1QMUA

Duck carboxypeptidase d domain ii
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carboxypeptidase
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
publication title Crystal Structure of Avian Carboxypeptidase D Domain II : A Prototype for the Regulatory Metallocarboxypeptidase Subfamily
pubmed doi rcsb
source organism Lophonetta specularioides
total genus 138
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1qmuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qmuA01
4P45A 2F8HA 3SJEA 2EWBA 3IO1A 3SJXA 1CBXA 4MHYA 3VH9A 1YLOA 3PBBA 3D7HA 3ISZA 2AFOA 1ZLHA 2HC9A 3H8FA 1F2PA 4AXVA 2QJ8A 1ZG7A 3DGVA 4MCSA 1YSJA 1Y7EA 2ZENA 5DS0A 4ONWA 1CX8A 1CG2A 1VHOA 3D4UA 3HN5A 4Z65A 4UF4A 4P44A 1OBRA 1ARLA 4NJQA 4OC4A 2XEIA 2PJAA 4W9YA 1JQGA 3FJUA 2PJCA 3SI0A 4IHMA 3GB0A 1Q7LA 2GREA 4OC5A 5AQ0A 1XMBA 2NYQA 5CBMA 1Y0YA 2PCUA 3KQXA 4UEEA 3KI9A 3L2NA 4NGMA 4MHNA 2V8HA 3LMSA 2FVGA 4NGRA 2GLFA 5K8NA 3B35A 5HXDA 4WI0B 4Q7AA 4EIUA 4KSIA 3S9LA 4G1PA 3FX6A 1QMUA 2OR4A 4EFDA 4ZI6A 3IEHA 1VHEA 1QQ9A 4PXDA 4R76A 3K2KA 2BCOA 4WWVA 4FXTA 2AFWA 5G5DB 3B2YA 2ABZA 4NFRA 3SI2A 3NA6A 1ELLP 4A94A 3KASA 3D7GA 4DYOA 1R43A 4ZX8A 3PBEA 1BLLE 1XRYA 1Z8LA 3NFZA 4WJBA 2AFUA 3BI1A 1CPSA 5HVHA 1HDQA 2IQ6A 1PYTB 2V8VA 3HLPA 4B6ZA 5I4MA 6CPAA 1LOKA 3KHZA 4GM5A 1TF8A 3FF3A 4RUHA 2PJBA 3NJVA 2F7VA 4FL4C 2J9AA 2ZEPA 3WC6A 5LRKA 4F8ZA 4EWTA 2PJ2A 4IYKA 2IJZA 4P4DA 1TKJA 2CTBA 1XFOA 4A37A 2AFSA 5HVFA 4P4BA 3PRTA 2PJ3A 4FAIA 1ARMA 2PJ6A 4MCPA 2O4HA 3FECA 1HDUA 4FBEA 2ZOGA 2NSMA 3CPAA 3VATA 2XHNA 3FEDA 4F9VA 3N5FA 1M4LA 2ZEMA 3BXMA 2O53A 2PIYA 2XEFA 3D7DA 3B3WA 1LANA 2XEGA 4P4EA 2DEAA 3T8WA 5LYFA 4ZY2A 2PJ5A 4ZY1A 2VL1A 4F9UA 1TKHA 5LYIA 8CPAA 2BO9A 3FH4A 4OC0A 4P6YA 3IFEA 2ZEFA 2ANPA 3WT4A 4PXEA 2JEWA 3RBUA 1Z5RA 4MCQA 3V38A 2PJ9A 1Y0RA 3V7ZA 4BD9A 4X3RA 3BI0A 2Q43A 4A39A 1ZG8A 4ZX9A 4UIBA 1LFWA 4MXUA 4DUKA 5LRJA 3B3CA 4P10A 1IGBA 3MRUA 4R8FA 3VARA 1ZG9A 3KQZA 3D7FA 4UIAA 5D8NA 5THWA 3RAMA 1UWYA 1BPMA 3PFEA 3D68A 3NH5A 2B59B 3ISXA 2EK8A 3H8EA 5K8OA 2RFHA 4NGNA 4OC2A 2XEJA 2EK9A 3PB9X 4R7MA 4OC1A 4YWYA 2V8GA 3KGQA 2PRQA 5ELYA 4MMOA 5J1QA 4LQGA 1CPXA 2PJ4A 2C6GA 1F57A 4MHPA 4OKOA 2WYRA 5D29A 5JGFA 3IIBA 4PXCA 5JH9A 1BAVA 3TC8A 5F09A 3NH4A 4NGTA 1CP6A 1VIXA 4MRIA 1GYTA 2Q51A 3KR4A 1KWMA 2QYVA 4OIWA 4OP4A 3E8VA 1FT7A 2JBJA 4P4FA 2OOTA 2IMOA 3NH8A 4X2TA 5K8MA 2G9DA 4EMEA 3IWWA 4JYWA 2PVVA 1RTQA 2JBKA 3KHXA 3D66A 4NGSA 4YOKA 3SJFA 5LYDA 1LAMA 1ZLIA 2RB7A 4H2KA 1Z2LA 3K9TA 2ZEDA 1NKGA 3KZWA 4TNUA 2AFXA 2PIZA 4A38A 4PPZA 3PFOA 4MHZA 2ZEHA 1PCAA 3B3SA 3GLJA 3JRUA 2PE3A 3DLJA 3FEEA 3QNVA 4PXBA 1IY7A 4PQAA 1LCPA 1R3NA 4DJLA 2ZOFA 4NGQA 4FWUA 4P4JA 3PB8X 3CDXA 3TX8A 2HB6A 3S9NA 3IJ3A 5K8PA 4NJRA 3LWUA 4CPAA 2PJ8A 3G3LA 3CPXA 1TKFA 1YMEA 1VGYA 2PJ1A 5K39B 3CT9A 1NSAA 2AFZA 3WC5A 2GLJA 1EE3P 2ZELA 2QVPA 2BOAA 1DTDA 2PJ7A 1TF9A 1AMPA 3MN8A 4OMEA 4MCRA 4ZY0A 4IK2A 4OC3A 3HUVA 1FNOA 1XJOA 3B3VA 7CPAA 2AFMA 3FVLA 3S9MA 1CP7A 1TXRA 4JZ0A 1YW4A 3KL9A 1XBUA 4FUUA 4IAVA 1AYEA 5CPAA 2C1CA 4ZYQA 3D67A 2PVWA 2C6PA 1DE4C 3IC1A 3WC7A 3B3TA 1ELMP 2CIJA 2CF4A 5HVGA 2CTCA 1H8LA 2V8DA 3B7IA 2WZNA 3KR5A 4TWEA 4OIDA 2ZEGA 2POKA 3PB6X 2V77A 3SI1A 2PJ0A 3RZAA 3SJGA 2I3CA 4UEFA 1YW6A 4P4IA 4O23A 1LAPA 4R6TA 3GUXA 3NJXA 5IB9A 4UEZA 3PB4X 2GU2A 1BPNA 3PEIA 1HEEA 3BHXA 2ZEEA 5LRGA 5JM6A 2C6CA 2ZEOA 3PB7X 3I1UA 4U3SB 1F2OA 5LYLA 4YU9A 3KCPA 2Q4ZA 4X8IA 4NGPA 3FMCA 4K3NA 3WABA 3H8GA
chains in the Genus database with same CATH superfamily
4WHYG 3GSXA 2ZUUA 2LV4A 4GIOA 4LCWE 4XXDB 2C1PB 1MCBA 1PVHA 1YYML 5HJ3A 4QRTB 3O9WA 5DO8A 3LVTA 2ZOTA 5F9JB 3ATBA 1GHFH 5JIIA 1KN4H 1R5VB 3FHQA 4K15A 1YLOA 3ISWA 1LK3H 2OTUB 4AGLA 3RVXD 3BW9A 4PJ5B 4LE8A 4L3CB 3MBEC 5TE4H 2Y6SD 4ZMWA 1XHHA 3V8CA 2YPVL 2WLJA 5ETUA 4F33B 4NKIL 2VN5A 2O1AA 2I9LA 5KSVA 5L8LB 5TD4A 1MHPH 3HJEA 5CZKA 1J9SA 1Q0YH 3ARFC 5FO9B 4PRIB 2VDML 4Z18A 3THMH 2AXWA 3QNYA 5D7LA 3FJUA 3SI0A 4MNQB 3WIFB 4K9EC 2QELA 1VIWA 2VDNH 3IDXL 4QTHA 3K71A 2H26A 2XY1A 1WWZA 3PDGA 4IU2B 4P5KA 1ZWIA 4IOIB 2BLFA 4KJPD 2ZYSA 5AL8A 4O58L 3HHSA 3ATAA 4FA7B 5LAXA 3OXRA 4NQCE 1D5IH 1C8QA 1SF5A 1P4IH 1KPUB 3JVNA 3FB5A 5J11C 2NNRA 2JJWA 1L6PA 1I9RL 3DO4A 3FU6A 2JB6B 3MV7B 3U2JA 4DN4L 4EOWH 3BZEB 5I1JH 4R26H 1XE4A 3PJSA 2FVGA 3WV0A 3IPFA 4R0LA 3PIQA 1XO8A 1QQDB 2REFA 5HVHB 4N2AA 2ADJA 4EVNB 1MHEA 2BP3A 3DVFA 2K78A 3O8XB 4V2BA 4BFNA 3WTTA 4M7JL 3NIGF 3G08B 1OF2A 2WVUA 5MENB 2BOLA 2P43B 3NEXA 4KOWA 2R4SH 3QUXD 5E99L 5AKSA 3SXNA 3FU5A 4UT9H 4H8HA 2BY1A 5JOFA 4KKNA 1T20A 1FCGA 4NO5A 1GA2A 3E38A 3L95B 3O4LB 5EB9A 1T1WA 2Y25A 3W56A 2VN3A 3BUBA 1A7RH 1EQWA 1ND0B 4FI8A 5I1LB 3KPPB 2DWYA 4KKQA 4OM1L 4AT6A 1HHHA 5M94B 5EPMB 3EDFA 3U4KA 5T1LD 1O6SB 4U6HA 1N18A 3IXTB 3N0AA 3QXAB 3NIGE 3RY6C 4OLXH 5D1ZC 3CFKA 1FFPB 1N68A 2YRPA 4RFOL 3UP1A 3TO4A 3B2YA 2GITB 4JFHD 1K3ZA 5EH1A 1V5JA 3U83A 1ZHKB 4PSWA 4KK5D 4IBVA 2VDRB 2F58L 3BH9A 1QHPA 3L9YA 3QJTB 4FFTA 3FB6B 4G7YH 4ODSL 2FT0A 5ICXA 2F74A 1AKJA 1B9ZA 1CXFA 3IN0A 3V4PH 4FS0A 4M6AA 4FN0A 3FOMB 4OFQA 1QVOB 4KJQD 2EDHA 3BFWA 3G5ZA 2Y4SA 2PXYC 4KMQA 5BUAA 3CFUA 5IBTL 1L9PA 4IRJB 4N0YH 3PY9A 1L6XA 5DEGA 5KZCB 1J0YA 1HC1A 2ADIB 3FH5A 5D7SL 1MCDA 2OMTB 1W0WA 3IMSA 1Q2YA 2H2PC 4IJ3C 3V55A 5KS9A 4UM8B 2XTJE 3QGVA 4PP2B 1J10A 1E28A 1T04A 3FTVA 1XF5B 5I15L 1QBLH 3EJZC 5GRVL 3WJMB 3FOLA 2A2QT 4Y5XC 1WC7A 2FEJA 4LSTH 1TF8A 3FF3A 1OGAD 1DE4A 2V2XB 3VFNA 1YDPB 4F7CA 3WE6B 4XXCA 3RB7A 1OCWL 1WFMA 3C2AH 3OKMA 1PZBA 1NOAA 3RDTD 3CFMA 3QQNA 1E4KC 4N2FA 5INDA 4AMXA 3R06A 5ESQB 3WLWD 1KULA 4DGWC 1TKJA 2CTBA 1KV3A 5HVFA 4MD5A 4CVZA 4J8RA 3BZFA 3BKJL 4LSSL 4RBPK 3APCA 2XTLA 4I2XA 5IJDC 5D4JA 5ID1A 3LY6A 1L7TH 2KPNA 2X1PA 1TMQA 1LTXA 4L8DB 3ZDXB 4X4KA 5EC2A 4ZS6C 3MRHA 3Q2NA 5A6MA 4L9LA 3PPSA 3VATA 2I00A 1FYTB 4OZGB 2B14A 3EFDH 4K73A 4G2AA 3DJZA 2IWGA 4ZUSA 3GJFH 4DQOH 1W6LA 2ZEMA 4KGLA 3OWEA 2G5BB 1UD3A 2YOAA 5EZIH 2FWOB 2EH8L 1IC5L 3UFIA 1AD9B 1HT6A 5T8IA 2UZXA 2E27H 4M03A 1BJ1J 1YEHL 2R1YB 2IFGA 3BMWA 1LANA 1LO4L 2LOEA 3CDFA 3MVSA 4DFHA 2CHNA 1ZSDB 2QR0A 2FSDA 4KKPA 5GS3A 4JW3A 4NZDA 2CALA 4JO1H 1UWGH 3QO0B 4O2FA 5D1QC 4LP4A 3KPLB 1WJ3A 4OIIH 5AAPA 3QFDA 4UINL 5EU3A 2V3DA 5L6YH 1A4BA 1OL0A 4OLLA 1NAML 2GVYA 5LN4A 3ETBJ 3QUHA 2YNCC 2Z65C 2Z9TA 3ARDA 4HLZH 4JGJA 3L17A 4CU6A 4GAYA 3N91A 1P84K 2BNQD 3FQNA 1RHHA 4P2OD 4RETB 1HHJA 2X6CA 2J4WL 4MCZB 3SKOB 5E6YA 3PWJA 3ZL4H 4A39A 1RIVH 4HJ1A 3WE1A 4XNMB 3VSVA 4BK5C 4Z95L 3MLXL 1D5RA 4OLWL 3EYQC 5BRZD 4UYQA 3L5HA 1IM3D 2X9YA 4N25A 3MRUA 5T1DH 1KZQA 1CI5A 3CHRA 2X3AA 1ZD6A 5CBEA 2JIXA 3FQ1A 4IKIA 1X4XA 4OV5B 3QNXA 3KE0A 4E0RA 3WEAA 2VUKA 7FABH 1R3HA 1A6TA 1CGUA 3RVXC 1MXGA 1M7IA 3PJLA 4MD4B 1JWSA 2Y6SC 4P2CG 2QLVB 1I8MA 3RIAK 4KJYB 2QDWA 3UPRB 4KOYA 3ARBD 2Y5TA 1QLEL 4N1EA 2OYKA 4C57C 4CVXA 1XT5A 1VZGA 4LP8A 5DMIH 1P5VA 2ETWA 5ELYA 4Q89A 1M4GA 4AG7A 3UTPE 1MH5B 2Q0ZX 1JD7A 3T04D 1WT5C 3FFOA 3E3QC 1S5IL 1A4AA 3VI3F 1IEAA 3EYUH 2V17H 4MZ3A 4CGLA 1AANA 1RK7A 2H32H 2X1XR 5CO1A 2OV0A 3RWEA 5BXFB 2AJXL 3TE4A 3SYCA 4LSQH 1G7PB 4KJPC 4HOWA 1OAJA 3FBQA 5EU5A 1MWAA 5JH9A 3AAZB 4JFQB 4UCPA 3PWVB 4MFHA 3TBYB 2CRIA 2SEBB 3IEAA 5JNYB 4AYDC 4JM4L 5SWSD 4IKJA 5DJYB 4P57B 5I28A 1XF3B 1XR9A 2BIQA 3S4SA 2NPLX 3O3BB 3QJQB 4Y19D 3MXVL 1T5XB 3VI3E 1JYVA 3BWZA 1YSOA 1MIEL 3U36A 2GCYA 4AIXA 1J8HB 4FFVC 4ATWA 2YUZA 4H5SB 1N5AB 3U0TA 1YNKL 3QUXC 4QHKJ 3WJJC 1DQIA 5G20A 2OW7A 2Q7BA 1N64L 1OV8A 3IKKA 4XNQB 4YOKA 1RAMA 2ICWJ 1NKRA 2O5XL 3AACA 3TFKC 1F2XK 3SOBH 3SGJA 3PWNB 4O5LH 4LSVL 2IPTH 4CAVA 4R90L 1QFHA 3GRBA 43C9A 1U2HA 2X0WA 3MGTA 4TNUA 4XO8A 5I0VA 5T3XE 1ZVHA 4A7SA 4G83A 2J73A 4AIOA 4DN3H 5LBSH 4NJAL 1EVUA 2FATH 2E74C 3B3SA 2CIIA 3GNMH 2DXQA 3RL1B 1P7QD 3GS7A 4OLZL 1ZVSA 1NBYA 3VXRA 1MRDH 4LNRB 3UTTE 3VWJB 1YVOA 1P2CA 1L5GB 4P23D 1VDGA 4NHCH 5GPRA 2EXTA 4K7FA 1BZEA 2DM3A 1JK8A 3U30B 2IBBA 1FO0B 5G21A 2ZCLL 3VWKB 3X1FA 2P5ED 1VKXA 2EIBA 4WGVB 1OM9A 1EAOA 1AVAA 4RRPM 3VMOA 1DBJL 2HH0H 5DRXB 3RBGA 5EBVA 4IIQA 1R9FA 5GJSL 4RI1A 4PTUA 3D0VA 3GSNL 1QYGH 1PZDA 2Q6WB 3OAUH 3QCTL 5DEJA 1T7XA 4YPJA 2PJ1A 1ZV2A 3OZ9H 4LLQA 3MBEA 3BWUF 4NC1E 2UY6A 4K8RH 4PV8A 5EIVA 1QSRA 4RRPG 4ZSOA 3WIAA 5INCB 4QRUA 3S37L 5IJVA 1L9RA 1BVOA 4PR5B 2ADGB 2I79A 4KO7A 2G3NA 4NPYA 5HI3C 3S9DB 4N2GA 4GEJA 3LD8C 3HEIB 3MRJB 2NSXA 2PCFA 2EE9A 4G43B 1E65A 2ODHA 3RDTC 4YS4A 5CNPA 1LYQA 4FI7A 1MSPA 4FI6A 4RX4D 1NLDL 5BPPA 2AF2A 4BQ6A 4HS8L 2YFOA 2DIBA 2OI9B 3UAJA 1OOWA 2EKJA 4NI3A 1IOIA 1FVDA 3C08H 5IT2H 2AK4D 3B2PA 3D6GA 2CO6B 1HKLH 2VZVA 2BEIA 4Y9FA 1A7QL 1PD0A 2YK1H 5AW9B 4YSOA 1L9MA 2PCPB 3UMNA 3QCVL 3PABA 4P5MA 3VFGL 4YLQT 1G5AA 4P2RB 2Y6TE 2ZP0T 2C4FT 2XXMB 2ZUXA 2CIJA 1RZKH 3ALXA 5E00B 4QRQB 3B7IA 4QTIL 1AIZA 3GGWB 3BDXA 1L9QA 3C5SA 5DJXB 5FIEA 4B5PB 5IV0A 4JQIA 3CH8A 3F7LA 4PRID 4UOQA 4FQIL 2AXJA 2MWCA 2XJKA 3FN9A 4N0UA 3FTXA 4MNQD 1VRSA 3QRBA 3WYRA 4YDKH 2XWXA 4K3EH 2BSBA 2PPCA 3CMGA 4WW2C 5EF1A 5AWNL 1S60A 3WHE0 5F96H 5EOCH 3RY6A 3C6EA 4JBSA 1CYXA 2DRUA 5HHXL 3KPOA 4JJOA 5C9JA 3L13A 2CHZA 3QJHA 1IGTB 1YY8A 3NIDF 5JM6A 1Y0LB 2ITCA 3DRQB 3OB0H 1BXUA 3MV7D 1G1CA 3IMRA 2V0AA 1OXYA 2QFPA 2RCSL 4RFNC 5BO0D 2UXFA 3F65A 4P2OC 4K3DL 2GEQA 3CN2A 3SSGA 3BDYL 3B8GA 3FMCA 4I3RH 4XZUA 3ELAT 4OM0H 2X4UB 2X1OA 2X2IA 3D9AL 4GUCA 2PXYA 4Y1AA 5J4MA 3ESUF 5MEND 3DUHA 1Z9NA 2X4OB 4KV5F 4X7CC 3IO1A 5CJQL 2CKBL 3DHMA 4N24A 4P5TA 5E08L 5E5RB 3T65B 2JDCA 1A9EB 1KTDA 2N4IA 4Z7VF 2NY5C 3O4LD 3NIDE 1EJFA 2X28A 4OGYH 3WKMH 3ZZIA 1BCIA 2X09A 1ETZB 3CZLA 4QYOB 4HJEA 4YHIA 1FDLH 4FNLL 1U93A 1ILUA 5I8KL 5TF1L 2HFGL 4NQSB 4JM2B 3MROB 3ULUL 4NT6B 1RFDH 3L9RA 4Q9QH 1AO7A 2FK9A 3NG5A 1W8OA 2OMWB 3OQ3B 4RCAA 2NY1C 4L29B 2ZCZA 3S37X 4ZNEA 2CK0H 4KV5E 1GS6X 5IMOB 3QRGH 1GPOH 1UCBL 1JZ2A 2UZYA 3ARBC 4U1KA 4U2YA 3RWFB 4FG2A 2NY7H 1XZ0A 4O9HH 5L0QC 4Z7VE 4CU8A 2ZUQC 3U0WL 4E42B 2XYCA 3SE8L 3UADA 4BUQA 5M95B 1R24B 3EYSH 2AXGB 1MHHB 1MCEA 4Y4KA 5E5MA 3JTBA 2Z3KA 1HEZB 1KJMB 2LT9A 1F11B 3GB7A 2VRKA 5C09E 2PCUA 2WXFA 4J6RL 3S6FA 4Y49C 2YAOA 4EI0A 3L2NA 4NGMA 4UFXA 1SBSH 3LEYL 4IRJD 2YQGA 3RPKA 2HT4D 5HPMB 5KZCD 3NGBC 2J1WA 1AZVA 4QHUB 2JLPA 4E9RA 1N5YL 1CC3A 4PJ9A 1AGCA 4HWEH 5DVNA 3N42F 3U4BL 3DI2B 1U8OA 5IEKB 5BS0E 5K69A 1I8LC 4P2QB 5IESL 1KXVC 4NZRH 3BP5B 4J3OG 5E8PA 2OR4A 1KN4L 3K1KC 4GIAA 1LK3L 1IQWL 2EDRA 1KBBA 5TPWL 5TE4L 3AWFA 3O3DB 1WIPA 4MA1C 2NNXA 2MKWA 2R69H 1JCVA 1KJVB 1QX1A 1DBAH 3STLB 1K4JA 1UD2A 1BV8A 1URIA 1VACB 4H8WH 5KYUA 5HHOE 4TV3A 1Q0YL 1WA0X 3O3EB 3DX7A 4LPUA 2GC4C 4WFGE 5I17B 1T0OA 1FNGA 3H4FA 5GQBA 1ETJA 2A74C 3CN3A 3THML 2MQCA 3DGGA 4JRXA 2Y07H 2X7BA 1EH9A 2VDNL 1T66D 4FG4A 3P0VH 4PRBA 4C68A 4BA8A 2C7UB 5DFWH 4BRVA 4FA6A 3C12A 1OY3B 1HFUA 5IWLC 1BLLE 3K4ZA 2YAEA 3T6QC 1INDL 3HZKA 3VYNA 4P23C 3T5WA 3S3DB 2HN7A 1P4IL 1QO3B 3HPLA 4M6NH 4EOWL 2NY6B 1SJVA 1KCUL 5FDYA 1RY7B 3QEGH 4A67A 1WFNA 3OAZK 4OSUH 4R26L 5I1JL 1UHVA 1TUPA 2I7SA 4R87A 2KMWA 1YQEA 1DANU 3JVGA 4NO0B 4OZHF 5D6DC 2MH4A 3V6BR 5FM4A 4U1IA 2C3GA 1E9QA 4OGQC 4QTFA 4U1SB 5D1XB 1ZT7B 2R4SL 4AI7A 2XY2A 4IBQA 4KO6A 4PRPE 4V1DD 5A1AA 1DVFB 1MEXH 1YMMA 4UT9L 1J86A 4KK6C 3HBPA 4ZUUA 2X3BA 1EWHA 4UT6A 1Q9LB 1RPQA 5E6IB 3SO3B 4A7GA 1CD8A 3GUFA 4JHUA 1TKWA 2F1AA 1EAPB 1U3HB 4H1LG 1TMCB 4YUEH 4L5FE 1A7RL 1QSZA 1DVQA 2VZZA 1FAIH 3SQOH 1SDDA 1KLUB 1AS7A 1HK6A 3MHZA 3F85A 3LS5H 2P5PA 4OZHE 4M6IA 1QR4A 4D94A 4ZMXA 1OAXH 1A6VH 4OLXL 3HPJB 2EECA 5KAQG 1JYNA 1QNZH 5E5LA 2VM9A 2E9IA 1V7ML 1HIML 1AQKH 1Q0XL 1C08A 3IMVA 3MNZA 4B27A 1MJJB 3P69A 4Z7UB 4NC2B 5H84A 4HUXB 2XV0A 3QQXA 2JB5H 2VL5B 5CR8A 3ZTDC 3V4PL 5DZ9A 3F05A 5JQ4A 2YPKB 4L1TA 3S98A 1YHPA 4J3GA 4HFUL 4TSBH 3TA4D 1ZDQA 3EBGA 3CX5K 4YO0A 2XKNA 2G2RB 1QABA 3SZ6A 4ZMYA 4N20A 2QEJA 3QUXA 4YZWA 1RZQA 3L3HA 1J8SA 4P07A 2DTML 3LDBC 4P4EA 3GEWB 3JV4B 3NJGA 5JYMA 4L0ZA 2AKRB 4I5BA 1A66A 3L5WA 1PCSA 1PU9A 1QBBA 4LSTL 5ESAA 2FO8A 5LGJB 1HDMB 2E6QA 2ZAIA 1S6NA 4EAEA 3O2WH 1ROCA 2JMRA 3LMJL 2O6DA 5KOVC 4ZW6A 1EHAA 5T1LA 1RUPH 2PTTB 1FL6A 5LGKA 4PV9B 2FZ3B 2NOYA 2V5RA 3UC0H 4X3RA 1R6VA 4ZO8A 2NXZB 4NF1A 2QQKH 2YAHA 3V4VA 5E8OB 4AE0A 4IEFA 4QJ5B 3MCLL 4RWHA 3SGKC 1IGMH 4F37F 4D9LH 1QP1A 4GG8A 5DD5L 1FBIL 1PNDA 3QUMB 4UBRA 2VMFA 4MDRA 1BVNT 1D7BA 3MODH 5HVHC 5K1VA 4MY0A 3GXMA 3A6CL 3O8XC 4AKPA 1M9SA 5EWIH 1SZNA 1PJWA 4XNAA 4NN5B 4NKOA 1S9VB 3TOAA 3U2IA 1T7YA 2P9RA 4P3WA 1Z0NA 4UIAA 4DQOL 4KXAA 2NLJB 3PWUB 1SXZA 5DI8A 2G9HB 2FRGP 4F7MB 5EZIL 2Z93B 5IFJB 4UT7H 3FO9A 4NZUH 4BKLA 3CVHH 4JFPB 2E27L 4OH2A 4P99A 5IQ9A 1IAIM 2BOCB 4HPOH 3QDMD 1JZGA 2IV8A 4X6DF 1ASPA 3SYAA 5D4HA 2GT9A 2ZUYA 4N86A 1TU2A 5A2IH 2OZ4H 4AQ1B 3IDIA 3TNNB 1OGAA 1IJNA 3L45A 1NICA 3VSTA 3ARRA 2VERA 3AQZA 3ENEA 2AV7A 3RDTA 5AL0A 2FL5B 4OIIL 5HDQL 3F0AA 3HKZA 4WZ9A 3QFJB 3QVAA 3AVEA 4XHJD 3VWJD 3ZO0A 5L6YL 1XCQA 4G1MB 4C56E 3FH8A 5ERWA 2X05A 3VWKD 3MLTB 1NGXB 3N06B 3KNBB 3V7AG 5CJXC 1EJOH 2XUWA 4X6DE 4K5MA 4QCIA 1INQA 3GMOB 3SBWA 3I6LE 3TC8A 5GJTH 4M61B 2V7HB 4XWOD 1I53A 4Q6IA 4F2MB 3ZL4L 2JWYA 4MXVF 4UOZA 4HK0A 1D2PA 1KB9K 4IRJC 5JXEC 2R7EA 1S7SA 3A0OA 1CQKA 3MOAH 4QRAA 4DEPB 2HT4C 4WRLA 5KJ7E 4A04A 4QI3A 1ADQH 4L8CA 5IBUB 1EO8L 1FT7A 1TIUA 5BCAA 2OMNA 1JD9A 5T1DL 3WG7B 3KDPB 2O30A 1IC4L 4AK1A 3SDXA 2AQ1A 1I7UB 1OE2A 4MNGB 3H42H 4KH9A 3W0WE 5FW6A 4XBEH 3RIKA 4ZQTA 5IHZA 5HDWA 4DP8X 1RTQA 2B5GA 1R1CA 1YNTA 2EXWD 4JLRA 1JF1A 1XEUA 2EEXA 2X7LA 3S2CA 4XP5H 1AMXA 4YGAB 4MJIE 5KVEE 4MXVE 5I9QB 5HGHA 4WW2A 3CFBB 3ABKB 3NCJL 4BELD 1KB5H 3ZYJA 4FHKA 3DJRA 4S1RL 3SPIA 5D7IE 3ZZQA 4RDQG 1AR1D 4NENA 1NA8A 2DQGH 1O9WA 3FT3B 4G6FB 4KNUA 4L23A 4TQ8A 4J2QA 2YAFA 1G7HB 4B9ZA 4MAUH 3BUYA 1CK0H 2X40A 5DVLA 2CR6A 1UKTA 1MRFH 2HKFH 3QARA 3EYUL 4KDVA 1XCTB 4PG2C 4XE5B 1AP2B 5B39A 1E90A 4P2RD 3NCYS 1QKZL 3DX3A 1YLBB 4LSQL 2CA4A 3KXFB 5JPHA 3MGAA 3WEOA 3TX8A 5D5MA 1HH6B 5GGQH 3NDYE 3SGDI 3D06A 4RA0C 4D0CB 3MFGB 4WKZB 4G8FA 4BBWA 4BZ1L 5I6MA 1G9MH 2VLMD 1AQDB 1FLRL 5BRZA 3MJ9H 3P2FA 1IM3A 2MCPL 1Q9OB 2WCGA 4JY4A 2ZWYA 3LEXB 1VGYA 2ZKXA 4KOBA 2NMTA 1LP9A 1CDYA 4B50A 2GLJA 3SJVE 1G7QA 4L3EB 3RUGF 1OANA 1XR8A 1NUNB 4ZK8A 4NNYB 3GZPA 4E9LA 1U91B 5FV2A 5J56B 3EGDA 4WUUE 2QSCH 4B9CA 3WNJA 3O45A 3SOBL 2IDCA 3JZ7A 4O5LL 3ARBA 3HUVA 2ATKB 2ESVE 1WZKA 3B3IA 2WAHA 2JTDA 1WV7T 4AVBA 1YG9A 2MNUA 1PF3A 1KUYA 5CCHE 1U8IB 4PS7A 1KGCE 2VR5A 4HJGA 1IGJB 4X6FA 1VEPA 5CCJA 1YEFL 4I48B 4DN3L 5D2NA 5LBSL 2QTEA 2C1CA 1DSFH 3KW8A 4Y9GA 2FATL 1PBYA 4X5WA 3QJOA 4K07A 5HHNB 3SKMA 4F91B 1UOLA 3RUGE 3GNML 3WEMA 2CSPA 5KBNC 3SKJL 3IETA 2HFTA 1BO4A 4PGBA 1J5DA 1I8UA 1MRDL 1LEGB 3A4EA 5CJOH 1XGPB 2K1MA 4BGLA 3D12B 2JKTM 2O6PA 3FAWA 2BWIA 2X4PB 3WO3B 5C7XL 4X0KA 1W0YT 3F6LA 2CF4A 5FKAA 3DV4B 2JLLA 4LBAA 5SWSA 3VGBA 1H8LA 5L2JB 1ZHBA 2R56H 2HH0L 3C09B 3DPBA 2QIRA 3H54A 1NUGA 4MMYB 3QUZB 5DJ6B 1I8LA 4TWEA 3I85A 4JM2D 4Y19A 5FOBB 5H2BA 4E36A 4L3FA 4LSUH 2FWUA 4QRPE 5HPOA 3IYLW 4G5ZH 2GJRA 4MYPA 4XN4A 2MQ3A 1UXSB 2XIDA 3LNFA 4X7SH 1G87A 4K8RL 4NP4H 5IM7B 2NQCA 4NYLA 5EN2A 3M88A 3V5DA 5E4AA 5E4EB 3PHOB 2GU2A 1CLYH 4TOYL 1NCIA 2F7QA 3OKLB 2XPGA 3FUMA 1TTRA 3KPRD 2WLKA 2XQYG 3NPZB 4G9DA 4FKEA 3BIKA 3B56A 3GHPA 4G8EA 1FN4B 5CGMA 3BYTA 3MV8B 3PU7A 5JHDE 2J8HA 5AG8A 1BM3H 1KXHA 2VEZA 3PAUA 1PDKB 5I1GL 1DVZA 5C0GA 3MOQA 5I6XB 1P7QA 4GP5B 3VXSB 1SEBB 2WK2A 5DTFA 3UEQA 1BVLA 5GZND 4B3VA 1EEYB 2ZOOA 4ODUB 1LEIA 5DC0A 1IVTA 3C08L 5IT2L 4BQ8A 1PGRB 4P23A 1HKLL 2BIMA 2K6YA 2W8CA 5DCCA 4R96A 3FTZA 1T22A 2EIEA 4RAUA 4J3OF 4W9EC 2YK1L 3VFPB 2P5EA 1QLEB 4P2QD 1BD2B 3RLSA 2B8OT 5BVJA 1UOVA 4W9ZA 2E7MA 5D6DA 4AL8C 2YSTA 5CUSH 4CDHA 2A4NA 3BDBA 5EUOA 2AFOA 4NN7B 2RQ8A 3S34H 1P53A 1NTDA 1QWHA 2EO1A 4F5CA 3DGVA 2J7LA 1EIBA 4UWJA 2ZT9C 1MFEH 3MRIA 1PQZA 3HN5A 1N9PA 4WY7H 1J5IA 2FJUB 3BPCB 2FECI 2ILLA 2W38A 4LGSB 3OLGA 5TK2A 4FFYA 3K2IA 1PUAA 1TEGA 1PIGA 4AYMC 5KJRH 1UA7A 4Z77B 8FABB 4E41E 3EOAB 4YDKL 2RA1A 1S8DB 2CHDA 2BRQA 4ZFOL 3H3BC 3TV3L 5EOCL 1AC0A 3EGXB 3QZLA 3WS3B 3ME0A 5CBMA 2BXYA 2NRDA 3MRGA 4XHJC 3SPVA 4RX4A 3VWJC 3H55A 4UZUA 1HOCA 5I66A 2HRPH 3MLZH 4PV6A 3U30C 2NY6D 4RMVA 4LEXL 1WA2X 3VWKC 1UFHA 3SQBA 2V8HA 2EDXA 4FXKB 1YEDA 5DHYA 2AK4A 2PPEA 2HAZA 4XXDA 5D7HA 4NO0D 2C1PA 4GJTB 4KTDL 4I3RL 4XN1A 1SJMA 4XWOC 1XH1A 5KVDE 2I85A 5F9JA 5EZOH 1R5VA 4WI9A 4TYUA 5D1XD 4KOXA 1F4HA 4XO5A 2OTUA 5F9AC 4LPWA 1TTUA 1E4WH 2QQQA 3EIFA 2ZWSA 4PHXA 4U49A 3VG9B 1HNYA 5IJCC 4NSQA 5H4YA 3R96A 2OCFD 4KRNA 5E6ID 3DSFH 4F2EA 2WXKA 3CLEH 4UIMB 4G8GB 4N2LA 3G5YB 3L3GB 3TURA 1NDMA 3GI9H 3F83A 2NUPB 5FYLD 3VFMA 2GAZB 4DT2A 4B7LA 2OL3H 3TA3B 1HEHC 4PY7B 2EXWC 4CVWA 1RFDL 4PJ8B 3JXAA 2M83A 4MNQA 2VAAB 3WIFA 3AY4C 2CK0L 2NMSA 3F2LA 1XSOA 2OJ1A 1GPOL 3QRGL 4TLTA 4XCYB 5AVTB 2VQYA 4IOIA 1JGDB 3ECBB 4PWIA 2E47A 2OI9C 4HBQA 4O9HL 3GSNB 5HY9A 4PCSA 1J48A 5TDPB 3EYSL 3CDYA 5FOJA 4G72B 1A9BB 1KPUA 5DD1H 5DUPH 1LO3H 5I6NA 3MV7A 3GS0A 4LZKA 4LCVA 3SGKA 1JGEB 1PEWA 4HJTA 4HKZA 3DXAD 1QQDA 2BSED 1MJ7H 5HVHA 2WXMA 3Q0HA 1HDQA 1NEZB 1OTTD 3N44F 1SBSL 4DOHE 3IJSA 3IRPX 3VNYA 3G08A 1B90A 1N3NB 5MENA 4ZG1A 4G6JL 1X6LA 1G9EA 3ULVD 1DQJB 3I6GB 4HWEL 4XPGH 3CSYB 1L9OA 3KWXA 4Z7OF 3O4LA 2FEDD 2WWKO 4LX9A 5I6KA 4WEEA 4JFDB 1ND0A 1KYOK 2N3JA 2VXUH 3KPPA 4WO0A 1FZMA 3O3AA 3W81A 2ZEPA 2X87A 1O6SA 1IFHH 3INOA 4JHAH 2Y24A 4XN7A 3QXAA 1VFBB 2M2DA 1UB6B 1FFPA 4PGEB 2Y7OA 2Z11A 1F00I 2GITA 1DBAL 4BWUA 3CSPA 4P4DA 4H8WL 2WQRA 5DFVD 1ZHKA 3A4AA 4NC0B 4PI2A 3B9KC 3PRTA 4Z7OE 4K9JA 3WKNA 3VFVB 1F97A 2GC7C 1JUFB 3AFLA 3OSVA 4KTEH 4FAIA 1OD9A 2YGVA 4W4NA 4GG6B 3FOMA 2FIKB 4FBEA 2ENSA 4N2CA 3CPAA 1TVBB 2IH3B 1RK0B 4GH7B 5K59F 1E5CA 4PV1C 3RFZB 3FEDA 1HQRB 1U0QA 3E9UA 3MX0A 4TUJA 3GBMH 1HN1A 4IRJA 3BE1H 1SOSA 1L0PA 4M6NL 3E6FA 3QEGL 1YPZF 3CMOL 3F6JA 5DZVA 3X3FH 1W72H 3L81A 4M9PA 1CDHA 4PP2A 1I1AA 4DEWA 4L4VE 1B3IA 3ZJ0A 4WEUD 5SWZB 1TCRA 3RILA 3RA7L 2H0JA 3T71A 1J5OH 3WJMA 3PE9A 1LNUA 3C6SB 3FO0H 4JM2C 4YQXL 4RWYL 1JZHA 1YDPA 3VO0A 4PK3A 1JV2A 3WE6A 4JZOA 4BFIB 5K59E 5JHBA 4UDUB 2WJ7A 4HETA 1M05B 1DQML 5CZVL 5IB2B 1JCKA 4AEFA 3QFJD 1RZFL 4PY8J 2R39A 1EO7A 3WT4A 5ESQA 3D33A 5AVSB 2QHRH 2X4TA 1M2VB 3UBXB 4YUEL 5AB9A 4HIJB 4LUAA 1DFXA 4MCYA 3O11A 1YPZE 2IPKA 1MJAA 2CKBB 1VA9A 3QDGB 3SQOL 4KX8A 1R34A 3LS5L 1IGIH 2P47B 2DYSB 1OAXL 4HXBL 1A6VL 3SHPA 4PG2A 4XCEB 1VAHA 2D3NA 2YD5A 1UADC 4LCCB 1QNZL 5B1BB 4EQ2A 1ZG8A 4OZGA 4GYBA 1V54B 1TJMA 5MP6H 4Q56A 1AQKL 3IWVA 2VLLB 5DQ9B 1CU4L 1U8PB 1ZSHA 2H7WA 3FO1A 2Y69B 3ZT5A 1MW0A 4YAQB 4AUUA 1RZIB 3DDGA 2G5BA 2JB5L 5DMGD 3W82A 4UOJA 2EVHA 4L0PB 2OXHB 2FWOA 1A7NH 5BZWB 4YEEA 2R1YA 3RWHB 1KIPA 4CKQA 4TSBL 4WFHE 4XVSH 1IL1A 1P4NA 1GZHA 3KG5A 1ZSDA 1B2WH 3FNKA 2N7AA 2KCWA 3QO0A 4V1DA 1RJLA 3K46A 5M7QA 3IU4H 2NZ9D 2K6ZA 2E4TA 3KPLA 4BGDA 1S7NA 3QW9A 1C8PA 4LRIA 4YWYA 3T2OA 4GMSH 1CFQA 2YGNA 2V8GA 2LLGA 3QHTC 1U41A 4HA1A 2AC0A 3WHXB 4FNRA 4MMOA 1ZV5A 4X5LA 3BLKA 5GGRA 4UQ2A 1REIA 5EC4A 3O2WL 3SDAB 3B9DA 3SGDH 4DKEL 3ESMA 5FYJU 2BHYA 4MHPA 4QHKI 1DO6A 3KXFD 1A64A 4ZMQA 4MCZA 4U1HB 5FUZL 3SKOA 3TN0B 3HE6B 2Z8RA 1XGZA 3KS0J 4OJAA 3GKRA 2QQKL 2RHEA 3MOBL 4PRDB 4P59H 4RN7A 4XPTH 1ID5I 1TNMA 1KJ2L 4FQCH 3WTUA 5IKCA 4D9LL 4NGTA 2HTLC 1D5BA 3BO8B 5DZAA 1FNAA 4IKNA 2J56A 5CJ8A 1HZKA 3TIEB 4HEPG 4L18A 5CKGA 3GZQA 4OV5A 4M9OA 2C1OB 5SV4A 4L3ED 1I75A 3BP6B 2GJ6E 5D1XC 3DK0A 3R9EA 1DVFC 5HGBB 1ECZA 2JBKA 3GIVB 1JZ5A 3FT1A 4XP1H 3O6LH 4R4ND 3SO3C 5E6IC 4HS6B 3ABMB 4CN6A 5IQ7H 4UT7L 3NAAL 4NZUL 1CXLA 3CVHL 4CL7A 5DQJB 3KH3A 5IW6B 1U3HC 5D2LB 3DETD 4RAHA 1I12A 4MAZA 2FWSA 4Z7WA 3PDOA 4TNWF 3D48R 3QXDB 4YLBA 1AZRA 3I74A 3OMAB 3MLUL 3IXAA 4QNPF 4D9RD 1MH5A 4TTDD 3SDCB 5GS0C 4YL9A 2CO1A 3AY2A 2OQJA 4P8QA 2NQDA 4QRRB 5BXFA 4F9LA 5ID0B 2YD2A 4HD9A 1G7PA 3QULB 2V33A 4Z7NF 5IFAL 4PIBA 1CXEA 2XETA 1OOAA 3AAZA 3KBPA 1BVNP 1ECYA 3KLAB 4JFQA 4L5FH 3PWVA 5IQNA 4ZFZB 3TBYA 2WZPD 1O0VA 2SEBA 3NSJA 5LCVH 4YXLL 5JNYA 2JQMA 4YSRA 3CQPA 4WCYH 5DJYA 5ANMA 4P57A 1EJOL 1A21A 2HUZA 4W1TA 1KELH 1XF3A 4WNJA 5FKPB 1ZGLA 2UY7B 2X0UA 4QNPE 3QUZD 2GABA 4II9A 1UD5A 5DYFA 3PUUA 1T5XA 3WD5H 3FPXA 3MOAL 2Z4QB 3FQWB 3BSHA 3M8OH 1KF9B 1P84J 4H5SA 4FXGB 1N5AA 3HUJF 2YS4A 4G7VH 1B6DA 3RQ3A 5AOZA 3ULVC 3MTRA 5JA9A 3VB8A 4Z7NE 4HJSA 3HG5A 1EE3P 4KRMB 3BJ7A 5KN5B 4FP8H 3FFDB 3H42L 3U9WA 1G9HA 3AC0A 4I4WB 3MNWA 4ONFH 2E7LC 4MJ5B 4OKVA 1BDYA 3QDMA 4HCRA 1BGXH 3BX7C 1ZHNB 3GSOB 4JM0A 5F1KC 4LVHC 4AK2A 5EEYA 1NDTA 3BP4B 3MV8D 4FD0A 1XD0A 1Q1JL 2J72A 1WFUA 4XAWH 5AFAA 5I76B 4YHOH 1FNOA 4LQ6A 2XFGB 5IG7B 1E3XA 1KB5L 1QSOA 3C26A 4JZ0A 1NH6A 1KT2B 3FSVA 1F1DA 2ZKWA 3HUJE 3VXSD 4IAVA 2NXZC 3MREA 1Z8WA 4LNRA 3VWJA 3MUGA 4TSAH 4Q4IA 1FO0A 3G5XB 1CFNA 2F68X 4X9GA 3NJJA 4PBXA 2JXMB 5K9QI 3D08A 2HKFL 1EEQA 4HGMA 3IDNB 5GGSA 3VD3A 3COOA 3VFRB 1KIRB 3OSKA 1JWUB 4NN5C 2QZ5A 4A2HA 4PJDA 3HTLX 1EHKB 1J11A 4MB1A 1E0OB 5GGQL 5DK2B 2Q6WA 3NK3A 1J0JA 4CSZA 4M93B 1MNNA 1OQXA 1N8ZB 1G9ML 4IBTA 2POKA 3H4HA 4MMXB 4NM8H 3ML8A 2R83A 5INCA 3EY5A 4M1DH 4KKCC 4HX1B 4PR5A 1HWWA 2ADGA 1GMEA 2C9AA 4N85A 5EA0H 2Q76B 1O7VA 4BXSV 3EO1B 4HEMA 5EV7A 1EERB 5E8EA 4AQ1C 2BVTA 1RUQH 1H8OA 4FL4B 3T4AB 3MRJA 1EZSA 5E9DB 5ECGA 1M6OB 4H0LC 4G43A 4JFOB 4Y9BA 2ZXWB 2AQ2A 1IC7H 1Z9SB 3NFPA 2QSCL 3CVCA 3BAWA 4JPKH 5MEOA 4L8BB 1XGRB 3L2LA 4CA4A 1NPJA 4AGQA 1X5IA 2ENJA 4FHBD 4TUOA 4PMFA 4LPVA 3L5XH 4NAMA 3QH3B 3PUCA 3VG0H 2ARJB 3UJJL 5GGTA 3VXMB 3P0GB 1EX0A 3ARWA 2D0HA 1VESA 2EIZB 2PCPA 3DBXB 3HZ3A 4BFKA 4P2RA 4DEPC 5J89A 4YXHH 2BSWA 3HS8A 2H0FA 5CJOL 3RNQB 2XX1A 2OZUA 4FERA 3TPUB 1U8HB 1J4JA 1O6TA 1ACZA 4NBXB 3GGWA 4UQCA 5DMGC 1MQ8A 3RVVD 4G8GD 2GE3A 3D68A 2L4OA 2R56L 2G3XA 4F1ZA 4KH2A 1Y7EA 4PJGF 3TA3D 5CEYB 5DS0A 2J6EA 3GFUA 2B3UA 4RZKA 3OF6D 4LSUL 3D4UA 4GKLA 3UZVB 4PJ8D 1II4E 4NP9A 4Z65A 4ALAH 5I9QC 1JZ6A 3D2TA 3MV01 4X7SL 3HC2A 4JGNA 4BV1A 3EJYC 1VKCA 4NP4L 3I9GL 4MSWB 4N2EA 5C1MB 1FUNA 1CICB 2DD8H 1I9EA 1IGTA 5E8NB 3VH8G 1CLYL 1Y0LA 2XSKA 3DRQA 5EF3A 2Q86B 2XA8L 1V3MA 1A7OL 3IFPA 1O7SA 1YYLH 2CNYA 4PJBF 1KTLB 4PJGE 4WSJA 4A32A 2YA2A 4TMPA 1BM3L 5IZ7A 2DLTA 5GXBB 3VAEA 1S46A 2X4UA 2VXQH 4ETQB 4KQ4H 4OLVH 1M44A 4KZ0A 3VB9A 4MHDA 1DYZA 2CA3A 5IK3A 1DUYA 5IF0B 3B35A 2ZTBA 3PQYD 4TL5A 4KSIA 1NCNA 2F1EA 2H41A 3MBXH 3ALPA 4JEGB 4JO4L 1HSBB 1T0NB 4JVWA 1NC2B 4Z78B 4PJBE 4LK4A 1K5WA 2EDNA 4EFDA 3FTUA 5CUSL 3RVTD 3MROA 1OP9A 2QKSA 3S34L 2J6WA 2GFQA 3PF2A 4X8XA 1VHEA 5KUKA 1BJ1H 5IHBA 3IT8D 2OMWA 3P54A 4UM9B 1YREA 4L29A 1ZA3B 1JNHA 1MFEL 4R4NC 4Y4HB 4WY7L 3T0EC 3RWFA 4HZAA 1YEKH 2B1HH 3PHSA 4GPVA 4KDWA 4E42A 3WNNA 5C70A 1R24A 2GBAA 4JVPA 3AT8A 3ZTNH 1RHFA 4MQSB 1HEZA 2EDBA 1EA9C 3ESOA 4TTDC 1OGPA 4NQEB 3KPRA 1M3IA 5H94B 1F11A 3D7GA 4KRPB 2FJGB 3OAYH 3CFEB 5FK9B 5I8OL 4ODVH 2FHFA 3D4CA 3BCDA 1Q2DA 1I8AA 1TFPA 4UB0H 4Y0GA 2HRPL 3MRPA 2AFUA 3MLZL 4H6ZA 2CDFA 5D7LE 5ICUA 5GZNA 1BYPA 1O9ZA 4JFYB 3HBQA 1RMFH 4Z3GA 1KBVA 4DUXA 5T3XL 1N2RA 2HTKC 4PYGA 3ELQA 5SWZD 2V9UA 3NSFA 4F92B 3QUZC 1MK4A 3NQIA 5EO0B 2Y23A 3BP5A 5EZOL 1HI6B 4DGYH 5I4MA 1LE9A 3J7HA 2NX5D 4IRZA 2UUDK 4TSCH 2NR6C 4E9WA 2XG4B 1WA1X 1MCQA 2A9CA 2P49B 1FORL 2GUOB 3O3DA 3WXVH 1NAKH 2PJBA 3RHWK 3D34A 4OT1H 1QUPA 3K2MC 3CLEL 4QPEA 3X14B 4MD0B 3W39B 1H6EA 4IGBB 5E4EC 1XSJA 3GI9L 3O2DH 1K4CA 3QRLA 3V9EA 3QDGD 5FUCC 4H8VA 3DHUA 5FR3A 1SY6H 2OL3L 3ES6B 1WH0A 4I18B 2PJ2A 4FX5A 1ZOXA 2LAGB 3RVUD 4ELME 1OE3A 3CD4A 4IJTA 3G9VA 4KVPA 4P4RB 1EFQA 1YVLA 4CVUA 2OSXA 2Y1AA 1O5PA 2C7UA 5HSFA 1PSKH 5I6XC 5MHSD 3MZGB 1I9IL 2IH8A 1CR9H 1ARMA 2D7OA 4AVCA 1TIQA 5F0JB 4XNHB 2RAMA 3E1F1 3RZWA 1QO3A 5DUPL 1LO3L 4F7EB 2MKLC 2DY2A 2G30A 2HFEB 2VW4A 3AQXA 3NJIA 4JZNA 5DEFB 3ZL2A 2EILB 1I7ZA 4RGNB 1MJ7L 4X4ZA 5MEPA 4NO0A 1YN6A 5KS9F 3O4OB 1IKNC 4NN7C 2DWDB 2PIYA 3IN2A 5DHMC 5D1XA 3LZFL 4HDIB 4U1SA 4KMLB 5IVXB 4X8GA 3TYFB 3SDYH 3TJHD 5CILH 1U42A 3WKQA 5E6IA 1DEEB 1Q9LA 1R5WB 1KBKA 1IARB 3ZSTA 2Z3NA 1EAPA 3FIXA 1Z9UA 2VXUL 5H4ZA 1ZPLA 1BREA 1WGVA 4I77H 1KLUA 1XXFC 3UC2A 1UM4H 4WU5B 4KC3B 3RY5A 3UTQA 4ZUVA 1IFHL 4JHAL 1CI3M 1UH3A 3FYNA 1MNUL 1L0XA 2P3YA 4M6OH 3TN0D 3CK0H 2R29H 3UBFA 3GMPA 2KLTA 1TNNA 2Q2EB 2H9GB 3HS9A 5KYWA 2A9DA 1ES0B 3PXLA 2IOMA 4PJFB 3CPUA 5F7WC 4X9YA 4Z7UA 2YKLH 5JHLH 1LK2A 2Q43A 5LGHH 4FXKC 4I13B 1ONQB 2E86A 2HVKB 2YEVB 2DM7A 4GKNB 4KTEL 5LRJA 3CZJA 3B3CA 1CFVH 3FTWA 3FUJA 4BSVA 3HAEB 2YPKA 1BFVH 1PG7X 1PZSA 2XZCH 3DXAA 4JDEB 2BSEA 1BAFH 2WTPA 1XL6A 4B9JA 3ZKQD 3DARA 1UZ6F 1VGKB 4JDTH 3CN1A 4PUBH 4RNRB 3LB6D 3VG9C 2CBTA 3BE1L 3HHRB 4ZFOB 4I2XE 1U95B 2VQTA 1RJYB 1YJDC 3RVVC 1W72L 5GS1A 3JV4A 5DC9B 1JPTH 4JX0A 1RJCA 3BWSA 3ECVA 3JWDH 2B58A 3JWNC 3TA3C 5T1JA 3FO0L 3TCTA 2E7LA 3NJKA 1FVEB 4PJ8C 1RO5A 1MW3A 4L2YA 1JNLL 1QSMA 4JG5A 2GK0B 5J1QA 4PV9A 1XVSA 5JW5B 3N1FC 1A22B 5AKTA 2QHRL 2WYTA 4LHUA 3TX4A 3WFHB 4MA8H 1ZVNA 2AJVH 2DQDH 5B38G 3CJJA 3EHBB 3PCYA 1FA4A 2FR4A 4F9PC 4MFKA 1MY5A 3BHBA 5E8OA 2BS9A 2YPVA 3C2SA 4M62L 3QS3A 2MRYA 1D3CA 3KGSA 3V5HB 3QUMA 4PB0L 1SMDA 5DSCA 2Q87A 1HQ4B 1DLHB 1B6UA 1PIFA 1PD6A 2CDGA 1NCJA 4F3FA 4N2BA 5EFIB 4KQ0A 3P4MB 1S9VA 5E1IA 2QVFB 3OR6B 2OZ4A 4DZBB 3B34A 4DP7X 3KR4A 4HLEA 4PMEA 2JBJA 4L8SA 1IIIA 4O02L 2NLJA 3PWUA 3BSZL 1ZIAA 2A6DB 3F7QA 3P2DA 3RY4A 2Z93A 2WWMD 4NCC2 4XC1H 2XWCA 4JFPA 2ZOKB 2EDMA 3MAWA 3D66A 4ZXBA 3LS4L 1FZJB 2OMVA 2WMPA 4UUJB 4ONHA 2FO4B 2A9NH 3VFWA 3A47A 3TNNA 1PNCA 3K91A 2JKXA 3FN3A 2ZZUT 1KXQA 1VGEH 3BN3B 4NZFA 4AH2A 2W94A 2HFFA 5I1AB 4B97A 1FI8C 2DMCA 2BW4A 3AMLA 3QFJA 2YIHA 3CX5J 4G70B 1CVSC 4EBQH 1ADQA 4G1MA 3MLTA 1SOKA 2ITDB 4FEMA 5BZZA 4PQAA 2EYSB 3H4QA 2CPUA 2ZXGA 3IJ8A 2ZOFA 3Q8BA 5CZRA 4U9YA 5FYJD 4TUKH 1N59B 4F2MA 3RFZC 1S3ZA 2DICA 1RI8A 4JFEB 2F5BL 2GTZB 1OT2A 5CWSB 1F6FB 2Y5QA 3GF8A 4XPTL 1QRNB 2J2ZA 4QF1B 4FQCL 4Y4FA 1EHLH 4OZFH 3D39D 1YMEA 1I7UA 2EO9A 4MNGA 4A2GA 3TJEH 3AXHA 2Z92B 1E6JH 3GS4A 4NOFA 4Y7OC 5E9DD 3LXCA 4KKAD 1KCRL 2WUBH 4NLAA 1OSPL 5GISH 4XP1L 3O6LL 1XD1A 1X9LA 1IICA 1VSCA 1ZTMA 5IQ7L 1EPFA 1HVXA 2MTAA 3CFBA 4YXKH 1ZLVH 4YVNA 4HIEA 4KZDH 2JKSA 2VZOA 2VISB 1XJOA 4I85A 4HMDA 5BZXA 5IOKA 5CSGA 3BT0A 1A6WH 4ZFGL 4DGVH 1E6OL 4K2UH 3VXMD 3RVUC 2BVQA 2R0WH 3KWUA 1YW4A 5CN3A 4FUUA 2ROYA 2K0RA 4YLCA 2DLFH 3W11D 1R19A 3MJ9A 3LX9A 2FBOJ 2FUTA 4YSAA 4A66A 1XCTA 4N1HB 1NFIB 4F57H 2VLRB 1PLAA 5DA0B 4LCCC 4M5SA 1D5MA 5FCSH 3TL5A 5AYUH 4QXVA 2ZWZA 3ULUC 3MRNA 3KXFA 5KSBB 2IFFH 5EIIA 4YZFF 1HH6A 1CFBA 4TTGA 4L5FL 4RIRB 2AFNA 5LCVL 1VENA 4WCYL 1AQDA 4Q74A 4WDIA 1KELL 1X5MA 1SFDA 3QPKA 4WNQB 3K1DA 1Q9OA 1TENA 5CEZD 3KR5A 3LEXA 3C8KA 4H2AA 3IFOB 2I60L 4QO1A 4HOMA 4PWGA 1NIEA 4G59C 4MJ4A 3VXRE 3WD5L 1C16A 1B9KA 3TBWA 3X1EA 1UKQA 5GRJL 4ISVA 3M8OL 4HUNB 3I50H 4L3EA 1QR1B 2HLEB 3A4DA 4MQ7A 1XF4B 2DBLH 4NNYA 1UZ8B 1X7QB 4YZFE 1U91A 3TJHC 4XMZA 4O23A 3VD0A 1M4IA 3U9UB 1KGYE 1KB9J 4AVIA 2YKKA 1P4UA 1G7MB 4TUUA 4ONFL 3JWNG 3RPBA 1AZNA 1BGXL 2ZXAA 1U8IA 1JHLL 3SDAC 1M1SA 4HCIA 4GOSA 4XAWL 4LGRB 4YHOL 2MIZA 4ZSOE 4EI6B 1E8YA 3I1UA 2IOIA 4HULB 3TN0C 2D7QA 2MHAB 5J0BA 3HE6C 5DUJA 3WFDH 4PLJD 1BVZA 4N6QA 4Y89A 4X8IA 1LEGA 3BVDB 1KXTB 3IWGA 1XGPA 2K45A 3T4YB 2FDBP 3HC4L 1KBPA 2E9WA 1Q94B 1D5XB 3HC0B 2WZPA 2NY2B 2XIBA 3U4EA 3GJEB 1QFWI 5J3HD 4X4XA 4M1CC 4CADB 5L2JA 4MJHA 4NERA 4LCWB 1HEJC 3ZIMA 4JHVA 2EEAA 3V6ZB 2IJ0C 4W9HC 3QUZA 5DJ6A 4E5XG 4ZAKB 3VXUB 5FOBA 3WL9A 2X4QB 4UCFA 3LB6C 1L3NA 4UM9D 5HI5D 3BP7A 3NCWA 3SPHA 3ZY7A 2MPVA 2J1KA 1F42A 4ONWA 1BPLB 3QWOA 2N7BA 1EXUB 1F4YH 3L6FA 1QTSA 4M1DL 2DMKA 3K72A 1I21A 2F19H 4OC4A 1A2YA 3D2UD 4IIZA 4JG9A 4WI2A 2E5EA 3PHOA 5JO5B 4L37B 4XGZA 3ZTCC 3SDDB 2AV1B 3SDCC 5BOZG 3OKLA 3NIFF 3QQDB 5BW7C 3GB0A 1RUQL 1KJ2B 2P8LA 3RIFF 3VCLB 4GO9A 1R46A 3E2HB 4F8NA 1VEOA 2IL4A 4YDIL 4KRPD 1FN4A 2OMZB 3MV8A 4XBMA 3K74B 1AD0B 1BPVA 4JPKL 4CAEA 1PDKA 2WBKA 3KYOB 4JL1A 2PQ8A 3K6DA 3K6IA 3MBWB 3VXSA 5EU7C 2JJTC 3JTTA 2EADA 2BM3A 1UD4A 3L5XL 1QLRB 4HT1L 4N0UE 3GKWH 4QLRA 1TJIH 4QRSB 3VG0L 4BHUI 2BL1A 5SX5K 4L4JA 4JO3L 1WD9A 1KB3A 3VFPA 3V95A 4ZOAA 4ZFQA 2I5YL 3DYOA 3CFDA 3NIFE 4KKBD 3X2QB 5HDLA 4PS8A 2RTTA 1AFVH 1Z5YD 3EH3B 1ZLEA 1JPFA 2W1NA 1KYDA 1D6VL 1I8KA 4FXGC 4WO4D 4RZCB 3KYKH 3RIAF 1N71A 4G1PA 4RS2A 1EBPA 3V0VA 4JAMA 3LQAH 1JNNH 2M26A 2P26A 4MQXD 1AG0A 4XN5A 1E8WA 3RFRA 2WWMC 5E1GA 3IEHA 2RB8A 3BPCA 2K3TA 1BMZA 3KLSA 2XN0A 1WICA 2OJZH 3KPMB 1FSKB 3U0PB 2ZUVA 4NXSA 8FABA 3QZWG 4ALAL 1NGZB 3EOAA 4JG1H 2I7OA 2E9GA 4R2GB 4EMZA 5IEHB 1MCSA 3L4ZA 4JRYD 5B1JA 4K3HA 4G42B 4W6XB 3WS3A 2ZQKA 3NCYP 2ITEA 3UBXG 1QSTA 2DD8L 4JHBA 3U1QA 2BVYA 5EUKB 1IOFA 2YMTA 1LMKA 2ZKHH 35C8H 4GBXB 3VD7A 4JKKA 1C7SA 4AKQA 3C5ZD 1Q0EA 1AO7E 1IIKA 3ABLB 3AQDA 3EW3B 1YYLL 5ABZA 4FTVB 4ZNEE 1T5KA 4RGND 4PRNB 2BP0B 4Z7QF 4BH7B 1PLBA 3S36H 5KVEL 5FVJA 2R51A 2IQ6A 3BAEH 3P9WB 3BN9D 3QZPA 4PJEB 1XF2B 4LNVA 2G3TA 4G3YL 1QHOA 2ARJQ 3TBTA 4AXWB 2HB0A 2R1IA 5DURB 3DVGB 3BKYH 5DRNB 1XGYH 3CSTA 3L4YA 4M93C 4ZFFB 3POCA 3OL2A 3VXNB 3RNKA 2HRHA 4MMXC 4JB9H 5TH2B 3PP3K 4ZX4A 1KB5B 1ETB1 1HL4A 1GYWA 4G8GA 1OCRB 3G5YA 3HZYA 4GY4A 3L3GA 2P8PB 4GM5A 2GAZA 3PPEA 2I32A 3L3JB 4QOKB 4X9FA 4Z7QE 1E40A 4FL4C 3T4AC 3QNZB 1G4MA 1IO4C 3OF6A 5EBMA 4DK3A 3BGMA 4PJ8A 2VWEE 2EDTA 4KKAC 2VAAA 4QXUH 3TF4A 2HZHA 3IGLA 3GRGA 4QVTA 4U1JB 5FUOL 5CEXA 4ZX5A 4XCYA 1M56B 1JGDA 1BJ8A 2VLKB 1KDJA 1YEKL 3ECBA 3ESPA 4LOUC 4ZTPH 3ZXAC 3VGHA 1MI5B 1Q9KB 5TDPA 4HJUA 3CBKB 3ZTNL 1OB0A 5EEWA 1HH9B 4P04A 1A9BA 5DRZB 1KYAA 3BQUA 5T3ZE 1U8LB 3W11C 2AGJH 5FF6B 5TE7L 1JGEA 2J8UB 2C3VB 2NNAB 4Q9RH 2LTQB 2O61B 2W9EH 4ODVL 1NEZA 3UYPA 4PY8I 3HG3A 4UB0L 1N3NA 2A0LD 2AEIT 5AD0B 5KYNA 4JRXE 5F1SA 3I6GA 4M48H 1RMFL 3N1GC 3PQYA 1OP3H 1RK1B 4HH8A 1T03H 2PW2B 3HMWH 3RX8A 2OA9A 2V5YA 4XPBH 2HVJB 2IBGA 3GK8H 5C9KA 1A7PH 1TVDA 3OX8B 5LYFA 1KTBA 3MYZA 4DGYL 3OWRA 3QHFL 4A7GF 4TSCL 3DIFB 3UAFA 3D69B 2BO9A 4HXAH 5SX4H 3WXVL 1NAKL 3FB8A 1VFBA 3OG6B 3DVNB 3VXOB 2E7CA 2WVVB 4OT1L 3RBUA 1EFXB 2WLMA 4ANUA 1Z5RA 3IM1A 4LLYA 1CICC 2QVMA 4K7PH 2LW3A 1IBFA 3O2DL 2VMJA 3CCHB 1Y0RA 1SF3A 1SY6L 1WTGT 4PW9A 1BIHA 4IMLA 1SYSA 4RFEB 2BHFA 4M8QB 4X6EB 1GTFA 2X12A 1HHIB 1JUFA 1YMME 3HN3A 1T83C 4MAYA 3DTUB 3TNMA 2Z6FA 3DYMA 4GG6A 1NCGA 2D7PA 2HX9A 3K2UH 4N0CD 1INEH 2J1XA 4UU9B 2O5YH 1UTDA 1PSKL 1TVBA 2IH3A 4P9HH 2FJSA 2RJMA 4Q36A 5DGQA 4X99B 3RFZA 1HQRA 3ZLQC 1J8KA 2KS0A 2XVGA 1DL7L 3MACH 4KOVA 3FPYA 3S5LG 1E3ZA 2L7EA 4YHKH 2FYYA 1YO4A 2Q7AA 1FL3B 2K8QA 5D8NA 5J3HC 2A7BA 2GI0A 3WFEH 2FTAA 5FHAH 2WNWA 5SWZA 2F53D 1VJSA 2BOBB 3NH5A 1MVFA 4OCSH 4PTTB 3C6SA 1MN4A 5DQDH 3W5NA 4B14A 3CNKA 1JERA 4R7LA 4UF7C 3ZQXA 2NX5A 5HI5C 1OO2A 4FNSA 3S2AA 4Y4HC 4UDUA 4X2UA 5CILL 5IB2A 3MA7B 4JQVC 4R3LA 1AQ8A 2Z91B 3EGSB 1MG2C 1M2VA 4HIJA 3HBZA 2JK5B 3T0AA 4AWJC 2R0KH 2YC1A 3QDGA 4UQEA 2D03H 1CDUA 1UM4L 3V0EA 3PS6A 1ACXA 1ZS8A 1CLCA 4HFWB 1RZ7H 4KRPC 1UGKA 1N7MH 4M6OL 4HKBA 2GJPA 3CK0L 3HR5B 5JGFA 4XCEA 4MVBC 1H15A 4KROD 1KYOJ 2AEWA 1ZK5A 2NYZA 4XMWA 2G9KA 5E2WH 3N04A 4Q6YA 2VLLA 4OKDA 5DQ9A 3KPNB 1U8PA 3QUKB 2YKLL 5DT1H 4ZOBA 5LGHL 3LPPA 4YAQA 3WIIL 1TQCB 3B7TA 4TKWA 1U8CB 1LO0H 2W0FB 2IMMA 1KLFA 5IOPA 4KKBC 1BFVL 2OYMA 4HKXA 2XZCL 1JHKH 1RULL 3M1BB 4PP1D 1PZUB 3SKUD 1A1MA 3GMMA 5K8MA 5I8EB 4LQFH 2FIRT 4JDTL 1VPOH 1QW8A 4PUBL 1CL7I 3G5VB 5IVNA 3LV3B 3ECWA 3ILQC 3VQ2C 5FV1L 5J6SA 1E4XI 1X6NA 4KUAA 4H26B 2ZYIA 3WUZA 1JPTL 4IGBC 4QXTB 2F0CA 4OJCA 5C8JB 1JV5B 2WXRA 1GC1L 3WHXA 1JRHI 1N0XH 3PDDA 1CF8L 1NGYA 4I18C 5CGYC 3FFCD 1X7SA 1DVSA 3I2CH 1BIIB 2VZ3A 5KVDL 1TETH 1QASA 2EVJA 4J23A 1ET8A 2NQ3A 2PYEB 3S3PA 2VTFA 4M5YH 4DO6A 1PCAA 2Q04A 1W8EA 1WFIA 2EYRB 2Y06L 3DI3B 2F7RA 1YRKA 4LARH 3PHAA 4O51B 1RXTA 4FFZH 5D1ZI 2FBJL 4HALA 3T9WA 4XNBA 2WBJB 1WAAA 3BXNB 4U1HA 4JRLA 4XBGB 2YPLD 1T21A 5CNHA 5DJAA 3EC4A 2ZP9A 2AJVL 4XNHC 4PRDA 3RGHA 5BV7L 2VUYA 3UL4A 1IAKB 1OGAE 3BKCH 3H9SA 3QIWD 2YMXL 4LU5H 2HXAA 5GS2H 2DI8A 2GI7A 4JFWA 3O6FC 4RGNC 5FECB 4D0BA 1KTJA 3IU3A 3IJEB 3TIEA 5L88H 3RZCD 3BN9C 5FO8B 4W4OA 3O4OC 3QJVB 3VFTB 2IEPA 3F7PC 3BP6A 3SDXF 5FLVA 4WUKH 5AB0A 3GXNA 4E9SA 2YJLA 3GIVA 4E9TA 1V0CA 4Y88A 3UERA 1YNTF 1UT1A 1DTDA 4XC1L 3ZJAA 4HG4K 4U4BA 4JD6A 3LN4B 5D2LA 2Y1VA 5F1IB 4FJYA 1CT8A 1UB5A 4WW2F 2IF7A 2ATRA 3QXDA 1FJ1B 4IK2A 3DJ9A 4TQIA 4DP0X 2A9NL 4OCWH 3K7UA 4ZTOH 2BS8A 3MLYH 2XG5B 3OAYK 2V2WA 1VGEL 5E6RB 4W93A 2NT1A 2VO5A 3SDXE 2YJQA 3F7YB 5KVGE 1QFWH 3AT0A 1CDGA 5AG9A 4M3SA 1XGUA 4WV1B 4EBQL 5I0ZA 2JJTA 2Z3PA 3KLAA 4ZFZA 1BLNA 3B3BA 1DR9A 2NY2D 3CZFA 3BVXA 4FLQA 3WC7A 5D5MF 4LCWD 3MKKA 4OUOA 2FB4H 5FKPA 2UY7A 3PJNA 1UJ3B 4Q58C 4ZAKD 5BO1H 3VXUD 5CMAA 4XCFL 4NCZA 3HG1B 1T4KB 4Y5YA 4M5ZH 5MEQB 2IV9A 1IGCL 2Z4QA 4XOAA 3ZR6A 2A0LC 3MFFB 3OWCA 1SXBA 2R1XB 1LP9F 4OADA 2CD0A 3FRMA 1EHLL 4AVHA 5DK0A 5KJ4A 4HS3B 5KN5A 3TJEL 2HG0A 3VTMA 4I4WA 5B7EA 5JR1L 3N85H 4MJ5A 3SDDD 4P4IA 3PREA 5D5ME 5I5JA 1X5AA 4NJ9H 3GUXA 1ZHNA 2Q3AA 4HK3N 5I76A 5GISL 3TP4A 2F15A 3MDJA 5BRZE 1S7KA 2DPSA 2XLLA 3BH4A 3R0NA 3MLSH 5IG7A 1HEEA 4N4YB 4BDVA 1H3GA 1KT2A 4IHOB 1ZLWH 4KZDL 2XX0A 1BA9A 1LP9E 3HA0A 1UQSB 3EHBC 2WZ6A 4B41A 2ZEOA 3QQ9D 2AQRA 5IHUH 4DGVL 2M1KA 4WEBL 4K2UL 3R1KA 1MIMH 2R0WL 4QAWA 3G5XA 1QSFE 3V5KA 5JW4Q 5I1IH 1Z66A 4APXB 3JVFC 2DLFL 1T89C 3LKRA 1RPUA 3B5TA 2Z7UA 3GBEA 3N0PB 1Z7JA 2VIRB 4GLRH 3WBDA 4DWHA 4AKOA 4F57L 3SCMD 5EZJB 3VFRA 1KIRA 2ARHA 1JWUA 5DDHB 5AYUL 1OCOB 5E1AB 5EORL 1W91A 2IFFL 1CBXA 4H7VA 1HKFA 3DRTB 3TOPA 1HCYA 1N8ZA 1UC6A 2QQNH 3AREA 3EJTA 3HW7A 3KL0A 5D2NE 4MMXA 5JLZA 3LVEA 4AXVA 2QJ8A 3BLBA 3D39A 3D51A 2E8YA 3WIHL 3WXWH 2N0MA 3M46A 1T5WB 5HGGS 3QJFB 1BQSA 4CYNA 1T80A 3S35H 2DH2A 4KI1A 3LIZL 2W0KA 5HGAB 4U4IA 5IVZB 3RGVB 2DQIH 4IBLT 1TEYA 5E9DA 1M6OA 2DBLL 4JFOA 2PJAA 4W9YA 4ZGYB 5SWSE 2VZSA 2NCEA 2PJCA 2ATPB 5FA3A 1XIWB 3K4AA 3CIAA 5FYKU 3FQ4A 4XNDA 2B39A 4Q0XH 4XTRD 3G6AA 3AGWA 4JN1L 5AQ0A 3JTSB 4Y19E 5GHWH 3ZE1B 4GBXD 4XBPB 3GD1C 2NYQA 4Z7VB 4AM0Q 3QH3A 3U1SH 4KY2A 4O02B 5GRZA 4RMBA 3TIDB 1Y0YA 4FTVD 3VXMA 5GSRB 1BEYH 4ADIA 3LRSB 2EIZA 5FGCE 3LMSA 3DBXA 5D93C 3PV7A 4A2MA 1NANH 3WFDL 4JPSA 5AKVA 5DURD 5K93A 3EF7A 3FCGA 2DIJA 1RVFH 3NJFA 5DLLA 5HYSG 2GLFA 4KY1H 4R7NA 3RNQA 2EABA 4JUTA 3B7RL 2WM0A 4PVLA 1ICTA 1ANUA 3F7RA 2GSIA 5EUOF 3F84A 1I3VA 1NMBH 2HLAB 4KVME 1QMUA 5H35B 1IV8A 1F1GA 4PP1C 4QOKD 4XWGL 4KX7A 4QRBA 3WJLC 5B1CA 2YAMA 4MA7H 1QI4A 3UZVA 1B4LA 4UYPA 4XNYH 3BD4A 4FMFA 2JDDA 5KSAB 1T6VN 1UYWH 3DX6A 3WY4A 4A6YA 1B3JA 1E4HA 4HKJA 2LU7A 2P5EE 1F4YL 2VLKD 1MFNA 3T1FB 3ZE0E 1NCBH 1MI5D 2UZIH 2VXQA 4RSYA 1JVOA 4P05A 4YR6B 5E8NA 4QR7A 5EUOE 5HHOB 3BD5A 5F8RC 3V7MA 1XEBA 2WTRA 1ULVA 4CGNA 4OQTH 4P46B 4I7ZC 4F5CE 1JGIA 1MWAH 5E0FA 2BRRH 4N8PA 3FS9A 4IOFD 3BUPA 2R2CA 3V52H 1KTCA 1T83A 2TSAA 4HSCX 1WLHA 4WHDA 3IF1A 3QI9B 5H37A 1WAEA 1OSEA 4UQAA 4NRXB 2H0EA 2J88H 1BQUA 3GLZA 4WTQA 4OLUH 4ETQA 3AS0A 1F3JB 3IB4A 2ZSVA 2Z7ZA 4NBYB 3GRWA 1RLBA 1ODUA 5IF0A 4POZD 2ODIA 4LLAA 2EAEA 2QQLH 2A9AA 4QEGA 1PYTB 4HV8B 5ECJE 2WJ5A 5DC2A 2VDQL 2HUHA 5F7KC 1UWFA 4G8IB 2C9QA 1HSBA 4GUOA 1KGJA 1JN6B 1T0NA 4Z78A 4I9XA 1XMWA 2DN7A 5FPIA 1AHWB 4X80L 3KYKL 3OKNB 3ZVVA 4B5ZA 6PAZA 4GW5A 3LQAL 2AK4E 4C58B 4RUHA 4UM9A 3QG7H 1EFXD 2FBRA 4HPYL 3EDEA 1MQKH 1OTUD 3FUNA 4DEUA 1IBDA 5LRKA 4NB7A 5C07D 1BVKB 32C2B 3IJHB 1N6UA 4MMZB 4B60A 3D2UA 1C7TA 5I73B 4X5QA 1BOGB 4R8WL 4GW4B 3UY5A 2AFSA 2ZKYA 5H94A 2CJ3A 4S1QH 1ET7A 1ZPUA 4RSVA 1CJWA 3MRMA 3CFEA 5FK9A 5AALA 3VXPA 2XN9B 1ZLUK 2MJWA 4OTXH 2O4HA 4TVPH 1IQDB 1JG9A 2EQDA 2ZP8A 5SV3A 4L05A 5HJBA 2JJVA 4N2OA 4DP6X 4MNQE 3MUY1 4JFYA 2NY2C 3GXTA 4APQD 1TTBA 3EOBB 5GRXG 4PWFA 1YA5A 3KS0H 3GBNH 2XZZA 5I1DB 4AV0A 3ZUNC 4ZAKC 3PNWB 4D0DB 4CW1B 2FEEI 2V7NB 1SEQL 1HI6A 2OZNA 3C9NB 3APDA 3BKYL 1XGYL 2VR4A 1OSZB 2D3JA 1H3WM 2VQ1B 7PAZA 4YDVA 4WO4A 2VN6A 2VZ1A 3MV7E 2XEGA 2K4WA 4JB9L 2BUEA 1MCHA 4N5EC 5JQ6H 2WO3B 1MJ9A 5JW4M 4RBPH 3X14A 4HYTB 1OGSA 3W39A 1J05B 2I07A 4GMTH 5I18H 1PD1A 2OXGA 2QV2A 4KI5D 4PH8A 3FQRB 3IFEA 4H6UA 4YHPB 3DBSA 3ULSB 1OAYH 5AOMA 2BIOA 2TRYA 2VDPH 3SDDC 1Q2CA 2W65B 4NO2B 5MENE 2UYLB 3QWRD 2ENYA 1F1AA 1YK3A 3E2HC 3V38A 2CCVA 3EADA 4M3HA 4QXUL 3OJ2C 3ECUA 5IP4A 1HYSD 4B5OA 2BWDA 3V7ZA 1Y1DA 2F6AA 3VUAA 4P4RA 4JRYA 2VO8A 2X4RB 3BIAX 1NBZB 4M7LH 3BZ4B 4ZTPL 1U8NB 1RZ8A 4LPTA 1RU9H 2E59A 2M8XA 3C75A 1S7WB 4UBDD 3BI0A 2X9WA 3HNSH 3QQ9C 1M57B 3MYJA 2FNWA 4ZUTB 4PRHA 3MGOA 4RISL 4MXUA 3RWIB 1CL7H 2DMBA 3C5ZA 1USQA 2HFEA 4OI9A 1V55B 3ZR5A 1I7RB 5TDOB 4R8FA 1JE6A 1MJ8H 4ZO6A 5D1ZB 1LL1A 2ZX7A 1D6EB 1KFGA 2I69A 4JQIH 2GBTA 2A6IA 5BZDB 1CXIA 2DWDA 4DPBX 4FD4A 2IC2A 4MXQD 2NY0B 5IVXA 1P0HA 4PHZA 3VDAA 1NGWA 5EDSA 3IDUA 1D7CA 2P5WD 4CMMB 3I3DA 1T03L 1DEEA 5GIRB 3HMWL 2GQHA 1VERA 1FSKC 1A7PL 1I85C 4KKLD 3DC0A 5B1AB 2XNAB 1N4XL 1FCCA 4F8LA 1N26A 3K0YA 3NFNB 2I27N 5JHLA 1XXDC 1X5JA 2PYED 2OYLA 4R2GC 1HESA 4WU5A 4AE1A 2ZAGA 1OVZA 2R1WB 3FQTB 2WUCL 5IMKA 1WZLA 4P4KD 4WKXA 3MUUA 3LXAA 3LPFA 1GGIL 3MMEB 3AU1A 2IIJA 4XTRC 4K7PL 4F7KA 5C71A 5HYEA 1NFKA 1JWQA 1PMYA 1FNEA 2H9GA 1ES0A 1Y9KA 3EDDA 4OUUB 2VM4A 4GBXC 2QMJA 3ZDXF 4LBEB 3SQRA 4FAAB 5HHMB 2KYIA 4ONOA 3ZDZF 4C56B 1ONQA 4WTZA 4PJAA 4OZGF 3C5JA 1L3WA 5DJDB 5EEZA 4MA3A 4NQDB 4DCQB 2GTWB 1MUJB 3EH5B 3FT2A 2F54B 1INEL 4QGTA 2O5YL 1CP6A 2O5NA 2F9BT 5CN2A 2ZICA 1SPDA 1VGKA 4AENB 3WN5B 1FLTX 4RNRA 5CIPB 4U7MA 3WDIA 4LRNH 1KC5H 3JUWA 2XWJB 4YHKL 2P48B 4RMWA 2GIVA 3P1VA 1WDAA 2O5ZH 1RJYA 4LKCB 3WFEL 1KIUA 2B4CL 3J8F7 5D6CB 2Q8BH 1U8JA 3ZDZE 5FHAL 5IB1B 4OI7A 4BRJA 1HXYB 3D8MA 4O2EB 4OCSL 3W0WB 3WGUB 5I6LA 2B3RA 3CX2A 5DQDL 4EZJA 1FVEA 1M42A 4PRAA 3VFOA 1YAIA 3KVDD 2N1KA 5K9KB 3I84A 2K7QA 2V3EA 3DJTA 1F45A 4O2CB 4MJIB 3FK3A 1T2XA 4RAVB 5J13B 5JW5A 2IQ9H 2IH9A 1IAII 3C6LB 4ZPTB 1M7DB 1M6UA 3RURA 4DP5X 2CJUH 1WUNT 4KHXH 5D7IB 2MTPA 3WFHA 3O41A 2AHIA 1XGTB 2PW1A 1FZKB 2DH3A 3MLVL 2R0KL 4PXBA 4PB9H 1HOEA 2FS5A 1FG2B 4BEIA 4C2ZA 2NTFB 4V1DE 3JTKA 1N7ML 4YX2H 4IOFC 3D25B 3HG1D 1HQ4A 1DLHA 2LTQC 3ARTA 3MCG1 4YFEA 2QFRA 5EFIA 3CFJB 3P4MA 5E2WL 1HNFA 3OR6A 4PD4J 2Q4VA 5DT1L 2VMEA 4CDGC 3CPXA 3FF7A 4NZTL 3LZQA 2D4OA 1MCCA 2A6DA 1LO0L 3OPZH 5T3ZH 4HHAB 1FRGH 1JHKL 1I1YB 2BHUA 4FQQA 3X12B 4BKTC 4JCLA 4EDXB 4AMWA 2F53A 4Z0XA 4LQFL 4UUJA 1TYEB 2FO4A 3QIUC 1HX0A 4FNUA 1CYWA 3SJVB 4QJ4B 4AYEC 4Z7WF 4WI8A 4MCRA 3LKOA 4ONGH 1BG1A 2XQBL 5CINH 5DR5H 5I1AA 1KDIA 2EDOA 4F7PB 4WUUB 1X5ZA 1N6VA 1TG8A 2IQAA 5DUML 2VCOA 3FVLA 1MG3C 2WO4A 1CP7A 1ZDSA 2ESVB 4QUOA 4IMKC 4UIKH 2WN2A 3I2CL 1S78C 2ITDA 5L8JB 5C0BB 2EYSA 1I82A 2WNGA 4OZFA 5T5NF 3U4AA 3X17A 3EBIA 1BF8A 3D67A 2J57A 4PM1A 4XPHH 3L54A 2UWEB 4LARL 2EH7L 1PKQA 4I8DA 4S1DC 2TSBA 4LHUG 3AWGA 4Z7WE 2G0BA 3LZPA 1Y07A 5CWSA 2EC9U 4N8VG 3CDZA 2YRZA 3BKCL 3II3A 4LU5L 2K5TA 2HJKA 3VJ6A 3PL6B 2P8MB 3MV9D 3LRKA 1ED3B 1BLIA 5DWPA 4A7TA 4BZ2H 2ADFH 1T1ZB 2GHZA 5JZ7D 2N01B 2BCMA 1RP9A 5JTWA 3RGVD 2XWBA 4WUKL 4H4NA 4QRPB 4KUZH 5KYXB 1G4RA 2G3AA 5F1NB 1H6TA 5ANME 1ZT1A 3QZMA 4R6TA 1IZKA 2ZYRA 2Y7QB 1A4JB 2O6FA 2QKIB 3L3KB 4DJMA 1WISA 2VISA 1BBJB 3QEHB 4P48A 4V11A 3BRGC 2OW6A 3BFOA 4HH9B 4JS7A 1IGYB 5DJ8B 4N2NA 2Q7YB 4MHHI 3FFCA 3ZHNA 1QSNA 3MLYL 1VADB 4KXCA 5HP5A 2GW5A 1M4KA 4U3SB 1F2OA 1JZFA 3DOSB 4IDLA 1JFHA 4Z3HA 1BZOA 3TT3H 4F8PA 4PCYA 4ZRGA 2Y7MA 2F18A 3QDME 4K3NA 2YPLA 4UBDC 4WI4A 4AOFA 1WBYB 3KH4A 3Q5OA 1TVHB 4EE2A 2ZF9A 5GGVH 1OP3K 1TQCC 3WI9A 1ZJBA 3QIWA 1J7VR 1IB5A 4PJDF 3N5AA 4Z8FH 4MHYA 1EMTH 5EU4B 3UABA 5BQ7B 2FB4L 4WNQA 1AI1H 2OR7A 5BO1L 2CGRH 3VD2A 4YFLF 3RZCA 1F2PA 4M5ZL 5I1KH 2R2HA 1IX2A 1BZ8A 1SXCA 3QBTB 1QR1A 3B6SB 4MXQC 5LVEA 1CG2A 3ZKSD 3NQKA 1UZ8A 1X7QA 3L1OH 5I5MA 4H89A 2ZJSH 2N56A 1SQMA 1Q4NX 3BC9A 3VGFA 4NJQA 1EUTA 4ZMLA 2EE6A 1XCXA 4KHTH 4CBPA 3N85L 4PJDE 5B1KA 4KKLC 5DK3A 2OLDA 3MRDB 5J1TC 3U48A 1NINA 1HL9A 2PCXA 1MELA 3HLKA 4NJ9L 4P46D 4XMUA 4OC5A 1EHNA 3GMNB 4E41B 2DKUA 2F5AH 3V4VH 4BK8A 5TQ0H 5T5FA 4EI6A 1K9TA 1R3LA 3MLSL 4JPVL 2WBJC 2MHAA 4UNIA 4FHJA 4LEBA 3KQXA 4HEME 1GTNA 1KXTA 5IHUL 2IALB 4OZ4B 3NRQA 3T4YA 5IB4B 2P6EA 1A6AB 1MIML 2YFNA 3FU0A 1D5XA 3FU7B 4NGRA 1GKOA 5ALCL 5I1IL 4PS4H 5DYOB 3HC0A 4CNIB 1JI2A 3IDGB 4FNPA 3KL5A 1KENH 2CKNA 2DLHA 3GJEA 2WZ5A 2WD0A 2X44D 1ODAA 3MRCB 4CADA 4Q2ZB 3D2MA 3QHZH 4KAQH 4Q7AA 1BFSA 3D4ZA 1S7QB 1MREH 4URTB 4ZAKA 3VXUA 2GTQA 3Q1EA 4JFFD 4KZTA 4U9ZA 2Y7LA 4N9GB 2CR0A 1SJEB 4N6RB 2R59A 4ZI6A 2QQNL 1EXUA 4K71B 1QQ9A 2BVEA 2DQEH 4KDTA 2X4SB 3OHXB 4P2RE 4R4BA 3S35L 3CFTA 3QZOA 5DJCB 3SBPA 5BV7B 2BCOA 4LEOB 3SDDA 1G0YR 2JQAA 5AGEA 4HZ1A 3U82B 1OW0A 3EH4B 3CFNA 1SM3H 4TQHA 4DIXA 4AYSA 2AFWA 4NFRA 1AGDA 4GQ9H 4XMKH 3B7SA 1MLBB 2VLME 4QHLB 5G4MA 1V3LA 1AD0A 2OSLA 2XN9D 4UCMA 2V8LA 1VZIA 4WW1B 4XP6H 4DAGL 3DURB 2B4BA 3KYOA 3BD3A 4YDJA 4WV1C 4ZX8A 5FYKD 2QSQA 3U7YH 2ATAA 4HWNA 1ORSB 3MBWA 3E1ZA 3BWUC 4H1LB 4LPCA 1I7TA 4QRSA 3B9VA 5ITFB 3FF8A 3R95A 2H45A 4AQEB 2VDOH 2Z3LA 4Z76B 3MRBB 4WJBA 2IMNA 1F90L 4R9MA 4M00A 1UJ3C 3HE7B 4QMEA 3QDJB 4MS6A 1UM6H 2ICEB 5GSVB 1ZAGA 4EZMA 3MRLB 5E2UL 3EDJA 4BBHA 3WUWG 1ZS2A 4KZEH 1QBAA 1NCCH 3SCMA 2V8VA 4AQ8A 3SXOA 3U9PH 1RVFL 3S96B 3BRDA 3JZYA 4KY1L 3DDFA 4JGUA 4RZCA 1QUNB 5L8KB 3H2QA 3FMGL 1G1YA 7TAAA 1UURA 1DLFH 4FRWA 2EICA 4A7QA 1NMBL 4JANB 3UXFA 3CC5B 4FZ8H 4M8VA 1KIQB 1LDPH 4RMTA 3A6BL 3EJPA 3H7BA 4PJXB 1DFBL