5A 2DPTA 1YLEA 1P4NA 1YK3A 5AG7A 3LD2A 4ORFA 4HKFA 5HH1A 3G8WA 3JUWA 4A30A 1GHEA 1LRZA 1CJWA 3FNCA 5KTAA 4CAFA 1MJBA 3FYNA 3D8PA 2GIVA 1QSMA 2ARHA 2Q44A 4UCMA 1RO5A 5AG4A 1WK4A 1MJAA 2NMTA 4MFKA 2OH1A 3E0KA 4JLYA 4CS0B 4A95A 2ZW7A 4OADA 5AG6A 3P2FA 1M4DA 3P2HA 2R98A 4E8OA 2Z3OA 4B14A 5G21A 4J3GA 1ON0A 2ZW4A 4NCZA 2R1IA 3BJ8A 2Z0ZA 2IL4A 3TT2A 3CXQA 3GKRA 1S3ZA 4KOWA 4FD6A 4KOTA 3PP9A 4CAWA 4QVTA 4KZTA 4C2ZA 5IV0A 1K4JA 2ATRA 2Z3MA 1IB1E 2BSWA 5EC4A 4AG9A 1CM0A 3FRMA 4R3LA 2Z10A 4MFPA 4KSFA 4F6AA 4KVME 5GCNA 5DWNA 1KUYA 2CNMA 4FD5A 2B5GA 4QBJA 4NEXA 4KOYA 2B5GB 4U9YA 5I0CA 1M4GA 2D4OA 3R9EA 4R87A 1MK4A 3CXPA 2C27A 3IWGA 1KUVA 3TCVA 4B5OA 1Q2CA 2EUIA 4JWPA 3EO4A 3RYOA 2J8MA 1I1DA 1YX0A 4CYOA 1S7KA 3BLNA 4IF5A 4NSQA 5AG5A 2Q4VA 4MY3A 3ZJ0A 4Q38A 5EBVA 2YNCC 1RXTA 5G20A 4XPKA 3NE7A 3SHPA 4IUSA 2QMLA 1Z9UA 3GYAA 3R96A 2B3VA 3W6XA 2REFA 4R3KA 2OZGA 2Q7BA 2R8VA 3EY5A 2FL4A 4C7IA 5F46A 3DR8A 3S6KA 2FSRA 2VQYA 3TO7A 4H89A 4U5YA 1NMTA 4YFJA 4MFQA 4UA3A 5HMNA 1NE9A 4AG7A 3VWEA 2KCWA 3N7ZA 4RI1A 4ZBGA 4MFZA 2P6FA 3TO6A 1S7FA 4ZGYB 4KVOE 2CY2A 2JLMA 4HNXB 2VI7A 1UFHA 1R57A 2VBQA 4CAVA 3K9UA 5J8FA 3QAHA 4R57A 1IYKA 1VKCA 4FD4A 3F5BA 4CRZB 3R95A 3KKWA 2WPWA 4AVCA 3IWEA 3FBUA 3SXNA 3DSBA 3I9SA 2I79A 2I00A 1YGHA 1QSRA 2Y0MA 4KOUA 4PSXA 4GS4A 2YNDA 1XMTA 2CXAA 3FXTA 4MFLA 4AVBA 3TOBA 5IX3A 2DPSA 2F5IA 5C82A 4CGPA 4NF1A 4UFXA 4KOXA 4CGMA 4LX9A 2B4DA 2B4BA 2QIRA 4YRHA 4L89A 5ISVA 5A27A 2B4DB 1I12A 2R7HA 2FIWA 4MI4A 5G22A 2GE3A 4CAXA 3D2PA 2VZZA 3R1KA 1IIDA 4Y49B 4C68A 4PK2A 4QC6A 1L0CA 4MFJA 1BO4A 1FY7A 2JDDA 5CNPA 4QB9A 2HUZA 4A2ZA 5F48A 2BL1A 2REEA 2B3UA 1NSLA 4CRYB 1N71A 4H6ZA 1YREA 2BEIA 2FCKA 3D3SA 2PDOA 2Z3PA 1YVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVX A;  1U6M A;  1XE4 A;  1IIC A;  1I21 A;  1WWZ A;  4KUB A;  4KLV A;  3C26 A;  4OLL A;  3DNS A;  1QST A;  2OZH A;  1YR0 A;  4KOS A;  2Z11 A;  3FIX A;  4MY0 A;  2PR8 A;  3T90 A;  3DR6 A;  4E2A A;  4EVY A;  2JEV A;  3PGP A;  2ZPA A;  3WR7 A;  1B6B A;  3EFA A;  3T9Y A;  4LUA A;  4Y49 C;  1S60 A;  5JPH A;  1SQH A;  3DDD A;  2FS5 A;  1Z4R A;  5KTC A;  2G0B A;  4OAE A;  4B5P A;  4MJ8 A;  2G3A A;  4B5P B;  2FT0 A;  1MJ9 A;  2PC1 A;  3GY9 A;  4AVA A;  4UBR A;  1Y7R A;  2K5T A;  1M1D A;  2HV2 A;  1Q2D A;  1PUA A;  2PQ8 A;  2O28 A;  2CNS A;  2JDC A;  1OZP A;  1P0H A;  4M3S A;  2AJ6 A;  3B8G A;  3OWC A;  4MHD A;  1Y9W A;  3S6F A;  4R9M A;  4QUS A;  1XIX A;  1Z4E A;  4RS2 A;  4DNC A;  3W6S A;  4NXY A;  4YGO A;  2FIA A;  4JJX A;  5C88 A;  5J8C A;  2DXQ A;  4UWI A;  1BOB A;  4XPL A;  1KUX A;  4II9 A;  2OZU A;  1XEB A;  3S6G A;  1KZF A;  4ONU A;  4U9Z A;  2P0W A;  2VEZ A;  3IGR A;  3D2M A;  3V8I A;  2A4N A;  4BMH A;  5KTD A;  3TOA A;  3F0A A;  5IB0 A;  3TTH A;  4E0A A;  4KLW A;  5F47 A;  1M44 A;  1TIQ A;  2PRB A;  1PU9 A;  3VWD A;  2OU2 A;  3MGD A;  2J8N A;  4XNH B;  2Q0Y A;  3CXS A;  2VZY A;  2GAN A;  2P6E A;  4XPD B;  4AB7 A;  3QB8 A;  1B87 A;  4PV6 A;  1J4J A;  3TO9 A;  1S5K A;  2HQY A;  4X5K A;  2Q4Y A;  5JQ4 A;  2FXF A;  1VHS A;  4MBU A;  4M85 A;  3R9F A;  2P6G A;  2FE7 A;  4KUA A;  5H84 A;  2X7B A;  3FB3 A;  5DWM A;  3PZJ A;  3BJ7 A;  2J8R A;  2ZXV A;  2PR1 A;  4HNY B;  2OB0 A;  5H86 A;  1QSN A;  2Q04 A;  2H5M A;  3G3S A;  4KOR A;  2CNT A;  2PSW A;  1V0C A;  4UWJ A;  3UY5 A;  3H4Q A;  1XF8 A;  1Y9K A;  1QSO A;  2BUE A;  2B58 A;  5E96 A;  5F49 A;  4L8A A;  1S7N A;  4FD7 A;  3F8K A;  2QEC A;  2ZW6 A;  3TFY A;  4KOV A;  1YVO A;  4PSW A;  4PK3 A;  4XNH C;  2G3T A;  1Q2Y A;  5FVJ A;  4I49 A;  2RC4 A;  4XPD C;  3I3G A;  3W91 A;  1M4I A;  1S7L A;  3EXN A;  3TE4 A;  2AE6 A;  2D4P A;  2WPX A;  4JXQ A;  3JVN A;  3R9G A;  4F0Y A;  3SXO A;  1IYL A;  2EVN A;  4JXR A;  4JD6 A;  3LOD A;  3ZZI A;  2VXK A;  4K30 A;  3EC4 A;  4HNW B;  4H6U A;  3S6H A;  2ZW5 A;  1YLE A;  1P4N A;  1YK3 A;  3LD2 A;  4ORF A;  4HKF A;  5HH1 A;  3G8W A;  3JUW A;  1GHE A;  1LRZ A;  1CJW A;  3FNC A;  5KTA A;  1MJB A;  3FYN A;  3D8P A;  2GIV A;  1QSM A;  2ARH A;  2Q44 A;  1RO5 A;  1WK4 A;  1MJA A;  2NMT A;  2OH1 A;  3E0K A;  4JLY A;  4CS0 B;  2ZW7 A;  4OAD A;  3P2F A;  1M4D A;  3P2H A;  2R98 A;  4E8O A;  4J3G A;  1ON0 A;  2ZW4 A;  4NCZ A;  2R1I A;  3BJ8 A;  2Z0Z A;  2IL4 A;  3TT2 A;  3CXQ A;  3GKR A;  1S3Z A;  4KOW A;  4FD6 A;  4KOT A;  3PP9 A;  4CAW A;  4QVT A;  4KZT A;  5IV0 A;  1K4J A;  2ATR A;  1IB1 E;  2BSW A;  5EC4 A;  4AG9 A;  1CM0 A;  3FRM A;  4R3L A;  2Z10 A;  4F6A A;  4KVM E;  5GCN A;  5DWN A;  1KUY A;  2CNM A;  4FD5 A;  2B5G A;  4QBJ A;  4NEX A;  4KOY A;  2B5G B;  4U9Y A;  5I0C A;  1M4G A;  2D4O A;  3R9E A;  4R87 A;  1MK4 A;  3CXP A;  2C27 A;  3IWG A;  1KUV A;  3TCV A;  4B5O A;  1Q2C A;  2EUI A;  4JWP A;  3EO4 A;  3RYO A;  2J8M A;  1I1D A;  1YX0 A;  1S7K A;  3BLN A;  4IF5 A;  4NSQ A;  2Q4V A;  4MY3 A;  3ZJ0 A;  5EBV A;  1RXT A;  4XPK A;  3NE7 A;  3SHP A;  4IUS A;  2QML A;  1Z9U A;  3GYA A;  3R96 A;  2B3V A;  3W6X A;  2REF A;  4R3K A;  2OZG A;  2Q7B A;  2R8V A;  3EY5 A;  2FL4 A;  5F46 A;  3DR8 A;  3S6K A;  2FSR A;  2VQY A;  3TO7 A;  4H89 A;  4U5Y A;  1NMT A;  4YFJ A;  4UA3 A;  5HMN A;  1NE9 A;  4AG7 A;  3VWE A;  2KCW A;  3N7Z A;  4RI1 A;  4ZBG A;  2P6F A;  3TO6 A;  1S7F A;  4KVO E;  2CY2 A;  2JLM A;  4HNX B;  2VI7 A;  1UFH A;  1R57 A;  2VBQ A;  4CAV A;  3K9U A;  5J8F A;  3QAH A;  4R57 A;  1IYK A;  1VKC A;  4FD4 A;  3F5B A;  4CRZ B;  3R95 A;  3KKW A;  2WPW A;  4AVC A;  3FBU A;  3SXN A;  3DSB A;  3I9S A;  2I79 A;  2I00 A;  1YGH A;  1QSR A;  2Y0M A;  4KOU A;  4PSX A;  4GS4 A;  1XMT A;  3FXT A;  4AVB A;  3TOB A;  5IX3 A;  2F5I A;  5C82 A;  4NF1 A;  4KOX A;  4LX9 A;  2B4D A;  2B4B A;  2QIR A;  4YRH A;  4L89 A;  5ISV A;  2B4D B;  1I12 A;  2R7H A;  2FIW A;  4MI4 A;  2GE3 A;  4CAX A;  3D2P A;  2VZZ A;  3R1K A;  1IID A;  4Y49 B;  4PK2 A;  4QC6 A;  1L0C A;  1BO4 A;  1FY7 A;  2JDD A;  5CNP A;  4QB9 A;  2HUZ A;  5F48 A;  2BL1 A;  2REE A;  2B3U A;  1NSL A;  4CRY B;  1N71 A;  4H6Z A;  1YRE A;  2BEI A;  2FCK A;  3D3S A;  2PDO A;  1YVK A; 
#chains in the Genus database with same CATH topology
 4KVX A;  3VAT A;  4A33 A;  5IB9 A;  3FMC A;  3PFO A;  5HVF A;  1U6M A;  1XE4 A;  1XFO A;  1IIC A;  4KS9 A;  1I21 A;  4IHM A;  1WWZ A;  4HPS A;  3T8W A;  4KUB A;  3CZX A;  5K8N A;  4KLV A;  2BCO A;  2ABZ A;  3C26 A;  1LCP A;  4OLL A;  2XEF A;  1QST A;  3DNS A;  2OZH A;  1IU8 A;  1BPM A;  1YR0 A;  3K9T A;  4A31 A;  4KOS A;  2Z11 A;  3IU1 A;  3FIX A;  4MY0 A;  3FED A;  1LFW A;  4OC4 A;  3KI9 A;  2NSM A;  2PR8 A;  5G1Z A;  3B7I A;  3T90 A;  3DR6 A;  4E2A A;  4UEZ A;  2Q51 A;  4EVY A;  3D66 A;  2JEV A;  3PBE A;  2ZPA A;  3PGP A;  2WSA A;  3WR7 A;  1B6B A;  1JQG A;  1H8L A;  3EFA A;  4MCR A;  3T9Y A;  4LUA A;  4Y49 C;  2XEG A;  1S60 A;  5JPH A;  1SQH A;  2ZEE A;  3DDD A;  3FH4 A;  4B10 A;  2FS5 A;  4CYQ A;  1KWM A;  1Z4R A;  3FF3 A;  1XJO A;  3D68 A;  2PIY A;  2PJ4 A;  4R7M A;  4A39 A;  4EWT A;  5KTC A;  2G0B A;  4NFR A;  4NJQ A;  4OAE A;  4F8Z A;  1TKH A;  1YLO A;  2C6P A;  4LQ6 A;  4MJ8 A;  2G3A A;  3B3W A;  4B5P A;  3D7D A;  4CPA A;  1YW6 A;  2C1C A;  1AYE A;  3B3C A;  4P4J A;  4H2K A;  4B5P B;  2FT0 A;  2WZN A;  1Y0Y A;  3SJG A;  4NGM A;  1MJ9 A;  2PC1 A;  3GY9 A;  4AVA A;  4UBR A;  5I4M A;  3LAC A;  4O23 A;  4MHP A;  4G1P A;  1X12 A;  1Y7R A;  2K5T A;  5AGE A;  2HC9 A;  3ISX A;  1M1D A;  1Y7E A;  5CBM A;  2ZEN A;  4DYO A;  2HV2 A;  3KAS A;  1ZG9 A;  1Q2D A;  2ZEP A;  2EBJ A;  4PXD A;  1VHE A;  1PUA A;  4KSI A;  2PQ8 A;  2O28 A;  2CNS A;  2JDC A;  1OZP A;  1P0H A;  4M3S A;  2AJ6 A;  3B8G A;  4UIA A;  1F2O A;  2Z3N A;  3OWC A;  4MHD A;  4GXH A;  1Y9W A;  3S6F A;  4R9M A;  4QUS A;  1XIX A;  1Z4E A;  4RS2 A;  5D29 A;  1ZLH A;  3W6S A;  4B13 A;  4DNC A;  4NXY A;  4YGO A;  2FIA A;  4JJX A;  5C88 A;  4C7H A;  5J8C A;  2PVV A;  2DXQ A;  1AUG A;  4UWI A;  4C2Y A;  4CGL A;  1BOB A;  2J9A A;  3SJF A;  4MCQ A;  2CF4 A;  4XPL A;  4MHY A;  1KUX A;  2POK A;  4KSA A;  3WAB A;  5LRK A;  2PJ5 A;  4II9 A;  2OZU A;  1XEB A;  5JGF A;  1TF9 A;  3BI1 A;  3S6G A;  3SI2 A;  1DTD A;  1VGY A;  1KZF A;  1LAM A;  2WUU A;  4ONU A;  2F8H A;  4U9Z A;  2I3C A;  2PCU A;  4M6G A;  4F0X A;  2YNE A;  2BO9 A;  1Z8X A;  2P0W A;  2VEZ A;  2EO8 A;  1Q7L A;  2JBJ A;  3GUX A;  3IGR A;  5LRG A;  2C6C A;  3D2M A;  3V8I A;  4B11 A;  4DJL A;  2A4N A;  3IO1 A;  4BMH A;  4MCP A;  1YQE A;  5KTD A;  3TOA A;  3F0A A;  1XMB A;  2YGW A;  4UFW A;  5IB0 A;  3FJU A;  3TTH A;  4E0A A;  4KLW A;  5F47 A;  1M44 A;  3A9L A;  1TIQ A;  1BPN A;  2PRB A;  3S9L A;  4LQG A;  4ZY1 A;  3SJX A;  4EFD A;  2EK9 A;  2PJ0 A;  1PU9 A;  3VWD A;  2EK8 A;  3KHX A;  2Z3K A;  2OU2 A;  3B3T A;  3MGD A;  2J8N A;  5A28 A;  4XNH B;  1YSJ A;  4MMO A;  3KL9 A;  2Q0Y A;  3GB0 A;  2YNC A;  3CXS A;  2VZY A;  2GAN A;  2DF5 A;  2P6E A;  4ZY2 A;  5LYD A;  2Z3L A;  3MRU A;  4MCS A;  1XRY A;  3S9M A;  4OC1 A;  4XPD B;  2FVG A;  4AB7 A;  3QB8 A;  1B87 A;  4R8F A;  4CGN A;  3KR5 A;  4PV6 A;  1J4J A;  3CDX A;  3TO9 A;  7CPA A;  1S5K A;  2Q43 A;  2HQY A;  4P10 A;  4X5K A;  2Q4Y A;  4A32 A;  5JQ4 A;  1CBX A;  3QAY A;  2FXF A;  1VHS A;  4X2T A;  4MBU A;  4M85 A;  1IGB A;  5LYL A;  4IK2 A;  3H8F A;  3R9F A;  4B6Z A;  3IFE A;  2P6G A;  2FE7 A;  3DLJ A;  4KUA A;  5H84 A;  2DEA A;  4C2X A;  2GFQ A;  2X7B A;  3FB3 A;  4A94 A;  2IJZ A;  4OC3 A;  4UFV A;  5DWM A;  4NGN A;  3PZJ A;  5D8N A;  3BJ7 A;  2G9D A;  2J8R A;  3FX6 A;  2JBK A;  3RBU A;  4NGT A;  4P4I A;  2ZXV A;  2PR1 A;  1IY7 A;  4ZX8 A;  2PJ8 A;  1M4L A;  2OB0 A;  4HNY B;  5H86 A;  4A37 A;  1QSN A;  4UCN A;  2Q04 A;  2H5M A;  2PE3 A;  3G3S A;  2ZED A;  4Q36 A;  4KOR A;  2V8V A;  2CNT A;  2F7V A;  2PSW A;  1V0C A;  4UWJ A;  4Q7A A;  3UY5 A;  3H4Q A;  4B12 A;  3PRT A;  5LRJ A;  1X10 A;  1XF8 A;  1Y9K A;  2QVP A;  1Z8W A;  1CPX A;  1QSO A;  4CGO A;  2BUE A;  5LYF A;  2B58 A;  3D7G A;  4MXU A;  5BWA B;  5E96 A;  5F49 A;  3BHX A;  4L8A A;  2XEI A;  2CTC A;  1S7N A;  2WYR A;  4UEE A;  4JYW A;  1CP6 A;  3PB4 X;  4FD7 A;  2CIJ A;  2O53 A;  3F8K A;  1ELL P;  3BXM A;  2QEC A;  1XOV A;  3RO0 A;  1CP7 A;  2ZW6 A;  3TFY A;  4KOV A;  1YVO A;  4PSW A;  4PK3 A;  3KGQ A;  2Q7S A;  4UCP A;  3V7Z A;  4XNH C;  3IU2 A;  2G3T A;  2IQ6 A;  1BLL E;  1Q2Y A;  3NH8 A;  4P6Y A;  2PJ9 A;  4CAE A;  5FVJ A;  4I49 A;  4CYP A;  2RC4 A;  4XPD C;  3L2N A;  3I3G A;  3W91 A;  5HVG A;  5K8P A;  1M4I A;  1S7L A;  1ZG7 A;  3EXN A;  3SI0 A;  3TE4 A;  2AE6 A;  2D4P A;  4CYN A;  1R43 A;  5THW A;  2WPX A;  2O4H A;  2AFO A;  3JVN A;  4JXQ A;  4OC0 A;  3GLJ A;  3R9G A;  3B35 A;  1TKF A;  3SXO A;  4PXB A;  4WWV A;  4DUK A;  4F0Y A;  3WC6 A;  3JTK A;  3H5Z A;  3PB7 X;  1IYL A;  1ZO0 A;  3B3S A;  1NSA A;  2EVN A;  4JXR A;  3DGV A;  4JD6 A;  3LOD A;  1IOF A;  3ZZI A;  4BBH A;  2OR4 A;  3FVL A;  2VXK A;  1LOK A;  3GIU A;  4K30 A;  3EC4 A;  4YU9 A;  4GM5 A;  4HNW B;  4H6U A;  3S6H A;  2ZW5 A;  2QJ8 A;  2DPT A;  1XBU A;  3I1U A;  3IWW A;  1YLE A;  1P4N A;  1YK3 A;  3KZW A;  5AG7 A;  1UWY A;  3LD2 A;  4ORF A;  4HKF A;  3WC7 A;  5HVH A;  5HH1 A;  3G8W A;  3JUW A;  2ZOF A;  4A30 A;  3CPX A;  3PBB A;  2GLF A;  1GHE A;  1LRZ A;  1FT7 A;  1JWQ A;  3S9N A;  1CJW A;  3FNC A;  4R6T A;  5KTA A;  4CAF A;  1DE4 C;  1MJB A;  3FYN A;  1LAP A;  2PJ1 A;  4OC5 A;  4ZYQ A;  3D8P A;  2AFS A;  6CPA A;  2GIV A;  3K2K A;  1CX8 A;  1QSM A;  2ZOG A;  2ZEO A;  2ARH A;  5K8O A;  1QQ9 A;  2Q44 A;  4UCM A;  1RO5 A;  3NFZ A;  2RFH A;  2V77 A;  5AG4 A;  1WK4 A;  1MJA A;  2NMT A;  3ISZ A;  3PFE A;  4MFK A;  2OH1 A;  1CPS A;  3E0K A;  4JZ0 A;  5DS0 A;  4JLY A;  3KQX A;  1R3N A;  4CS0 B;  4A95 A;  3BI0 A;  1Z2L A;  2PIZ A;  5HXD A;  2ZW7 A;  1QMU A;  4OAD A;  5AG6 A;  3P2F A;  1ELM P;  1M4D A;  3P2H A;  2ZEF A;  4MRI A;  2R98 A;  4E8O A;  2Z3O A;  4B14 A;  5G21 A;  4J3G A;  1ON0 A;  2ZW4 A;  4FWU A;  1HEE A;  4NCZ A;  2ZEL A;  2R1I A;  1Y0R A;  3BJ8 A;  3D7H A;  2Z0Z A;  2IL4 A;  5K8M A;  2NYQ A;  3D4U A;  1OBR A;  3TT2 A;  2GU2 A;  2PJA A;  4F9V A;  1FNO A;  4NGR A;  4OP4 A;  4UF4 A;  2V8H A;  3CXQ A;  3GKR A;  3KQZ A;  1S3Z A;  4KOW A;  3RZA A;  1ARM A;  4FD6 A;  4NGS A;  1F57 A;  4KOT A;  3PP9 A;  1LAN A;  4QVT A;  4CAW A;  4KZT A;  1TF8 A;  4C2Z A;  5IV0 A;  1K4J A;  2ATR A;  2Z3M A;  1IB1 E;  2BSW A;  3SI1 A;  5EC4 A;  1VHO A;  2VL1 A;  3PB6 X;  4AG9 A;  1CM0 A;  3FRM A;  4MHZ A;  4R3L A;  2Z10 A;  3D7F A;  4MFP A;  4KSF A;  4F6A A;  2PJ3 A;  1IOI A;  3HLP A;  4KVM E;  5GCN A;  5DWN A;  1VIX A;  5CPA A;  4F9U A;  1KUY A;  2CNM A;  4FD5 A;  2B5G A;  3MN8 A;  4FAI A;  4QBJ A;  4NEX A;  4KOY A;  4MHN A;  2B5G B;  4U9Y A;  5I0C A;  1M4G A;  4FBE A;  1HDU A;  2D4O A;  3R9E A;  4R87 A;  4PQA A;  4PPZ A;  1MK4 A;  2ZEH A;  3CXP A;  3H8E A;  1HDQ A;  2C27 A;  2ODF A;  3IJ3 A;  3IWG A;  1KUV A;  2OOT A;  3TCV A;  1Q2C A;  4B5O A;  2EUI A;  8CPA A;  2AFZ A;  2XEJ A;  1F2P A;  4JWP A;  4OID A;  3EO4 A;  2HB6 A;  1Z5R A;  3D67 A;  2J8M A;  1I1D A;  3RYO A;  1YX0 A;  4CYO A;  1S7K A;  3BLN A;  4IF5 A;  4NSQ A;  4RN7 A;  5AG5 A;  2Q4V A;  4MY3 A;  1EE3 P;  3ZJ0 A;  2IMO A;  4Q38 A;  4P4E A;  4YWY A;  3KHZ A;  5EBV A;  3PEI A;  3FEE A;  4P4B A;  3IC1 A;  2YNC C;  3TX8 A;  4Z65 A;  1RXT A;  5G20 A;  4XPK A;  3NE7 A;  3SHP A;  4A38 A;  4IUS A;  2QML A;  1Z8L A;  1Z9U A;  3GYA A;  3R96 A;  2B3V A;  4FUU A;  2GRE A;  3W6X A;  2REF A;  4R3K A;  5JM6 A;  2OZG A;  2Q7B A;  2R8V A;  3EY5 A;  2FL4 A;  4PXE A;  4C7I A;  5F46 A;  3DR8 A;  2BOA A;  2RB7 A;  3RNZ A;  3S6K A;  4EME A;  2AFM A;  2FSR A;  4TNU A;  2ANP A;  2VQY A;  3PB8 X;  4NJR A;  3TO7 A;  4H89 A;  4U5Y A;  1NMT A;  4YFJ A;  4MFQ A;  4UA3 A;  5HMN A;  4NGQ A;  4BIN A;  1NE9 A;  4P4D A;  3FEC A;  3HUV A;  3VWE A;  2KCW A;  2V8D A;  3N7Z A;  4AG7 A;  4RUH A;  3N5F A;  2PRQ A;  3CT9 A;  4RI1 A;  2AFX A;  4MFZ A;  4ZBG A;  2P6F A;  3TO6 A;  2QYV A;  1ZLI A;  2GLJ A;  1S7F A;  4ZGY B;  4KVO E;  2C6G A;  1RTQ A;  3NH5 A;  2CY2 A;  2JLM A;  4ZI6 A;  3H8G A;  1TXR A;  4HNX B;  2VI7 A;  1UFH A;  3TC8 A;  1Z8T A;  1R57 A;  3LMS A;  3PB9 X;  2VBQ A;  4CAV A;  1AMP A;  1ARL A;  4BD9 A;  3K9U A;  4OIW A;  5J8F A;  2EWB A;  3QAH A;  4R57 A;  1IYK A;  1VKC A;  4FD4 A;  3F5B A;  5LYI A;  2PJ2 A;  2PVW A;  4CRZ B;  2V8G A;  3R95 A;  1CG2 A;  5F09 A;  3KKW A;  2WPW A;  4AVC A;  3IWE A;  4K3N A;  3FBU A;  3B3V A;  3SXN A;  3DSB A;  3I9S A;  2AFW A;  4X3R A;  1TKJ A;  2I79 A;  3IEH A;  2PJ7 A;  4M6I A;  1YW4 A;  3RAM A;  2I00 A;  3LWU A;  1YGH A;  4OC2 A;  1QSR A;  2Y0M A;  4KOU A;  4PSX A;  4GS4 A;  3WC5 A;  2YND A;  1XMT A;  1GYT A;  5ELY A;  2CXA A;  1A2Z A;  3FXT A;  4MFL A;  3TOB A;  4IAV A;  4AVB A;  4ZY0 A;  2DPS A;  5IX3 A;  1PYT B;  3NH4 A;  2F5I A;  5JH9 A;  4NGP A;  3VAR A;  5C82 A;  4CGP A;  4NF1 A;  3NA6 A;  3QNV A;  2PJ6 A;  4UFX A;  1PCA A;  4ONW A;  4KOX A;  4CGM A;  2JEW A;  4M6H A;  4OKO A;  4LX9 A;  2B4D A;  2Q4Z A;  5EMI A;  3CPA A;  2B4B A;  2PJB A;  3V38 A;  2QIR A;  4YRH A;  4L89 A;  5ISV A;  4P4F A;  5A27 A;  2B4D B;  1I12 A;  2R7H A;  4AXV A;  2FIW A;  3IIB A;  4MI4 A;  4OME A;  5G22 A;  2GE3 A;  3SJE A;  4WJB A;  4CAX A;  3D2P A;  4TWE A;  2VZZ A;  3R1K A;  1IID A;  4X8I A;  4Y49 B;  4C68 A;  4P44 A;  4W9Y A;  4PK2 A;  3NE8 A;  4QC6 A;  2ZEG A;  3WT4 A;  2ZEM A;  1L0C A;  1BAV A;  2AFU A;  1BO4 A;  3KR4 A;  4MFJ A;  4UIB A;  2PJC A;  1FY7 A;  3B2Y A;  2JDD A;  4P45 A;  5CNP A;  3JRU A;  5J1Q A;  4QB9 A;  2HUZ A;  3VH9 A;  4A2Z A;  5F48 A;  4UEF A;  1ZG8 A;  2BL1 A;  2B3U A;  1YME A;  2REE A;  4PXC A;  1NSL A;  4CRY B;  1N71 A;  4H6Z A;  2CTB A;  4R76 A;  1YRE A;  2BEI A;  2FCK A;  3D3S A;  2PDO A;  4ZX9 A;  2Z3P A;  1YVK A; 
#chains in the Genus database with same CATH homology
 4KVX A;  4A33 A;  1U6M A;  1XE4 A;  1IIC A;  4KS9 A;  1I21 A;  1WWZ A;  4KUB A;  4KLV A;  3C26 A;  4OLL A;  3DNS A;  1QST A;  2OZH A;  1YR0 A;  4A31 A;  4KOS A;  2Z11 A;  3IU1 A;  3FIX A;  4MY0 A;  2PR8 A;  5G1Z A;  3T90 A;  3DR6 A;  4E2A A;  4EVY A;  2JEV A;  3PGP A;  2ZPA A;  2WSA A;  3WR7 A;  1B6B A;  3EFA A;  3T9Y A;  4LUA A;  4Y49 C;  1S60 A;  5JPH A;  1SQH A;  4B10 A;  3DDD A;  2FS5 A;  4CYQ A;  1Z4R A;  5KTC A;  2G0B A;  4OAE A;  4B5P A;  4MJ8 A;  2G3A A;  4B5P B;  2FT0 A;  1MJ9 A;  2PC1 A;  3GY9 A;  4AVA A;  4UBR A;  1Y7R A;  2K5T A;  5AGE A;  1M1D A;  2HV2 A;  1Q2D A;  1PUA A;  2PQ8 A;  2O28 A;  2CNS A;  2JDC A;  1OZP A;  1P0H A;  4M3S A;  2AJ6 A;  3B8G A;  2Z3N A;  3OWC A;  4MHD A;  1Y9W A;  3S6F A;  4R9M A;  4QUS A;  1XIX A;  1Z4E A;  4RS2 A;  4DNC A;  3W6S A;  4B13 A;  4NXY A;  4YGO A;  2FIA A;  4JJX A;  5C88 A;  4C7H A;  5J8C A;  2DXQ A;  4UWI A;  4C2Y A;  4CGL A;  1BOB A;  4XPL A;  1KUX A;  4KSA A;  4II9 A;  2OZU A;  1XEB A;  3S6G A;  1KZF A;  2WUU A;  4ONU A;  4U9Z A;  4F0X A;  2YNE A;  2P0W A;  2VEZ A;  3IGR A;  4B11 A;  3D2M A;  3V8I A;  2A4N A;  4BMH A;  5KTD A;  3TOA A;  3F0A A;  2YGW A;  4UFW A;  5IB0 A;  3TTH A;  4E0A A;  4KLW A;  5F47 A;  1M44 A;  3A9L A;  1TIQ A;  2PRB A;  1PU9 A;  3VWD A;  2Z3K A;  2OU2 A;  3MGD A;  2J8N A;  5A28 A;  4XNH B;  2Q0Y A;  2YNC A;  3CXS A;  2VZY A;  2GAN A;  2P6E A;  2Z3L A;  4XPD B;  4AB7 A;  3QB8 A;  1B87 A;  4CGN A;  4PV6 A;  1J4J A;  3TO9 A;  1S5K A;  2HQY A;  4X5K A;  2Q4Y A;  4A32 A;  5JQ4 A;  2FXF A;  1VHS A;  4MBU A;  4M85 A;  3R9F A;  4C2X A;  2P6G A;  2FE7 A;  4KUA A;  5H84 A;  2X7B A;  3FB3 A;  5DWM A;  4UFV A;  3PZJ A;  3BJ7 A;  2J8R A;  2ZXV A;  2PR1 A;  4HNY B;  2OB0 A;  5H86 A;  1QSN A;  4UCN A;  2Q04 A;  2H5M A;  3G3S A;  4Q36 A;  4KOR A;  2CNT A;  2PSW A;  1V0C A;  4UWJ A;  3UY5 A;  4B12 A;  3H4Q A;  1XF8 A;  1Y9K A;  1QSO A;  4CGO A;  2BUE A;  2B58 A;  5BWA B;  5E96 A;  5F49 A;  4L8A A;  1S7N A;  4FD7 A;  3F8K A;  2QEC A;  2ZW6 A;  3TFY A;  4KOV A;  1YVO A;  4PSW A;  4PK3 A;  4UCP A;  4XNH C;  3IU2 A;  2G3T A;  1Q2Y A;  4CAE A;  5FVJ A;  4I49 A;  4CYP A;  2RC4 A;  4XPD C;  3I3G A;  3W91 A;  1M4I A;  1S7L A;  3EXN A;  3TE4 A;  2AE6 A;  2D4P A;  4CYN A;  2WPX A;  4JXQ A;  3JVN A;  3R9G A;  4F0Y A;  3SXO A;  3JTK A;  3H5Z A;  1IYL A;  1ZO0 A;  2EVN A;  4JXR A;  4JD6 A;  3LOD A;  3ZZI A;  4BBH A;  2VXK A;  4K30 A;  3EC4 A;  4HNW B;  4H6U A;  3S6H A;  2ZW5 A;  2DPT A;  1YLE A;  1P4N A;  1YK3 A;  5AG7 A;  3LD2 A;  4ORF A;  4HKF A;  5HH1 A;  3G8W A;  3JUW A;  4A30 A;  1GHE A;  1LRZ A;  1CJW A;  3FNC A;  5KTA A;  4CAF A;  1MJB A;  3FYN A;  3D8P A;  2GIV A;  1QSM A;  2ARH A;  2Q44 A;  4UCM A;  1RO5 A;  5AG4 A;  1WK4 A;  1MJA A;  2NMT A;  4MFK A;  2OH1 A;  3E0K A;  4JLY A;  4CS0 B;  4A95 A;  2ZW7 A;  4OAD A;  5AG6 A;  3P2F A;  1M4D A;  3P2H A;  2R98 A;  4E8O A;  2Z3O A;  4B14 A;  5G21 A;  4J3G A;  1ON0 A;  2ZW4 A;  4NCZ A;  2R1I A;  3BJ8 A;  2Z0Z A;  2IL4 A;  3TT2 A;  3CXQ A;  3GKR A;  1S3Z A;  4KOW A;  4FD6 A;  4KOT A;  3PP9 A;  4CAW A;  4QVT A;  4KZT A;  4C2Z A;  5IV0 A;  1K4J A;  2ATR A;  2Z3M A;  1IB1 E;  2BSW A;  5EC4 A;  4AG9 A;  1CM0 A;  3FRM A;  4R3L A;  2Z10 A;  4MFP A;  4KSF A;  4F6A A;  4KVM E;  5GCN A;  5DWN A;  1KUY A;  2CNM A;  4FD5 A;  2B5G A;  4QBJ A;  4NEX A;  4KOY A;  2B5G B;  4U9Y A;  5I0C A;  1M4G A;  2D4O A;  3R9E A;  4R87 A;  1MK4 A;  3CXP A;  2C27 A;  3IWG A;  1KUV A;  3TCV A;  4B5O A;  1Q2C A;  2EUI A;  4JWP A;  3EO4 A;  3RYO A;  2J8M A;  1I1D A;  1YX0 A;  4CYO A;  1S7K A;  3BLN A;  4IF5 A;  4NSQ A;  5AG5 A;  2Q4V A;  4MY3 A;  3ZJ0 A;  4Q38 A;  5EBV A;  2YNC C;  1RXT A;  5G20 A;  4XPK A;  3NE7 A;  3SHP A;  4IUS A;  2QML A;  1Z9U A;  3GYA A;  3R96 A;  2B3V A;  3W6X A;  2REF A;  4R3K A;  2OZG A;  2Q7B A;  2R8V A;  3EY5 A;  2FL4 A;  4C7I A;  5F46 A;  3DR8 A;  3S6K A;  2FSR A;  2VQY A;  3TO7 A;  4H89 A;  4U5Y A;  1NMT A;  4YFJ A;  4MFQ A;  4UA3 A;  5HMN A;  1NE9 A;  4AG7 A;  3VWE A;  2KCW A;  3N7Z A;  4RI1 A;  4ZBG A;  4MFZ A;  2P6F A;  3TO6 A;  1S7F A;  4ZGY B;  4KVO E;  2CY2 A;  2JLM A;  4HNX B;  2VI7 A;  1UFH A;  1R57 A;  2VBQ A;  4CAV A;  3K9U A;  5J8F A;  3QAH A;  4R57 A;  1IYK A;  1VKC A;  4FD4 A;  3F5B A;  4CRZ B;  3R95 A;  3KKW A;  2WPW A;  4AVC A;  3IWE A;  3FBU A;  3SXN A;  3DSB A;  3I9S A;  2I79 A;  2I00 A;  1YGH A;  1QSR A;  2Y0M A;  4KOU A;  4PSX A;  4GS4 A;  2YND A;  1XMT A;  2CXA A;  3FXT A;  4MFL A;  4AVB A;  3TOB A;  5IX3 A;  2DPS A;  2F5I A;  5C82 A;  4CGP A;  4NF1 A;  4UFX A;  4KOX A;  4CGM A;  4LX9 A;  2B4D A;  2B4B A;  2QIR A;  4YRH A;  4L89 A;  5ISV A;  5A27 A;  2B4D B;  1I12 A;  2R7H A;  2FIW A;  4MI4 A;  5G22 A;  2GE3 A;  4CAX A;  3D2P A;  2VZZ A;  3R1K A;  1IID A;  4Y49 B;  4C68 A;  4PK2 A;  4QC6 A;  1L0C A;  4MFJ A;  1BO4 A;  1FY7 A;  2JDD A;  5CNP A;  4QB9 A;  2HUZ A;  4A2Z A;  5F48 A;  2BL1 A;  2REE A;  2B3U A;  1NSL A;  4CRY B;  1N71 A;  4H6Z A;  1YRE A;  2BEI A;  2FCK A;  3D3S A;  2PDO A;  2Z3P A;  1YVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...