4YFJA

Crystal structure of aminoglycoside acetyltransferase aac(3)-ib
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
SIIATVKIGPDEISAMRAVLDLFGKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPRTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside 3'-N-acetyltransferase
publication title Crystal structure of aminoglycoside acetyltransferase AAC(3)-Ib
rcsb
source organism Pseudomonas aeruginosa
total genus 40
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4yfjA00
4YGOA 2X7BA 3W6XA 4MJ8A 5J8FA 3JVNA 3S6KA 3RYOA 3QB8A 4U9ZA 3S6FA 2B3VA 4FD4A 3D3SA 2Z10A 2BSWA 1YREA 1UFHA 1I21A 4II9A 3R9EA 4K30A 1QSOA 3F8KA 2B58A 4HNXB 2Q44A 4AG7A 4KVOE 2B4DA 2H5MA 4EVYA 2PDOA 4KUBA 1M4DA 2G3AA 4KLWA 1S7NA 4L8AA 5CNPA 4U5YA 4UA3A 1Z9UA 1KUYA 4PSWA 3D2PA 2EUIA 5F48A 4HNWB 1QSTA 2P6GA 2I79A 3DDDA 3TFYA 5ISVA 1Q2DA 4KOTA 3VWDA 3TO9A 1Y9WA 2HV2A 2OH1A 2R1IA 1YGHA 2G3TA 2R98A 2D4PA 1XEBA 3PZJA 4R57A 4KUAA 5C82A 3KKWA 3T90A 3FYNA 4XPDB 4E8OA 2OZUA 4X5KA 1M44A 2GIVA 3BJ7A 3DR6A 2K5TA 1NE9A 4CRYB 3TO7A 3SHPA 1SQHA 4R3LA 2FE7A 3QAHA 2D4OA 1P0HA 3ZZIA 5F46A 2JDCA 4QUSA 3W91A 3JUWA 5C88A 1YVOA 3R95A 1IYLA 2WPWA 1YK3A 1QSNA 5KTAA 2ZW7A 2WPXA 3FIXA 3S6HA 1KZFA 3DSBA 3F5BA 3NE7A 2FCKA 3MGDA 5H86A 3I9SA 4U9YA 1MJ9A 4R3KA 4BMHA 5KTDA 4JXRA 3CXSA 5JQ4A 2FSRA 2ZW5A 4FD6A 5IB0A 3IGRA 1M4GA 3ZJ0A 4XPLA 3P2HA 4UWIA 3TO6A 4RI1A 3FNCA 4M85A 3EO4A 2AE6A 3TOBA 3B8GA 4AG9A 1MJAA 1P4NA 2QECA 4QBJA 2HQYA 4NSQA 1YLEA 1ON0A 5EC4A 4AVBA 4NXYA 3EY5A 2F5IA 1QSMA 4H89A 4GS4A 3R9GA 2B3UA 1I12A 1B6BA 3V8IA 4DNCA 5H84A 4KORA 2A4NA 4IUSA 4FD5A 2Z0ZA 2VBQA 1S60A 1M1DA 2BUEA 2Z11A 2CNTA 4YFJA 1YVKA 3E0KA 3VWEA 1Z4RA 3I3GA 1GHEA 4KOUA 3D8PA 2IL4A 3T9YA 1N71A 1BOBA 1Z4EA 2JDDA 5IV0A 4MY0A 4XNHC 1Y9KA 3BJ8A 4PK3A 2J8RA 4CAVA 2REEA 5HH1A 1I1DA 4E0AA 5J8CA 3WR7A 2ATRA 2P0WA 4F6AA 3R1KA 2C27A 2G0BA 2VI7A 3FB3A 2RC4A 3TOAA 3G8WA 3OWCA 1XMTA 2PR1A 4R87A 2P6EA 5F49A 4ZBGA 4KOWA 2FL4A 4I49A 4KOVA 2Q0YA 3BLNA 1S3ZA 3G3SA 1IIDA 4OAEA 4CS0B 4J3GA 2JLMA 1FY7A 2PRBA 2ARHA 2VZZA 4JLYA 1WWZA 2J8NA 4MBUA 4CAXA 1XF8A 2R8VA 2I00A 4FD7A 1WK4A 4KZTA 1XIXA 1QSRA 3EC4A 2HUZA 2EVNA 4JXQA 2DXQA 3FXTA 4MHDA 4OLLA 4KVXA 2B5GA 3EFAA 1YX0A 3UY5A 5E96A 3P2FA 4B5PA 2CNSA 5DWNA 4MY3A 3FRMA 4HNYB 3GKRA 2Q7BA 1NMTA 5I0CA 1NSLA 2Q04A 4LUAA 3SXOA 2OZGA 4E2AA 4NEXA 3PGPA 5FVJA 4JJXA 5IX3A 5GCNA 1MJBA 3N7ZA 1PUAA 1S7LA 2CNMA 3H4QA 1Y7RA 3TCVA 3PP9A 4F0YA 4KOSA 4KOYA 2FT0A 2Q4VA 1R57A 3TE4A 1S5KA 2Q4YA 4MI4A 1RXTA 2CY2A 4ORFA 3DNSA 2PC1A 2PR8A 3D2MA 2NMTA 3FBUA 1Q2YA 3IWGA 2ZPAA 1MK4A 1PU9A 1L0CA 2OU2A 3R96A 3F0AA 4YRHA 4PV6A 3CXQA 2R7HA 2OZHA 4R9MA 4XPDC 3LD2A 1V0CA 2JEVA 3S6GA 4KLVA 4CRZB 1CJWA 3GY9A 2FIAA 2P6FA 4AB7A 3CXPA 1BO4A 1IB1E 4JWPA 1M4IA 4ONUA 4IF5A 2VQYA 2BEIA 4PK2A 3LODA 4QB9A 2GE3A 1IICA 4AVAA 2VEZA 1VHSA 1CM0A 1TIQA 4UWJA 1KUVA 2B5GB 1J4JA 1KUXA 4B5PB 4H6ZA 3SXNA 3TT2A 4XNHB 3TTHA 5HMNA 4HKFA 4NF1A 4XPKA 2FS5A 2AJ6A 3C26A 1U6MA 4QC6A 4LX9A 4Y49C 2OB0A 2FXFA 1B87A 2VZYA 2ZW4A 4OADA 3DR8A 1IYKA 2Y0MA 2PSWA 1XE4A 2BL1A 3K9UA 4QVTA 4H6UA 4B5OA 2J8MA 4PSXA 3R9FA 1RO5A 3W6SA 4KOXA 2B4BA 2ZXVA 4M3SA 5EBVA 3GYAA 4L89A 2O28A 4RS2A 2QMLA 4NCZA 5JPHA 5KTCA 2QIRA 4JD6A 1S7FA 4UBRA 1OZPA 1Q2CA 2B4DB 2FIWA 2PQ8A 3EXNA 4KVME 5F47A 1VKCA 2REFA 2GANA 1S7KA 5DWMA 1K4JA 2ZW6A 1YR0A 4Y49B 4AVCA 2VXKA 2KCWA 1LRZA 4CAWA
chains in the Genus database with same CATH superfamily
4YGOA 3ISZA 4NGSA 5LRGA 3WC5A 2X7BA 3W6XA 1LANA 4MJ8A 5J8FA 3JVNA 4PXCA 4ZI6A 8CPAA 4A31A 3S6KA 1PCAA 2PJ9A 3QB8A 4U9ZA 3RYOA 4UCPA 3S6FA 4MCRA 1VHEA 2B3VA 4FD4A 3D3SA 4P4EA 2EWBA 2Z10A 2BSWA 3VATA 1YREA 1F57A 1UFHA 1I21A 3B3TA 3D68A 4II9A 3R9EA 4UFVA 4K30A 1QSOA 4UCMA 3F8KA 2BOAA 3WABA 2B58A 5K8NA 3GUXA 3NFZA 4HNXB 2Q44A 1XMBA 4AG7A 4KVOE 1LOKA 2B4DA 4A37A 2H5MA 2WSAA 3S9MA 4EVYA 2Z3PA 4KSIA 2PDOA 2YNEA 4KUBA 2PJCA 3V38A 1YMEA 4MFKA 4MHZA 1M4DA 2G3AA 2DPTA 4KLWA 4WWVA 4CAEA 4NGMA 2O4HA 1S7NA 3D4UA 4L8AA 3SI2A 3D67A 3L2NA 2G9DA 5CNPA 4OIDA 3FECA 4U5YA 1Z9UA 4UA3A 1KUYA 1YQEA 4PSWA 4UIBA 2Z3LA 1TKFA 2EK8A 1LAPA 3D2PA 2EUIA 5F48A 4MFPA 1ELMP 1QSTA 3PFOA 4HNWB 2P6GA 2ZEPA 2I79A 2YNDA 4MXUA 3D66A 3DDDA 1LCPA 4ZY1A 2IMOA 2NSMA 3TFYA 2FVGA 5ISVA 2YNCC 4UFXA 1TXRA 4B6ZA 4CGLA 1Q2DA 4KOTA 2F8HA 4GM5A 4P4FA 4CGMA 3IJ3A 3VWDA 3TO9A 1IGBA 1Y9WA 2HV2A 4M6HA 2OH1A 2R1IA 4CYOA 3N5FA 1YGHA 2V8DA 2Q7SA 3K9TA 4W9YA 2G3TA 2R98A 1CX8A 2D4PA 1XEBA 4UFWA 3PZJA 4DJLA 2AFWA 4R57A 4KUAA 3KQZA 5C82A 2QVPA 3KKWA 3T90A 3FYNA 4P4JA 1Q7LA 4XPDB 4JYWA 4UEFA 4E8OA 3IWWA 1IOIA 2OZUA 1BPNA 3QAYA 4X5KA 4CAWA 2PIZA 4NGTA 1M44A 2GIVA 3BJ7A 3DR6A 2K5TA 3JRUA 1NE9A 2Q4ZA 2QJ8A 3PB8X 3RAMA 4CRYB 1TF8A 2J9AA 4PQAA 3SHPA 1SQHA 3PRTA 4R3LA 2FE7A 3QAHA 3TO7A 2D4OA 1P0HA 3ZZIA 4B12A 5F46A 2JDCA 4QUSA 3IWEA 3W91A 2CIJA 2GREA 1CP6A 4P44A 3JUWA 5C88A 2AFUA 1YVOA 2HB6A 3R95A 1IYLA 1OBRA 1ZLHA 2PRQA 4DYOA 2WPWA 1YK3A 1Z5RA 2DF5A 1QSNA 5KTAA 2ABZA 1XRYA 2ZW7A 2WPXA 2WUUA 3FIXA 4LQ6A 3S6HA 1KZFA 4PXDA 3B3VA 3DSBA 5BWAB 3B2YA 3F5BA 4K3NA 1HDQA 3NE7A 3TC8A 4YU9A 3NA6A 2FCKA 5DS0A 3MGDA 5H86A 5I4MA 2PJ6A 4ZY0A 4EMEA 4NJQA 2EBJA 3SJFA 3D7DA 3I9SA 3RZAA 1F2PA 4U9YA 1MJ9A 3FX6A 4R3KA 5AG5A 4BMHA 2C6PA 5KTDA 4BINA 4JXRA 3CXSA 1JWQA 1JQGA 2PE3A 3KI9A 5JQ4A 2YGWA 3WC6A 2FSRA 2ZW5A 2ODFA 2ZEHA 4FD6A 4OC0A 5IB0A 3D7GA 3IGRA 1CPSA 1M4GA 4MFZA 1Y0YA 3ZJ0A 1ZG7A 4XPLA 4CGOA 4ZGYB 3P2HA 4MFJA 1Y7EA 4UWIA 3PBBA 3TO6A 1YW4A 4RI1A 3FNCA 1Z8LA 2YNCA 4FWUA 4M85A 5G21A 3EO4A 1KWMA 5CPAA 3FEEA 3HUVA 4OC2A 3FF3A 3VH9A 4AXVA 2AE6A 2AFSA 2GU2A 3TOBA 3B8GA 4ZX9A 4AG9A 1MJAA 1P4NA 3I1UA 2JBJA 2QECA 1BPMA 4QBJA 2HQYA 2CTCA 2CXAA 5AG6A 2ZEEA 1ZO0A 4NSQA 3VARA 2OR4A 1YLEA 1YLOA 3PEIA 1ON0A 5EC4A 1PYTB 4NXYA 4AVBA 4BBHA 3EY5A 2F5IA 4BD9A 1QSMA 4H89A 2PJ2A 4GS4A 3PB4X 3R9GA 2B3UA 2PCUA 1I12A 1B6BA 2QYVA 3V8IA 5H84A 3WC7A 4ZY2A 4KORA 2A4NA 4IUSA 4KSFA 4FD5A 2Z0ZA 2VBQA 5HXDA 1S60A 4Q36A 1M1DA 3IIBA 5THWA 4A95A 1HEEA 2BUEA 2Z11A 4CYQA 4LQGA 4UEEA 5D8NA 2CNTA 2Q43A 5LYDA 4P10A 1ZG9A 4OP4A 4MCSA 4YFJA 4FAIA 1YVKA 3E0KA 3VWEA 1Z4RA 5LYIA 4ONWA 1EE3P 1GHEA 3I3GA 4KOUA 1Z8TA 2V77A 4X3RA 3HLPA 2ZEDA 2ZEGA 2ZEFA 3D8PA 2IL4A 3IFEA 3PB7X 4NGNA 3T9YA 1R3NA 1Z8XA 3SI0A 1N71A 1BOBA 1Z4EA 4HPSA 4P4DA 4C7HA 2AFOA 2JDDA 3V7ZA 5IV0A 4MY0A 4XNHC 1Y9KA 3LWUA 2VL1A 1VGYA 3BJ8A 4M6GA 4PK3A 1LFWA 3GIUA 2J8RA 1R43A 3DLJA 4CAVA 4C68A 2ZENA 1AYEA 2REEA 4TNUA 1XFOA 3TX8A 1ARMA 2V8VA 5HH1A 1I1DA 3ISXA 4E0AA 5K8PA 3FEDA 5J8CA 3WR7A 2ATRA 2EK9A 4B14A 2P0WA 1BLLE 5G20A 1XBUA 4F6AA 3CPAA 4OC1A 3R1KA 1ZG8A 2XEJA 2PJ4A 5K8OA 2V8GA 2C27A 2G0BA 2VI7A 2XEIA 2RC4A 3FB3A 3TOAA 3G8WA 2Z3OA 1IU8A 2PVWA 2GLFA 1XMTA 3OWCA 2PR1A 4P4IA 4YWYA 4R87A 4NGQA 5HVHA 2P6EA 5F49A 2I3CA 1VIXA 4ZBGA 3FH4A 4KOWA 2FL4A 4I49A 4NFRA 4KOVA 4A2ZA 4B10A 2Q0YA 3BLNA 3IC1A 4PPZA 1CPXA 5LRKA 3BXMA 2DEAA 1S3ZA 4P6YA 4X2TA 1Z2LA 3G3SA 3SI1A 1XOVA 1IIDA 4OAEA 2V8HA 1TF9A 4CS0B 4J3GA 2JLMA 1FY7A 3IU1A 2PRBA 2ARHA 2CF4A 4KS9A 2VZZA 4JLYA 3CT9A 1WWZA 2J8NA 4MBUA 3NE8A 4C2YA 4CAXA 4PXBA 1XF8A 4MHNA 2R8VA 2I00A 2WZNA 3B3WA 4H2KA 3KGQA 3KR4A 4FD7A 5LYLA 4FBEA 1HDUA 1YW6A 2PVVA 4CPAA 1WK4A 4KZTA 1XIXA 3B35A 3NH8A 1QSRA 4NJRA 3EC4A 5ELYA 2HUZA 2AFXA 3B3SA 3KHXA 2EVNA 4JXQA 4OMEA 4MHYA 2DPSA 2DXQA 2Z3NA 3FXTA 4MHDA 4CYNA 4OLLA 1RTQA 1A2ZA 4KVXA 2B5GA 3EFAA 1YX0A 3UY5A 3BI1A 2IJZA 3JTKA 5E96A 3D7FA 3P2FA 5G22A 4B5PA 2CNSA 5DWNA 3GLJA 4MY3A 4MFLA 2XEFA 4MFQA 3RNZA 5LYFA 3FRMA 4HNYB 3RBUA 2PJ7A 1LAMA 3GKRA 3IO1A 4TWEA 2Q7BA 1NMTA 7CPAA 5I0CA 4C2XA 1NSLA 2Q04A 4LUAA 3SXOA 2OZGA 3LMSA 4O23A 4OC5A 4E2AA 2GFQA 3MRUA 1F2OA 4NEXA 3PGPA 5FVJA 2C6GA 4JJXA 2OOTA 2PJ3A 4UF4A 3KASA 4IK2A 4A38A 1TKHA 5IX3A 3IU2A 2EO8A 5GCNA 1MJBA 2POKA 5HVGA 2ZOFA 3D7HA 4R8FA 5HVFA 4UCNA 3N7ZA 5D29A 5A27A 1PUAA 1S7LA 2CNMA 2Q51A 3FVLA 3H4QA 5K8MA 1TKJA 2Z3KA 1Y7RA 1GYTA 3PP9A 3TCVA 4F0YA 2RFHA 4KOSA 4KOYA 2FT0A 2Q4VA 2ZOGA 1R57A 3TE4A 1S5KA 2Q4YA 4MI4A 5A28A 2XEGA 1RXTA 1CG2A 2CY2A 4ORFA 4B13A 3DNSA 2PC1A 4A39A 4KSAA 2PR8A 3D2MA 1ZLIA 3WT4A 2NMTA 3FBUA 3KZWA 1X10A 1Y0RA 1Q2YA 2NYQA 2PIYA 3IWGA 2ZPAA 4CGNA 1MK4A 1PU9A 5G1ZA 2ZEOA 3SJEA 4F9VA 2JBKA 1IY7A 3H5ZA 1L0CA 2OU2A 3R96A 4X8IA 3A9LA 3F0AA 4PV6A 4YRHA 4Z65A 3CXQA 3H8EA 5AGEA 5EMIA 1M4LA 3BI0A 4CYPA 1ARLA 2JEWA 2OZHA 2PJ8A 2R7HA 4R9MA 2Z3MA 2RB7A 4NGRA 2PJ5A 4OC3A 4XPDC 4B11A 3LD2A 4OIWA 1V0CA 3KQXA 2ANPA 4ZYQA 2JEVA 3RO0A 5JGFA 3S6GA 3H8FA 4KLVA 3QNVA 2C6CA 4CRZB 1CJWA 2ZEMA 4F9UA 3GY9A 1FT7A 2FIAA 2F7VA 2P6FA 4AB7A 3S9NA 3CXPA 4R6TA 4RN7A 4DUKA 1BO4A 3LACA 5JM6A 4OC4A 1IB1E 4JWPA 3PFEA 4R76A 4G1PA 1H8LA 4P4BA 1M4IA 4C2ZA 3S9LA 3SJGA 2AFZA 4EFDA 5AG4A 3CPXA 4M6IA 4ONUA 4IF5A 2VQYA 2BEIA 4PK2A 3LODA 4QB9A 1CBXA 2GE3A 4P45A 5CBMA 3CZXA 1IICA 4AVAA 1AUGA 1QQ9A 4MCPA 4JZ0A 3PBEA 2VEZA 1VHSA 4ZX8A 2HC9A 1CM0A 1TIQA 4UWJA 1KUVA 2B5GB 4FUUA 1J4JA 1KUXA 4B5PB 1YSJA 4H6ZA 3NH4A 3SXNA 3TT2A 2PJ1A 4EWTA 3B3CA 1Z8WA 4UIAA 4XNHB 3FJUA 3TTHA 5HMNA 1NSAA 1AMPA 3H8GA 3PB6X 1DTDA 4PXEA 3DGVA 2PJAA 4HKFA 1QMUA 4NF1A 2BCOA 3SJXA 4XPKA 2FS5A 3IEHA 5IB9A 4Q7AA 2AFMA 4F8ZA 3MN8A 2AJ6A 5JH9A 4A94A 3C26A 3T8WA 1U6MA 1CP7A 4QC6A 4LX9A 4Y49C 2OB0A 5LRJA 2IQ6A 2FXFA 2GLJA 1B87A 2VZYA 4OKOA 2ZW4A 4OADA 3DR8A 3CDXA 1IYKA 3GB0A 4IHMA 4NGPA 2CTBA 4MHPA 2Y0MA 3KR5A 3PB9X 4A32A 4F0XA 2PSWA 1XE4A 2BL1A 1X12A 3K9UA 4QVTA 4CAFA 4H6UA 2C1CA 2WYRA 4B5OA 2J8MA 4MMOA 3B7IA 4MCQA 1DE4C 4PSXA 4UEZA 3R9FA 1RO5A 1XJOA 3W6SA 5F09A 2ZELA 4KOXA 2B4BA 2ZXVA 1VHOA 1IOFA 4A30A 4IAVA 4M3SA 5EBVA 2BO9A 4DNCA 1ELLP 3GYAA 4L89A 4A33A 2O28A 2PJBA 4RS2A 2QMLA 4Q38A 3NH5A 4GXHA 2PJ0A 4NCZA 3KL9A 3K2KA 3BHXA 1BAVA 5JPHA 2O53A 5KTCA 5AG7A 2QIRA 4JD6A 1S7FA 4UBRA 1OZPA 1Q2CA 2B4DB 2FIWA 2PQ8A 3EXNA 3FMCA 4MRIA 4KVME 5F47A 1VKCA 4WJBA 2REFA 2GANA 1S7KA 5DWMA 1FNOA 1K4JA 6CPAA 2ZW6A 1UWYA 5J1QA 1YR0A 4Y49B 4AVCA 4C7IA 2VXKA 2KCWA 1LRZA 4CGPA 4RUHA 3KHZA 4R7MA
chains in the Genus database with same CATH topology
4YGOA 2X7BA 3W6XA 4MJ8A 5J8FA 3JVNA 4A31A 3S6KA 3RYOA 3QB8A 4U9ZA 3S6FA 4UCPA 2B3VA 4FD4A 3D3SA 2Z10A 2BSWA 1YREA 1UFHA 1I21A 4II9A 3R9EA 4UFVA 4K30A 1QSOA 4UCMA 3F8KA 2B58A 4HNXB 2Q44A 4AG7A 4KVOE 2B4DA 2H5MA 2WSAA 4EVYA 2Z3PA 2PDOA 2YNEA 4KUBA 4MFKA 1M4DA 2G3AA 2DPTA 4KLWA 4CAEA 1S7NA 4L8AA 5CNPA 4U5YA 4UA3A 1Z9UA 1KUYA 4PSWA 2Z3LA 3D2PA 2EUIA 5F48A 4MFPA 4HNWB 1QSTA 2P6GA 2I79A 2YNDA 3DDDA 3TFYA 5ISVA 2YNCC 4UFXA 4CGLA 1Q2DA 4KOTA 4CGMA 3VWDA 3TO9A 1Y9WA 2HV2A 2OH1A 2R1IA 4CYOA 1YGHA 2G3TA 2R98A 2D4PA 4UFWA 1XEBA 3PZJA 4R57A 4KUAA 5C82A 3KKWA 3T90A 3FYNA 4XPDB 4E8OA 2OZUA 4X5KA 1M44A 2GIVA 3BJ7A 3DR6A 2K5TA 1NE9A 4CRYB 3TO7A 3SHPA 1SQHA 4R3LA 2FE7A 3QAHA 2D4OA 1P0HA 3ZZIA 4B12A 5F46A 2JDCA 4QUSA 3IWEA 3W91A 3JUWA 5C88A 1YVOA 3R95A 1IYLA 2WPWA 1YK3A 1QSNA 5KTAA 2ZW7A 2WPXA 2WUUA 3FIXA 3S6HA 1KZFA 3DSBA 5BWAB 3F5BA 3NE7A 2FCKA 3MGDA 5H86A 3I9SA 4U9YA 1MJ9A 4R3KA 5AG5A 4BMHA 5KTDA 4JXRA 3CXSA 5JQ4A 2YGWA 2FSRA 2ZW5A 4FD6A 5IB0A 3IGRA 4MFZA 1M4GA 3ZJ0A 4CGOA 4XPLA 4ZGYB 3P2HA 4MFJA 4UWIA 3TO6A 4RI1A 3FNCA 2YNCA 5G21A 4M85A 3EO4A 2AE6A 3TOBA 3B8GA 4AG9A 1MJAA 1P4NA 2QECA 4QBJA 2HQYA 2CXAA 5AG6A 1ZO0A 4NSQA 1YLEA 1ON0A 5EC4A 4AVBA 4NXYA 4BBHA 3EY5A 2F5IA 1QSMA 4H89A 4GS4A 3R9GA 2B3UA 1I12A 1B6BA 3V8IA 4DNCA 5H84A 4KORA 2A4NA 4IUSA 4KSFA 4FD5A 2Z0ZA 2VBQA 1S60A 4Q36A 1M1DA 4A95A 2BUEA 2Z11A 4CYQA 2CNTA 4YFJA 1YVKA 3E0KA 3VWEA 1Z4RA 3I3GA 1GHEA 4KOUA 3D8PA 2IL4A 3T9YA 1N71A 1BOBA 1Z4EA 4C7HA 2JDDA 5IV0A 4MY0A 4XNHC 1Y9KA 3BJ8A 4PK3A 2J8RA 4CAVA 4C68A 2REEA 5HH1A 1I1DA 4E0AA 5J8CA 3WR7A 2ATRA 4B14A 2P0WA 5G20A 4F6AA 3R1KA 2C27A 2G0BA 2VI7A 3FB3A 2RC4A 3TOAA 3G8WA 2Z3OA 3OWCA 1XMTA 2PR1A 4R87A 2P6EA 5F49A 4ZBGA 4KOWA 2FL4A 4I49A 4KOVA 4A2ZA 4B10A 2Q0YA 3BLNA 1S3ZA 3G3SA 1IIDA 4OAEA 4CS0B 4J3GA 2JLMA 1FY7A 3IU1A 2PRBA 2ARHA 4KS9A 2VZZA 4JLYA 1WWZA 2J8NA 4MBUA 4C2YA 4CAXA 1XF8A 2R8VA 2I00A 4FD7A 1WK4A 4KZTA 1XIXA 1QSRA 3EC4A 2HUZA 2EVNA 4JXQA 2DPSA 2DXQA 2Z3NA 3FXTA 4MHDA 4CYNA 4OLLA 4KVXA 2B5GA 3EFAA 1YX0A 3UY5A 3JTKA 5E96A 5G22A 3P2FA 4B5PA 2CNSA 5DWNA 4MY3A 4MFLA 4MFQA 3FRMA 4HNYB 3GKRA 2Q7BA 1NMTA 5I0CA 4C2XA 1NSLA 2Q04A 4LUAA 3SXOA 2OZGA 4E2AA 4NEXA 3PGPA 5FVJA 4JJXA 5IX3A 3IU2A 5GCNA 1MJBA 4UCNA 3N7ZA 5A27A 1PUAA 1S7LA 2CNMA 3H4QA 2Z3KA 1Y7RA 3TCVA 3PP9A 4F0YA 4KOSA 4KOYA 2FT0A 2Q4VA 1R57A 3TE4A 1S5KA 2Q4YA 4MI4A 5A28A 1RXTA 2CY2A 4ORFA 4B13A 3DNSA 2PC1A 4KSAA 2PR8A 3D2MA 2NMTA 3FBUA 1Q2YA 3IWGA 2ZPAA 4CGNA 1MK4A 1PU9A 5G1ZA 3H5ZA 1L0CA 2OU2A 3R96A 3A9LA 3F0AA 4PV6A 4YRHA 3CXQA 5AGEA 4CYPA 2R7HA 2OZHA 4R9MA 2Z3MA 4XPDC 4B11A 3LD2A 1V0CA 2JEVA 3S6GA 4KLVA 4CRZB 1CJWA 3GY9A 2FIAA 2P6FA 4AB7A 3CXPA 1BO4A 1IB1E 4JWPA 1M4IA 4C2ZA 5AG4A 4ONUA 4IF5A 2VQYA 2BEIA 4PK2A 3LODA 4QB9A 2GE3A 1IICA 4AVAA 2VEZA 1VHSA 1CM0A 1TIQA 4UWJA 1KUVA 2B5GB 1J4JA 1KUXA 4B5PB 4H6ZA 3SXNA 3TT2A 4XNHB 3TTHA 5HMNA 4HKFA 4NF1A 4XPKA 2FS5A 2AJ6A 3C26A 1U6MA 4QC6A 4LX9A 4Y49C 2OB0A 2FXFA 1B87A 2VZYA 2ZW4A 4OADA 3DR8A 1IYKA 2Y0MA 4A32A 4F0XA 2PSWA 1XE4A 2BL1A 3K9UA 4QVTA 4CAFA 4H6UA 4B5OA 2J8MA 4PSXA 3R9FA 1RO5A 3W6SA 4KOXA 2B4BA 2ZXVA 4A30A 4M3SA 5EBVA 3GYAA 4L89A 4A33A 2O28A 4RS2A 2QMLA 4Q38A 4NCZA 5JPHA 5KTCA 5AG7A 2QIRA 4JD6A 1S7FA 4UBRA 1OZPA 1Q2CA 2B4DB 2FIWA 2PQ8A 3EXNA 4KVME 5F47A 1VKCA 2REFA 2GANA 1S7KA 5DWMA 1K4JA 2ZW6A 1YR0A 4Y49B 4AVCA 4C7IA 2VXKA 2KCWA 1LRZA 4CGPA 4CAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGO A;  2X7B A;  3W6X A;  4MJ8 A;  5J8F A;  3JVN A;  3S6K A;  3RYO A;  3QB8 A;  4U9Z A;  3S6F A;  2B3V A;  4FD4 A;  3D3S A;  2Z10 A;  2BSW A;  1YRE A;  1UFH A;  1I21 A;  4II9 A;  3R9E A;  4K30 A;  1QSO A;  3F8K A;  2B58 A;  4HNX B;  2Q44 A;  4AG7 A;  4KVO E;  2B4D A;  2H5M A;  4EVY A;  2PDO A;  4KUB A;  1M4D A;  2G3A A;  4KLW A;  1S7N A;  4L8A A;  5CNP A;  4U5Y A;  4UA3 A;  1Z9U A;  1KUY A;  4PSW A;  3D2P A;  2EUI A;  5F48 A;  4HNW B;  1QST A;  2P6G A;  2I79 A;  3DDD A;  3TFY A;  5ISV A;  1Q2D A;  4KOT A;  3VWD A;  3TO9 A;  1Y9W A;  2HV2 A;  2OH1 A;  2R1I A;  1YGH A;  2G3T A;  2R98 A;  2D4P A;  1XEB A;  3PZJ A;  4R57 A;  4KUA A;  5C82 A;  3KKW A;  3T90 A;  3FYN A;  4XPD B;  4E8O A;  2OZU A;  4X5K A;  1M44 A;  2GIV A;  3BJ7 A;  3DR6 A;  2K5T A;  1NE9 A;  4CRY B;  3TO7 A;  3SHP A;  1SQH A;  4R3L A;  2FE7 A;  3QAH A;  2D4O A;  1P0H A;  3ZZI A;  5F46 A;  2JDC A;  4QUS A;  3W91 A;  3JUW A;  5C88 A;  1YVO A;  3R95 A;  1IYL A;  2WPW A;  1YK3 A;  1QSN A;  5KTA A;  2ZW7 A;  2WPX A;  3FIX A;  3S6H A;  1KZF A;  3DSB A;  3F5B A;  3NE7 A;  2FCK A;  3MGD A;  5H86 A;  3I9S A;  4U9Y A;  1MJ9 A;  4R3K A;  4BMH A;  5KTD A;  4JXR A;  3CXS A;  5JQ4 A;  2FSR A;  2ZW5 A;  4FD6 A;  5IB0 A;  3IGR A;  1M4G A;  3ZJ0 A;  4XPL A;  3P2H A;  4UWI A;  3TO6 A;  4RI1 A;  3FNC A;  4M85 A;  3EO4 A;  2AE6 A;  3TOB A;  3B8G A;  4AG9 A;  1MJA A;  1P4N A;  2QEC A;  4QBJ A;  2HQY A;  4NSQ A;  1YLE A;  1ON0 A;  5EC4 A;  4AVB A;  4NXY A;  3EY5 A;  2F5I A;  1QSM A;  4H89 A;  4GS4 A;  3R9G A;  2B3U A;  1I12 A;  1B6B A;  3V8I A;  4DNC A;  5H84 A;  4KOR A;  2A4N A;  4IUS A;  4FD5 A;  2Z0Z A;  2VBQ A;  1S60 A;  1M1D A;  2BUE A;  2Z11 A;  2CNT A;  4YFJ A;  1YVK A;  3E0K A;  3VWE A;  1Z4R A;  3I3G A;  1GHE A;  4KOU A;  3D8P A;  2IL4 A;  3T9Y A;  1N71 A;  1BOB A;  1Z4E A;  2JDD A;  5IV0 A;  4MY0 A;  4XNH C;  1Y9K A;  3BJ8 A;  4PK3 A;  2J8R A;  4CAV A;  2REE A;  5HH1 A;  1I1D A;  4E0A A;  5J8C A;  3WR7 A;  2ATR A;  2P0W A;  4F6A A;  3R1K A;  2C27 A;  2G0B A;  2VI7 A;  3FB3 A;  2RC4 A;  3TOA A;  3G8W A;  3OWC A;  1XMT A;  2PR1 A;  4R87 A;  2P6E A;  5F49 A;  4ZBG A;  4KOW A;  2FL4 A;  4I49 A;  4KOV A;  2Q0Y A;  3BLN A;  1S3Z A;  3G3S A;  1IID A;  4OAE A;  4CS0 B;  4J3G A;  2JLM A;  1FY7 A;  2PRB A;  2ARH A;  2VZZ A;  4JLY A;  1WWZ A;  2J8N A;  4MBU A;  4CAX A;  1XF8 A;  2R8V A;  2I00 A;  4FD7 A;  1WK4 A;  4KZT A;  1XIX A;  1QSR A;  3EC4 A;  2HUZ A;  2EVN A;  4JXQ A;  2DXQ A;  3FXT A;  4MHD A;  4OLL A;  4KVX A;  2B5G A;  3EFA A;  1YX0 A;  3UY5 A;  5E96 A;  3P2F A;  4B5P A;  2CNS A;  5DWN A;  4MY3 A;  3FRM A;  4HNY B;  3GKR A;  2Q7B A;  1NMT A;  5I0C A;  1NSL A;  2Q04 A;  4LUA A;  3SXO A;  2OZG A;  4E2A A;  4NEX A;  3PGP A;  5FVJ A;  4JJX A;  5IX3 A;  5GCN A;  1MJB A;  3N7Z A;  1PUA A;  1S7L A;  2CNM A;  3H4Q A;  1Y7R A;  3TCV A;  3PP9 A;  4F0Y A;  4KOS A;  4KOY A;  2FT0 A;  2Q4V A;  1R57 A;  3TE4 A;  1S5K A;  2Q4Y A;  4MI4 A;  1RXT A;  2CY2 A;  4ORF A;  3DNS A;  2PC1 A;  2PR8 A;  3D2M A;  2NMT A;  3FBU A;  1Q2Y A;  3IWG A;  2ZPA A;  1MK4 A;  1PU9 A;  1L0C A;  2OU2 A;  3R96 A;  3F0A A;  4YRH A;  4PV6 A;  3CXQ A;  2R7H A;  2OZH A;  4R9M A;  4XPD C;  3LD2 A;  1V0C A;  2JEV A;  3S6G A;  4KLV A;  4CRZ B;  1CJW A;  3GY9 A;  2FIA A;  2P6F A;  4AB7 A;  3CXP A;  1BO4 A;  1IB1 E;  4JWP A;  1M4I A;  4ONU A;  4IF5 A;  2VQY A;  2BEI A;  4PK2 A;  3LOD A;  4QB9 A;  2GE3 A;  1IIC A;  4AVA A;  2VEZ A;  1VHS A;  1CM0 A;  1TIQ A;  4UWJ A;  1KUV A;  2B5G B;  1J4J A;  1KUX A;  4B5P B;  4H6Z A;  3SXN A;  3TT2 A;  4XNH B;  3TTH A;  5HMN A;  4HKF A;  4NF1 A;  4XPK A;  2FS5 A;  2AJ6 A;  3C26 A;  1U6M A;  4QC6 A;  4LX9 A;  4Y49 C;  2OB0 A;  2FXF A;  1B87 A;  2VZY A;  2ZW4 A;  4OAD A;  3DR8 A;  1IYK A;  2Y0M A;  2PSW A;  1XE4 A;  2BL1 A;  3K9U A;  4QVT A;  4H6U A;  4B5O A;  2J8M A;  4PSX A;  3R9F A;  1RO5 A;  3W6S A;  4KOX A;  2B4B A;  2ZXV A;  4M3S A;  5EBV A;  3GYA A;  4L89 A;  2O28 A;  4RS2 A;  2QML A;  4NCZ A;  5JPH A;  5KTC A;  2QIR A;  4JD6 A;  1S7F A;  4UBR A;  1OZP A;  1Q2C A;  2B4D B;  2FIW A;  2PQ8 A;  3EXN A;  4KVM E;  5F47 A;  1VKC A;  2REF A;  2GAN A;  1S7K A;  5DWM A;  1K4J A;  2ZW6 A;  1YR0 A;  4Y49 B;  4AVC A;  2VXK A;  2KCW A;  1LRZ A;  4CAW A; 
#chains in the Genus database with same CATH topology
 4YGO A;  3ISZ A;  4NGS A;  5LRG A;  3WC5 A;  2X7B A;  3W6X A;  1LAN A;  4MJ8 A;  5J8F A;  3JVN A;  4PXC A;  4ZI6 A;  8CPA A;  4A31 A;  3S6K A;  1PCA A;  2PJ9 A;  3QB8 A;  4U9Z A;  3RYO A;  4UCP A;  3S6F A;  4MCR A;  1VHE A;  2B3V A;  4FD4 A;  3D3S A;  4P4E A;  2EWB A;  2Z10 A;  2BSW A;  3VAT A;  1YRE A;  1F57 A;  1UFH A;  1I21 A;  3B3T A;  3D68 A;  4II9 A;  3R9E A;  4UFV A;  4K30 A;  1QSO A;  4UCM A;  3F8K A;  2BOA A;  3WAB A;  2B58 A;  5K8N A;  3GUX A;  3NFZ A;  4HNX B;  2Q44 A;  1XMB A;  4AG7 A;  4KVO E;  1LOK A;  2B4D A;  4A37 A;  2H5M A;  2WSA A;  3S9M A;  4EVY A;  2Z3P A;  4KSI A;  2PDO A;  2YNE A;  4KUB A;  2PJC A;  3V38 A;  1YME A;  4MFK A;  4MHZ A;  1M4D A;  2G3A A;  2DPT A;  4KLW A;  4WWV A;  4CAE A;  4NGM A;  2O4H A;  1S7N A;  3D4U A;  4L8A A;  3SI2 A;  3D67 A;  3L2N A;  2G9D A;  5CNP A;  4OID A;  3FEC A;  4U5Y A;  1Z9U A;  4UA3 A;  1KUY A;  1YQE A;  4PSW A;  4UIB A;  2Z3L A;  1TKF A;  2EK8 A;  1LAP A;  3D2P A;  2EUI A;  5F48 A;  4MFP A;  1ELM P;  1QST A;  3PFO A;  4HNW B;  2P6G A;  2ZEP A;  2I79 A;  2YND A;  4MXU A;  3D66 A;  3DDD A;  1LCP A;  4ZY1 A;  2IMO A;  2NSM A;  3TFY A;  2FVG A;  5ISV A;  2YNC C;  4UFX A;  1TXR A;  4B6Z A;  4CGL A;  1Q2D A;  4KOT A;  2F8H A;  4GM5 A;  4P4F A;  4CGM A;  3IJ3 A;  3VWD A;  3TO9 A;  1IGB A;  1Y9W A;  2HV2 A;  4M6H A;  2OH1 A;  2R1I A;  4CYO A;  3N5F A;  1YGH A;  2V8D A;  2Q7S A;  3K9T A;  4W9Y A;  2G3T A;  2R98 A;  1CX8 A;  2D4P A;  1XEB A;  4UFW A;  3PZJ A;  4DJL A;  2AFW A;  4R57 A;  4KUA A;  3KQZ A;  5C82 A;  2QVP A;  3KKW A;  3T90 A;  3FYN A;  4P4J A;  1Q7L A;  4XPD B;  4JYW A;  4UEF A;  4E8O A;  3IWW A;  1IOI A;  2OZU A;  1BPN A;  3QAY A;  4X5K A;  4CAW A;  2PIZ A;  4NGT A;  1M44 A;  2GIV A;  3BJ7 A;  3DR6 A;  2K5T A;  3JRU A;  1NE9 A;  2Q4Z A;  2QJ8 A;  3PB8 X;  3RAM A;  4CRY B;  1TF8 A;  2J9A A;  4PQA A;  3SHP A;  1SQH A;  3PRT A;  4R3L A;  2FE7 A;  3QAH A;  3TO7 A;  2D4O A;  1P0H A;  3ZZI A;  4B12 A;  5F46 A;  2JDC A;  4QUS A;  3IWE A;  3W91 A;  2CIJ A;  2GRE A;  1CP6 A;  4P44 A;  3JUW A;  5C88 A;  2AFU A;  1YVO A;  2HB6 A;  3R95 A;  1IYL A;  1OBR A;  1ZLH A;  2PRQ A;  4DYO A;  2WPW A;  1YK3 A;  1Z5R A;  2DF5 A;  1QSN A;  5KTA A;  2ABZ A;  1XRY A;  2ZW7 A;  2WPX A;  2WUU A;  3FIX A;  4LQ6 A;  3S6H A;  1KZF A;  4PXD A;  3B3V A;  3DSB A;  5BWA B;  3B2Y A;  3F5B A;  4K3N A;  1HDQ A;  3NE7 A;  3TC8 A;  4YU9 A;  3NA6 A;  2FCK A;  5DS0 A;  3MGD A;  5H86 A;  5I4M A;  2PJ6 A;  4ZY0 A;  4EME A;  4NJQ A;  2EBJ A;  3SJF A;  3D7D A;  3I9S A;  3RZA A;  1F2P A;  4U9Y A;  1MJ9 A;  3FX6 A;  4R3K A;  5AG5 A;  4BMH A;  2C6P A;  5KTD A;  4BIN A;  4JXR A;  3CXS A;  1JWQ A;  1JQG A;  2PE3 A;  3KI9 A;  5JQ4 A;  2YGW A;  3WC6 A;  2FSR A;  2ZW5 A;  2ODF A;  2ZEH A;  4FD6 A;  4OC0 A;  5IB0 A;  3D7G A;  3IGR A;  1CPS A;  1M4G A;  4MFZ A;  1Y0Y A;  3ZJ0 A;  1ZG7 A;  4XPL A;  4CGO A;  4ZGY B;  3P2H A;  4MFJ A;  1Y7E A;  4UWI A;  3PBB A;  3TO6 A;  1YW4 A;  4RI1 A;  3FNC A;  1Z8L A;  2YNC A;  4FWU A;  4M85 A;  5G21 A;  3EO4 A;  1KWM A;  5CPA A;  3FEE A;  3HUV A;  4OC2 A;  3FF3 A;  3VH9 A;  4AXV A;  2AE6 A;  2AFS A;  2GU2 A;  3TOB A;  3B8G A;  4ZX9 A;  4AG9 A;  1MJA A;  1P4N A;  3I1U A;  2JBJ A;  2QEC A;  1BPM A;  4QBJ A;  2HQY A;  2CTC A;  2CXA A;  5AG6 A;  2ZEE A;  1ZO0 A;  4NSQ A;  3VAR A;  2OR4 A;  1YLE A;  1YLO A;  3PEI A;  1ON0 A;  5EC4 A;  1PYT B;  4NXY A;  4AVB A;  4BBH A;  3EY5 A;  2F5I A;  4BD9 A;  1QSM A;  4H89 A;  2PJ2 A;  4GS4 A;  3PB4 X;  3R9G A;  2B3U A;  2PCU A;  1I12 A;  1B6B A;  2QYV A;  3V8I A;  5H84 A;  3WC7 A;  4ZY2 A;  4KOR A;  2A4N A;  4IUS A;  4KSF A;  4FD5 A;  2Z0Z A;  2VBQ A;  5HXD A;  1S60 A;  4Q36 A;  1M1D A;  3IIB A;  5THW A;  4A95 A;  1HEE A;  2BUE A;  2Z11 A;  4CYQ A;  4LQG A;  4UEE A;  5D8N A;  2CNT A;  2Q43 A;  5LYD A;  4P10 A;  1ZG9 A;  4OP4 A;  4MCS A;  4YFJ A;  4FAI A;  1YVK A;  3E0K A;  3VWE A;  1Z4R A;  5LYI A;  4ONW A;  1EE3 P;  1GHE A;  3I3G A;  4KOU A;  1Z8T A;  2V77 A;  4X3R A;  3HLP A;  2ZED A;  2ZEG A;  2ZEF A;  3D8P A;  2IL4 A;  3IFE A;  3PB7 X;  4NGN A;  3T9Y A;  1R3N A;  1Z8X A;  3SI0 A;  1N71 A;  1BOB A;  1Z4E A;  4HPS A;  4P4D A;  4C7H A;  2AFO A;  2JDD A;  3V7Z A;  5IV0 A;  4MY0 A;  4XNH C;  1Y9K A;  3LWU A;  2VL1 A;  1VGY A;  3BJ8 A;  4M6G A;  4PK3 A;  1LFW A;  3GIU A;  2J8R A;  1R43 A;  3DLJ A;  4CAV A;  4C68 A;  2ZEN A;  1AYE A;  2REE A;  4TNU A;  1XFO A;  3TX8 A;  1ARM A;  2V8V A;  5HH1 A;  1I1D A;  3ISX A;  4E0A A;  5K8P A;  3FED A;  5J8C A;  3WR7 A;  2ATR A;  2EK9 A;  4B14 A;  2P0W A;  1BLL E;  5G20 A;  1XBU A;  4F6A A;  3CPA A;  4OC1 A;  3R1K A;  1ZG8 A;  2XEJ A;  2PJ4 A;  5K8O A;  2V8G A;  2C27 A;  2G0B A;  2VI7 A;  2XEI A;  2RC4 A;  3FB3 A;  3TOA A;  3G8W A;  2Z3O A;  1IU8 A;  2PVW A;  2GLF A;  1XMT A;  3OWC A;  2PR1 A;  4P4I A;  4YWY A;  4R87 A;  4NGQ A;  5HVH A;  2P6E A;  5F49 A;  2I3C A;  1VIX A;  4ZBG A;  3FH4 A;  4KOW A;  2FL4 A;  4I49 A;  4NFR A;  4KOV A;  4A2Z A;  4B10 A;  2Q0Y A;  3BLN A;  3IC1 A;  4PPZ A;  1CPX A;  5LRK A;  3BXM A;  2DEA A;  1S3Z A;  4P6Y A;  4X2T A;  1Z2L A;  3G3S A;  3SI1 A;  1XOV A;  1IID A;  4OAE A;  2V8H A;  1TF9 A;  4CS0 B;  4J3G A;  2JLM A;  1FY7 A;  3IU1 A;  2PRB A;  2ARH A;  2CF4 A;  4KS9 A;  2VZZ A;  4JLY A;  3CT9 A;  1WWZ A;  2J8N A;  4MBU A;  3NE8 A;  4C2Y A;  4CAX A;  4PXB A;  1XF8 A;  4MHN A;  2R8V A;  2I00 A;  2WZN A;  3B3W A;  4H2K A;  3KGQ A;  3KR4 A;  4FD7 A;  5LYL A;  4FBE A;  1HDU A;  1YW6 A;  2PVV A;  4CPA A;  1WK4 A;  4KZT A;  1XIX A;  3B35 A;  3NH8 A;  1QSR A;  4NJR A;  3EC4 A;  5ELY A;  2HUZ A;  2AFX A;  3B3S A;  3KHX A;  2EVN A;  4JXQ A;  4OME A;  4MHY A;  2DPS A;  2DXQ A;  2Z3N A;  3FXT A;  4MHD A;  4CYN A;  4OLL A;  1RTQ A;  1A2Z A;  4KVX A;  2B5G A;  3EFA A;  1YX0 A;  3UY5 A;  3BI1 A;  2IJZ A;  3JTK A;  5E96 A;  3D7F A;  3P2F A;  5G22 A;  4B5P A;  2CNS A;  5DWN A;  3GLJ A;  4MY3 A;  4MFL A;  2XEF A;  4MFQ A;  3RNZ A;  5LYF A;  3FRM A;  4HNY B;  3RBU A;  2PJ7 A;  1LAM A;  3GKR A;  3IO1 A;  4TWE A;  2Q7B A;  1NMT A;  7CPA A;  5I0C A;  4C2X A;  1NSL A;  2Q04 A;  4LUA A;  3SXO A;  2OZG A;  3LMS A;  4O23 A;  4OC5 A;  4E2A A;  2GFQ A;  3MRU A;  1F2O A;  4NEX A;  3PGP A;  5FVJ A;  2C6G A;  4JJX A;  2OOT A;  2PJ3 A;  4UF4 A;  3KAS A;  4IK2 A;  4A38 A;  1TKH A;  5IX3 A;  3IU2 A;  2EO8 A;  5GCN A;  1MJB A;  2POK A;  5HVG A;  2ZOF A;  3D7H A;  4R8F A;  5HVF A;  4UCN A;  3N7Z A;  5D29 A;  5A27 A;  1PUA A;  1S7L A;  2CNM A;  2Q51 A;  3FVL A;  3H4Q A;  5K8M A;  1TKJ A;  2Z3K A;  1Y7R A;  1GYT A;  3PP9 A;  3TCV A;  4F0Y A;  2RFH A;  4KOS A;  4KOY A;  2FT0 A;  2Q4V A;  2ZOG A;  1R57 A;  3TE4 A;  1S5K A;  2Q4Y A;  4MI4 A;  5A28 A;  2XEG A;  1RXT A;  1CG2 A;  2CY2 A;  4ORF A;  4B13 A;  3DNS A;  2PC1 A;  4A39 A;  4KSA A;  2PR8 A;  3D2M A;  1ZLI A;  3WT4 A;  2NMT A;  3FBU A;  3KZW A;  1X10 A;  1Y0R A;  1Q2Y A;  2NYQ A;  2PIY A;  3IWG A;  2ZPA A;  4CGN A;  1MK4 A;  1PU9 A;  5G1Z A;  2ZEO A;  3SJE A;  4F9V A;  2JBK A;  1IY7 A;  3H5Z A;  1L0C A;  2OU2 A;  3R96 A;  4X8I A;  3A9L A;  3F0A A;  4PV6 A;  4YRH A;  4Z65 A;  3CXQ A;  3H8E A;  5AGE A;  5EMI A;  1M4L A;  3BI0 A;  4CYP A;  1ARL A;  2JEW A;  2OZH A;  2PJ8 A;  2R7H A;  4R9M A;  2Z3M A;  2RB7 A;  4NGR A;  2PJ5 A;  4OC3 A;  4XPD C;  4B11 A;  3LD2 A;  4OIW A;  1V0C A;  3KQX A;  2ANP A;  4ZYQ A;  2JEV A;  3RO0 A;  5JGF A;  3S6G A;  3H8F A;  4KLV A;  3QNV A;  2C6C A;  4CRZ B;  1CJW A;  2ZEM A;  4F9U A;  3GY9 A;  1FT7 A;  2FIA A;  2F7V A;  2P6F A;  4AB7 A;  3S9N A;  3CXP A;  4R6T A;  4RN7 A;  4DUK A;  1BO4 A;  3LAC A;  5JM6 A;  4OC4 A;  1IB1 E;  4JWP A;  3PFE A;  4R76 A;  4G1P A;  1H8L A;  4P4B A;  1M4I A;  4C2Z A;  3S9L A;  3SJG A;  2AFZ A;  4EFD A;  5AG4 A;  3CPX A;  4M6I A;  4ONU A;  4IF5 A;  2VQY A;  2BEI A;  4PK2 A;  3LOD A;  4QB9 A;  1CBX A;  2GE3 A;  4P45 A;  5CBM A;  3CZX A;  1IIC A;  4AVA A;  1AUG A;  1QQ9 A;  4MCP A;  4JZ0 A;  3PBE A;  2VEZ A;  1VHS A;  4ZX8 A;  2HC9 A;  1CM0 A;  1TIQ A;  4UWJ A;  1KUV A;  2B5G B;  4FUU A;  1J4J A;  1KUX A;  4B5P B;  1YSJ A;  4H6Z A;  3NH4 A;  3SXN A;  3TT2 A;  2PJ1 A;  4EWT A;  3B3C A;  1Z8W A;  4UIA A;  4XNH B;  3FJU A;  3TTH A;  5HMN A;  1NSA A;  1AMP A;  3H8G A;  3PB6 X;  1DTD A;  4PXE A;  3DGV A;  2PJA A;  4HKF A;  1QMU A;  4NF1 A;  2BCO A;  3SJX A;  4XPK A;  2FS5 A;  3IEH A;  5IB9 A;  4Q7A A;  2AFM A;  4F8Z A;  3MN8 A;  2AJ6 A;  5JH9 A;  4A94 A;  3C26 A;  3T8W A;  1U6M A;  1CP7 A;  4QC6 A;  4LX9 A;  4Y49 C;  2OB0 A;  5LRJ A;  2IQ6 A;  2FXF A;  2GLJ A;  1B87 A;  2VZY A;  4OKO A;  2ZW4 A;  4OAD A;  3DR8 A;  3CDX A;  1IYK A;  3GB0 A;  4IHM A;  4NGP A;  2CTB A;  4MHP A;  2Y0M A;  3KR5 A;  3PB9 X;  4A32 A;  4F0X A;  2PSW A;  1XE4 A;  2BL1 A;  1X12 A;  3K9U A;  4QVT A;  4CAF A;  4H6U A;  2C1C A;  2WYR A;  4B5O A;  2J8M A;  4MMO A;  3B7I A;  4MCQ A;  1DE4 C;  4PSX A;  4UEZ A;  3R9F A;  1RO5 A;  1XJO A;  3W6S A;  5F09 A;  2ZEL A;  4KOX A;  2B4B A;  2ZXV A;  1VHO A;  1IOF A;  4A30 A;  4IAV A;  4M3S A;  5EBV A;  2BO9 A;  4DNC A;  1ELL P;  3GYA A;  4L89 A;  4A33 A;  2O28 A;  2PJB A;  4RS2 A;  2QML A;  4Q38 A;  3NH5 A;  4GXH A;  2PJ0 A;  4NCZ A;  3KL9 A;  3K2K A;  3BHX A;  1BAV A;  5JPH A;  2O53 A;  5KTC A;  5AG7 A;  2QIR A;  4JD6 A;  1S7F A;  4UBR A;  1OZP A;  1Q2C A;  2B4D B;  2FIW A;  2PQ8 A;  3EXN A;  3FMC A;  4MRI A;  4KVM E;  5F47 A;  1VKC A;  4WJB A;  2REF A;  2GAN A;  1S7K A;  5DWM A;  1FNO A;  1K4J A;  6CPA A;  2ZW6 A;  1UWY A;  5J1Q A;  1YR0 A;  4Y49 B;  4AVC A;  4C7I A;  2VXK A;  2KCW A;  1LRZ A;  4CGP A;  4RUH A;  3KHZ A;  4R7M A; 
#chains in the Genus database with same CATH homology
 4YGO A;  2X7B A;  3W6X A;  4MJ8 A;  5J8F A;  3JVN A;  4A31 A;  3S6K A;  3RYO A;  3QB8 A;  4U9Z A;  3S6F A;  4UCP A;  2B3V A;  4FD4 A;  3D3S A;  2Z10 A;  2BSW A;  1YRE A;  1UFH A;  1I21 A;  4II9 A;  3R9E A;  4UFV A;  4K30 A;  1QSO A;  4UCM A;  3F8K A;  2B58 A;  4HNX B;  2Q44 A;  4AG7 A;  4KVO E;  2B4D A;  2H5M A;  2WSA A;  4EVY A;  2Z3P A;  2PDO A;  2YNE A;  4KUB A;  4MFK A;  1M4D A;  2G3A A;  2DPT A;  4KLW A;  4CAE A;  1S7N A;  4L8A A;  5CNP A;  4U5Y A;  4UA3 A;  1Z9U A;  1KUY A;  4PSW A;  2Z3L A;  3D2P A;  2EUI A;  5F48 A;  4MFP A;  4HNW B;  1QST A;  2P6G A;  2I79 A;  2YND A;  3DDD A;  3TFY A;  5ISV A;  2YNC C;  4UFX A;  4CGL A;  1Q2D A;  4KOT A;  4CGM A;  3VWD A;  3TO9 A;  1Y9W A;  2HV2 A;  2OH1 A;  2R1I A;  4CYO A;  1YGH A;  2G3T A;  2R98 A;  2D4P A;  4UFW A;  1XEB A;  3PZJ A;  4R57 A;  4KUA A;  5C82 A;  3KKW A;  3T90 A;  3FYN A;  4XPD B;  4E8O A;  2OZU A;  4X5K A;  1M44 A;  2GIV A;  3BJ7 A;  3DR6 A;  2K5T A;  1NE9 A;  4CRY B;  3TO7 A;  3SHP A;  1SQH A;  4R3L A;  2FE7 A;  3QAH A;  2D4O A;  1P0H A;  3ZZI A;  4B12 A;  5F46 A;  2JDC A;  4QUS A;  3IWE A;  3W91 A;  3JUW A;  5C88 A;  1YVO A;  3R95 A;  1IYL A;  2WPW A;  1YK3 A;  1QSN A;  5KTA A;  2ZW7 A;  2WPX A;  2WUU A;  3FIX A;  3S6H A;  1KZF A;  3DSB A;  5BWA B;  3F5B A;  3NE7 A;  2FCK A;  3MGD A;  5H86 A;  3I9S A;  4U9Y A;  1MJ9 A;  4R3K A;  5AG5 A;  4BMH A;  5KTD A;  4JXR A;  3CXS A;  5JQ4 A;  2YGW A;  2FSR A;  2ZW5 A;  4FD6 A;  5IB0 A;  3IGR A;  4MFZ A;  1M4G A;  3ZJ0 A;  4CGO A;  4XPL A;  4ZGY B;  3P2H A;  4MFJ A;  4UWI A;  3TO6 A;  4RI1 A;  3FNC A;  2YNC A;  5G21 A;  4M85 A;  3EO4 A;  2AE6 A;  3TOB A;  3B8G A;  4AG9 A;  1MJA A;  1P4N A;  2QEC A;  4QBJ A;  2HQY A;  2CXA A;  5AG6 A;  1ZO0 A;  4NSQ A;  1YLE A;  1ON0 A;  5EC4 A;  4AVB A;  4NXY A;  4BBH A;  3EY5 A;  2F5I A;  1QSM A;  4H89 A;  4GS4 A;  3R9G A;  2B3U A;  1I12 A;  1B6B A;  3V8I A;  4DNC A;  5H84 A;  4KOR A;  2A4N A;  4IUS A;  4KSF A;  4FD5 A;  2Z0Z A;  2VBQ A;  1S60 A;  4Q36 A;  1M1D A;  4A95 A;  2BUE A;  2Z11 A;  4CYQ A;  2CNT A;  4YFJ A;  1YVK A;  3E0K A;  3VWE A;  1Z4R A;  3I3G A;  1GHE A;  4KOU A;  3D8P A;  2IL4 A;  3T9Y A;  1N71 A;  1BOB A;  1Z4E A;  4C7H A;  2JDD A;  5IV0 A;  4MY0 A;  4XNH C;  1Y9K A;  3BJ8 A;  4PK3 A;  2J8R A;  4CAV A;  4C68 A;  2REE A;  5HH1 A;  1I1D A;  4E0A A;  5J8C A;  3WR7 A;  2ATR A;  4B14 A;  2P0W A;  5G20 A;  4F6A A;  3R1K A;  2C27 A;  2G0B A;  2VI7 A;  3FB3 A;  2RC4 A;  3TOA A;  3G8W A;  2Z3O A;  3OWC A;  1XMT A;  2PR1 A;  4R87 A;  2P6E A;  5F49 A;  4ZBG A;  4KOW A;  2FL4 A;  4I49 A;  4KOV A;  4A2Z A;  4B10 A;  2Q0Y A;  3BLN A;  1S3Z A;  3G3S A;  1IID A;  4OAE A;  4CS0 B;  4J3G A;  2JLM A;  1FY7 A;  3IU1 A;  2PRB A;  2ARH A;  4KS9 A;  2VZZ A;  4JLY A;  1WWZ A;  2J8N A;  4MBU A;  4C2Y A;  4CAX A;  1XF8 A;  2R8V A;  2I00 A;  4FD7 A;  1WK4 A;  4KZT A;  1XIX A;  1QSR A;  3EC4 A;  2HUZ A;  2EVN A;  4JXQ A;  2DPS A;  2DXQ A;  2Z3N A;  3FXT A;  4MHD A;  4CYN A;  4OLL A;  4KVX A;  2B5G A;  3EFA A;  1YX0 A;  3UY5 A;  3JTK A;  5E96 A;  5G22 A;  3P2F A;  4B5P A;  2CNS A;  5DWN A;  4MY3 A;  4MFL A;  4MFQ A;  3FRM A;  4HNY B;  3GKR A;  2Q7B A;  1NMT A;  5I0C A;  4C2X A;  1NSL A;  2Q04 A;  4LUA A;  3SXO A;  2OZG A;  4E2A A;  4NEX A;  3PGP A;  5FVJ A;  4JJX A;  5IX3 A;  3IU2 A;  5GCN A;  1MJB A;  4UCN A;  3N7Z A;  5A27 A;  1PUA A;  1S7L A;  2CNM A;  3H4Q A;  2Z3K A;  1Y7R A;  3TCV A;  3PP9 A;  4F0Y A;  4KOS A;  4KOY A;  2FT0 A;  2Q4V A;  1R57 A;  3TE4 A;  1S5K A;  2Q4Y A;  4MI4 A;  5A28 A;  1RXT A;  2CY2 A;  4ORF A;  4B13 A;  3DNS A;  2PC1 A;  4KSA A;  2PR8 A;  3D2M A;  2NMT A;  3FBU A;  1Q2Y A;  3IWG A;  2ZPA A;  4CGN A;  1MK4 A;  1PU9 A;  5G1Z A;  3H5Z A;  1L0C A;  2OU2 A;  3R96 A;  3A9L A;  3F0A A;  4PV6 A;  4YRH A;  3CXQ A;  5AGE A;  4CYP A;  2R7H A;  2OZH A;  4R9M A;  2Z3M A;  4XPD C;  4B11 A;  3LD2 A;  1V0C A;  2JEV A;  3S6G A;  4KLV A;  4CRZ B;  1CJW A;  3GY9 A;  2FIA A;  2P6F A;  4AB7 A;  3CXP A;  1BO4 A;  1IB1 E;  4JWP A;  1M4I A;  4C2Z A;  5AG4 A;  4ONU A;  4IF5 A;  2VQY A;  2BEI A;  4PK2 A;  3LOD A;  4QB9 A;  2GE3 A;  1IIC A;  4AVA A;  2VEZ A;  1VHS A;  1CM0 A;  1TIQ A;  4UWJ A;  1KUV A;  2B5G B;  1J4J A;  1KUX A;  4B5P B;  4H6Z A;  3SXN A;  3TT2 A;  4XNH B;  3TTH A;  5HMN A;  4HKF A;  4NF1 A;  4XPK A;  2FS5 A;  2AJ6 A;  3C26 A;  1U6M A;  4QC6 A;  4LX9 A;  4Y49 C;  2OB0 A;  2FXF A;  1B87 A;  2VZY A;  2ZW4 A;  4OAD A;  3DR8 A;  1IYK A;  2Y0M A;  4A32 A;  4F0X A;  2PSW A;  1XE4 A;  2BL1 A;  3K9U A;  4QVT A;  4CAF A;  4H6U A;  4B5O A;  2J8M A;  4PSX A;  3R9F A;  1RO5 A;  3W6S A;  4KOX A;  2B4B A;  2ZXV A;  4A30 A;  4M3S A;  5EBV A;  3GYA A;  4L89 A;  4A33 A;  2O28 A;  4RS2 A;  2QML A;  4Q38 A;  4NCZ A;  5JPH A;  5KTC A;  5AG7 A;  2QIR A;  4JD6 A;  1S7F A;  4UBR A;  1OZP A;  1Q2C A;  2B4D B;  2FIW A;  2PQ8 A;  3EXN A;  4KVM E;  5F47 A;  1VKC A;  2REF A;  2GAN A;  1S7K A;  5DWM A;  1K4J A;  2ZW6 A;  1YR0 A;  4Y49 B;  4AVC A;  4C7I A;  2VXK A;  2KCW A;  1LRZ A;  4CGP A;  4CAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...