1QMUA

Duck carboxypeptidase d domain ii
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Avian Carboxypeptidase D Domain II : A Prototype for the Regulatory Metallocarboxypeptidase Subfamily
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
total genus 138
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1qmuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qmuA01
1ZLIA 4NGRA 3NFZA 2ZEMA 4OC2A 3D7GA 2PJ9A 4NGNA 2IMOA 3D7DA 2AFXA 4ZYQA 2CIJA 4ZY1A 2Q43A 3KHZA 3LMSA 2CTBA 3KR4A 4NGSA 3NJVA 3PBEA 2ZEEA 4UF4A 2PIYA 4P45A 4OC4A 3V7ZA 1TF8A 2F8HA 3FF3A 1IY7A 3S9NA 5G5DB 2OR4A 1BAVA 4JZ0A 4NGTA 3NH8A 3D7FA 4X3RA 1KWMA 1XFOA 2PJ3A 4MCPA 2POKA 5IB9A 3NH5A 5LRGA 3NJXA 2PVVA 2I3CA 3QNVA 7CPAA 3B35A 2O4HA 4MRIA 1LOKA 5JM6A 2PRQA 5I4MA 5CBMA 4OKOA 4DJLA 2CF4A 4MHZA 3KQXA 2AFSA 4UIBA 4NJQA 1ELMP 1FT7A 1YLOA 3DLJA 4P4EA 5DS0A 1VIXA 3IC1A 2ZOFA 3PBBA 1ZG7A 4WI0B 2NYQA 5CPAA 3KZWA 2ZEHA 2V8HA 2RB7A 3V38A 4R7MA 2PJ4A 2GLFA 2PJ0A 4MCQA 3VARA 3PEIA 4R76A 4UIAA 3S9LA 5THWA 3B3TA 2PJ7A 2C6CA 1BLLE 1XJOA 2EK8A 4WWVA 1AMPA 1UWYA 1IGBA 2XHNA 4TNUA 1CPSA 3WABA 5K8PA 4PXEA 3KASA 1ZG9A 1QQ9A 3D68A 1EE3P 1TKHA 2XEFA 4P4JA 5K8NA 4CPAA 1CP6A 3IEHA 2CTCA 4F9UA 2OOTA 3B3VA 2XEJA 2PCUA 2XEIA 1XBUA 3HLPA 3NA6A 4MCSA 4OC0A 4ZY0A 3CDXA 4NGMA 2J9AA 5LYLA 4F9VA 1Y0RA 4A39A 4MHNA 2ANPA 1YW6A 1HDUA 4A94A 5K8MA 4K3NA 4ZX9A 3E8VA 2WZNA 1M4LA 2C6GA 3IFEA 2ZEGA 3B3SA 3PFEA 4W9YA 2PJAA 2AFUA 3SJGA 4YWYA 4P4FA 1Z2LA 1ZG8A 4NJRA 3FJUA 4OMEA 1TF9A 3FEDA 1BPMA 4Z65A 1PCAA 3TC8A 1OBRA 1VHEA 2QJ8A 4MHYA 4PXBA 4OIDA 1YW4A 5LYDA 4DYOA 2B59B 2IQ6A 4IYKA 1CX8A 4MHPA 2JEWA 3K2KA 3B2YA 4P44A 1R43A 4EMEA 4EWTA 4AXVA 1NSAA 2WYRA 3KI9A 1GYTA 4UEZA 5LYIA 2PJ5A 4F8ZA 2ABZA 2PJ2A 4PQAA 3BI0A 2PJBA 3HN5A 1BPNA 2JBKA 3B3WA 5F09A 4X8IA 3HUVA 4X2TA 3GLJA 4O23A 3PB4X 1LAPA 3IO1A 1YMEA 2DEAA 2BOAA 5J1QA 1XMBA 5LYFA 2V8GA 3IJ3A 1RTQA 2V77A 4KSIA 3KGQA 4PXDA 5D29A 3PB6X 3BHXA 3PRTA 4FXTA 4FAIA 1F57A 4YOKA 2V8DA 1H8LA 2AFMA 3FECA 2V8VA 4P10A 4P4IA 1NKGA 5JH9A 5HXDA 4EIUA 2PVWA 3FH4A 3KCPA 3JRUA 3RBUA 3TX8A 1DTDA 4ZY2A 3CT9A 2PJ1A 3CPAA 3PB9X 3T8WA 3GB0A 3B3CA 1YSJA 2VL1A 3WC7A 3PFOA 3KQZA 3FMCA 1JQGA 1LFWA 3H8FA 1CPXA 5HVGA 4GM5A 1HEEA 1VHOA 1F2OA 6CPAA 4U3SB 3SJFA 1XRYA 3VATA 4A38A 3SI2A 4YU9A 1QMUA 4BD9A 2PIZA 1Y7EA 4MXUA 3FX6A 3D7HA 4IK2A 2ZELA 3KL9A 3MN8A 2GLJA 2QYVA 3PB7X 4PPZA 3H8GA 1ELLP 3FVLA 3WT4A 3H8EA 3BXMA 4PXCA 1CBXA 2XEGA 1AYEA 5LRJA 4P4DA 2AFOA 2EWBA 2G9DA 4B6ZA 2ZENA 3N5FA 4EFDA 4OC3A 2C1CA 5JGFA 3DGVA 4R6TA 3WC5A 2GREA 1Y0YA 4IAVA 2PE3A 3SJXA 2BO9A 3FEEA 1ZLHA 5HVFA 2PJ8A 3D66A 3RAMA 4FWUA 3PB8X 4NFRA 3IWWA 3ISXA 3SI1A 4MMOA 5D8NA 3NH4A 2QVPA 2HB6A 2JBJA 4FL4C 2BCOA 2PJCA 2IJZA 4ONWA 4TWEA 3B7IA 1LCPA 3IIBA 3SI0A 2ZEPA 2Q51A 3L2NA 4LQGA 4DUKA 4UEFA 1LANA 3D4UA 1Z5RA 5LRKA 4H2KA 4ZX8A 1TKFA 1FNOA 1TKJA 2C6PA 5K39B 2HC9A 2ZEFA 4RUHA 1TXRA 3VH9A 2ZEOA 3S9MA 1Q7LA 5ELYA 5K8OA 1HDQA 1CP7A 3SJEA 3BI1A 2O53A 4R8FA 4Q7AA 4IHMA 2GU2A 2FVGA 2RFHA 1CG2A 1Z8LA 4OIWA 4G1PA 4P6YA 4FUUA 4WJBA 4NGQA 2AFWA 5AQ0A 1ARLA 2Q4ZA 4P4BA 3RZAA 4MCRA 2AFZA 2EK9A 3K9TA 4FBEA 2PJ6A 8CPAA 4OC5A 3LWUA 3I1UA 2NSMA 4UEEA 2ZEDA 1R3NA 4JYWA 1LAMA 4ZI6A 3MRUA 3D67A 3WC6A 5HVHA 4A37A 4OC1A 3ISZA 1ARMA 2ZOGA 3CPXA 1PYTB 4OP4A 1DE4C 4NGPA 2F7VA 3G3LA 1F2PA 3GUXA 1VGYA 3KHXA 3KR5A
chains in the Genus database with same CATH superfamily
3E7JA 5IHWA 1U3NA 4X5WB 1U58B 5EOCJ 1P6WA 3U30B 2X87A 2NQCA 2G3MA 4E41A 5I66A 3QUYB 4CU7A 5AOJA 1G0YR 3QDGB 3D7DA 1OF2B 2Z4TA 1S7LA 3BRDA 3DXAE 3RWDB 4YNYB 4ZY1A 2VRAA 1YY9C 5F7EH 4YLQT 1P2CB 3O6KH 4ZXBC 5KYXA 1HEZA 3HI6H 5F3HA 2CDFB 1N59B 2ZE0A 4PLNC 4I87A 1LP9B 5L2KB 3VVVA 4K8RD 4P4RA 4AYBA 2WUUA 1BFOA 2YD5A 1YY8B 4Y16B 3ESVF 4KVCH 3NJKA 1HINL 3KR3H 5EDXA 2GIYA 5T1LD 4DKAA 4JO3L 4M7LL 5HDBB 2UZPA 3TC9A 4P45A 2LR4A 2WUBL 2RD0A 2IJ0C 2WBJB 3CLFH 2Q2LA 5KVDE 5E2JA 3VXMB 4PJ7E 3FN9A 2X1OA 1J1PH 3TO4A 3OKEB 4NGTA 5EEXA 1UD4A 5DUPL 3NH8A 1AZUA 1IX2A 2Q76A 5E70A 4GKSA 1UM6H 4HD5A 4WI0A 4XI5C 3NH5A 2DM3A 4NN6C 1NINA 1HKLL 2VR7A 3RDTB 1KGCD 3ROOA 4FFZH 1ORQA 3FSAA 7FABL 1FORH 3MRCB 2IQAB 3APMA 4JFVA 3KPSB 5FYKH 1OAYL 2YD3A 3WFCL 5INCB 1OP9A 4ZUTB 2RFXA 1LO3H 1VENA 3QVAA 4JKMA 4S1QH 1I9RH 4NO0A 5I76B 3WTTA 3BE1L 2OMYA 1FRGH 1KJ3L 3LZQA 4DPBX 5JM6A 35C8H 4L5FH 4X6FA 3IE4A 3FRPG 3GGWA 1GC1C 3FUNA 4OKOA 4U1HA 2F53D 4PQXA 2BY0A 2V5RA 4B9FA 3HUJB 4GSDH 3TOPA 1KN4H 3FIXA 3KQXA 4H0HB 3S36X 4AVCA 5I76A 4CL7A 4Z8FH 2IADA 1LO5B 5B3NA 2C9AA 5JR1L 2WXGA 4XP6H 1CGWA 2VQUA 1JNJA 4XMWA 5TGBA 4KOYA 3TOAA 3FUDA 4XBGA 2XN1A 1E7VA 1WZKA 3BWZA 4WI0B 3MUHL 4BUHA 5JW4N 4HIJB 5G1ZA 2B2XH 4QHKI 1DE4B 1WE5A 2BHUA 3MRFB 2F5AH 4L8SC 2UWEE 4QXTB 3B6SB 1ON0A 2GLFA 1FRGL 1KJ3H 1RPUA 2JCCB 3MFGB 1TYRA 4HQQH 3SDCB 3TL5A 5I1JH 5IOKA 1IZJA 4APQB 2AVGA 4TPRL 5EBLB 2ZZUT 4G6KL 4WTZA 4JM2C 2PC1A 1MAML 4WGKA 2KQNA 1I8AA 3NH7L 4GAYB 4OJEH 3V0EA 4JR9L 4X50A 4F9LC 3ARXA 4TV3A 3W5NA 4DN3H 3GK8H 2ED9A 2ZXAA 1CBVL 4ONHA 2I7OA 2FIAA 2YGWA 4K7PL 3L7EA 15C8H 2BOBA 2OMYB 5LVEA 2R56H 5HVHB 4RZCA 4HP5A 1H8SA 1XTLA 3JVGA 2QSQA 4NYLB 1GGCH 3W39A 3MRCA 5C08E 4AZ8B 3L17A 4KXBA 4QCIB 2XEIA 1BOBA 1BCIA 2VUKA 3CBKB 4YDLB 2QGEA 5E2TL 5F8RC 2A5UA 4GFTB 1OCWL 3RBGA 3JYBA 2H0EA 1NFDA 2EP6A 4HK0A 4NNPH 4NUJA 4F9VA 3UX9B 1T0NA 5F3FA 2AQNA 1KBBA 4OJYA 4EBQL 2BK8A 3RDTA 3ROOB 3H4FA 4W68A 4RGNE 4Q6KA 1DBBL 5A2IH 2DEWX 4XVSL 4JFOB 2A9NH 4UQIM 2Z3LA 5I8CB 4QTFA 3FO2A 3QO1A 2DQJL 4I18A 5IV0A 2Z64C 4ZNCD 2GEEA 4J8RA 3N0PB 2Q4VA 3FRPA 3DHJA 4Y4FA 3WJMA 1KGCE 4JFYA 5CXPA 3QUKB 2YNEA 1KCLA 4BV1A 3ZX1A 5C0CE 1CGSL 4Y4KC 1PX8A 4PJ9D 3GSXA 4WWKB 3HE6C 3NCWA 4NJRA 5TF1H 2CO2A 2BSTA 4GSRA 4KHTL 4LAQL 4R90H 2OAAA 2IAMB 3MA7A 4C7HA 4AG4L 4QRUA 3RWIB 2CBQA 3TN0D 1C1EL 4Y5VA 2V2XA 4PBDA 4MHYA 4LEOB 2LOEA 5C3TA 1DE4A 3NA9L 3PAZA 4NB7A 4NO0D 5KWYC 3U9PL 3QIWC 4IYKA 1IEBA 3FYEB 5ERWA 1TETL 2CKBL 1K5WA 5CM1A 1RZIA 5E6IC 4U5YA 3W39B 5CSBA 1FAIH 1X5JA 4PJBB 2QKIC 4RMTA 2GG1A 4RA3A 4UT6H 4AC4A 4BE6A 5IKCA 3WTSA 1NSAA 3T9YA 4Q4IA 5I1LB 1R6VA 1K8DB 4HZ1A 4AVBA 2VB5A 2A6IB 1IL1B 2QKSA 4NHCH 5F7NC 4ZMPA 2WW8A 5T33L 3HC4H 4OFDA 5C09D 2OV0A 4GW4A 5J6GB 2ABZA 3BI0A 4L4TA 3FT2B 4BSJA 1G6RA 43CAA 1LEIB 5AL8A 1UC6A 4X0NA 4X7SH 1BPNA 3B3WA 4K23H 5E6IA 4QY8A 4K0OA 3EGSB 3ZGHA 1LAPA 4J4PD 4IOFC 5IMOA 3DYMA 4LPVA 5LKNA 3FXTA 1WTGT 3BH4A 3GWJA 2CKBB 4HJUA 1NC2D 2X9WA 1R57A 1YQ2A 2K1MA 4PYHA 3VWJB 3C09B 4N90E 3DV6B 4E2OA 4MFJA 5C2UB 2V8GA 4UCNA 1VEOA 2ARHA 4JY5H 5CP7B 2NY0C 1WEJH 4MCYA 3VRIA 5CKGA 5FYLD 1S7XB 4ZAKC 4NKMA 2IMMA 2DJMA 4M1GH 2E6JA 3IMRA 1OZUA 3C8DA 1PG7X 4J3TA 4QOKD 3RZCB 4HC1A 4P10A 2DH2A 2EH7L 3OB8A 3QORC 4G6JH 4K94L 2I25N 3W56A 3HTLX 3LPWA 3HNSH 3OHXB 3S97C 3MV7A 5I71B 2DWEA 2ZOLB 2H1PL 3QUZC 2PCFA 4G80B 1A5FL 1BQHG 1KTLB 3WO4B 1BVLB 3OMNB 3PB9X 3CZFB 1D3CA 3OTTA 5T5NG 2XIBA 2VW4A 4ETYA 1I3GH 1FJ1B 3CFKB 4O58H 2WXHA 3NT0A 4RDBA 4U1GB 3VXRB 5GS1A 3BP6B 4GKSB 5ENWB 3LXBA 1Z4EA 4HPHA 2KZBA 4ELMF 4WI9A 3FULA 3RWFA 5DC9B 1MFAH 2ZXWB 2UXTA 3DX4A 5DA0B 4RSVA 1RZKH 3BWUF 3LQMA 2O6PA 1BPVA 4Y4FD 5KSBF 4ACTA 4B0MB 5DWUL 1J0KA 5I9QB 4W9FC 1FE8H 3RY5A 4OFIA 2CXKA 3V0WL 2OW7A 4LLMB 4F7TB 1XMTA 2DWXA 1DTUA 3JWOC 4YU9A 1MREL 2XTJB 5K33A 1L0QA 4HWZA 3F65A 4ZX4A 4PJGE 3I85A 2R1YB 3PL6D 3U0TA 3G6JB 3VXPB 3BESR 4DIXA 3HNTL 4H0GA 1LVEA 1HQ4B 3AY2A 3M7OA 4ZFOA 5LDSA 4UV7L 3STLB 1PS3A 3GRGA 2ZP0T 5TFSH 2OMXB 2FLBT 4OGXL 4BEIA 4P3CH 1CYGA 3EO0A 2DQHH 5JHLA 2F7IA 2X0WA 1UM4H 1KTDA 1R5IA 4UOW1 1U33A 5HHNA 1G7HA 5E5MB 2L3BA 1KB5B 1JZIA 3BUQA 2JV6A 3NYKA 4Z76A 3TJEH 1ZA6B 2VJXA 1RJLA 2GJPA 4NZTL 4UT9H 1INEL 2MOQA 2QADC 2JJWA 3BSZL 4ZS7L 5L2KE 4WVRA 1VJSA 5GGTA 2ZAGA 3RTQC 4ANVA 4QRPD 3QIBA 4Z7QF 5GCNA 1H3UA 1ZY9A 1ILUA 3MOAH 2GREA 4M7KL 3O3EA 3QJUB 3OR6B 3PQYA 4U1MA 2FQFA 3HS0C 5CBEA 3UBXG 1I8KA 3UMTA 1EH9A 5HHPA 3BIKA 3OR7A 4JQIL 3CN4A 5FKPA 4FD4A 3TP4A 4P5MA 4DQOH 2DICA 3ISXA 1E28B 1AO7E 5T1DL 1KIUB 3R96A 1E3ZA 1M3IA 1IQWL 1V3KA 3PF2A 3K7UA 4F2FA 3UAJC 2X4SA 3MUY1 3P0GB 3WL9B 5F9OH 2X44D 4L2YA 3UTZA 4KOVA 4AWJC 1R19A 4F7KA 1AKPA 3O9WC 2WLNA 3LIZH 3VWEA 4LLQB 2HT3D 3EH1A 5KTCA 3H3PH 3ZDWA 3DUSB 5I74C 2R27A 3IU4L 4XNUH 5AOZA 2VOTA 5D6CB 1LANA 5IVNA 1IQDB 1CXKA 2XN9D 3EYFA 1Z9MA 4K3DH 3B3IA 1MZYA 5C0CB 3X14A 3X17A 1AQKH 1QLFB 3PE9A 3HPJB 1KPRA 2EIEA 4XHQA 4JY4B 3KLSA 3WV0A 4BMHA 3KPMB 4HJTA 4JG0H 3O2DH 4PGDA 4AQ1A 5HYJE 1L0CA 4PGCB 2AEPL 2UZYA 3ATBA 3GMOA 1QRNE 3H42L 1OD9A 4JHZA 3PQYB 4KMTL 4U1MB 4PJGF 2WD0A 4J39A 4Q9BA 3QIUC 1GS8A 1FVCB 4WO4B 4U1IA 3UGEA 4F37K 5E6YA 1DBJH 3ARDB 3E9TA 2D4OA 3GMRA 3QIBB 3GKRA 5FDWB 2MQCA 3KE0A 4AKOA 2EECA 5KBNC 1OF2A 2LFGA 2FO4B 3E9UA 3KW7A 2PWDA 5E8DH 1LO0H 1CG9A 1UVQA 3EYOA 3QQDA 5D1QD 3BKJH 1H3GA 2XNAB 4NEHB 4QYOB 1OD7A 1LTXA 1U58A 4YQXH 1K3IA 4G1PA 3EO9H 1GGUA 4G3YH 4FN0A 1U8HB 4HU2A 4ZMVA 1KXHA 2X4SB 1C12A 1ARLA 2NSXA 4OZIE 4DESA 2W9LA 2H32H 3I9PA 2E8ZA 5ECJE 5K9JL 2J43A 2H8PB 2GSGB 4FBEA 5CMAB 2BXYA 4U6YA 3THMH 3QQNA 3D2TA 3FNCA 3HKZA 3SKJL 1FF5A 2OJZL 2K5TA 3NSDA 3PXLA 5DJ0B 1XF4B 3P4LA 3KYAA 1LL1A 3LD8B 1LAMA 4UNVA 4R26L 1CDBA 5B38B 5ICYB 2VDML 2XQBL 2EVHA 3ARED 4KXCA 3IFNL 3MRJA 3KG5A 3RWEA 2AXGB 2ZW4A 3E3QE 4YHMH 3I6SA 4Z7WB 3ISZA 3WIIL 1I8IA 3KPLB 1NCAH 3OSVA 3ARDA 5I1IH 3FF8A 1UM5H 3PHQA 4AYSA 5JHAA 2O93L 4MWFA 4HJJH 5IVXE 4N2HA 1JGEA 2WTRB 4ELMA 3H7BB 4H20H 4FXGA 4ZODA 2EE6A 1CTNA 2ZOUA 4B60A 4HXBH 3FCGA 1T66D 2QV2A 4U33A 4PTUA 4ZFGH 5I1HH 3JUWA 4OFKA 4BKLA 4UNTA 4NGRA 2FAUA 4FG6D 3DX3A 1MAJA 3QGVA 2E46A 4CN4A 2ZEMA 3BKYL 1RMFL 2PJ9A 5KSVB 1AQDA 4MMZA 4EXPX 1FG2A 2I24N 4JQIA 5LAXB 2BCKB 4K9EL 1TZOA 1E90A 3T2NH 1CFVL 3KPSD 2X4TA 2Y7SA 1P9MC 3WHXB 4FQHB 1T1ZB 5DI8B 4AXWA 1ADQH 2JIXD 4V11A 2CLRA 5KOMC 3LNIA 4CJ0A 4ZMLA 1NGYB 3ARPA 1FYHB 3KR4A 3RX9A 1QP1A 4KDVA 3LZPA 2IH1B 1KDJA 1X7QB 1GGIL 3K8LA 3HZMA 5DO2D 4EZLA 4UF4A 2YAFA 1E6OH 1XBDA 4NXKA 2FCKA 2VT0A 4I3GA 4UF7C 3VXMD 3K46A 2BY1A 2CGRL 3JXAA 3G6AA 2OTUA 4FMKA 4HA1A 1I8IB 4JFTA 5I6PA 1KELL 3W2DH 3ZKSD 3VWJA 2X05A 2V9QA 4XMZA 1SYSB 1LK2B 1A4JA 3X2QB 4I5BA 1V27A 2R1XB 3DX2A 2WJ5A 3KNBB 5EOTB 4M6GA 3EXJA 3BAJA 1QFUL 2AJUH 3UG3A 2FEDD 2EDOA 2OZ4H 1HU8A 3DXAB 2VN3A 2I3CA 2ESVE 4FXLA 3FS9A 4AQOA 3NJIA 5JHDB 5KTAA 4L0ZA 2X3AA 1MFCH 1VGEL 3RGVC 3UZQA 4QO1A 4WW2B 3K1KC 1DCLA 4PVMA 3Q8FA 4XBEL 3VI4A 5DFVD 2AFNA 3LVEA 4G59C 4XC3H 4K2UL 3HMXH 1ED3B 3VD9A 5FF6B 5LAPA 3C09C 5I1CH 4EI6A 1F41A 3ZPDA 5EZIL 5HMNA 2H6PA 3WY2A 4W4NA 1NFIB 1A4BA 1A1NA 1O9WA 3GXIA 1VB9A 3NEXA 1N6VA 1F3RB 5EOCH 3HI1B 3PHOA 4PVNA 3RI5K 1AQ8A 1DQJB 4P2RA 5FGBC 2VH5H 2HRPH 2CNYA 4OLZH 4FZEH 4XBEH 4MCZB 4JDVA 1TVHA 3LRHA 2O61A 1U8OA 2X6MA 3EH4B 1UD5A 3WXWH 4N24A 1TJMA 3S3JA 3VARA 4PJHB 1CFMA 2G4GA 1Y7VA 4RDQF 5I26A 4F7EA 3AACA 1QSFD 2VKXA 3IRZA 3WFHA 3JQOB 5ABZA 3WGUB 2JMRA 4NUGH 4OJFL 5GISL 2AQ1A 3RNQB 3HHSB 5TDNA 2CGRH 2B9BA 2C3GA 2VM3A 5GSRB 4Z7NF 5IB3B 4HOXA 2BINA 5IQOA 3S37L 4TQPA 4HJGB 4UTAH 4AMKH 3QDJE 4RX4D 2OK0L 4Y1AA 1KYOK 2NX5B 1NEZG 4L1SA 4TTDD 5J9PA 3CK0L 2P5WB 2Z7ZA 2AJYL 4QRRD 1QR1B 4U2YA 5DEFA 3B2UC 5J5EA 3V0HA 3DMMA 3PWPE 4HJSA 5EO1A 3TN0A 2I27N 4P5RA 1QO3B 5GIRA 2GJZA 1Q0XH 1SN0A 2YLKA 1DCEA 2WWKO 1L9RA 5AKRA 5LCVH 4N8VA 4XNQB 1KGJA 4NWTH 3X12A 2WP3T 4P4KB 2J44A 3PCYA 4XGZB 1T1WA 4IDJL 5TK2A 1NIDA 3IDIB 3NCCB 5H37A 1NIFA 2VL4A 3RFRA 4LQFH 1UEMA 4H89A 1T3FB 5C0BB 3D87B 3FTGB 3MLPA 5A3IC 2G3NA 1KPUB 3WS6C 1A3RL 3U1SH 2YEZB 2VJ0A 3O3EB 4K3GA 3FPXA 1CCZA 3ISYA 5EUOE 1BD2E 3G9VA 3NBNA 3D33A 2ITEA 3IFOA 3MAWA 1HHJA 1P7HL 1VA9A 2VZVA 4ZTPL 3SEPA 1XZ0A 3ISRA 2CKBA 2BVPB 7TAAA 1A02N 1MJ8L 4G9FA 3SDCA 3NVQA 4NF1A 1J1OH 4H8PA 1J0HA 3MPCA 3GTVA 4ZNEE 3U4EA 4OZFG 3AXIA 5CGBA 1DVYA 1CD8A 1S46A 4B97A 3MJ6A 2ZUQB 1HOCA 3D69A 3MRIB 4QPEA 2WUCH 1U8CB 3BDBA 1KIQA 1PEWA 1NSNH 3LZRA 5T5FA 4ANXA 3KDMB 1N5YH 5C0IA 1HYSD 2YKLH 4XX5A 2L04A 1MHCA 5FV1L 3VFMA 4JM2B 4AJWA 4ZZFA 5JW4Q 3EC4A 4WCYL 3Q06A 4Z78B 5J1TC 3RJQB 2XG4A 4EMEA 4EWTA 2YFNA 1NPUA 1TYJA 1KLFB 2J8OA 4BQCA 3UZVA 2EC8A 4XMTA 2TRYA 2XQYK 3VGEA 1U0QA 3SBWC 1D6EA 1NAML 4UQ9A 5LXGH 3VW3L 3JWNG 4N2AA 5E8DL 1YYCA 3LXAA 4J8RB 1WZ1H 2PJBA 4F9LA 5EOQH 1Z3RA 3VWDA 3QJHB 1DSYA 1Q72L 1AOHA 2BOLA 4LL9A 5C0AA 3DO3A 4XGZA 4HS8H 1T22A 2JFCA 3F12B 2DKUA 2YA0A 3GZPA 4EVYA 1ZV2A 3BFQG 3HMXA 5CKAA 2YD7A 3ZK0A 2CCLA 4KMTH 5C07D 2DTML 3P40A 2JI2A 4EKXA 2BOAA 2ZSVB 5E03A 1OALA 2WO2B 3ZQ9A 2AEPH 3BAWA 3G08B 1NFDB 4LARH 1BVOA 4F6AA 5L2JA 1P6FA 4MJ2A 1W6LA 3V7AG 3TH3T 5SWZE 3QZLA 3FDWA 4MCMA 5GJTH 3MNVA 1RURH 1KLFA 5DZOA 3QNZB 3EF7A 5D70L 3RWHA 5BS0A 5EDSA 1L3WA 3IDNB 3WNLA 2A3TA 4AGLA 5A28A 4NN6B 3RDTC 3MGAA 2DY2A 4HKXA 4N0YH 5CJ8A 3MQIA 1N9PA 3IMUA 2YPVL 3NRFA 5IHHA 4MNGB 1KTBA 4J7RA 1JWMB 4PP1D 3RX8A 4P4IA 3SKNB 3EJQA 3TPUA 1B0RB 3ARUA 1YR0A 4PRID 4D9QE 1TTRA 2WBJC 3QA3A 1YJDH 3K6NA 4O2FA 1OZPA 1WICA 1CFNA 3CIQA 3LEVH 5T1DH 4HULB 1DFBL 4XN4A 1AIFB 4ZFZB 4Q9QH 1YECH 3MROA 3MV11 4LU5L 4XCFH 5TE4L 4KZTA 3V9EA 1ZV5A 1E6JH 3MLWH 1PY0A 2IDUA 3BPOB 1HWGB 3LRSB 2Y1AA 2C9RA 4HAKA 1OSZA 4KK8D 1HEEA 1PUAA 3FT9A 3QUYC 4KK5D 5DVKA 2FR4B 4ZRGA 4LCWE 5CLYA 1Q38A 2BNRE 3FTXA 2EDKA 1EBAA 4BRVA 4PIRF 3S98A 2K0RA 3VDAA 5BV7H 1HFUA 2D7MA 3CVBA 3IN0A 3WLBB 1MCNA 3D3VB 1ZS2A 5TFSL 2ZELA 1V8HA 4P2AA 3KL9A 4LAJH 3NJJA 4TTGA 3RGVB 4G82A 4UV7H 3UJJL 2DLGA 4MZIA 4KQ3L 4NM8L 4B9GA 5CU9A 3QK0A 3EJPA 1DEEB 4R96A 4JO5A 1OO2A 4KUCF 3GSVB 4HBQA 1P4IH 2Y69B 3WY1A 4H5SB 3FUJA 1K85A 4NENA 1L9MA 3H8EA 3SO5A 2AJSH 1HSBB 3F7RA 4TL4A 3O4OC 5AAPA 2VJ8A 4BQ6A 2K6WA 2AK4A 2ZKHH 4JFXA 5ESVB 1G7MB 2WJ7A 3MRKB 3RNQA 4MZ3A 4A6YH 1WFNA 4ODUA 1HI6B 4OY9A 4N2DA 4D8OA 1JK9A 4OGQC 4W9IC 3DGVA 1CGYA 4A1RA 3WC5A 4LSRH 5ICUA 4PRBA 2CDFA 4ADIA 1BAGA 1E2WA 1KGXA 3TWCH 2DWTA 5F0JB 2VXVL 3DJSA 5FX3A 1U2CA 5HJ3B 5JW3L 3OM3B 2OSXA 1I7ZA 1EO5A 3FFCD 2NY2B 4YNYA 4D94A 2QEJA 4GYBA 2XWBB 4UT7L 3CVHA 4WU5A 1QBLL 3GHBL 4GBXA 2J72A 4JRLA 4PJXF 1ZHKB 5F7BA 3CPLA 2E7BA 4HK3N 4LKCB 4LRIA 2VERA 3Q05A 1ZDSA 3NH4A 2EZ0D 4M1CD 5DWNA 4OKVA 4JX0A 2VZSA 1GCFA 1YYLL 3TIDA 2H6PB 3B34A 4LVNC 4DAGH 4WW1A 3EXNA 3X3FL 1FFPB 4PJAF 3F3HA 4PBVC 1CLZH 4LX9A 4M8QA 1RIVH 4WFFD 1CIDA 4S0SD 3VACA 3RVXC 1MLCB 2AV1B 3NN8B 2AJXL 4P9ML 2E6QA 1KENL 2HN7B 2WZ5A 1Z32X 1T6WA 4OCSL 3RVUC 4H2KA 3W0WA 4PJXB 5CCKH 1SLUA 4ODTH 1XGTB 5DD0L 5A2CA 1D5XB 5DQJB 1KLGB 3BLKA 3L1OL 3QNFA 5ICXA 4XPKA 5DHMC 5CCJA 3C9NA 2UV3A 3GMQA 2PPEA 3CXDH 3QEUB 1TKJA 2R0LL 3B2MA 3Q5OA 4LEEA 4Q2ZB 3B2VL 3PAUA 3UJIL 5F9JA 4QJ5B 2ZEFA 3RWGB 2YKKA 1NWOA 3O4LE 2OCFD 1GZQB 3EHBB 3QB7C 3QULB 4JPKH 4N0CD 4RRPG 4X6DF 5E8OB 3O81A 1FZKA 5GRVL 1BAFH 3BT2L 1FBIL 2IAND 4PJCE 4LE8A 1Z6JT 1L9SA 1FIGH 2R2BA 2VDLH 3F7KA 3MRFA 3Q2LA 5CSZB 2CLVA 4PJGB 1PJ9A 4G7VL 3Q1SL 5F70A 3D39E 1PD1A 3GI9L 5ESAA 1MFEH 5TDOB 3SKMA 2CR3A 2R69L 2FH8A 4AIOA 3H55A 5I19H 1ET8A 1WFUA 3WSQL 4AYGA 3WHXA 1D7DA 1BZ8A 2HRGA 4YSTA 4DGWC 1S9WB 4YS4A 4IBQA 3GZQA 3GMMB 2BNQA 4N8CL 3RGHA 3SPJA 2RIKA 3BKCL 4RWYH 5IESH 1BXVA 1GOGA 1YMMB 1Q2DA 1EHNA 3CIAA 3RU8H 4DGIL 3AABA 3NE7A 2R69H 4TSCL 1AGEB 5DHYA 3S0PA 3UG4A 4MB5A 4TOYL 4MCRA 2FJSA 3FB8A 3QIBC 3FO1A 5CD5D 3GO1L 4C2ZA 4A2GA 4KU1A 5F3BA 5A2BA 5IM7B 3P9LA 1P7QB 4FFYH 4JANB 2OSLA 1KZYA 2NUPA 3RA7H 4GMSH 3OZKA 2YD4A 4NP4H 1FH5H 2VIRA 2DJSA 3KNBA 3MLTA 4JPIA 5LCVA 2FO4A 1IB5A 5D7LE 2C3VA 1ND0A 3CHXA 2O5ZL 3QJRB 4JFDE 4ZUUB 1OE1A 2P47B 3BP7B 4W4OA 3T6ZA 1E67A 1GSMA 4G1MB 3TTSA 4DEUA 1LE9B 4YIQB 2FB4L 1ZEAH 1RUKL 4OCSH 5F89A 5LXVA 1QBBA 2EVIA 4NFCA 4JVUA 5D4QA 2DQIH 3V4PB 3HCVB 4MQXD 1UADC 2EBJA 2X7LB 2X12A 1BOGA 3FB8B 4LF3B 2REFA 5ID0A 3DIVA 3O9WB 4OCXL 1D6VL 4WHYH 3KYOA 4DAGL 3EUUA 3DVNB 1JNLH 3VQMA 2IALB 4GO8A 4MJ5B 1CL7H 2X7BA 4NGNA 3VFSA 1FFNB 2ZXBA 3S7GA 3MYZA 1CVSC 4KROC 1NQBA 2ZUXA 5I6KA 4LRNH 5J7CC 2XXFA 4NWUL 2CIJA 2VQ1A 2XTJD 3T0AA 1GJUA 5C1MB 1G1KA 1V3JA 3VXQA 2UWEF 5KS9E 2WLMA 1TVDA 5CSZA 3A0OA 2AGJL 3QFJD 5FUCC 3I9SA 3LN4A 3QDJA 4LSVL 5HY9B 4HKJA 1E27A 3H7BA 4B9CA 4BFKA 4NLAA 3IDJB 4A7TA 3G6JF 2WTPA 4W9DC 5B8CC 8PAZA 4KOSA 2QADB 4A6YL 2GUOB 2ATPB 4P5MB 3AQXA 1NGWA 3CQPA 2ZCHL 4YBLC 3JV4B 4YK4B 2C9PA 3GSOA 3ZDYE 1P5VA 2J3SA 5JA9A 4G6KH 3M88A 5EBWB 4HNYB 2XXCB 2GAZA 3FJTA 1JDAA 5ABAA 3S6FA 1GS7A 1TZHB 5CINH 1T21B 3HB3B 2UWEB 3AMLA 3US9A 4LVEA 1A2ZA 2DD8L 2WANA 1C7TA 1ZA6A 4FFTA 1FNHA 4IHBA 3ME0B 5GQBA 1T5WB 3E6FB 4NQQA 4UOJA 3CFMA 3RY4A 5SWSA 3DROB 1JPTL 1E27B 2DIAA 4KVNH 1E9PB 1W0WB 5IGXL 2X2IA 2HLFD 2CK0L 3BUYB 3IF1A 4NQTA 3GSUA 1IU1A 4KNTA 3DYPA 4YHNB 2AFSA 3DJZA 1CN4A 5F7KC 5LGJA 1L6PA 2CO6B 2EUZA 1F0LA 4HW6A 4NQUA 1EBPA 2R2HA 2VXUL 1J7VR 1QSMA 4L5FL 2E9IA 4G43A 4FTVD 2NXYC 1NAKL 3BE1H 4L4JA 4ZI8A 3L5XL 1NC2B 5I0YA 3OMAB 5ANHA 4OLXH 3HHRB 2CPCA 1PSKH 3PS6A 4AVJA 3GTTA 4KX8A 2QTVA 1JZ2A 3NPZB 4IMLA 4LQ6A 4I7ZC 5ISZA 3S9LA 2NY7H 2E0PA 3N6YA 5J6HA 3QZWB 3LODA 4N9GB 2R8SH 3AT8A 5IQNA 2FIRT 4D0BB 5TK4A 3WO4C 2C6CA 2BX5A 1UXWA 4J4PA 4ZSOA 4M00A 5B39G 3WELA 1ACCA 2E9BA 1BD2A 4WWVA 1PL3A 1DJGA 1QNZL 5ANME 5FHAL 4EKJA 2DKMA 3QDHA 2ZUTA 5FK9A 3FN0L 1ID2A 3HZ3A 3BHBB 2AW2A 5T3XE 4JGNA 4GXUN 1GZHC 3D18B 4PXEA 1EAPA 1WO2A 4Z7NB 3K1DA 4Q6YA 4QT5B 1XGQA 4A6YB 1MRDL 4G6AD 3H3KA 5KEZA 2I9LA 2IDQA 3RHWK 5IJVB 1P4BH 5FFOA 2R7HA 4Z0XB 2F53E 1J1XH 2P5EA 4OCYH 3VWKC 3DA0A 1OGTA 2HLEB 5EB9A 3WFBH 3EYQD 4ZD3H 4LARL 5DCCA 3BCDA 2EQDA 1A8JH 4C57C 4QLWA 3PWUB 1F1DA 3FFCE 5F72S 1XDTT 1EUUA 4RQQA 3S8GB 3K2UL 4KKLD 3TBTB 2DH3A 4E5XB 3FQ4A 1GTFA 4BINA 4JDZB 1ZLVH 2ENYA 3IVKB 4JPVH 3F7PC 1DLFH 1ZANH 3R9EA 2IFFL 2R23B 1CICD 1KYAA 3K6IA 4KI1A 4N2FA 2X4QB 2YUZA 5FHBH 5ESAB 2J6EA 2B4DB 2XJKA 3B3SA 3NIFB 1EHKB 1FFRA 7CGTA 1P1VA 1I4FA 4TSCH 1IM3B 4KK6C 4AC2A 3V4PL 1MG3C 2YPLA 1KB9J 3P9MA 4UM8B 2XVLA 4B9IA 4E42B 2QKIB 4P2OD 2LU5A 4M6OH 4M7ZC 3GXTA 2Z3FA 1JYVA 1J0ZA 1AD0B 3FUIA 3SKNA 2NT0A 1FNEB 3WSQH 4JZJC 4UMSA 1M1XA 2WLZA 1MHEB 4DUVA 2WKLA 4PXBA 4DEPB 3GI9H 2FS5A 1XIXA 3REWB 4CN6A 4G7VH 4WFED 4ZMWA 2BJMH 4GY4A 4RISL 1Q2YA 5CCHE 2Y2WA 1RJZB 3VTTA 2MTAA 5KN5A 4P23A 3ABMB 3ARFC 4QLRA 2OTWA 2ADFH 3AU1A 4UILL 3EFFA 4KAQH 3U2IA 5KZCD 4ORFA 4F24A 3SPHA 3SKOB 3UYPA 4ONUA 1OAXH 5SV4A 4WWKC 5HHME 2VSDA 2ZX8A 2X6VA 5DEGA 4LPUA 2K7QA 1NBQA 4G5ZL 5EPMA 2OMTB 3FB5A 1M7IA 3FT3B 1TMCB 5DD1L 4XPTH 2Q0YA 2DN7A 3HUVA 4O23A 2WTOA 1A9VA 3TBSA 1UCBH 5EU4A 4FQXC 4KH9A 4PK2A 3RWFB 2Y07H 4B14A 4X4YB 2NW2A 2CIIB 5GZNA 4OCRL 1FLTX 4FKEA 5DVMA 5FO9A 5BVPL 3N7ZA 1URZA 3I6GA 3PL6A 3AS3A 2P80A 1CDCA 4RMBA 3S5LA 4DTGH 3ULVC 3QDMD 1L4IA 5T3XL 2Z0BA 4KY2A 1ZT7A 3GEWB 3UACA 4X5XA 4HHAA 4OLEA 2KLRA 1CF1A 2FX7L 3V0VB 4KOTA 1JF6A 4MAYD 1N19A 3F7YB 1H8LA 1IAKA 3W11C 4GRMA 1XF3B 3H7LA 3I6KB 1OARH 1RZJH 2PWEA 2X40A 3MRHB 4R4NC 3RL1B 1QSFE 3DOSA 4YHKL 2VXVH 3QNZA 2UZXA 4FG4A 1IC4H 4H8WH 3RWIA 2IWEA 2IF7A 4ONGL 2YD6A 3FH4A 3FTUA 5JHLH 1BECA 1MWAA 3F5WB 5ICZB 4F15C 1JZEA 2HYMA 4C55A 2FYVA 2NYKA 3UIZA 2H5UA 1BZQK 1SOXA 3FU7A 3V6OE 3HE7B 3U0WH 1UZ6E 4QAWA 3SDCC 1YSJA 4XH2A 1EVUA 1LEKB 4ONHB 1Q9OA 2JWYA 3KXFA 3SDDC 3HG2A 5B22A 1ZIBA 2MQ3A 4DPCX 1QNIA 4XMLL 5I15L 3MREA 5EN3A 5AVSB 4OLZL 4CGMA 4BZYA 43CAB 2BM3A 2ITCA 3CFDA 4S1RL 1JVLA 4IDLA 4JFSA 1U8KA 1RXLA 1QFWM 1T1XA 2DLTA 4JFQB 4JO1H 4P2QB 1CGVA 4XR8C 3AGVA 2BRRL 4WK4B 1VACB 4ZPVA 3R7QA 4MMYA 1Y7EA 4I1NB 4XC3L 2P49B 1TU2B 2GTWB 5IG7A 4NCZA 1EZVX 3ZYZA 4XE5B 4NT6B 5FGCB 1I12A 1VFAA 4FQPA 4OZ4B 3TV8A 4LVOC 2N0MA 2PTTB 2XN9A 3DR8A 3HG1D 1S7RA 4EI5C 1V54B 1WBXA 4XZ4A 4J6RH 4P23D 4I88A 1FNAA 1CB4A 3O6FA 4YE0A 1JNHB 2DMKA 1PZDA 1R4XA 4R7DA 1J10A 2R0WL 2UZIH 4WSGA 3BDXA 4XZUA 2VZTA 2Z3NA 3HUJE 1MN4A 4K3EL 2ZJSH 2BNQE 1NDGA 2H45A 2AJ3B 2J88L 1G9ML 1N59A 1O5DT 3V0DA 4PJDA 1A14L 2ADGB 4PV8A 1A7BA 2GHZA 4YXKL 1XD1A 4PY7B 3N1GC 2NYYD 4XC1L 1DQML 1ZHNA 5SX5H 4Y7MA 1X4YA 3GS4A 4I4WA 3MODL 2D7QA 2REEA 5D5ME 1T0MA 1L0PA 1RK7A 3PPSA 3ZZIA 5DQDL 4N0YL 4JFOA 1JP5A 3GXMA 5D1QA 5JOPE 4P2RE 4OIAA 4ANUA 2V0AA 2ZKXA 3KYNB 5C8JA 4NFRA 2JE8A 4ECNA 4AK1A 3S3PA 1OSPL 4MJIE 1A4AA 2OJ1A 4P4RB 5GS0H 1JNNL 1T1YB 5BWAB 4J3UA 4UQCA 2X38A 1VZIA 3NZ8B 5AG5A 4HJ0C 4F9PA 1TJGH 2PO6B 2PF6A 2YMXH 1NCBH 4NHUA 3TZVC 2IC2A 4M61A 5HYJB 4MFLA 5T3ZE 2CALA 4YHYC 3UZQB 1LP9E 2XT1B 2WYTA 1HK6A 3QUGA 4FZ8H 4XMXA 1WA0X 4K7FA 3K6DA 5HJ3A 3CXHJ 2UVEA 3QPXH 1NL0H 1ORQB 1YJDC 5B4MC 2HWZH 3BZEA 1U8CA 1HI6A 2J6EL 4XWOD 1N6QH 4ZUWA 2H3XC 4N2CA 1FNOA 1PZSA 3VXUD 3ULVE 1IEAA 3PJLA 4H2AA 2Q3XA 4XNZB 4Z7UB 3O6FB 2QKIA 4L4VE 3M1BB 3V79C 3V9FA 4JREB 1HYSC 4HJ1A 4GS7C 3VH9A 3KPNB 2DQUL 3KXFD 3S9MA 4L3ED 3WHE0 1OLZA 3HAEG 1EO7A 4WV1C 2Y3NA 2GY5A 3KBPA 5BCAA 1AZBA 2Q9OA 3GBNH 5DF0A 5DUBA 3LQZA 5IB4A 3C6LB 1X12A 2RR3A 2H47C 1CLOL 2ADIB 4BFIB 4W9LC 5TPWH 5SWQB 1WZAA 2CWRA 3RUGE 3BI1A 1XTMA 5HI4D 5FO2A 2O5XL 4GKNA 2GU2A 1NEPA 3VX1A 1EAQA 4YSCA 3RWDA 3IT8D 2AV7A 1AE6L 2ZYHA 4Q9RH 4V1DB 3UAEA 1MJ8H 2IG2H 5LNDA 5H84A 3MJ7A 3CN1A 2X5PA 1AD9A 1O6VA 4WJBA 1S2EA 4E41B 4GQ9L 5JOPD 5DMGD 1YEKL 2VR5A 1ZS8A 1K72A 5DURB 2NNFA 3R06A 3P0VL 1MCQA 2OM5A 2EDTA 1MXDA 4JKWA 3KXFB 1V10A 2J8UA 1Q9OB 3OSKA 2WXPA 2GSIA 1SJHA 3DMMB 1RFDL 3K4AA 2G5BA 4OBSA 5EIIG 1OPGL 4YZFF 12E8H 4ZOAA 4F8TA 2XKNA 3O2DL 3F62A 3KAAA 3G04B 2J25A 2F9BT 4QHMB 4PJIB 3IWVA 4TYUA 3T04D 4B12A 2X4OA 4C56A 3AM8C 3QWOA 4HPOH 2EYSB 4BWTA 1IFHL 1X5AA 2ENPA 3JT2A 4NQVB 2OXGA 5TE6H 5C0NC 1PYTB 4OP4A 4A2HA 2UXVA 1QUNB 2IMNA 3TBTA 2WVVA 2HUZA 4IIQA 1D5IL 4Z3FA 1YHPA 2QHRL 4I85A 4MJHA 4OF7A 4AYDC 4AV5A 1MEXH 1G0XA 5G4OA 5KG9B 1IM9B 4N0UB 1MH5A 2NPLX 4QMEA 4M93C 3MXVL 5B21A 5ALCH 1XIWC 2VE6B 4NC2B 3FUHA 2Q0ZX 5L9DL 3R9FA 3L9RA 3MBXL 5DYOB 3RB5A 2XA8H 4YLBA 5A2JH 2Q7YA 1IFRA 4JDVB 5DT1L 4FHBD 4I77L 1CXIA 4BELD 1M05B 2GTWA 2VSMB 1BZ7A 3REVB 1OAKL 1UVQB 4N1HB 4JRYE 4WKXA 1W0YT 1QLEB 2DQEL 5MENE 3DETC 3IJHB 1CF8H 3GB7A 4I77H 4ODVH 2P6FA 4XPHH 4HFWA 2KI6A 5GS1C 1DUYB 1PVHA 3HR5A 2XA8L 1SXBA 2HT4C 4G7SB 5C0AB 5EMIA 5C0DA 1HDMA 1IM9D 3T8MA 1OP4A 3MCKB 5L9DH 2ODHA 3I75A 5E00A 1HEHC 4ZTOH 1E7UA 1MUJA 1RK1B 4PJCB 5C92A 5GZOD 1BREA 4X7EC 5G5DB 4GXFA 2APWA 2CDEA 4PG9B 3QXUA 2YA1A 2ZPKL 2HUEA 5SX5K 1D5IH 2Z31B 3NFSL 5D2LF 1MSPA 5D7IF 4R97C 4FFWC 5JQ6L 1XCTA 4AMXA 4KLVA 3P1VA 3B9KD 5IBUB 3MRPA 3HBZA 1YEIL 4DNLA 4XBPA 3DUSA 3TGXA 2TSAA 3D39A 3N41F 2O4HA 4MRIA 3KPRA 2F5IA 3DMMD 1KJ2H 1MOEA 3KWWA 4R5XA 1PD0A 4KK9C 4PS7A 5KANI 1D5BB 3HBGA 4ZS6D 4M9PA 3VI3B 5B3JE 1OTSC 1PG7H 4OV5A 2CF4A 3FZUC 1BDYA 2F15A 4K8RH 4KRPB 3VTMA 1O7DE 3BWAA 1FT7A 4MXQD 5FA3B 4OI7A 4GRLC 1QSTA 2N4IA 1EHAA 1RJYA 2ZG2A 3GLAA 2ZOFA 2IALA 2WSPA 1DQDL 1OAZH 4FG2A 5C70A 4GIPD 4MFHA 2Y7QB 4FMVA 5KSVA 4AG9A 2NYQA 2TSBA 4TNFA 4U1IB 2V8HA 5HPMA 3C2AL 4MVBD 5KSBA 2OZGA 4OQTA 2AXWA 1P5VB 4LDOB 4XNXH 4W4OC 3A4EA 1I1RA 3DSFL 3VFUA 1BGXL 4Q14A 3LPOA 4QRTA 5FYJE 3U2SB 1XE4A 2F54A 1NEZB 2D2OA 2EIMB 1PZ5B 4XRCA 3G6DH 3AUVA 1MQKL 1G7HB 1ZD6A 1CLOH 5E5MA 4U3SA 1QAWA 5F7UA 4KUZH 1AGCB 1KEMH 4WSJA 3HZVB 4C56D 3AADB 2O72A 3GLZA 4HUMB 2E9GA 1G7PA 2A38A 3DURA 4J3VA 3NJLA 4X6CA 1YEJH 1JZJA 5F49A 4F57L 3FCTA 5CJQL 4YGOA 1NIEA 2A6DA 2VIRB 4JPIB 1T83C 4LKXB 3WLWC 5FECB 3VU2A 4MAYB 4ZFGL 1TKHA 4DP8X 2APSA 1ZK5A 3BFOA 3NPSB 2XWTB 3N42F 3MNWA 2RQEA 3DWTA 2NXZD 4IK7A 4LGRB 5GGUA 4J3OF 3MBWB 5J06A 4PJEA 2R1YA 2PPAA 1YN6B 4LSUL 3WAJA 2J9AA 3NAAH 3VFGL 1KBGH 1LEGB 1Y0LA 3FCSB 3VI3A 2X7LA 2EACA 1ZK9A 4OTXL 2M8XA 1DP0A 1QLEL 3TBWB 2OA9A 3UY5A 4Z6AT 4S1DC 3NJHA 3BIKB 3OR7B 5J8OA 5ITBL 4X99A 3VGAB 3GTNA 4CA4A 2BRQA 4N2NA 5CJQH 1CE1L 1MNUL 4XBPB 3SO3B 1W72A 3G5WA 3VDBA 1Z9NA 3QSKB 1N12A 1AJ7H 4H8WC 2QLVB 1WWZA 4X5QA 5E99H 4DJMA 1BXXA 4G43B 5EWIH 4XCCH 3Q6FB 2OXHA 4YHLH 4Q56A 2ENJA 4ZYKA 1M6UA 4LDEB 4PJHE 1EV2E 2WQVA 3HG3A 1TJHH 3IVKA 1CZ8H 5DC2A 5ILTH 3P9LB 5E1HB 5D71L 1ZG8A 5CZXC 4XO5A 5LLIC 4CYPA 3SBRA 1DQLL 5DYFA 3T65B 2Z3PA 5DYOA 4RMVA 4YFLI 1EAJA 3PWVA 3FEDA 3EJYC 1A7OH 4WUUE 5DJ6A 4B9YA 3I3EA 4Z3IA 1TETH 2CKBH 1S7FA 5AVYB 1IT9H 5C7ZA 1RPKA 4RGMB 3RYMA 3IJSB 2WOYA 1HNGA 2CE6A 4AMWA 2IQ9H 5BV7C 1DVSA 1MJJA 1SJVA 5E7FA 1FG9C 1KTCA 4PJEB 2FH6A 1ROCA 2Q1EA 3VQ2C 3HEIB 3HG1B 4O4YL 1DBJL 4TNVF 2WINB 3RL2B 2J7LA 3UH8A 1CD1B 1LRZA 3APCA 5EOTA 3IJYB 4MY3A 1UJ3B 1XH1A 1WK4A 1R43A 4TSBL 5TF1L 5ILTL 1IFGA 1I7RB 1YUHB 4MZ2A 3I02A 3QAZC 1TJHL 1UH3A 4XVJH 2YZ1A 3DSBA 2GUOA 1Z4RA 4CMHC 3BVWA 2ZOWA 2ODFA 3BHBA 1UWFA 1NC4B 4W9CC 4OI9A 2ZTBA 5F09A 5E99L 3IJ8A 3T0EC 4FNPA 5LQBH 1CE1H 4L3EA 3IO1A 4JHAL 3S6GA 1KXQA 3F64A 5E5RB 3UYRH 4BHUA 1J8HD 2HKHL 1AR1D 1HVXA 2FZ3B 3H3PL 2B1AH 3KPQA 3MLRH 3EH5B 4IBWA 3ULVH 2PMZA 1C5CL 2F5BL 3T6WA 1KTLA 1Z9PA 5DEZA 3IAGC 4PV9A 2IDCA 4ZSOE 1N26A 3QISA 1CD1A 1NC2A 4P5SA 5E95B 3QCUH 5F1KC 2GBVA 5D6DA 4J3XA 5EU6E 4ODVL 3OJ2C 1ZVHA 4XXWA 3C26A 5LGHH 4N2OA 1PF3A 3Q2WA 4QF1B 2VZ1A 4AYMC 3BHXA 4FERA 5D2LA 1SF3A 2DQEH 4FXTA 3RZWA 4DVRH 2XPGA 1JV2B 2AQ3A 1B3IA 2BZCA 2HJFA 4M7JH 4H25A 1EQWA 3VXTB 5L0QC 4Y9CA 3C6LA 4J8QA 2V7HA 2BEIA 4XAWH 2BCMA 2VN7A 1TUPA 3BVTA 3QG7L 3PXJA 1JHKH 5JHLL 3QO0B 4H40A 4X2UA 4KTDH 3FT4B 1BQUA 1OW0A 4LIQE 1LE9A 3CN2A 2GJ6B 1H6FA 3STLA 1UTDA 3BN3B 4L1HA 4OGYH 1EAPB 4KUZL 4C4KT 4KS9A 3RBUA 1OARL 1RZJL 1ZHBA 5ALBH 4PIBA 2PJ1A 1A47A 2WB1A 3MLTB 4TPRH 1IU8A 5BZDA 1WPCA 3QDMB 4TSAH 4LCCC 3W0WD 2Q8AH 4J3SA 1TZHA 2N0KA 5B39A 2EXWC 3QRFM 1IYKA 5DJCA 3UL4A 1A2YA 1KIRB 4PK3A 4XCYB 1RVFL 1IGJA 2EIZB 3BPLB 3P2TA 1IFHH 3A6BH 2VDPH 4GW4B 2PW2A 2VDNL 4BH8A 4Z5RA 2WXOA 1XRYA 2R51A 1VIWA 2Y07L 2Y36L 5HXMA 3T77B 4A38A 4OAEA 3OG6B 4MYPA 5HGBA 3TFKD 3SI2A 2P8LB 2QPFA 4YHZL 2A6KA 4FYRA 5GGUB 3SCMD 4FD7A 2ARJB 2F18A 4ZXBA 1WS8A 4CVXA 4MX7B 1QBML 4PJ5B 5HYSG 3CH1A 3KJ4B 5I28A 5G20A 3BZ4A 5H86A 2ERJB 4NPKA 1LMKA 1CPUA 4RGOH 2Q7YB 3DSNA 3MZTA 3BDYL 4OZIB 3LTVA 4PJ5D 4HHWA 2XFXA 3REVA 1HWWA 2OLDA 1IILE 1XAKA 3RKDC 3SCMB 5L6YL 4XB3A 1TTUA 4G7YL 3DRTB 1TITA 3FFDA 3WN5A 4IS6A 1CDUA 3WFCH 3GMRB 4X6CE 1RZFL 4FD5A 3NZHL 4QGTA 5FA4B 2WO4A 2CBTA 2J1ZA 2JKIS 1CBXA 3HG4A 2ZXDA 3OWRA 3Q6GL 2F54B 4ZOCA 2G2RA 2Q8AL 4ZQTA 3BQVA 3QNYB 4TSAL 4F8OA 2D0FA 4Z7WE 2AABL 5FGCE 3S6KA 5ALBL 1W80A 5LNEA 3T8XB 2ZENA 3N5FA 1DZ0A 5SWSE 3IJEA 1QLFA 4FQXA 5T3ZH 3OKMA 4JO3H 4M7LH 4R6TA 5I8KL 2DJUA 3FCTB 1KF9B 1ZDQA 4MA3A 4WJKB 1WT5A 5JLZA 5FUZL 4X98A 4JG9A 4FMFA 5EU6D 2Y0MA 3DO4A 3HMWH 4KDWA 3VI4F 2GJ6D 2YGVA 1KXVC 3QI9B 5CEYB 2VWEC 4OF8A 3LB6D 1HHKA 4K9EC 1JF5A 4U6XA 4CGNA 1RLBA 3BP5A 5KVMC 2W88A 3EG9A 2E27H 4U7KA 1ZT4A 3GJEB 4OIBA 2BP3A 1AKJD 1H3TA 1S7WA 4MAUL 2CO1A 3O9WD 2KDGA 1HL4A 3HRZB 4ZPTA 3ZLQC 5JPNB 2YMXL 1OK0A 2BNQB 3I84A 4DGVL 4UNIA 3L7FA 1MHCB 3T0BA 1AP2B 1JOIA 1H15A 4JHAH 4X7FC 4N2BA 1PPIA 5DQ9A 4AH2A 2PP8A 2FO1A 2VDQB 2JLMA 2FJFA 2MCPH 4K5PA 4PWJA 1XF5A 3P0YL 4W93A 4EVNB 1KUYA 2ZSVA 3T4AA 5GRVK 3GMNB 1HSAA 2Z7YA 4B95C 2H32A 2IEPA 3PGDB 4YDVB 3MFFA 2D3NA 3Q44A 3PDDA 5I0XA 3NUKA 3WS3A 1NC4D 1JD7A 5BVJB 4N0FB 3QI9D 2AJ6A 3A6OA 1NCCH 2F19H 1NPJA 2DQGL 4QHLA 2P48B 4RIRB 2EEAA 1A3LH 5AOIA 4QXTA 5I5IA 5LDUA 1AS8A 4KVME 1AACA 3T4AC 3QYCA 5KVFH 5IOPA 1WFJA 2HX9A 2YXMA 4G7QB 5I1EL 4IRZL 4JFYB 5E1QA 3OZ9L 3TBBA 4DPRA 3HE7A 4B9PA 4N2KA 2R29H 1I85C 3L3OB 3WIAA 1E5AA 2VMEA 1TSHA 2VE6A 4YZWA 3N1QC 1E2VA 2BS8A 2WSKA 4CMMA 4MJ4A 1PJWA 3GIZL 2O5XH 5IREA 4FUUA 2NY1B 3WBDA 1OSZB 2KDYA 3ZKND 4A2MA 3CU7A 4UINL 4LCUB 3V0FA 4YHLL 3KKWA 4LCVA 1A7PH 1MJAA 3OAZK 5EO1B 2BPBA 5F88B 4D9RE 4ZMNA 3LEXB 2PJ6A 2WSDA 1ECZA 3WJLA 2BVQB 1BFVL 1AJ7L 1INDH 3PNWA 4IOSA 3DR6A 1ZE3H 2VUOA 2BFGA 1U2HA 4KKNA 4KVNL 4EN3C 3S5ZA 1CFNB 1VKXA 2BSSA 2F8IA 5E4IA 4ZUSB 3TVMD 3U6RB 4MI4A 5DFAA 4B13A 2COQA 2GSIB 2L0DA 3CTTA 3CZNA 3DNSA 1JHLL 3PV7A 1DQTA 4G72B 1KCRL 2G9HA 4FYTA 4IKJA 4Y19E 2AEWA 3MRQA 5F8QC 3GMQB 5IFJA 2EXSA 4HPYL 1LP9A 3GSWB 4HU8A 4FKKA 4PS3A 1JZ4A 3VGFA 5IW1A 3T6QC 2X4OB 2EICA 3WFDL 4ZTEA 2Z34A 3QXTA 2J55A 1EMTL 1ZRUA 3DECA 3FTVA 3QO0A 5FYJU 3CXQA 1X5IA 3MBED 4H5SA 4ANWA 1MVUA 4X4ZA 1NCTA 1S7RB 3QFJB 3RBSA 1PZ3A 1HSAB 3UC0H 4JD6A 1RUAH 2YAMA 4H8WL 1DDHB 1M71B 3IKCA 1YVLA 3B7RL 1BBDL 2UVFA 3BD4A 4LSVH 5DLLA 3LKPB 3BSZA 4V2CB 1MQKH 4Y2DB 4BUQA 1YNKL 4UFXA 2Q44A 3WMSA 1H3XA 4XPGH 1T1XB 2VN4A 5I6MA 1XWVA 4KTYA 2FX7H 5EO9B 3ZO0A 2C4FU 1AHWC 2XPZA 4NWUH 3K8MA 4WKZA 3CPLB 3REWA 1NGXA 4NQCE 2EE2A 4JLRA 2YNCA 1TCRA 3R4DA 1U92A 4OM1H 3EGSA 5DVNA 4DP9X 4CYOA 4IKKA 2YQ2A 4OFPA 2WGXA 3MRGB 2DQFA 2JSFA 5KVEL 5FIEA 2B15A 5A1AA 5LNGA 4IGBC 3BP5B 2IQAA 2HPOA 4NIKB 3OC5A 2R0ZL 3P11H 4Z8FL 4IMKA 1AR1B 1S7VA 1JZ8A 5CO1A 4ZUSA 3UZEC 4JM2A 4PRHE 5E51A 1BIIA 3LRLA 1D9KB 2POKA 3LKSA 4Y2DA 1Q4NX 1TTFA 4XPBL 3D4YA 2BS9A 2BFVH 2G3TA 3GSRB 2O5ZH 3FXIC 1CM0A 1NCWL 1P7QD 3PDOB 1OAYH 5AZ2L 1KIPB 3M17B 4FQQB 2O30A 3FQYA 2V7HB 4Y16A 3RX5A 2N7BA 2KT6A 2WLLA 3GUTA 1G7LB 2EC9U 2WBXA 1P7KA 5K59F 1SQMA 2JI1A 4MHZA 1SN2A 4JJ5A 2GIMA 5AENA 1IBGL 4JO1L 2ZPKH 1NKOA 1IMHC 2I85A 1S5HB 2G0LA 2BJML 4RISH 4PJ7B 5DD5H 2Z31D 4X5XB 2NNRA 2IOOA 1CWVA 1QQDA 2NQ3A 5K5YA 5IVXA 5E4AA 4P5TC 2NW2B 1GW6A 2PW1B 4YBHA 4LGSB 5FWQA 3FRPB 2LW3A 3I6GB 2BVYA 4R5TA 2Z9TA 3KR3L 1T1YA 1WFMA 4IIQC 4R4FH 1I3RA 1GPOL 5HH1A 2OMZA 3IK2A 3QUMB 3HPLB 3K3QA 5D9SB 2JI3A 3GNML 3AM8A 4H0LC 3QJZA 1Y18A 4N8VB 1FZOB 4XNQA 2LU7A 1GZPA 1IGYB 1HHGA 3DKHA 3AG3B 1BLLE 3EFAA 3HC0B 2ORBL 2BERA 3ELQA 3L08A 4MNHA 5DZLA 3SDAD 1UWYA 1NDMA 4PRIB 3KDPB 3Q0HA 1X5HA 4YHOL 5J56B 4L0YA 4XCYA 4AQEB 3MXVH 2IGLA 5FYKD 3FOLB 2XEFA 4XAKD 5K8NA 4NZRL 1FFOA 4CPAA 1AP2A 3EFFB 3IEHA 4FLOA 3FCBA 1OT1A 1T89C 4E9XA 4Y1AD 2OOTA 4AKPA 1UG9A 2BO0A 5A16A 4NZDA 4OC0A 1KIQB 1KYDA 1UQSA 4XBMA 4MAYA 5GRUH 1WBXB 4BZ1L 2VLLA 1M4IA 3ESOA 5H35A 3E80A 2X4RA 3R18A 3NIFE 1MRDH 4G9DA 5MERA 4OM0L 5F7YC 4NO5A 3VQLA 1R3KB 1BF8A 3RFZA 5C07B 1Q9KA 2CUMA 3U1QA 5C71A 5D7SH 4WFEE 1HDUA 2ESVA 3PHQB 2LU4A 1KFAL 2K78A 1Z5HA 3QUXC 2QVKA 2NY5L 2EH8L 3GM0A 4A7UA 4J1UB 4OLLA 5F46A 1P4UA 4XPTL 5F48A 3N0AA 1BQLL 4F91B 2K3TA 3ZHKA 2NY2D 2QQNL 3EO1B 4YWGH 1A6AB 1X9LA 5F1IA 5CWSB 2BP0B 3W81A 3R1KA 4NKQB 5KSBB 1YEKH 5GZND 3OKDA 3SHPA 2JKWA 4R5VA 4I13B 5JPMA 3O11A 2R39A 2EVGA 1LO5A 2GW5A 4CVZA 3UTSA 4WLCA 5IJDC 3MRHA 1PSKL 1RJYB 4JM2D 4PG2C 1CFTB 3ZTDC 1TF9A 1XB3A 3C5XA 4PJ7F 2J4WL 3FQUA 4UBDC 2DWDA 2WLHA 3VYPA 1FYTA 2QJ8A 1RIUL 2DLFL 4R9HA 3AXLA 4L9LB 2B59B 5ICZA 4WWID 3QEHB 4G6MH 1S7NA 3VYOA 3F5WA 3SDYL 1BJ1J 4MHPA 2OB0A 4G11A 3PP4H 1KT2A 5I82A 4KRPD 2Z0ZA 3OD3A 5TD4A 1C7SA 3CHRA 3CVHL 3C6LD 3IFPB 4BA8A 1KBVA 1TKWA 4PMFA 2M26A 3ZBMA 1JPTH 3R19A 2WYRA 1Z9UA 3MTXA 3N43B 4KQ3H 4P2YA 2APTA 3V4PH 4J3OH 4PUBL 4WY7L 3HG1A 3TO4B 1M6OA 2NY5C 3U48A 3RGBA 2PJ2A 4X7TB 1WCBB 3WJJA 5DHVA 2CAKA 3O6FD 4Q6IC 4I0PD 3B9KB 3GSNH 3VXUB 2QFRA 3L3JA 3GLJA 3PIQA 4XMPL 3VD2A 3VU1A 4CDGC 1ODUA 3I50H 2YQ3A 1ETJA 4KXZI 5JPMB 1N2RB 3GXPA 1ZXKA 2XWDA 4H1LB 4JRXD 1UD8A 1TJGL 4KHXH 5T8IA 1R34A 3ETTA 3GBEA 4CRPA 4Y49B 4O02L 4UDTB 4N87A 5CD3A 3SGJC 3FFDB 3WN5B 4OZGA 2YLHA 1A22B 1G87A 2BNRD 2YOCA 3C5ZD 2PDOA 5LGJB 2Y5QA 3BSGA 3RNZA 3EOBA 5A6IA 4YE4H 3HI1A 3PHOB 2BHZA 4QC6A 3BUIA 4PSWA 3QIUA 2FTAA 4MX7A 5DJZA 1PCXA 7PCYA 4FAIA 3S3SA 4IU2A 3W1ZA 2JELH 1FNFA 3DROA 4YOKA 3WKYA 3MO1A 2VC2B 4POZD 1Y6KR 4PP1C 3ZKXB 3US0A 1CURA 1N4XL 4JB9L 2JQZA 4CGUB 3O6ML 1CS6A 5HXDA 1ACYH 2ITFA 3RPKA 4PAZA 5C0RL 3JUYA 4GRWE 1WWBX 4I9WD 2EABA 2YARA 1I8MA 5KSAC 3QJFA 4HIXH 4K5NA 5DJ8B 4R87A 5E4EC 2EKSA 2WQSA 4PCSA 5EZOH 1E8YA 5AGEA 3OBAA 1FO0A 1T7XA 4FL4B 4Y2OB 5IBTL 1MCFA 4U1LA 5F44A 3HS8A 4YE4L 3ZT6A 2MJWA 1SHMA 1EJOH 3R8QA 1MLCA 3IKKA 2FYYB 3H8FA 4B41A 1JDCA 1NAKH 1F90L 2B4CL 4JFHE 5D1ZA 3VGHA 4K94C 1H5BC 1EANA 1RH8A 3I6LD 5IFHH 3U36B 2XV6B 2J1XA 1KPVA 4HSAC 3B5GA 3I50L 4GG6F 2R9HD 3T71A 4IOIB 6PCYA 4NAMA 2XVKA 3SY0A 1QMUA 3VFUB 1JV2A 5DMYA 4FP8L 3KLHC 2PIZA 1KTRL 5IQ9B 2K4AA 1TFHA 3KBEA 1N0LB 4WFGD 1XGQB 4AIZB 2ICWI 2H26A 4NI6A 1NUNB 4KJQC 2Y7QA 1IGTA 5HDRA 3APDA 2GKIA 4B5OA 3BJ7A 4D0DA 3O9WA 1SNRA 1NCNA 1N2RA 2N1KA 3DVNA 1FO0H 4DP7X 4BM7A 2JKJA 3KPPA 4JFUA 4M62L 1SVCP 4F8QA 4LCIL 3KMDA 1S7QA 1XR9A 4MRCA 2XEGA 3D09A 3Q9PA 2A74B 4U7SA 2AFOA 3RVTC 4ZFFA 4U1KA 1JD9A 1NSNL 3S6HA 3SYOA 3NSCA 3ZTNH 1FNGB 2VSCA 1IAMA 3KPTA 5JOFA 4PRPA 2VM9A 4LHUG 4CNIB 1WFOA 1FBIH 4MD4B 4MDRA 4JKNA 1BIIB 3IDYB 1KXTB 3BGFB 1HAUA 1S9VA 3WHE1 4JFEE 3HAEA 3QP3A 5IR1A 5A40E 5E9NA 3DDFA 2B59A 2NUPB 2DQFB 2Z1KA 3DYOA 1W2KT 1ZAGA 1PLGH 1OE3A 4IU3B 5T3XH 5AVQB 1A3RH 3U1SL 4TVPD 2KS0A 1FCCA 4AIEA 4LLWB 1YEEH 3RVWC 3Q2CA 2PLTA 3BO8B 3SI0A 4ZW6A 4IDJH 4JFPB 2PXYC 4ENEC 4I3RL 4LPXA 4P46B 2YRBA 1PYWB 5CNHA 3ARVA 3BIBX 5AL0A 1ONQB 2XZQH 4OZHB 1YLEA 4JZJA 1UWXH 4HS6A 3L4ZA 4Z95L 2DL2A 4IKIA 2E9WA 1TVBA 3IF1B 3VRJA 4ZDHB 3ZRFC 1KJMB 5C0GB 3VFVA 5LUMA 4LVHB 2B5GB 1CE6A 2Z8RA 1FDLL 5AW8B 1ZLSH 2GTZB 2ICWB 4Z76B 5KJ4A 1FZKB 3EGXB 5LG1A 3AWFA 5JO5A 4FI6A 2AJYH 5BJTA 2N1TE 3SBQA 3HI5L 4ONFH 5IW1B 4BSWA 3CQFA 1PZ5A 1WD9A 1MH5B 2GI7A 3B8YA 1IM9A 4R4BB 3HZYA 3PP3H 3TVMA 4PD4J 3L3JB 2ICCA 3A47A 5F1SA 2OSYA 2N56A 3F00A 4WFFE 4DVBB 3MLXL 3LPPA 3EBGA 3SGKA 1QVOB 2OXGB 2HTKC 1L7IL 2X0VA 4MASA 3RHWF 1RZPA 3VFSB 4JQVC 1OCOB 2ZKHL 3L9EA 3RU8L 4DCQA 2AZUA 3C6SB 4DGIH 5INDB 3NRQA 3TFYA 3L3KB 1RAMA 1RZIB 3LHPL 2HTLC 1DANT 1X10A 2E75C 2KPNA 1SVZA 4M6OL 3NSYA 4DP1X 1S7SA 4R4FL 3C08L 1CYWA 4WTXA 2XPYA 5I19L 2SODB 2YAQA 4U6HB 4JFED 2AFWA 1AIZA 1OTTC 5CGTA 5B1JC 5C86A 3Q1SH 4MNGA 3F6IA 1RZQA 1U8KB 1IM3D 2H3NB 2V37A 4KKCC 5G4MA 4OC5A 3BT2H 3LQAL 1BAFL 1A9BB 1DLFL 2DQTH 4NJ9L 1GY2A 4G1MA 4RAUB 5I2IA 4LHQB 5FW8A 5JMOC 3NIDE 2OTPA 1KXVA 2YC1A 1I9JL 4TNWK 2XXGA 5E24E 3GD1C 4B53A 4PU2A 3O4LA 3L3GA 3WFEH 2OYKA 2WYHA 3N50A 2I32A 3UZVB 1CQYA 3ZDXF 2EDYA 3DJ9A 3N85L 3BQUD 4ODTL 4AQAB 4PGEA 4JDEB 4FQ1L 1EJOL 5AUMB 2X6BA 4A2EA 4XCFL 2ED8A 3D05A 2ZONA 2AJXH 2BNUA 4M8UA 5CN2A 1S7UB 4NN7B 1JGIA 4L8CB 4BFOA 3HVDA 4IRSD 3D69B 3LEVL 4Q89A 5JW4R 5EEWA 4OZHF 4XT1C 4EUPB 3FHEA 1YJDL 3CX5J 3HN8A 2OMXA 4EVNA 1J9TA 1SOQA 1FL6B 4WSKA 3JTKA 2Q3ZA 3UABA 2JIXB 2R83A 4GEJA 3FN0H 4Z7OB 1GGIH 2XN0A 2HV2A 1G6RL 1ZLWK 2XG4B 4F7MB 4XHJC 2EILB 2O5NA 3QORD 3TA4D 2WXMA 2AFXA 5F7HA 2FGWL 5AEAA 2JELL 1D5ZA 2VAAA 3PP3K 5KYWB 2Q43A 4P2QA 5E2VH 4QRFA 3QQ3A 4YX2L 5IQMA 1IJ9A 3DO7A 3MRBB 2K8QA 1T2QH 3TEUA 5CN3A 1BBDH 4KZDL 1VRSA 2APXA 3RPIA 3RY6C 1LEIA 1AGDB 5ESQB 2E4TA 5EO0A 4R2GC 1XCQA 4JFDA 3SGEH 1E5CA 4FG0A 5C08A 3V7ZA 4D7BA 3OR6A 4NRXB 4L8BA 3FQXA 2J21A 3QEQE 4IJ3C 1EMTH 4KHXL 3RJDA 4YPGB 4Y19A 4WAFA 2UX7A 1IVLA 3I2CL 2BIIA 2DTMH 3F58H 1ORSA 3M07A 4RFOH 2A9ML 3VXUE 3FU7B 4X3RA 3AREC 5DJDA 1QHOA 1ZLEA 3APNA 5CHNA 3RY6A 3T3MB 4GSXA 2W9EH 2Y6TE 4FRWA 5BXFA 4R7VA 2ICEC 3V52L 3TF4A 1DSFL 4HIPA 3ARRA 5GGVY 4IEFB 5LRGA 2QPUA 3SKOA 3UYPB 5KYUB 3DRQA 5I18L 1F00I 1I85A 3FB7B 4TUKH 2JKTM 3U1PA 5JNYA 1FP5A 4GW1B 3EJRA 1XEBA 2LT9A 5L2KA 4ZJ9A 2HLFC 1E3FA 2D03L 3FQ1A 5DZVA 5BV7L 1ASOA 2W0FB 1K2DA 3ULSA 5MEQB 1FCGA 4KOBA 3IMTA 1IKNA 2YNDA 1BBJA 3UO8B 1QO3A 2D2CC 1KIPA 5GIRB 1A7PL 3WXVH 1NE9A 3QS3A 4Y4FB 2NRDA 1PFOA 2EADA 3NGBC 3KHOA 3FUEA 1FPTL 4G8GE 4P57B 4H8UA 5BXFB 1E5UI 3LKSB 3PAVA 1RY7B 1I4FB 1G0DA 3TZVA 4HOWA 2Y3AA 3TT2A 4LU5H 2C9SA 4U4BA 1SMAA 1NAMA 1UA3A 5EBMA 1QSOA 4KPHH 4YLCA 3I74A 3FT0A 5EO0B 3CZXA 3E8UH 1HL8A 1QOKA 2YBRA 1U3HD 4TNUA 3ZDZB 4KFZC 2Z10A 5K8PA 4RMUA 1YN7A 1WIPA 4WI3A 5D7SL 5DSCA 5IVXB 1OGTB 4OLWL 4PBXA 3TJHC 5IKCB 3L5IA 4DO6A 1PNCA 4RAHA 5K1JA 3T3PE 4RCAA 3Q5YA 1XCXA 2I69A 2ZUSA 2MCMA 3TX4A 4URKA 3P0YH 1EPFA 1IAIM 3OLEA 1ZEAL 1NEUA 1QLRB 3O0RL 4GG6E 3P3YA 3ZRSA 1GYAA 1SYSA 2A9BA 2IPTH 1UGKA 5F7FA 5EBLA 3CDZB 2EEDA 1Y0RA 5CUSH 4A39A 2ZKYA 2FBJL 2HJKB 2LU3A 4NZRH 1K6QL 3LIZL 2LABA 3MRLA 4JDEA 2B77A 4A94A 1FHNA 4LDCA 4NPYB 3S37H 1YREA 3MRQB 4K3NA 1O0VA 2DQ6A 2G9HB 4D9LH 4JQXA 4GUPA 5DUJA 1Q72H 5DSCB 2C1PA 4RRPM 3TURA 5I73B 5C09B 1GTNA 3CDCA 3BC9A 2AKRB 1ZTXE 3COOA 4JO2H 3MLZL 3INUH 3LKNB 3V5HB 4I3SH 4IRJA 1A6UH 3KEDA 4MJ6A 5JDJA 1G1YA 3FJUA 2ZF8A 6TAAA 4M7KH 4OUOA 4HUUB 4PJAA 1IJNA 1EEYA 5HYIA 4CGLA 3OKOA 4D3CL 3MROB 4X9YA 4K3JL 2XYCA 3FONA 3NGBB 4NZTH 4A67A 2BHYA 4KI5F 3TN0B 3RWHB 5BS0B 5J12B 5LYDA 2AABH 3MOQA 1N10A 2OL3L 1DO5A 2XBDA 2IQ6A 3CQQA 3KYNA 3BLBA 5C8JB 2IAMD 4LCYB 5EIIA 3R1GL 3OPUA 1ESOA 1M44A 4PFEA 5L4IA 1FG2B 3QS2A 2W38A 4WWKD 1JZ5A 1MHPL 3T2QA 3B2VH 4R6UA 5AZ2H 3LAFA 5IT2H 1GYTA 1YCSA 4Q0XL 3EHBD 3WTYA 1WWAX 1MFCL 1MPAH 4UIMA 4M6HA 4LP4A 1J87A 1J9RA 1S78C 1Z9LA 2YAHA 4XO9A 3T0DA 2XKUA 3ZL1A 2VDRH 4EIBA 4UV4L 2DLHA 3C5SB 3TWYA 3A4DA 1VFOA 1MZZA 3L4XA 4UZSA 5T1KB 1J0YA 3KXFE 5E1AA 2Y36H 3V0WH 5C6PB 5L4JA 4Z7OE 4CAXA 1TQCC 1I1AA 3GJFB 2VLJE 2MKLC 4X5KA 2WXFA 4JCWA 2C4XA 2G4EA 2QT6A 4QTIH 4N86A 3SCMA 5DWMA 4G42B 4OW6A 3QUYA 5BW7C 3ZZSA 4TLSA 3ULVD 3UIYA 2V77A 1RKRA 2X4QA 4NT6A 3VXRD 1JSYA 4FULA 3LEXA 1A1NB 3OAUH 5DO8A 1OM3L 2ITDB 3L4YA 4IKLA 1CU4L 1FH2A 2HP4A 2IADB 3PRTA 1I3GL 1F57A 4KRLB 2J8UF 3ZTJH 3GINA 1NMBH 1SDYA 3QDME 5GGTH 4AUUA 1A5FH 2Q7SA 1O6SA 1YNTB 3RAJL 4B5EA 2WN2A 4B9KC 1CDYA 1J88A 3RZCD 2BSBA 3C6SA 4UTBA 4LSRL 3CSFA 3FB3A 2PCYA 3HG1E 4C83B 3UC0L 2RFXB 4AEHH 3NE8A 3PG2A 3TX8A 2BOBB 4P06A 1HQRA 2VKWA 1DQIA 3CZSA 4E36A 4AV4A 2VERN 3BD5A 4E2AA 5CEYA 3D3SA 1U4EA 3WJJC 1N8ZB 1JVOA 2VDRL 5GGRY 3SDDD 4E9LA 5LGHL 3S3DB 4A04A 1WEJL 4JPQA 1SMOA 3CGTA 3HZKB 5JOFB 1U8NA 1NCDL 1KCRH 3K9UA 4B0MM 3IDUA 3VAEA 2CO7A 1MPAL 4LP5A 2WCGA 4EOWH 4NM8H 1MCDA 3ILQD 3K72B 3MJGX 4JPSA 4FA6A 1A1MB 4EAEA 4IRSA 1UXWB 4TNEA 2JQMA 4Y4HB 1HZHH 2QR0B 2B1AL 5HYQB 2X4UB 5FOJA 5CP3H 3NCFB 5D93B 2ZAIA 5D2LB 1A7RL 4QXUH 4Z77A 1KV3A 2CUHA 3FQTA 5IMLA 5LQBL 4MMXB 4LNRB 3EF4A 3V0VA 3STZA 1KIUA 4XAKE 4DZ8B 4X7SL 4MMZB 1FFNA 1BM3L 4KKAC 4NI3A 3AROA 4IK2A 2PR8A 3G5ZA 4GSUA 4ORGB 2BCKA 1T1WB 1FA4A 4PREB 4JY6A 4LDLB 3M8OL 4O9HL 4AIXA 1A6VL 3H6JA 3FVLA 2BP5M 2FLRT 2CK2A 2R7EB 2WLIB 4DNCA 3VCLB 2WYIA 1E6JL 3ERXA 3LRKA 1U93B 3QXDA 1YMMD 3EFDH 3Q8AA 1B4JH 1BAWA 2VL5B 4N8PA 1A6UL 5FC9A 3P2FA 3EJTA 1AANA 5HYSB 5CJOL 1U8JA 5DD6B 3GMLA 2H2SC 3AQZA 5CGMA 4IRSB 4JO2L 4Y4HA 1OSEA 1LO0L 2X4PA 1DFBH 1WUNT 2JCCF 3W2DL 2VDMB 4AQ1C 3P73A 3MGTB 5D7IA 4D9LL 2BP8A 1IT9L 4OR1A 3EO0B 3MV9E 1TPXB 1A7OL 4L29A 1KLUB 3BQUB 1R0AL 2JTDA 4NRZB 4R90L 4IAVA 1TLMA 2DQGH 5J8CA 1CD0A 1CL7I 1DQLH 1EVTC 2WAHA 2BO9A 2VLKE 5B39B 1RUPL 1N64L 3P77A 1G84A 2VLMD 5DTFB 4X6BA 2BVUA 1XR8A 3N5AA 4XXCA 3T2NL 3U7YL 1LE5B 1BO4A 2F7PA 5DC4B 3T3ME 2WP3O 4D7PA 3D12B 5D8NA 3LD2A 4PI0A 3QUYD 4OZGE 3AITA 5FF6A 1XF2A 1RMFH 2UX6A 2HB6A 2BCOA 1AGEA 5F9WB 1L6ZA 3B2UD 1QRND 1MW0A 3NDYE 4UUJB 1BLIA 3NP4A 2CHZA 3D4CA 3L4UA 4MA7L 3GMMA 2AQPA 1IAOA 5D7LD 3L95A 5EA0H 1NSLA 5D96B 4XP1H 5HHVL 3BZ4B 1KBGL 3ZE1F 3TO9A 5H37H 3NZSA 3D2UA 4HJJL 4OF3A 3ZKQD 3HE6D 2P44B 2FEEL 3BO8A 4FQJH 5CGYC 2OSWA 2V3DA 4XWOC 3SE8L 2Q6WB 3ZN6A 3VW3H 3OZLA 1TO5A 1SDDA 1ZA3A 2DIJA 4PJDE 3F0AA 4GKZA 3F7VB 3I9IA 2E5EA 4D0BA 1SUHA 4K9JA 1P84J 5D7JA 1QD0A 4U1KB 1KUMA 5DRWB 3HFFA 2CR0A 2HG0A 4M56A 5IMKB 5KVEE 3LNHA 4HUCA 4HIQA 1TXRA 2RC4A 1JF1A 4DN3L 1EFXA 1XEDA 3TONA 1JGUH 1F3DH 2P80D 2VRQA 3SGDH 5DJ8A 1INEH 3LRGA 1JFQL 1KXTA 1SLXA 5HI4C 5LAXA 3E0KA 2DTSA 1HE8A 1C5BL 2AXFB 3IGFA 1KBPA 1ND0B 1IQDA 2A74C 2XWZA 3U0PB 1ZE3C 3UTTD 5HD8C 1Z8LA 5ACZA 1JHTB 4HNXB 2J2ZB 3P4NB 1FLRL 4KOXA 4OGXH 4QIRA 4P46D 1ZXQA 4XP4L 2Q86B 2G0BA 4FQLH 3JWOH 4YHPA 1PGRB 5E8EA 1X5XA 3VXTA 4NAQA 5EN2B 1R9FA 1GR7A 1YPZA 3D34A 3QFDA 1NOAA 2NDGA 3V6ZB 3P4NA 4M4RB 2EK9A 5D1XB 2YGQA 1IBYA 3PABB 1JF1B 2GIXA 1FSKB 3FAWA 1GL4B 3VG9C 4AV0A 4X6BB 2GEQA 4HIHB 3CN3A 4UEEA 2D4DA 5AG8A 5HP5A 3T0EA 3KH3A 1KB5L 3R8BB 3F83A 1A6AA 1SQ2N 1FYTE 4LSTH 4F7CB 4IBVA 1I9RL 1IBZA 2NW3A 1KPVB 2F7QA 4KZEH 3TYFB 1ARMA 1QI3A 4XOAA 4MLSA 3SDXF 4P4KD 1VGKB 1JGLH 2AMUA 4PRHD 2ESVB 1MCRA 1SQHA 1MFAL 4X9GA 2AI0L 1EGJA 1OAUH 4LCCA 1CDJA 3V5KA 4HKJB 3QULA 2OZ4A 2X4RB 4Y1AE 3CK0H 1Q1PA 3MO1B 1U30A 3FU5A 4YGVA 4XOCA 4UT6L 4D9RD 1N70A 3FO0L 1QTSA 2EIBA 2H1PH 2WIMA 1C16A 1DBKL 1LXMA 1NIAA 5ICXB 3NFZA 4XO8A 1HINH 4DQAA 3EAKA 5L88L 4O51A 1QRNA 3HN3A 3WLBA 1OKEA 5JOEA 3JTTA 2H8PA 1BM7A 4XPFH 3JSSA 4ZW7A 1FN4B 3EO4A 4ISVA 5KAQF 2VR9A 5AG6A 1JPFA 1R3HA 1KLUA 1ITCA 3BT0A 3D2UD 4N68A 4Q36A 1NBCA 5IP4A 3BSZH 3EOBB 5H4ZA 2RCSH 1S6NA 3NIFF 3DNKA 4GBXB 1I1AD 3S9NA 3LN4B 1RULL 1BAVA 1I1AB 4N0RA 3D7FA 4KJPD 2DQHL 1ECYA 3WIFA 3VM7A 3RIAF 4J4PC 4FNSA 3IFPA 5GRYA 3PUCA 4PWFA 5B7MA 3QHZH 3O8XD 2J73A 3HMXL 4QCIA 3T2OA 2WNXA 3LZNA 5BO1L 5I1GH 5F3BB 3BN9D 3OHXA 4JFHD 1F1GA 5D7KE 3C08H 2FHBA 2QDWA 4J12A 5KS9B 4HWBH 1U93A 5DHVB 3BMWA 5I4MA 1YNTA 3ATEA 5CBMA 3VD7A 1O6SB 1OPGH 1U4FA 1KCKA 5BOZG 1IOIA 3EKCA 3CFQA 3X14B 4M3KB 5CLTA 4PWGA 2DBJA 2XZAL 3OHMB 3MNZA 3RVVD 1KCWA 4GW1A 4DKEH 3QXAB 3EOAB 3P0VH 1YLOA 2G2PA 4ZMAT 3ZKMD 4NKMB 3WKML 2JF1A 2EAEA 5F97E 1XV8A 4WUUA 5EEVA 1E65A 4GP8B 2RB7A 3WS6A 3G5XB 5DMKA 3AS2A 1LK3H 3G5YA 4KHTH 5KS9F 4TUOA 2PJ0A 1M4KA 1GSKA 4HIEA 1ZSDA 1F6AA 2YEZA 2ARWA 2GHWB 3D4GA 4TLUA 4ODSL 5BQDA 2RACA 1GH7A 2D7PA 5GS0C 3LSOB 4F93B 2R2EB 3OXRB 4Q2ZA 1I8LA 1Z5LA 1TTGA 5G4NA 3D07A 5FUOH 2G0KA 4H0IA 4NQSA 4Z95H 4XNMB 1YYML 1H8NA 2A4ZA 3UBXB 3OKDB 3CHOA 4FA8A 1HH6B 2FWLB 1MNUH 1NCHA 1FGNH 3S88H 5FYJL 4XVSH 2EZ0C 5HI3D 4Z0BL 2MRYA 1XF8A 2Z8WC 4QTHB 1QQ9A 2EVFA 3BISA