1QMUA

Duck carboxypeptidase d domain ii
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
380
structure length
380
Chain Sequence
b'QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
publication title Crystal Structure of Avian Carboxypeptidase D Domain II : A Prototype for the Regulatory Metallocarboxypeptidase Subfamily
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
total genus 138
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1qmuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qmuA01
4P6YA 2ZEMA 4EMEA 1TKFA 5F09A 2OR4A 5K8OA 3ISXA 4NGTA 4H2KA 1QQ9A 2Q4ZA 4F9VA 2V8VA 4IK2A 4NJQA 4WJBA 4JYWA 4W9YA 3KASA 2AFWA 4FBEA 2PJAA 5JH9A 4PXCA 4B6ZA 2PIZA 3BI1A 3FEEA 1XBUA 2PE3A 4A94A 2QYVA 3MN8A 2BCOA 3L2NA 2WZNA 1R3NA 4ZYQA 2AFMA 3D68A 3NH4A 4ZY2A 5LRKA 4UEFA 4MCPA 2RB7A 3WABA 3IWWA 1Y0YA 4R6TA 3BXMA 1DE4C 2PJ7A 2PJ9A 3S9MA 5IB9A 4KSIA 4OIDA 2G9DA 3K9TA 1XMBA 4WI0B 5CBMA 2CTBA 4A39A 2PJCA 2Q43A 3PFOA 1CX8A 2F7VA 3LWUA 4R76A 3PBEA 1YW4A 2JBKA 2ZENA 3PRTA 2PJ5A 1YLOA 4K3NA 1ZG7A 2PVVA 4MHZA 2ZEHA 4PXDA 2ZEEA 1ARMA 1LFWA 2HC9A 5K39B 3SI2A 4IHMA 3TC8A 2C6GA 5G5DB 4P4DA 2GLFA 5D8NA 2PCUA 4ZI6A 3G3LA 1GYTA 4OC5A 3ISZA 4IYKA 3PEIA 2XEFA 3VH9A 1CP6A 4FAIA 3GUXA 3WT4A 3B3CA 1TKJA 4MCQA 3D4UA 2ZOGA 5HVFA 4OP4A 3B3VA 1LCPA 3KHZA 3D7FA 4MRIA 3WC6A 7CPAA 2HB6A 4UEZA 3PFEA 3V38A 4PXBA 3IEHA 2C1CA 4PXEA 5HVGA 2PIYA 4EIUA 4R7MA 4MHYA 4X2TA 1LAMA 2ABZA 2BOAA 1LAPA 2ZEOA 1M4LA 3NH8A 2ZEDA 3FH4A 3QNVA 4MHNA 2AFXA 2AFOA 2OOTA 3KQZA 2Q51A 2XEGA 1BLLE 2FVGA 2POKA 4MMOA 2IMOA 4F8ZA 1F2PA 3T8WA 4P44A 2XEJA 4ZX9A 3KGQA 4P10A 2V8HA 1Q7LA 1R43A 4U3SB 2CTCA 5D29A 4PQAA 3PB9X 3RAMA 3S9LA 2PJ4A 4ZY0A 2ZEFA 3CPAA 3D66A 2ANPA 4F9UA 4NJRA 5HXDA 1XFOA 2JBJA 1F2OA 4NGPA 1ARLA 1YMEA 2IJZA 4X3RA 1NKGA 5K8NA 6CPAA 4PPZA 1TXRA 5LYFA 4UIBA 1VIXA 1ZG9A 4NGRA 3CDXA 5AQ0A 3GLJA 2C6CA 3RBUA 5I4MA 4R8FA 2PVWA 4CPAA 1TKHA 2O53A 1XJOA 2JEWA 4DYOA 4P4JA 3FMCA 1FNOA 1PYTB 3LMSA 3MRUA 5LYDA 2PJ2A 2ZOFA 1EE3P 3RZAA 1TF8A 1CPSA 4MHPA 3KZWA 3H8GA 3SJFA 3HUVA 3B35A 1VGYA 4A37A 4Q7AA 5JM6A 4P4EA 1ELMP 2IQ6A 2GREA 3IO1A 1NSAA 1LANA 4FWUA 1CG2A 1BAVA 1ZLHA 2V77A 3NJXA 2PJ8A 5J1QA 4OC2A 3CPXA 3IC1A 3DLJA 3I1UA 3PB6X 4OC4A 3KL9A 3D7DA 2F8HA 3H8FA 2ZEPA 3H8EA 3FECA 4TNUA 2ZEGA 5K8MA 2B59B 1LOKA 4NGMA 2NSMA 2AFZA 1AMPA 1CPXA 4WWVA 4DUKA 1Z2LA 2QVPA 4EFDA 3FVLA 2PJ0A 2GU2A 4FUUA 5K8PA 1VHOA 1Y7EA 4NFRA 4RUHA 3B3SA 3JRUA 4FL4C 2ZELA 2QJ8A 3GB0A 3D7GA 1ZG8A 1BPNA 1FT7A 3WC7A 3BI0A 1RTQA 2DEAA 4ZY1A 3SJEA 3V7ZA 4IAVA 3HLPA 2XHNA 3SI0A 1CBXA 4A38A 2PJ6A 4NGSA 2PJBA 4DJLA 1AYEA 4OIWA 5LRGA 3TX8A 1HDUA 1Z8LA 1UWYA 5ELYA 3BHXA 3S9NA 2GLJA 3VARA 3KCPA 4G1PA 2O4HA 4OC0A 2C6PA 1Y0RA 2PJ1A 3VATA 4GM5A 2AFUA 1PCAA 3FJUA 1ELLP 4YU9A 2J9AA 3IJ3A 5LYLA 1F57A 1YW6A 1JQGA 1CP7A 3SI1A 3D7HA 2VL1A 3PB7X 3FEDA 3KR4A 5DS0A 2V8DA 4UF4A 3HN5A 4OC1A 4YWYA 1VHEA 4JZ0A 3E8VA 2CF4A 5HVHA 3NFZA 4O23A 1KWMA 5LRJA 4BD9A 1H8LA 1BPMA 1YSJA 4Z65A 3KR5A 4MXUA 1HDQA 1OBRA 4P45A 1QMUA 3N5FA 4OMEA 3SJXA 4NGQA 4TWEA 1DTDA 3WC5A 3PBBA 3IIBA 4OC3A 1IGBA 2EK8A 3B2YA 3B3WA 2CIJA 4MCSA 2EK9A 4YOKA 1TF9A 3DGVA 3B7IA 2WYRA 3NA6A 2RFHA 3D67A 3KHXA 3PB8X 5LYIA 2PJ3A 5JGFA 2I3CA 4LQGA 3NH5A 3B3TA 8CPAA 3FF3A 4MCRA 5CPAA 4ONWA 2EWBA 3KQXA 1IY7A 4OKOA 4ZX8A 3KI9A 4EWTA 1ZLIA 3PB4X 3FX6A 4P4FA 3IFEA 4NGNA 1XRYA 4FXTA 2V8GA 4UIAA 4AXVA 2NYQA 1HEEA 2XEIA 3CT9A 4X8IA 3NJVA 2AFSA 1Z5RA 2PRQA 2BO9A 4P4BA 3K2KA 4P4IA 5THWA 3SJGA 4UEEA
chains in the Genus database with same CATH superfamily
3OKKA 1SYSB 2ZEMA 3TE4A 1IC7L 1JK9A 1MH5B 4AGOA 2BVOA 1PG7H 4O58H 4PRDA 1JPTH 3TJHC 3ISXA 1C7TA 1YYCA 4XPGH 1MJUH 4JEGB 4AEHH 3FCSA 3QP3A 1F13A 4G83A 5FYJH 3MR9A 1IQDB 1KCSL 4HJUA 1SEBA 1UH2A 4LSSL 2X6AA 2FT0A 4WJBA 1NGZA 3Q01A 3FKUS 3Q8CA 2X5PA 1UYWL 3D4YA 4OTXH 3LIUA 3HG2A 3VFWA 2WM0A 4JCLA 1IAOA 2BL1A 2FHBA 2PIZA 3MA7A 5CEZD 3C6SB 5HYQA 4OLVH 1I8MA 3F8KA 3RWEB 1ZLVK 4U1JB 5C9JB 4XMTA 1OSZA 2CGRH 2OR7A 4KTEH 3UBGA 4U3XA 1EGJL 3JV4B 4JPKL 3O6LL 1L5GA 4JO5A 5EU7E 2WXNA 3HZ3A 5IW3A 4JLYA 1JYXA 4UV4L 1W2KT 3ZL2A 3MRCA 3BXMA 3CC5B 2PJ7A 4WU7A 4PK2A 2N4IA 4KQ4H 4OIAA 4OT1H 5A2BA 1QD0A 1WK4A 2VLKE 4YH6A 5B1BB 2YZ8A 5IBLD 1AFVH 4LSUL 2HN7B 3GSQB 3N3EA 5JZ7D 4YDIH 5EOCH 4TSAL 4KHXL 3DVFA 5EBLA 1X5MA 3BN9D 1HINL 1P7HL 3OTTA 3OHXA 2CDGA 3GBNL 5AB1A 1WIOA 4JQIL 3WJMB 3QJHA 1BWMA 4WO4C 5HI5D 1U93A 1KBPA 2KERA 4JLRA 3L08A 3RBGA 1E5CA 3AWEA 4EUPB 2YMOA 5AEAA 4LLDB 4M48H 3MLRH 4G8GE 2H7WA 3FSOA 3FCUB 3ILQD 1I82A 3PRTA 3HE6B 1UWXH 4KK5C 1U2CA 4YHLL 2CRYA 3N43F 2JKIS 1I7ZA 5D9SA 3WIFA 4EQ2A 2A77L 3EGXA 3FRPG 4UM8B 4QT5A 3BPNC 4OD2A 3V52L 1LWHA 2DZEA 3STBA 3T1FB 3T2LA 1HILA 1SMOA 3O3AA 3SGDI 5IGXL 3DXAB 4ZW5A 5JW4M 4HC1L 3QEQE 4R7DB 5IUCA 1BZ9B 2Y3AA 2UXVA 3WJLC 4NWUL 2KZKA 4LHJB 4XMXA 1IKFL 4JR9L 3FRUB 5F0JB 4IBSA 5A6MA 5D8NA 1KTDB 2FBJH 4M5YH 4XVSL 4OIFA 1DE4A 2WBJB 5GRWA 5C7ZA 4XZ4A 3PEIA 3CTTA 3UYPA 5E8NB 1KLFA 1MDTA 3TT3L 2C3WA 3WG7B 5J11C 4RVBA 1AD0B 3MNVB 4DO6A 5EUOB 2FZ3B 5HVFA 5TDNB 4X7TB 5FOBA 3RVUD 1AD9A 5TGBB 1Y9KA 1HXMB 2M26A 4XPHH 1DVYA 3OAZK 1Z3GH 4ABUA 4X5XA 4KV5E 3UTPE 4Z7QF 1YRKA 4FJZA 2JJSC 2PCYA 4UEZA 4F7KA 5HGAA 3SOBL 4L8CA 4BA0A 2GSMB 2OKMA 3U6RA 5FK9B 5ACZB 3F3HA 5E8EA 2UXGA 3S4SG 3CWGA 1IL1B 4XNYL 5EC2B 5KBKA 4O5LL 3FZUC 4LVOB 1LAMA 1MF2H 1N6QL 3BWSA 2XFGB 3PIQA 3QORA 3SHPA 4OCNC 2V2XA 3CFKB 5EZIH 5EZPA 2HG5B 3PNRB 4KQ3L 2NY5C 3MI6A 3Q8EA 1W80A 1FCCA 2V5SA 3V9CA 5JIPA 3FH4A 1YEEL 4QF1A 3CQPA 1ZRUA 4NRYB 1BMGA 3KPSD 2FUQA 4O02A 3RVTD 4DP9X 1WD9A 1F02I 1MDAA 4KY2A 3ARED 4HJJL 5F7AA 3BVDB 2GTWB 5BVPL 3ULUF 1BLLE 1H9VA 2Y7LA 1CXHA 4JQVC 4IS6A 4H40A 4H4NA 3VXUA 1OW0C 1JZJA 4YDKH 3T8WA 1D5IH 4AIOA 4HS3B 2ARJA 1RP9A 4LCUB 1FL3B 2BHUA 4M6AA 3CXQA 3EH5B 1T1ZB 2R7EB 5GS2H 4MWFA 4X6DE 3MACL 1GGCL 1KZYA 5INDA 5CD5D 2YD3A 4BFIB 1UCBL 1U8KA 4HK3N 2VLLB 2R4SL 2CJSA 1XFOA 4JJHA 1MSPA 3IBEA 1AIFA 3KEDA 4LBAA 2PR4H 5A43C 1YR0A 1IU1A 3DV6A 3WNPA 5DD0L 1REIA 4XPTL 1DBBL 2DKMA 1T80A 3FW6A 5SWSA 4HK0A 1QG3A 4WTZG 1TQVA 1DYZA 4OLZH 4UQDA 1AHWB 3DVIA 4HT1L 2J8HA 3HCVA 4JO3L 4OD3H 4WI9A 3ZIYA 4AM0Q 2WSDA 1NC2A 1IBFA 4I48B 1BGXL 3S36H 3QZNA 4UQ3A 2O6CA 2F8XC 2JI1A 3QDGD 3ZDYF 3F7QA 3WFHA 4LBEA 4CPAA 3ZRSA 5IY5B 4AYSA 5C6TH 1IGTA 1UHVA 4ZW3A 4BRJA 4TNEA 4GBXA 5A1AA 3GWJA 4I1PA 4FD5A 5DJAA 4KOYA 3CFMA 4R7NA 4UT9H 5D7JD 1M05B 4DYOA 1KC5L 1U9KA 4LT7A 3RWCB 2MQ3A 3INUL 1E27B 4FFWD 3D0VB 3OB0K 2CD0A 4UQ2A 1MWAB 4MAYD 2PJ2A 3OZ9H 1NCGA 1J8HD 2TSBA 2OYLA 4FXKC 3SQOL 3B2VH 4LOEA 4MHPA 2YR3A 1KXVC 2HVJA 3B9EA 1MAJA 3ZO0A 1P1ZB 5J3HC 1ZT4A 4HG4K 2ZYRA 4JXRA 2VJ0A 1KTLA 2KQNA 3PWNB 1SOSA 3C60C 3OMIB 1NOLA 2HUEA 3IO1A 4ABQA 5F9JB 3EXJA 3GMRA 4JQXC 1PZSA 3R95A 1HK6A 4QHMB 2R2CA 1QTYT 2O5YH 2ARHA 4PRID 2Y69B 3VFVA 3PXLA 2ICEC 3G5ZA 4HBCL 3SDCC 4N9OB 2ZX8A 3P9MB 5I1AA 4IGBA 5T5FA 4F37K 1U2HA 1W0WB 4FTVD 1LK2B 1GKOA 1GTFA 1ACXA 3S35X 1X5AA 2FAUA 3MV9E 3QULA 1NGZB 3BH4A 1A3ZA 2D7QA 3O9WD 2C9VA 2PC1A 3BH8B 3EH3B 4IOFC 2OSWA 1BHGA 3FOLA 2KZBA 1B3IA 4Q6IC 1OE3A 4AQEB 5IVZB 4CUCA 1RERA 5DRZB 1VEMA 3CVHA 5AYQA 4L1SA 3KXFB 1UH4A 1USQA 4OLUH 3IGAB 4N2NA 4XPDC 1F1GA 4ICXA 3DPBB 3CN2A 1BVKA 1T21A 5H8DA 1L5GB 1P7BA 4FFYH 4YAQA 4FQCH 2BX5A 1EJ8A 3MRCB 1MRFH 3K6IA 2F58L 3MZTA 4F0XA 3Q5TA 1IC1A 2QPFA 3O2VH 5DLLA 2GU2A 3EZJB 4W9CC 1IGIH 1Z7JA 1N3NB 1BLIA 2AV7B 2E6QA 3SKNB 2JVUA 1LO2L 5AWNL 2AABL 2BRRH 1FT7A 4CJ0A 2ENYA 3ILEA 2QKSA 1V27A 4JLRB 4YHML 4EI5C 1RTQA 1YJDC 5GGUA 1MCLA 2RB8A 4ZXBB 2F74B 4MMXC 5I82A 3KS0H 1T6VN 3I9GL 4NWTH 4WUUA 4AYFA 2AERT 2IBZX 4Y5XC 4YHKL 4ISVA 1CDHA 3BAXA 3UJJH 1IILE 1BQLH 3ARFC 4BCXA 2YXMA 4YR6A 4ZFGL 2JLMA 1LO3H 1VZGA 4M8QB 4EDXA 4PB9L 3DTUB 1I7ZB 4TL5A 3VXSA 3EGXB 4RFOH 1X9LA 3CVIL 3W6XA 5I1JL 2NXZC 2CGZA 5EF3A 4Y4KA 5ANME 2YKLL 1SZNA 1HILB 2OJEB 4KVCL 1FIGL 1PL3A 4ONOA 5JOPE 1RUQL 1P2CB 2B5IB 4J8QA 1OCWL 3QFDB 3TFYA 1VPOH 1KJ2B 3WFDH 4XBGA 1JRHL 1T22B 2FQGA 1DBMH 2C1OB 1HXKA 3FQNA 3I9SA 4HIJA 1NOAA 1MRDH 2QADB 3K4ZA 1A7QL 3PGCB 1BD2B 1CGSL 2WQ8A 3HJ0A 1U3JA 2WTRB 4AW7A 2JQZA 1K8DB 2RD0A 3NCWA 1Q0YH 2UWEF 1T4WA 3ETBJ 4NAJA 4Y5VB 5HI4D 1TFPA 3GMMA 3L1GA 3Q0HA 4UILH 2DQUH 3BI9X 1ELLP 2VWEE 1FA4A 3BIBX 2A9BA 4TPRL 2V37A 3QIUC 4CYOA 4JFUA 4XP6L 2ZAIA 3KWVA 4X5XB 1VCAA 4ZUTB 2HCZX 3D85B 4LLYA 2EIJB 3WNOA 2HT2C 1HCFX 2MPVA 1PBYA 1HHGA 1EAQA 5IROA 3G9AB 3FF8A 3GXNA 2GK2A 3WDHA 1D7BA 4Z18A 1WRFA 1ZTXH 3SBRA 5LUMA 1WZLA 5JW5B 4KH2A 3V5HB 5BS0D 2JLPA 4WCYL 1N19A 3QORB 2NY0C 3HG5A 3UBXI 5L9DH 2NNAB 1OSEA 2XWZA 4M6OH 5SWZE 3IJYB 2LGNA 4GG8A 5HGBB 3QZWG 1X5IA 1JZ3A 3O6FC 3TBCA 3E2HB 4HCGA 2DLHA 2PCPA 2WOBA 4JHAL 3UAJD 1I1FA 4MKMA 3FONA 4UNIA 5GRVK 4P2QA 1CCZA 4IS6B 2MH4A 3VXUB 3EFOA 1G9HA 1NDMA 3BX7C 2WWKO 5CCJA 1R9FA 2ARJB 3ZE0E 2MCG1 3OBAA 3NAAH 1I3VA 5IJBC 1NMAH 2FCBA 4MWFB 4M7JL 3D3VE 2HLEB 1RVFH 5JIQA 2HMIC 3GMPA 5INDB 5HH1A 2WXRA 3IDJA 4PN6A 4Y19A 5LBSA 2BIPA 1CPUA 1P0HA 3VFSA 3OWEA 2IV9A 4BSWB 1ES0A 3FUNA 1JAEA 1ZV9A 4DGYH 3NJGA 5DI8A 5JQHC 5F6IC 1H6FA 2QL1A 1XCWA 1JPFA 3IJSA 1UTDA 3GSUB 1PAZA 1I7RB 4H8QA 5E8PA 4K8RH 2DEWX 2W94A 3V4PH 1AR2A 1KZQA 5JW3L 5SWSB 5TDPB 4LCWA 3KJ6H 4GRWH 1TENA 1FGNH 2VLMD 4G3YL 3HCVB 4K9EL 2DL2A 5FXCH 1MJ9A 1X6LA 4ZBGA 4XZUA 3WFHB 4LBEB 1HHKB 2OQJB 5CGBA 3V8IA 1IGTB 2X53A 4EWTA 3F64A 3RA7H 1JRHI 1M6OA 1RIVH 4YEFA 4CYPA 3RPIA 3BDYL 3NE8A 3VU1A 2BHZA 3K72B 1S7FA 2Y07H 3BWUC 3C5XA 1VGEL 2PXYD 2VXSL 3NSCA 2OL3L 4FMVA 4PCYA 4Y2DB 4HPOH 2OMTA 2CKBA 4FQ1L 2ALAA 5E56A 1W6LA 1FZJB 5IB3B 3WTTA 3OAUL 3TZVD 1YY8A 3UEZA 1YYLH 1SHSA 4UQ2B 4CMHB 1JMZA 1Z0NA 1QYGH 5T1DL 4PW9A 3IJHA 5HHVL 1CM0A 3E6FA 4KI1A 1F11A 3L16A 5JDSB 1P4NA 3FUEA 1U3NA 5I1KH 5HHMB 2E7DA 4GFXA 2YPLE 1B4JH 4P6YA 3GSOB 1RJLB 3IYLW 1YQVH 5DT1L 2HV2A 2AJVH 4FI8A 3TH4T 5GJSH 3D6GA 5L2JA 1JNLL 4LSTL 3P30L 3S37H 4ZMNA 3AAZA 5T1MB 2P47B 2VERA 3KEHA 2BSED 1G6RL 1I3UA 4UOW0 1DUZB 2AFWA 3GIUA 3VFVB 4FBEA 1P7KA 1X6NA 1EHAA 3S5LA 2E7LC 2QZQA 5I1AB 3NABH 1UT2A 4OLWH 3ZBMA 1XF4A 1F2XK 5HD8D 4XCFH 3T4AA 4DN3L 4XPKA 5CHNB 3ESMA 4EBQH 3L5HA 4E9QA 3O45A 5D93C 2N3JA 2VNCA 4ZY2A 4L9DA 3S0PA 4PJBA 5T33L 3EADA 4WWKA 4UEFA 5DJXA 4IRSC 3WABA 2NY3C 4EDWL 2V9RA 3OL2A 3RPBA 5CGTA 3L17A 4GQPH 2MTAA 1GOFA 2WYTA 3B2MA 5KVFE 5LRKA 4Z6AT 2ID5A 2KS0A 3H8NA 5CP3H 5F7LB 4P9HC 1OY3B 5AL8A 4XO5A 3DBXA 5BZDA 2CHDA 2D4DA 2NY2D 4AGNA 3ZXAC 3L9BA 4OJFL 2BNRE 5H2BA 1CS6A 1JV2A 5E9DB 4XN4A 4B41A 1BLNA 2IBGA 4Y1AD 3PFUA 3MRFA 4PJBF 4W4OA 3RILA 4GRLA 4JRWA 3QJSB 3CLWA 3Q43A 2CK2A 1PX3A 4G7VH 1JUFA 1UA6L 1XXFC 2ADGA 1YHPA 2Z7ZA 2AZUA 1PVHA 1TQBC 4XP5L 1K4CA 5GPRA 2QIRA 1Y6MR 5G4NA 5CU5A 2L3BA 3BT2H 3BUIA 3H7BA 4KK6D 3WNJA 5C0BA 4NZJA 4WWOA 5GGUB 1CF8H 1MJ7L 4ZO8A 3WR7A 4OCRL 4WUUB 1EK3A 2YGVA 1GZQA 3L3OA 4OZFH 3MJGX 5D5ME 5DFAA 1SN5A 5GZOA 3WIHL 5J5EA 2UX6A 4FRWA 1CLCA 4XC1L 4ZPVB 3VXSB 4DP7X 3FTWA 3NZUA 4JHWL 2CUAA 3EYQD 1QSFB 2H0PA 4NPJA 4Y4KB 1F1AA 1NSLA 4IOSA 1TU2A 4M7LH 4NQQA 4PJDE 2MCAA 4U6HA 5T3XH 3IXTB 3RKPA 4B9GA 4C4BA 4E41E 1PZCA 1MFAL 4U0QB 3GBML 3CHSA 4XBGB 3RWDB 1PZ2A 2NUTA 4GLRH 4Q0XH 1P5VB 2IDUA 2ZOGA 1JZIA 4F57H 1RU9H 2Q7NA 3HZMA 4G8EA 3VD2A 5BZWB 4NSKB 1Q9WA 1NA8A 1MI5B 2MEJB 1EXUB 1SYVA 4GI8A 4LL4A 4FQQA 1RUPH 4AVHA 1G7LB 1NJ9A 1X9QA 4R8WH 3GMMB 4F7PA 1B0GB 3OM3B 2W91A 4TLTA 3P73A 3CXHJ 2GEEA 5TE4L 3GMNA 3QNXA 4N0UA 1M4IA 4O2FB 2VOTA 4ZRGA 3LS5L 4LLYB 3V0HA 1I1AD 2EUIA 1MIEH 4K30A 4NNPL 4RI1A 5LN8A 4XN1A 3NN8B 3OGCB 1Y6KR 4LLMA 1PZ5B 4XP1H 5PCYA 4XBEL 3QNVA 5EIIA 3Q2VA 5TF1L 4HJSA 5EIQA 4FJ6A 4HNWB 1OPOA 4TLUA 4B53A 3DOSB 3US9A 1UGKA 2FSDA 1G94A 5GZND 3SDXA 5I71B 5FIEA 2JLLA 1T5WA 4XPFL 5LJYH 2R29H 1B0RA 1HKLL 2J1KA 5MI0B 1F2PA 1S78D 4R57A 2Z91B 4YHIA 2X4NB 5B39G 2WXJA 2QHRL 1ZA6A 1R3LA 4QTIH 3H56A 2ADIB 1NLBL 3CDFA 2I7SA 4NC2B 3D2MA 2WKOF 3SDAD 3K71A 1PPIA 1PKQA 3CSYA 1XZWA 3CPAA 3EFOB 2OMNA 5I19H 1K6QH 4N0FA 1J1OL 4I18B 4W6WB 4ZAKC 5LAPA 3ABMB 5CBEB 1G43A 2IPUG 3SCMC 4QJ4B 1LEGA 3BPOB 5KSAB 3HKFA 1J9RA 2VDQH 2VDOL 3SDXF 1CK0H 4H44C 1WWCA 2B2XL 1T4KA 4ZODA 2J8UB 2G75A 5EA0L 3V0VA 4JFPA 2PR9A 5DJCA 4NQCD 4LNRA 1HI6A 4YK4C 5I23A 4QUOA 1AQ8A 4K3GA 1JCVA 4NPYB 5EN2A 2EE6A 5AOLA 4M6MH 1TF4A 3IJSB 5EG6C 5DCCA 3EFDL 1EZVY 3APCA 1DVZA 2D3JA 2YXWA 1MQKL 4RWHA 3V4VB 3OZLA 3DPDA 2XG4A 4NN7B 4ZMPA 4LCWB 1H3WM 1FFOA 1LNUA 1BEYL 1O7DC 1PYWA 3FB3A 1UKQA 3PWPA 4WW2C 3ARPA 4EMZA 1WFMA 3TEXA 3MRIA 1DO6A 4FNUA 3HB3C 3RPIB 3UTZA 4Z7QE 3BKJL 3C6LD 1R3IH 1ZEAH 3K81A 2DM4A 3GIZL 3BW9A 5L4FA 3B35A 2P5EE 3AG4B 3LRLA 5IEKB 2OZUA 5IF0A 4P4EA 3S8GB 5ELIA 2VDLL 3IJHB 1OO2A 4LSRL 4MQXD 2NT0A 2O5NA 3T2NL 5KVDH 1U41A 1OP9A 2HRGA 3SGKC 4NXYA 4ZG1A 4GS7B 1K8IA 4PRNB 1JGVL 3MLSL 4IHOB 4GH7B 1J5CA 4CYQA 3GXIA 1NZRA 5FYLH 1VENA 1SOQA 2BCKA 4YX2L 1RUAL 4P49A 5L2JB 1EV2E 3C26A 3P40A 5ECJE 2VQ1B 3KVPA 2CMRH 2V7NB 4F7CB 3ULUE 4HAKA 3HAEG 3KBEA 1N0XH 4UT9A 1D5BB 3ZHNA 5CLXA 3RJQB 1PY4A 2EIDA 3ARGA 4XVUD 1P7KB 5BO0D 4TSBH 5KAQF 1XAKA 2ZEPA 2IH3A 2IAMD 2KCWA 1XF4B 3WIIL 2R1XA 3T4AB 2IPKA 5C08D 4HGMA 2PWFA 3AU1A 1XXDC 4HLZH 3ECWA 2FB4L 1N68A 1S7RA 1FYTD 4LCCA 1A14H 5FYKD 4RETB 3QG7L 1EJFA 2WB7A 3ECVA 3WKYA 4YMPA 3TF4A 2YARA 4DK5A 3QDMA 1BFOB 4L8SC 3B7TA 2B4BA 3GBLA 1JMXA 4XH2B 2QVPA 4MX7A 4P2YA 5AZEL 2IADB 4WFEE 4Z7AA 1G7JA 4FG6C 4IEFB 3TBBA 5AVXB 4L4VB 3TCLA 2EECA 3TH2T 1L6XA 2Z92A 5DK0B 4XWGL 2WQWA 2BNUB 2PR1A 1IGCL 1KIQB 3FO1A 3K74B 4MCNA 1K2DA 5H2BB 1BLNB 1OCOB 3CN3A 3HS0C 2LOEA 2NX5D 4PWIA 2VT0A 3SXOA 3ZDYE 5E5LA 4CU8A 4H5SA 4A2FA 1Y07A 2F53A 4IMLA 3STZB 1RIHH 2VXTH 4Z7VF 3JYCA 2XHNA 1MVFA 1J5IA 3QCVH 2A0LC 4JPQA 3O4LE 4NKDB 2BFVL 3LV3B 3MFFA 2VDRL 4G5ZH 4H7VA 2Z8SA 3C2AL 3LKPA 2YAQA 4M03A 3KLHC 2FEEL 4AENA 1BXUA 1A7OL 4AOFA 4OIWA 2NNCA 4G1EA 3ZE2B 3H3KA 4TUKH 2WUUA 3L3OB 1U6AH 3CAFA 4H13C 3D50A 4FA6A 1QSZA 4MASA 1QQDA 1WA0X 2E0PA 4TNVF 5KS9A 3QJFA 3TLRA 4UV7H 3BKMH 1OAQL 4FZ8L 1QSEB 4L8BB 3CLEH 5JPNC 1SM3H 2B14A 2LLLA 2BOLA 2RCSH 1THAA 3HJEA 5I6NA 1SBSH 2FECI 2JJTC 4OZHA 2D3NA 1J0JA 3GMQA 1CE6B 4WTXA 3EDKA 1NMCB 2VH5H 4BZ2H 4YNYB 3FK3A 4RGNE 2PJ1A 4GM5A 1OTTC 2IH1B 2NUTB 4AMKH 1NTDA 3U1QA 1X5XA 1K4JA 5DRWB 4JM0A 1IBBA 1MCNA 4JFHE 1RZJL 5IWLC 1ND0B 1AZVA 3MLVH 2EC9U 2X7LB 3TO2A 2GCYA 4OD1H 5KS9F 3A22A 1W0YT 2VGLM 4QTHA 1ZSHA 2HLAB 1NJ9B 5DYOB 3KPQB 1EHXA 4XMWA 3LEVL 4I1RA 4PRBB 4F7PB 5FUOH 2FO4A 4IBYA 1XF2A 4OZHF 5F3FA 4A6YL 3EJJX 1K5WA 2AK1H 3RTQA 3VRJA 5EZLA 4YWYA 3GMNB 1PZ3A 3QNXB 5FUZH 2COQA 4NIKB 5DUMH 3KMDA 1XR8B 3EDFA 4P4KC 2CHNA 3CN1A 4MS8D 4L18A 2CF4A 3VW3H 1RURH 4LLMB 1RZKH 4W9GC 3T2PA 1AZUA 1HEJC 3X3GL 1YMMD 3IXAA 5DJ2B 4Y2LA 3H42L 1AHKA 5A2AA 1KFAH 1RZ8B 1QFOA 3BQUD 4AIZA 5C8JA 3HW7A 4HS6A 1UADC 1T5WB 1B0RB 4IRJA 2ETWA 1WO2A 1H6TA 2BCMA 5IMKA 1KLUB 4NUJB 2AMGA 1ZA6B 2XUWA 2Y72A 1R3LB 2AKRB 4FI6A 5CJ8A 1PMYA 1H19A 1YEHL 2X4TA 4A7GA 2EO8A 1AXTL 3RZCC 2ZCLL 3TNNB 4OC3A 4PJ7E 4XBMA 1IGBA 3QISA 1GRWA 1A2ZA 3MRJB 1MRCH 5F93C 4EVNA 5I66B 3SDDB 1SVCP 5AOMA 3QIBA 5C0CE 4QRRD 1T4KB 5H94A 2AEQL 2JB6B 3HUJA 3QIWB 1OGAA 4JFPB 4JE0A 4P9ML 4OI7A 4R9MA 4DCQA 4GSQA 4TRPL 4JVPA 4U4IA 2ZW4A 4LQGA 5EU6E 2FEEI 4U1HB 5I74C 2VR4A 4KO6A 2WGNB 3EBAA 2M83A 3WMSA 4OCWL 4AJWA 3MRLA 3ILPB 3IFOB 3QUMA 2X4PA 2DPKA 2CXAA 3W6SA 1CFSA 4S1SL 2OI9C 1XZ0B 1CIDA 5IW6A 5L6YL 1NBCA 3ARDC 4YSUA 3DIFB 4QCIA 5GRVL 3UDWA 1ZLIA 2ATAA 1I9IL 3AMLA 4ZFQA 4P04A 4OVVA 3DC0A 1TJGH 6CGTA 4GG6A 4M5TA 2AI0H 2EEAA 3CFQA 2UWEE 1T7WA 3MRMB 5C0IB 1C1EL 2LTQB 3IFLL 3MLUL 3RIFF 2EDQA 1S4IA 1UM5H 2DYPB 2MFNA 2W8CA 3GXMA 3HG0A 4ODXA 5LG1A 1UQSB 2C1PA 3UEQA 3V10A 4HPHA 5D72H 3U0TB 2D0GA 4OZFG 2FEDC 4X83A 5IFJB 1FZOA 5DZOA 2MCMA 4WKXA 2O1AA 4JRYE 4MMYA 4PJ9B 5KBMA 2NYZA 3RVXC 3SSGA 4YXKL 4XAWH 3V4PA 1ZDQA 4WZ9A 5FO9A 4ENED 2XZAL 5AAMA 3NIGF 2BOBB 3VTTA 4APQB 1S7TB 1G87A 1ANUA 4GG6F 4JDZB 2OZNA 2Q4ZA 3RWJB 3GGWB 4IK2A 4OV6F 4A2MA 5LNGA 5DD5H 4P06A 4ZMVA 4KSAA 5AG4A 1QPPA 3JWOH 4W9YA 2X3AA 4J5VA 5D7IA 2WVUA 5JXAH 1OPGL 5JH9A 2EDMA 3OV6A 5JNYA 2BCKB 2R2HB 1XSIA 4RGMC 4M43H 2F9BT 4P23D 5CJXC 2P28B 3DJSA 3QAHA 1VACA 3WMQA 4P5TD 2WZNA 1B88A 1WT5A 4X4ME 4YEEA 5ICXB 3VXMB 3AWGA 3JWNH 4R5TA 1FPTH 2XTJE 4Q9QL 2QHLA 3BN3B 5DURD 4GRWF 4DW2H 2IPKB 5FW6A 1SMAA 1PU0A 3A4DA 2BP5M 2EDFA 5K9JL 5KEZA 5DRNB 2YPVL 3WE6A 4IKNA 4PJHF 4H26B 3L5JA 5CO1A 5HVGB 2Q8AL 4QRSA 4DUVA 4DFIA 2J44A 5A2FA 3L3DA 4JAMA 1I9JH 1GJWA 1IFGA 4JDTL 1IFRA 3BAEH 4ERSL 1KXTA 3ULUL 4MX7B 1J88A 3ARWA 5B3JF 2EILB 1G7JB 3EHBC 4WI0B 4ZW6A 1CL7H 2OV0A 3PXJA 3MLTA 2PJCA 2AEPL 2FSEA 3PFOA 4P59H 4Y1SA 1YYML 2I32A 3TNMA 2XXGA 4P46D 3FO1B 2X0WA 3TFKC 5L88L 3GRWH 2DQCL 5FDWA 4K71B 1GYWA 5IT2H 4AT6B 3QUKB 2HJKA 2AJSL 2IG2H 3NPSB 5TK4A 4H5SB 1YA5A 3CH8A 3QO0A 2F53B 2ZEHA 2BZDA 2XKUA 4XHJD 4A7UA 4XXWC 4UWIA 4O02L 3GYAA 2YO3A 3H3BC 5DHVH 5FCUH 4PAZA 3SI2A 4J6RH 4BFFA 2JQMA 2P8MA 3L95A 4LIQH 3QB8A 1LK3L 3F84A 3QHZL 3CFJB 3CU1A 2OS7A 5CP3A 4RLDA 4YDLC 4ZI6A 5D1XC 3O0LA 1S5KA 2PWEA 3DX6A 3OJDA 4OC5A 2J8NA 2GABA 3PL6A 4NFCA 1KPRA 4ZUUA 1YUHA 3L9YA 1QQDB 4CU7A 1AHMA 3QWOA 4DQAA 2P9RA 4FAAB 1U21A 1TKJA 1EDHA 3NCXA 3TPUA 4K7FA 2B1HL 4G42A 3J7HA 3WUWA 5I2IB 3ZDXE 5BRPA 4MRIA 3WLWD 1DTUA 5IJKA 4E42B 2YHGA 1OP3K 4K94L 1AZZC 3EGSB 1KIUA 1X9RA 1QNZL 3ARXA 2JK5A 2WBJC 2IGFL 4HNYB 1ZHKA 3BUBA 4XMUA 3MRDA 5TQ0L 4P5MB 4EI5D 2QKIA 1MCFA 3D0LA 2XVLA 5E00A 4OLLA 3TO2B 2HUZA 3IFNH 5AL0A 2O72A 4ONGL 1R4XA 5EF2A 5GGTL 3WNKA 4OZFA 2OM5A 4JM2B 3SE9L 4DGIL 4YIQA 3KLKA 1LAPA 2ZEOA 3D39A 4LEOB 1M9WA 1OIOA 3RVVD 1FRGH 2FYYB 2ZXDA 4QAWA 5EO1B 3NUKA 3VRJB 1FH2A 4FQHA 3VQ1C 5DVLA 4E36A 5EU3A 4O2CA 2IIJA 3LEXA 2Z11A 5LN4A 3S5YA 5MEND 4M1DH 1G6RB 2H9GA 4FYQA 4M5SA 1BF8A 3WIAA 4A66A 5T1LB 4OF6A 5CILL 2OP4L 4LVOC 2Q8BL 3QGVA 1WCBB 3B56A 3IXAB 5CGMA 3VG0H 4JO4L 1OT2A 4RFEA 4DAGL 3RNZA 1E40A 2A7BA 3Q8FA 1R43A 5K39A 2BY2A 4AIZB 3ULVC 2FO8A 1MREH 4PRHD 3FFCE 1FFNB 3TBVA 4IRJB 3P4MA 1ILSA 4OGYH 1NFIA 4PJCF 4ODWA 2JDDA 2W88A 5E6IA 3OWRA 4X5WB 3VFRA 3VFPB 4ZGYB 1HESA 4ODTH 3BVNB 5C07E 1R5IB 5D2NE 4NP4L 3GK8L 4ZDHA 4B9CA 5FHBH 4B13A 4M8UA 2OMUA 4P57A 3MJ6A 4ZYKA 3BP5A 4LARL 1MPAL 3VU2A 1E4JA 5DR5H 3NA9H 1BFTA 1EFXA 3MV9B 3QIBB 4PJ8B 4HKZA 1XF3B 4UM9B 1S7QB 3CZLA 5F48A 3BLNA 3HUJB 3QFJD 2J4WH 1OGAB 1IEBB 2DI7A 2IPUK 1J8RA 3MRRB 3FU9A 5HVWA 3FXTA 4DCQB 3CZGA 3IMTA 3CDGA 1FUNA 3HRZB 2XN9E 1CDIA 1JTPA 1MHPL 3O3DB 2WYZA 3MO1A 3NA4A 4Q74A 1HEZA 3VA6A 5A3IC 3QUMB 5DZAA 3QUHA 4F8LA 2FXFA 2GTQA 4OFKA 4I0KA 3CSPA 3AW5A 4LVNB 5FFLA 1NM9A 3OXRB 4JK0D 1YNLH 2WPXA 3IDYB 2CR6A 2P26A 1IM9B 3AZUA 2CHZA 1OTUC 2WGXA 1HDMB 2VN4A 3AACA 1O9ZA 5E5MA 5GJTH 5D6DA 1M7IA 1VEOA 2ED8A 3KPLB 3N04A 4ODXB 2E8ZA 3F5BA 3EJTA 5GS0L 1VZIA 1FFPA 2V17L 3MCLL 1TCRA 1ZGLM 2GREA 1IGML 4BFBD 5A2KH 1QVOA 5D7KE 1Z0MA 2E56A 3SODB 4JZJB 5DUPL 1BAFH 1DJYA 3PAZA 5BO1L 4AG4L 3O11A 3VM5A 4NHUB 3PWVB 1AQHA 3GLAA 3QT2A 1DVFA 1BFVH 1X7TA 1G7MB 4XCEB 5AVRB 1IZKA 1IB5A 3A67L 4HBQA 5FV2A 5BVJA 4N0YL 2IAAC 3V5DA 5ISVA 3QQNA 1QZ1A 2EC8A 2D73A 2Y23A 1S3ZA 1BJ1J 1F1DA 2H1PL 1VLXA 5D7IB 5EWIL 3AT9A 4WNSA 1YSOA 2WLKA 4R4BA 3X12A 4F7TB 3D7DA 4BFJA 3U9PL 4N0UE 2YGWA 5D4QA 4JJOA 2EE2A 3UX9B 4UCPA 4YBQC 1VACB 1CLZH 3DYPA 1CDGA 5DHXB 4H88L 2H5MA 2A74A 5FOJA 2VR6A 1UWFA 4H20H 2X6MA 4NC1E 4J3OD 4W9HC 5DC9B 2ZONA 4FX5A 4HHGA 5D8JL 4AUUA 5ID1A 1N5YL 1CD0A 4DEPB 3FB7A 2R8SL 1A65A 1E7VA 1RY7B 3LKSA 4S0SD 2WP3O 5C6PB 3H2QA 5I1IH 1BYPA 1H15B 4WWVA 3PJNA 3FU3A 4LU5H 3C9NA 2PJ0A 2I5YH 3WSQL 5F89B 3LH8A 5K8PA 7PAZA 2OW6A 4P2RD 4PHZA 2EEFA 3VI4F 4NQDD 4QRSB 1UCTA 2XKNA 5HJ3B 1N4XH 4Z7NB 3H4QA 4JAMB 4F8OA 1ZG8A 2Q4YA 3UTQB 5EUKA 3U7WH 5HVHB 5IHWA 4M62L 4BJLA 4NQEA 4HMDA 4NJ9L 4UNTA 4U1GB 1F4XL 2K8MA 3WD5H 5I16B 3KD4A 1FVDB 3VDBA 2XFXA 4YZFE 3KYOA 4Z7UA 4M9OA 1CBXA 2XZQH 1L4IA 3QXDA 4IKKA 5FDWB 1V3LA 5BV7C 2QT6A 5J1AA 5I6LA 4DJLA 3O2DL 1D2OA 3QO0B 4X80L 1OLZA 4AKOA 3NJHA 4OCSH 1X5KA 3ME0A 1HKFA 1QHPA 3CFCL 4IOIA 2G4EA 1BYNA 1EAPA 4K3JL 1QWUA 2NY3D 2UX7A 3CJJA 3QRBA 1KXHA 4ZXBC 2PSWA 4ENZA 3I2CL 5IV0A 4QRPD 3KCPA 4ONFH 1FG2A 2PPFA 4LLUB 4LCIH 1FO0L 5KSUB 1FV1A 2VN6A 2H2SD 5C0GB 1KIPA 3PL6B 3PGDB 1KN4L 4ZUUB 1YUHB 1NH6A 1NC4A 2NYYC 5DD1L 1AS8A 3D3VB 4N3UA 3QWOB 4R4ND 5EF1A 2PYEE 3KH3A 1XGPB 2F5AL 3QZLA 2YBRB 1JTOA 2FE7A 4CGLA 2NR6D 4G42B 5D71L 3GXTA 3S3CB 2B5IC 4YU9A 2ZXAA 2C4XA 4X5LA 1FORL 3IMWA 4LSPL 2FL5A 5IQMA 4DN4H 5LGHL 2V2WB 3FAXA 4F80A 1XTLA 2QADC 3C5JA 4G6AC 5F7MC 3SGJA 3SKMA 4PSPA 5GRXG 3KDMA 1IC4H 4NHCH 3WFBL 5CR1A 3FPYA 3V6OE 2ESVA 1KCUL 4TSCL 2XA8L 4NAQA 2VDLB 4PWFA 1J0IA 4PSWA 4ICWA 3PDGA 3NE7A 4EZMA 4PD4K 4Y5VC 1B4TA 4HKJB 2C9QA 4F15B 2YNCA 2WAQA 3S8WA 4BK5A 3NRPA 5GSVB 1KN2H 2NTSP 1JZ6A 1Q0XL 2VMEA 4J1UA 2H4EA 1KWMA 1SLVA 3SIKA 5IZ7A 4FQHB 3HLAA 5EU3B 5HHXL 5F3HA 2CKBL 1ORQA 3U30B 4X7CC 2VMDA 2OR9L 3HC3L 3RWFA 2DLGA 1U8LA 4BZ2A 1GJIA 1HDQA 4JFZL 1OALA 5SWQA 4U2YA 4PU2A 3RB5A 5I0ZA 2BERA 5HXMA 4ONHA 3QFGA 1XMWA 3SPVB 3S35H 1AKJB 3FN0L 1QUNB 2CCVA 4XNAA 1ZLUH 2FT7A 2G9KA 3QWQB 4HEPA 4OF7A 4POYA 1S7WB 2CUIA 3ARBA 2UY6A 2WV3A 4Z7VE 2XIBA 3E2HC 2YJQA 4Y4HD 4NQSA 1Z9SB 2YD5A 5F9WC 4RESB 3T6VA 3NA6A 4ZUWA 1BOGA 3QYCA 5H86A 4XAKE 1AGFA 3BP6B 3KHXA 2B20A 4UF7C 5LYIA 3MRQA 4L1LA 3CZUB 2HB0A 4N9GA 2OMUB 4U1SB 1SXBA 2OLDA 4MNGE 4Y4FA 5ENWB 5I8OL 2PQ8A 3UJTL 4ZYKB 1FBIL 1KBKA 4XWOD 1KTBA 4XOBA 4UT6L 4I2XA 3TA3A 1BEXA 3DUUB 3LJ3A 3N06B 4ORGB 4DT2A 1I8KB 3D1MC 5E4EB 1G4MA 3KJ4C 4D9LL 4GQRA 2W80C 3OG4B 3C5SA 4KDTA 3TBYA 4ONWA 2LU3A 3CHOA 2C7UB 2K1MA 1TTAA 2P5PA 2VSDA 2EO9A 1GS7A 5D7JA 5HJGA 1P5UA 1JHKH 3SDYH 4OM0L 5FM4A 3MO1B 3LKRB 1HEZB 3NCJL 2VDRB 2VMCA 1VFAB 5C6WH 2E8YA 1RAMA 1J8HA 2A4EA 2GITA 4RIRA 5ALCH 2QFPA 4MSWB 1F41A 4O58L 1PG7L 1JPTL 1WBZA 2MCPH 3K2IA 4RA0C 4XPGL 5FYKH 1J9QA 1MJUL 4FEMA 3TT1H 2ADYA 1MN4A 4HFWB 2ZCHH 2BNRB 4WSKA 3VQMA 4BSVB 2AJUL 4MCYA 1QPXA 4AX3A 1ZGLP 4ZAKD 1GA2A 2QELA 5IVNA 1D9KC 5B38G 2X88A 3G6JA 4OTXL 4DERA 3LRSB 4MD0B 2O6DA 3BGAA 2ZOUA 5DZNA 1BO4A 3LRKA 2EVNA 1A6ZA 4QXVA 2DQIL 5IG7B 3FJTA 1IKNC 2BSSA 4JFEA 2ZKMX 4WKZA 3PDOB 3QH3A 4Y2DC 1QVOB 2VITA 2B7DT 5EO0A 1JVLA 1DUYB 1KCBA 4CMHC 4FTVA 2IXQA 3CMGA 3KH4A 1NGYB 3C8DA 3AXLB 4FA7B 5BVJB 1RMFL 1OD9A 3O9WA 5AYTA 5AW8B 5D5MB 5DTFA 1I8LC 3VWJA 1RQ5A 4A94A 3SKUD 2ITFA 5CN3A 5H37G 3WXWH 1YEDA 4LLQA 3LY6A 3G6JF 1A4JB 4EE2A 3D51A 5K33A 4YDIL 5EOCL 4LAJH 4N2EA 3WN6A 1JI2A 1HCVA 2VC2H 4FMKA 3X12B 4KRNA 3UTSD 3L5WB 5CBAB 4O4YH 4G59C 4PJDB 2FGWL 4KRLB 1R3KA 3WMPA 3SBQA 3Q13A 1I1RA 2OJZH 1RJYA 5HYJD 4II9A 2RJMA 3T71A 3WO3B 1P0SE 1MFUA 4M48L 1ADWA 5AW2B 2VRAA 4KSIA 3CX2A 1AGDA 1RFDL 1RZIA 3IFPB 3CLFH 4PI2A 4B5PA 4G7RB 3QUZD 5A16A 3C9NB 3RVWC 3X17A 3S6KA 3IT8D 3N55A 1AGEA 3W0WE 1JJUA 2W9LA 4G1MA 1N18A 1AXSB 2FT8A 2OULB 5IFHL 2WLHA 3WL9B 4QY8A 1UXMA 1C9SA 1FNSH 3PP3K 1MW3A 3DRQB 3BO8A 2X1XR 5EUKB 1TETH 1ZXKA 3LXAA 1T20A 2R0ZL 2WQRA 1UOLA 2FBJL 4M5YL 1Z9PA 4JDEA 3CZFB 4LPXA 2CU9A 1E3ZA 4FFZH 3KYOB 4RNRA 4Z7UB 2HC9A 2AXGB 4Y16B 1ZGLB 4V1DE 2XBDA 3KWTA 2PMZA 2VCOA 1D6EB 3U4EB 4JGMA 2GLFA 2HFFB 2VDKH 2WN2A 4D0BA 3ME0B 4OCYL 1NLDH 1Z3GL 4OZ4B 3N6YA 1KT2B 5E8OB 3SYPA 1KJVA 4IOIB 2ZG2A 1EAPB 5F96H 4E68A 3ISZA 4BFGA 1OTSC 1QBLH 3CZEA 3W39A 4DF9A 1QTPA 5EO9B 1FG2B 2BSRA 4MA7H 3OKLA 4YSPA 4QXTA 3NIGE 2FHFA 1FV1B 4M7LT 1LVEA 3RGVD 1HU8A 1SNRA 5LWYH 3D7FA 1NC4B 3BZ5A 5JHMA 3S3DB 2IOMA 3GRWA 1F5WA 4UQAA 4U05A 4AM0A 4JMXA 4WK4B 3VD7A 4TTGA 1FFTB 4RFNB 4BYHA 3NVQA 3CMOH 3FUKA 3I6LE 2GJ6E 2WKLA 1BECA 1DQDH 1NFDB 3BYTA 3EUDA 2EIEA 3EJSA 4IU3A 4ODVH 3CCHA 3PHQB 3KLAA 2K45A 5M95B 4X2TA 1TVBA 1DO5A 2JCCA 4P2OD 3SKMB 4JO2H 1D5IL 3EDEA 2ESVB 1BZ7B 1VA9A 2NY6D 4GRWE 3FT4B 3ZKMD 4GKNA 5TPWH 3VX1A 2CWRA 3ETTA 4AQ8A 1JGEA 4GS4A 3S9DB 5T8IA 1PUAA 4GUPB 2NY5H 3CFDA 3V6ZB 4JN1L 2OOTA 4PJHE 2Z31D 3OAWA 3FUFA 4PP2A 3A3YB 2CLRA 4WV1A 4Y9EA 3EGDA 2ZOLA 4J1UB 4XNHC 2PR4L 2R98A 4KUZH 4P10A 4MFJA 4HJEA 2J6EH 2P5EB 1U8LB 3S3SA 4PQAA 2OZGA 3PB9X 2PJ4A 1DLFL 1W72L 3PHSA 3OKMA 4KMLB 3LPPA 2FIAA 2IQAB 4OU3A 4B0MM 1IBHA 5JYLA 5E1HB 3QYNA 1CI5A 2IGLA 2OTWB 2CDEB 4OD3L 1V05A 2D3LA 1DBKL 3S36L 2VJXA 3U36A 3VFTA 4BH7A 1FAKT 1HHHA 4F7MB 5KTDA 5FB8B 1TEGA 1A4BA 2X44D 4AZ8A 5C6TL 3FUIA 1DZ0A 2PO6B 3RHWF 1JGLH 1S9YB 4NQSB 4OFQA 4AVCA 2EYSB 2HT4C 2V3FA 4UT9L 2EVFA 4NGHH 4CGTA 2VE6B 2X4UA 2Y22A 2K8QA 4DUXA 5ISZE 5ERWB 1Y0LA 4I18C 3CC1A 3C09B 5CS7A 2O5ZH 3TN0C 4DKFL 4BDVA 3UAAA 5MEQB 3BPOC 3OZ9L 5KSAC 4P4KD 3H2WA 3B2VL 3FCTA 2ARWA 5F2FA 1J9TA 3MNZA 4I2XB 3TA3B 3KYMB 4A95A 1U3HB 2FJHA 3E6HB 4ZQTA 3PHOA 1UVQA 1H0DA 4H0LC 2JTDA 4I3GA 3S48A 3VGGA 3GDCA 3OKOA 4G9FE 4YDNA 3W9EA 2BIOA 2CCWA 3WTWA 3NFPA 2ZXQA 1ED3A 1P5UB 4PLOB 2PXYA 3RDTA 1G84A 5TH2A 4KDWA 3KDPB 4K5OA 4FQPA 3UG4A 3KZWA 1J05A 2O5YL 2REEA 1B90A 4RIRB 1VGYA 5AYUH 2HH0H 4MNQB 2ATPA 4NI3A 5LB1A 1WS8A 3OX8A 2G2RA 3TBWB 3D12B 1UM4H 1T7ZA 3IGKA 2CJUL 3TBSA 2IWEA 5BPPA 4R7VA 5FKAA 1GW6A 2Y5TB 5FF6B 1R47A 1B6DA 4DZ8B 2GBTA 2KZ1B 4E9RA 1E2VA 5AFAA 1QWNA 3DHJA 2WSAA 2OB0A 4PGBA 4POUB 4CAWA 3P3TA 4J3UA 5F1IA 1P84K 4ALAH 4JFEB 3MBEB 2X9WA 3N1PC 3O4LB 3VRIA 2VITB 2H3NA 3TVMC 4NFDA 3HZYA 3HC2A 4GO6B 1S9XA 1H5BC 5D1QE 5FW8A 1W0VB 5EEZA 4FFYL 3GPEA 3T0EE 3TYGH 4FQCL 1GC1H 3MOBH 4JFDA 1MRFL 5DA0B 4PGEA 3EO9L 2A99A 3O2VL 1QRND 3MCG1 1XIWB 3AROA 1YEDB 2FLRT 3DO4A 1SXAA 1IGIL 2V7HB 2A6KA 4I88A 4C56A 1VKXA 2AJYH 5I28A 1HQ4B 3ZGIA 1J12A 4PJCE 3OAYH 3IMBA 2BRRL 1KDJA 1IGFH 1CPXA 1R5WB 3CXDL 1HJCA 3G5VB 5T1KB 4M7ZC 4RGNB 2G5BA 1XO8A 4OZIE 3FRPB 3GSXA 2ZKYA 2VXUH 3NFNB 1LDPH 2FEDD 4LXFA 2EKSB 4FNTA 4NFRA 4O51A 4OFYD 3QEUB 2PLTA 4ETQA 4PVMA 1GGIL 1A6WH 1A5FH 1RZIB 3UJJL 1U58A 5IBUB 5B7FA 1BQLL 4PV6A 1UKSA 1WA2X 2WAHA 4I9XA 4N2BA 4I0PB 1PCXA 4MFHA 4RFOL 4HJ0D 3FCBA 1UD2A 2B16A 3C08H 3Q3GA 5FLUA 2Z0UA 4G1MB 3V7ZA 3CUPB 1X4ZA 5CJOH 2Q7YA 3N41F 5CZXC 3RFRA 3BJ7A 3PV7A 1YJDH 2BP3A 4HIHA 2DWTA 2WZ6A 4LPWA 1ZLEA 3INOA 1NEZG 1T20B 3HPLB 3WFDL 1DBML 4YHNB 2Z4QA 2CO3A 4JDEB 3QPQC 1YN7A 1YZZA 1INEH 5FO8A 2Y06H 43CAA 2P6EA 4WNQB 1MLBB 2CO6A 3VXRE 1IB1E 4CAEA 3P0YL 4UQ9A 3GJFH 2FIRT 2XNAB 2V6HA 3T1WA 3MREA 4KKBD 2H0FA 4YHYB 5C0ND 4UILL 1E5UI 1T89A 4X9HA 5JOFA 4D0BB 4JRXE 5TD4A 1KJVB 4PGCA 5AOKA 3HNTH 3QI9D 4XNQA 5SX5K 4YVNA 5AAPA 5LXGL 4AG7A 1MUJA 1T1XA 3SKOA 4PJ7B 5GSRB 2BSRB 1FNHA 4DQOL 3BRDA 4CN1A 4OH2A 1F4YH 2CRIA 2BS8A 5J6SA 1IAIL 3O8XD 2Q10A 5CN1A 5DO2C 1ZTXL 3GC3A 3BE1H 4N8CH 1F6AA 1HL5A 1WUZA 3N44B 1GGTA 4PJ5A 5H4YA 4D0CA 1E3XA 2GFQA 3VNYA 3NP4A 3CZKA 5L9DL 1FVCA 1MFCH 2YSSB 3QXUA 4M6OL 3I6KA 5D4IA 5AG9A 2EDBA 1KGWA 1I1AA 5EU6B 3KWWA 4KJWC 2E59A 3R1GH 5C0EA 1J5HA 5EN3A 4U7KA 3CCHB 1A9EA 2ZCZA 3KLAB 3IJ7A 4JZ0A 1TVBB 2JCCB 2QSTA 4W9JC 2QFRA 3ATFA 3UO1H 3WE1A 4UTCA 4Y8AA 5F72S 3UPRA 4ZMTA 1T7XA 4P99A 1NMAL 2XWJB 2VDPB 2ITEA 2OZ4H 3HE6D 2EDYA 4X6CA 5CEZE 3HS8A 2QQKL 1CN4A 1EO7A 1JDDA 3IRZA 5ICZB 3Q2NA 1YSJA 3VI4E 4HUCA 3DJ9A 1T7VA 4WV1B 4LUAA 4V11A 2I9TB 1ACZA 1KEGL 1GSMA 4DGYL 4FKEA 3KE0A 1XHHA 1UWEH 2QQLH 5G2NA 2W95A 4TWEA 4NP9A 3CFTA 3BUYA 4K8RL 4JRYB 3V4PL 4UB0L 1FI8C 2ICWB 3UFIA 4FKHA 4LNVA 3F12B 3HTLX 3SPCA 1G0YR 2QTEA 3KJ6L 1BXXA 4DP1X 5IP4A 3GF8A 4URKA 2XICA 4X6CF 3DRTB 3EFFA 3FQRB 3RNKB 1O9WA 4N3TA 1J7VR 2A3TA 2RFHA 3ZHLA 3VB9A 1JG9A 4X8XA 5I30H 1UUSA 2UUDK 4FQLH 4KVPA 4AVJA 4Q7DA 3RA7L 1MW1A 2W1NA 3EOAB 1OGTB 1KGIA 3B3TA 1T2QH 2Y07L 1DJWA 1OD7A 2X4UB 3BZ4B 2VLRA 4HPOL 1AH1A 1JYWA 1LP9A 4FGMA 1AQKL 2ATRA 5IX3A 5TK2A 4BD4A 4NZUH 4QRBA 4ZO6A 1PNDA 1R6VA 1NGXB 5IJVA 1QYGL 4S2SB 2ITDA 5BUPA 3DROA 4K7PH 4KKLD 4KXAA 3B9KA 3V9EA 1RK7A 2EUWA 1SF5A 1N64H 1CICA 3PHOB 2R2BA 5FFOA 1NEZA 4PLKC 3IFEA 1H0DB 1ZOXA 1SHWA 4GOSA 1G7PA 5ITFA 5E8DH 1YQVL 4W68A 4GSDH 3NFPB 4J3OH 2NYQA 1DQLH 4H8WL 3T6QC 3RDTB 5TH2B 4KU1A 1U91A 4HCFA 2DKUA 2F1EA 5EU7C 1CD8A 2BXZA 2UYLA 4AIEA 2CDFA 5THWA 1EDQA 5IFAH 4LKCA 4BZ1L 1FO0B 4OLWL 5FLVA 4XCFL 2Q3ZA 3DHPA 1LL1A 4HKBB 4NSQA 3IMRA 1TIUA 1U8MA 3DV4B 3NJNA 5E6YA 2WWMC 4FLQA 4MFKA 4AY0A 1SEQH 5BZZA 1QBMH 2P48B 3LMJH 5IHZA 1VCBC 4KK8D 1EZLA 1ACCA 1FSKB 4EJ1C 2C7FA 1A1NA 1JWUB 3T3PE 3RYMA 2C9PA 4N8VG 1KXQE 4PJ9C 3RRQA 3VRIB 4B0MB 2FR4B 3L2NA 4X7SH 2PPDA 1GGUA 4D94A 1GCYA 4BWWA 1S9XB 3D2UD 3KM1A 4CW1A 3TJEH 2B77A 4APQC 5JHDD 3OLGA 1M1XA 1INQA 4JFDB 4EXKA 1FYTA 3UAEA 4XR8C 4R0LC 3ML8A 5FA4A 4ZO9A 4C56B 2A6KB 4HHWA 3S9MA 3KPSE 2D7TH 4HDIB 3Q8AA 2R2EA 1OTUD 3U0PB 3AT8A 5CP7A 1UM6L 1GH7A 3D4GA 4YHPA 2P0WA 3DX7A 4A2ZA 3ZDXB 4CC0A 3JTSA 4F9LC 1ON0A 1JGDA 4BK8A 1Z4EA 1HX0A 3GJEA 1AO7D 4GQQA 5I1DA 5J1SC 1MCOL 3PFQA 1CF8L 4BINA 4ODUA 2DBLL 4BFKA 4FJYA 4O51B 4XMZA 3G04B 5I6XB 1ODAA 4NZTH 3LWUA 2FHCA 3H54A 1A02N 1KPUB 4M93B 3R9FA 1BOYA 2FJGB 4JFQB 4OW6A 3ULSA 3Q3GB 3G3SA 1ILUA 4QMEA 1MKFA 4FQJH 3S6GA 1ETB1 1G7IA 3R19A 1YPZA 4JHUA 4PR5A 3CFBB 2CO4A 3TASA 2Q7YB 5T3XL 3DGGB 1I9EA 1QPKA 1QX1A 4NPKA 1ZO0A 1A8ZA 4JPIA 4I87A 4DEWA 1MHCB 3CZXA 3QQ4A 4ZUVB 4NB7A 1CFVH 4V2CB 4NO3B 2Y36H 2HTKC 2N0MA 2Z4QB 1I8IB 4F57L 5JW4Q 3TV3L 4G6MH 3QDGE 4A31A 4K71C 43CAB 5CWSA 2MOGA 2VL5B 3MX0A 4K0OA 4JCMA 5FA3A 4AV5A 1MOEA 4IYKA 1RUPL 2CRZA 4R8WL 1UD6A 2DMGA 5KANG 5AENA 3GUTA 3RUGA 3GEWB 3FFCB 3JTKA 2GSIB 1YPZF 1FZKA 3BSHA 4UNUA 2IC2A 4Q6KA 2IDFA 2DQDH 4PGCB 3LNEA 3MU3A 1T03H 4WO4A 4XNQB 1ZV5A 1MIEL 5D2NB 1T1XB 1FNLA 1OZUA 5K9OA 2R1WA 4NKOA 5IEHB 1PS3A 2X2IA 4K9EC 4XP1L 4UFVA 3D9AH 4JREB 2BWQA 4PGDB 5IQOA 4ZJ9A 5J6HA 2HLFC 4XMLH 1KSRA 3BPCB 3QQ3A 3ZDZB 1NGQH 1QHQA 3NIDF 4D0CB 5KZCB 4DIXA 3D69A 1M71A 3RUGF 2QQQA 3A4FA 1FVCB 2R29L 3DJZA 3D87B 1MJJA 2HYMA 3I6KB 5IHBA 1J1XH 3LKOA 2XN9B 1FH5H 3GBEA 4PRIE 3PWLA 3KWWB 4N0CC 3OMNB 4QTIL 5C0EB 3VFGL 3EOBA 3WJLA 4AK2A 2F54A 2YMXH 3EJYC 2AFXA 3EDJA 4FTVE 3N42B 4JMNA 4C59B 1T2XA 1UEMA 32C2A 3OSKA 5C0JB 4HZLA 4ZXBD 1K6QL 2BVPA 2NY4C 3ZYOA 4AEIH 2PRBA 2PR8A 4AUJA 3DVNB 1P4UA 4LPTA 5F9DC 1F18A 1F86A 3BQUA 4LGSB 4JM2C 4PY7A 3PJSA 4EF3A 3CFEA 5TQ2H 3CVCA 5I1HL 1IAIM 5FR3A 1LHZA 5D29A 3MDJA 2G3NA 1QSMA 2ZEFA 3HMXH 4L5FE 4DGVL 1UASA 3KR3H 4M6ML 1R5VB 5EF0A 3L3HA 1DVQA 3IE9A 2R7HA 2JJSA 3SY0B 4DGWC 3MLXL 1ML0A 1N10A 1IGYA 4MAZA 2F7QA 3I50H 1QI3A 1CFMA 4G6AD 1ZHNA 5HDBF 2Q87A 2WJ7A 1ZLWH 2NY7L 5JW4N 4UIBA 2A6DB 5E23A 1BD2D 2P5WA 3EJZC 5KW9H 1VSCA 3O4OB 5CEZL 2CIIA 1IE4A 4FF9A 1I3RA 3MV7B 4X4XA 1T2JA 1QR1B 3GLJA 3LAFA 3S5ZA 3SE4A 1MCWW 2EIBA 3WU1A 5LGKA 5G20A 3FO9A 5E2UH 1K5NA 4GLRI 1JFQL 1DVTA 4NT6A 3LQAH 1ZEAL 1QLEH 1XJOA 5DFVC 5C92A 2VLRB 2OXGB 4K7PY 3X14B 1YLEA 1LP9B 4CL7A 3TA4D 1CLOH 4QVTA 2A5UA 4JQVA 3Q1SH 2J6EA 4JHVA 4UFWA 1SHXA 4ZK8A 5I24A 5IJVB 2V2TB 1N71A 3MRUA 4PJ8C 1A9BA 5KVDL 3TWCL 4TQ8A 1GAFH 4IJ3B 2OK0H 1TSHA 3NIFE 2IMMA 5CIPH 2ZOFA 1S60A 1Z5HA 1CICB 3QORD 2CO7A 3HRZC 5FYLL 3V0EA 2XVBA 4U2ZA 5ITFB 3K9UA 4YUEH 3MV8A 4XTRD 3ZHKA 2G5RA 2Y6SD 1BQHG 2CMRL 3ZUCA 4D2NA 3PPSA 4PJIF 5EH1A 5B4MC 4OGQC 3F85A 3VFMA 4LVNC 2HJFB 4L4TE 3VXUD 1BJMA 3CH1B 3BCDA 3FQWA 3IDYC 3VXOB 4CGOA 2ZIDA 1VB9A 2H6UA 4GQ9H 4HWUA 4LHUA 2EZ0C 4R5XA 2FX9H 4RBPK 2N59A 1OHQA 4KKAC 5TDOB 1A14L 3DO7A 1FDLL 4EKJA 2R8VA 3RJDA 3HI6H 3WFEL 2BC4A 5EOTB 5I75B 2YRBA 3ZIMA 2DWXA 4N6RA 3U25A 5HYSG 2XBTA 1QLFA 1YAZA 5AW7B 1A4AA 5JMOC 4DTGH 2UZPA 2Z64C 1T66C 3ETBF 1VFOA 4JZJC 4WUKH 5KSBA 4HXAH 1NCDH 3M46A 2EDXA 1M1SA 3H9SA 4X9FA 2B58A 2OPCA 4XCNB 1A9VA 4EZKA 2P52A 5BS0E 4CW1B 4ZX6A 4NN6B 4F5CA 5SWSD 1O6VA 1KB3A 3KPRA 2DI8A 3OMAB 4FXKA 7CGTA 5EC1A 1RKRA 3FQUA 3L3GB 5FA4B 4YFJA 4LHQB 3ZKNC 2RMNA 2WCPA 8CGTA 1UA7A 4DUKA 5J9PA 2PYEB 5EPMB 3FVLA 2YNDA 1KENH 4G43A 4X8JB 2CBPA 3C60A 2R2EB 4PREB 1RIHL 2DPSA 2VXTL 5CP7B 4RUHA 4EI0A 5KSBF 4OCLC 5HMNA 3QCVL 4BQ8A 4TTDD 1S3KH 4YHPB 5CGYD 2ZELA 4JQXA 4MD5A 4PP1C 4L8DA 3GJEB 2JI2A 2W0PA 2KDYA 4WGVB 4DEPC 2X1PA 4Y2DD 2VIRA 3QCUH 2N1TE 3GS0A 4P46A 4MVBD 2ICEA 4WY7L 3HRPA 5BNXD 1W72B 3IK2A 3SDCA 3GPSA 2GIMA 1NDGA 2B39A 3AFLA 4IAVA 1U6AL 2M1KA 5IQNA 3HLPA 3MXWH 2XBZA 2JV6A 5DEJA 4JFVA 4NUGL 4PJEE 5HHMD 4UV7L 3BKML 3DSNB 2VWEC 4XVJH 4MA1C 3CLEL 1EAOA 4U9ZA 5DMGD 4ZQKB 5KVEH 4Q6IA 3VRLF 3LKQA 2RCSL 5IBTH 5HI3D 1SBSL 2NXYD 1Q9LA 1GPOL 1R3JA 1TEYA 1MG3C 4JFFA 3SO5A 1INDL 2VH5L 4ZFFA 5ELYA 4JPIB 4MXWH 4E9TA 4EZLA 4M29A 3QQ4B 4HF5H 3TIEB 2NY1C 1FIEA 4FZEH 5KN5B 1N6VA 4UI2A 3U48A 4IGBD 3MRHB 5EZJA 1XGUA 3U9UB 3BEWB 4OD1L 3WI9A 4OM1H 1LO5A 4G2AA 3L1OH 1U8IA 3L3KB 3EYFA 3ISRA 4N2GA 1JS4A 5FUOL 4L2YA 5D96C 4HV8A 3SHSA 3S3PA 1HIMH 2DLFH 2X4QA 5FO7B 4LF3A 3KPPA 4LPUA 4PMEA 2R4RH 3REVB 1MCHA 2XXCB 2Y1ZA 1JD9A 5DUML 1OLLA 3UACA 4EI5A 5K9OB 5T3ZD 4N1HB 1XD0A 2R1WB 4MMXA 3APNA 4P3WA 1RURL 4MNGB 3PUCA 4HQQH 1RZKL 3BGMB 4Y5XA 5CNPA 1FC1A 1Q9KA 3LDBB 4R6UA 2VZYA 4J3OG 5F44A 1QR4A 3ARFA 2AQNA 5E9DD 3O0RH 3RPKA 4MB3A 1WAPA 3F7RA 4GKOA 3GJFA 3LNDA 1NGWB 4JO1H 3BPNB 3MBWA 4AQZA 1DSYA 1JF1A 3HI5H 2O6FA 3LKOB 3B2UD 3IU2A 1V10A 3PWLB 4J4PC 1C12B 2OTUA 1JWMA 1Z3RA 2E7MA 3EOBB 4I9WD 2ZYIA 1H8LA 1BPMA 1MLCB 4B11A 32C2B 3W5MA 2MNWA 4AWJC 3QR0A 5D2LE 3VSVA 1KUVA 2QGDA 5KYXA 1OBRA 3GXPA 1NCBH 1J8KA 1U4EA 4D9RD 4P45A 1MRCL 3MCKA 4WUUD 3VGFA 2Q3AA 2O61A 2GK0A 1YEWA 4PY7B 1QFWM 2I85A 3CN0A 3DSFH 3VI3A 3PE9A 4PRHA 1AZNA 3RDJA 2I60H 2YQBA 3I6GA 4QOKA 1WLHA 1JK8A 3VXSD 3JYBA 4AVAA 2GHZA 1ZHLA 2F08A 4GUCA 5J56B 4Y4KD 3U30C 3QIUA 5EMIA 2Z35A 3NT0A 3GSWA 1URIA 1TF9A 1XCQB 3KLLA 5DA4A 4XNMA 3PB8X 2BP8B 4JZNA 4MB4A 1N5AB 5E2JA 4Y1AE 4F2ME 2JKRM 3JBG7 4M3JA 4Y9FA 4LDEB 3L7EA 4I0CC 4PWJA 2L0DA 1DSWA 3VI3F 2I3CA 4ZD3H 1OQOA 4OBSA 4GUQA 1TJGL 3DYMA 3BKYL 3QUXC 2AQTA 4WK2B 4KMTH 2YAEA 2OZ4A 4D7BA 1AAJA 2CG9X 4UQIM 1HOEA 2JEVA 1UM5L 4ZBJA 2C27A 1YG9A 2E7HA 3N0AA 4L5FL 4L37A 3DR6A 3O6FA 1RJZA 4DP6X 4RMBA 1TKWA 3Q2WA 3HI1A 2HSIA 4P4FA 3NJIA 5GRYA 1KWKA 3BSZH 4XAWL 5DK2B 5IROD 4ODHH 3JUYA 4GIPD 2R0KL 3S97C 4C47A 1AJ7H 5D1ZB 1I3GH 2GAZA 5E4EC 3TYFA 2VZUA 3OGOE 1HSBA 3HAEB 1RO5A 4GYBA 1F56A 4X5KA 3JWOL 3W0WB 2CR0A 5JXAL 2AQ2A 1BQSA 3MV8B 4UEEA 4HIXL 3C5ZC 4M43L 3VFUA 5INCA 1LE9B 5JQ4A 3ABZA 1KB5H 5GGRB 2X89A 2Q20A 5GISH 4MZ2A 3MJWA 5HP5A 4K5LA 1WAAE 4P2QD 3MRNB 1OSYA 3KASA 3N40P 1TQCC 4Q36A 3SBWC 1Q1JH 1T0NA 2B8OT 2VQ4A 4LHUB 3L3JB 2X9ZA 4M5ZH 1S9WB 4G6FB 1G5GA 3N50A 4QRTA 4U6XA 4UOW1 1JCKA 5KVGH 3M1CA 3THMH 1QSVA 3ZN6A 4F91B 3NJJA 1DVXA 4V1DB 3TS8A 4FADA 2O5XH 1PTZA 4B9ZA 3B5TA 4FLSA 1N6UA 1QLFB 4BBWA 1YQEA 1RK1A 3WN5C 1PLGH 1EVUA 5L4JA 1S46A 2DM7A 4QC6A 1C16B 5C0DA 2IV8A 3H9SB 5HHPA 2VDNB 1RZJC 4XOAA 5FC9A 1E0OB 1KYOJ 1SOXA 3GZPA 3VFOB 3VWKB 4P59L 4LCWD 4X6FA 3IU3A 3UBXG 4E9VA 4EIBA 3GRWL 4NO0B 5IT2L 1J18A 3NEEA 2EDRA 1JZ4A 3HN8A 3OKNA 2Q44A 1MCIA 1RUKL 1UOWA 4R87A 4KJPD 4HEME 5DFTA 3P2BA 3DURB 3CZSA 1HQRA 3UIYA 4L29B 2ZCKH 4WSGA 4J3OF 5FCUL 5AAWC 4B5OA 4MD5B 3GRBA 1GY2A 2VR3A 2ZPKH 4L8DB 4MJ4A 2BH0A 5ESVA 2QV2A 9PCYA 1I7TA 3QUYB 2RHEA 2EVGA 4UDTA 4EZJA 2ICEB 4KJQC 4MDJB 2VM4A 4OVUA 2E7LA 3SDCB 5TJWK 2GIYA 1NDGB 2X70B 5IB2B 1YDPB 4PJAA 2D31A 4NQCE 4I49A 4FEIA 4AVIA 3NZHH 3PP9A 4UTBH 5LGJA 1CBJA 2R56L 5K1NA 3RAJH 2BMKB 5FKPB 4DVRL 1WFNA 2EVHA 4IRSA 3QRGH 1TYEB 1Q9LB 1R3JB 3EG9B 2WVVA 3MLWH 1BJ1H 3BH9A 1YNTB 4EUPH 4JPSA 5JW4R 1B6BA 3AQDA 4F0YA 3N9GL 2MKWA 3RWGB 3U9WA 4XPDB 3SB3A 4NZRL 4RSYA 2JB5H 1SJVA 1FNGA 4QLWA 4OKVA 3T8XA 3X1GA 1IIDA 3WT4A 2W9EL 1RZ7L 4U6YB 4PJAF 3F7VA 2OZHA 4Y16C 1XGUB 4OP4A 5AVUB 3B3VA 3LPWA 1U8IB 4KKQA 3E1F1 5EBMA 3T5WA 5DC2A 4FABH 3O3UN 5CAYB 4TYUA 4GIOA 2HB6A 2G60H 2GHWB 2VO8A 4X99A 4OLYH 4WWKD 3MYJA 3LB6D 4X6BA 1FGVH 1FRGL 2VR5A 2X4QB 1PSKH 3HHMA 1HWGB 4K4KA 4IUSA 1L9PA 4LF3B 1J1PH 5DVMA 2EADA 2WXIA 3QNYB 4XXDA 3ROLB 3SYCA 4PXEA 2XVKA 4MJ5B 4EIUA 2YD1A 4YWGH 4M1DL 3LZPA 2X0UA 5ISZB 4DSYA 3O3EB 4OGXH 4GMTL 3ZL4H 1TYJA 4MMXB 5CINL 2GUOB 3PGFH 4HG4J 4R96A 4Q6YA 4PY8I 1UD8A 4Y5XB 3VG0L 2XZCH 4DZBB 2BHFA 3FUHA 3QPQD 4GJTB 4BZYA 4KKZA 2A4NA 2WNXA 3GSRA 2P3YA 1CLVA 2HRLA 3IU4H 4RFNC 4AI7A 5IIEA 5FYJD 4Z7OF 4GEIA 3RLSA 2BRQA 1LO0H 3HNVH 1U95A 3Q5YA 5J13B 1A6UH 2YEZB 4FHJA 4G9FB 3RU8H 3KNBA 3NCCB 1WSST 5I15L 1ET7A 4MMOA 1CFQA 1CL7I 4X6EB 3Q2LA 1JWMB 1ASPA 1T3FB 2K0RA 2VKXA 1Q7LA 5C08E 5C0BD 5FHBL 4ZZKA 2IDQA 3PCYA 2AJXL 3G9VA 5FYKE 1IBDA 1Z8WA 2AZAA 3ZUNC 1DANU 3L54A 5DR5L 3NA9L 1GZPA 4TNWF 4JKWA 5GGSY 4JJ5B 2HKAA 3ULVH 3K4DA 1RK0A 3I6GB 4OQ1A 5GZOD 3SN6N 2J4WL 1KJ3L 1EEUA 1ZHLB 1YCSA 1IV8A 4X7DC 3LN9A 5LYFA 1PQZA 1MIMH 2Z35B 4IOSD 2Y2WA 2YC1A 3MGOB 1TJHL 3DKHA 3QDHA 3QDJA 2W38A 1XR9A 3HC4L 4TVPD 1ET5A 4LAQH 5D1QB 2NX5E 2D0HA 3LNFA 4CVZA 2VI7A 2FO1A 3S96B 1YNLL 4I7ZC 4AQ1B 1YUKB 4EI6A 4DNCA 4CRPA 2BSCA 2O53A 1CU4H 2PO6C 3U6XA 5GJTL 3EJPA 1YEIH 3HMWH 4J3TA 1RZFL 4KNTA 1U8QA 2I07A 4L37B 2XDHA 3FU5A 1FNOA 2JKNA 3O3BB 3ULUC 1D5XB 3O6FB 4RAVA 1RXTA 3HMXA 4N2HA 5G21A 2G3MA 2WNGA 2NMTA 2F5BH 3ZE1F 3C09C 4G9DA 1BAFL 3M7OA 4W6XB 4P3CH 4J3BA 4OZIB 2BHYA 2EVIA 4MD4B 3HNSL 3ABKB 4L3CB 2AHIA 1RLWA 1V3MA 1DN2A 2GAZB 1U3HC 2XRAH 3R18A 2H6OA 4ZAKA 3IDNB 3SCMA 1JYNA 2FJSA 3NIDE 5IVXA 4LCYA 4QWWC 3ZSSA 5GS1C 3KVQA 5DD3H 2GJJA 3RWIA 2EINB 3GLDA 4EOWL 2Z3KA 3BPLB 4BH8B 1GIGH 2ZAGA 2MNUA 2YRZA 4QHKI 4QXGH 5DJ8A 2BY1A 3LXCA 1OOWA 4FLOA 1DDHB 2HFTA 1CLZL 5C1MB 3VGEA 1E5BA 5F6IB 4MHDA 1OAXL 5GGVH 1MWAH 1JV5A 2WNWA 5GRUH 3D18B 3I1UA 1JFHA 3DI3B 4R3LA 2G5UA 1HYSC 3EOTH 4H2CA 1BX2A 3KLDA 4HIEB 1KUYA 1P4IH 4DPAX 3X13A 5IVXF 5DQJA 7FABH 1KCRL 4XMKL 1L3NA 3P3SA 4PPTA 3SDDD 5J0BA 2WLIA 5CIPA 3EO4A 2XT1B 3QIWD 2IWKA 4WW2A 3K5SA 4NGMA 4XO3A 2ZWLT 3MBEC 4GO8A 1BDYA 1N4XL 2NSMA 2OJ1A 3GSNA 4JRXB 3UC0H 3EBGA 4Z76B 4NQVB 2Q76B 1M7DB 2K78A 2W0KA 1E90A 3U7WL 2YSTA 1YMME 5BRZA 1DN0A 4YGVB 4B95C 3WD5L 3ESVF 2R9HD 3IVKA 1BM3H 2DQEH 3UZQA 3WY2A 4YSOA 1WTLA 5I0VA 1LLAA 1XIWC 2XZQL 3RIAF 1U8HA 3SGKA 4U6VL 5CZKA 2QJ8A 5GS2D 2WCGA 3OMZA 4WW2F 1AUGA 5AOZA 3PWPD 1N12A 3BZFB 1HQRB 1SHMA 4OCSL 5CJQH 2R69H 1DJIA 1TZAA 4RGNC 4RWYH 4H1LG 1QRKA 4L3AA 4Z7WE 2CLVB 1IGJA 3ZMNA 1CO1A 2ADFH 5ESVB 4ONFL 3AG3B 5D4JA 4MXQC 2X6VA 1O6SA 1AC6A 1YY9D 4O2EA 2YUXA 4OJEH 5HDRA 2EYTB 4QRRE 4F1ZA 1J8SA 2H0JA 2JE8A 5LAXB 4AG9A 3BD4A 1A2YA 3DX2A 4I0PC 2VJ8A 4Q4IA 4APQD 4F27A 4M85A 1OT4A 3E9TA 2I24N 4N28A 3Q7JA 1RUMH 4H6ZA 2DEYX 1MJ8H 3NK4A 4AZUA 3BSGA 4HZAA 5K1JA 2J57A 4IRSB 1HEHC 2ROXA 5IQLA 4N2IA 4WHYH 1NPNA 2WIIA 3RI5K 1ZLSL 4D8PB 4DVBB 4L8SA 2O4HA 3BH9B 1CJYA 2YD9A 2ZW7A 5E2TL 3PWJA 3HN3A 3WXVH 4PJIE 3FUJA 2YS4A 1UOKA 3V4UL 4QRAA 4PW4A 3VXMD 3POHA 2FIKB 3VYOA 4DN4L 3LPFA 3FF7A 1FNGB 3UOAB 1OF2B 1BAWA 3ARGD 4MMZB 4NHCL 4XOEA 5C0AB 3T8XB 3LIZH 5I76B 2J1ZA 5D7EA 3F7VB 5IOPA 3BIAX 5I5JA 4C83A 5MERA 1RPQA 5E24E 4QPEA 4YHYC 3HS0A 4BELD 2LU7A 4C8XA 4ZFOA 4N20A 1C08A 2A83A 2DAVA 1JQGA 1ZVNA 4NJAH 4X6BB 3W11D 3FL7A 3EYVA 2GT9A 4JPVL 3J2PA 1KJ2H 3QDMD 3CK0H 4PJXF 1TQBB 4FS0A 3UTPD 3ECBB 1JE6A 4ESKA 3ZJAA 1HVXA 5A2CA 3FO0H 2ITCB 2F7PA 5DVNA 3B4NA 4R96B 5IMOA 4XN9A 1S5IL 2Q3XA 1PJWA 3H2PA 5JIHA 5LRJA 3FS9A 4YPJA 5IIEB 1AG0A 1MFMA 4KOTA 4E5XA 1U95B 3QDAA 4HZ1A 2EUXA 4YPGA 3ZYZA 5GS0C 1A7BA 4MXUA 5JPNA 2F53D 3T77A 3KYNA 4UOQA 2H3KA 3UCRA 1ZHBA 5F7UA 1QMUA 3H5ZA 1YEJH 3DOIA 1EANA 2A9AA 4ELME 4JZOA 3I02A 2AK4A 4RSVA 43C9B 5CSZA 3TOAA 4NXSA 1U8CB 4L3EA 4UQEA 5CNHA 2PWDA 4S11A 4LK4A 5IWLA 4F8TA 3B3WA 3P9LB 1BF2A 5JR1H 2WTOA 1F3DJ 3IGRA 1RK0B 3QO1A 1S5HA 1HHIB 4ZUSB 2FSRA 3Q6FB 3L4YA 2VSKB 3ETSA 4U1IA 2JKLA 1SDAB 2OW7A 4Y89A 3LSOB 4FG2A 4WW1A 3SDYL 2NCEA 1PQZB 3FTSA 3T3PB 3V7MA 2J2ZA 3HPJA 2YC1B 3QG6B 1CBVH 4WJKB 3QEHB 1IMHC 5DS1A 1OM3H 2IH9A 3QDJB 3QPKA 4IU2A 4P4KA 2AAAA 5ALCL 4CVXB 4N5UA 1XH3A 2MCPL 2HKHH 5FYKL 3TT1L 4JY4A 3KPMB 3UP6A 2ZCHL 5EBGA 2WBKA 2A4ZA 3FOMB 4KI5D 4KTDH 5DSCB 1U8PA 4MBOA 1FJ1B 3IPFA 2Q7SA 4JM2D 4NM8L 2RC4A 4PJGE 3DYOA 1OVZA 3AREB 2J88H 3B37A 2CNZA 4WJ5A 1OAYL 4JPWH 3Q6GL 4MFLA 3W2DH 3RTQD 3JV6B 4N22A 4N8PA 5ETUB 5GGSA 2X3BA 2KKQA 3RZCA 3CHQA 4N25A 2XTJC 5EBWB 3WO4B 4UCNA 2FATH 2BO9A 1QO3B 3E38A 4P4IA 3E3QE 4YDVA 4AL8H 3U79A 3L5IA 2D4PA 2IALB 3IETB 5EOQH 4EUPG 2EIMB 2A6IA 3H9ZA 4PV8B 1WBXB 3DK2A 4LCYB 3WXWL 2OMVA 3II1A 1QQ9A 4H2KA 1OB0A 5GGVY 3B2DC 2UV3A 4GAYA 4M7KH 5A2LH 4IRJD 1TZHA 2IDSA 1NIFA 1YK3A 2XQYK 2MMXA 3V95A 4WTQA 2XC8A 1ORSB 3AXHA 3VXQB 2OJZL 3ESUF 4B6ZA 7PCYA 2ZOKA 3UTTA 5JHLL 2TSAA 5DJYA 3KPNA 3DX9A 3DVGB 4TNWK 3ARDA 3BSZA 1XGYH 4GUOA 3X13B 2A4CA 4RISL 4XBPA 5DQJB 4NUMA 2Z8WC 2OXHB 1IKOP 1ECYA 2WLIB 4JBSA 3QIBD 3D7PA 3NSFA 4PG9B 4PBDA 4PCSA 3MJ9A 1FSKC 3FTYA 1DQJA 1OGAD 1BV8A 2PABA 2WJ5A 3G5XA 3M88A 2K70A 2Z7UA 3NYKA 4LKXB 5MENE 5EU4A 4LDOB 2BDNH 3GSNB 3PHAA 3ES6A 1P4LA 5IJDC 1FNSL 1EBAA 1X7QA 3CNKA 3ZGHA 4MAYB 1V7NH 3H3PH 5T5FH 1DN0B 1KB5A 2O4EA 2BWIA 3WLBA 4AKQA 1NPJA 4MY0A 3CQQA 3E8UH 2O30A 3UZQB 4FFZL 4FQ2L 4PRHE 1X3DA 1HAUA 4RMWA 5DS8B 2RR3A 3WDJA 1E9QB 5DDHA 2KC0A 2J55A 5EDXA 5LCVL 2ZENA 4KZDH 1KGUA 3OR7A 2PYFA 4NYLB 3G08B 1YLOA 4GW1A 1L9RA 4D8OA 3P4OA 1TPXC 4YE4L 2PVVA 5T3ZH 5J6GA 4NKMA 5CJXA 1NLDL 3G6AA 2CLZA 4MNQA 5HSFA 3QZPA 1WZ1H 1CDYA 1SYSA 2PKDA 1CMOA 3RGBA 3PJLA 1MH5A 4L2LA 2ENJA 4MA7L 1Y18B 3VXPA 5I6XC 5JXEC 3U7AA 2H32A 3QEGH 1IQDA 3QFJE 4HWBL 4AQAB 1AOZA 4X9IA 1A2YB 2FX8L 4M93C 5LWYL 2UY7A 3NH7H 5IMMB 4DKEH 1AANA 2IJ0C 2VDMB 4Z0BH 1CVSC 3X1NA 3JXAA 3GDBA 4AGMA 3B83A 3C6SA 4KOVA 4U1KB 3SE6A 1JGUL 2WZ5A 4GT7A 1E3FA 4JB9H 4KRPB 3RWEA 3D4UA 2LU4A 4YGOA 4U1JA 1DQDL 5C9JA 3P9WB 2D3VA 5AW6B 4XI5C 3NBNA 1IEAB 1MY5A 3VSTA