1QMUA

Duck carboxypeptidase d domain ii
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Avian Carboxypeptidase D Domain II : A Prototype for the Regulatory Metallocarboxypeptidase Subfamily
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
total genus 138
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1qmuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qmuA01
3D7HA 2PJ5A 4MHPA 2V8DA 1CG2A 3S9MA 1ZLIA 2ZELA 4F8ZA 2ZEPA 1Y0RA 3L2NA 2XEJA 3S9NA 2OR4A 4EWTA 3PRTA 4P44A 1FT7A 1OBRA 1Z8LA 3WT4A 3JRUA 2XEGA 1EE3P 3QNVA 3PB4X 2ZEGA 4GM5A 1PCAA 4IK2A 1LAPA 2NSMA 1DE4C 1TXRA 2BOAA 4DYOA 5HVGA 2ANPA 5LYLA 2JBKA 4PQAA 3GLJA 4X3RA 1YW4A 3IFEA 1VHOA 2IMOA 3B2YA 3IIBA 4A38A 5F09A 2VL1A 4MHYA 4MRIA 4R7MA 3BI0A 1TKJA 3H8FA 5K8OA 4NGTA 3FEDA 4WI0B 2CF4A 4NJRA 3KL9A 2EWBA 2C1CA 3ISZA 5K8NA 1F2OA 2PJ7A 3WC7A 4MCSA 1UWYA 4FUUA 3WABA 4OC3A 1QMUA 3KZWA 4CPAA 4P4FA 3KCPA 3KGQA 1CP6A 4ZY2A 4ZX9A 4F9VA 1CP7A 2PIZA 3FX6A 3FF3A 1YSJA 4NGPA 3PEIA 4PXEA 2XHNA 1CX8A 4EIUA 5I4MA 2B59B 3ISXA 2J9AA 4MCRA 2POKA 3FH4A 4NJQA 4KSIA 4PXCA 3RZAA 1ZLHA 4OC2A 4P10A 3VARA 3D7DA 3D68A 2ZEOA 1Q7LA 3CPXA 1LANA 4LQGA 2IQ6A 1XFOA 3SI0A 2PVWA 4MHNA 1QQ9A 1H8LA 2QYVA 4NFRA 4X2TA 3KQXA 4UEFA 4OIWA 1Y0YA 2JBJA 5JH9A 5K8PA 2PJ3A 5LRGA 3RAMA 3HN5A 2PJAA 1HDUA 4IYKA 3BHXA 2GLJA 3PBEA 3V7ZA 1NSAA 2PJ8A 3FECA 4TWEA 4NGNA 2PJ2A 2QJ8A 1ELMP 3CDXA 2GREA 4IAVA 2GU2A 3BI1A 3SJEA 2FVGA 5IB9A 2ZOGA 3GB0A 5CPAA 4A37A 4Z65A 3MRUA 4DJLA 3PB7X 4NGRA 4FBEA 4UF4A 1IGBA 4OMEA 1ELLP 1TKHA 2PJCA 4TNUA 4DUKA 3KQZA 4OC0A 3DLJA 2PVVA 2V8GA 5JGFA 2PJ6A 5G5DB 1R3NA 3PB6X 3B3SA 4IHMA 4UEZA 4OC4A 2XEIA 4ONWA 5HVHA 5K39B 2Q43A 4UIAA 4FXTA 1TF8A 3SJGA 2RFHA 4WJBA 4FAIA 5LYFA 2O53A 4P4BA 4P4JA 5JM6A 3S9LA 1R43A 1YMEA 3FMCA 3IC1A 5K8MA 4G1PA 4NGSA 2ABZA 4ZI6A 3SJXA 4O23A 3B3VA 2IJZA 1HDQA 2HC9A 1ARMA 4YU9A 1BLLE 1ZG8A 4MCPA 1CBXA 4PXBA 4P45A 2PE3A 4MCQA 3NA6A 2G9DA 2HB6A 4H2KA 8CPAA 4JZ0A 5D29A 3B3TA 4FL4C 2PJ9A 2XEFA 2EK9A 2PJ1A 1XJOA 1DTDA 4AXVA 3KASA 2ZEDA 2ZENA 7CPAA 1GYTA 4YOKA 2ZOFA 2AFXA 3KHZA 3PB8X 3GUXA 4K3NA 3KI9A 2C6GA 3LWUA 3VH9A 5CBMA 2PCUA 3HLPA 5DS0A 2RB7A 3DGVA 2GLFA 4Q7AA 4YWYA 1F57A 3NH8A 1KWMA 2C6PA 3PFEA 3RBUA 3D7FA 2BCOA 2CTBA 3CT9A 2DEAA 4OC1A 2PRQA 4NGMA 3SI1A 3WC6A 3SI2A 5LRKA 1ARLA 1Z5RA 2QVPA 2NYQA 4U3SB 3KR5A 4F9UA 4JYWA 1TKFA 1TF9A 2V77A 2C6CA 1JQGA 3SJFA 4RUHA 5J1QA 4P6YA 3IEHA 3K9TA 2WZNA 4WWVA 5THWA 1BPNA 4FWUA 3B3CA 1ZG9A 2V8VA 4R76A 1VHEA 3H8GA 4OP4A 3G3LA 2F7VA 3D67A 1AMPA 1LAMA 1LCPA 1M4LA 2PJ0A 4P4EA 3FEEA 5LYDA 2EK8A 4OIDA 4R6TA 5HVFA 1Y7EA 3PBBA 2CIJA 1BPMA 3NJVA 4BD9A 3D66A 2OOTA 3LMSA 3K2KA 4EFDA 4PPZA 4UEEA 4PXDA 1YLOA 2CTCA 1FNOA 2WYRA 1ZG7A 2Q51A 1AYEA 3D4UA 4ZYQA 1RTQA 3V38A 3TX8A 3B7IA 2PIYA 2V8HA 1VIXA 4P4DA 4UIBA 1F2PA 4MMOA 3VATA 4OKOA 4R8FA 3N5FA 2AFMA 5AQ0A 2I3CA 2F8HA 4NGQA 3HUVA 4A39A 2ZEHA 3BXMA 4A94A 1CPXA 1Z2LA 3B3WA 1XBUA 1BAVA 1NKGA 3T8WA 3WC5A 5HXDA 3B35A 3TC8A 4B6ZA 2JEWA 3KHXA 1PYTB 1IY7A 4W9YA 4OC5A 2BO9A 3CPAA 1LFWA 3NFZA 1XRYA 3NJXA 4ZX8A 3MN8A 3H8EA 2AFSA 3FJUA 4P4IA 1XMBA 2ZEMA 4EMEA 3PFOA 3KR4A 2AFWA 3NH4A 5LYIA 2AFZA 3E8VA 1CPSA 1YW6A 2Q4ZA 4MHZA 3D7GA 5ELYA 2PJ4A 1VGYA 2AFUA 3I1UA 3NH5A 2ZEEA 3FVLA 6CPAA 1HEEA 4ZY1A 2AFOA 4ZY0A 2O4HA 3PB9X 4MXUA 1LOKA 3IO1A 5D8NA 3IJ3A 2ZEFA 2PJBA 4X8IA 3IWWA 5LRJA
chains in the Genus database with same CATH superfamily
3PY9A 3C5XA 3SDXA 5BVPL 4N2DA 3FT2A 4H7VA 4G42A 1RZGA 5AVZB 3X11B 3VW3L 2KUTA 1N26A 4YBLB 4AKOA 3QAZB 2YSSB 3SDXE 3WG7B 2V8DA 1P7HL 3WS6A 2MCPL 1F1GA 3WS6C 1AYRA 3EDEA 1J1OH 1KCRL 1BOGA 2WTRB 1WT5A 1TJHL 1UT1A 4BQBA 4XPLA 4X9YA 5F72S 4BUGA 1GAFH 2TRYA 2CR3A 5C6TH 4X4XB 3ARVA 1OAXH 4OLWL 3CIAA 5F9AC 1EFXA 1XMWA 2XACC 4DAGL 4OV5B 2D0GA 2WUCL 4UWIA 4HU8A 2WCGA 2E7CA 3AMLA 1NE9A 2V3EA 2NY7L 1N0LB 4YSSA 4K5PA 5T1DL 3CZUB 3H55A 1EE3P 2Z4QA 3PL6B 1P2CB 4RCAA 4WK4B 1HHJA 4CUCA 3QCUH 2NSMA 4GQZA 4BKLA 3F7VA 3EF4A 1K8DB 5E23A 2C1PA 1CJWA 1P4IL 4P4RA 5IB5A 1T7ZA 2R0KL 4R7NA 1NIDA 4ZMTA 3EGXA 1QWNA 4GKNB 1OK8A 1PBYA 4O51B 1IL1A 1NGPL 1HXYB 4MJIE 3SDDC 1KXTB 4NIYE 2FZ3B 2R23A 2WN2A 3LRGA 5FOJA 4G8AC 2VDNB 3FSWA 3GTTA 1JZHA 4MJIA 4RMWA 4CMMA 4DP9X 1F4YL 1JPEA 5J06A 4NZJA 3FPYA 1EFXB 2AK4B 3BJLA 3F5WB 3ISZA 4APQB 4HSAC 4EZMA 5IHUH 3GZOA 2JJUA 3AAZA 5HJBA 1IAOB 4NN7C 4ZG1A 2GTWB 1BZ9A 3T0EB 1J1PL 1CFTB 1FL3A 3PL6A 4YL4A 3WAKA 5DHXB 5AAMA 5LB1A 2P1YA 1UGNA 3B9KC 1EO7A 4R8WL 5T3XH 1N3NB 2R29H 1LILA 4P2RE 2ZPKH 1KDIA 3HB3B 3V5HB 2QL1A 43CAB 5I1CL 2A9DA 3EGDA 1VENA 1MCPH 3EJYD 1LO4H 3WUWG 4KNTA 4AIXA 1IFGA 4P2RA 2W9EH 3KNBA 4WHCA 4AGQA 3CXSA 3C8KB 4LQFH 4G9FA 4R5XA 2BRRL 5BJTB 2AJXL 1WK4A 4HWBH 1KGUA 3WE1A 4L8BA 2EEXA 2ZXCA 2B3VA 1A22B 1TZ8A 2YNDA 3QORB 3B7YA 4G71B 3RZAA 3WDIA 3SZ6A 2CLVB 1PX8A 3C5SA 2IAMA 3ARED 1Q7LA 1PU0A 4I3GA 3TV3L 1LANA 1K72A 2WQ8A 1K4DB 5J6GA 2ZAGA 2P6FA 2H1LM 5DZNA 1L3WA 2VLJE 3HI5H 4TF4A 3UGEA 4ZS7H 5F8RC 1KLFA 1SQHA 1ITCA 4DKEL 3ULVD 2GTWA 3T0EA 4NZRL 4PJDA 4JQXA 3VXNB 3FULA 3D0VA 4PLJD 2JBJA 2RH0A 5LVEA 4F80A 4PG2C 3GIVA 1ZD6A 2AEOA 2K7PA 2XN2A 3CH1A 4JDVB 3I9GH 5EO9A 5TF1L 2YGQA 4QF1A 1IIIA 4P46D 5TDOB 5TK2A 3ZDXE 1KT2A 2KLTA 1VGKB 2IOIA 5BV7L 4MXVE 4GQ9L 3HFFA 4BYHA 5E2TL 2KYIA 4HUKB 1EBAA 1ZSDB 4IJTA 4XPBL 5B1BB 5C0BE 1YNLL 4TVUA 5INDA 1VADA 3MR9B 2QVMA 3B1UA 5BJTA 1MCOL 5LHDA 5C6WH 1BJ1J 2Y24A 4ODXA 4NP4L 5CEZL 1H5BA 4LCYA 3TT2A 4GH7B 3D2TA 1FLRH 1KJMA 1R5IA 1KYOK 3BAKA 4ACPA 1Q94A 1U3HA 2GJZA 2OFQA 2GK0B 3P02A 4APXB 4P2RD 1U3HB 1GZQB 2WXQA 1WWWX 1IGBA 3VQ1C 4PY7B 3HR5B 4GUPB 1ELLP 3C26A 5LBSA 1TKHA 5J89A 3L9YA 3VWKB 1EHLH 3HR5A 4GUPA 5IBUB 4PRAB 3IJHA 1ZVHA 4EN2A 4QY8A 1K5NA 2C4FU 4IHMA 2DD8H 4ZDHA 4I0CC 3ALWA 2VXVH 3FU7B 3KGRA 4D8PA 1A66A 5I8KH 3DUUA 2WTPA 2Y23A 5DI8B 3PF2A 3VQLA 4AX3A 4EIBA 4N0CD 5J5EA 1EFQA 5FOBB 3MBXL 4K0OA 2DQGL 1OP5H 2VDRH 4Z6AT 5JW4M 5FYLH 1MIEL 1SJMA 4DP1X 1U8KB 5JPHA 2VC2L 5HDQH 2Z35A 4G8EB 3C8HA 4GKSA 2Z91B 3DYPA 4GKSB 1XGPB 5TDNB 1FGNH 3QNXB 1IEAA 1MI5A 2R0LL 4G9FD 2HN7A 3KGSA 4Q4IA 5IB2A 4OKVB 5HSFA 5DRWA 5CFAA 2N59A 3VI4A 2F8XC 3L4VA 2WINB 4FG2A 4HCRL 5JW3H 2GK0A 2WANA 3J07A 1TYRA 3CDGA 2F1AA 4GRLB 4JFTA 4AMXA 5B38B 1DUYB 2R1XA 4YPGA 4G7QB 5E94A 4POZD 4B53A 4JRXB 2XPYA 1D2PA 1DQLL 3OKKA 1UVQB 2CUMA 3FU3A 1FJ1B 2EC9T 5AVTB 2VMDA 1P5UB 2FHBA 4L23A 3E2HC 3JTTA 2DWDB 4JKPH 5H37H 3MV01 5FS5A 4EAEA 4LCCA 3GBDA 3JTTB 1MW2A 4EI6B 1F3JB 3OPZL 4F27A 1T83A 3T4AA 1L3NA 3GMQA 5BVJA 4U6HB 3KYNB 4QI3A 5GGSA 3JXAA 3IGFA 4NKDB 3H4HA 1KYOJ 5LCVA 1DQQB 2Z3NA 25C8L 1TFHA 3OHMB 5EFIA 3T77A 4HWUA 3DNKA 3R8BB 2YKKA 4GI9A 4RMSA 1MH5A 3UZQB 1ND0B 4JO8A 2IADA 1QBLH 1UYWL 3CLFL 5MI0C 2ZENA 3LZPA 1IEAB 1MI5B 3IPEA 3UTTB 2YFNA 2WBWB 2YSSA 2EH8L 3RZCD 3O0LA 3UTTA 3V95A 4GT7A 5IT2H 5ES4B 4EUPG 4ISVA 3ECBB 4Y19B 3R7RA 1BEYL 3V8CA 1XD0A 2PTTA 3ZE2E 3KR3H 5JHDD 1V8HA 3QDJB 2D73A 4WHTA 1J0YA 3WEXA 3BD5A 3R0MA 2C8NA 3K80A 3PFEA 3T3PF 4MZ3A 4X7EC 2DEAA 1GGBL 1NUFA 4TUJB 3P30H 2WNKA 1LO2L 2AMUA 1F3JA 1MWOA 2OR8A 1WEJH 3IFNL 1G9NL 4OZHA 5LRKA 2NY3C 1KPUB 1U8JB 2EYSB 2JCCA 4BFEA 3US0A 1A7NH 4O58L 4H6ZA 3NZHH 1M2OA 3OKEA 3TN0C 5T3ZD 1KPUA 1U8JA 3FUDA 5D7SH 5LJYH 2GJ6E 2ERJC 4RLDA 1TJIH 2GSIB 2VZOA 3GXIA 3BFQG 4D8OA 3RVUD 3BKMH 2J1XA 3WE6B 4XVSL 2WXNA 1MN4A 2YGPA 1ND0A 3QZMA 4MYPA 5J3HC 4EUPH 2HX8A 1A4KA 5ALCH 2WVUA 2VDRB 1TKWB 2XT1B 4JG0L 4OCNC 3WXVH 4L2LA 3BVVA 3R19A 1FE8H 2FECI 4OUOA 2IXQA 4PJ7B 1IGTB 3KPOA 4NUJA 4N8CH 4HKZA 5DMIL 1ZXQA 5L88H 1DLFL 2JNZA 4YBQD 3GDCA 4F93B 4UTAH 1W6LA 3QUZA 4OCYL 2BHZA 4YO0B 4G3YL 4TQ8A 4F3FB 4P9HL 3QG6A 4CAXA 1RQ5A 1KBWA 4Y0GA 1JWSA 4X2UA 5DVOA 5KYYA 2I07A 1GS8A 4WNJA 4UV4L 5E9DD 5DJ2A 3OF6A 3T90A 3DMMA 3V0VA 3V0WH 4Z76A 2PJ0A 4P4EA 3S37L 4M6OL 3L16A 5EU3A 4DN4H 3DI2B 5A2CA 2BC4B 5AD0B 1L0PA 1KXQA 2C9AA 1CLZL 3ZHDA 3T6XA 1AD9B 4U1HA 2UV3A 3L3KB 5CGYD 5I75B 1BPMA 4HF5L 4YHML 2PR1A 4KK6D 5HHVL 1E4HA 1MREL 3DX8B 2OOTA 3V5HA 4CDGC 4CN4A 5ISZE 3BPLB 3OXSA 1T03H 4MS8C 4KRPC 1MNUH 4MZIA 1OQXA 2GY5A 1DSWA 2QHRH 5E5MB 4UEEA 4AEHH 3GXUB 3ZXAC 4HQQH 2R2HB 2YO3A 1FDLL 3CV5A 2CTCA 3B2VH 1ZVNA 3AU0A 1A9EB 3GZPA 2OZHA 3C12A 4NC1C 3VTTA 1G7IB 3C5JA 1OSZA 1HI6A 1WWBX 2X38A 3QUMA 3LSOB 4JY6A 4KDVA 4XCCL 3T2OA 4ZYQA 3NFSL 2PKDA 4IOSA 1KY6A 1VACA 3K0WA 1HH9B 3ZL4H 2R8SH 3DR8A 4FJYA 3GM0A 4GQPH 1L5GB 4Q4EA 2CU9A 1OB1A 3UZVB 3TOBA 1SMDA 3M17A 3LHAA 4JHAL 1QSFD 1Z5YD 2PW1A 4BEIA 4MFKA 5KSAA 4PGEB 1Z8WA 4W1TA 3F62A 3E38A 5FYJH 3VU1A 2NUTB 1DZ0A 3ABMB 2I3CA 5CEZD 4NGQA 3BDBA 3VXNA 3WI9A 2KPNA 2WAQA 3QISA 3BKCL 3R06B 2EDLA 5EU5B 4A39A 2X0WA 4B3EA 4ZFOA 3LH9A 5JHLH 3KDMA 4IU2A 2IDCA 3ZE1B 4NHUA 1UC6A 2G75A 1BMGA 4UANA 1KCSL 3VTAA 3UO8B 2ZP9A 2YEZA 1ZGLA 4LSTH 4G5ZL 4KY1L 2N0KA 2BXZA 3B3WA 1XBUA 1PKQE 1VLXA 1XQ4A 4Y9GA 3GC3A 4MCZB 3MO1A 4RFOH 2HUZA 3FTGB 2YBGA 1JHLL 1X4YA 3GSQA 3UTOA 3ECWA 4EZJA 5CKGA 5C0BB 3WKYA 2E27H 1U4EA 3LRHA 2WSDA 2REFA 3HC0A 2ALWA 3OHXA 4FFWD 2J8UE 1J9TA 2ITDA 3P40A 5AG9A 4OZIB 1F3RB 3EBIA 4M9PA 2QV4A 3S3JA 3CPAA 1D3CA 3QUKB 1HNYA 1NGZA 3MJ8A 5KSAB 5FHBH 2BDNH 5IM7A 4LP4A 2V2TB 4R3LA 4L2YA 4N2EA 2LR4A 4FQQB 5H35B 2UY7A 1OWRM 2AAVA 4W9GC 2XKUA 4P4IA 4AG7A 2GITB 4N85A 3QUHA 3MV11 3KLHC 4JFVA 3P2HA 2EIDA 2JB5H 4I3SL 2RD0A 3ZGHA 5ILTH 4C54A 4MHZA 3BKYH 1BBJA 3WNKA 3LODA 4XOAA 5F97E 2AJUH 3BAXA 5F7DA 1BO4A 4WRLA 4G70B 3U7AA 5FOBA 1A1MB 1I9RL 3V52H 4U4IA 3HG1E 2VLKB 3U0TA 1C08A 2Z91A 3BN9D 5CUSL 3JWOH 4Z95L 4Z7AA 3U0TB 1TVHB 4ORFA 5D5MB 3UEZA 4JM2B 4HJEA 3PAUA 4G7YL 4HPYH 3IJ3A 2XA3A 2YIHA 4RH4A 2UVFA 4M7LH 5DUJA 3BQUD 5C0DB 1ET7A 3EG9B 4UCPA 5MEOB 1SLVA 1Z3GL 5I30H 5E24E 4Y2DA 2GJZB 4N90D 4IRJB 3PP9A 3HUJF 3MKKA 4FZEH 4GKLA 3DHJA 2HMIC 1CURA 4LF3A 3L4TA 2OSXA 1O5DT 4ZO6A 4YFDB 4WWKA 5EBMB 3OJ2C 1ON0A 3D09A 4UI2A 3KM2A 2IOOA 2VDNL 1DBJH 3SGKA 4HJGA 5G2NA 2Q86B 2A6JA 4R96B 2Y72A 2YRBA 1G7LB 4XI5D 3V9FA 4AGMA 1JGIA 1SHXA 1V3LA 2DLFH 3RWDA 3PRTA 3EYUH 4EJ1C 5B8CC 3UG4A 4TUOB 2K70A 2H2PD 1QSEE 4CKVX 3HC4L 3AROA 1REIA 3CC1A 2FRGP 3ZTJH 2RB8A 2QADC 1JTTA 3X14A 1QSVA 2HTKC 3TL5A 3BVTA 2E9GA 3KWUA 4ODUA 4N2OA 1TTAA 3BGAA 3AREA 1UZ8A 4ZW5A 1I31A 4ELMB 3G5WA 3NIGB 2P80D 5IMOA 3EH1A 3ARSA 4BKTC 3EO9H 4POUB 3FQ1A 1EJ8A 3B2YA 3CVCA 3A22A 2E6JA 4A38A 4Z5RB 5A2BA 2VL1A 3W11C 2BNRE 3I2CL 1RK0A 3ULUF 4WWKB 3N0PB 4LEXL 2YNCA 3BI0A 4KJQC 4X8CA 2NZ9C 2EEAA 3AREC 1JF1B 5CP3H 4CJ0A 5D7LD 4CAEA 2PW2B 3N1FC 2OM5A 4Q14A 1QA9B 3FEDA 3NCXA 2BWIA 1LQBC 4HG4K 4KV5E 3NAAH 3ZTDC 2MEJB 2EDWA 3N3EA 3SKMB 2DYPD 3GDBA 1Z9OA 2W0PA 1PDKA 1T4WA 3K6FA 1FLTX 1OD9A 1JNLL 3I75B 2N01B 4NO3A 5DRXB 3RYOA 4EKXA 2EEFA 5GQBA 1CD9B 2B1HH 3JTSB 3PDOA 1KYAA 4KUBA 3UZQA 1NCAL 2YKLL 4S1DC 2IFGA 2JDDA 3IBEA 2OSLA 4PIRF 5HVWA 2FEJA 1AMXA 3DVIA 3RGHA 1FL6B 4HH8A 5F9WB 1QFUL 4YWGL 1RXLA 1A6AA 4TPRH 1NTDA 3QUMH 3B9KD 3TA3A 5L2KA 4N3UA 1Y18B 2H3NB 5KTEH 1AE6L 5FEBA 4K94C 4L5FE 2GT9A 4RZCB 4LCUA 1QNIA 3LN4B 4RNRB 4S1RL 2XVKA 4NGPA 4LCIL 2B3IA 3MLSL 4C2YA 1GGCH 1O6VA 1U42A 4YO0A 3PNWB 3W9DB 4Z23A 1P5UA 1M4DA 1TDQA 2FBRA 1R1CA 4PN6A 2XV3A 2RA1A 4B41A 2IDTA 4C4UA 2WSAA 2WO3B 5D7JB 1QA9A 2BSSA 1UACL 4EVYA 2BHUA 3E7JA 3VARA 5HI3C 2WYHA 3A6BL 4L48A 4LO9A 5FYLD 3U25A 4ELME 2Y6SD 3US9A 1A25A 4AOFA 2ZEOA 3UGXA 4MZ2A 4OJEH 1TLKA 3R9EA 4NZUH 3OKEB 3C9NA 3QIUD 2EE9A 1UOWA 3A4AA 1E5YA 1A1OA 3MLUL 3CNKA 3PHOA 4OFVA 5IW3A 1UXWA 4RGNE 2DWSA 3S34H 1M2VB 1NCJA 4ZPVB 2AMGA 1B0IA 1YG9A 2FL5B 3BAEL 3M6DA 2CD0A 3NIDB 2KDGA 1B0RA 1E6JH 1N2RB 4MJ6A 3A6CH 4OI7A 1I9IH 3WNJA 2MNWA 3RUGA 1HU8A 1CGYA 2F9BT 4BUQA 3A67H 3KPRB 1BOGB 3H2WA 3LSOA 5CIPH 5I19H 3TJHD 4JDTL 1F1DA 2X7LB 5FVJA 1HE7A 4M5SA 1SJHA 3E6FA 4NKQB 2CJUH 1N5AA 2ED9A 3HLKA 4H5SA 3ARDB 2WKLA 4ZUWB 1NBQA 4Q8BA 3NSFA 3JTBA 4N0UA 3TT1H 1GIGH 2UZYB 3VI3E 3F3HA 5T8IA 5GS0C 4ZBJA 1W80A 3RL1B 1A0QL 2B14A 4DIXA 2E9WA 3CCHA 4MNHB 3H9ZA 3REVA 1N6QL 1XSOA 5I1LA 3IFLH 1G9MH 4XPAL 3NUKA 3VXSB 1E5CA 4PRIA 4LPWA 1ODUA 5D2NE 1KGXA 3ZUCA 5F0JB 4CW1A 5I82A 5K9KA 1S9KC 4P2OC 2A9ML 3MUY1 2X4RA 4JFQA 4Y5VC 3LYRA 3LKSA 4Y5YC 4PJDF 4P59H 4MA8H 3UTTD 5CM1A 3TNMB 2ZOKA 1A6TB 1ZHKA 4UEZA 3C6SB 3Q5TA 4CSSA 3KJ4C 1KXTA 3KM1A 4BBHA 2VITA 4LLMB 3MGOB 1QI4A 1OHQA 3FQ4A 1CK0H 3QZWA 5EORH 4BBWA 5T5NG 4PW3A 1AQMA 1KIPA 5HYJD 5EZIH 5KJRL 5LYFA 4Z7QB 3MRCA 3V6ZA 3ZE0E 4R57A 5JM6A 3Q2LA 3LXCA 3FL7A 1BWWA 2BERA 3BRGC 3F5WA 5AW9B 3LQZA 4NZTL 3CFNA 1G7JA 4X4ZA 1PX3A 3C09C 1KV3A 3MV8D 4XAKE 2RAMA 1GOGA 4KUZH 3UYOD 1SXCA 3O0RH 3Q13A 3TU6A 3U2SB 5I1GH 1NOLA 2YAHA 4X6CA 2PCXA 1BLNB 1HL4A 2VXUL 3HZVA 1NFDA 1IBGH 2YAEA 1SQMA 4YNYA 2K4AA 4N2NA 1PSKH 4ABWA 2WBJA 2DPSA 3OX8A 1AC6A 1ZLSL 4EMZA 3TIEA 3ABLB 4S10A 4MD0A 5GRWA 4A2MA 2DH2A 4UZGA 2PWEA 2HYMA 4AYGA 2H6PA 2Y5TB 3CFBB 5DFTA 2RTTA 1CT8A 2HVJA 2MFNA 1QYGH 2KDYA 3CZGA 5BQDA 3VE0B 2QPSA 1OANA 3ETTA 1OLLA 3SPHA 4E9WA 2ZCHH 3UZEC 1EBPA 4KKZA 1AP2B 4N2BA 3WHXA 1FFTB 5EUKA 3DMMD 3GMNA 3H0TA 2AFXA 5GCNA 3PWUB 3RGVC 3L1OH 2H32H 3I9IA 1CCZA 1CLYH 1RJLB 4K5NA 3D07A 1IVTA 1I85A 2E6PA 4PGCB 1TMCB 4YBHA 4PY8I 2XKNB 4H1LH 4WSKA 2WXJA 1NANI 3AC0A 4Y8DC 3HRZA 1BVOA 3GSUB 3FH5A 1JDDA 3ZQXA 1FZJB 1FQ9C 4NB7A 1C5DA 2I9LB 2FE7A 4HXBL 1S78C 2QZ5A 3FHEA 3LEVH 1TQWA 3F04A 4DP7X 1A1MA 3QCUL 4YHZH 3QXDA 5C0GA 1HSAB 1T1YB 2KL6A 3H9HA 3ILQC 3QIBB 4BE5A 1M71B 5GGVY 3FFCB 2X0VA 1J12A 2BNRB 2VIRA 4QTHB 3QIBC 4QTIL 3T3ME 3B3IA 1XH0A 3G5ZA 2Z7YA 1KG0A 2BOLA 4Q6IA 1E3ZA 1UZ8B 3IWUA 1JZ3A 5B7MA 5A3ID 1TKFA 1R17A 4NJAL 1ZLVK 1P1ZB 4WEUD 4AC2A 5KTCA 1GZPB 1Q8MA 5IB3B 3S96B 2VN7A 2AI0H 3CDYA 3VFOB 1JZIA 1WGVA 2P45B 5KVDH 4YHKH 4YSDA 3TEWA 4M8VA 4AJWA 2AGJL 1B6UA 3P11H 3DRTB 3WOVA 3N43F 4FABL 2HJFA 1YSOA 1JNHB 3MV8A 3SY6A 4ZX3A 3O2DH 1WD8A 3HN3A 4ENZA 4R96A 5JNYA 4NC0B 1E27A 3JT2A 3STZB 1ORSA 5DJYA 3IFPB 3GKWH 1MVYA 1LAMA 4FJ6A 4W9JC 4MSWB 1T20A 3WY2A 1N5YH 1M4LA 1UA6L 4IHOA 1R75A 1C08B 5JLZA 2EC8A 5JA9A 3I6GA 3EZ8A 4V2BA 4ODWA 2B4DA 2V7HA 2A9AA 2YPLE 4PR5B 3TN0A 1RUAH 3CPUA 3FN0L 4L4TD 3FFCE 3RJOA 1CICA 3SE9H 4RWYH 3GLDA 4A1RA 2XN9B 5IF0B 5GS1C 2BVUA 1JI1A 1OAQL 1S7TA 1CICB 4JFED 4MRCA 3PP4L 4Y4HB 4DVRL 3LH2H 5K9QG 3LMSA 1BCIA 4XCNB 2GI7A 2WINA 4BELD 2YMXL 3LNHA 1QTPA 4YZWA 4FP8L 4KTEH 2DBLH 4NERA 5CWSA 1ZLUK 1IC7H 1JDAA 1JV2B 4YSTA 3MCLH 2W0LA 3EDJA 2B59A 2EH7L 5E1QA 3VXUB 3KPMB 4QRAA 4MHDA 3CSPA 3PGFH 1UFHA 2FO1A 2W81C 1UVQA 1XBRA 1OPGL 3PWVA 4LL1A 4YLCA 4GAGH 4Q52A 1FV1B 2H32B 4DUVA 9CGTA 1A4BA 2JJTA 4P3WA 2QSCL 3GHEL 4PW9A 3V5KB 4UIBA 4PJDE 3NVQA 2XX0A 3MACH 1MY5A 5IESH 2VISB 4PW4A 3ZMEA 1F2PA 4LNVA 5JPMB 2JKRM 2E46A 5HYSG 1DQQA 1ADQA 1XH3B 3PPEA 4E9YA 5LDSA 2HSIA 2WPXA 2VM9A 4PRHB 4YUEH 2EUIA 5EOQL 3HG2A 4JKNA 1FF5A 4HUUA 4WSGA 5IBUG 5A6IA 4XP4L 3BYYA 3MBEA 4JL1A 4BD4A 2CKBL 4YSCA 3HS9A 2X89A 3ARGB 4MX7A 4OSUL 4KX7A 4M62L 4QMEA 1JTOA 5I71B 4JPIB 3D69A 5FO2A 2B15A 3TCXA 3DTUB 3HLAA 3PDDA 1N10A 4P48A 4LHQB 1U8MA 4A7SA 2B4CL 4OLZL 3CFUA 4U3SA 3GM8A 5SX4I 3GS7A 3QWOA 1WZLA 1U8CA 2HFGL 5DD5H 3BD4A 5EZLA 5EF0A 4B6ZA 4Z7VE 5FF6B 5CD3A 1R5VB 3EJPA 2BSSB 4U6VL 4XNZC 1KN2L 1XEBA 2M8XA 5JW5B 2NOYA 4O9HL 2ORBH 2YD8A 2RIKA 3N1MC 5DMKB 2UY6B 4GQRA 4GLRH 2F8VA 1EHLL 5AZUA 3AGVA 2ZOWA 1JNNL 2IGLA 3D34A 1TO5A 2OBGA 3PG2A 4Z7NE 4N8PA 2D2OA 4NFDA 1A4JB 2ESVA 3H8EA 2AFSA 1UADC 3KJ6H 4IKNA 4D0CA 1S5IL 4X7CC 3H4QA 1DQDH 2WLKA 5D9SB 3VNYA 1A6AB 1Y07A 5JZ7C 2VDRL 1BM3H 5D9SA 4KITB 1Q9KB 3S5LB 3SQBA 5HXMA 1F45A 3X13B 4MJ6B 1UWGH 3DX2A 4I2XE 5T3ZH 4ZW8A 3EXJA 2AFUA 4UUJA 3QEQE 2VL5A 4ZBGA 4Y2NA 4MMZB 1YEDA 2D2CC 5FDWA 1AQ8A 5D7LB 3KG5A 3C5SB 4PRDB 4EVNB 3IMBA 3S48A 2G3XA 3RP1A 1CVSC 1JYXA 3HZKB 1Y1UA 4DO4A 1SJHB 4TOYL 4W6WB 3V6ZB 5L4MA 1FFRA 3VI4E 1CB4A 5TE4H 2IANB 3NJGA 3RWHA 4MXUA 2HLFD 2CG9X 5C08A 3DRQA 3IFOB 3O6MH 1T7WA 3J2PA 4K3DL 1T4KA 3LAFA 5F9JA 2VWEC 2PJBA 4DVBA 4F8PA 5IFJB 3TVMA 3FUHA 4OUUA 5GZND 4ONGL 5KS9B 2DS4A 5KYUA 4DGVL 43CAA 2CPUA 1TZGH 3K0YA 1AKJB 1G0XA 1GMIA 1CVRA 4J4PD 1CIDA 1LNUB 1XIWD 1J0KA 2B5IB 2VAAB 3HTLX 4P3DA 4UQEA 1Y0RA 1T5KA 5CNPA 1A6VL 5EBVA 2P46B 3NJLA 5CCGE 4WHYH 1S9VB 5FO8A 1MFEH 4K5MA 1OSPL 1G0YR 1VDGA 4PG2A 1SMAA 4NNPH 2WQXA 4IEFB 1Z8LA 4LNRA 2LQRA 3VD2A 3HMWL 1UQSA 1QAWA 4PS8A 2VITB 2F5BH 5DZ9A 1AOHA 2NX5E 2R9HC 4K7FB 5DRNB 3TFKD 2DQCH 1SXAA 3QAZC 4N8VA 5EU7E 4BK5A 2W8CA 4ZUWA 4GM5A 4NQVA 2IWEA 5ALBH 1DJZA 3UX9B 3DRQB 3IFOA 5HDWA 3NQKA 2JXMA 1W72B 1OL0A 5LYLA 2JBKA 3NEOA 1MCSA 2OTPA 3JBG7 3QXVA 4F1ZA 5JQ6L 3NCJH 2XX1A 4LBEA 5DZPA 2CO2A 4N20A 3EF7A 5E6ID 4FNUA 5D96B 4AV5A 2ZXBA 5DSCA 3EYOB 2Z3FA 2VZ1A 4K23L 1O9WA 1N64H 4CAVA 1G9NH 3BESR 5ICZB 4H25A 1XSKA 1TQTA 2P43B 2CF4A 2OXHB 3CMGA 5FA4B 4B5ZA 1DN2A 1KJ3H 1H5BB 2E8YA 3NFNB 2MIZA 4LCYB 4C8XA 4ZMVA 5I15H 1AZRA 2JQMA 2K8MA 4MD5A 1IB1E 3RZCB 1WK0A 4F7CA 4DP4X 1U3ZA 4LPUA 4ZYKB 3JUYA 5E8EA 1CU4L 1ORQA 4K7PY 3ULUH 3OKOB 3HUJA 4PU2A 5C0ND 1J9SA 1UWYA 3QR2A 3SDAD 4OC3A 2FEEL 3KZWA 2WKOA 1AANA 5TK4A 1I8IB 4II9A 2AQPA 3KGQA 3MLXL 3BLBA 3F7PC 4MASA 1VF5C 2ZXDA 5C08D 5TQ0H 5D1QC 2KI6A 2PMZA 1NCTA 1RULL 2A83A 1PIGA 3HVNA 4FG6C 2WUBH 4CGMA 1JI2A 2WLYA 3SDDA 1GJIA 1IGJA 3N1GC 1GTFA 4I18B 1FFQA 4M6OH 2ARJB 2BSRB 3N06B 4P07A 2G4EA 3B8YA 1FZJA 1AKPA 5AL0A 4CADA 3UPRB 5E0FA 5EZOH 1GA2A 5HHVH 1X7QA 4DO5A 3RKDC 3MBWB 4KXDA 3M7FB 1G1YA 1QNZH 1UWFA 4NSKB 2L7QA 4BSVB 3WFDH 5HHQB 4MBUA 4UFWA 4XXWC 4XXWA 5CEYB 2FJFA 3RVWC 1KGCD 5D5MA 4BRVA 4JFDA 2A4NA 3EDKA 5IF0A 3KQXA 1VFAB 1MXGA 4UOW0 4HEPA 3RUGF 3JTKA 3KLLA 3GMNB 4R9HA 3UAJD 2PJ3A 5K8PA 2AJZA 1C5BH 1Z4EA 5IW6B 1LO5A 2FWSA 5IVNA 4X5PA 1PY9A 2Q0ZX 4OLUH 1INDL 2FSEA 1PJ9A 3SO3C 2YK1L 4JHWL 4FI6A 4HEME 5FW6A 2R2EB 4GMSL 4JKMA 4PJFF 4PWEA 3WD5H 1BJ1H 1UXSA 2JKIS 1WT5C 1H15A 2BXYA 2NSXA 5C3LD 2A3TA 3MRGB 3F7YA 4F5CA 3GTNA 3DXAB 4YE4L 1C12A 3HG4A 4JJXA 2KMWA 3O9WB 1MF2H 1YVLA 3IJEA 1NPJA 3GK8H 3NZSA 3EDFA 2Q6WA 4XPHH 4P3CH 1RMFH 5DJXB 5FGRA 2PR9A 4IIQA 2EDJA 4PJGB 1EZVY 3QYCA 3PWPB 2QT6A 2X9XA 1WIUA 1SLWA 2BSED 3QCTH 1USQA 2PYEE 2V3FA 4OQTH 3SPVA 3WKNA 5KVEE 2ADFH 5C07D 1I1RA 4PGJA 5JGFA 1I4FB 2DQEL 1NMCB 2Z3MA 3BWAA 3HLAB 4XN5A 4DKDC 5BS0E 3B3SA 1UCBL 4J6RL 1E4XH 3L7EB 3SDAA 2NY5C 1LEGA 4AJYV 3L7EA 3LMJL 2OP4L 4XO3A 3SDAB 1F41A 1CDUA 2R15A 1G43A 1G5GA 3SCMD 4OCXH 4PJCE 2HT2D 5IW1B 5E9DA 4UNVA 1QW8A 3LD8C 4XOEA 4NHCH 1UOVA 4R7VA 3ROOA 3O3DB 5A2JH 2Q2EB 2YC1B 2X40A 2QFRA 1FSKC 4JANB 2Z11A 3VWEA 4ANVA 5TGBB 5PCYA 2G9HA 3LZFL 2WW8A 1HTYA 2K4WA 4ANUA 4P5TD 5DJXA 5KVDE 2Z10A 3PDOB 3H3BC 4PS3A 5AW2B 1LGVA 1MFNA 2DQDL 5B4MD 3OLEA 2X3AA 3GI8H 4KNUA 4ZK8A 3S7GA 1G9MC 5JIKA 3QA3A 4FA8A 2G3AA 1CBJA 3V0IA 3VFTA 4FYRA 1CIUA 2ZCLL 1E6OH 4MCQA 1L5GA 3NSXA 4RDQG 3EFOB 3NA6A 2G9DA 1NCBL 3WIIH 2LW3A 1A7OL 4S1DD 3RPKA 1E28A 3S88H 1QLEH 5D29A 2DWEA 4L37B 2D7NA 4WI4A 4MQSB 3JZ7A 4JFSA 4KVPA 4HLZH 2PJ1A 4JFYA 5D7EA 3WNOA 4YXKL 3I85A 1ZJAA 3PFQA 4DQOH 1DTDA 1JD7A 1O75A 4JO1L 1C9SA 4WZ9A 4D7PA 4Y4KA 1LMKA 2FL4A 4WI5A 5L2KD 3GBML 2YQGA 1P4BH 3D4CA 1Z5LB 3AS1A 4R4FH 5TFSL 2COQA 2V6HA 4XPFH 1HIML 5EOCL 3DNSA 1AG0A 4R90H 3TN0D 1NBCA 1Q9OB 4LLQA 4QHNB 3LQAH 4WUUE 1QSEA 4XP1L 5D1QA 4B9PA 2A6IB 4OJCA 1WAPA 3EKCA 4ZPTA 1IKFL 4H88H 3CDZA 1YYLH 1JOIA 1F8TL 4HS6A 4WUUA 5F9WC 4CC0A 3EO1A 4ZXBA 1S7FA 3IGRA 1HKLH 5GRUL 2VRKA 4NO0D 4PD4J 1YEDB 1A2YB 4GG6E 1NFIA 4NQDE 1K4DA 4M1GH 4KVME 1EXGA 4K73A 3RPBA 3MJ9H 4L4VD 3DVNB 1XR9B 4MFHA 5IMKB 4AMKH 2KZKA 1YR0A 5E5LA 1Z66A 3QO1A 1QQDB 3S35X 4KY2A 3QYNA 4ZO9A 2C6CA 1W8EA 1XCTA 1KEGL 2QFPA 4HOMA 3RAJH 3GS4A 2EIJB 2EDKA 2VI7A 4R7NB 2OYMA 4XAWL 2F53A 5JA8B 4XNYH 4UM9A 1MFMA 2YA2A 4J3UA 4KI5F 1CR9L 3EGDB 1TVDA 4KX8A 4Z7NF 3V5DB 4BV1A 3B2UC 4J3BA 2WBKA 3B3CA 4XMTA 2LABA 2RBLA 3KYOA 4KGLA 2XWCA 4JFQB 4XCFH 4DNLA 4RAUA 3UTSE 3FO0H 1AZCA 3MLRH 4D7BA 1VKXB 4PP1C 2RCSH 4GI8A 2PTVA 5E8OB 5KYXA 4ZRGA 2VLJA 4GBXD 2GIMA 4JFXB 5FGCB 2DTMH 5E8OA 5KYXB 1INEL 1FBIL 4APQA 1YQEA 2YZ1A 5IVXB 3LD2A 3G5YB 3T3PB 4WFGE 4CU8A 3D2PA 1AXIB 2DEYX 5E8PB 1R3KB 1KB5L 1Z9PA 1Q9WB 4L3CA 3VI4F 3WEAA 2ENJA 2P5ED 3D4GA 4WK0B 2H5MA 3CE1A 2FJHA 4HHWA 4FZ8H 4XNXL 4DEWA 4NXYA 2E7BA 3MRDA 3BZFB 5F1NB 4OLEA 5TDOA 1FNOA 3FB8B 4UCFA 1P4IH 3D12B 1YPZB 2DQJH 5KEZA 1QPXA 4GO6B 3IMRA 5AVYB 1EHXA 1U95A 1IC5L 4AKPA 2G5BA 3ZDXF 1CICC 1R24A 3AG4B 3S34L 4H0IA 5CHNB 4DOHB 1LK3L 3N43B 1F6FB 2AE6A 2CNSA 4UQCA 1A1NA 3AUVA 4HPOH 4NM4L 2VWEE 4XHQA 2OMTA 5G22A 4PJGE 2FR4A 2SODB 2NDFA 5L7XL 5GJSH 4YPGB 5E94B 35C8H 1UWXK 2W59A 5EULV 1HL9A 4GW4B 3PQYA 4H0LC 5BXFA 1P84K 1R5WA 2Q86A 3B7RL 3K2MC 1URIA 3BRFA 3S5ZA 1DVQA 1CPXA 4JGUA 3FUMA 2ILLA 5CBAB 4QY8B 1TFPA 4K55A 1T22B 3GMQB 4NKOA 1KBVA 4BFKA 3U4BH 3FTXA 1E30A 5A27A 2HT4D 2IMNA 3QJHA 3U48A 5ADOL 1FG2A 1MZZA 3W2DH 1LO4L 3TC8A 5AOZA 4C55A 1HWGB 5IWLC 2G5BB 3ILQD 3LJ3A 4HGWB 4RN7A 5J8CA 3GJEB 1N6QH 3IXTA 1G9ML 4U05A 4HIPA 1WWZA 3D6GA 3P73B 4IMKC 5D4IA 4QO1B 2ADJA 4H1LA 3QH3A 4P5KA 4E41A 4W9FC 2Y7QA 1A1NB 4R26H 4HJ0D 4Q6YA 2HN7B 3ECBA 4NPKA 2D31A 2MWCA 2AHIA 1G7QA 3D5OF 3QUXC 4QJ5B 4Q7DA 2P47B 1ETA1 2FX8H 1OK0A 1S9WB 2C34A 4N0RA 2ADIA 3VFPA 2QPUA 4OVUA 4B60A 2J8MA 1PZ5B 4APQD 2AFZA 1WBYA 2AJSH 5E6IA 2R9HD 1YEKH 4Y4FD 4FQ2H 1D5ZA 1U8LB 1JVKA 4LESA 2P6GA 5CGYC 1WWCA 4NZTH 1BDYA 2KERA 1F18A 4M7JL 5AOMA 3UC0H 4KK9D 1K3ZA 2G2PA 2UUDH 2FIKB 3OR7B 5HYJE 1U8KA 3ARFC 4X6EB 2OMYA 2DLEA 3PQYD 4OZHF 4GEIA 3HZMB 4KXCA 1TITA 1FRGL 4Q9QH 1MJ7L 4NKMB 2J8UB 1NFDE 2AV1B 2NY2D 4OJDH 4YDKH 1OAZL 3QPKA 4NCC2 3QFJD 4LKXA 2BCKA 3QUYD 1J9RA 1PSKL 1MLBA 3FT1A 1ZLIA 3VGBA 3CVHH 3SQOL 2ZP0T 3HC3L 4EQ2A 3BPNC 4PREB 1NCDH 1JERA 3AG1B 2IGFH 1MUJB 5IHWA 4WGWB 3FRMA 4Y4FC 1UGKA 1UEYA 4ODSH 1XCQB 1CC3A 3ZE1F 3KPMA 2YXWA 2G3ZA 4L1DA 1TZIB 4L8DA 5D7KD 1RZ8B 3OB0K 2Y69B 1MWAB 1E43A 4YHPA 4PD4K 1E4KA 3D2UA 4I1RA 2QPDB 5JHBA 3DO7A 3BGMB 1F4HA 1X5JA 3REVB 5G4OA 1QUNB 1XH1A 5A2FA 4HJ0C 2R1WA 4HPSA 2WXIA 5MI0B 1CS6A 1DFBH 1ZHNA 5HGGS 3WSQL 5F96H 2AQ3A 4DQAA 2VC2H 2NTFB 3VXOA 1SY6L 2PLTA 2X4QA 1Q9OA 1IKNC 3HS0B 3QEGL 4H44C 4PRPD 3QC6X 3RQ3A 4NLHA 3OC8A 4KOXA 1A9EA 2OMNA 3LV3B 1DJIA 4PLOB 5AOLA 3V6BR 5DD6B 3R8QA 2R0LH 2NX5B 5L4JA 2BSCA 3H8FA 2J8OA 4JY6B 1D5IH 2V2XA 5FKAB 4R7LA 3WEXB 1RLBA 4L4VB 2VMCA 1KIPB 2ICES 4LLUB 1U91B 4F7KA 1NJ9B 3APMA 4KOUA 4U7KA 4FQCH 2F54D 3M1OA 2LAGB 4F3FA 7PCYA 2VLLA 3UABA 3D85A 4QDGA 3SGJA 3UG5A 3VFGL 1YAZA 5L0QC 3KL9A 1CN4A 4LK4A 5DDHA 2ATKB 4YHOH 2AXFB 32C2A 5ESVA 1F2OA 1YJDH 3H42L 5DDHB 5GXBB 4TNWK 2Z4QB 5CD3B 3OPZH 5C0CA 1NIEA 4PJXB 5EUOE 3B34A 4RSYA 1TQCC 1KIRA 2R59A 3EYVA 3WABA 3H6JA 3KDMB 2X4TB 3KDPB 3Q9PA 4IU2B 1WH0A 5E70A 4CPAA 2L0DA 2WXOA 3NP4A 4UIKL 4WKXA 1CP6A 1W91A 5CJ8A 2J6EL 3HRZC 5IB5B 4FABH 1ECYA 2PO6C 3B3BA 2W9LA 4W9DC 3TASA 1AGEB 1CPUA 1KCLA 3JYBA 2BSEA 2DLGA 1WZ1L 4NQXA 2XHNA 1CX8A 1UATA 5MEPB 3TBTB 1TU2B 3DSFH 1KF9B 5E7FA 4BFIB 2F1BA 2C4XA 4CMMB 2WUUA 4MHHG 5KVGL 2W9EL 2AJVH 4U1GC 3CFQA 1R3LB 4N2KA 4PXCA 4L3EE 2OMWA 1MFCL 1IFHL 1SXZA 5AWNL 3DIVA 5E1GA 4G11A 1OP3K 5I16B 5EUKB 1QFWH 5IJDC 5A6LA 4JY4B 4RWYL 1SDDB 5FGCE 5AW0B 1AOZA 4CYOA 4ONHB 2UWEE 5H35A 1RJLA 1OTTC 4ZMAT 4PS4H 2YMXH 3WIFB 1VEOA 3MNZB 2ZKXA 3ZT6A 5HYFA 3PZJA 2PXYB 3V4VH 4BWTA 3S4SG 5D8JL 3H9SE 3H4FA 5EU6A 4GIAA 4HKXB 1K3IA 1M1XA 1U8IB 2KLRA 3PGFL 4NAJA 1IRAY 1PKQA 3D2UD 1W72L 3FCBA 3GMOA 4FI8A 4FN0A 5C0IB 4HCRA 1JZ7A 4PLKD 2PR8A 4POYA 4OZGB 1W8OA 5E9AA 4PJEE 4P2RB 2ZWSA 1NSAA 3FQWB 4UOZA 4JG0H 4UT9L 4MXQC 4TWEA 3QEHA 5ITBH 3R7QA 2D0FA 3TNNA 2YPVH 3EOTL 1HX0A 2QEJA 2WLIA 5IVXF 1IT9H 5DMIH 1QSOA 4MMXA 4U6XB 3SJEA 2OMWB 3F7QA 1AH1A 2ROYA 2FVGA 4M3SA 1KBGL 2JIXB 5CPAA 4J2XA 4S1SL 3UBFA 4NP4H 5CEZH 2G9KA 3Q0HA 3TFYA 1N0XL 1H6TA 3OMNB 4GSRA 1EK3A 4MJ5B 1KJ2L 2EUXA 5HHOD 1YEJL 2Z1PA 2PJ6A 4DK3A 3FCSA 3MLVL 2I85A 1HYSC 3T71A 2FJGB 2AEQL 4UMSA 3WTSA 2GIYA 1ZLWK 1J9QA 2FNBA 3QRLA 4GRLD 1VGKA 3NIGE 3O4LD 1MREH 4ZZFA 2ZG3A 4HZLA 3KBEA 1D5RA 1E9QB 3DXAD 3RWIB 3ES6B 1M71A 2ORBL 5E2VL 4G9FB 4UDUB 2CM6A 3VXUE 2NT1A 1NC2B 4AQEB 3LH8A 4LVHC 4TQIA 1J8KA 4P05A 3DECA 4Q6IB 2V7NB 5TDNA 1WIOA 1ZANH 3T1FA 1JIBA 3SYQA 1F00I 1ZGLP 1EXUB 3V10A 3G6JE 4LOVA 5B1KA 4TNVK 1EZSA 1EA9C 2AABL 4OKVA 3SGDI 4KJYB 4ODHH 5J6GB 2Z8VC 3FCTA 5D70H 3IC1A 3LRSB 1OF2B 4M7KL 5J9PA 4OF7A 2FH8A 3GIUA 4X5WA 4ZI6A 5A2AA 2DF3A 4AITA 4XBMA 4G7VH 4AW4A 1WC7A 1TIQA 3L9RA 4TLSA 4JPSA 5JDJA 1NMBH 5EIIB 4ZUUB 5BXFB 4Q6KA 3OV6A 1BLLE 5JPNA 4W9ZA 4NJ9L 3FAXA 2DIAA 5I6KA 5I6XC 2GIXA 3IBOA 5I6MA 2C26A 4CA4A 1M6OB 3KPRE 2I7OA 2AZUA 1FZKB 2A6KA 2AITA 2BS9A 2OCJA 3MRFA 3EJQA 4GXVH 4JY5H 4PJ8A 4RQQA 4WWKC 4F33A 3POHA 4MXWL 4IHOB 4DT2A 4HOWA 5BUGA 3BAIA 4WEEA 1BVLB 2ATPB 1QTSA 4JKKA 2CCWA 2OL3H 4MQ7A 1U33A 2X88A 4G5ZH 1RVFL 4B97A 2YUWA 2EE0A 3WXWH 2FNWA 1E9PB 1FYTB 1ZT7B 4FTVD 4QRPE 1IGML 4GAAA 3BVUA 2I32A 4ELMA 1ZEAH 4ZSOE 1AAJA 4YOKA 2XIBA 4OADA 3FYNA 1A6VH 1OTSC 5IGXH 2JDCA 2XRAH 4X5LA 3LWUA 2FT0A 5KSVA 2V4LA 2FIAA 3WN5C 3OKYA 1PQZB 4M1DH 4DFHA 3DO3A 4G7SB 3BKJL 3VRIB 5AZ2L 4UQ9A 4KZDH 1J88A 2CE6A 2OTWB 3NH8A 1Z3RA 4QOKE 1A9BA 4ZTOH 1BEYH 3N91A 3QQXA 3QUXD 3CQFA 2H8PB 2VW4A 3FYIB 1LP9B 1MSPA 1MFDH 4N2GA 1M6OA 1YZZA 2ZUWA 3K6DA 4N5UA 4X7SH 2JLMA 4AVJA 2Z3KA 3OGCA 2NW3A 3FRUA 4JFZH 1HDMA 3G6AA 1GGBH 3JWNE 3P2BA 3NCJL 1LO2H 4JFDD 4JM2D 2B77A 1I9RH 1CFVH 3RILA 2R69A 3IJEB 1FL6A 3P77B 4XI5C 1TKWA 3F5BA 3BISA 4WKZB 1TJIL 3GINA 4M7ZB 1SVZA 1IGYB 2ZE0A 1JZJA 1UWEL 2Z31B 4NRXB 1P6AB 4RUHA 4I8DA 4QPEA 3X13A 1Q4NX 2J1WA 4XVUD 1FN4A 4AV0A 5KAQF 1JV5B 4JDEB 4QRRA 4JO2L 4WWVA 2Q76B 3S6FA 3HHSA 3HS8A 2X1WL 1T2QL 2VDMH 1HE8A 4PGBB 4ZFFA 1IE4A 2P5EB 2FX9L 2VLME 2XV6B 4QRRE 1P7KB 2XWTB 3O3AB 1JZFA 1EXHA 2PW2A 4C56D 1F58H 2MPAH 5FA3B 2QVKA 3UBXG 3UOAB 3U46A 4QYOA 1JPSL 1DBJL 2VLRE 3ARGC 5GGSB 4M7LT 4QXGL 4K9EL 5JIHA 4L3EB 2D7TH 1OKEA 2EXWD 4R6TA 4E9SA 1VZIA 1JBJA 3C9NB 4MAYA 1XL6A 3V0WL 4X42A 1RULH 4NAQA 4R0LB 2YD0A 1QR1B 3WDHA 1WF5A 2CBTA 2YS4A 1MJ8H 3O3EA 4R0LA 1QR1A 5IK3A 2C3XA 1FORL 2FL5A 2XZCL 4IBYA 2Q7YB 2CXAA 4MMXC 4HF5H 4YHMH 1J5OL 1G0DA 4WFFD 4OV6F 1YUKB 5IFAH 4ERSL 3BPOC 1EUTA 1MNUL 2Y3AA 3PREA 4LMQI 2NY6C 3R4DA 1CXFA 3L4YA 2QVTA 3SO3B 2V5YA 3RWCB 3ZRSA 3QQ9C 4JFDE 2QKIC 4I85A 3JT0A 1EO8H 1CFQA 1SMOA 4I77H 2XG5B 1FZOB 5DVMA 4MJ8A 2R8SL 1JVLA 4KKQA 5J11C 4GFXA 2L4OA 3SDAC 4UNTA 4PP1D 5KANG 1HL8A 4AGPA 4BA0A 2BFVL 3ML8A 4JK0D 4BA8A 4NRZB 1INDH 5AOIA 4LU5H 3QO0B 4LSQL 5JHAA 1F11A 2OS7A 3SKUD 2VH5L 3SYPA 2N56A 2DY2A 3GJFA 1BGXL 1BMZA 2JKSA 2WBJD 3MRPA 3FUEA 3V0EA 4BQ8A 2MCPH 3EFDH 3WTWA 1ZRUA 5AYQA 4BHUA 2O5XH 1NCAH 3F7KA 2FSRA 3SBQA 1IGTA 3KPOB 1NKGA 2HJKB 3IDGB 2YD1A 3TH4T 4BQ6A 3VMNA 3T8WA 2A6IA 1UB5A 2AQ1A 2E7HA 5IOPA 2H1XA 4BFIA 4A68A 1LO3L 4J3OF 3MV9D 4P3CL 5I8EB 4ATWA 2UZIH 2YOAA 3LQAC 1JPGB 4NENB 1IYKA 3K2UL 4LLYA 1R3LA 3TBYB 5A28A 5DYOA 3U0WH 1XTMA 4OC5A 4OQTL 1ZE3C 3OHXC 4LIQL 3VWJD 1BQSA 2WSPA 2AANA 2UY7B 3QQNA 1F56A 4JCWA 3EJUA 4JFPA 4JZJB 1PFOA 3NJNA 2AQ2A 4XO9A 4Q2ZB 1RIUL 3KH3A 3F05A 4AYFA 4Y1SA 5A2KH 1XMBA 4KC3B 1UJ3C 1VCBC 2LU5A 1NSLA 2OP4H 5AFAA 1HWHB 5F7UA 3DGGA 5IROD 3MODH 4KK6C 1NFDB 5AOJA 3RFZA 5FM8A 5DS8B 1F5WA 5M7QA 5F46A 4JN1L 4DZ8A 4FMFA 4YXLL 2PETA 2GIVA 4D9LH 2MCAA 3U4AA 4TNGA 4ZY0A 5AKRA 3TJEH 1W0VA 3G9AB 4GPVA 4OGAD 1IM9A 5AOKA 4B9JA 5IG7B 1GC1C 4BMHA 1T66D 3N85H 1PLGH 3GPSA 5GISH 3VXUD 4R5TA 3FO9B 2VDOL 4M48L 2VXSL 5HH1A 5AYUL 3W39B 2N4IA 1FNEA 2E3VA 5DJDA 2PJ5A 1Q72H 5EEVA 2CA4A 4KOVA 2CKNA 1CICD 5KOVC 3TT1L 2HRPH 4QHUB 3EOAB 1Z3GH 1E4KC 4C2ZA 1OT4A 4AVKA 4ZI8A 4NM8H 3ZZIA 1PZ3A 1RJYA 2Q3ZA 3NACH 1A0QH 1WCBA 3MKGA 1ETB1 3GMOB 5J3HD 3HA0A 4WTWA 1O6TA 3BP7A 4PUBH 1QPPA 3FJTA 1LEKA 2EYTB 3RVVC 3ZR6A 1WA0X 3CMOL 2EE2A 5I0YA 2AJXH 2DM2A 3RVXD 4HWBL 4OM1H 2IFFH 1H8OA 3H9SB 5EH1A 3RWIA 1NBZA 4NSKA 4A7GA 5HHQA 2IV8A 5C0GB 5KW9H 1G9EA 2FCKA 4MA8L 5BOZG 4EN3A 4HIEB 5EV7A 4UTBA 1F3DJ 2FHCA 1PCAA 3K4AA 4XPFL 3T04D 1SJEA 5JIMA 1E2ZA 1TPXB 4N0CC 5DK0A 5ID1A 1IX2A 3BC9A 2ANPA 4ZX5A 4GAYA 3LNFA 3HJ0A 4QRQB 1M6UA 5I1DB 5IROA 2Q20A 4B50A 4DKEH 3SDCB 5SWSE 4UA3A 1OARH 3DPBA 3CAFA 5JIQA 3VTMA 3BI9X 3NIFE 1D6EB 2G2RB 3IIBA 3EH2A 1UM4H 4L18A 5GZOC 5GRUH 2BM3A 3S98A 3S8WA 3TZVD 3L9RB 3NCEB 5M95B 1T6VN 4YSEA 5MENE 2BW4A 4ALAL 2UZXB 1JGUH 3RI5K 5BV7H 3RVTD 1I3UA 1MEXH 3B2UD 5IW1A 4L05A 1ADQH 3ULVE 4Y49B 1A21A 3VGDA 2RQ8A 1QP1A 3WEBA 4IKIA 2EYRB 3FIXA 1XMEB 3CZKA 5DFVC 3SCMA 1H3UA 5CD5C 3QW9A 3BZ5A 1OZTG 2APWA 1BIHA 1MCOH 1KCVL 2ERJB 4D9QD 2VXUH 1IBGL 3WC7A 3Q3GB 4DEPB 2BOBA 3FFCA 3MX0A 1TG8A 5CMAB 4HU2A 4ZOAA 5F6HJ 5K5YA 4OZIF 2QJDA 3QJFA 3KKWA 3C5ZA 2O61B 3HG5A 2W65B 4X98A 3WV0A 4AH2A 4KJYA 4QCIB 1P1ZA 3CSTA 4WI6A 5F49A 4F9VA 3H1ZA 2QKIB 4QRFA 1S3KH 2QKSA 4A66A 4N2HA 1KBPA 2QLVB 1S9YB 2Q4YA 4JGNA 1GZHA 3VXUA 1L6PA 2R1XB 1KY7A 4ZMWA 1JV2A 1DJWA 1M3IA 5DURB 1I3RB 2ENQA 5F7KC 2ALAA 3O3AA 2DTML 3SE4C 3FH7A 4RGMC 4TTDC 4YZFE 2POKA 3H8NA 4WIQA 2XWZA 3QJOA 1NL0L 1GGCL 1BX2A 3MOAH 3FUNA 3QEQA 3SPCA 2DQGH 3DX4A 1KYUA 2ZP8A 1LD9A 4WFHD 4UQ3B 3ARBD 1SM3H 3RVVD 3BO8B 3H3PH 4M00A 4KDWA 2R0KH 5GZNA 1IZJA 1UURA 4J3WA 1VHSA 3LN9A 4PEEA 4UEFA 4WJKB 1B0RB 4NZUL 4F8TA 4QRPD 2D03L 1MQKL 1G94A 4F58L 3EJYC 4N4YB 3P4OA 2ETWA 5T5NF 1I8AA 4GOSA 2ZUTA 3BUBA 2BIIA 3VXMA 1OAUH 4IYKA 4CU7A 3IK2A 5E5UB 2Y7MA 1S9YA 1VGEH 2BVPA 3DJTA 3UERA 6PAZA 2GLJA 1LQSR 2OYPA 3ZT7A 2Y2YA 4JKPL 3IDJA 3GRGA 3PUCA 4YVUA 3V8OA 2WXMA 3J27A 2FX7L 4TSCL 4ZSOA 4X6BB 5FUCE 3T2QA 3J7HA 1VFMA 3PWNA 2H0JA 2HX9A 5ECJE 1ACYH 4HUVB 3I3GA 2GREA 2WTOA 4KQ3L 5B38G 2GU2A 4WNQB 2G0KA 4OD2B 5EF3A 4Q9RL 4FFTA 1EEZA 2VR8A 3FFDB 2JKTM 5TJWK 3BUYB 5DGRA 1MRCH 2O5YH 2QMLA 1R3JB 4LLWA 4X6DF 5T3XL 3BLNA 3S5YA 2YAOA 4Q58C 4MQXC 4ZFZA 5HYSB 2DICA 4APQC 1E67A 3KQZA 1N5YL 1CL7H 1ZHNB 2IEPA 4QC6A 5HDRA 3FPXA 1DQMH 4MJIB 3QORC 3KPQB 4DTGL 4EZKA 2O72A 4BDVB 4JJ5A 3A6OA 3P4LA 4QWWC 4Y88A 5ICUA 1FVCA 3BP5B 1RZ7H 5GRVK 2BWQA 3BGFC 5DD6A 4ONWA 3UL4A 2W0FB 4E9QA 3OG6B 3SQRA 3WTXA 3ARXA 5LCVL 3DHPA 3IAGC 5ESAA 3FQTA 3L3DA 5IJKA 1IARB 3V55A 1WEJL 4DUWA 5F7FA 3MCLL 1ONQA 4XT1C 4L3CB 4PK3A 1HQ4A 1AXSB 1U8PB 5EZIL 3D08A 1XF5A 1O6SA 4BGDA 5IFJA 3ME0A 4ELKB 3L4WA 1FO0H 4Y16B 1S7VA 3PWJB 3L5HA 2DMBA 1OXYA 3WNMA 5LAPA 3LPGA 4HKBB 4PJXA 5F7NC 3TBSB 4O23A 1KZQA 4MNHA 3I9GL 5DO8A 4DKFL 3WFCL 3U36B 2OR9H 4KOCA 5I1IH 2I24N 4ZFGH 1T21A 4JRYE 1FH5H 4MZRA 3ZQWA 2F54A 2DN7A 1DANT 1RUPL 4P45A 4IEFA 3RVTC 3MLTB 5DFAA 4MD0B 4UT7L 4UOQA 1ZLEA 4PWFA 2X7LA 4JGJA 2FWOB 3B9DA 4S1QH 4HS8H 5FM5O 4FX5A 4FXGA 4PRHE 2NNFA 2EDEA 2OJEA 4MVBC 2YXMA 3S37H 2O1AA 2F7IA 3MREB 1JK9B 3LKPB 4FNPA 1S7RB 5ISVA 1ES0A 3UJIH 2E86A 2C9SA 4DCQA 3QZWG 2A74C 2NUTA 5HJGA 3UBXA 5KYUB 4WO4B 3RDTB 2V9QA 4FNLH 1TO4A 3HLPA 1MG3C 4HKBA 3N44F 4LHUB 1AG6A 3D3VE 4PRIB 2F6AA 1CLYL 1KCBA 2VZSA 3QAHA 1SZNA 3SEPA 3RTQA 1FUNA 1KWMA 1VHPA 2X4RB 1C5DB 1H3XA 2I9LA 2JV6A 3D3VA 3M8OL 5DS1A 2EXWC 5F7AA 4H25B 5FUOH 2CTBA 4HV8A 3CZEA 4XBPB 4OZGA 5JMOC 1T1YA 3QIBA 4G8IA 1IB5A 2ZX7A 4NN7B 1IM3A 3NFNA 2QVPA 1RERA 2VO5A 2WQRA 5F70A 4OJFH 4PJ5B 3IGUA 1B6BA 2AK1H 2XN9E 4Y2OB 4JZNA 2LFEA 3G3SA 4M8QB 3QEGH 1E2VA 2CSPA 4G1MA 2VEZA 3MAWA 3JSSA 2WVVB 2YPLB 4U6XA 3TCVA 4G59C 1TQUA 2X4SB 1ETZA 4R2GB 3KGTA 1JGDB 5F9DC 4ECNA 4YHNA 3DPBB 2I27N 1IGFL 3SJFA 3HE7C 4FG0A 4XXCA 3SBWC 3TBVA 4LBEB 1V7NH 4NCDA 1NLDH 1XR8B 4R3SA 3WBDA 2PP7A 2WXKA 2JLPA 4FQCL 4Y4HD 5TE7H 3QJUB 2XLLA 4LB8A 3X3FL 1OZPA 4YHOL 2BIOA 4TSAL 4Y2LA 1ZHLB 4OZGF 1YJDL 5CP7B 1ED3B 4LRIA 3VFVA 2TSBA 4GSXA 1JMXA 2P8MB 2OJZH 3ARTA 5H4YA 2XV2A 3E6HB 5EBLA 3BAYA 3BLKA 3RU8H 2E27L 4XE5B 3T8VA 5GGTH 4OD3H 4G9FE 4N9OB 1GS7A 1J7VR 1SBSL 4MD5B 1Z1WA 2D4OA 2OXGA 2IAMD 3GSNB 4YE0A 3CFJA 3EYQC 2OXGB 4QUOA 3GFUA 1EH9A 5KBPA 4P2YA 5CEYA 5IKCB 2EH8H 3PBBA 4LKXB 4B5PB 5IT2L 4J3OH 3KBHE 1FNAA 3ZMNA 4JE0A 3K9UA 3BDXA 5D1ZA 3TFKC 1WZ1H 3D3VD 3VWJA 5F21B 4RGOL 3DGCR 2I5YH 1YLOA 3Q05A 1D5ZB 1U8LA 2VYRE 1XF2B 1WRFA 5HDBB 4E5XG 1CFSA 4F5CE 1J0HA 2VDLB 3O2VH 3SOBL 5JQ6H 4YK4B 3MNWB 5IMLA 1NOAA 3MUGB 4G6FB 4FXKA 4CVUA 2CGRH 5DT1L 3NZHL 1SF5A 4MA1C 2ZCZA 4KI5C 1ED3A 3VFVB 4PS4L 3FMGH 1D5MB 1IKOP 4GAGL 2F58H 1RZKC 3SDXB 1Z0NA 5DMGC 4NSQA 3H9SA 5EU6E 4XVSH 1BVLA 1AY1H 2ATPA 4N2LA 2AFMA 2EILB 1CFMA 2D9CA 1XO8A 2I7SA 3G6DH 3WIHL 4AENB 1FPTH 2EAEA 2EDHA 1PIFA 1NDTA 3RIFF 1V7MH 1XBDA 1A64A 4I9XA 2H47C 4Y5YA 4YUEL 1J8SA 5EC1A 15C8H 4AH2B 4Y5YB 1J0IA 5IB3A 4QGYA 1CDJA 1X5GA 3OXRB 3V6OC 4KOSA 1LTXA 1QSED 2DI9A 3GMLB 2LFGA 4BRJA 1FVEA 5BRZE 4N5ED 4FRWA 5EOTB 3KPLA 3T6ZA 3NE8A 1RK1A 1X4ZA 2G3MA 4JUTA 2XY1A 1MLCA 1UB6A 1KBGH 1BD2A 1P4LB 3B9AA 3PFUA 4F8LA 3SKOA 1JNHA 2ZUQB 3IGAB 1NDGB 8PAZA 2XXFA 3MLWL 4LLVB 1J8HB 5KVMC 4CAFA 1G87A 1JDCA 4PBWD 1MCEA 1AJ7H 5G4NA 5ACZB 2FYYB 2BO9A 1DVFA 2CDFA 4O02B 2GUOB 4J7RA 1U8HB 1LP9E 4UAOB 2WBXA 3UMTA 2L3BA 1A4JA 2ZX8A 1S78D 1HHIA 2NQCA 3Q2VA 4KHXH 5L4FA 4X5KA 4PJCB 4XMXA 3OKMB 4F57L 2QADD 3M7OA 2IAND 1ZS8B 1FDLH 1IAMA 2ZSVA 5HHME 1QO3A 4M6NL 4WUUB 2G0BA 3NTCL 1X5FA 5F0MB 3VDBA 4OGYL 2CMRL 3T8XA 3DOHA 2K5TA 1GCYA 1ZVSB 2J12B 3CZFB 4LAJH 5BS0B 3QWRA 1JWMA 3HG3A 3FOLB 4ZY1A 4FCAA 2VN5A 2QV2A 2Z1KA 4DH2A 4ODHL 3DVNA 3LIZL 4XMKH 3K5SA 3ULUD 4A95A 1J1XL 3STLA 1UUNA 2FB4L 4QGTA 1DR9A 3K1DA 4X80H 5DZLA 5FYJL 3OAUL 4PYGA 3PIQB 4L0ZA 5FF6A 3FB3A 5J8FA 3FB5B 2FECL 4X8IA 1DFXA 4U1SB 2F53D 4A55A 3CHPA 1PVHA 1MVUB 3HE6C 1AQHA 5EU6B 5E6RB 2H26A 2VLKE 4IU3A 3HG1B 1KCRH 4O02A 5B1CA 2OL3A 3ETBF 1Q2YA 5JHLL 4OZ4B 1RK7A 3C6LC 4H1LG 5KVGE 3AVEA 4PRNB 1RZFH 3T0EE 4DKFH 5D1QB 1THCA 4AVIA 3TA3C 4DGVH 3VCLA 2Y7NA 5SWZD 3D18A 2IBZY 3L8QA 4PI2A 1MCIA 4O2CA 3FO2A 2OQJB 3SKNB 4ICWA 4BDVA 1GJWA 2NY6D 4F92B 3RVWD 4P44A 3IJ8A 3EO1B 2ADFL 1N59B 1RZKH 1NMAL 2W0FA 2B0SL 1BP3B 4AGOA 1OCOB 2Z31D 4PY8J 3QNVA 3PGPA 1R4XA 4ZQKB 4HCIA 1Q9LB 1GS6X 3RDTD 2CHXA 2CM5A 1W72A 4YFLI 3V9EA 2XXCB 4M1DL 1F4XH 3BSZH 4B96A 2GJRA 4AIZA 5DLML 2PO6D 1LHZA 5DD3L 1CFNB 2EP6A 5ERWA 2ADGA 4P0DA 5DUML 4CVXA 5HYQA 1XV8A 3GSRB 5ERWB 1H8SA 3OLIA 3QHFH 1CG9B 3OWCA 3BKYL 5CJQH 4JRFA 4A04A 3FQ2A 4QRSA 1P1VA 4W6XB 5JXAL 1U95B 2YQBA 4L8BB 4HC1H 1ZA3A 4NGTA 1KGCE 2R56H 2FQFA 2LU4A 1UEMA 3JWOL 1TQBC 1R24B 5FX3A 2IAMB 3RRQA 1PFCA 2GC7C 4E2AA 1T1WB 1JHKH 4GG8A 4PHZA 3RE0A 3N42F 3OF6D 5DC2A 2QECA 3O4OC 5A3IC 4MCSA 3AAZB 2XZQL 1Q9LA 2A1WH 1THAA 5DJAB 4UBDC 1ANUA 3K2IA 1T4KB 5F9JB 2H2SD 3UAEA 1KWKA 2EDTA 3S88L 1SFDA 4HW6A 3ASWA 1O6SB 4ORGB 3U9PH 1EAPB 2CZNA 4UOW1 1IC1A 2W07B 4XPAH 2ZCKH 1SEBA 4BH7A 1CD8A 5EN2B 1CP7A 3RHWF 1Z0MA 4Q2ZA 1FGVH 1QFHA 2FO4B 3L5IA 3U7WH 4G8FB 3GWJA 2EDFA 3SO5A 5C0JB 3PEIA 4H8QA 1JGEB 5IHBA 1DVYA 3QJHB 3ZZ1A 3T3MF 3ZW3A 4UV7H 2MH4A 3EFAA 4M43H 4XO5A 4MQ7B 5DC4B 2D7TL 5DD1H 3THMH 3FONB 2FJSA 1TVHA 4FQIH 4KKAC 5BW7C 1E40A 4JM4L 2OX5A 3MRIA 3EJTA 2JKLA 4YXHH 4AXWB 2DYPB 1SVBA 4PFEA 4HDIB 5I1JL 2EXTA 1F8TH 4QT5A 5I0VA 2FWOA 3VD9A 2XZCH 1FORH 1IM9B 5EZOL 4CMHC 4Z3JA 5D7IF 5KUMA 2ICCA 5TF1H 2OMTB 2V5SA 3IAQA 3ULSA 1UXMA 2ZUSA 4JRYA 1Y0YA 2D3LA 2X6BA 3P2DA 3B8GA 2BJML 1YQVL 2CGZA 3RYMA 2EVJA 1YNLH 4X9BA 3RAMA 4HIQA 4CBPA 3WJLA 2PJAA 3WHE1 3EC4A 4RGMB 3BHXA 3GMRB 3WL9B 1S7SA 2XTJE 1X9LA 5B39A 2XXGA 2HRGA 2WWKO 2NNAA 3AXIA 3VQ2C 2E7LA 2NYYD 4G7RB 2O5ZH 3RTQB 5G20A 2AERT 2PO6A 3N40P 5IBLC 3VM7A 5EF2A 1FLRL 2EECA 1QLFB 4EOWH 1WBXB 3RY5A 5I5IA 3D0LA 4HWZB 1ELMP 4IAVA 3V0GA 2BP0B 1XXFC 3JWNH 4OLVL 4LU5L 4KI5D 3MRIB 4AE0A 5C0AE 3P3YA 3QH3B 3W5NA 2DIJA 3GB0A 3SKJH 1BGXH 1SGKA 3P73A 1NOFA 3S0PA 1R5IB 4OLWH 3QWNA 3ARBC 2Z92B 4JFOA 2VUKA 3G5ZB 2XVGA 1OCCB 4W9IC 2PTTB 3L1OL 3JV4B 3MI6A 5JZ7D 2PJCA 4TNUA 4BFNA 3QULB 4NDMB 2PVVA 1I8LC 2JK5B 2PCFB 1MFAH 4XWGL 3GSVA 1MUJA 1KB5H 1LYQA 3M46A 4KKLC 5CBAA 2FSEB 1HHGA 3HZ3A 4PCTA 5HDQL 3L5XL 3PAZA 3CN4A 4X8XA 1J5IA 3FRUB 4LHUG 5KSAC 1EHAA 1JN6B 5D6DC 1Q0EA 3A6BH 3SDDB 4D0BB 5JHMA 1Q90A 5TDPB 4TTGA 3D85D 5I26A 2JQAA 3FT9A 4YHZL 2MTPA 5KBMA 1NUGA 5JPMC 1YQ2A 3GJFK 1NGPH 4QKXB 3REWB 4R4BB 1AUGA 1A14L 3N44B 1K8IA 5E6UB 4E9LA 4JREC 4NHCL 4GSUA 4HLZG 4NRXA 3QNYB 3HZMA 4B9CA 4UDTA 4QRUA 3CFJB 2P5WD 3QJFB 4IKJA 2XWRA 5TE6L 4MS6A 2MMXA 4QHMB 2IJZA 4FG4A 5DFVD 3AG3B 4UTBL 3QI9D 4WDIB 4WW2B 3HB3C 5EG6C 5D72L 4U33A 5E2UH 1BXUA 2P24A 1UKTA 1GL4B 2L04A 4LLUA 1FJ1A 3TJEL 4HNWB 4IMLB 4NPYB 2V5TA 1ASOA 4AGNA 5DEFB 4D9QE 3DX6B 3IDIB 5AG6A 3H7BA 3HKFA 3N85L 1WFTA 4Y9FA 2YWYA 1YMMB 3O2DL 2WP3T 2AP2A 1RZIA 2I79A 1RUQL 4HFUH 1MCHA 5FYKD 4POZC 5CLXA 4ZOBA 1Q72L 4I87A 3GKWL 2B16A 2FYVA 3MUJA 1FNGB 1XAUA 1C12B 3D87B 5JPMA 3BSGA 1ZS2A 1GYTA 1JPTL 1M42A 1K8IB 2WQVA 2FYYA 1MJAA 1DVFB 2CDFB 4YDVA 4XP5H 4ETYA 5EHFA 3VFMA 2QMJA 3KR3L 3LKRB 4RGNC 2C6GA 3SY0B 1WISA 3QXUA 4AYSA 3RUGB 4PUBL 4I2XB 4X99A 3MV9B 1B4LA 3PWPA 3KPSD 2C7UB 2G60H 2XKSA 1TETL 1UENA 4R4FL 4XC1H 1HZKA 1DLHB 4OM1L 1BVKB 4FFVD 4NOBA 3UYRL 2JF1A 1BF8A 2CO6B 4PREA 3WMPA 3KLSA 2YUZA 5IX3A 5HGAB 2WGNB 3U0PB 3GNMH 4L9LA 1UJ3B 4CGTA 5EU3B 4YIQB 3BW9B 5AW1B 3UPCA 5CILL 3FN3A 5KJ4A 3MACL 2KCWA 2FUTA 3ZKND 3QCVH 1I1AC 4G2AA 3SYAA 3KD4A 1AR2A 3LPWA 4X0KB 2PSWA 5DVNA 2BP8B 1R19A 2IO5A 1JF6A 5G5DA 5I5JA 3K8LA 3N0AA 5HYQB 2ZSWA 4PJHE 3ARFD 1HHIB 2E7LC 3KLDA 4P6YA 2OLDA 4ICXA 5JQIB 1P4NA 4UTAL 4OCYH 3DV4B 3U1SL 4YS4A 1NAMB 2ZWNA 4PJCA 2VDLL 1RI8A 4NWUL 3WYRA 1OSZB 1ACCA 2DQUL 5CR8A 2V8VA 4NI6A 1NEZB 3RNZA 4M7ZC 4DK6A 1HXMA 3O6FD 1H6EA 1NEZA 3TO7A 1ML0A 4R97C 3RLSA 4BGLA 3QDME 5D5MF 3QFJB 3NCYS 1WIPA 4PJ9A 5CZXC 2HFGH 3OKNB 4PQXA 4N9GB 5HJ3A 4L1HA 4WK2B 1HXKA 1YY8B 1T83C 2IJ0C 5GSVB 3T4AC 3FF7A 5IQOA 1XZ0B 3TTYA 2CIJA 3CC5B 4YEFA 1INEH 1G1CA 3ALPA 3BFOA 4AVHA 3BVXA 2W07A 3RFRA 2PTUA 2X28A 5FIEA 3MBXH 4FERA 3T0WA 1EEUA 2YEZB 1ZGLB 2R7EA 3CVDA 3K2KA 3QT2A 4ES9A 1NFKA 3OXSB 2ZKYA 1OP5K 4UTCA 5I6PA 2BNQD 2Q7NA 3QXWA 2CCVA 4HIXH 2WC7A 1XGTB 2SEBA 2K8QA 4XOBA 4TNEA 4HP5A 2HT4C 1A65A 3RGVD 3ZE2B 3ZL4L 3F6LA 2XBDA 5F96L 4A7VA 2HLAA 3IE4A 4D9RE 5KS9F 4A2LA 1KJ2B 4MB1A 4DP5X 5F3BA 4QXTB 5SWZE 2EBJA 3AFLA 2QHLA 4J8RA 5HI4C 4MMXB 5F3BB 2H5UA 2NW2A 3WJLC 3KPSA 4JCMA 3TOPA 3WHXB 3VXRB 1P0SE 4TOYH 4MWFB 3H6AA 5KJ7E 3KPSB 4OKOA 2D03H 1CLCA 3VXRA 5I1DA 4FQXA 1U3YA 4K7FA 1QRKA 4IRJA 3DBSA 4AM0A 5GSRA 5C1MB 1KCSH 1N18A 3MNVA 4FQLL 2A9CA 4NQEA 4LSTL 2OU2A 4JKLA 1BG1A 4HJGB 5MENB 3DOSA 2EVFA 4LSVH 3AW5A 4YFLF 4ZFQA 3RX5A 4ZUVB 3GIVB 4Z3TA 1ZOXA 2GSGB 3BT0A 3QUXB 3NIFB 5IV2B 1ACYL 4K30A 1VADB 3GT6A 4K7PL 1NM4A 3FN9A 2DI8A 4N28A 1U3HC 5KVEL 1YNKH 3LIUA 4X50A 4NZFA 3COOA 4NX0A 1YDPB 4AKQA 2JJSA 3EBHA 1NGYB 5DK3A 4HUWA 3OLGA 4ODXB 1YY9D 1SPDA 2DRUA 4KS9A 4K71C 2WQUA 3V2AR 2XYBA 2OMUA 4IMKA 4UAHA 3VRJB 5I0DA 4NQDB 4OGQC 4PRPE 4XE0A 1T1WA 3HHMA 2BLFA 3N6YA 4Z78A 5JOFA 1S60A 1TOXA 1X5KA 4QT5B 3DX0A 4P06A 4HBQA 5DRZB 2EXSA 3RNKB 2QIRA 1AFVH 4PSRA 1NSNH 2Y25A 5ISZD 1QBML 3NA9H 2CRMA 2EINB 4AM0B 2VBQA 1I8KB 1RZ7L 4P2OD 1OW0C 4OT1L 4R26L 3PFOA 3JVGA 1K5NB 1UZGA 4QEGA 4YDZA 1SEQL 4FA7B 3QS3A 4PJFB 5H2BB 3DOSB 1RCYA 2F7RA 4UBDD 3RWDB 5MP6L 1N64L 1SYVB 3HE6D 1ZHBB 2FX8L 1I3GL 2PJ4A 2EABA 2E4FA 3IF1B 3R4RA 3I9PA 1DUZA 4PK2A 2AJSL 2Q10A 5HD8C 3X1GA 2TAAA 5DI8A 3LEYL 1A7RL 3SYOA 4RRPM 5JYLA 2A2QT 5ICXB 5KVFE 1EMTH 4DEUA 1L7IH 4N22A 1XGYL 4HT1H 1LOKA 4H8VA 1G5AA 4ZOCA 2QBWA 3WJJA 3EADA 4UT9H 3HE6B 1SYSB 5CHNA 4EBQL 5C0DA 3ULUL 3NEEA 5DURD 1DLFH 2YN3A 5I1IL 2ATRA 4JL2A 4ZFGL 1YN6B 1MCCA 1FN4B 3GSNL 1UD2A 1LO0H 3GXMA 2ZWYA 4JFDB 4JFWA 1CG2A 1RUPH 1M44A 1MJ7H 2HWZH 4KO7A 4TV3A 2DWYA 3VB8A 7CGTA 1H0DA 2EDDA 3QJTB 3KWVA 4WW1B 4QRTA 3L7FB 4RMVA 2F2HA 3NN8B 4PJFA 2B4CH 4Z18A 3B2PA 1NUNB 2CK0H 3DYOA 4NQED 2VDQL 5IHLB 4NO5B 5SWSD 1BAFH 4YAQB 1ROCA 3IDMB 1NINA 4C4KO 5HBBA 1E5UI 1G6RA 3NESA 3WT4A 4M8UA 1PF3A 3VH8B 4JMXA 3D4YA 1V3MA 2WY3B 1MCKA 2CK2A 4GRWB 4ODSL 2QHRL 4RGNB 5ESQB 1AXTL 2J7LA 3UTZB 4U1LA 4B9KC 4OZIE 1IE5A 2GI0A 4TUKH 4Q9BA 1LAPA 2Q0YA 1M2VA 2W38A 4XP9L 1E2WA 4WWPA 3HVDA 4KVNL 1XFPA 2F19H 3HE6A 2AJYL 4A33A 4JPIA 2XWEA 4LEXH 1EPFA 2MHAA 4MTMA 4FTVB 4ODVH 1UM5L 1OW0A 1OGSA 3NFSH 4GP4B 1CGUA 2Y07L 3HHSB 3MYJA 4OZGE 4ZFFB 1Z9UA 3ZE1E 1OAKL 2XTSA 3SDCD 1DBBL 2AABH 1WICA 3MRQA 4U5YA 4IOSD 4ESKA 2YK1H 4JHWH 3QG6B 3L3DB 4GRMA 4WI0B 2PR4L 1JNLH 3U0PA 1A7PL 3ZUNC 4H8WH 5ITFA 1D5IL 4S11A 3HNTL 4PV8A 1DJYA 4YAQA 2F7QA 3O6ML 4PTTB 4I9WE 3D39D 4XODA 4L5FL 4P9ML 3OPUA 3FQYA 3PNRB 4UFXA 2VJ0A 3DHUA 5DRXA 4Y89A 2AJ6A 2ESVB 3U6XA 1OGTA 5LGYA 1CUOA 3AXLB 5KSBB 4IK6A 5DA4A 12E8H 1FNGA 1BZQK 1MAJA 1RMFL 3PABB 1T21B 2OMVA 3H9YA 3QG7L 1DJHA 2Y5QA 5T1LB 3ELAT 4ZY2A 1K85A 2BZDA 2D4PA 4G72B 4LEEA 1AGEA 2Q7YA 2WNXA 5IK3B 2CIKA 7FABH 2Z8WC 5HHXL 3FX6A 2KQNA 2AXHA 2BK8A 2R69H 1A3ZA 3OM3B 2IXQB 4XZUA 3MOQA 4A31A 5DHEA 4PRID 5F0LB 1NKRA 3MV9A 5BQ7B 1G7IA 3C5JB 4LARH 4ONUA 3LPOA 4IRJC 3II2A 1UH2A 3DVGB 5GGUB 5JO5B 1PG7X 5PAZA 4UT9A 3AS0A 4I5BA 3KPTA 2AC0A 2VGLM 5D1ZC 3T0ED 4I4WB 3K5RA 2O30A 4X5XB 2VNCA 3O6FC 1ZLHA 3U83A 4X5XA 3V8IA 3RIKA 2AW2A 1MPAH 2WZ5A 4DP6X 3VFRA 2PVWA 1FZOA 1AZVA 4P23D 2Y4SA 3UBXB 4AEIL 5J4MA 2J43A 2M83A 4ZFOB 5EO1B 4ZX6A 1I8MB 2ICWJ 3QJSB 4X0KA 3RY6A 5EO1A 1GOHA 5C0AA 1IU8A 1YN7B 2YEQA 4L4VE 4JQVC 4HMCA 2X89D 4QVTA 3QIUB 1O0VA 5CSGA 2F54B 1HDUA 4NOFA 4AQ1C 3OBAA 3QE5A 4H8WC 1QEWA 3P4MB 2JB6A 2X4OB 5K39A 3OQRA 4FE9A 1V0CA 2F61A 1W72H 2CXKA 1CGVA 4CSTA 1KJ3L