4RS2A

1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
HHTDPALRALIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEHFNRFGLCGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Predicted acyltransferase with acyl-CoA N-acyltransferase do
publication title 1.55 Angstrom Crystal Structure of GNAT Family N-acetyltransferase (YhbS) from Escherichia coli in Complex with CoA.
rcsb
source organism Escherichia coli
total genus 48
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4rs2A00
3SHPA 5H86A 2Y0MA 2ZW5A 1QSTA 3C26A 3W6XA 3SXNA 2Q0YA 1VHSA 4AG9A 3IWGA 1IICA 3W91A 4R87A 2B58A 4II9A 3BJ7A 4KORA 2F5IA 2PRBA 2FSRA 2GE3A 1LRZA 4U9ZA 5EC4A 4UWIA 1Y9KA 2A4NA 3SXOA 2VBQA 3I3GA 4R3KA 4KUAA 2EUIA 3R9FA 3S6FA 2B5GB 3W6SA 2FE7A 2FS5A 3BJ8A 3TO6A 3TOAA 4KVOE 4NEXA 2REFA 4AVBA 5C82A 2P0WA 4GS4A 4PV6A 5I0CA 1N71A 1B6BA 3TO7A 2IL4A 4M3SA 2VQYA 1Z9UA 3FYNA 3CXQA 1BO4A 3R9GA 3P2FA 1UFHA 2B4DB 4DNCA 2CY2A 2ARHA 1KUXA 4CAWA 4PSXA 1M44A 4KLVA 3DR8A 2PR1A 4XPDB 4QC6A 1IIDA 1XMTA 2B4BA 4OAEA 4MY3A 3FIXA 2C27A 2Q4YA 4E2AA 2OH1A 4CAVA 1S7LA 1TIQA 4KVXA 1M1DA 2PSWA 4MI4A 3EFAA 4PK2A 5J8FA 4HNWB 2HV2A 3D2PA 2FL4A 1MJBA 2AE6A 5F48A 4H6ZA 4I49A 1WWZA 3EO4A 3H4QA 4KOTA 3JVNA 4R9MA 1L0CA 4KLWA 1S7KA 2EVNA 2WPWA 1I21A 1J4JA 2R98A 2JLMA 3N7ZA 3R96A 4JXRA 2I00A 1Q2YA 4Y49B 1QSMA 3V8IA 1PU9A 2FT0A 2J8NA 4KOWA 2ATRA 4FD6A 2G3AA 5HMNA 2GANA 1Q2CA 4NXYA 4X5KA 3FRMA 2BL1A 4IUSA 4QBJA 3TO9A 4XNHB 1VKCA 2QIRA 3ZJ0A 2AJ6A 4QUSA 4R3LA 3TFYA 4L89A 3R95A 4JJXA 1K4JA 4UBRA 2D4OA 5KTAA 3DR6A 3QAHA 4BMHA 2I79A 3E0KA 4J3GA 4UA3A 2JDDA 2B3VA 5E96A 3S6KA 2G0BA 1Z4EA 1IYKA 1MJ9A 1M4DA 4LX9A 2CNSA 2B3UA 1XE4A 4YFJA 5EBVA 4XPLA 3G3SA 4F0YA 3GYAA 2G3TA 3FNCA 4AVAA 2PC1A 1U6MA 4MY0A 1NE9A 5JQ4A 1IYLA 2Q04A 4KOUA 2Z10A 2NMTA 1OZPA 1IB1E 3D2MA 2FCKA 3JUWA 4OADA 4B5OA 1QSRA 3PZJA 2R7HA 3VWDA 2FIWA 4L8AA 2K5TA 3IGRA 1YGHA 2OZHA 1M4GA 4AG7A 4FD5A 4AVCA 4MBUA 2J8MA 4U5YA 4B5PA 1Z4RA 5H84A 1RO5A 4MJ8A 1BOBA 2WPXA 4JXQA 2Z11A 3KKWA 1YX0A 5ISVA 3PGPA 5KTDA 1WK4A 2ZXVA 4RI1A 4ZBGA 2OZUA 1YR0A 2PQ8A 2ZW7A 1FY7A 5GCNA 2JEVA 4XNHC 3TOBA 1Q2DA 2ZW6A 3GKRA 3K9UA 4CRYB 4KOSA 4KOXA 1I12A 4E8OA 4JD6A 1S60A 1I1DA 3CXSA 2KCWA 2Q44A 2B5GA 5F49A 3FB3A 1S5KA 3R1KA 4NSQA 4U9YA 5IX3A 4KZTA 1YK3A 3S6HA 5DWNA 3T9YA 2BEIA 4H89A 4M85A 3UY5A 4NF1A 1S7NA 4EVYA 5F46A 3F0AA 1XF8A 4QB9A 2RC4A 2B4DA 2ZW4A 3RYOA 3VWEA 3EXNA 1QSNA 4YRHA 4PSWA 3D8PA 3LODA 4UWJA 3R9EA 3B8GA 2ZPAA 3NE7A 2GIVA 1XEBA 5IV0A 1RXTA 2VEZA 4QVTA 4ORFA 4CAXA 3BLNA 1KUVA 2J8RA 4XPDC 4KOVA 2H5MA 1XIXA 3FBUA 2FIAA 3TT2A 1ON0A 3DNSA 1MJAA 2JDCA 1SQHA 1GHEA 4HKFA 3TE4A 2Z0ZA 4CS0B 4K30A 4E0AA 3TCVA 4FD7A 4ONUA 4HNYB 3G8WA 1PUAA 4NCZA 2CNTA 1Y7RA 2HQYA 4FD4A 3LD2A 5FVJA 5KTCA 1M4IA 3FXTA 5DWMA 3F5BA 3EY5A 4RS2A 2PR8A 5IB0A 5JPHA 2REEA 1NMTA 3GY9A 1P0HA 3S6GA 3DDDA 1NSLA 4KVME 4XPKA 2VZYA 4KUBA 5C88A 4YGOA 1S7FA 2BSWA 2VI7A 1V0CA 2HUZA 4R57A 4Y49C 3WR7A 4PK3A 3I9SA 4LUAA 1YVOA 4OLLA 5F47A 3ZZIA 2FXFA 4H6UA 1CM0A 2OZGA 2P6GA 1Y9WA 4AB7A 4MHDA 2Q4VA 2QMLA 3TTHA 1QSOA 1B87A 2BUEA 2VZZA 5J8CA 2R8VA 3CXPA 2R1IA 1YVKA 3OWCA 4JLYA 1MK4A 3T90A 3EC4A 2CNMA 4JWPA 1KUYA 2D4PA 2OB0A 3MGDA 1YLEA 2OU2A 1R57A 2QECA 3D3SA 2PDOA 2Q7BA 1P4NA 5HH1A 2P6FA 4IF5A 4F6AA 2P6EA 4KOYA 2X7BA 1CJWA 3P2HA 4HNXB 3QB8A 2VXKA 1KZFA 4CRZB 5CNPA 4B5PB 2O28A 1S3ZA 3F8KA 3PP9A 1YREA 2DXQA 3DSBA
chains in the Genus database with same CATH superfamily
3SHPA 1PCAA 3SJGA 4M6GA 5H86A 2Y0MA 3A9LA 4A2ZA 2AFXA 2ZW5A 1ZO0A 1QSTA 4A30A 4MHPA 4ZGYB 3C26A 3W6XA 3SXNA 2Q0YA 1VHSA 1ARMA 1IOFA 2PJ3A 4AXVA 2DEAA 1ELLP 1QQ9A 4AG9A 3IWGA 1IICA 4C2XA 3W91A 4B6ZA 4R87A 1CP6A 3PB4X 2B58A 2PIYA 1FT7A 2PJ6A 2Q51A 4OIDA 3BJ7A 4CGOA 3FX6A 4II9A 1CP7A 1ELMP 4KORA 2F5IA 2PRBA 2EWBA 2FSRA 2GE3A 5J1QA 2IJZA 1LRZA 2ZEMA 4U9ZA 5EC4A 4UWIA 3KASA 3VATA 4A32A 1Y9KA 4CAFA 2A4NA 4EFDA 3SXOA 5EMIA 3S9NA 2VBQA 3I3GA 4OC5A 3NH4A 1IU8A 2PJ8A 3HUVA 4R3KA 5LRJA 4KUAA 3RNZA 3SI1A 2EUIA 5JGFA 1CPXA 2ZEOA 3R9FA 3S6FA 4FWUA 1LAMA 2B5GB 3IU2A 1DE4C 3W6SA 1VHOA 3D7HA 2FE7A 2FS5A 4M6HA 4UCPA 4HPSA 3BJ8A 2JBJA 2AFOA 4UFWA 2ZEEA 4NGMA 3TO6A 3FEDA 2DF5A 4IAVA 1Q7LA 4NGPA 3LWUA 3TOAA 4P4DA 4KVOE 4NEXA 4RUHA 1FNOA 3BHXA 5AG7A 2REFA 4AVBA 4C2YA 2AFZA 5C82A 1YW4A 2P0WA 4W9YA 2V8GA 4GS4A 1TKJA 4P4FA 1N71A 4PV6A 3B3TA 5I0CA 1B6BA 3TO7A 2IL4A 4M3SA 1BPMA 2VQYA 1Z9UA 3PFOA 3FYNA 2AFWA 3CXQA 1BO4A 3IEHA 4CGPA 4IHMA 1HDQA 3R9GA 3P2FA 4UFXA 4CYNA 1UFHA 3D7GA 2B4DB 2OR4A 5A27A 4DNCA 2CY2A 4ONWA 2PJBA 2ARHA 1KUXA 4CAWA 4PSXA 4FUUA 1M44A 2XEJA 3FF3A 4NJQA 4CGMA 4KLVA 2V77A 1Y0YA 2FVGA 3DR8A 2PR1A 4XPDB 4QC6A 4PXCA 1IIDA 4Q7AA 8CPAA 4ZI6A 4R6TA 1XMTA 5K8PA 1VGYA 4A94A 3B35A 2B4BA 4OIWA 1YQEA 4OAEA 4MY3A 3FIXA 2DPSA 2C27A 1Y7EA 2Q4YA 4ZY2A 4BBHA 4E2AA 3NFZA 2OH1A 4CAVA 2J9AA 1S7LA 1TIQA 4KVXA 1NSAA 1EE3P 1M1DA 1X10A 2PSWA 4MI4A 4H2KA 6CPAA 2GLFA 3EFAA 3SJFA 3H8GA 4UF4A 4PK2A 5J8FA 3VARA 2RFHA 4ZY0A 4HNWB 5AG4A 2HV2A 3D2PA 2FL4A 4IK2A 1MJBA 2AE6A 3ISXA 5LRKA 5F48A 3SI2A 4MHZA 3WC6A 4GM5A 5ELYA 4H6ZA 4I49A 2F7VA 5JH9A 4ZYQA 2ZOGA 2PJ9A 1WWZA 3EO4A 3V38A 2HC9A 1ZG7A 3H4QA 4KOTA 2AFUA 3JVNA 1XMBA 4R9MA 4CGNA 5DS0A 1L0CA 3T8WA 3CZXA 3FECA 3WABA 4KLWA 1S7KA 2EVNA 3IWEA 4G1PA 2WPWA 1I21A 1J4JA 2O53A 2PJ7A 2R98A 1ZLIA 2JLMA 2C6PA 3N7ZA 3R96A 4JXRA 4NGRA 2I00A 2C6GA 3K9TA 1Y0RA 1Q2YA 4Y49B 1QSMA 4OKOA 3V8IA 1PU9A 2FT0A 4MFPA 2J8NA 3IFEA 4KOWA 2ATRA 4FD6A 2G3AA 2GU2A 3CPXA 5HMNA 2GFQA 3D66A 2GANA 3HLPA 3WT4A 4EWTA 3IIBA 1A2ZA 3D7DA 1Q2CA 4NXYA 4X5KA 3FRMA 2BL1A 4IUSA 4QBJA 4Q38A 3TO9A 1LFWA 4P4IA 2CIJA 1AYEA 4EMEA 4R7MA 4MMOA 3H5ZA 4CYPA 4XNHB 3FVLA 1VKCA 2QIRA 3GB0A 4P4BA 3ZJ0A 5D29A 1OBRA 2AJ6A 4QUSA 4JZ0A 3VH9A 5HVGA 3CDXA 4OC4A 4R3LA 3TFYA 2Z3NA 4L89A 3R95A 2PJ5A 4JJXA 2Z3PA 4DJLA 4F9VA 1K4JA 4DYOA 4UBRA 1RTQA 4BD9A 2C6CA 2D4OA 5LYDA 5KTAA 2Z3MA 3DR6A 5CBMA 1X12A 4CGLA 3PFEA 4P4JA 2QYVA 3QAHA 5LYIA 2I79A 4BMHA 4ZX8A 3E0KA 2PJAA 4J3GA 5F09A 3SI0A 4Z65A 2OOTA 4UA3A 2JDDA 2B3VA 1F2PA 5E96A 1Z8TA 1CX8A 1CG2A 4P45A 3S6KA 2G0BA 1Z4EA 2YNCA 4R8FA 1IYKA 1MJ9A 1M4DA 4LX9A 4OC0A 3GLJA 3WC7A 2WSAA 3RBUA 2CNSA 4MCRA 4A95A 2B3UA 3GIUA 3JRUA 3NH8A 4UCMA 3H8EA 3IWWA 2ABZA 2XEIA 4O23A 1XE4A 4YFJA 3S9LA 5EBVA 4XPLA 3G3SA 4FBEA 4F0YA 1HEEA 3CPAA 2Q43A 2YNCC 3GYAA 2G3TA 2PJ1A 3FNCA 1YSJA 2PC1A 4AVAA 5I4MA 4OC2A 1U6MA 4MY0A 1NE9A 5IB9A 5JQ4A 4UEZA 4CYQA 1IYLA 5THWA 2PRQA 2Q04A 3PB7X 4KOUA 2PCUA 2Z10A 3WC5A 2NMTA 1OZPA 4C7IA 1CBXA 1IB1E 3LACA 1Z8LA 1KWMA 2XEGA 3D2MA 2FCKA 2IQ6A 3PEIA 3JUWA 5A28A 3RZAA 1TKHA 3KHZA 4OADA 4B5OA 2AFSA 1QSRA 3D4UA 2R7HA 3PZJA 2ZEGA 3VWDA 2FIWA 4L8AA 7CPAA 3KR5A 4CAEA 4NGTA 2K5TA 2ZEFA 3KZWA 3IGRA 1YGHA 1LCPA 3TC8A 3QAYA 2OZHA 1M4GA 4AG7A 1DTDA 4FD5A 4AVCA 1IY7A 1AUGA 4MBUA 2J8MA 4U5YA 3KL9A 4B5PA 1Z4RA 1HDUA 1CPSA 2YNDA 5H84A 3PB8X 1RO5A 3PBEA 4MJ8A 4UIBA 1BOBA 2WPXA 4JXQA 1QMUA 1XBUA 2Z11A 3KKWA 1YX0A 5ISVA 3QNVA 3PGPA 4B13A 5KTDA 2PJ2A 1WK4A 2ZXVA 4RI1A 1GYTA 2NSMA 4ZBGA 2OZUA 4MHNA 3KQZA 1YR0A 2PQ8A 2ZW7A 2AFMA 4A37A 4PXEA 5JM6A 1FY7A 5GCNA 4R76A 2JEVA 4XNHC 3TOBA 1Q2DA 2ZW6A 4MCQA 2Q7SA 3CT9A 5LRGA 2O4HA 3GKRA 3K9UA 4PXBA 1H8LA 4CRYB 2CXAA 2PE3A 1R3NA 1YLOA 2G9DA 4KOSA 5AG5A 4DUKA 2HB6A 2V8DA 1LANA 4KOXA 3KHXA 1I12A 4E8OA 1XJOA 3H8FA 4JD6A 2VL1A 3V7ZA 1LAPA 1ZG8A 1M4LA 4F0XA 1S60A 4UCNA 3S9MA 4ZX9A 1IGBA 1I1DA 4ZY1A 3CXSA 3NH5A 2KCWA 2Q44A 5LYLA 2GREA 2B5GA 4MFZA 4B10A 2V8VA 2QVPA 3B3SA 5F49A 3FB3A 2POKA 1VHEA 3FJUA 5AGEA 2NYQA 3JTKA 1S5KA 3R1KA 4NSQA 5BWAB 1XFOA 4OP4A 4U9YA 5IX3A 2BO9A 3IU1A 4KZTA 1YK3A 3KQXA 3B3VA 3S6HA 1YMEA 5DWNA 4C7HA 1JWQA 1Z2LA 3T9YA 2BEIA 4A38A 4H89A 4M85A 3UY5A 1ZG9A 4NF1A 1S7NA 3DLJA 4EVYA 1LOKA 5F46A 3MN8A 3F0AA 1XF8A 4MRIA 4QB9A 1PYTB 1AMPA 2RC4A 2WYRA 2B4DA 2ZW4A 3RYOA 3K2KA 3BXMA 2PJCA 3PRTA 3EXNA 3VWEA 1QSNA 1YW6A 4YRHA 4CPAA 1Z5RA 4PSWA 3B7IA 1BLLE 1ZLHA 2EK8A 3D8PA 3LODA 4UWJA 3R9EA 1TF9A 3ISZA 2ZENA 3B8GA 4Q36A 2ZPAA 3BI0A 3NE7A 1VIXA 5G21A 5HVHA 2GIVA 4F9UA 5HVFA 5HXDA 1XEBA 2WZNA 3TX8A 5IV0A 1RXTA 2VEZA 2DPTA 3D67A 2XEFA 3NE8A 4QVTA 4ORFA 5CPAA 4CAXA 2BOAA 3BLNA 2PVVA 1KUVA 2J8RA 2ZEPA 4XPDC 4NGSA 1UWYA 4KOVA 2H5MA 2F8HA 1XIXA 3FBUA 4LQ6A 2FIAA 1ARLA 4P4EA 3TT2A 2YNEA 1ON0A 1TKFA 4KSAA 3DNSA 1MJAA 2I3CA 2JDCA 2RB7A 1SQHA 2ZOFA 3SJXA 1GHEA 4TNUA 4HKFA 4UEFA 3TE4A 3NA6A 2Z0ZA 4CS0B 4K30A 4X2TA 4UFVA 3TCVA 4MFLA 4FD7A 4RN7A 3SJEA 4E0AA 4ONUA 2CTCA 4HNYB 3G8WA 4YU9A 1PUAA 4LQGA 4NCZA 2CNTA 1Y7RA 2C1CA 1BPNA 2HQYA 2Z3LA 4FD4A 4UEEA 4A39A 3LD2A 5FVJA 5G1ZA 2JBKA 5KTCA 1M4IA 4A31A 2YGWA 3FXTA 5K8OA 3RO0A 4OC3A 4UIAA 3LMSA 3F5BA 5DWMA 3EY5A 4RS2A 3B2YA 2PR8A 5IB0A 4JYWA 5JPHA 2REEA 1NMTA 3GY9A 1P0HA 4PPZA 2ZEDA 3S6GA 4PXDA 3DDDA 4MFJA 1NSLA 4KS9A 4KVME 4XPKA 2PJ4A 2VZYA 2WUUA 1IOIA 3PB6X 2ANPA 4KUBA 5C88A 4YGOA 3B3WA 1S7FA 2EBJA 2BSWA 2VI7A 2Z3OA 1V0CA 5K8NA 4NFRA 4B12A 2HUZA 4R57A 4MCSA 1BAVA 4Y49C 3D68A 3WR7A 4NGNA 3MRUA 4PK3A 4WWVA 3I1UA 3B3CA 1YVOA 2Q4ZA 3I9SA 4LUAA 4OLLA 4X3RA 5G22A 5LYFA 3L2NA 5F47A 3ZZIA 5AG6A 3IO1A 4MFQA 2FXFA 4P6YA 2PVWA 3FEEA 4H6UA 1CM0A 1TF8A 2OZGA 2P6GA 4OMEA 1Y9WA 3KI9A 4AB7A 4MHDA 2Q4VA 1XRYA 2QMLA 4FAIA 2GLJA 3TTHA 1QSOA 4MFKA 1B87A 3BI1A 2BUEA 2VZZA 4NGQA 5J8CA 2IMOA 3PB9X 2R8VA 3CXPA 3FH4A 3GUXA 2R1IA 4C68A 2ODFA 1YVKA 2JEWA 3OWCA 4JLYA 1MK4A 4NJRA 3T90A 2BCOA 2PIZA 3EC4A 4TWEA 3PBBA 4X8IA 4YWYA 2CNMA 3KGQA 3DGVA 4JWPA 3N5FA 1KUYA 1R43A 4OC1A 2D4PA 2OB0A 3MGDA 4MCPA 1YLEA 1XOVA 1TXRA 2EO8A 1F2OA 2OU2A 1R57A 2QECA 4WJBA 1Z8WA 4C2ZA 4F8ZA 3IJ3A 3D3SA 2CF4A 4BINA 2PDOA 2Q7BA 2Z3KA 4KSFA 4GXHA 5G20A 1P4NA 5HH1A 2P6FA 4P10A 4MXUA 3RAMA 4IF5A 4B11A 4F6AA 4CYOA 2P6EA 2ZELA 4MHYA 4KOYA 2QJ8A 2PJ0A 4B14A 2X7BA 5K8MA 4M6IA 3FMCA 3IC1A 1CJWA 3P2HA 4HNXB 4P44A 4A33A 3QB8A 1F57A 2VXKA 1KZFA 4CRZB 5CNPA 4B5PB 3KR4A 5D8NA 1Z8XA 2O28A 4PQAA 4KSIA 1S3ZA 3D7FA 3F8KA 1JQGA 3PP9A 1YREA 2EK9A 2V8HA 2DXQA 2CTBA 2ZEHA 3DSBA 4K3NA
chains in the Genus database with same CATH topology
3SHPA 5H86A 2Y0MA 3A9LA 4A2ZA 2ZW5A 1ZO0A 1QSTA 4A30A 4ZGYB 3C26A 3W6XA 3SXNA 2Q0YA 1VHSA 4AG9A 3IWGA 1IICA 4C2XA 3W91A 4R87A 2B58A 4II9A 4CGOA 3BJ7A 4KORA 2F5IA 2PRBA 2FSRA 2GE3A 1LRZA 4U9ZA 5EC4A 4A32A 4UWIA 4CAFA 1Y9KA 2A4NA 3SXOA 2VBQA 3I3GA 4R3KA 4KUAA 2EUIA 3R9FA 3S6FA 3IU2A 2B5GB 3W6SA 2FE7A 2FS5A 4UCPA 3BJ8A 4UFWA 3TO6A 3TOAA 4KVOE 4NEXA 5AG7A 2REFA 4AVBA 4C2YA 5C82A 2P0WA 4GS4A 4PV6A 5I0CA 1N71A 1B6BA 3TO7A 2IL4A 4M3SA 2VQYA 1Z9UA 3FYNA 3CXQA 1BO4A 4CGPA 3R9GA 3P2FA 4UFXA 4CYNA 1UFHA 2B4DB 5A27A 4DNCA 2CY2A 2ARHA 1KUXA 4CAWA 4PSXA 1M44A 4CGMA 4KLVA 3DR8A 2PR1A 4XPDB 4QC6A 1IIDA 1XMTA 2B4BA 4OAEA 4MY3A 3FIXA 2DPSA 2C27A 2Q4YA 4E2AA 4BBHA 2OH1A 4CAVA 1S7LA 1TIQA 4KVXA 1M1DA 2PSWA 4MI4A 3EFAA 4PK2A 5J8FA 4HNWB 5AG4A 2HV2A 3D2PA 2FL4A 1MJBA 2AE6A 5F48A 4H6ZA 4I49A 1WWZA 3EO4A 3H4QA 4KOTA 3JVNA 4R9MA 4CGNA 1L0CA 4KLWA 1S7KA 2EVNA 3IWEA 2WPWA 1I21A 1J4JA 2R98A 2JLMA 3N7ZA 3R96A 4JXRA 2I00A 1Q2YA 4Y49B 1QSMA 3V8IA 1PU9A 2FT0A 4MFPA 2J8NA 4KOWA 2ATRA 4FD6A 2G3AA 5HMNA 2GANA 1Q2CA 4NXYA 4X5KA 3FRMA 2BL1A 4IUSA 4QBJA 4Q38A 3TO9A 3H5ZA 4CYPA 4XNHB 1VKCA 2QIRA 3ZJ0A 2AJ6A 4QUSA 4R3LA 3TFYA 2Z3NA 4L89A 3R95A 4JJXA 2Z3PA 1K4JA 4UBRA 2D4OA 5KTAA 2Z3MA 3DR6A 4CGLA 3QAHA 4BMHA 2I79A 3E0KA 4J3GA 4UA3A 2JDDA 2B3VA 5E96A 3S6KA 2G0BA 1Z4EA 2YNCA 1IYKA 1MJ9A 1M4DA 4LX9A 2WSAA 2CNSA 4A95A 2B3UA 4UCMA 1XE4A 4YFJA 5EBVA 4XPLA 3G3SA 4F0YA 3GYAA 2YNCC 2G3TA 3FNCA 4AVAA 2PC1A 1U6MA 4MY0A 1NE9A 5JQ4A 4CYQA 1IYLA 2Q04A 4KOUA 2Z10A 2NMTA 1OZPA 4C7IA 1IB1E 3D2MA 2FCKA 3JUWA 5A28A 4OADA 4B5OA 1QSRA 3PZJA 2R7HA 3VWDA 2FIWA 4L8AA 4CAEA 2K5TA 3IGRA 1YGHA 2OZHA 1M4GA 4AG7A 4FD5A 4AVCA 4MBUA 2J8MA 4U5YA 4B5PA 1Z4RA 2YNDA 5H84A 1RO5A 4MJ8A 1BOBA 2WPXA 4JXQA 2Z11A 3KKWA 1YX0A 5ISVA 3PGPA 4B13A 5KTDA 1WK4A 2ZXVA 4RI1A 4ZBGA 2OZUA 1YR0A 2PQ8A 2ZW7A 1FY7A 5GCNA 2JEVA 4XNHC 3TOBA 1Q2DA 2ZW6A 3GKRA 3K9UA 4CRYB 2CXAA 4KOSA 5AG5A 4KOXA 1I12A 4E8OA 4JD6A 4F0XA 1S60A 4UCNA 1I1DA 3CXSA 2KCWA 2Q44A 2B5GA 4MFZA 4B10A 5F49A 3FB3A 5AGEA 3JTKA 1S5KA 3R1KA 4NSQA 5BWAB 4U9YA 5IX3A 3IU1A 4KZTA 1YK3A 3S6HA 5DWNA 4C7HA 3T9YA 2BEIA 4H89A 4M85A 3UY5A 4NF1A 1S7NA 4EVYA 5F46A 3F0AA 1XF8A 4QB9A 2RC4A 2B4DA 2ZW4A 3RYOA 3VWEA 3EXNA 1QSNA 4YRHA 4PSWA 3D8PA 3LODA 4UWJA 3R9EA 4Q36A 3B8GA 2ZPAA 3NE7A 5G21A 2GIVA 1XEBA 5IV0A 1RXTA 2VEZA 2DPTA 4QVTA 4ORFA 4CAXA 3BLNA 1KUVA 2J8RA 4XPDC 4KOVA 2H5MA 1XIXA 3FBUA 2FIAA 3TT2A 2YNEA 1ON0A 4KSAA 3DNSA 1MJAA 2JDCA 1SQHA 1GHEA 4HKFA 3TE4A 2Z0ZA 4CS0B 4K30A 4UFVA 3TCVA 4MFLA 4FD7A 4E0AA 4ONUA 4HNYB 3G8WA 1PUAA 4NCZA 2CNTA 1Y7RA 2HQYA 2Z3LA 4FD4A 3LD2A 5FVJA 5G1ZA 5KTCA 1M4IA 4A31A 2YGWA 3FXTA 5DWMA 3F5BA 3EY5A 4RS2A 2PR8A 5IB0A 5JPHA 2REEA 1NMTA 3GY9A 1P0HA 3S6GA 3DDDA 4MFJA 1NSLA 4KS9A 4KVME 4XPKA 2VZYA 2WUUA 4KUBA 5C88A 4YGOA 1S7FA 2BSWA 2VI7A 2Z3OA 1V0CA 4B12A 2HUZA 4R57A 4Y49C 3WR7A 4PK3A 3I9SA 4LUAA 1YVOA 5G22A 4OLLA 5F47A 3ZZIA 5AG6A 4MFQA 2FXFA 4H6UA 1CM0A 2OZGA 2P6GA 1Y9WA 4AB7A 4MHDA 2Q4VA 2QMLA 3TTHA 1QSOA 4MFKA 1B87A 2BUEA 2VZZA 5J8CA 2R8VA 3CXPA 2R1IA 4C68A 1YVKA 3OWCA 4JLYA 1MK4A 3T90A 3EC4A 2CNMA 4JWPA 1KUYA 2D4PA 2OB0A 3MGDA 1YLEA 2OU2A 4C2ZA 1R57A 2QECA 3D3SA 2PDOA 2Q7BA 2Z3KA 4KSFA 5G20A 1P4NA 5HH1A 2P6FA 4IF5A 4B11A 4F6AA 4CYOA 2P6EA 4KOYA 4B14A 2X7BA 1CJWA 3P2HA 4HNXB 4A33A 3QB8A 2VXKA 1KZFA 4CRZB 5CNPA 4B5PB 2O28A 1S3ZA 3F8KA 3PP9A 1YREA 2DXQA 3DSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHP A;  5H86 A;  2Y0M A;  2ZW5 A;  1QST A;  3C26 A;  3W6X A;  3SXN A;  2Q0Y A;  1VHS A;  4AG9 A;  3IWG A;  1IIC A;  3W91 A;  4R87 A;  2B58 A;  4II9 A;  3BJ7 A;  4KOR A;  2F5I A;  2PRB A;  2FSR A;  2GE3 A;  1LRZ A;  4U9Z A;  5EC4 A;  4UWI A;  1Y9K A;  2A4N A;  3SXO A;  2VBQ A;  3I3G A;  4R3K A;  4KUA A;  2EUI A;  3R9F A;  3S6F A;  2B5G B;  3W6S A;  2FE7 A;  2FS5 A;  3BJ8 A;  3TO6 A;  3TOA A;  4KVO E;  4NEX A;  2REF A;  4AVB A;  5C82 A;  2P0W A;  4GS4 A;  4PV6 A;  5I0C A;  1N71 A;  1B6B A;  3TO7 A;  2IL4 A;  4M3S A;  2VQY A;  1Z9U A;  3FYN A;  3CXQ A;  1BO4 A;  3R9G A;  3P2F A;  1UFH A;  2B4D B;  4DNC A;  2CY2 A;  2ARH A;  1KUX A;  4CAW A;  4PSX A;  1M44 A;  4KLV A;  3DR8 A;  2PR1 A;  4XPD B;  4QC6 A;  1IID A;  1XMT A;  2B4B A;  4OAE A;  4MY3 A;  3FIX A;  2C27 A;  2Q4Y A;  4E2A A;  2OH1 A;  4CAV A;  1S7L A;  1TIQ A;  4KVX A;  1M1D A;  2PSW A;  4MI4 A;  3EFA A;  4PK2 A;  5J8F A;  4HNW B;  2HV2 A;  3D2P A;  2FL4 A;  1MJB A;  2AE6 A;  5F48 A;  4H6Z A;  4I49 A;  1WWZ A;  3EO4 A;  3H4Q A;  4KOT A;  3JVN A;  4R9M A;  1L0C A;  4KLW A;  1S7K A;  2EVN A;  2WPW A;  1I21 A;  1J4J A;  2R98 A;  2JLM A;  3N7Z A;  3R96 A;  4JXR A;  2I00 A;  1Q2Y A;  4Y49 B;  1QSM A;  3V8I A;  1PU9 A;  2FT0 A;  2J8N A;  4KOW A;  2ATR A;  4FD6 A;  2G3A A;  5HMN A;  2GAN A;  1Q2C A;  4NXY A;  4X5K A;  3FRM A;  2BL1 A;  4IUS A;  4QBJ A;  3TO9 A;  4XNH B;  1VKC A;  2QIR A;  3ZJ0 A;  2AJ6 A;  4QUS A;  4R3L A;  3TFY A;  4L89 A;  3R95 A;  4JJX A;  1K4J A;  4UBR A;  2D4O A;  5KTA A;  3DR6 A;  3QAH A;  4BMH A;  2I79 A;  3E0K A;  4J3G A;  4UA3 A;  2JDD A;  2B3V A;  5E96 A;  3S6K A;  2G0B A;  1Z4E A;  1IYK A;  1MJ9 A;  1M4D A;  4LX9 A;  2CNS A;  2B3U A;  1XE4 A;  4YFJ A;  5EBV A;  4XPL A;  3G3S A;  4F0Y A;  3GYA A;  2G3T A;  3FNC A;  4AVA A;  2PC1 A;  1U6M A;  4MY0 A;  1NE9 A;  5JQ4 A;  1IYL A;  2Q04 A;  4KOU A;  2Z10 A;  2NMT A;  1OZP A;  1IB1 E;  3D2M A;  2FCK A;  3JUW A;  4OAD A;  4B5O A;  1QSR A;  3PZJ A;  2R7H A;  3VWD A;  2FIW A;  4L8A A;  2K5T A;  3IGR A;  1YGH A;  2OZH A;  1M4G A;  4AG7 A;  4FD5 A;  4AVC A;  4MBU A;  2J8M A;  4U5Y A;  4B5P A;  1Z4R A;  5H84 A;  1RO5 A;  4MJ8 A;  1BOB A;  2WPX A;  4JXQ A;  2Z11 A;  3KKW A;  1YX0 A;  5ISV A;  3PGP A;  5KTD A;  1WK4 A;  2ZXV A;  4RI1 A;  4ZBG A;  2OZU A;  1YR0 A;  2PQ8 A;  2ZW7 A;  1FY7 A;  5GCN A;  2JEV A;  4XNH C;  3TOB A;  1Q2D A;  2ZW6 A;  3GKR A;  3K9U A;  4CRY B;  4KOS A;  4KOX A;  1I12 A;  4E8O A;  4JD6 A;  1S60 A;  1I1D A;  3CXS A;  2KCW A;  2Q44 A;  2B5G A;  5F49 A;  3FB3 A;  1S5K A;  3R1K A;  4NSQ A;  4U9Y A;  5IX3 A;  4KZT A;  1YK3 A;  3S6H A;  5DWN A;  3T9Y A;  2BEI A;  4H89 A;  4M85 A;  3UY5 A;  4NF1 A;  1S7N A;  4EVY A;  5F46 A;  3F0A A;  1XF8 A;  4QB9 A;  2RC4 A;  2B4D A;  2ZW4 A;  3RYO A;  3VWE A;  3EXN A;  1QSN A;  4YRH A;  4PSW A;  3D8P A;  3LOD A;  4UWJ A;  3R9E A;  3B8G A;  2ZPA A;  3NE7 A;  2GIV A;  1XEB A;  5IV0 A;  1RXT A;  2VEZ A;  4QVT A;  4ORF A;  4CAX A;  3BLN A;  1KUV A;  2J8R A;  4XPD C;  4KOV A;  2H5M A;  1XIX A;  3FBU A;  2FIA A;  3TT2 A;  1ON0 A;  3DNS A;  1MJA A;  2JDC A;  1SQH A;  1GHE A;  4HKF A;  3TE4 A;  2Z0Z A;  4CS0 B;  4K30 A;  4E0A A;  3TCV A;  4FD7 A;  4ONU A;  4HNY B;  3G8W A;  1PUA A;  4NCZ A;  2CNT A;  1Y7R A;  2HQY A;  4FD4 A;  3LD2 A;  5FVJ A;  5KTC A;  1M4I A;  3FXT A;  5DWM A;  3F5B A;  3EY5 A;  4RS2 A;  2PR8 A;  5IB0 A;  5JPH A;  2REE A;  1NMT A;  3GY9 A;  1P0H A;  3S6G A;  3DDD A;  1NSL A;  4KVM E;  4XPK A;  2VZY A;  4KUB A;  5C88 A;  4YGO A;  1S7F A;  2BSW A;  2VI7 A;  1V0C A;  2HUZ A;  4R57 A;  4Y49 C;  3WR7 A;  4PK3 A;  3I9S A;  4LUA A;  1YVO A;  4OLL A;  5F47 A;  3ZZI A;  2FXF A;  4H6U A;  1CM0 A;  2OZG A;  2P6G A;  1Y9W A;  4AB7 A;  4MHD A;  2Q4V A;  2QML A;  3TTH A;  1QSO A;  1B87 A;  2BUE A;  2VZZ A;  5J8C A;  2R8V A;  3CXP A;  2R1I A;  1YVK A;  3OWC A;  4JLY A;  1MK4 A;  3T90 A;  3EC4 A;  2CNM A;  4JWP A;  1KUY A;  2D4P A;  2OB0 A;  3MGD A;  1YLE A;  2OU2 A;  1R57 A;  2QEC A;  3D3S A;  2PDO A;  2Q7B A;  1P4N A;  5HH1 A;  2P6F A;  4IF5 A;  4F6A A;  2P6E A;  4KOY A;  2X7B A;  1CJW A;  3P2H A;  4HNX B;  3QB8 A;  2VXK A;  1KZF A;  4CRZ B;  5CNP A;  4B5P B;  2O28 A;  1S3Z A;  3F8K A;  3PP9 A;  1YRE A;  2DXQ A;  3DSB A; 
#chains in the Genus database with same CATH topology
 3SHP A;  1PCA A;  3SJG A;  4M6G A;  5H86 A;  2Y0M A;  3A9L A;  4A2Z A;  2AFX A;  2ZW5 A;  1ZO0 A;  1QST A;  4A30 A;  4MHP A;  4ZGY B;  3C26 A;  3W6X A;  3SXN A;  2Q0Y A;  1VHS A;  1ARM A;  1IOF A;  2PJ3 A;  4AXV A;  2DEA A;  1ELL P;  1QQ9 A;  4AG9 A;  3IWG A;  1IIC A;  4C2X A;  3W91 A;  4B6Z A;  4R87 A;  1CP6 A;  3PB4 X;  2B58 A;  2PIY A;  1FT7 A;  2PJ6 A;  2Q51 A;  4OID A;  3BJ7 A;  4CGO A;  3FX6 A;  4II9 A;  1CP7 A;  1ELM P;  4KOR A;  2F5I A;  2PRB A;  2EWB A;  2FSR A;  2GE3 A;  5J1Q A;  2IJZ A;  1LRZ A;  2ZEM A;  4U9Z A;  5EC4 A;  4UWI A;  3KAS A;  3VAT A;  4A32 A;  1Y9K A;  4CAF A;  2A4N A;  4EFD A;  3SXO A;  5EMI A;  3S9N A;  2VBQ A;  3I3G A;  4OC5 A;  3NH4 A;  1IU8 A;  2PJ8 A;  3HUV A;  4R3K A;  5LRJ A;  4KUA A;  3RNZ A;  3SI1 A;  2EUI A;  5JGF A;  1CPX A;  2ZEO A;  3R9F A;  3S6F A;  4FWU A;  1LAM A;  2B5G B;  3IU2 A;  1DE4 C;  3W6S A;  1VHO A;  3D7H A;  2FE7 A;  2FS5 A;  4M6H A;  4UCP A;  4HPS A;  3BJ8 A;  2JBJ A;  2AFO A;  4UFW A;  2ZEE A;  4NGM A;  3TO6 A;  3FED A;  2DF5 A;  4IAV A;  1Q7L A;  4NGP A;  3LWU A;  3TOA A;  4P4D A;  4KVO E;  4NEX A;  4RUH A;  1FNO A;  3BHX A;  5AG7 A;  2REF A;  4AVB A;  4C2Y A;  2AFZ A;  5C82 A;  1YW4 A;  2P0W A;  4W9Y A;  2V8G A;  4GS4 A;  1TKJ A;  4P4F A;  1N71 A;  4PV6 A;  3B3T A;  5I0C A;  1B6B A;  3TO7 A;  2IL4 A;  4M3S A;  1BPM A;  2VQY A;  1Z9U A;  3PFO A;  3FYN A;  2AFW A;  3CXQ A;  1BO4 A;  3IEH A;  4CGP A;  4IHM A;  1HDQ A;  3R9G A;  3P2F A;  4UFX A;  4CYN A;  1UFH A;  3D7G A;  2B4D B;  2OR4 A;  5A27 A;  4DNC A;  2CY2 A;  4ONW A;  2PJB A;  2ARH A;  1KUX A;  4CAW A;  4PSX A;  4FUU A;  1M44 A;  2XEJ A;  3FF3 A;  4NJQ A;  4CGM A;  4KLV A;  2V77 A;  1Y0Y A;  2FVG A;  3DR8 A;  2PR1 A;  4XPD B;  4QC6 A;  4PXC A;  1IID A;  4Q7A A;  8CPA A;  4ZI6 A;  4R6T A;  1XMT A;  5K8P A;  1VGY A;  4A94 A;  3B35 A;  2B4B A;  4OIW A;  1YQE A;  4OAE A;  4MY3 A;  3FIX A;  2DPS A;  2C27 A;  1Y7E A;  2Q4Y A;  4ZY2 A;  4BBH A;  4E2A A;  3NFZ A;  2OH1 A;  4CAV A;  2J9A A;  1S7L A;  1TIQ A;  4KVX A;  1NSA A;  1EE3 P;  1M1D A;  1X10 A;  2PSW A;  4MI4 A;  4H2K A;  6CPA A;  2GLF A;  3EFA A;  3SJF A;  3H8G A;  4UF4 A;  4PK2 A;  5J8F A;  3VAR A;  2RFH A;  4ZY0 A;  4HNW B;  5AG4 A;  2HV2 A;  3D2P A;  2FL4 A;  4IK2 A;  1MJB A;  2AE6 A;  3ISX A;  5LRK A;  5F48 A;  3SI2 A;  4MHZ A;  3WC6 A;  4GM5 A;  5ELY A;  4H6Z A;  4I49 A;  2F7V A;  5JH9 A;  4ZYQ A;  2ZOG A;  2PJ9 A;  1WWZ A;  3EO4 A;  3V38 A;  2HC9 A;  1ZG7 A;  3H4Q A;  4KOT A;  2AFU A;  3JVN A;  1XMB A;  4R9M A;  4CGN A;  5DS0 A;  1L0C A;  3T8W A;  3CZX A;  3FEC A;  3WAB A;  4KLW A;  1S7K A;  2EVN A;  3IWE A;  4G1P A;  2WPW A;  1I21 A;  1J4J A;  2O53 A;  2PJ7 A;  2R98 A;  1ZLI A;  2JLM A;  2C6P A;  3N7Z A;  3R96 A;  4JXR A;  4NGR A;  2I00 A;  2C6G A;  3K9T A;  1Y0R A;  1Q2Y A;  4Y49 B;  1QSM A;  4OKO A;  3V8I A;  1PU9 A;  2FT0 A;  4MFP A;  2J8N A;  3IFE A;  4KOW A;  2ATR A;  4FD6 A;  2G3A A;  2GU2 A;  3CPX A;  5HMN A;  2GFQ A;  3D66 A;  2GAN A;  3HLP A;  3WT4 A;  4EWT A;  3IIB A;  1A2Z A;  3D7D A;  1Q2C A;  4NXY A;  4X5K A;  3FRM A;  2BL1 A;  4IUS A;  4QBJ A;  4Q38 A;  3TO9 A;  1LFW A;  4P4I A;  2CIJ A;  1AYE A;  4EME A;  4R7M A;  4MMO A;  3H5Z A;  4CYP A;  4XNH B;  3FVL A;  1VKC A;  2QIR A;  3GB0 A;  4P4B A;  3ZJ0 A;  5D29 A;  1OBR A;  2AJ6 A;  4QUS A;  4JZ0 A;  3VH9 A;  5HVG A;  3CDX A;  4OC4 A;  4R3L A;  3TFY A;  2Z3N A;  4L89 A;  3R95 A;  2PJ5 A;  4JJX A;  2Z3P A;  4DJL A;  4F9V A;  1K4J A;  4DYO A;  4UBR A;  1RTQ A;  4BD9 A;  2C6C A;  2D4O A;  5LYD A;  5KTA A;  2Z3M A;  3DR6 A;  5CBM A;  1X12 A;  4CGL A;  3PFE A;  4P4J A;  2QYV A;  3QAH A;  5LYI A;  2I79 A;  4BMH A;  4ZX8 A;  3E0K A;  2PJA A;  4J3G A;  5F09 A;  3SI0 A;  4Z65 A;  2OOT A;  4UA3 A;  2JDD A;  2B3V A;  1F2P A;  5E96 A;  1Z8T A;  1CX8 A;  1CG2 A;  4P45 A;  3S6K A;  2G0B A;  1Z4E A;  2YNC A;  4R8F A;  1IYK A;  1MJ9 A;  1M4D A;  4LX9 A;  4OC0 A;  3GLJ A;  3WC7 A;  2WSA A;  3RBU A;  2CNS A;  4MCR A;  4A95 A;  2B3U A;  3GIU A;  3JRU A;  3NH8 A;  4UCM A;  3H8E A;  3IWW A;  2ABZ A;  2XEI A;  4O23 A;  1XE4 A;  4YFJ A;  3S9L A;  5EBV A;  4XPL A;  3G3S A;  4FBE A;  4F0Y A;  1HEE A;  3CPA A;  2Q43 A;  2YNC C;  3GYA A;  2G3T A;  2PJ1 A;  3FNC A;  1YSJ A;  2PC1 A;  4AVA A;  5I4M A;  4OC2 A;  1U6M A;  4MY0 A;  1NE9 A;  5IB9 A;  5JQ4 A;  4UEZ A;  4CYQ A;  1IYL A;  5THW A;  2PRQ A;  2Q04 A;  3PB7 X;  4KOU A;  2PCU A;  2Z10 A;  3WC5 A;  2NMT A;  1OZP A;  4C7I A;  1CBX A;  1IB1 E;  3LAC A;  1Z8L A;  1KWM A;  2XEG A;  3D2M A;  2FCK A;  2IQ6 A;  3PEI A;  3JUW A;  5A28 A;  3RZA A;  1TKH A;  3KHZ A;  4OAD A;  4B5O A;  2AFS A;  1QSR A;  3D4U A;  2R7H A;  3PZJ A;  2ZEG A;  3VWD A;  2FIW A;  4L8A A;  7CPA A;  3KR5 A;  4CAE A;  4NGT A;  2K5T A;  2ZEF A;  3KZW A;  3IGR A;  1YGH A;  1LCP A;  3TC8 A;  3QAY A;  2OZH A;  1M4G A;  4AG7 A;  1DTD A;  4FD5 A;  4AVC A;  1IY7 A;  1AUG A;  4MBU A;  2J8M A;  4U5Y A;  3KL9 A;  4B5P A;  1Z4R A;  1HDU A;  1CPS A;  2YND A;  5H84 A;  3PB8 X;  1RO5 A;  3PBE A;  4MJ8 A;  4UIB A;  1BOB A;  2WPX A;  4JXQ A;  1QMU A;  1XBU A;  2Z11 A;  3KKW A;  1YX0 A;  5ISV A;  3QNV A;  3PGP A;  4B13 A;  5KTD A;  2PJ2 A;  1WK4 A;  2ZXV A;  4RI1 A;  1GYT A;  2NSM A;  4ZBG A;  2OZU A;  4MHN A;  3KQZ A;  1YR0 A;  2PQ8 A;  2ZW7 A;  2AFM A;  4A37 A;  4PXE A;  5JM6 A;  1FY7 A;  5GCN A;  4R76 A;  2JEV A;  4XNH C;  3TOB A;  1Q2D A;  2ZW6 A;  4MCQ A;  2Q7S A;  3CT9 A;  5LRG A;  2O4H A;  3GKR A;  3K9U A;  4PXB A;  1H8L A;  4CRY B;  2CXA A;  2PE3 A;  1R3N A;  1YLO A;  2G9D A;  4KOS A;  5AG5 A;  4DUK A;  2HB6 A;  2V8D A;  1LAN A;  4KOX A;  3KHX A;  1I12 A;  4E8O A;  1XJO A;  3H8F A;  4JD6 A;  2VL1 A;  3V7Z A;  1LAP A;  1ZG8 A;  1M4L A;  4F0X A;  1S60 A;  4UCN A;  3S9M A;  4ZX9 A;  1IGB A;  1I1D A;  4ZY1 A;  3CXS A;  3NH5 A;  2KCW A;  2Q44 A;  5LYL A;  2GRE A;  2B5G A;  4MFZ A;  4B10 A;  2V8V A;  2QVP A;  3B3S A;  5F49 A;  3FB3 A;  2POK A;  1VHE A;  3FJU A;  5AGE A;  2NYQ A;  3JTK A;  1S5K A;  3R1K A;  4NSQ A;  5BWA B;  1XFO A;  4OP4 A;  4U9Y A;  5IX3 A;  2BO9 A;  3IU1 A;  4KZT A;  1YK3 A;  3KQX A;  3B3V A;  3S6H A;  1YME A;  5DWN A;  4C7H A;  1JWQ A;  1Z2L A;  3T9Y A;  2BEI A;  4A38 A;  4H89 A;  4M85 A;  3UY5 A;  1ZG9 A;  4NF1 A;  1S7N A;  3DLJ A;  4EVY A;  1LOK A;  5F46 A;  3MN8 A;  3F0A A;  1XF8 A;  4MRI A;  4QB9 A;  1PYT B;  1AMP A;  2RC4 A;  2WYR A;  2B4D A;  2ZW4 A;  3RYO A;  3K2K A;  3BXM A;  2PJC A;  3PRT A;  3EXN A;  3VWE A;  1QSN A;  1YW6 A;  4YRH A;  4CPA A;  1Z5R A;  4PSW A;  3B7I A;  1BLL E;  1ZLH A;  2EK8 A;  3D8P A;  3LOD A;  4UWJ A;  3R9E A;  1TF9 A;  3ISZ A;  2ZEN A;  3B8G A;  4Q36 A;  2ZPA A;  3BI0 A;  3NE7 A;  1VIX A;  5G21 A;  5HVH A;  2GIV A;  4F9U A;  5HVF A;  5HXD A;  1XEB A;  2WZN A;  3TX8 A;  5IV0 A;  1RXT A;  2VEZ A;  2DPT A;  3D67 A;  2XEF A;  3NE8 A;  4QVT A;  4ORF A;  5CPA A;  4CAX A;  2BOA A;  3BLN A;  2PVV A;  1KUV A;  2J8R A;  2ZEP A;  4XPD C;  4NGS A;  1UWY A;  4KOV A;  2H5M A;  2F8H A;  1XIX A;  3FBU A;  4LQ6 A;  2FIA A;  1ARL A;  4P4E A;  3TT2 A;  2YNE A;  1ON0 A;  1TKF A;  4KSA A;  3DNS A;  1MJA A;  2I3C A;  2JDC A;  2RB7 A;  1SQH A;  2ZOF A;  3SJX A;  1GHE A;  4TNU A;  4HKF A;  4UEF A;  3TE4 A;  3NA6 A;  2Z0Z A;  4CS0 B;  4K30 A;  4X2T A;  4UFV A;  3TCV A;  4MFL A;  4FD7 A;  4RN7 A;  3SJE A;  4E0A A;  4ONU A;  2CTC A;  4HNY B;  3G8W A;  4YU9 A;  1PUA A;  4LQG A;  4NCZ A;  2CNT A;  1Y7R A;  2C1C A;  1BPN A;  2HQY A;  2Z3L A;  4FD4 A;  4UEE A;  4A39 A;  3LD2 A;  5FVJ A;  5G1Z A;  2JBK A;  5KTC A;  1M4I A;  4A31 A;  2YGW A;  3FXT A;  5K8O A;  3RO0 A;  4OC3 A;  4UIA A;  3LMS A;  3F5B A;  5DWM A;  3EY5 A;  4RS2 A;  3B2Y A;  2PR8 A;  5IB0 A;  4JYW A;  5JPH A;  2REE A;  1NMT A;  3GY9 A;  1P0H A;  4PPZ A;  2ZED A;  3S6G A;  4PXD A;  3DDD A;  4MFJ A;  1NSL A;  4KS9 A;  4KVM E;  4XPK A;  2PJ4 A;  2VZY A;  2WUU A;  1IOI A;  3PB6 X;  2ANP A;  4KUB A;  5C88 A;  4YGO A;  3B3W A;  1S7F A;  2EBJ A;  2BSW A;  2VI7 A;  2Z3O A;  1V0C A;  5K8N A;  4NFR A;  4B12 A;  2HUZ A;  4R57 A;  4MCS A;  1BAV A;  4Y49 C;  3D68 A;  3WR7 A;  4NGN A;  3MRU A;  4PK3 A;  4WWV A;  3I1U A;  3B3C A;  1YVO A;  2Q4Z A;  3I9S A;  4LUA A;  4OLL A;  4X3R A;  5G22 A;  5LYF A;  3L2N A;  5F47 A;  3ZZI A;  5AG6 A;  3IO1 A;  4MFQ A;  2FXF A;  4P6Y A;  2PVW A;  3FEE A;  4H6U A;  1CM0 A;  1TF8 A;  2OZG A;  2P6G A;  4OME A;  1Y9W A;  3KI9 A;  4AB7 A;  4MHD A;  2Q4V A;  1XRY A;  2QML A;  4FAI A;  2GLJ A;  3TTH A;  1QSO A;  4MFK A;  1B87 A;  3BI1 A;  2BUE A;  2VZZ A;  4NGQ A;  5J8C A;  2IMO A;  3PB9 X;  2R8V A;  3CXP A;  3FH4 A;  3GUX A;  2R1I A;  4C68 A;  2ODF A;  1YVK A;  2JEW A;  3OWC A;  4JLY A;  1MK4 A;  4NJR A;  3T90 A;  2BCO A;  2PIZ A;  3EC4 A;  4TWE A;  3PBB A;  4X8I A;  4YWY A;  2CNM A;  3KGQ A;  3DGV A;  4JWP A;  3N5F A;  1KUY A;  1R43 A;  4OC1 A;  2D4P A;  2OB0 A;  3MGD A;  4MCP A;  1YLE A;  1XOV A;  1TXR A;  2EO8 A;  1F2O A;  2OU2 A;  1R57 A;  2QEC A;  4WJB A;  1Z8W A;  4C2Z A;  4F8Z A;  3IJ3 A;  3D3S A;  2CF4 A;  4BIN A;  2PDO A;  2Q7B A;  2Z3K A;  4KSF A;  4GXH A;  5G20 A;  1P4N A;  5HH1 A;  2P6F A;  4P10 A;  4MXU A;  3RAM A;  4IF5 A;  4B11 A;  4F6A A;  4CYO A;  2P6E A;  2ZEL A;  4MHY A;  4KOY A;  2QJ8 A;  2PJ0 A;  4B14 A;  2X7B A;  5K8M A;  4M6I A;  3FMC A;  3IC1 A;  1CJW A;  3P2H A;  4HNX B;  4P44 A;  4A33 A;  3QB8 A;  1F57 A;  2VXK A;  1KZF A;  4CRZ B;  5CNP A;  4B5P B;  3KR4 A;  5D8N A;  1Z8X A;  2O28 A;  4PQA A;  4KSI A;  1S3Z A;  3D7F A;  3F8K A;  1JQG A;  3PP9 A;  1YRE A;  2EK9 A;  2V8H A;  2DXQ A;  2CTB A;  2ZEH A;  3DSB A;  4K3N A; 
#chains in the Genus database with same CATH homology
 3SHP A;  5H86 A;  2Y0M A;  3A9L A;  4A2Z A;  2ZW5 A;  1ZO0 A;  1QST A;  4A30 A;  4ZGY B;  3C26 A;  3W6X A;  3SXN A;  2Q0Y A;  1VHS A;  4AG9 A;  3IWG A;  1IIC A;  4C2X A;  3W91 A;  4R87 A;  2B58 A;  4II9 A;  4CGO A;  3BJ7 A;  4KOR A;  2F5I A;  2PRB A;  2FSR A;  2GE3 A;  1LRZ A;  4U9Z A;  5EC4 A;  4A32 A;  4UWI A;  4CAF A;  1Y9K A;  2A4N A;  3SXO A;  2VBQ A;  3I3G A;  4R3K A;  4KUA A;  2EUI A;  3R9F A;  3S6F A;  3IU2 A;  2B5G B;  3W6S A;  2FE7 A;  2FS5 A;  4UCP A;  3BJ8 A;  4UFW A;  3TO6 A;  3TOA A;  4KVO E;  4NEX A;  5AG7 A;  2REF A;  4AVB A;  4C2Y A;  5C82 A;  2P0W A;  4GS4 A;  4PV6 A;  5I0C A;  1N71 A;  1B6B A;  3TO7 A;  2IL4 A;  4M3S A;  2VQY A;  1Z9U A;  3FYN A;  3CXQ A;  1BO4 A;  4CGP A;  3R9G A;  3P2F A;  4UFX A;  4CYN A;  1UFH A;  2B4D B;  5A27 A;  4DNC A;  2CY2 A;  2ARH A;  1KUX A;  4CAW A;  4PSX A;  1M44 A;  4CGM A;  4KLV A;  3DR8 A;  2PR1 A;  4XPD B;  4QC6 A;  1IID A;  1XMT A;  2B4B A;  4OAE A;  4MY3 A;  3FIX A;  2DPS A;  2C27 A;  2Q4Y A;  4E2A A;  4BBH A;  2OH1 A;  4CAV A;  1S7L A;  1TIQ A;  4KVX A;  1M1D A;  2PSW A;  4MI4 A;  3EFA A;  4PK2 A;  5J8F A;  4HNW B;  5AG4 A;  2HV2 A;  3D2P A;  2FL4 A;  1MJB A;  2AE6 A;  5F48 A;  4H6Z A;  4I49 A;  1WWZ A;  3EO4 A;  3H4Q A;  4KOT A;  3JVN A;  4R9M A;  4CGN A;  1L0C A;  4KLW A;  1S7K A;  2EVN A;  3IWE A;  2WPW A;  1I21 A;  1J4J A;  2R98 A;  2JLM A;  3N7Z A;  3R96 A;  4JXR A;  2I00 A;  1Q2Y A;  4Y49 B;  1QSM A;  3V8I A;  1PU9 A;  2FT0 A;  4MFP A;  2J8N A;  4KOW A;  2ATR A;  4FD6 A;  2G3A A;  5HMN A;  2GAN A;  1Q2C A;  4NXY A;  4X5K A;  3FRM A;  2BL1 A;  4IUS A;  4QBJ A;  4Q38 A;  3TO9 A;  3H5Z A;  4CYP A;  4XNH B;  1VKC A;  2QIR A;  3ZJ0 A;  2AJ6 A;  4QUS A;  4R3L A;  3TFY A;  2Z3N A;  4L89 A;  3R95 A;  4JJX A;  2Z3P A;  1K4J A;  4UBR A;  2D4O A;  5KTA A;  2Z3M A;  3DR6 A;  4CGL A;  3QAH A;  4BMH A;  2I79 A;  3E0K A;  4J3G A;  4UA3 A;  2JDD A;  2B3V A;  5E96 A;  3S6K A;  2G0B A;  1Z4E A;  2YNC A;  1IYK A;  1MJ9 A;  1M4D A;  4LX9 A;  2WSA A;  2CNS A;  4A95 A;  2B3U A;  4UCM A;  1XE4 A;  4YFJ A;  5EBV A;  4XPL A;  3G3S A;  4F0Y A;  3GYA A;  2YNC C;  2G3T A;  3FNC A;  4AVA A;  2PC1 A;  1U6M A;  4MY0 A;  1NE9 A;  5JQ4 A;  4CYQ A;  1IYL A;  2Q04 A;  4KOU A;  2Z10 A;  2NMT A;  1OZP A;  4C7I A;  1IB1 E;  3D2M A;  2FCK A;  3JUW A;  5A28 A;  4OAD A;  4B5O A;  1QSR A;  3PZJ A;  2R7H A;  3VWD A;  2FIW A;  4L8A A;  4CAE A;  2K5T A;  3IGR A;  1YGH A;  2OZH A;  1M4G A;  4AG7 A;  4FD5 A;  4AVC A;  4MBU A;  2J8M A;  4U5Y A;  4B5P A;  1Z4R A;  2YND A;  5H84 A;  1RO5 A;  4MJ8 A;  1BOB A;  2WPX A;  4JXQ A;  2Z11 A;  3KKW A;  1YX0 A;  5ISV A;  3PGP A;  4B13 A;  5KTD A;  1WK4 A;  2ZXV A;  4RI1 A;  4ZBG A;  2OZU A;  1YR0 A;  2PQ8 A;  2ZW7 A;  1FY7 A;  5GCN A;  2JEV A;  4XNH C;  3TOB A;  1Q2D A;  2ZW6 A;  3GKR A;  3K9U A;  4CRY B;  2CXA A;  4KOS A;  5AG5 A;  4KOX A;  1I12 A;  4E8O A;  4JD6 A;  4F0X A;  1S60 A;  4UCN A;  1I1D A;  3CXS A;  2KCW A;  2Q44 A;  2B5G A;  4MFZ A;  4B10 A;  5F49 A;  3FB3 A;  5AGE A;  3JTK A;  1S5K A;  3R1K A;  4NSQ A;  5BWA B;  4U9Y A;  5IX3 A;  3IU1 A;  4KZT A;  1YK3 A;  3S6H A;  5DWN A;  4C7H A;  3T9Y A;  2BEI A;  4H89 A;  4M85 A;  3UY5 A;  4NF1 A;  1S7N A;  4EVY A;  5F46 A;  3F0A A;  1XF8 A;  4QB9 A;  2RC4 A;  2B4D A;  2ZW4 A;  3RYO A;  3VWE A;  3EXN A;  1QSN A;  4YRH A;  4PSW A;  3D8P A;  3LOD A;  4UWJ A;  3R9E A;  4Q36 A;  3B8G A;  2ZPA A;  3NE7 A;  5G21 A;  2GIV A;  1XEB A;  5IV0 A;  1RXT A;  2VEZ A;  2DPT A;  4QVT A;  4ORF A;  4CAX A;  3BLN A;  1KUV A;  2J8R A;  4XPD C;  4KOV A;  2H5M A;  1XIX A;  3FBU A;  2FIA A;  3TT2 A;  2YNE A;  1ON0 A;  4KSA A;  3DNS A;  1MJA A;  2JDC A;  1SQH A;  1GHE A;  4HKF A;  3TE4 A;  2Z0Z A;  4CS0 B;  4K30 A;  4UFV A;  3TCV A;  4MFL A;  4FD7 A;  4E0A A;  4ONU A;  4HNY B;  3G8W A;  1PUA A;  4NCZ A;  2CNT A;  1Y7R A;  2HQY A;  2Z3L A;  4FD4 A;  3LD2 A;  5FVJ A;  5G1Z A;  5KTC A;  1M4I A;  4A31 A;  2YGW A;  3FXT A;  5DWM A;  3F5B A;  3EY5 A;  4RS2 A;  2PR8 A;  5IB0 A;  5JPH A;  2REE A;  1NMT A;  3GY9 A;  1P0H A;  3S6G A;  3DDD A;  4MFJ A;  1NSL A;  4KS9 A;  4KVM E;  4XPK A;  2VZY A;  2WUU A;  4KUB A;  5C88 A;  4YGO A;  1S7F A;  2BSW A;  2VI7 A;  2Z3O A;  1V0C A;  4B12 A;  2HUZ A;  4R57 A;  4Y49 C;  3WR7 A;  4PK3 A;  3I9S A;  4LUA A;  1YVO A;  5G22 A;  4OLL A;  5F47 A;  3ZZI A;  5AG6 A;  4MFQ A;  2FXF A;  4H6U A;  1CM0 A;  2OZG A;  2P6G A;  1Y9W A;  4AB7 A;  4MHD A;  2Q4V A;  2QML A;  3TTH A;  1QSO A;  4MFK A;  1B87 A;  2BUE A;  2VZZ A;  5J8C A;  2R8V A;  3CXP A;  2R1I A;  4C68 A;  1YVK A;  3OWC A;  4JLY A;  1MK4 A;  3T90 A;  3EC4 A;  2CNM A;  4JWP A;  1KUY A;  2D4P A;  2OB0 A;  3MGD A;  1YLE A;  2OU2 A;  4C2Z A;  1R57 A;  2QEC A;  3D3S A;  2PDO A;  2Q7B A;  2Z3K A;  4KSF A;  5G20 A;  1P4N A;  5HH1 A;  2P6F A;  4IF5 A;  4B11 A;  4F6A A;  4CYO A;  2P6E A;  4KOY A;  4B14 A;  2X7B A;  1CJW A;  3P2H A;  4HNX B;  4A33 A;  3QB8 A;  2VXK A;  1KZF A;  4CRZ B;  5CNP A;  4B5P B;  2O28 A;  1S3Z A;  3F8K A;  3PP9 A;  1YRE A;  2DXQ A;  3DSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...