4RS2A

1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
HHTDPALRALIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEHFNRFGLCGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted acyltransferase with acyl-CoA N-acyltransferase do
publication title 1.55 Angstrom Crystal Structure of GNAT Family N-acetyltransferase (YhbS) from Escherichia coli in Complex with CoA.
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 48
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4rs2A00
1TIQA 1S7FA 5F47A 1I12A 5H84A 2WPWA 2G3TA 4AB7A 3DR6A 4PV6A 3LODA 3DR8A 1QSOA 4OAEA 4FD4A 2R7HA 4H89A 4ORFA 1V0CA 4L8AA 3FB3A 2G3AA 4FD6A 4XNHB 5KTAA 3FNCA 2FSRA 1BOBA 4BMHA 1Q2CA 4UA3A 4PSXA 4LX9A 1Q2YA 3VWDA 4IUSA 1M4DA 3JUWA 1YK3A 1B87A 4CRZB 1IICA 3B8GA 2IL4A 4OLLA 1QSMA 4YRHA 2P6GA 1XMTA 1UFHA 5HMNA 2B4BA 3QB8A 2VQYA 4JXRA 1WK4A 1KZFA 4HNWB 3SXNA 2VBQA 3TT2A 3P2HA 1Y9WA 4AG9A 4CAXA 4M3SA 2H5MA 2GE3A 3F8KA 4YFJA 3TOAA 4KORA 1YGHA 4JLYA 1QSRA 3T90A 2J8RA 3GKRA 2EUIA 1VKCA 2B5GB 2WPXA 4DNCA 4XPDB 4E0AA 3IGRA 3EO4A 1IB1E 1P4NA 3K9UA 4I49A 4J3GA 2PDOA 4QUSA 1PU9A 2Q04A 1RXTA 2B58A 4RI1A 3TO7A 2GANA 1J4JA 3ZJ0A 3T9YA 3NE7A 3TO9A 4AG7A 4L89A 1YVKA 4AVCA 1QSTA 2I79A 2Q0YA 1IIDA 2F5IA 1R57A 4E8OA 4CAWA 4JD6A 2OU2A 2VZZA 4JWPA 2HUZA 3G8WA 4B5PB 4R57A 1KUYA 4U9YA 2B3UA 1RO5A 3DSBA 3C26A 3EC4A 4X5KA 4XNHC 3S6HA 5GCNA 3SXOA 4EVYA 3E0KA 2REFA 2JDCA 2A4NA 1Q2DA 2ZW7A 3R96A 3W6XA 3BJ8A 4AVAA 3CXSA 4NCZA 4NEXA 1LRZA 4E2AA 5E96A 2JDDA 3FIXA 1M4IA 5HH1A 3S6FA 4KVOE 1QSNA 1OZPA 3GY9A 2QECA 1S5KA 4UWJA 4R3LA 3ZZIA 3R9FA 2ZW5A 3EXNA 1N71A 2K5TA 2R98A 3PP9A 4JJXA 2Z0ZA 5DWNA 3UY5A 2CNSA 2QIRA 3DDDA 1S60A 4UBRA 1M4GA 2R8VA 2FT0A 3FYNA 2BEIA 3H4QA 4KUBA 2FXFA 2ZW6A 4XPDC 1WWZA 2REEA 2D4PA 5H86A 2J8MA 2Q7BA 3PZJA 4QBJA 2FCKA 2BUEA 1YR0A 2ARHA 4AVBA 5IB0A 2OB0A 4QC6A 1CM0A 3QAHA 5ISVA 2EVNA 1XIXA 4ZBGA 2AE6A 3TCVA 2HV2A 3S6KA 2JEVA 4KOSA 1IYLA 2OH1A 2KCWA 2FS5A 1L0CA 2Z10A 1NMTA 4FD7A 2FIAA 3V8IA 2CNTA 4HNXB 3I9SA 1M44A 4HKFA 5EBVA 3JVNA 4QVTA 2PQ8A 5C88A 2ZW4A 3IWGA 5EC4A 4KOXA 3D2PA 2B4DA 2OZGA 4UWIA 4R3KA 2FIWA 2P0WA 5F46A 4MI4A 2PRBA 4LUAA 4Y49B 2VZYA 1P0HA 2B4DB 3N7ZA 4MBUA 5F48A 3TTHA 1S3ZA 3D8PA 3EFAA 4MY3A 3EY5A 1SQHA 4PK2A 2ZPAA 4CAVA 2Q44A 2RC4A 4KOTA 1YX0A 1Z4RA 1XEBA 2Q4VA 4B5OA 1VHSA 3R9GA 3I3GA 4NF1A 1NE9A 2Q4YA 1CJWA 2BL1A 5CNPA 2DXQA 3TOBA 1Y7RA 1PUAA 3DNSA 2JLMA 4KUAA 5J8CA 1Z9UA 4XPLA 2HQYA 4KOUA 4YGOA 4NSQA 3GYAA 2QMLA 4ONUA 2B3VA 1BO4A 4KZTA 2C27A 3MGDA 2BSWA 3BLNA 3LD2A 4JXQA 1YLEA 2FL4A 1Y9KA 4KVME 1K4JA 1ON0A 2O28A 3WR7A 3TE4A 4II9A 2P6FA 3P2FA 4R9MA 1S7LA 3SHPA 5FVJA 5JQ4A 3VWEA 2VXKA 5J8FA 4F6AA 1MJAA 3F0AA 1YREA 5IV0A 2GIVA 2PR1A 1I1DA 1MJ9A 2I00A 3RYOA 4XPKA 2PC1A 4MHDA 1XF8A 1S7KA 3KKWA 3CXPA 3R1KA 1B6BA 3F5BA 4K30A 1GHEA 2CY2A 4NXYA 4MY0A 1Z4EA 1U6MA 1IYKA 4KVXA 1KUVA 4RS2A 1NSLA 3CXQA 3TO6A 2ATRA 2R1IA 4PK3A 3S6GA 3TFYA 3BJ7A 3R9EA 4H6ZA 5DWMA 4CRYB 2VEZA 2PSWA 2B5GA 3W6SA 2Y0MA 4Y49C 2D4OA 4KOWA 5I0CA 4KLWA 4M85A 3R95A 4U9ZA 2G0BA 2OZHA 3G3SA 4R87A 1YVOA 4IF5A 1MK4A 2Z11A 4PSWA 3FBUA 4U5YA 2FE7A 2PR8A 2J8NA 3W91A 2ZXVA 2CNMA 4F0YA 5KTDA 4MJ8A 2VI7A 4KLVA 1MJBA 4OADA 1XE4A 2OZUA 4KOVA 2NMTA 1I21A 4KOYA 5KTCA 4CS0B 4GS4A 4FD5A 4B5PA 4HNYB 1M1DA 3D3SA 5IX3A 3FXTA 2P6EA 5JPHA 1S7NA 3FRMA 2AJ6A 1FY7A 3PGPA 4H6UA 3OWCA 4QB9A 5C82A 1KUXA 2X7BA 3D2MA 5F49A
chains in the Genus database with same CATH superfamily
1TIQA 1FNOA 4CYNA 1S7FA 2ZOFA 5F47A 1I12A 2PJ1A 5H84A 2GLFA 2WPWA 1LAPA 4OC5A 3SJXA 2G3TA 4MHNA 2XEGA 2ZOGA 4AB7A 3B35A 1TKJA 3DR6A 4PV6A 3LODA 3RZAA 5LRGA 5LYDA 1IOFA 1QSOA 3DR8A 3PB9X 4OAEA 1IU8A 3IJ3A 4FD4A 5LRJA 4FBEA 1Y7EA 2R7HA 4H89A 4ORFA 2WYRA 1V0CA 4L8AA 4W9YA 5JM6A 3S9LA 3FB3A 2YNCA 4MHPA 1LCPA 1XRYA 2G3AA 4FD6A 4XNHB 5KTAA 4WJBA 2POKA 1Z8XA 3FNCA 2FSRA 3JTKA 5G1ZA 1XFOA 1BOBA 2C6CA 4MCRA 4UF4A 1F2OA 3FF3A 4OMEA 1Q2CA 4UA3A 3WABA 4BMHA 4OC3A 4Z65A 4MRIA 1JWQA 4PSXA 1ZG8A 4LX9A 3FJUA 4MCQA 4GM5A 4EWTA 4G1PA 1Q2YA 2PJ5A 3LMSA 1M4DA 4IUSA 4LQGA 3VWDA 3JUWA 1H8LA 1AMPA 1YK3A 4MFJA 1B87A 3PBEA 3DGVA 4CRZB 5I4MA 4P4JA 1IICA 3B8GA 2IL4A 4OLLA 3VARA 5HVGA 1QSMA 3CPXA 3CZXA 4YRHA 5LYIA 2P6GA 4LQ6A 1XMTA 1UFHA 5HMNA 2PE3A 1GYTA 1LANA 2B4BA 3QB8A 1CPXA 3H5ZA 2VQYA 3KGQA 4JXRA 1WK4A 4KSAA 1CX8A 4MHZA 3D7DA 4MFQA 2QJ8A 2WSAA 1KZFA 1F57A 4HNWB 3SXNA 2VBQA 3MN8A 3ISZA 3TT2A 5CBMA 3P2HA 1BAVA 1Y9WA 4AG9A 4CAXA 4M3SA 2H5MA 4A30A 4MFPA 2GE3A 2Q7SA 1CP6A 4OIDA 4UFXA 3KASA 1YQEA 2XEFA 3F8KA 4ZX8A 4YFJA 3TOAA 4CPAA 4KORA 1YGHA 4A2ZA 2O53A 1QSRA 2ZEHA 4JLYA 3T90A 1NSAA 1QQ9A 4PXCA 8CPAA 2J8RA 3GKRA 1VGYA 4OC0A 2AFZA 3CPAA 2EUIA 3B7IA 2YNEA 4CGLA 4HPSA 1VKCA 4PPZA 3KHXA 2B5GB 4OC4A 2WPXA 4UCNA 4DNCA 4XPDB 4RN7A 4E0AA 2PJ0A 3EO4A 3IGRA 4F9VA 1IB1E 1P4NA 2GREA 3K9UA 4I49A 5A27A 4J3GA 4ZI6A 2YGWA 2PDOA 4C7HA 1Q7LA 4QUSA 2RB7A 1PU9A 4OC1A 2Q04A 1RXTA 2B58A 2Z3KA 4RI1A 3TO7A 1Z8WA 2GANA 1J4JA 2Z3LA 3KHZA 3LACA 3ZJ0A 3T9YA 4ONWA 2J9AA 3NE7A 4O23A 3TO9A 1ZLHA 4AG7A 4L89A 1YVKA 3RAMA 4AVCA 5LRKA 1QSTA 2I79A 5D8NA 2Q0YA 2V8HA 3PB4X 4PXEA 5LYLA 2BCOA 4PXBA 1CP7A 4NGNA 1IIDA 1YLOA 3KQXA 4CGMA 2F5IA 1R57A 4E8OA 1ARMA 4CAWA 1CPSA 2ODFA 4YWYA 3A9LA 4C7IA 4JD6A 3IU2A 2OU2A 4NGRA 4CAEA 2VZZA 2BO9A 4JWPA 2HUZA 3G8WA 4B5PB 4OP4A 5AG7A 5CPAA 3BI0A 4R57A 3B2YA 2DEAA 4ZX9A 1KUYA 4M6HA 4OKOA 4U9YA 2B3UA 2CF4A 1RO5A 6CPAA 3DSBA 5AGEA 2FVGA 1YW6A 3C26A 3EC4A 4X5KA 4XNHC 3NH4A 3S6HA 1CG2A 5GCNA 3SXOA 4EVYA 3E0KA 2REFA 2JDCA 2ZEPA 2A4NA 3K9TA 4C2YA 2PRQA 1ELLP 1IOIA 4Q36A 3JRUA 1A2ZA 1Q2DA 4F9UA 2ZW7A 3R96A 3W6XA 3BJ8A 2GLJA 3DLJA 4AVAA 3CXSA 4NCZA 4NEXA 1LRZA 5HVFA 3LWUA 4DJLA 4E2AA 5E96A 4DYOA 2XEJA 2JDDA 3FIXA 1M4IA 5HH1A 3IC1A 1Z2LA 3S6FA 1F2PA 4KVOE 1QSNA 1DTDA 1OZPA 2Q43A 3GY9A 1VIXA 1BPNA 2EK8A 2QECA 4OIWA 4OC2A 4EMEA 1S5KA 2ZEEA 4NGTA 2PVVA 2G9DA 4UWJA 3FX6A 4R3LA 2OOTA 3ZZIA 3R9FA 1ZLIA 2ZW5A 2NYQA 4A33A 3EXNA 2EWBA 4CYQA 1N71A 4R8FA 4A95A 3D4UA 2K5TA 2R98A 3IU1A 3PP9A 3FECA 2Z0ZA 1ELMP 4JJXA 4NGSA 2CNSA 1UWYA 5DWNA 4MCSA 3UY5A 2HC9A 2IQ6A 4Q38A 2QIRA 4CAFA 1XBUA 3DDDA 1Z5RA 4UEFA 4B13A 1S60A 5G20A 2PJBA 1M4GA 2Z3PA 4IHMA 4MHYA 1FT7A 4NJQA 4UBRA 1M4LA 2R8VA 2FT0A 2Z3MA 3NA6A 3PBBA 3FYNA 1X10A 4NJRA 4P10A 3RNZA 4UEEA 3B3TA 2F8HA 1HDUA 2BEIA 2RFHA 3FEEA 3H4QA 2FXFA 2ZW6A 2DPTA 4KUBA 4XPDC 1WWZA 4C2XA 2REEA 1IY7A 5F09A 4A39A 1Z8TA 2D4PA 5H86A 3B3SA 2J8MA 2Q7BA 3PZJA 5JH9A 4TWEA 4QBJA 4P4EA 2FCKA 4F8ZA 2BUEA 1YR0A 2ARHA 4AVBA 5IB0A 2OB0A 4QC6A 3KR4A 1XMBA 2Q51A 3S9MA 1CM0A 4GXHA 3QAHA 5ISVA 2EVNA 1XIXA 4ZBGA 3KZWA 1LFWA 2AE6A 3TCVA 2HV2A 3S6KA 2V8VA 4P44A 2JEWA 2JEVA 4H2KA 5HVHA 3SJGA 4NGMA 3B3WA 4KOSA 2YNDA 1IYLA 2JBJA 2OH1A 3NH5A 3NH8A 2Z3OA 2KCWA 2FS5A 1L0CA 4P4BA 2Z10A 4AXVA 5LYFA 1NMTA 4FD7A 1ZO0A 4P45A 3TX8A 5J1QA 2ZEMA 1TKFA 1CBXA 2FIAA 1XJOA 5JGFA 3V8IA 2CNTA 4HNXB 2PJ7A 3I9SA 1M44A 4HKFA 5EBVA 3SJEA 3JVNA 4FUUA 4QVTA 3HUVA 2PQ8A 3T8WA 3NFZA 5C88A 2ZW4A 4B10A 3IWGA 4A31A 1LOKA 3FMCA 5IB9A 3WC7A 5EC4A 3SI0A 3SI2A 4KOXA 3D2PA 2B4DA 3TC8A 2OZGA 4P4IA 4R3KA 4UWIA 3BHXA 1LAMA 2FIWA 2P0WA 5F46A 4MI4A 4MCPA 3RO0A 2Q4ZA 4FAIA 2PJ8A 1PCAA 2CTCA 2PRBA 4PQAA 4LUAA 4Y49B 2VZYA 1P0HA 2B4DB 3N7ZA 4MBUA 3KI9A 5F48A 1S3ZA 3D8PA 3TTHA 3EFAA 4X3RA 2QYVA 1YW4A 4MY3A 3EY5A 2EO8A 1SQHA 4PK2A 2ZPAA 3H8EA 5AG6A 4CAVA 2Q44A 2RC4A 4B11A 5K8PA 4EFDA 4KOTA 1YX0A 1Z4RA 1XEBA 2Q4VA 1AYEA 4B5OA 1VHSA 2ZENA 1TF8A 3B3CA 1ZG9A 4IAVA 7CPAA 4BD9A 2NSMA 4ZYQA 3R9GA 3I3GA 4NF1A 3PRTA 1NE9A 3FH4A 4A94A 2CIJA 3IIBA 4MFLA 3VH9A 2V8DA 4A38A 2V77A 2ZEOA 2PJ2A 2Q4YA 1CJWA 2BL1A 2YNCC 3FVLA 5CNPA 1R3NA 2DXQA 3TOBA 1RTQA 2AFWA 4Q7AA 4ZY2A 2ZEFA 3FEDA 4BBHA 2PIZA 1Y7RA 5K8MA 1PYTB 3WC6A 4X2TA 3IO1A 4YU9A 1KWMA 1PUAA 5K8OA 4BINA 2O4HA 3V7ZA 3DNSA 2JLMA 4KSFA 4KUAA 2IJZA 5J8CA 4KS9A 2CTBA 1Z9UA 4XPLA 2C1CA 2HQYA 2AFUA 2VL1A 4KOUA 4NFRA 4YGOA 2ANPA 2AFSA 3D7FA 3BXMA 3GYAA 4NSQA 2QMLA 4ONUA 1TF9A 1XOVA 2ZELA 4B6ZA 2B3VA 5G21A 3HLPA 1BO4A 2IMOA 4KZTA 2C27A 2C6GA 3IWWA 3MGDA 2PJ4A 3KQZA 5AG5A 5HXDA 4A32A 4CGNA 2BSWA 1Y0YA 3BLNA 3LD2A 4JXQA 4M6GA 1YLEA 2FL4A 1Y9KA 5ELYA 4ZGYB 4KVME 1DE4C 3SI1A 1K4JA 1ON0A 2PIYA 4MFKA 3H8GA 2O28A 3PB6X 2AFMA 2XEIA 3WR7A 1VHEA 3TE4A 4II9A 2P6FA 5D29A 3GB0A 3P2FA 4R9MA 3D66A 2PVWA 5F49A 1BLLE 1S7LA 2HB6A 3SHPA 5FVJA 2PJAA 5JQ4A 3VWEA 4F0XA 4UCMA 2I3CA 2VXKA 5K8NA 5J8FA 4JZ0A 4F6AA 2Z3NA 1MJAA 3F0AA 4R6TA 4UFWA 1YREA 3IFEA 3PFOA 5IV0A 3CT9A 2GIVA 2BOAA 2PR1A 1I1DA 1MJ9A 2I00A 4P6YA 3RYOA 3GLJA 4XPKA 2ZEDA 2PC1A 1JQGA 1EE3P 4MHDA 4JYWA 1XF8A 3KR5A 2PJ6A 1S7KA 3KKWA 3VATA 3CXPA 3R1KA 1B6BA 3F5BA 4K30A 4P4FA 1GHEA 2CY2A 4NXYA 2WZNA 1Z4EA 1U6MA 4MY0A 1IYKA 4KVXA 1KUVA 3IWEA 4M6IA 3CXQA 3N5FA 4RS2A 1NSLA 3TO6A 4DUKA 1R43A 2ATRA 3RBUA 2R1IA 2JBKA 3H8FA 4KSIA 2CXAA 4PK3A 3S6GA 1BPMA 3QNVA 4UIAA 5A28A 3TFYA 3BJ7A 4C2ZA 3R9EA 4H6ZA 5DWMA 2EBJA 4CRYB 1HDQA 2QVPA 2VEZA 2PSWA 4PXDA 3D7GA 3L2NA 2B5GA 3PFEA 2Y0MA 3W6SA 4Y49C 2D4OA 4CGOA 2PCUA 4KOWA 5I0CA 4KLWA 3ISXA 4M85A 3R95A 4U9ZA 2G0BA 2OZHA 1YSJA 3G3SA 3I1UA 4MXUA 4RUHA 4CYPA 3IEHA 3CDXA 4R87A 4X8IA 4NGPA 1YVOA 4IF5A 4B12A 2AFOA 5EMIA 1MK4A 3PEIA 2Z11A 2WUUA 4PSWA 1QMUA 3FBUA 4U5YA 2FE7A 3KL9A 2DPSA 3WC5A 2PR8A 5BWAB 2J8NA 3W91A 1YMEA 2ZXVA 4K3NA 4UCPA 2F7VA 3GIUA 2CNMA 4B14A 4R7MA 2V8GA 2EK9A 2C6PA 3D68A 4MJ8A 2VI7A 2OR4A 4F0YA 5KTDA 4KLVA 1MJBA 4R76A 4NGQA 2ZEGA 4UIBA 2GU2A 1ZG7A 4OADA 1XE4A 1AUGA 3V38A 3WT4A 4IK2A 2OZUA 3S9NA 4KOVA 1HEEA 2GFQA 4CGPA 1X12A 2NMTA 1Z8LA 4CYOA 1ARLA 4UFVA 3SJFA 1I21A 2AFXA 4KOYA 5KTCA 4A37A 4C68A 4CS0B 3MRUA 4MMOA 4ZY0A 4GS4A 5THWA 4FD5A 4P4DA 5DS0A 1TXRA 3PB7X 1VHOA 2PJ9A 4B5PA 4FWUA 1M1DA 3BI1A 3D3SA 3K2KA 3FXTA 4HNYB 4MFZA 5IX3A 2P6EA 3PB8X 1TKHA 3B3VA 2PJ3A 3GUXA 5JPHA 1S7NA 1Y0RA 2ABZA 1OBRA 2AJ6A 3FRMA 5AG4A 4TNUA 3D67A 2DF5A 1FY7A 3PGPA 2PJCA 4H6UA 4ZY1A 4WWVA 3NE8A 3OWCA 4QB9A 5C82A 1KUXA 3QAYA 4UEZA 5G22A 2X7BA 3D2MA 1IGBA 3D7HA
chains in the Genus database with same CATH topology
1TIQA 4CYNA 1S7FA 5F47A 1I12A 5H84A 2WPWA 2G3TA 4AB7A 3DR6A 4PV6A 3LODA 3DR8A 1QSOA 4OAEA 4FD4A 2R7HA 4H89A 4ORFA 1V0CA 4L8AA 3FB3A 2YNCA 2G3AA 4FD6A 4XNHB 5KTAA 3FNCA 2FSRA 3JTKA 5G1ZA 1BOBA 4BMHA 1Q2CA 4UA3A 4PSXA 4LX9A 1Q2YA 3VWDA 4IUSA 1M4DA 3JUWA 4MFJA 1YK3A 1B87A 4CRZB 1IICA 3B8GA 2IL4A 4OLLA 1QSMA 4YRHA 2P6GA 1XMTA 1UFHA 5HMNA 2B4BA 3QB8A 3H5ZA 2VQYA 4JXRA 1WK4A 4KSAA 4MFQA 2WSAA 1KZFA 4HNWB 3SXNA 2VBQA 3TT2A 3P2HA 1Y9WA 4AG9A 4CAXA 4M3SA 2H5MA 4A30A 4MFPA 2GE3A 4UFXA 3F8KA 4YFJA 3TOAA 4KORA 1YGHA 4A2ZA 4JLYA 1QSRA 3T90A 2J8RA 3GKRA 2EUIA 2YNEA 4CGLA 1VKCA 2B5GB 2WPXA 4UCNA 4DNCA 4XPDB 4E0AA 3IGRA 3EO4A 1IB1E 1P4NA 3K9UA 4I49A 5A27A 4J3GA 2YGWA 2PDOA 4C7HA 4QUSA 1PU9A 2Q04A 1RXTA 2B58A 2Z3KA 4RI1A 3TO7A 2GANA 1J4JA 2Z3LA 3ZJ0A 3T9YA 3NE7A 3TO9A 4AG7A 4L89A 1YVKA 4AVCA 1QSTA 2I79A 2Q0YA 4CGMA 1IIDA 2F5IA 1R57A 4E8OA 4CAWA 3A9LA 4C7IA 4JD6A 3IU2A 2OU2A 4CAEA 2VZZA 4JWPA 2HUZA 3G8WA 4B5PB 5AG7A 4R57A 1KUYA 4U9YA 2B3UA 1RO5A 3DSBA 5AGEA 3C26A 3EC4A 4X5KA 4XNHC 3S6HA 5GCNA 3SXOA 4EVYA 3E0KA 2REFA 2JDCA 2A4NA 4C2YA 4Q36A 1Q2DA 2ZW7A 3R96A 3W6XA 3BJ8A 4AVAA 3CXSA 4NCZA 4NEXA 1LRZA 4E2AA 5E96A 2JDDA 3FIXA 1M4IA 5HH1A 3S6FA 4KVOE 1QSNA 1OZPA 3GY9A 2QECA 1S5KA 4UWJA 4R3LA 3ZZIA 3R9FA 2ZW5A 4A33A 3EXNA 4CYQA 1N71A 4A95A 2K5TA 2R98A 3IU1A 3PP9A 4JJXA 2Z0ZA 5DWNA 3UY5A 2CNSA 4Q38A 2QIRA 4CAFA 3DDDA 4B13A 1S60A 5G20A 2Z3PA 1M4GA 4UBRA 2Z3MA 2R8VA 2FT0A 3FYNA 2BEIA 3H4QA 4KUBA 2FXFA 2ZW6A 2DPTA 4XPDC 1WWZA 4C2XA 2REEA 2D4PA 5H86A 2J8MA 2Q7BA 3PZJA 4QBJA 2FCKA 2BUEA 1YR0A 2ARHA 4AVBA 5IB0A 2OB0A 4QC6A 1CM0A 3QAHA 5ISVA 2EVNA 1XIXA 4ZBGA 2AE6A 3TCVA 2HV2A 3S6KA 2JEVA 4KOSA 2YNDA 1IYLA 2OH1A 2Z3OA 2KCWA 2FS5A 1L0CA 2Z10A 1NMTA 4FD7A 1ZO0A 2FIAA 3V8IA 2CNTA 4HNXB 3I9SA 1M44A 4HKFA 5EBVA 3JVNA 4QVTA 2PQ8A 5C88A 2ZW4A 4B10A 3IWGA 4A31A 5EC4A 4KOXA 3D2PA 2B4DA 2OZGA 4UWIA 4R3KA 2FIWA 2P0WA 5F46A 4MI4A 2PRBA 4LUAA 4Y49B 2VZYA 1P0HA 2B4DB 3N7ZA 4MBUA 5F48A 3TTHA 1S3ZA 3D8PA 3EFAA 4MY3A 3EY5A 1SQHA 4PK2A 2ZPAA 5AG6A 4CAVA 2Q44A 2RC4A 4B11A 4KOTA 1YX0A 1Z4RA 1XEBA 2Q4VA 4B5OA 1VHSA 3R9GA 3I3GA 4NF1A 1NE9A 4MFLA 2Q4YA 1CJWA 2BL1A 2YNCC 5CNPA 2DXQA 3TOBA 4BBHA 1Y7RA 1PUAA 3DNSA 2JLMA 4KSFA 4KUAA 5J8CA 4KS9A 1Z9UA 4XPLA 2HQYA 4KOUA 4YGOA 4NSQA 3GYAA 2QMLA 4ONUA 2B3VA 5G21A 1BO4A 4KZTA 2C27A 3MGDA 5AG5A 4A32A 4CGNA 2BSWA 3BLNA 3LD2A 4JXQA 1YLEA 2FL4A 1Y9KA 4ZGYB 4KVME 1K4JA 1ON0A 4MFKA 2O28A 3WR7A 3TE4A 4II9A 2P6FA 3P2FA 4R9MA 1S7LA 3SHPA 5FVJA 5JQ4A 3VWEA 4F0XA 4UCMA 2VXKA 5J8FA 4F6AA 2Z3NA 1MJAA 3F0AA 4UFWA 1YREA 5IV0A 2GIVA 2PR1A 1I1DA 1MJ9A 2I00A 3RYOA 4XPKA 2PC1A 4MHDA 1XF8A 1S7KA 3KKWA 3CXPA 3R1KA 1B6BA 3F5BA 4K30A 1GHEA 2CY2A 4NXYA 4MY0A 1Z4EA 1U6MA 1IYKA 4KVXA 1KUVA 3IWEA 4RS2A 3CXQA 1NSLA 3TO6A 2ATRA 2R1IA 2CXAA 4PK3A 3S6GA 5A28A 3TFYA 3BJ7A 4C2ZA 3R9EA 4H6ZA 5DWMA 4CRYB 2VEZA 2PSWA 2B5GA 3W6SA 2Y0MA 4Y49C 2D4OA 4CGOA 4KOWA 5I0CA 4KLWA 4M85A 3R95A 4U9ZA 2G0BA 2OZHA 3G3SA 4CYPA 4R87A 1YVOA 4IF5A 4B12A 1MK4A 2Z11A 2WUUA 4PSWA 3FBUA 4U5YA 2FE7A 2DPSA 2PR8A 5BWAB 2J8NA 3W91A 4UCPA 2ZXVA 2CNMA 4B14A 4F0YA 5KTDA 4MJ8A 2VI7A 4KLVA 1MJBA 4OADA 1XE4A 2OZUA 4KOVA 4CGPA 2NMTA 4CYOA 4UFVA 1I21A 4KOYA 5KTCA 4C68A 4CS0B 4GS4A 4FD5A 4B5PA 4HNYB 1M1DA 3D3SA 4MFZA 5IX3A 3FXTA 2P6EA 5JPHA 1S7NA 3FRMA 5AG4A 2AJ6A 1FY7A 3PGPA 4H6UA 3OWCA 4QB9A 5C82A 1KUXA 5G22A 2X7BA 3D2MA 5F49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIQ A;  1S7F A;  5F47 A;  1I12 A;  5H84 A;  2WPW A;  2G3T A;  4AB7 A;  3DR6 A;  4PV6 A;  3LOD A;  3DR8 A;  1QSO A;  4OAE A;  4FD4 A;  2R7H A;  4H89 A;  4ORF A;  1V0C A;  4L8A A;  3FB3 A;  2G3A A;  4FD6 A;  4XNH B;  5KTA A;  3FNC A;  2FSR A;  1BOB A;  4BMH A;  1Q2C A;  4UA3 A;  4PSX A;  4LX9 A;  1Q2Y A;  3VWD A;  4IUS A;  1M4D A;  3JUW A;  1YK3 A;  1B87 A;  4CRZ B;  1IIC A;  3B8G A;  2IL4 A;  4OLL A;  1QSM A;  4YRH A;  2P6G A;  1XMT A;  1UFH A;  5HMN A;  2B4B A;  3QB8 A;  2VQY A;  4JXR A;  1WK4 A;  1KZF A;  4HNW B;  3SXN A;  2VBQ A;  3TT2 A;  3P2H A;  1Y9W A;  4AG9 A;  4CAX A;  4M3S A;  2H5M A;  2GE3 A;  3F8K A;  4YFJ A;  3TOA A;  4KOR A;  1YGH A;  4JLY A;  1QSR A;  3T90 A;  2J8R A;  3GKR A;  2EUI A;  1VKC A;  2B5G B;  2WPX A;  4DNC A;  4XPD B;  4E0A A;  3IGR A;  3EO4 A;  1IB1 E;  1P4N A;  3K9U A;  4I49 A;  4J3G A;  2PDO A;  4QUS A;  1PU9 A;  2Q04 A;  1RXT A;  2B58 A;  4RI1 A;  3TO7 A;  2GAN A;  1J4J A;  3ZJ0 A;  3T9Y A;  3NE7 A;  3TO9 A;  4AG7 A;  4L89 A;  1YVK A;  4AVC A;  1QST A;  2I79 A;  2Q0Y A;  1IID A;  2F5I A;  1R57 A;  4E8O A;  4CAW A;  4JD6 A;  2OU2 A;  2VZZ A;  4JWP A;  2HUZ A;  3G8W A;  4B5P B;  4R57 A;  1KUY A;  4U9Y A;  2B3U A;  1RO5 A;  3DSB A;  3C26 A;  3EC4 A;  4X5K A;  4XNH C;  3S6H A;  5GCN A;  3SXO A;  4EVY A;  3E0K A;  2REF A;  2JDC A;  2A4N A;  1Q2D A;  2ZW7 A;  3R96 A;  3W6X A;  3BJ8 A;  4AVA A;  3CXS A;  4NCZ A;  4NEX A;  1LRZ A;  4E2A A;  5E96 A;  2JDD A;  3FIX A;  1M4I A;  5HH1 A;  3S6F A;  4KVO E;  1QSN A;  1OZP A;  3GY9 A;  2QEC A;  1S5K A;  4UWJ A;  4R3L A;  3ZZI A;  3R9F A;  2ZW5 A;  3EXN A;  1N71 A;  2K5T A;  2R98 A;  3PP9 A;  4JJX A;  2Z0Z A;  5DWN A;  3UY5 A;  2CNS A;  2QIR A;  3DDD A;  1S60 A;  4UBR A;  1M4G A;  2R8V A;  2FT0 A;  3FYN A;  2BEI A;  3H4Q A;  4KUB A;  2FXF A;  2ZW6 A;  4XPD C;  1WWZ A;  2REE A;  2D4P A;  5H86 A;  2J8M A;  2Q7B A;  3PZJ A;  4QBJ A;  2FCK A;  2BUE A;  1YR0 A;  2ARH A;  4AVB A;  5IB0 A;  2OB0 A;  4QC6 A;  1CM0 A;  3QAH A;  5ISV A;  2EVN A;  1XIX A;  4ZBG A;  2AE6 A;  3TCV A;  2HV2 A;  3S6K A;  2JEV A;  4KOS A;  1IYL A;  2OH1 A;  2KCW A;  2FS5 A;  1L0C A;  2Z10 A;  1NMT A;  4FD7 A;  2FIA A;  3V8I A;  2CNT A;  4HNX B;  3I9S A;  1M44 A;  4HKF A;  5EBV A;  3JVN A;  4QVT A;  2PQ8 A;  5C88 A;  2ZW4 A;  3IWG A;  5EC4 A;  4KOX A;  3D2P A;  2B4D A;  2OZG A;  4UWI A;  4R3K A;  2FIW A;  2P0W A;  5F46 A;  4MI4 A;  2PRB A;  4LUA A;  4Y49 B;  2VZY A;  1P0H A;  2B4D B;  3N7Z A;  4MBU A;  5F48 A;  3TTH A;  1S3Z A;  3D8P A;  3EFA A;  4MY3 A;  3EY5 A;  1SQH A;  4PK2 A;  2ZPA A;  4CAV A;  2Q44 A;  2RC4 A;  4KOT A;  1YX0 A;  1Z4R A;  1XEB A;  2Q4V A;  4B5O A;  1VHS A;  3R9G A;  3I3G A;  4NF1 A;  1NE9 A;  2Q4Y A;  1CJW A;  2BL1 A;  5CNP A;  2DXQ A;  3TOB A;  1Y7R A;  1PUA A;  3DNS A;  2JLM A;  4KUA A;  5J8C A;  1Z9U A;  4XPL A;  2HQY A;  4KOU A;  4YGO A;  4NSQ A;  3GYA A;  2QML A;  4ONU A;  2B3V A;  1BO4 A;  4KZT A;  2C27 A;  3MGD A;  2BSW A;  3BLN A;  3LD2 A;  4JXQ A;  1YLE A;  2FL4 A;  1Y9K A;  4KVM E;  1K4J A;  1ON0 A;  2O28 A;  3WR7 A;  3TE4 A;  4II9 A;  2P6F A;  3P2F A;  4R9M A;  1S7L A;  3SHP A;  5FVJ A;  5JQ4 A;  3VWE A;  2VXK A;  5J8F A;  4F6A A;  1MJA A;  3F0A A;  1YRE A;  5IV0 A;  2GIV A;  2PR1 A;  1I1D A;  1MJ9 A;  2I00 A;  3RYO A;  4XPK A;  2PC1 A;  4MHD A;  1XF8 A;  1S7K A;  3KKW A;  3CXP A;  3R1K A;  1B6B A;  3F5B A;  4K30 A;  1GHE A;  2CY2 A;  4NXY A;  4MY0 A;  1Z4E A;  1U6M A;  1IYK A;  4KVX A;  1KUV A;  4RS2 A;  1NSL A;  3CXQ A;  3TO6 A;  2ATR A;  2R1I A;  4PK3 A;  3S6G A;  3TFY A;  3BJ7 A;  3R9E A;  4H6Z A;  5DWM A;  4CRY B;  2VEZ A;  2PSW A;  2B5G A;  3W6S A;  2Y0M A;  4Y49 C;  2D4O A;  4KOW A;  5I0C A;  4KLW A;  4M85 A;  3R95 A;  4U9Z A;  2G0B A;  2OZH A;  3G3S A;  4R87 A;  1YVO A;  4IF5 A;  1MK4 A;  2Z11 A;  4PSW A;  3FBU A;  4U5Y A;  2FE7 A;  2PR8 A;  2J8N A;  3W91 A;  2ZXV A;  2CNM A;  4F0Y A;  5KTD A;  4MJ8 A;  2VI7 A;  4KLV A;  1MJB A;  4OAD A;  1XE4 A;  2OZU A;  4KOV A;  2NMT A;  1I21 A;  4KOY A;  5KTC A;  4CS0 B;  4GS4 A;  4FD5 A;  4B5P A;  4HNY B;  1M1D A;  3D3S A;  5IX3 A;  3FXT A;  2P6E A;  5JPH A;  1S7N A;  3FRM A;  2AJ6 A;  1FY7 A;  3PGP A;  4H6U A;  3OWC A;  4QB9 A;  5C82 A;  1KUX A;  2X7B A;  3D2M A;  5F49 A; 
#chains in the Genus database with same CATH topology
 1TIQ A;  1FNO A;  4CYN A;  1S7F A;  2ZOF A;  5F47 A;  1I12 A;  2PJ1 A;  5H84 A;  2GLF A;  2WPW A;  1LAP A;  4OC5 A;  3SJX A;  2G3T A;  4MHN A;  2XEG A;  2ZOG A;  4AB7 A;  3B35 A;  1TKJ A;  3DR6 A;  4PV6 A;  3LOD A;  3RZA A;  5LRG A;  5LYD A;  1IOF A;  1QSO A;  3DR8 A;  3PB9 X;  4OAE A;  1IU8 A;  3IJ3 A;  4FD4 A;  5LRJ A;  4FBE A;  1Y7E A;  2R7H A;  4H89 A;  4ORF A;  2WYR A;  1V0C A;  4L8A A;  4W9Y A;  5JM6 A;  3S9L A;  3FB3 A;  2YNC A;  4MHP A;  1LCP A;  1XRY A;  2G3A A;  4FD6 A;  4XNH B;  5KTA A;  4WJB A;  2POK A;  1Z8X A;  3FNC A;  2FSR A;  3JTK A;  5G1Z A;  1XFO A;  1BOB A;  2C6C A;  4MCR A;  4UF4 A;  1F2O A;  3FF3 A;  4OME A;  1Q2C A;  4UA3 A;  3WAB A;  4BMH A;  4OC3 A;  4Z65 A;  4MRI A;  1JWQ A;  4PSX A;  1ZG8 A;  4LX9 A;  3FJU A;  4MCQ A;  4GM5 A;  4EWT A;  4G1P A;  1Q2Y A;  2PJ5 A;  3LMS A;  1M4D A;  4IUS A;  4LQG A;  3VWD A;  3JUW A;  1H8L A;  1AMP A;  1YK3 A;  4MFJ A;  1B87 A;  3PBE A;  3DGV A;  4CRZ B;  5I4M A;  4P4J A;  1IIC A;  3B8G A;  2IL4 A;  4OLL A;  3VAR A;  5HVG A;  1QSM A;  3CPX A;  3CZX A;  4YRH A;  5LYI A;  2P6G A;  4LQ6 A;  1XMT A;  1UFH A;  5HMN A;  2PE3 A;  1GYT A;  1LAN A;  2B4B A;  3QB8 A;  1CPX A;  3H5Z A;  2VQY A;  3KGQ A;  4JXR A;  1WK4 A;  4KSA A;  1CX8 A;  4MHZ A;  3D7D A;  4MFQ A;  2QJ8 A;  2WSA A;  1KZF A;  1F57 A;  4HNW B;  3SXN A;  2VBQ A;  3MN8 A;  3ISZ A;  3TT2 A;  5CBM A;  3P2H A;  1BAV A;  1Y9W A;  4AG9 A;  4CAX A;  4M3S A;  2H5M A;  4A30 A;  4MFP A;  2GE3 A;  2Q7S A;  1CP6 A;  4OID A;  4UFX A;  3KAS A;  1YQE A;  2XEF A;  3F8K A;  4ZX8 A;  4YFJ A;  3TOA A;  4CPA A;  4KOR A;  1YGH A;  4A2Z A;  2O53 A;  1QSR A;  2ZEH A;  4JLY A;  3T90 A;  1NSA A;  1QQ9 A;  4PXC A;  8CPA A;  2J8R A;  3GKR A;  1VGY A;  4OC0 A;  2AFZ A;  3CPA A;  2EUI A;  3B7I A;  2YNE A;  4CGL A;  4HPS A;  1VKC A;  4PPZ A;  3KHX A;  2B5G B;  4OC4 A;  2WPX A;  4UCN A;  4DNC A;  4XPD B;  4RN7 A;  4E0A A;  2PJ0 A;  3EO4 A;  3IGR A;  4F9V A;  1IB1 E;  1P4N A;  2GRE A;  3K9U A;  4I49 A;  5A27 A;  4J3G A;  4ZI6 A;  2YGW A;  2PDO A;  4C7H A;  1Q7L A;  4QUS A;  2RB7 A;  1PU9 A;  4OC1 A;  2Q04 A;  1RXT A;  2B58 A;  2Z3K A;  4RI1 A;  3TO7 A;  1Z8W A;  2GAN A;  1J4J A;  2Z3L A;  3KHZ A;  3LAC A;  3ZJ0 A;  3T9Y A;  4ONW A;  2J9A A;  3NE7 A;  4O23 A;  3TO9 A;  1ZLH A;  4AG7 A;  4L89 A;  1YVK A;  3RAM A;  4AVC A;  5LRK A;  1QST A;  2I79 A;  5D8N A;  2Q0Y A;  2V8H A;  3PB4 X;  4PXE A;  5LYL A;  2BCO A;  4PXB A;  1CP7 A;  4NGN A;  1IID A;  1YLO A;  3KQX A;  4CGM A;  2F5I A;  1R57 A;  4E8O A;  1ARM A;  4CAW A;  1CPS A;  2ODF A;  4YWY A;  3A9L A;  4C7I A;  4JD6 A;  3IU2 A;  2OU2 A;  4NGR A;  4CAE A;  2VZZ A;  2BO9 A;  4JWP A;  2HUZ A;  3G8W A;  4B5P B;  4OP4 A;  5AG7 A;  5CPA A;  3BI0 A;  4R57 A;  3B2Y A;  2DEA A;  4ZX9 A;  1KUY A;  4M6H A;  4OKO A;  4U9Y A;  2B3U A;  2CF4 A;  1RO5 A;  6CPA A;  3DSB A;  5AGE A;  2FVG A;  1YW6 A;  3C26 A;  3EC4 A;  4X5K A;  4XNH C;  3NH4 A;  3S6H A;  1CG2 A;  5GCN A;  3SXO A;  4EVY A;  3E0K A;  2REF A;  2JDC A;  2ZEP A;  2A4N A;  3K9T A;  4C2Y A;  2PRQ A;  1ELL P;  1IOI A;  4Q36 A;  3JRU A;  1A2Z A;  1Q2D A;  4F9U A;  2ZW7 A;  3R96 A;  3W6X A;  3BJ8 A;  2GLJ A;  3DLJ A;  4AVA A;  3CXS A;  4NCZ A;  4NEX A;  1LRZ A;  5HVF A;  3LWU A;  4DJL A;  4E2A A;  5E96 A;  4DYO A;  2XEJ A;  2JDD A;  3FIX A;  1M4I A;  5HH1 A;  3IC1 A;  1Z2L A;  3S6F A;  1F2P A;  4KVO E;  1QSN A;  1DTD A;  1OZP A;  2Q43 A;  3GY9 A;  1VIX A;  1BPN A;  2EK8 A;  2QEC A;  4OIW A;  4OC2 A;  4EME A;  1S5K A;  2ZEE A;  4NGT A;  2PVV A;  2G9D A;  4UWJ A;  3FX6 A;  4R3L A;  2OOT A;  3ZZI A;  3R9F A;  1ZLI A;  2ZW5 A;  2NYQ A;  4A33 A;  3EXN A;  2EWB A;  4CYQ A;  1N71 A;  4R8F A;  4A95 A;  3D4U A;  2K5T A;  2R98 A;  3IU1 A;  3PP9 A;  3FEC A;  2Z0Z A;  1ELM P;  4JJX A;  4NGS A;  2CNS A;  1UWY A;  5DWN A;  4MCS A;  3UY5 A;  2HC9 A;  2IQ6 A;  4Q38 A;  2QIR A;  4CAF A;  1XBU A;  3DDD A;  1Z5R A;  4UEF A;  4B13 A;  1S60 A;  5G20 A;  2PJB A;  1M4G A;  2Z3P A;  4IHM A;  4MHY A;  1FT7 A;  4NJQ A;  4UBR A;  1M4L A;  2R8V A;  2FT0 A;  2Z3M A;  3NA6 A;  3PBB A;  3FYN A;  1X10 A;  4NJR A;  4P10 A;  3RNZ A;  4UEE A;  3B3T A;  2F8H A;  1HDU A;  2BEI A;  2RFH A;  3FEE A;  3H4Q A;  2FXF A;  2ZW6 A;  2DPT A;  4KUB A;  4XPD C;  1WWZ A;  4C2X A;  2REE A;  1IY7 A;  5F09 A;  4A39 A;  1Z8T A;  2D4P A;  5H86 A;  3B3S A;  2J8M A;  2Q7B A;  3PZJ A;  5JH9 A;  4TWE A;  4QBJ A;  4P4E A;  2FCK A;  4F8Z A;  2BUE A;  1YR0 A;  2ARH A;  4AVB A;  5IB0 A;  2OB0 A;  4QC6 A;  3KR4 A;  1XMB A;  2Q51 A;  3S9M A;  1CM0 A;  4GXH A;  3QAH A;  5ISV A;  2EVN A;  1XIX A;  4ZBG A;  3KZW A;  1LFW A;  2AE6 A;  3TCV A;  2HV2 A;  3S6K A;  2V8V A;  4P44 A;  2JEW A;  2JEV A;  4H2K A;  5HVH A;  3SJG A;  4NGM A;  3B3W A;  4KOS A;  2YND A;  1IYL A;  2JBJ A;  2OH1 A;  3NH5 A;  3NH8 A;  2Z3O A;  2KCW A;  2FS5 A;  1L0C A;  4P4B A;  2Z10 A;  4AXV A;  5LYF A;  1NMT A;  4FD7 A;  1ZO0 A;  4P45 A;  3TX8 A;  5J1Q A;  2ZEM A;  1TKF A;  1CBX A;  2FIA A;  1XJO A;  5JGF A;  3V8I A;  2CNT A;  4HNX B;  2PJ7 A;  3I9S A;  1M44 A;  4HKF A;  5EBV A;  3SJE A;  3JVN A;  4FUU A;  4QVT A;  3HUV A;  2PQ8 A;  3T8W A;  3NFZ A;  5C88 A;  2ZW4 A;  4B10 A;  3IWG A;  4A31 A;  1LOK A;  3FMC A;  5IB9 A;  3WC7 A;  5EC4 A;  3SI0 A;  3SI2 A;  4KOX A;  3D2P A;  2B4D A;  3TC8 A;  2OZG A;  4P4I A;  4R3K A;  4UWI A;  3BHX A;  1LAM A;  2FIW A;  2P0W A;  5F46 A;  4MI4 A;  4MCP A;  3RO0 A;  2Q4Z A;  4FAI A;  2PJ8 A;  1PCA A;  2CTC A;  2PRB A;  4PQA A;  4LUA A;  4Y49 B;  2VZY A;  1P0H A;  2B4D B;  3N7Z A;  4MBU A;  3KI9 A;  5F48 A;  1S3Z A;  3D8P A;  3TTH A;  3EFA A;  4X3R A;  2QYV A;  1YW4 A;  4MY3 A;  3EY5 A;  2EO8 A;  1SQH A;  4PK2 A;  2ZPA A;  3H8E A;  5AG6 A;  4CAV A;  2Q44 A;  2RC4 A;  4B11 A;  5K8P A;  4EFD A;  4KOT A;  1YX0 A;  1Z4R A;  1XEB A;  2Q4V A;  1AYE A;  4B5O A;  1VHS A;  2ZEN A;  1TF8 A;  3B3C A;  1ZG9 A;  4IAV A;  7CPA A;  4BD9 A;  2NSM A;  4ZYQ A;  3R9G A;  3I3G A;  4NF1 A;  3PRT A;  1NE9 A;  3FH4 A;  4A94 A;  2CIJ A;  3IIB A;  4MFL A;  3VH9 A;  2V8D A;  4A38 A;  2V77 A;  2ZEO A;  2PJ2 A;  2Q4Y A;  1CJW A;  2BL1 A;  2YNC C;  3FVL A;  5CNP A;  1R3N A;  2DXQ A;  3TOB A;  1RTQ A;  2AFW A;  4Q7A A;  4ZY2 A;  2ZEF A;  3FED A;  4BBH A;  2PIZ A;  1Y7R A;  5K8M A;  1PYT B;  3WC6 A;  4X2T A;  3IO1 A;  4YU9 A;  1KWM A;  1PUA A;  5K8O A;  4BIN A;  2O4H A;  3V7Z A;  3DNS A;  2JLM A;  4KSF A;  4KUA A;  2IJZ A;  5J8C A;  4KS9 A;  2CTB A;  1Z9U A;  4XPL A;  2C1C A;  2HQY A;  2AFU A;  2VL1 A;  4KOU A;  4NFR A;  4YGO A;  2ANP A;  2AFS A;  3D7F A;  3BXM A;  3GYA A;  4NSQ A;  2QML A;  4ONU A;  1TF9 A;  1XOV A;  2ZEL A;  4B6Z A;  2B3V A;  5G21 A;  3HLP A;  1BO4 A;  2IMO A;  4KZT A;  2C27 A;  2C6G A;  3IWW A;  3MGD A;  2PJ4 A;  3KQZ A;  5AG5 A;  5HXD A;  4A32 A;  4CGN A;  2BSW A;  1Y0Y A;  3BLN A;  3LD2 A;  4JXQ A;  4M6G A;  1YLE A;  2FL4 A;  1Y9K A;  5ELY A;  4ZGY B;  4KVM E;  1DE4 C;  3SI1 A;  1K4J A;  1ON0 A;  2PIY A;  4MFK A;  3H8G A;  2O28 A;  3PB6 X;  2AFM A;  2XEI A;  3WR7 A;  1VHE A;  3TE4 A;  4II9 A;  2P6F A;  5D29 A;  3GB0 A;  3P2F A;  4R9M A;  3D66 A;  2PVW A;  5F49 A;  1BLL E;  1S7L A;  2HB6 A;  3SHP A;  5FVJ A;  2PJA A;  5JQ4 A;  3VWE A;  4F0X A;  4UCM A;  2I3C A;  2VXK A;  5K8N A;  5J8F A;  4JZ0 A;  4F6A A;  2Z3N A;  1MJA A;  3F0A A;  4R6T A;  4UFW A;  1YRE A;  3IFE A;  3PFO A;  5IV0 A;  3CT9 A;  2GIV A;  2BOA A;  2PR1 A;  1I1D A;  1MJ9 A;  2I00 A;  4P6Y A;  3RYO A;  3GLJ A;  4XPK A;  2ZED A;  2PC1 A;  1JQG A;  1EE3 P;  4MHD A;  4JYW A;  1XF8 A;  3KR5 A;  2PJ6 A;  1S7K A;  3KKW A;  3VAT A;  3CXP A;  3R1K A;  1B6B A;  3F5B A;  4K30 A;  4P4F A;  1GHE A;  2CY2 A;  4NXY A;  2WZN A;  1Z4E A;  1U6M A;  4MY0 A;  1IYK A;  4KVX A;  1KUV A;  3IWE A;  4M6I A;  3CXQ A;  3N5F A;  4RS2 A;  1NSL A;  3TO6 A;  4DUK A;  1R43 A;  2ATR A;  3RBU A;  2R1I A;  2JBK A;  3H8F A;  4KSI A;  2CXA A;  4PK3 A;  3S6G A;  1BPM A;  3QNV A;  4UIA A;  5A28 A;  3TFY A;  3BJ7 A;  4C2Z A;  3R9E A;  4H6Z A;  5DWM A;  2EBJ A;  4CRY B;  1HDQ A;  2QVP A;  2VEZ A;  2PSW A;  4PXD A;  3D7G A;  3L2N A;  2B5G A;  3PFE A;  2Y0M A;  3W6S A;  4Y49 C;  2D4O A;  4CGO A;  2PCU A;  4KOW A;  5I0C A;  4KLW A;  3ISX A;  4M85 A;  3R95 A;  4U9Z A;  2G0B A;  2OZH A;  1YSJ A;  3G3S A;  3I1U A;  4MXU A;  4RUH A;  4CYP A;  3IEH A;  3CDX A;  4R87 A;  4X8I A;  4NGP A;  1YVO A;  4IF5 A;  4B12 A;  2AFO A;  5EMI A;  1MK4 A;  3PEI A;  2Z11 A;  2WUU A;  4PSW A;  1QMU A;  3FBU A;  4U5Y A;  2FE7 A;  3KL9 A;  2DPS A;  3WC5 A;  2PR8 A;  5BWA B;  2J8N A;  3W91 A;  1YME A;  2ZXV A;  4K3N A;  4UCP A;  2F7V A;  3GIU A;  2CNM A;  4B14 A;  4R7M A;  2V8G A;  2EK9 A;  2C6P A;  3D68 A;  4MJ8 A;  2VI7 A;  2OR4 A;  4F0Y A;  5KTD A;  4KLV A;  1MJB A;  4R76 A;  4NGQ A;  2ZEG A;  4UIB A;  2GU2 A;  1ZG7 A;  4OAD A;  1XE4 A;  1AUG A;  3V38 A;  3WT4 A;  4IK2 A;  2OZU A;  3S9N A;  4KOV A;  1HEE A;  2GFQ A;  4CGP A;  1X12 A;  2NMT A;  1Z8L A;  4CYO A;  1ARL A;  4UFV A;  3SJF A;  1I21 A;  2AFX A;  4KOY A;  5KTC A;  4A37 A;  4C68 A;  4CS0 B;  3MRU A;  4MMO A;  4ZY0 A;  4GS4 A;  5THW A;  4FD5 A;  4P4D A;  5DS0 A;  1TXR A;  3PB7 X;  1VHO A;  2PJ9 A;  4B5P A;  4FWU A;  1M1D A;  3BI1 A;  3D3S A;  3K2K A;  3FXT A;  4HNY B;  4MFZ A;  5IX3 A;  2P6E A;  3PB8 X;  1TKH A;  3B3V A;  2PJ3 A;  3GUX A;  5JPH A;  1S7N A;  1Y0R A;  2ABZ A;  1OBR A;  2AJ6 A;  3FRM A;  5AG4 A;  4TNU A;  3D67 A;  2DF5 A;  1FY7 A;  3PGP A;  2PJC A;  4H6U A;  4ZY1 A;  4WWV A;  3NE8 A;  3OWC A;  4QB9 A;  5C82 A;  1KUX A;  3QAY A;  4UEZ A;  5G22 A;  2X7B A;  3D2M A;  1IGB A;  3D7H A; 
#chains in the Genus database with same CATH homology
 1TIQ A;  4CYN A;  1S7F A;  5F47 A;  1I12 A;  5H84 A;  2WPW A;  2G3T A;  4AB7 A;  3DR6 A;  4PV6 A;  3LOD A;  3DR8 A;  1QSO A;  4OAE A;  4FD4 A;  2R7H A;  4H89 A;  4ORF A;  1V0C A;  4L8A A;  3FB3 A;  2YNC A;  2G3A A;  4FD6 A;  4XNH B;  5KTA A;  3FNC A;  2FSR A;  3JTK A;  5G1Z A;  1BOB A;  4BMH A;  1Q2C A;  4UA3 A;  4PSX A;  4LX9 A;  1Q2Y A;  3VWD A;  4IUS A;  1M4D A;  3JUW A;  4MFJ A;  1YK3 A;  1B87 A;  4CRZ B;  1IIC A;  3B8G A;  2IL4 A;  4OLL A;  1QSM A;  4YRH A;  2P6G A;  1XMT A;  1UFH A;  5HMN A;  2B4B A;  3QB8 A;  3H5Z A;  2VQY A;  4JXR A;  1WK4 A;  4KSA A;  4MFQ A;  2WSA A;  1KZF A;  4HNW B;  3SXN A;  2VBQ A;  3TT2 A;  3P2H A;  1Y9W A;  4AG9 A;  4CAX A;  4M3S A;  2H5M A;  4A30 A;  4MFP A;  2GE3 A;  4UFX A;  3F8K A;  4YFJ A;  3TOA A;  4KOR A;  1YGH A;  4A2Z A;  4JLY A;  1QSR A;  3T90 A;  2J8R A;  3GKR A;  2EUI A;  2YNE A;  4CGL A;  1VKC A;  2B5G B;  2WPX A;  4UCN A;  4DNC A;  4XPD B;  4E0A A;  3IGR A;  3EO4 A;  1IB1 E;  1P4N A;  3K9U A;  4I49 A;  5A27 A;  4J3G A;  2YGW A;  2PDO A;  4C7H A;  4QUS A;  1PU9 A;  2Q04 A;  1RXT A;  2B58 A;  2Z3K A;  4RI1 A;  3TO7 A;  2GAN A;  1J4J A;  2Z3L A;  3ZJ0 A;  3T9Y A;  3NE7 A;  3TO9 A;  4AG7 A;  4L89 A;  1YVK A;  4AVC A;  1QST A;  2I79 A;  2Q0Y A;  4CGM A;  1IID A;  2F5I A;  1R57 A;  4E8O A;  4CAW A;  3A9L A;  4C7I A;  4JD6 A;  3IU2 A;  2OU2 A;  4CAE A;  2VZZ A;  4JWP A;  2HUZ A;  3G8W A;  4B5P B;  5AG7 A;  4R57 A;  1KUY A;  4U9Y A;  2B3U A;  1RO5 A;  3DSB A;  5AGE A;  3C26 A;  3EC4 A;  4X5K A;  4XNH C;  3S6H A;  5GCN A;  3SXO A;  4EVY A;  3E0K A;  2REF A;  2JDC A;  2A4N A;  4C2Y A;  4Q36 A;  1Q2D A;  2ZW7 A;  3R96 A;  3W6X A;  3BJ8 A;  4AVA A;  3CXS A;  4NCZ A;  4NEX A;  1LRZ A;  4E2A A;  5E96 A;  2JDD A;  3FIX A;  1M4I A;  5HH1 A;  3S6F A;  4KVO E;  1QSN A;  1OZP A;  3GY9 A;  2QEC A;  1S5K A;  4UWJ A;  4R3L A;  3ZZI A;  3R9F A;  2ZW5 A;  4A33 A;  3EXN A;  4CYQ A;  1N71 A;  4A95 A;  2K5T A;  2R98 A;  3IU1 A;  3PP9 A;  4JJX A;  2Z0Z A;  5DWN A;  3UY5 A;  2CNS A;  4Q38 A;  2QIR A;  4CAF A;  3DDD A;  4B13 A;  1S60 A;  5G20 A;  2Z3P A;  1M4G A;  4UBR A;  2Z3M A;  2R8V A;  2FT0 A;  3FYN A;  2BEI A;  3H4Q A;  4KUB A;  2FXF A;  2ZW6 A;  2DPT A;  4XPD C;  1WWZ A;  4C2X A;  2REE A;  2D4P A;  5H86 A;  2J8M A;  2Q7B A;  3PZJ A;  4QBJ A;  2FCK A;  2BUE A;  1YR0 A;  2ARH A;  4AVB A;  5IB0 A;  2OB0 A;  4QC6 A;  1CM0 A;  3QAH A;  5ISV A;  2EVN A;  1XIX A;  4ZBG A;  2AE6 A;  3TCV A;  2HV2 A;  3S6K A;  2JEV A;  4KOS A;  2YND A;  1IYL A;  2OH1 A;  2Z3O A;  2KCW A;  2FS5 A;  1L0C A;  2Z10 A;  1NMT A;  4FD7 A;  1ZO0 A;  2FIA A;  3V8I A;  2CNT A;  4HNX B;  3I9S A;  1M44 A;  4HKF A;  5EBV A;  3JVN A;  4QVT A;  2PQ8 A;  5C88 A;  2ZW4 A;  4B10 A;  3IWG A;  4A31 A;  5EC4 A;  4KOX A;  3D2P A;  2B4D A;  2OZG A;  4UWI A;  4R3K A;  2FIW A;  2P0W A;  5F46 A;  4MI4 A;  2PRB A;  4LUA A;  4Y49 B;  2VZY A;  1P0H A;  2B4D B;  3N7Z A;  4MBU A;  5F48 A;  3TTH A;  1S3Z A;  3D8P A;  3EFA A;  4MY3 A;  3EY5 A;  1SQH A;  4PK2 A;  2ZPA A;  5AG6 A;  4CAV A;  2Q44 A;  2RC4 A;  4B11 A;  4KOT A;  1YX0 A;  1Z4R A;  1XEB A;  2Q4V A;  4B5O A;  1VHS A;  3R9G A;  3I3G A;  4NF1 A;  1NE9 A;  4MFL A;  2Q4Y A;  1CJW A;  2BL1 A;  2YNC C;  5CNP A;  2DXQ A;  3TOB A;  4BBH A;  1Y7R A;  1PUA A;  3DNS A;  2JLM A;  4KSF A;  4KUA A;  5J8C A;  4KS9 A;  1Z9U A;  4XPL A;  2HQY A;  4KOU A;  4YGO A;  4NSQ A;  3GYA A;  2QML A;  4ONU A;  2B3V A;  5G21 A;  1BO4 A;  4KZT A;  2C27 A;  3MGD A;  5AG5 A;  4A32 A;  4CGN A;  2BSW A;  3BLN A;  3LD2 A;  4JXQ A;  1YLE A;  2FL4 A;  1Y9K A;  4ZGY B;  4KVM E;  1K4J A;  1ON0 A;  4MFK A;  2O28 A;  3WR7 A;  3TE4 A;  4II9 A;  2P6F A;  3P2F A;  4R9M A;  1S7L A;  3SHP A;  5FVJ A;  5JQ4 A;  3VWE A;  4F0X A;  4UCM A;  2VXK A;  5J8F A;  4F6A A;  2Z3N A;  1MJA A;  3F0A A;  4UFW A;  1YRE A;  5IV0 A;  2GIV A;  2PR1 A;  1I1D A;  1MJ9 A;  2I00 A;  3RYO A;  4XPK A;  2PC1 A;  4MHD A;  1XF8 A;  1S7K A;  3KKW A;  3CXP A;  3R1K A;  1B6B A;  3F5B A;  4K30 A;  1GHE A;  2CY2 A;  4NXY A;  4MY0 A;  1Z4E A;  1U6M A;  1IYK A;  4KVX A;  1KUV A;  3IWE A;  4RS2 A;  3CXQ A;  1NSL A;  3TO6 A;  2ATR A;  2R1I A;  2CXA A;  4PK3 A;  3S6G A;  5A28 A;  3TFY A;  3BJ7 A;  4C2Z A;  3R9E A;  4H6Z A;  5DWM A;  4CRY B;  2VEZ A;  2PSW A;  2B5G A;  3W6S A;  2Y0M A;  4Y49 C;  2D4O A;  4CGO A;  4KOW A;  5I0C A;  4KLW A;  4M85 A;  3R95 A;  4U9Z A;  2G0B A;  2OZH A;  3G3S A;  4CYP A;  4R87 A;  1YVO A;  4IF5 A;  4B12 A;  1MK4 A;  2Z11 A;  2WUU A;  4PSW A;  3FBU A;  4U5Y A;  2FE7 A;  2DPS A;  2PR8 A;  5BWA B;  2J8N A;  3W91 A;  4UCP A;  2ZXV A;  2CNM A;  4B14 A;  4F0Y A;  5KTD A;  4MJ8 A;  2VI7 A;  4KLV A;  1MJB A;  4OAD A;  1XE4 A;  2OZU A;  4KOV A;  4CGP A;  2NMT A;  4CYO A;  4UFV A;  1I21 A;  4KOY A;  5KTC A;  4C68 A;  4CS0 B;  4GS4 A;  4FD5 A;  4B5P A;  4HNY B;  1M1D A;  3D3S A;  4MFZ A;  5IX3 A;  3FXT A;  2P6E A;  5JPH A;  1S7N A;  3FRM A;  5AG4 A;  2AJ6 A;  1FY7 A;  3PGP A;  4H6U A;  3OWC A;  4QB9 A;  5C82 A;  1KUX A;  5G22 A;  2X7B A;  3D2M A;  5F49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...