4RS2A

1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
HHTDPALRALIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEHFNRFGLCGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted acyltransferase with acyl-CoA N-acyltransferase do
publication title 1.55 Angstrom Crystal Structure of GNAT Family N-acetyltransferase (YhbS) from Escherichia coli in Complex with CoA.
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 48
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4rs2A00
2FE7A 4MHDA 3R1KA 2BSWA 3DDDA 5ISVA 3B8GA 1YLEA 4UWIA 3S6HA 1QSNA 2FXFA 2PSWA 3FNCA 3DR8A 4H6UA 4F0YA 2OZGA 3F8KA 4U9YA 4E8OA 2REFA 5F49A 2VXKA 5JPHA 1IYKA 2PC1A 1BOBA 1S60A 3IGRA 2B3UA 5J8FA 4KUAA 3OWCA 4NCZA 2Z0ZA 4HNWB 1KUXA 1YX0A 1P4NA 2Q04A 4ZBGA 3S6GA 1Q2YA 5JQ4A 3EC4A 4KZTA 2D4PA 1IIDA 1Z4RA 3JVNA 4B5PB 2I00A 2OZHA 1YR0A 2B5GB 3TTHA 1XEBA 2FT0A 4AVAA 4IF5A 4JJXA 4ORFA 4H89A 4OADA 3D8PA 4AG7A 2ZW4A 2KCWA 4JXRA 3CXQA 2RC4A 2VBQA 2GANA 5IV0A 3FB3A 2Q4YA 4CAWA 2BUEA 2G3AA 3QB8A 1M1DA 1CM0A 4AB7A 1S7FA 5IB0A 4I49A 3SHPA 4FD5A 1J4JA 4PK3A 1SQHA 2P6FA 4BMHA 2OU2A 2PR1A 4E2AA 4CAXA 4KOTA 3D3SA 2BEIA 2PRBA 3PP9A 3KKWA 3TO6A 1Q2CA 2QECA 3PGPA 3TOAA 2PQ8A 1PUAA 3PZJA 4DNCA 1YREA 4NXYA 4AVBA 2HV2A 2B4BA 2VZZA 2CNSA 3D2MA 3N7ZA 4QUSA 3R95A 4MI4A 3P2HA 3EO4A 5H86A 3F0AA 4KVOE 4IUSA 1NMTA 2ZW6A 2Q44A 4R3KA 3TO9A 5I0CA 5KTCA 2ZW5A 4XPKA 4YGOA 2ZW7A 2JDCA 1GHEA 1MJAA 3VWDA 2K5TA 1MK4A 2PR8A 1L0CA 4YRHA 2FL4A 1UFHA 3R9GA 4KLVA 2ZPAA 3MGDA 3V8IA 2C27A 3T90A 2Z10A 3S6KA 2AJ6A 2VEZA 4B5OA 4UA3A 1VHSA 3LD2A 1Q2DA 4HNYB 2IL4A 2F5IA 4JD6A 3SXNA 1XF8A 2CNMA 4MJ8A 2NMTA 4AG9A 4KORA 4RI1A 3T9YA 2Q0YA 2GE3A 1M4GA 2FCKA 4KUBA 2Q4VA 1IYLA 2D4OA 1YK3A 1XE4A 4H6ZA 4KOXA 2R7HA 3P2FA 3NE7A 4CAVA 3LODA 2R8VA 1BO4A 1WK4A 5KTAA 4M3SA 3CXPA 3BJ8A 4QB9A 3TO7A 3TT2A 2I79A 4U9ZA 5C88A 4NF1A 4Y49C 1MJBA 1YGHA 5HH1A 3DSBA 1KZFA 3W91A 1Y7RA 3C26A 1FY7A 4LUAA 4F6AA 3GKRA 3FXTA 3EY5A 4PSWA 1K4JA 3TFYA 1P0HA 4R57A 4AVCA 5F46A 2JDDA 3TOBA 5E96A 4XPDC 3H4QA 2QMLA 1Z9UA 4K30A 3FYNA 3E0KA 4LX9A 2B4DA 1VKCA 2P6GA 4QBJA 2JLMA 3I3GA 2BL1A 3F5BA 1S5KA 2J8MA 2Q7BA 1CJWA 4KLWA 5HMNA 4GS4A 5J8CA 2JEVA 2G3TA 1KUVA 2WPXA 1NE9A 2VI7A 4QVTA 4CRYB 1B6BA 2FSRA 3I9SA 2J8NA 1QSRA 2ARHA 2DXQA 3ZZIA 4CS0B 3G3SA 1IB1E 4KOWA 4Y49B 3RYOA 1S3ZA 4FD4A 4OLLA 1Z4EA 1OZPA 4JXQA 3K9UA 5EC4A 1WWZA 4JLYA 1LRZA 4OAEA 2A4NA 1Y9KA 1RXTA 3ZJ0A 2OB0A 3GY9A 1KUYA 2ATRA 3CXSA 2G0BA 3FBUA 2J8RA 2P6EA 2AE6A 4PV6A 4YFJA 4HKFA 2B58A 4HNXB 3TCVA 3BLNA 3BJ7A 4J3GA 4PK2A 4X5KA 4E0AA 4PSXA 4M85A 1R57A 2HUZA 4L89A 1I12A 1ON0A 1B87A 2OH1A 3W6XA 4KOVA 2CY2A 3JUWA 3G8WA 1U6MA 3S6FA 5KTDA 1S7KA 1V0CA 2VZYA 1QSOA 4MBUA 2ZXVA 3TE4A 5F47A 4II9A 2CNTA 4FD7A 4KVME 3FIXA 5C82A 5F48A 2OZUA 4MY0A 1QSMA 4NSQA 4KOYA 1M4DA 2R98A 2HQYA 4XNHC 3QAHA 1XIXA 1NSLA 5H84A 3UY5A 5DWNA 2Z11A 4B5PA 2B5GA 4FD6A 4U5YA 4JWPA 5EBVA 1TIQA 2P0WA 2VQYA 3R9EA 4EVYA 3EXNA 3DR6A 2Y0MA 3D2PA 3R96A 4ONUA 2EUIA 2EVNA 2GIVA 1M4IA 3FRMA 3W6SA 1S7LA 2FIWA 2FIAA 1I21A 2B4DB 3VWEA 3R9FA 3EFAA 4RS2A 2X7BA 4L8AA 3IWGA 4KOSA 2FS5A 4R87A 4R9MA 2QIRA 1YVOA 1Y9WA 2R1IA 2O28A 2PDOA 4KVXA 1RO5A 4R3LA 4XPLA 1I1DA 3WR7A 1N71A 4UBRA 1S7NA 5IX3A 2REEA 3DNSA 4XNHB 1QSTA 5GCNA 1PU9A 4QC6A 1YVKA 2B3VA 3GYAA 5FVJA 2WPWA 1MJ9A 5CNPA 1M44A 5DWMA 4XPDB 4UWJA 2H5MA 1IICA 1XMTA 4KOUA 4NEXA 3SXOA 4CRZB 4MY3A
chains in the Genus database with same CATH superfamily
4MCSA 4OC5A 4PQAA 2FE7A 4MHDA 4ZX9A 1X10A 3R1KA 2BSWA 1EE3P 4C7IA 3DDDA 5J1QA 2GREA 2QVPA 5ISVA 1R43A 3B8GA 2BO9A 1H8LA 1YLEA 3QNVA 3PEIA 3QAYA 1LFWA 1ZG8A 2XEGA 2YNEA 4RN7A 4UWIA 3S6HA 5JGFA 3GUXA 3PRTA 1FNOA 1QSNA 2FXFA 2PSWA 5HXDA 3FNCA 4UIBA 3DR8A 3FH4A 1YW6A 1IOFA 4H6UA 4Q7AA 4F0YA 4CGLA 4DUKA 2OZGA 3F8KA 4OMEA 3BXMA 4CGPA 2PRQA 3KQXA 2XEJA 4CYPA 2EO8A 4U9YA 4R6TA 1IY7A 3VARA 4E8OA 5LYDA 4UCNA 2REFA 5F49A 4CGMA 2V8VA 4OC1A 2VXKA 5JPHA 1IYKA 2PC1A 1BOBA 1S60A 4OC0A 4LQ6A 3IGRA 2B3UA 5J8FA 1ELMP 2ODFA 4KUAA 4P44A 3OWCA 4OC2A 1ZLHA 2DEAA 3FMCA 4NCZA 2Z0ZA 2PIYA 4HNWB 1IU8A 3RZAA 2ZENA 1KUXA 1GYTA 4LQGA 4MFJA 4NGPA 1YX0A 4A32A 2WZNA 3TX8A 1P4NA 2Q04A 4ZBGA 4PXBA 3S6GA 1Q2YA 3TC8A 5IB9A 2YNDA 2ANPA 4UEZA 5JQ4A 3SI0A 1ZLIA 3EC4A 2OOTA 4KZTA 2D4PA 4NJQA 1IIDA 1Z4RA 3JVNA 1PCAA 1RTQA 4B5PB 3KGQA 2I00A 2OZHA 1YR0A 2B5GB 4YWYA 1VGYA 1XEBA 2FT0A 3TTHA 4IF5A 4AVAA 4JJXA 4ORFA 4H89A 4OADA 2OR4A 1UWYA 3D8PA 4AG7A 5D8NA 2DF5A 3BHXA 3PBEA 2PJCA 3PB4X 2V8DA 4F8ZA 2ZW4A 3D7DA 1OBRA 1VHEA 3H5ZA 2G9DA 4FUUA 2KCWA 1JQGA 4B6ZA 4JXRA 3CXQA 4OIWA 2RC4A 1YLOA 2VBQA 2GANA 5IV0A 1CBXA 3IEHA 3FB3A 3SJFA 3SI2A 2Q4YA 4CAWA 3SI1A 2BUEA 2G3AA 3QB8A 1M1DA 4NGNA 1CM0A 1FT7A 2EK9A 4P4IA 3L2NA 3SJGA 4O23A 5HVFA 4MHPA 4AB7A 1S7FA 5IB0A 2AFSA 5G22A 5F09A 2ZEGA 2O53A 4I49A 3SHPA 2ZEHA 3KHZA 1J4JA 4FD5A 1SQHA 2P6FA 3FECA 3K2KA 4PK3A 4ZX8A 3S9MA 4BMHA 4DYOA 1ARMA 2EK8A 4CGNA 1HEEA 5JH9A 2OU2A 2PR1A 4MFQA 3VATA 4BD9A 4P4BA 4CAXA 4E2AA 4KOTA 4PXCA 2C1CA 3D3SA 1DE4C 2Z3PA 3FX6A 2AFUA 2BEIA 2PRBA 3B3SA 3KHXA 3KKWA 3PP9A 3TO6A 1Q2CA 2QECA 5THWA 4BINA 2JBJA 3KL9A 3PGPA 2PQ8A 3TOAA 1PUAA 3PZJA 4DNCA 1YREA 4CPAA 2Q43A 4NXYA 4AVBA 3LACA 1X12A 5LYIA 4H2KA 2HV2A 2B4BA 2VZZA 2CNSA 3D2MA 3N7ZA 4QUSA 2Q7SA 3R95A 4MI4A 3P2HA 1TF8A 4W9YA 3EO4A 1Z8XA 2RFHA 5K8OA 2PVVA 5LYLA 3KASA 5H86A 1Z5RA 3F0AA 4KVOE 4IUSA 3B2YA 4ZY2A 2PJ5A 1Z8TA 4MFLA 1XBUA 5CPAA 4F9UA 4KSAA 1NMTA 2F7VA 2ZW6A 2Q44A 3WT4A 5AGEA 3KR4A 5ELYA 1AYEA 4R3KA 3TO9A 5I0CA 2PJ2A 2V8HA 5KTCA 3NH8A 2ZW5A 4XPKA 4YGOA 2ZW7A 2PE3A 2JEWA 3D68A 2JDCA 1YSJA 1GHEA 1MJAA 3HLPA 3LWUA 2ZEOA 3KZWA 3VWDA 2K5TA 1MK4A 5BWAB 3FEEA 2PR8A 3DLJA 4X2TA 4ZI6A 1L0CA 1Q7LA 4YRHA 1F57A 2AFZA 3CT9A 3PB9X 1CPXA 3V7ZA 2FL4A 4UFWA 1UFHA 3R9GA 5LRKA 1BPMA 2PJ9A 4KLVA 1YW4A 2ZPAA 3GIUA 1XFOA 3MGDA 3V8IA 2C27A 3T90A 2Z10A 3S6KA 4OIDA 2AJ6A 4UCPA 2VEZA 3VH9A 4B5OA 3IWEA 4UA3A 3NA6A 4WJBA 1CP7A 3S9LA 1VHSA 4UEFA 3T8WA 3LD2A 1Q2DA 2AFOA 4HNYB 2IL4A 2F5IA 4FWUA 2CTCA 1XF8A 2CNMA 4JD6A 2NMTA 4MJ8A 3SXNA 4AG9A 3BI0A 2Z3KA 4KORA 4RI1A 3T9YA 2Q0YA 3PFOA 2GE3A 4MY3A 1M4GA 2FCKA 4KUBA 2Q4VA 1IYLA 2D4OA 1YK3A 1XE4A 1Z8LA 4H6ZA 4IK2A 4KOXA 1HDUA 2R7HA 1IOIA 3P2FA 5CBMA 3NE7A 4M6HA 4UFVA 4CAVA 2C6PA 3FEDA 3LODA 2R8VA 1BO4A 1WK4A 5KTAA 4M3SA 3B3TA 1LCPA 3CXPA 4C2ZA 1ARLA 3BJ8A 3ISXA 4P4JA 2EBJA 4NGTA 3D7FA 4QB9A 3TO7A 3S9NA 2PJ3A 3TT2A 4PPZA 3V38A 2I3CA 2I79A 8CPAA 7CPAA 2PIZA 4A39A 5K8PA 3FJUA 4Q36A 2AFMA 4NGRA 5LRJA 4U9ZA 1Y0YA 5C88A 3ISZA 3H8GA 4NF1A 4NJRA 4Y49C 2PJ4A 1MJBA 3IJ3A 2FVGA 1YGHA 5HH1A 3DSBA 1KZFA 3MN8A 1Y7RA 3MRUA 3W91A 3D7GA 3C26A 1FY7A 4LUAA 4F6AA 4UCMA 1Z2LA 4CYOA 3GKRA 2QJ8A 2CIJA 3FXTA 3EY5A 4A30A 3FVLA 4OKOA 4PSWA 4WWVA 1K4JA 3TFYA 2DPSA 1F2PA 1P0HA 5G21A 4R57A 4AXVA 5K8NA 3WC5A 2PJ8A 4AVCA 4B10A 4EWTA 2YGWA 5F46A 2Z3LA 4NGMA 2JDDA 3TOBA 5E96A 3RAMA 4MRIA 4MHZA 4XPDC 2O4HA 3H4QA 2QMLA 3H8FA 1CX8A 4C68A 4C7HA 1BPNA 1Z9UA 3FF3A 4K30A 2J9AA 4P10A 3D67A 2RB7A 3FYNA 4A31A 4CYQA 1F2OA 2CXAA 3PB8X 3E0KA 3KI9A 4LX9A 2F8HA 2B4DA 3IFEA 4MCRA 1VKCA 2P6GA 2Z3MA 3B7IA 2Q4ZA 3SXOA 3GB0A 2JLMA 4QBJA 3I3GA 2CTBA 2BL1A 3RNZA 3SJEA 2PJBA 3DGVA 3F5BA 3IIBA 1ZG7A 2Q51A 1ZO0A 1S5KA 5JM6A 2J8MA 2Q7BA 1CJWA 4NFRA 4KLWA 1JWQA 4GS4A 5HMNA 4Q38A 5J8CA 2PJ6A 2V8GA 4YU9A 2JEVA 3LMSA 3GLJA 5AG5A 2Z3OA 3N5FA 2G3TA 1KUVA 2WPXA 5HVGA 1NE9A 3H8EA 2VI7A 4QVTA 4CRYB 1B6BA 2FSRA 4TWEA 2GLFA 3I9SA 2J8NA 1Z8WA 4EMEA 1QSRA 5HVHA 3JRUA 2ARHA 2Z3NA 1ZG9A 2DXQA 3ZZIA 4CS0B 2C6GA 4R7MA 3IU2A 3WC6A 2PVWA 3CDXA 3G3SA 2QYVA 4MMOA 1IB1E 4KOWA 1XOVA 2PJ0A 4Y49B 4G1PA 3RYOA 4CAFA 4P45A 1S3ZA 4FD4A 4OLLA 2ZEDA 1Z4EA 1OZPA 4OC3A 4JXQA 4A38A 3K9UA 5EC4A 1WWZA 4JLYA 4A33A 2XEIA 1LRZA 3PBBA 5DS0A 3WABA 2ZEEA 3B3CA 3PFEA 4OAEA 2A4NA 1Y9KA 1RXTA 3ZJ0A 4RUHA 2OB0A 1LANA 3GY9A 1CP6A 2WUUA 1KUYA 2HC9A 2ATRA 1TKJA 3A9LA 2EWBA 3CXSA 2G0BA 3FBUA 2J8RA 1IGBA 2P6EA 2AE6A 4MHYA 1PYTB 4PV6A 4YFJA 2ZOFA 3PB7X 4HKFA 2B58A 3RO0A 4HNXB 3TCVA 3BLNA 4K3NA 3BJ7A 4DJLA 4CYNA 2ZEMA 1TXRA 2ABZA 4CAEA 4J3GA 2JBKA 4ONWA 1TKHA 2PJ7A 4PK2A 4X5KA 4F0XA 4E0AA 4PSXA 3B35A 4KSIA 1R57A 4M85A 4C2XA 1BLLE 4GM5A 4Z65A 2GFQA 2VL1A 3WC7A 2HB6A 2HUZA 4B14A 4L89A 1I12A 1ON0A 1B87A 3HUVA 1M4LA 2OH1A 2AFWA 3W6XA 4KOVA 4KS9A 2CY2A 3JUWA 3K9TA 3D4UA 3G8WA 2POKA 1XJOA 1U6MA 1YQEA 3S6FA 5KTDA 1S7KA 1V0CA 2VZYA 2IQ6A 3CPAA 1QSOA 4UF4A 4F9VA 4MBUA 5AG6A 2ZXVA 3TE4A 2NSMA 5F47A 3NE8A 1LOKA 2PJAA 1Y7EA 5LRGA 4II9A 2IMOA 2CNTA 4R8FA 4FD7A 4KVME 1QQ9A 4A94A 3FIXA 4EFDA 5C82A 5F48A 2OZUA 4OP4A 4MY0A 2ZEPA 3KR5A 1QSMA 3IWWA 1VIXA 4A2ZA 4PXDA 4P4DA 4NSQA 4KOYA 4MFZA 1M4DA 2R98A 3CPXA 4FBEA 2HQYA 4NGQA 3NH4A 2WSAA 4XNHC 3QAHA 1XIXA 1NSLA 5H84A 5LYFA 4ZGYB 2NYQA 3UY5A 5G20A 3NFZA 2WYRA 4MCPA 1ELLP 1A2ZA 2Z11A 1BAVA 5DWNA 4B5PA 4IAVA 2YNCC 4M6IA 2B5GA 4FD6A 4U5YA 1XMBA 4JWPA 5EBVA 3B3VA 4MCQA 2PJ1A 1TIQA 2P0WA 2VQYA 3R9EA 4CGOA 1VHOA 3DR6A 3EXNA 4NGSA 4EVYA 2Y0MA 3D2PA 3R96A 4ONUA 4A37A 1TF9A 2EUIA 5A28A 2EVNA 4MXUA 4UFXA 2GIVA 1CG2A 1M4IA 1KWMA 2IJZA 3FRMA 3SJXA 3W6SA 1S7LA 3I1UA 1YMEA 3JTKA 2FIWA 2FIAA 1I21A 2B4DB 4ZYQA 2V77A 4M6GA 1TKFA 4GXHA 3VWEA 5I4MA 3R9FA 4OC4A 3EFAA 4A95A 5K8MA 3D66A 5D29A 2BOAA 2X7BA 4RS2A 4L8AA 2DPTA 3IWGA 4KOSA 2FS5A 1QMUA 4IHMA 4R87A 4JYWA 4R9MA 1HDQA 3B3WA 3KQZA 4B11A 2QIRA 1YVOA 3IO1A 4PXEA 4ZY1A 5AG4A 1Y9WA 3RBUA 1XRYA 4UEEA 3NH5A 2XEFA 4KSFA 4P4FA 1DTDA 3IC1A 4P4EA 5EMIA 2R1IA 2O28A 4MHNA 4R76A 4BBHA 2PDOA 3BI1A 4KVXA 1CPSA 1RO5A 2BCOA 4JZ0A 1I1DA 1LAMA 4R3LA 4XPLA 4MFPA 4TNUA 2ZEFA 3PB6X 1Y0RA 2AFXA 2C6CA 3WR7A 1N71A 4UBRA 1S7NA 5IX3A 1LAPA 4UIAA 2REEA 1R3NA 3DNSA 4P6YA 2ZELA 4XNHB 1QSTA 2ZOGA 5GCNA 1PU9A 2CF4A 4QC6A 5AG7A 4FAIA 1YVKA 2B3VA 4HPSA 1NSAA 3GYAA 5FVJA 4C2YA 2GU2A 3D7HA 2YNCA 2GLJA 5G1ZA 2WPWA 4B13A 1MJ9A 5CNPA 1M44A 5DWMA 3CZXA 4XPDB 4UWJA 2H5MA 5A27A 1AUGA 4B12A 1IICA 1XMTA 2PCUA 4ZY0A 4KOUA 4NEXA 6CPAA 4MFKA 4X3RA 4X8IA 4CRZB 1AMPA 3IU1A
chains in the Genus database with same CATH topology
2FE7A 4MHDA 3R1KA 2BSWA 4C7IA 3DDDA 5ISVA 3B8GA 1YLEA 2YNEA 4UWIA 3S6HA 1QSNA 2FXFA 2PSWA 3FNCA 3DR8A 4H6UA 4F0YA 4CGLA 2OZGA 3F8KA 4CGPA 4CYPA 4U9YA 4E8OA 4UCNA 2REFA 5F49A 4CGMA 2VXKA 5JPHA 1IYKA 2PC1A 1BOBA 1S60A 3IGRA 2B3UA 5J8FA 4KUAA 3OWCA 4NCZA 2Z0ZA 4HNWB 1KUXA 4MFJA 1YX0A 4A32A 1P4NA 2Q04A 4ZBGA 3S6GA 1Q2YA 2YNDA 5JQ4A 3EC4A 4KZTA 2D4PA 1IIDA 1Z4RA 3JVNA 4B5PB 2I00A 2OZHA 1YR0A 2B5GB 3TTHA 1XEBA 2FT0A 4AVAA 4IF5A 4JJXA 4ORFA 4H89A 4OADA 3D8PA 4AG7A 2ZW4A 3H5ZA 2KCWA 4JXRA 3CXQA 2RC4A 2VBQA 2GANA 5IV0A 3FB3A 2Q4YA 4CAWA 2BUEA 2G3AA 3QB8A 1M1DA 1CM0A 4AB7A 1S7FA 5IB0A 5G22A 4I49A 3SHPA 4FD5A 1J4JA 4PK3A 1SQHA 2P6FA 4BMHA 4CGNA 2OU2A 2PR1A 4MFQA 4E2AA 4CAXA 4KOTA 3D3SA 2Z3PA 2BEIA 2PRBA 3PP9A 3KKWA 3TO6A 1Q2CA 2QECA 3PGPA 3TOAA 2PQ8A 1PUAA 3PZJA 4DNCA 1YREA 4NXYA 4AVBA 2HV2A 2B4BA 2VZZA 2CNSA 3D2MA 3N7ZA 4QUSA 3R95A 4MI4A 3P2HA 3EO4A 5H86A 3F0AA 4KVOE 4IUSA 4MFLA 4KSAA 1NMTA 2ZW6A 2Q44A 5AGEA 4R3KA 3TO9A 5I0CA 5KTCA 2ZW5A 4XPKA 4YGOA 2ZW7A 2JDCA 1GHEA 1MJAA 3VWDA 2K5TA 1MK4A 5BWAB 2PR8A 1L0CA 4YRHA 2FL4A 4UFWA 1UFHA 3R9GA 4KLVA 2ZPAA 3MGDA 3V8IA 2C27A 3T90A 2Z10A 3S6KA 2AJ6A 4UCPA 2VEZA 4B5OA 3IWEA 4UA3A 1VHSA 3LD2A 1Q2DA 4HNYB 2IL4A 2F5IA 4JD6A 3SXNA 1XF8A 2CNMA 4MJ8A 2NMTA 4AG9A 2Z3KA 4KORA 4RI1A 3T9YA 2Q0YA 2GE3A 4MY3A 1M4GA 2FCKA 4KUBA 2Q4VA 1IYLA 2D4OA 1YK3A 1XE4A 4H6ZA 4KOXA 2R7HA 3P2FA 3NE7A 4UFVA 4CAVA 3LODA 2R8VA 1BO4A 1WK4A 5KTAA 4M3SA 3CXPA 4C2ZA 3BJ8A 4QB9A 3TO7A 3TT2A 2I79A 4Q36A 4U9ZA 5C88A 4NF1A 4Y49C 1MJBA 1YGHA 5HH1A 3DSBA 1KZFA 3W91A 1Y7RA 3C26A 1FY7A 4LUAA 4F6AA 4UCMA 4CYOA 3GKRA 3FXTA 3EY5A 4A30A 4PSWA 1K4JA 3TFYA 2DPSA 1P0HA 5G21A 4R57A 4AVCA 5F46A 4B10A 2YGWA 2Z3LA 2JDDA 3TOBA 5E96A 4XPDC 3H4QA 2QMLA 4C68A 4C7HA 1Z9UA 4A31A 4K30A 3FYNA 4CYQA 2CXAA 3E0KA 4LX9A 2B4DA 1VKCA 2P6GA 2Z3MA 4QBJA 2JLMA 3I3GA 2BL1A 3F5BA 1ZO0A 1S5KA 2J8MA 2Q7BA 1CJWA 4KLWA 5HMNA 4GS4A 4Q38A 5J8CA 2JEVA 5AG5A 2Z3OA 2G3TA 1KUVA 2WPXA 1NE9A 2VI7A 4QVTA 4CRYB 1B6BA 2FSRA 3I9SA 2J8NA 1QSRA 2ARHA 2Z3NA 2DXQA 3ZZIA 4CS0B 3IU2A 3G3SA 1IB1E 4KOWA 4Y49B 3RYOA 4CAFA 1S3ZA 4FD4A 4OLLA 1Z4EA 1OZPA 4JXQA 3K9UA 5EC4A 1WWZA 4JLYA 4A33A 1LRZA 4OAEA 2A4NA 1Y9KA 1RXTA 3ZJ0A 2OB0A 3GY9A 2WUUA 1KUYA 2ATRA 3A9LA 3CXSA 2G0BA 3FBUA 2J8RA 2P6EA 2AE6A 4PV6A 4YFJA 4HKFA 2B58A 4HNXB 3TCVA 3BLNA 3BJ7A 4CYNA 4CAEA 4J3GA 4PK2A 4X5KA 4F0XA 4E0AA 4PSXA 4M85A 4C2XA 1R57A 4B14A 2HUZA 4L89A 1I12A 1ON0A 1B87A 2OH1A 3W6XA 4KOVA 4KS9A 2CY2A 3JUWA 3G8WA 1U6MA 3S6FA 5KTDA 1S7KA 1V0CA 2VZYA 1QSOA 4MBUA 5AG6A 2ZXVA 3TE4A 5F47A 4II9A 2CNTA 4FD7A 4KVME 3FIXA 5C82A 5F48A 2OZUA 4MY0A 1QSMA 4A2ZA 4NSQA 4KOYA 4MFZA 1M4DA 2R98A 2HQYA 2WSAA 4XNHC 3QAHA 1XIXA 1NSLA 5H84A 4ZGYB 3UY5A 5G20A 5DWNA 2Z11A 4B5PA 2YNCC 2B5GA 4FD6A 4U5YA 4JWPA 5EBVA 1TIQA 2P0WA 2VQYA 3R9EA 4CGOA 3EXNA 3DR6A 4EVYA 2Y0MA 3D2PA 3R96A 4ONUA 2EUIA 5A28A 2EVNA 4UFXA 2GIVA 1M4IA 3FRMA 3W6SA 1S7LA 3JTKA 2FIWA 2FIAA 1I21A 2B4DB 3VWEA 3R9FA 3EFAA 4A95A 4RS2A 2X7BA 4L8AA 2DPTA 3IWGA 4KOSA 2FS5A 4R87A 4R9MA 4B11A 2QIRA 1YVOA 5AG4A 1Y9WA 4KSFA 2R1IA 2O28A 4BBHA 2PDOA 4KVXA 1RO5A 4R3LA 4XPLA 1I1DA 4MFPA 3WR7A 1N71A 4UBRA 1S7NA 5IX3A 2REEA 3DNSA 4XNHB 1QSTA 5GCNA 1PU9A 4QC6A 5AG7A 1YVKA 2B3VA 4C2YA 3GYAA 5FVJA 2YNCA 5G1ZA 2WPWA 4B13A 1MJ9A 5CNPA 1M44A 5DWMA 4XPDB 4UWJA 2H5MA 5A27A 4B12A 1IICA 1XMTA 4KOUA 4NEXA 4MFKA 3SXOA 4CRZB 3IU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE7 A;  4MHD A;  3R1K A;  2BSW A;  3DDD A;  5ISV A;  3B8G A;  1YLE A;  4UWI A;  3S6H A;  1QSN A;  2FXF A;  2PSW A;  3FNC A;  3DR8 A;  4H6U A;  4F0Y A;  2OZG A;  3F8K A;  4U9Y A;  4E8O A;  2REF A;  5F49 A;  2VXK A;  5JPH A;  1IYK A;  2PC1 A;  1BOB A;  1S60 A;  3IGR A;  2B3U A;  5J8F A;  4KUA A;  3OWC A;  4NCZ A;  2Z0Z A;  4HNW B;  1KUX A;  1YX0 A;  1P4N A;  2Q04 A;  4ZBG A;  3S6G A;  1Q2Y A;  5JQ4 A;  3EC4 A;  4KZT A;  2D4P A;  1IID A;  1Z4R A;  3JVN A;  4B5P B;  2I00 A;  2OZH A;  1YR0 A;  2B5G B;  3TTH A;  1XEB A;  2FT0 A;  4AVA A;  4IF5 A;  4JJX A;  4ORF A;  4H89 A;  4OAD A;  3D8P A;  4AG7 A;  2ZW4 A;  2KCW A;  4JXR A;  3CXQ A;  2RC4 A;  2VBQ A;  2GAN A;  5IV0 A;  3FB3 A;  2Q4Y A;  4CAW A;  2BUE A;  2G3A A;  3QB8 A;  1M1D A;  1CM0 A;  4AB7 A;  1S7F A;  5IB0 A;  4I49 A;  3SHP A;  4FD5 A;  1J4J A;  4PK3 A;  1SQH A;  2P6F A;  4BMH A;  2OU2 A;  2PR1 A;  4E2A A;  4CAX A;  4KOT A;  3D3S A;  2BEI A;  2PRB A;  3PP9 A;  3KKW A;  3TO6 A;  1Q2C A;  2QEC A;  3PGP A;  3TOA A;  2PQ8 A;  1PUA A;  3PZJ A;  4DNC A;  1YRE A;  4NXY A;  4AVB A;  2HV2 A;  2B4B A;  2VZZ A;  2CNS A;  3D2M A;  3N7Z A;  4QUS A;  3R95 A;  4MI4 A;  3P2H A;  3EO4 A;  5H86 A;  3F0A A;  4KVO E;  4IUS A;  1NMT A;  2ZW6 A;  2Q44 A;  4R3K A;  3TO9 A;  5I0C A;  5KTC A;  2ZW5 A;  4XPK A;  4YGO A;  2ZW7 A;  2JDC A;  1GHE A;  1MJA A;  3VWD A;  2K5T A;  1MK4 A;  2PR8 A;  1L0C A;  4YRH A;  2FL4 A;  1UFH A;  3R9G A;  4KLV A;  2ZPA A;  3MGD A;  3V8I A;  2C27 A;  3T90 A;  2Z10 A;  3S6K A;  2AJ6 A;  2VEZ A;  4B5O A;  4UA3 A;  1VHS A;  3LD2 A;  1Q2D A;  4HNY B;  2IL4 A;  2F5I A;  4JD6 A;  3SXN A;  1XF8 A;  2CNM A;  4MJ8 A;  2NMT A;  4AG9 A;  4KOR A;  4RI1 A;  3T9Y A;  2Q0Y A;  2GE3 A;  1M4G A;  2FCK A;  4KUB A;  2Q4V A;  1IYL A;  2D4O A;  1YK3 A;  1XE4 A;  4H6Z A;  4KOX A;  2R7H A;  3P2F A;  3NE7 A;  4CAV A;  3LOD A;  2R8V A;  1BO4 A;  1WK4 A;  5KTA A;  4M3S A;  3CXP A;  3BJ8 A;  4QB9 A;  3TO7 A;  3TT2 A;  2I79 A;  4U9Z A;  5C88 A;  4NF1 A;  4Y49 C;  1MJB A;  1YGH A;  5HH1 A;  3DSB A;  1KZF A;  3W91 A;  1Y7R A;  3C26 A;  1FY7 A;  4LUA A;  4F6A A;  3GKR A;  3FXT A;  3EY5 A;  4PSW A;  1K4J A;  3TFY A;  1P0H A;  4R57 A;  4AVC A;  5F46 A;  2JDD A;  3TOB A;  5E96 A;  4XPD C;  3H4Q A;  2QML A;  1Z9U A;  4K30 A;  3FYN A;  3E0K A;  4LX9 A;  2B4D A;  1VKC A;  2P6G A;  4QBJ A;  2JLM A;  3I3G A;  2BL1 A;  3F5B A;  1S5K A;  2J8M A;  2Q7B A;  1CJW A;  4KLW A;  5HMN A;  4GS4 A;  5J8C A;  2JEV A;  2G3T A;  1KUV A;  2WPX A;  1NE9 A;  2VI7 A;  4QVT A;  4CRY B;  1B6B A;  2FSR A;  3I9S A;  2J8N A;  1QSR A;  2ARH A;  2DXQ A;  3ZZI A;  4CS0 B;  3G3S A;  1IB1 E;  4KOW A;  4Y49 B;  3RYO A;  1S3Z A;  4FD4 A;  4OLL A;  1Z4E A;  1OZP A;  4JXQ A;  3K9U A;  5EC4 A;  1WWZ A;  4JLY A;  1LRZ A;  4OAE A;  2A4N A;  1Y9K A;  1RXT A;  3ZJ0 A;  2OB0 A;  3GY9 A;  1KUY A;  2ATR A;  3CXS A;  2G0B A;  3FBU A;  2J8R A;  2P6E A;  2AE6 A;  4PV6 A;  4YFJ A;  4HKF A;  2B58 A;  4HNX B;  3TCV A;  3BLN A;  3BJ7 A;  4J3G A;  4PK2 A;  4X5K A;  4E0A A;  4PSX A;  4M85 A;  1R57 A;  2HUZ A;  4L89 A;  1I12 A;  1ON0 A;  1B87 A;  2OH1 A;  3W6X A;  4KOV A;  2CY2 A;  3JUW A;  3G8W A;  1U6M A;  3S6F A;  5KTD A;  1S7K A;  1V0C A;  2VZY A;  1QSO A;  4MBU A;  2ZXV A;  3TE4 A;  5F47 A;  4II9 A;  2CNT A;  4FD7 A;  4KVM E;  3FIX A;  5C82 A;  5F48 A;  2OZU A;  4MY0 A;  1QSM A;  4NSQ A;  4KOY A;  1M4D A;  2R98 A;  2HQY A;  4XNH C;  3QAH A;  1XIX A;  1NSL A;  5H84 A;  3UY5 A;  5DWN A;  2Z11 A;  4B5P A;  2B5G A;  4FD6 A;  4U5Y A;  4JWP A;  5EBV A;  1TIQ A;  2P0W A;  2VQY A;  3R9E A;  4EVY A;  3EXN A;  3DR6 A;  2Y0M A;  3D2P A;  3R96 A;  4ONU A;  2EUI A;  2EVN A;  2GIV A;  1M4I A;  3FRM A;  3W6S A;  1S7L A;  2FIW A;  2FIA A;  1I21 A;  2B4D B;  3VWE A;  3R9F A;  3EFA A;  4RS2 A;  2X7B A;  4L8A A;  3IWG A;  4KOS A;  2FS5 A;  4R87 A;  4R9M A;  2QIR A;  1YVO A;  1Y9W A;  2R1I A;  2O28 A;  2PDO A;  4KVX A;  1RO5 A;  4R3L A;  4XPL A;  1I1D A;  3WR7 A;  1N71 A;  4UBR A;  1S7N A;  5IX3 A;  2REE A;  3DNS A;  4XNH B;  1QST A;  5GCN A;  1PU9 A;  4QC6 A;  1YVK A;  2B3V A;  3GYA A;  5FVJ A;  2WPW A;  1MJ9 A;  5CNP A;  1M44 A;  5DWM A;  4XPD B;  4UWJ A;  2H5M A;  1IIC A;  1XMT A;  4KOU A;  4NEX A;  3SXO A;  4CRZ B;  4MY3 A; 
#chains in the Genus database with same CATH topology
 4MCS A;  4OC5 A;  4PQA A;  2FE7 A;  4MHD A;  4ZX9 A;  1X10 A;  3R1K A;  2BSW A;  1EE3 P;  4C7I A;  3DDD A;  5J1Q A;  2GRE A;  2QVP A;  5ISV A;  1R43 A;  3B8G A;  2BO9 A;  1H8L A;  1YLE A;  3QNV A;  3PEI A;  3QAY A;  1LFW A;  1ZG8 A;  2XEG A;  2YNE A;  4RN7 A;  4UWI A;  3S6H A;  5JGF A;  3GUX A;  3PRT A;  1FNO A;  1QSN A;  2FXF A;  2PSW A;  5HXD A;  3FNC A;  4UIB A;  3DR8 A;  3FH4 A;  1YW6 A;  1IOF A;  4H6U A;  4Q7A A;  4F0Y A;  4CGL A;  4DUK A;  2OZG A;  3F8K A;  4OME A;  3BXM A;  4CGP A;  2PRQ A;  3KQX A;  2XEJ A;  4CYP A;  2EO8 A;  4U9Y A;  4R6T A;  1IY7 A;  3VAR A;  4E8O A;  5LYD A;  4UCN A;  2REF A;  5F49 A;  4CGM A;  2V8V A;  4OC1 A;  2VXK A;  5JPH A;  1IYK A;  2PC1 A;  1BOB A;  1S60 A;  4OC0 A;  4LQ6 A;  3IGR A;  2B3U A;  5J8F A;  1ELM P;  2ODF A;  4KUA A;  4P44 A;  3OWC A;  4OC2 A;  1ZLH A;  2DEA A;  3FMC A;  4NCZ A;  2Z0Z A;  2PIY A;  4HNW B;  1IU8 A;  3RZA A;  2ZEN A;  1KUX A;  1GYT A;  4LQG A;  4MFJ A;  4NGP A;  1YX0 A;  4A32 A;  2WZN A;  3TX8 A;  1P4N A;  2Q04 A;  4ZBG A;  4PXB A;  3S6G A;  1Q2Y A;  3TC8 A;  5IB9 A;  2YND A;  2ANP A;  4UEZ A;  5JQ4 A;  3SI0 A;  1ZLI A;  3EC4 A;  2OOT A;  4KZT A;  2D4P A;  4NJQ A;  1IID A;  1Z4R A;  3JVN A;  1PCA A;  1RTQ A;  4B5P B;  3KGQ A;  2I00 A;  2OZH A;  1YR0 A;  2B5G B;  4YWY A;  1VGY A;  1XEB A;  2FT0 A;  3TTH A;  4IF5 A;  4AVA A;  4JJX A;  4ORF A;  4H89 A;  4OAD A;  2OR4 A;  1UWY A;  3D8P A;  4AG7 A;  5D8N A;  2DF5 A;  3BHX A;  3PBE A;  2PJC A;  3PB4 X;  2V8D A;  4F8Z A;  2ZW4 A;  3D7D A;  1OBR A;  1VHE A;  3H5Z A;  2G9D A;  4FUU A;  2KCW A;  1JQG A;  4B6Z A;  4JXR A;  3CXQ A;  4OIW A;  2RC4 A;  1YLO A;  2VBQ A;  2GAN A;  5IV0 A;  1CBX A;  3IEH A;  3FB3 A;  3SJF A;  3SI2 A;  2Q4Y A;  4CAW A;  3SI1 A;  2BUE A;  2G3A A;  3QB8 A;  1M1D A;  4NGN A;  1CM0 A;  1FT7 A;  2EK9 A;  4P4I A;  3L2N A;  3SJG A;  4O23 A;  5HVF A;  4MHP A;  4AB7 A;  1S7F A;  5IB0 A;  2AFS A;  5G22 A;  5F09 A;  2ZEG A;  2O53 A;  4I49 A;  3SHP A;  2ZEH A;  3KHZ A;  1J4J A;  4FD5 A;  1SQH A;  2P6F A;  3FEC A;  3K2K A;  4PK3 A;  4ZX8 A;  3S9M A;  4BMH A;  4DYO A;  1ARM A;  2EK8 A;  4CGN A;  1HEE A;  5JH9 A;  2OU2 A;  2PR1 A;  4MFQ A;  3VAT A;  4BD9 A;  4P4B A;  4CAX A;  4E2A A;  4KOT A;  4PXC A;  2C1C A;  3D3S A;  1DE4 C;  2Z3P A;  3FX6 A;  2AFU A;  2BEI A;  2PRB A;  3B3S A;  3KHX A;  3KKW A;  3PP9 A;  3TO6 A;  1Q2C A;  2QEC A;  5THW A;  4BIN A;  2JBJ A;  3KL9 A;  3PGP A;  2PQ8 A;  3TOA A;  1PUA A;  3PZJ A;  4DNC A;  1YRE A;  4CPA A;  2Q43 A;  4NXY A;  4AVB A;  3LAC A;  1X12 A;  5LYI A;  4H2K A;  2HV2 A;  2B4B A;  2VZZ A;  2CNS A;  3D2M A;  3N7Z A;  4QUS A;  2Q7S A;  3R95 A;  4MI4 A;  3P2H A;  1TF8 A;  4W9Y A;  3EO4 A;  1Z8X A;  2RFH A;  5K8O A;  2PVV A;  5LYL A;  3KAS A;  5H86 A;  1Z5R A;  3F0A A;  4KVO E;  4IUS A;  3B2Y A;  4ZY2 A;  2PJ5 A;  1Z8T A;  4MFL A;  1XBU A;  5CPA A;  4F9U A;  4KSA A;  1NMT A;  2F7V A;  2ZW6 A;  2Q44 A;  3WT4 A;  5AGE A;  3KR4 A;  5ELY A;  1AYE A;  4R3K A;  3TO9 A;  5I0C A;  2PJ2 A;  2V8H A;  5KTC A;  3NH8 A;  2ZW5 A;  4XPK A;  4YGO A;  2ZW7 A;  2PE3 A;  2JEW A;  3D68 A;  2JDC A;  1YSJ A;  1GHE A;  1MJA A;  3HLP A;  3LWU A;  2ZEO A;  3KZW A;  3VWD A;  2K5T A;  1MK4 A;  5BWA B;  3FEE A;  2PR8 A;  3DLJ A;  4X2T A;  4ZI6 A;  1L0C A;  1Q7L A;  4YRH A;  1F57 A;  2AFZ A;  3CT9 A;  3PB9 X;  1CPX A;  3V7Z A;  2FL4 A;  4UFW A;  1UFH A;  3R9G A;  5LRK A;  1BPM A;  2PJ9 A;  4KLV A;  1YW4 A;  2ZPA A;  3GIU A;  1XFO A;  3MGD A;  3V8I A;  2C27 A;  3T90 A;  2Z10 A;  3S6K A;  4OID A;  2AJ6 A;  4UCP A;  2VEZ A;  3VH9 A;  4B5O A;  3IWE A;  4UA3 A;  3NA6 A;  4WJB A;  1CP7 A;  3S9L A;  1VHS A;  4UEF A;  3T8W A;  3LD2 A;  1Q2D A;  2AFO A;  4HNY B;  2IL4 A;  2F5I A;  4FWU A;  2CTC A;  1XF8 A;  2CNM A;  4JD6 A;  2NMT A;  4MJ8 A;  3SXN A;  4AG9 A;  3BI0 A;  2Z3K A;  4KOR A;  4RI1 A;  3T9Y A;  2Q0Y A;  3PFO A;  2GE3 A;  4MY3 A;  1M4G A;  2FCK A;  4KUB A;  2Q4V A;  1IYL A;  2D4O A;  1YK3 A;  1XE4 A;  1Z8L A;  4H6Z A;  4IK2 A;  4KOX A;  1HDU A;  2R7H A;  1IOI A;  3P2F A;  5CBM A;  3NE7 A;  4M6H A;  4UFV A;  4CAV A;  2C6P A;  3FED A;  3LOD A;  2R8V A;  1BO4 A;  1WK4 A;  5KTA A;  4M3S A;  3B3T A;  1LCP A;  3CXP A;  4C2Z A;  1ARL A;  3BJ8 A;  3ISX A;  4P4J A;  2EBJ A;  4NGT A;  3D7F A;  4QB9 A;  3TO7 A;  3S9N A;  2PJ3 A;  3TT2 A;  4PPZ A;  3V38 A;  2I3C A;  2I79 A;  8CPA A;  7CPA A;  2PIZ A;  4A39 A;  5K8P A;  3FJU A;  4Q36 A;  2AFM A;  4NGR A;  5LRJ A;  4U9Z A;  1Y0Y A;  5C88 A;  3ISZ A;  3H8G A;  4NF1 A;  4NJR A;  4Y49 C;  2PJ4 A;  1MJB A;  3IJ3 A;  2FVG A;  1YGH A;  5HH1 A;  3DSB A;  1KZF A;  3MN8 A;  1Y7R A;  3MRU A;  3W91 A;  3D7G A;  3C26 A;  1FY7 A;  4LUA A;  4F6A A;  4UCM A;  1Z2L A;  4CYO A;  3GKR A;  2QJ8 A;  2CIJ A;  3FXT A;  3EY5 A;  4A30 A;  3FVL A;  4OKO A;  4PSW A;  4WWV A;  1K4J A;  3TFY A;  2DPS A;  1F2P A;  1P0H A;  5G21 A;  4R57 A;  4AXV A;  5K8N A;  3WC5 A;  2PJ8 A;  4AVC A;  4B10 A;  4EWT A;  2YGW A;  5F46 A;  2Z3L A;  4NGM A;  2JDD A;  3TOB A;  5E96 A;  3RAM A;  4MRI A;  4MHZ A;  4XPD C;  2O4H A;  3H4Q A;  2QML A;  3H8F A;  1CX8 A;  4C68 A;  4C7H A;  1BPN A;  1Z9U A;  3FF3 A;  4K30 A;  2J9A A;  4P10 A;  3D67 A;  2RB7 A;  3FYN A;  4A31 A;  4CYQ A;  1F2O A;  2CXA A;  3PB8 X;  3E0K A;  3KI9 A;  4LX9 A;  2F8H A;  2B4D A;  3IFE A;  4MCR A;  1VKC A;  2P6G A;  2Z3M A;  3B7I A;  2Q4Z A;  3SXO A;  3GB0 A;  2JLM A;  4QBJ A;  3I3G A;  2CTB A;  2BL1 A;  3RNZ A;  3SJE A;  2PJB A;  3DGV A;  3F5B A;  3IIB A;  1ZG7 A;  2Q51 A;  1ZO0 A;  1S5K A;  5JM6 A;  2J8M A;  2Q7B A;  1CJW A;  4NFR A;  4KLW A;  1JWQ A;  4GS4 A;  5HMN A;  4Q38 A;  5J8C A;  2PJ6 A;  2V8G A;  4YU9 A;  2JEV A;  3LMS A;  3GLJ A;  5AG5 A;  2Z3O A;  3N5F A;  2G3T A;  1KUV A;  2WPX A;  5HVG A;  1NE9 A;  3H8E A;  2VI7 A;  4QVT A;  4CRY B;  1B6B A;  2FSR A;  4TWE A;  2GLF A;  3I9S A;  2J8N A;  1Z8W A;  4EME A;  1QSR A;  5HVH A;  3JRU A;  2ARH A;  2Z3N A;  1ZG9 A;  2DXQ A;  3ZZI A;  4CS0 B;  2C6G A;  4R7M A;  3IU2 A;  3WC6 A;  2PVW A;  3CDX A;  3G3S A;  2QYV A;  4MMO A;  1IB1 E;  4KOW A;  1XOV A;  2PJ0 A;  4Y49 B;  4G1P A;  3RYO A;  4CAF A;  4P45 A;  1S3Z A;  4FD4 A;  4OLL A;  2ZED A;  1Z4E A;  1OZP A;  4OC3 A;  4JXQ A;  4A38 A;  3K9U A;  5EC4 A;  1WWZ A;  4JLY A;  4A33 A;  2XEI A;  1LRZ A;  3PBB A;  5DS0 A;  3WAB A;  2ZEE A;  3B3C A;  3PFE A;  4OAE A;  2A4N A;  1Y9K A;  1RXT A;  3ZJ0 A;  4RUH A;  2OB0 A;  1LAN A;  3GY9 A;  1CP6 A;  2WUU A;  1KUY A;  2HC9 A;  2ATR A;  1TKJ A;  3A9L A;  2EWB A;  3CXS A;  2G0B A;  3FBU A;  2J8R A;  1IGB A;  2P6E A;  2AE6 A;  4MHY A;  1PYT B;  4PV6 A;  4YFJ A;  2ZOF A;  3PB7 X;  4HKF A;  2B58 A;  3RO0 A;  4HNX B;  3TCV A;  3BLN A;  4K3N A;  3BJ7 A;  4DJL A;  4CYN A;  2ZEM A;  1TXR A;  2ABZ A;  4CAE A;  4J3G A;  2JBK A;  4ONW A;  1TKH A;  2PJ7 A;  4PK2 A;  4X5K A;  4F0X A;  4E0A A;  4PSX A;  3B35 A;  4KSI A;  1R57 A;  4M85 A;  4C2X A;  1BLL E;  4GM5 A;  4Z65 A;  2GFQ A;  2VL1 A;  3WC7 A;  2HB6 A;  2HUZ A;  4B14 A;  4L89 A;  1I12 A;  1ON0 A;  1B87 A;  3HUV A;  1M4L A;  2OH1 A;  2AFW A;  3W6X A;  4KOV A;  4KS9 A;  2CY2 A;  3JUW A;  3K9T A;  3D4U A;  3G8W A;  2POK A;  1XJO A;  1U6M A;  1YQE A;  3S6F A;  5KTD A;  1S7K A;  1V0C A;  2VZY A;  2IQ6 A;  3CPA A;  1QSO A;  4UF4 A;  4F9V A;  4MBU A;  5AG6 A;  2ZXV A;  3TE4 A;  2NSM A;  5F47 A;  3NE8 A;  1LOK A;  2PJA A;  1Y7E A;  5LRG A;  4II9 A;  2IMO A;  2CNT A;  4R8F A;  4FD7 A;  4KVM E;  1QQ9 A;  4A94 A;  3FIX A;  4EFD A;  5C82 A;  5F48 A;  2OZU A;  4OP4 A;  4MY0 A;  2ZEP A;  3KR5 A;  1QSM A;  3IWW A;  1VIX A;  4A2Z A;  4PXD A;  4P4D A;  4NSQ A;  4KOY A;  4MFZ A;  1M4D A;  2R98 A;  3CPX A;  4FBE A;  2HQY A;  4NGQ A;  3NH4 A;  2WSA A;  4XNH C;  3QAH A;  1XIX A;  1NSL A;  5H84 A;  5LYF A;  4ZGY B;  2NYQ A;  3UY5 A;  5G20 A;  3NFZ A;  2WYR A;  4MCP A;  1ELL P;  1A2Z A;  2Z11 A;  1BAV A;  5DWN A;  4B5P A;  4IAV A;  2YNC C;  4M6I A;  2B5G A;  4FD6 A;  4U5Y A;  1XMB A;  4JWP A;  5EBV A;  3B3V A;  4MCQ A;  2PJ1 A;  1TIQ A;  2P0W A;  2VQY A;  3R9E A;  4CGO A;  1VHO A;  3DR6 A;  3EXN A;  4NGS A;  4EVY A;  2Y0M A;  3D2P A;  3R96 A;  4ONU A;  4A37 A;  1TF9 A;  2EUI A;  5A28 A;  2EVN A;  4MXU A;  4UFX A;  2GIV A;  1CG2 A;  1M4I A;  1KWM A;  2IJZ A;  3FRM A;  3SJX A;  3W6S A;  1S7L A;  3I1U A;  1YME A;  3JTK A;  2FIW A;  2FIA A;  1I21 A;  2B4D B;  4ZYQ A;  2V77 A;  4M6G A;  1TKF A;  4GXH A;  3VWE A;  5I4M A;  3R9F A;  4OC4 A;  3EFA A;  4A95 A;  5K8M A;  3D66 A;  5D29 A;  2BOA A;  2X7B A;  4RS2 A;  4L8A A;  2DPT A;  3IWG A;  4KOS A;  2FS5 A;  1QMU A;  4IHM A;  4R87 A;  4JYW A;  4R9M A;  1HDQ A;  3B3W A;  3KQZ A;  4B11 A;  2QIR A;  1YVO A;  3IO1 A;  4PXE A;  4ZY1 A;  5AG4 A;  1Y9W A;  3RBU A;  1XRY A;  4UEE A;  3NH5 A;  2XEF A;  4KSF A;  4P4F A;  1DTD A;  3IC1 A;  4P4E A;  5EMI A;  2R1I A;  2O28 A;  4MHN A;  4R76 A;  4BBH A;  2PDO A;  3BI1 A;  4KVX A;  1CPS A;  1RO5 A;  2BCO A;  4JZ0 A;  1I1D A;  1LAM A;  4R3L A;  4XPL A;  4MFP A;  4TNU A;  2ZEF A;  3PB6 X;  1Y0R A;  2AFX A;  2C6C A;  3WR7 A;  1N71 A;  4UBR A;  1S7N A;  5IX3 A;  1LAP A;  4UIA A;  2REE A;  1R3N A;  3DNS A;  4P6Y A;  2ZEL A;  4XNH B;  1QST A;  2ZOG A;  5GCN A;  1PU9 A;  2CF4 A;  4QC6 A;  5AG7 A;  4FAI A;  1YVK A;  2B3V A;  4HPS A;  1NSA A;  3GYA A;  5FVJ A;  4C2Y A;  2GU2 A;  3D7H A;  2YNC A;  2GLJ A;  5G1Z A;  2WPW A;  4B13 A;  1MJ9 A;  5CNP A;  1M44 A;  5DWM A;  3CZX A;  4XPD B;  4UWJ A;  2H5M A;  5A27 A;  1AUG A;  4B12 A;  1IIC A;  1XMT A;  2PCU A;  4ZY0 A;  4KOU A;  4NEX A;  6CPA A;  4MFK A;  4X3R A;  4X8I A;  4CRZ B;  1AMP A;  3IU1 A; 
#chains in the Genus database with same CATH homology
 2FE7 A;  4MHD A;  3R1K A;  2BSW A;  4C7I A;  3DDD A;  5ISV A;  3B8G A;  1YLE A;  2YNE A;  4UWI A;  3S6H A;  1QSN A;  2FXF A;  2PSW A;  3FNC A;  3DR8 A;  4H6U A;  4F0Y A;  4CGL A;  2OZG A;  3F8K A;  4CGP A;  4CYP A;  4U9Y A;  4E8O A;  4UCN A;  2REF A;  5F49 A;  4CGM A;  2VXK A;  5JPH A;  1IYK A;  2PC1 A;  1BOB A;  1S60 A;  3IGR A;  2B3U A;  5J8F A;  4KUA A;  3OWC A;  4NCZ A;  2Z0Z A;  4HNW B;  1KUX A;  4MFJ A;  1YX0 A;  4A32 A;  1P4N A;  2Q04 A;  4ZBG A;  3S6G A;  1Q2Y A;  2YND A;  5JQ4 A;  3EC4 A;  4KZT A;  2D4P A;  1IID A;  1Z4R A;  3JVN A;  4B5P B;  2I00 A;  2OZH A;  1YR0 A;  2B5G B;  3TTH A;  1XEB A;  2FT0 A;  4AVA A;  4IF5 A;  4JJX A;  4ORF A;  4H89 A;  4OAD A;  3D8P A;  4AG7 A;  2ZW4 A;  3H5Z A;  2KCW A;  4JXR A;  3CXQ A;  2RC4 A;  2VBQ A;  2GAN A;  5IV0 A;  3FB3 A;  2Q4Y A;  4CAW A;  2BUE A;  2G3A A;  3QB8 A;  1M1D A;  1CM0 A;  4AB7 A;  1S7F A;  5IB0 A;  5G22 A;  4I49 A;  3SHP A;  4FD5 A;  1J4J A;  4PK3 A;  1SQH A;  2P6F A;  4BMH A;  4CGN A;  2OU2 A;  2PR1 A;  4MFQ A;  4E2A A;  4CAX A;  4KOT A;  3D3S A;  2Z3P A;  2BEI A;  2PRB A;  3PP9 A;  3KKW A;  3TO6 A;  1Q2C A;  2QEC A;  3PGP A;  3TOA A;  2PQ8 A;  1PUA A;  3PZJ A;  4DNC A;  1YRE A;  4NXY A;  4AVB A;  2HV2 A;  2B4B A;  2VZZ A;  2CNS A;  3D2M A;  3N7Z A;  4QUS A;  3R95 A;  4MI4 A;  3P2H A;  3EO4 A;  5H86 A;  3F0A A;  4KVO E;  4IUS A;  4MFL A;  4KSA A;  1NMT A;  2ZW6 A;  2Q44 A;  5AGE A;  4R3K A;  3TO9 A;  5I0C A;  5KTC A;  2ZW5 A;  4XPK A;  4YGO A;  2ZW7 A;  2JDC A;  1GHE A;  1MJA A;  3VWD A;  2K5T A;  1MK4 A;  5BWA B;  2PR8 A;  1L0C A;  4YRH A;  2FL4 A;  4UFW A;  1UFH A;  3R9G A;  4KLV A;  2ZPA A;  3MGD A;  3V8I A;  2C27 A;  3T90 A;  2Z10 A;  3S6K A;  2AJ6 A;  4UCP A;  2VEZ A;  4B5O A;  3IWE A;  4UA3 A;  1VHS A;  3LD2 A;  1Q2D A;  4HNY B;  2IL4 A;  2F5I A;  4JD6 A;  3SXN A;  1XF8 A;  2CNM A;  4MJ8 A;  2NMT A;  4AG9 A;  2Z3K A;  4KOR A;  4RI1 A;  3T9Y A;  2Q0Y A;  2GE3 A;  4MY3 A;  1M4G A;  2FCK A;  4KUB A;  2Q4V A;  1IYL A;  2D4O A;  1YK3 A;  1XE4 A;  4H6Z A;  4KOX A;  2R7H A;  3P2F A;  3NE7 A;  4UFV A;  4CAV A;  3LOD A;  2R8V A;  1BO4 A;  1WK4 A;  5KTA A;  4M3S A;  3CXP A;  4C2Z A;  3BJ8 A;  4QB9 A;  3TO7 A;  3TT2 A;  2I79 A;  4Q36 A;  4U9Z A;  5C88 A;  4NF1 A;  4Y49 C;  1MJB A;  1YGH A;  5HH1 A;  3DSB A;  1KZF A;  3W91 A;  1Y7R A;  3C26 A;  1FY7 A;  4LUA A;  4F6A A;  4UCM A;  4CYO A;  3GKR A;  3FXT A;  3EY5 A;  4A30 A;  4PSW A;  1K4J A;  3TFY A;  2DPS A;  1P0H A;  5G21 A;  4R57 A;  4AVC A;  5F46 A;  4B10 A;  2YGW A;  2Z3L A;  2JDD A;  3TOB A;  5E96 A;  4XPD C;  3H4Q A;  2QML A;  4C68 A;  4C7H A;  1Z9U A;  4A31 A;  4K30 A;  3FYN A;  4CYQ A;  2CXA A;  3E0K A;  4LX9 A;  2B4D A;  1VKC A;  2P6G A;  2Z3M A;  4QBJ A;  2JLM A;  3I3G A;  2BL1 A;  3F5B A;  1ZO0 A;  1S5K A;  2J8M A;  2Q7B A;  1CJW A;  4KLW A;  5HMN A;  4GS4 A;  4Q38 A;  5J8C A;  2JEV A;  5AG5 A;  2Z3O A;  2G3T A;  1KUV A;  2WPX A;  1NE9 A;  2VI7 A;  4QVT A;  4CRY B;  1B6B A;  2FSR A;  3I9S A;  2J8N A;  1QSR A;  2ARH A;  2Z3N A;  2DXQ A;  3ZZI A;  4CS0 B;  3IU2 A;  3G3S A;  1IB1 E;  4KOW A;  4Y49 B;  3RYO A;  4CAF A;  1S3Z A;  4FD4 A;  4OLL A;  1Z4E A;  1OZP A;  4JXQ A;  3K9U A;  5EC4 A;  1WWZ A;  4JLY A;  4A33 A;  1LRZ A;  4OAE A;  2A4N A;  1Y9K A;  1RXT A;  3ZJ0 A;  2OB0 A;  3GY9 A;  2WUU A;  1KUY A;  2ATR A;  3A9L A;  3CXS A;  2G0B A;  3FBU A;  2J8R A;  2P6E A;  2AE6 A;  4PV6 A;  4YFJ A;  4HKF A;  2B58 A;  4HNX B;  3TCV A;  3BLN A;  3BJ7 A;  4CYN A;  4CAE A;  4J3G A;  4PK2 A;  4X5K A;  4F0X A;  4E0A A;  4PSX A;  4M85 A;  4C2X A;  1R57 A;  4B14 A;  2HUZ A;  4L89 A;  1I12 A;  1ON0 A;  1B87 A;  2OH1 A;  3W6X A;  4KOV A;  4KS9 A;  2CY2 A;  3JUW A;  3G8W A;  1U6M A;  3S6F A;  5KTD A;  1S7K A;  1V0C A;  2VZY A;  1QSO A;  4MBU A;  5AG6 A;  2ZXV A;  3TE4 A;  5F47 A;  4II9 A;  2CNT A;  4FD7 A;  4KVM E;  3FIX A;  5C82 A;  5F48 A;  2OZU A;  4MY0 A;  1QSM A;  4A2Z A;  4NSQ A;  4KOY A;  4MFZ A;  1M4D A;  2R98 A;  2HQY A;  2WSA A;  4XNH C;  3QAH A;  1XIX A;  1NSL A;  5H84 A;  4ZGY B;  3UY5 A;  5G20 A;  5DWN A;  2Z11 A;  4B5P A;  2YNC C;  2B5G A;  4FD6 A;  4U5Y A;  4JWP A;  5EBV A;  1TIQ A;  2P0W A;  2VQY A;  3R9E A;  4CGO A;  3EXN A;  3DR6 A;  4EVY A;  2Y0M A;  3D2P A;  3R96 A;  4ONU A;  2EUI A;  5A28 A;  2EVN A;  4UFX A;  2GIV A;  1M4I A;  3FRM A;  3W6S A;  1S7L A;  3JTK A;  2FIW A;  2FIA A;  1I21 A;  2B4D B;  3VWE A;  3R9F A;  3EFA A;  4A95 A;  4RS2 A;  2X7B A;  4L8A A;  2DPT A;  3IWG A;  4KOS A;  2FS5 A;  4R87 A;  4R9M A;  4B11 A;  2QIR A;  1YVO A;  5AG4 A;  1Y9W A;  4KSF A;  2R1I A;  2O28 A;  4BBH A;  2PDO A;  4KVX A;  1RO5 A;  4R3L A;  4XPL A;  1I1D A;  4MFP A;  3WR7 A;  1N71 A;  4UBR A;  1S7N A;  5IX3 A;  2REE A;  3DNS A;  4XNH B;  1QST A;  5GCN A;  1PU9 A;  4QC6 A;  5AG7 A;  1YVK A;  2B3V A;  4C2Y A;  3GYA A;  5FVJ A;  2YNC A;  5G1Z A;  2WPW A;  4B13 A;  1MJ9 A;  5CNP A;  1M44 A;  5DWM A;  4XPD B;  4UWJ A;  2H5M A;  5A27 A;  4B12 A;  1IIC A;  1XMT A;  4KOU A;  4NEX A;  4MFK A;  3SXO A;  4CRZ B;  3IU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...