1QMUA

Duck carboxypeptidase d domain ii
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Avian Carboxypeptidase D Domain II : A Prototype for the Regulatory Metallocarboxypeptidase Subfamily
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
total genus 138
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1qmuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qmuA01
4F9VA 4ZYQA 2AFZA 3NFZA 4ZX8A 1LCPA 2ZEGA 3NA6A 1YW6A 1DTDA 1Z5RA 3IC1A 5I4MA 1QQ9A 2AFOA 2Q43A 4UEEA 3VATA 1IY7A 2AFXA 3B2YA 1PCAA 3KL9A 4ZY2A 1TKFA 2V8HA 3ISXA 4UEFA 2DEAA 3KCPA 2PJ3A 3S9NA 3LWUA 4UIAA 3LMSA 2PJ9A 2PRQA 5K8MA 5CBMA 2QJ8A 4A94A 4OIDA 1OBRA 4GM5A 4G1PA 2C6GA 3IIBA 1F57A 3D7FA 2XEIA 4MRIA 3B7IA 1VGYA 1BAVA 1XFOA 2PJ7A 4IYKA 2ZEOA 4MHYA 4A37A 2RB7A 3S9MA 3D7GA 2ANPA 2PJAA 5K8PA 4FXTA 4OC1A 2IJZA 4WJBA 4NGNA 1TF8A 4NGTA 3KQZA 5LYIA 3BXMA 2EWBA 1LAMA 3B3TA 1ARMA 1XRYA 3K9TA 6CPAA 3KQXA 4FL4C 5HVHA 3NH4A 5F09A 1YW4A 1XJOA 5HXDA 5IB9A 4OC2A 2G9DA 3PB8X 2NYQA 3FEEA 4WI0B 4X3RA 3CDXA 2EK9A 2F8HA 1HEEA 5K8NA 2ZEEA 3PB4X 3D67A 2XEJA 2XHNA 2Q51A 3B3SA 4PXDA 3RBUA 4R8FA 3KGQA 1HDQA 2O4HA 2V8DA 1AMPA 1TF9A 3N5FA 3HLPA 3JRUA 3H8FA 3SJEA 2JEWA 4OKOA 3V7ZA 1CBXA 4UIBA 5JGFA 3B3CA 4CPAA 1BLLE 1CX8A 3T8WA 4OIWA 3KHZA 1ZG9A 4PQAA 4MCQA 4NJQA 3PBEA 5D29A 4WWVA 4JYWA 3NJXA 3RZAA 3G3LA 2AFSA 1R43A 2GREA 4KSIA 1GYTA 4Z65A 3WC6A 3DLJA 3VH9A 2PCUA 1Y7EA 1VHEA 3FF3A 1NSAA 3GUXA 5DS0A 4MHPA 2C6PA 4EIUA 2PJ1A 1LANA 3HUVA 2I3CA 1PYTB 2RFHA 1BPNA 1YMEA 2WZNA 1UWYA 4TNUA 1DE4C 3BI1A 1YSJA 4NGSA 3PFOA 2J9AA 1Z8LA 3PFEA 4UEZA 3WC5A 2F7VA 4OC3A 3KASA 4P45A 2ZENA 4EMEA 2ZEDA 4MCPA 5G5DB 3WABA 2OOTA 5K8OA 4FWUA 5JH9A 4ONWA 5LYFA 5JM6A 2V8VA 3PB7X 3FH4A 3IFEA 1LAPA 2WYRA 4P44A 4O23A 2ZELA 4PPZA 3FMCA 1YLOA 4FAIA 4W9YA 2C6CA 2PJ2A 1VHOA 4B6ZA 3CT9A 4NGPA 4P4DA 4UF4A 1HDUA 1JQGA 1ZG8A 3PRTA 4RUHA 2IQ6A 4OC4A 2V8GA 3D68A 4MCSA 2BOAA 1Y0RA 4DUKA 4OC0A 4A39A 4AXVA 3PEIA 3S9LA 5HVFA 2NSMA 3NH8A 1Q7LA 2QVPA 4FBEA 2VL1A 4NGQA 2C1CA 2B59B 1IGBA 3TC8A 3NJVA 1ZG7A 1RTQA 3BHXA 4NJRA 2GU2A 3D66A 2IMOA 4R7MA 1ELMP 3CPXA 1XBUA 3IJ3A 4P4JA 4ZI6A 1FT7A 4IAVA 4OMEA 1R3NA 4BD9A 3K2KA 1ZLIA 4R76A 4EFDA 3I1UA 4OP4A 5LRJA 1QMUA 5J1QA 3QNVA 2HC9A 4X8IA 3MN8A 3PB6X 2CF4A 1TXRA 2CTCA 2PIYA 3GLJA 1Y0YA 1NKGA 1LOKA 2POKA 4MHNA 4MXUA 2HB6A 4JZ0A 4MMOA 2QYVA 3KHXA 3L2NA 3KR4A 4YU9A 4NGRA 5AQ0A 3B35A 2PVVA 4R6TA 2AFMA 7CPAA 1ELLP 3DGVA 2PE3A 3KZWA 4P4EA 3B3VA 1XMBA 1KWMA 4TWEA 1EE3P 5LYDA 3GB0A 1TKHA 2O53A 4NFRA 2ZOFA 1ZLHA 2EK8A 2BCOA 3FEDA 1CG2A 3TX8A 3E8VA 5K39B 2XEFA 1ARLA 4DYOA 3H8GA 5D8NA 4Q7AA 1CP7A 3SI0A 3PBBA 1F2PA 3NH5A 3D7HA 2XEGA 3SI1A 4K3NA 5LYLA 8CPAA 3CPAA 4P10A 1F2OA 2FVGA 3FVLA 1FNOA 1BPMA 3IEHA 4IHMA 4P4BA 2V77A 3RAMA 3ISZA 2OR4A 2Q4ZA 4P4FA 1AYEA 4PXBA 3IO1A 2BO9A 4PXCA 4ZY0A 2PJ5A 2PJ8A 5CPAA 4YWYA 4P4IA 3D7DA 3FX6A 4OC5A 3WC7A 5LRGA 4PXEA 2JBKA 2GLFA 3VARA 2PJ4A 2PJBA 4NGMA 4LQGA 4IK2A 5ELYA 2PJCA 3KI9A 1H8LA 2ZOGA 3V38A 3IWWA 1Z2LA 5LRKA 5THWA 3KR5A 4MCRA 2ZEMA 4EWTA 4A38A 2CIJA 3HN5A 2AFUA 1CPSA 2PVWA 3SJFA 1VIXA 2PJ6A 1CP6A 2ZEHA 4YOKA 5HVGA 4X2TA 3PB9X 3FECA 3H8EA 1M4LA 4MHZA 4P6YA 2PIZA 2AFWA 4ZY1A 3SI2A 3WT4A 4DJLA 1CPXA 3SJXA 1LFWA 3MRUA 2ZEPA 4H2KA 3BI0A 4ZX9A 3D4UA 2ABZA 4FUUA 2PJ0A 1TKJA 4F9UA 2CTBA 3B3WA 2GLJA 4U3SB 2JBJA 2ZEFA 4F8ZA 3FJUA 3SJGA
chains in the Genus database with same CATH superfamily
3ZUNC 5C6PB 5D7LB 2F53B 4XBEL 4JFUA 5ADPL 4MQXC 3D69A 1G1OA 2D9CA 4Y19D 5C0AB 2OI9B 3NACH 3KNBA 4IJ3C 4CAFA 4G70B 4N2OA 3DDGA 2FSRA 3CCHA 5IMMA 2EICA 2R2EB 3HKFA 4JVPA 1VGKA 3C8DA 2W65A 5HJ3B 1YW6A 3T0BA 2Z3MA 2QDVA 5BRQA 2QQQA 4YDVB 3NN8B 3UO1L 4NF1A 3U4AA 2IO5A 2R56H 4A2DA 1GCFA 3K0WA 2G0BA 3MJWA 5D7IF 2EC9U 3W82A 1MEXH 4HLZG 1NGPH 4OF3A 3O2DL 3VATA 4KY2A 5SX5H 5JOEA 2OYMA 2X4PB 4ZAKB 2FYVA 3FULA 2F8XC 3VFGH 3ISXA 2YGVA 3O4LE 1CXEA 5GGQH 2Q9OA 1T20B 1S4IA 1XVSA 3LRSA 5KJ4A 4E41A 1ROWA 4WI9A 1KPRA 2WC7A 2WXJA 2QSCL 5KANG 5B7EA 2HB0A 1LEGB 4KUCD 3RX5A 3GPSA 3GK8L 4PM1A 3ARDA 5EU6E 4Z7QF 3PG2A 4ZYKA 4H0HB 4Q9QL 1XF4A 4DN4L 3JTSB 5DHVH 3QHFH 4G6FB 2FJUB 3PY9A 4YPJA 5IGXL 4CGNA 1J87A 1T22A 5B1AB 4BELD 5FGCB 1MVUB 3G6JB 4Z7NB 3TBTB 1JUFA 1XGQA 3UCRA 1GGBH 1YVOA 5CILL 2HAZA 3QXWA 4LLVA 1A1OA 1W0WB 4QXTA 5E4EC 1GHEA 3BLNA 5IR1B 4OD3H 4JBSA 2E7LA 4IYKA 4PK2A 1HSBA 5AW0B 1NC2D 5E2TH 3REWA 3V6FB 4XXWA 4RI1A 1IFHH 3OC8A 1FIGL 3QUHA 3BI9X 3S34H 5CSZA 5JHLH 1JWUB 4UCFA 1A6WH 3QAQA 1AOZA 4DKFH 4CRPA 5FM8A 3OC5A 1PLCA 3O6FD 1ZTXH 3BO8B 4PW4A 4LP4A 4XNUL 2D7TH 1LAMA 3GBLA 5BXFA 5KBMA 3VXOA 4X5KA 4CVXB 4TF4A 4ETYA 3QXDB 4O5LL 1EANA 3ECBB 5I76B 5F09A 2EVHA 2QLYA 3BT2H 3RVTD 2UZPA 3B1TA 1MFDL 1TJMA 3F2LA 3TA3C 5HGGS 1D7DA 2ROXA 2IPKA 5HHPA 1GS8A 2K70A 4AL8C 2OH1A 5JIHA 2XWZA 1FORH 3MLYH 3QEHB 3LPOA 5SX5K 3IPEA 3W91A 5F21B 2BPBA 4PP1C 3GMLA 1H6TA 4PY7B 2A74A 3MKGA 5HPOA 2JDDA 2J44A 1ZLUH 4KY1L 3WFZA 2X7BA 2VDOB 3FBQA 3BEWB 2LQRA 3DX2A 3GJFA 4GRWE 3U7YL 4TSAL 3OV6A 2REEA 2DIEA 3BHBB 3S6GA 4ACTA 3TFBA 1E8WA 4Z0XB 4PGDB 3CLFH 3ARUA 3GT6A 2CK0L 1P4LB 7CGTA 4P5TC 2V5TA 2Z8WC 3FC8A 4AYID 1F42A 2B15A 2V8DA 1NGZA 4X83A 5AW2B 4H20H 5BS0D 1UD4A 3S34L 4OB5L 5CIPH 1F4XH 3ZMEA 4B11A 2JEWA 1D5XA 2YQ2A 1ZPLA 3EFAA 3V7ZA 2G5UA 1YMMA 4YXLL 1JPGB 1ZTMA 2ICES 4E0RA 1HHIA 4G7YL 4ELMB 2WPWA 1JF1A 2GBAA 3VACA 4CC0A 5L88L 2YR3A 4NO2A 4N90E 3RL2B 4OV5A 1X7TA 1R9FA 1JCKA 1ZSDA 2ZOWA 3QEGH 3SDYL 3V6FA 5HMNA 4FD0A 3AU1A 5FLVA 2E76C 1S7UA 4H6UA 4FNLL 3DX9B 4GS7C 3FCBA 3O45B 3CXHJ 3C5ZC 3JT0A 1JZFA 4JB9L 5BNXD 1F58L 3PWNB 2CNZA 5SWSD 4E9VA 3AREB 2NTFB 2D73A 2QQNL 3LXCA 5TDOB 2EUZA 5HXMA 2X89A 2Y0SA 5PCYA 4I85A 2MHAA 1D7CA 4GW5A 5D93C 3SE9L 3FPYA 3AACA 1LTXA 3HE7A 3RVVC 5F47A 1U8IA 3JWNG 4B96A 1VHEA 4EN3A 2QBWA 4HBCH 4ONUA 1IT9L 1D7BA 3UFIA 4EPSA 2EADA 1F5WA 3AGVA 1CUOA 2GBTA 4FQXD 5M95B 2X70A 2PWHA 3O3DB 1M6OA 1NC4A 1KIPB 4X9HA 4RAVA 1BQLH 5BRPA 4AK1A 3R0NA 3LQMA 1G7LB 4XMPL 2QKIC 2ZXBA 3RHWF 1NSNH 5DEJA 1T3FB 5B8CC 5KBNC 3IDIB 3FXIC 3EJYD 3KJ4C 3PFEA 4IBQA 4KZCA 5F3BB 1IIIA 1M71B 3IXTA 5LO7A 3VX0A 5JW4N 1OAKH 2OXHA 5CLWA 4ANKA 5EOQH 5T1KA 2GIVA 4ZMPA 4QRPE 5G5DB 3MLWL 3HHRB 4OVVA 2BVOA 4KTDH 3K7UA 2WQXA 4MAUH 3H6AA 1GW6A 1TZOA 2CKNA 3GRBA 1A2YB 2X0VA 4OQTA 5FA3B 4FYTA 4TLKA 1Y0LA 5D1XE 2WYRA 1Y7VA 2KC0A 1ZIBA 2WLJA 2DB8A 4NZ8A 3FUNA 3D07A 3I9PA 4NWTL 1VFBB 2WQAA 5CR1A 5AVWB 1E2ZA 3WUWA 4X5XA 5K33A 2WWNA 4DUWA 4N2KA 4YHNB 3BXNA 1WE5A 2YPLD 2ICWJ 2PJ2A 2IOIA 1QO3B 2W9DH 4RZCB 1DZ0A 4QR7A 4TPRH 4Y2NA 2X4TA 2Z7WA 4F7PA 2A9BA 3BCFA 1PYWB 4M43H 4EUPA 4TVPH 3HE6C 4E5XB 4OFDA 4PJ7E 5B1JA 3V0FA 3CMGA 2X4TB 5AFAA 4KKBC 1FNHA 5IESL 5T3XL 3WKNA 1EO8L 4UNVA 2F18A 2IJ0C 4EF3A 1DBAH 2EH8L 4XBMA 5C71A 3HG3A 5ID1B 1P4UA 4KO5A 3O6FB 3FFCD 2BC4A 5CJQH 4NQUA 4F8LA 2BNRD 2H3KA 1OAKL 2IPTL 3EH5B 4JMNA 5DHVB 1I3RA 3QZWB 4HG4J 3CZJA 4M6GA 4KJYA 4PB0H 2A6JA 3HS0A 3PS6A 1MG3C 1SOSA 2YA2A 3FTXA 2WXQA 1YA5A 3UTSE 2EO1A 1A6TA 2XV2A 3I9IA 4X8JB 1OP5K 1NQBA 2X4OA 3EYFA 3SKMB 4BH8B 4F3FB 1FV1B 5FHBH 1XH3B 4MAYB 3FH7A 4YPGA 1E42A 4GQPH 2JXMA 4JNXA 4MHHG 4B97A 3KPSD 1BG1A 3RB7A 2V7HB 2AEPH 3EBGA 4HWBL 2FGWL 4NB7A 5CJXC 4K9JA 4L37A 1U8PA 5FWQA 1W6WA 1AG0A 3U1PA 4NXYA 5I1IH 5KSBE 4UOZA 1IE4A 5D7JC 4F8OA 5AG8A 4WFEE 1G9ML 3D25B 3ZKSD 4HKJB 4WI8A 3D0AA 4TNWK 1JGVL 4O58L 3TTHA 1BF5A 3SD2A 4AKPA 1SBSL 4H8WH 2A9MH 2DS4A 1GS7A 1HQRA 2HT4D 4GXUM 1Z0MA 2AMGA 3S8GB 3EZ8A 1XCTB 4OCXL 1SN0A 4KTDL 1PX4A 1J8HB 2GEQA 4A33A 1WWAX 1NBYA 2CUHA 1X7QB 1AS8A 1EXUA 3BMVA 5EORL 2VZVA 5KYUA 4LAQL 1A1MB 1D5BB 3B2UD 1B9KA 1UH2A 2VLKB 3WFHA 4YO0A 1JWQA 3RUGE 1K5WA 4P4KB 4JM0A 3DTDA 1OAQL 1B88A 5IROA 2QGEA 2EDBA 4YGOA 4IW4C 2ESVD 3L3JA 5E8PB 1NSNL 1A4KB 2WCPA 1TVBB 3NJNA 3O45A 3DX9A 4FTVB 4HYTB 4HG4K 3OJMB 2AV1A 4X4YB 1KIUB 2KUTA 1R5WB 2DWEB 5FYJD 1NLDH 4P4EA 3H3PH 3S98A 1JGEA 5TJWK 2R4SH 3KPOA 4DVRH 5IHBA 4BCZA 4W68A 3NA9H 1XMBA 2AV7A 3S36H 2D7TL 2VAAA 5IK3A 3SBWC 3L1OL 3QJFA 4L2YA 2XNAB 1UD6A 2F53D 3V0WH 1HEHC 5FO7A 1EO5A 2J71A 4FNRA 4TM9A 2OMTA 2CH8A 5LAXB 3FQ4A 4HIIB 2GI7A 1SMDA 5GS1A 5CGBA 1CGUA 4JFYB 4J3BA 5AYUL 5FYKL 2ZYHA 4Y7MA 5C0CE 5I23A 2ZUQB 1ITCA 4KWUA 2DBJA 5EOTB 4GQZA 3KPNA 2EC9T 5BOJA 1UXWA 2IGFH 3HZKA 1OM3H 3KVPA 3O6KH 3T0EC 2GC7C 1CXHA 3UZQA 1MCWM 5F46A 4MQTB 1P4BL 2F5BH 2VMCA 2X9XA 4HJGB 3AJ7A 1RO5A 2D2OA 2HVJA 4U7KA 2W0FB 1KYAA 4ODBD 4AYSA 2AQ3A 4FG6D 2E74C 3LZNA 3PUUA 5E6ID 2ILLA 3FK3A 4JFEA 2PABA 5ITBL 5I8EA 3NT0A 1KYDA 4ZG1A 1Q9OB 2VR5A 2NXZD 4POZC 2VXSL 3ZW3A 1SJEB 1JFQL 4XR8C 4FQIH 2DDQL 3QUZB 5T5FL 5E2TL 1KCBA 1AP2B 2OL3B 3T6ZA 1AC0A 2UX7A 4I13B 4PJFA 1PX3A 4P3CH 3ROOB 1I1DA 3B5HA 2I26N 4PSRA 4XC1H 1ZA6A 1HYSD 4ZD3L 1MFBH 1PLGH 5TF1L 3WL9A 2V77A 3FN9A 5KJRL 1FO0H 1MNNA 2YNCC 2Y7MA 4YEFA 1FL3B 3D8PA 3AM8A 2VLJE 1FL6B 5ACLA 3DVIA 3ARDC 5FYLH 4QF1A 4QHMB 4S10A 4U6XA 4Y88A 4P0DA 4Z8FH 1N6QL 4YSRA 2FNBA 4DP5X 3ABMB 3SE3A 4HV8A 3U7WH 3NIFF 3HRPA 4EOWH 4ZMOA 2ZWYA 3GSQB 3SHSA 1OP3K 4RMRA 3GDCA 3OZLA 3ASWA 3WMPA 4N68A 4WWNA 4Z76A 3K2MC 3S36L 4N0UB 1HHGA 1YMHB 3CWGA 5I71B 4Z7OB 2CRIA 4IDJL 1MJUL 3T4AB 4LVOC 2XQYK 3CQQA 1OGTA 1UH3A 4F2MA 5ELYA 5D93B 4PIBA 4B9ZA 2C34A 4EBQL 3RWIA 4XXDB 3HHSA 1OSEA 2FWLB 4AG4L 1G9NH 1JNJA 2W0FA 2CR6A 3WIHL 4Z3TA 3RDJA 1ZMYA 4W70A 4N0UE 5ALBL 2JI3A 4G8GD 2PJ6A 4HU2A 2Y24A 2O30A 3L5XH 2R0KL 3VUAA 4YDVA 3M1CA 3FECA 4MMXB 4Y19A 4OD1L 4LVNC 4K3HA 4R3SB 3WNNA 2FGZA 3S3DB 3SI2A 2OJZH 4FCHA 4O9HL 2DWTA 5I5IA 3S3BB 3NFPB 3CHXA 1KTLA 2GQHA 1QRNA 4HKZB 5DS8B 4AC2A 4APQA 5A6IA 5AOZA 4GLRI 2EDXA 4CSZA 1XCTA 1YECH 1EEYB 5AAWC 4QKXB 4A63A 3QNXB 4IKKA 1TTUA 5TQ2H 4E8OA 2JV6A 2XC8A 5LCVA 1XIWB 3AC0A 4QIRA 3DI2B 3RVUC 2P8PB 2R8VA 2VL4A 2C3HA 4IGBD 4OM0L 1QLFA 4X4YA 1CFNA 5EIIA 1LP9E 3UO1H 4QXGH 2DLFL 3RE0A 4Q56A 3TPKA 4EBQH 5E99L 2AJVH 4KQ4H 4B7IA 3K2IA 3DBXB 3RVWD 4HLZH 3VXRE 4U1JB 3W11D 4CMMA 4OFVA 5A43C 3NACL 3MOBL 1A1NB 5I4MA 1F90H 2R29A 3H85A 4KDVA 3QR1A 4MZ2A 5AZEH 1MG2C 5MI0B 1JPEA 2FUTA 5HYQB 3CFCH 2H0FA 2V9UA 1AJ7L 2SEBA 4CMHB 4I0PA 1J05A 2YXWA 1FO0A 4WEEA 4HPHA 4ILDA 4JGNA 1S3RA 2WQUA 2SEBB 4MB1A 4XNXH 3WAJA 4TNVF 3HBPA 4BSJA 1ZHNA 5CCKL 1DJZA 3QUXB 4CS0B 3SDXA 2QTVA 1FL5A 1QKZL 3UYPB 1B4JH 2G2NA 2I5YH 5B38B 5EC4A 3VXUE 4G80B 4YSUA 2CAKA 2EIZA 3Q06A 5HDOA 3LN9A 3EADA 3VYOA 1MCKA 1V54B 2BVTA 2YSSB 3VI4A 4A6YB 3IGUA 5ES4B 4EI5A 5F8RC 3QUGA 4MRIA 4BUGA 2RBLA 4MA3A 3O2VL 5GJSH 3RWEB 5CEZD 1BAVA 4KO9A 2WUCH 4QOKA 1Q1JH 2VDMH 5AOLA 4LCUB 3GTTA 1E28A 5I1AA 1AP2A 2OL3A 3TEWA 3B2UC 3N85L 4PJEE 2HWZH 3RG1C 1DFXA 3KE0A 2ZWSA 4A2ZA 3WEMA 4A2EA 1FZMA 3NTCH 3D4GA 3OKNA 4I3SL 2JJVA 3O6FC 1KV3A 1H8SA 3NFPA 4NGTA 3QFDA 2BHUA 4ZW8A 2VMFA 1RIVL 1YEFL 3R18A 3N5AA 4Y5XB 1XOVA 3S9DB 4IJTA 4X4XA 3NCEB 3BH9A 2NNCA 1MQKL 5J5EA 2P5WB 1Q38A 1YZZA 3WNLA 1QO3A 3S37L 4PLNC 1UWEL 1YEEH 2CSPA 2GY7B 1LO0L 3V79C 1ZLEA 4JO8A 3B2DC 4L23A 5C6TL 2J8UA 1HX0A 5I0WA 2VN3A 1IOIA 4W4OA 2ZF9A 4FQQA 1MJJA 1RULL 2WXMA 5A3ID 5JOPE 4H5SA 5J89A 3TV8A 4KKCD 3ULUF 1DL7L 4JZJB 3HLAB 3PCYA 2WBWB 1S7LA 1GOFA 1OGTB 2X4RA 3S96B 3EIFA 4TV3A 3QNYA 2VXKA 2ZX6A 4WI6A 5E6YA 2NY4B 3WDIA 4A32A 4LLDB 2P8LB 2PYED 4M5YH 2XZAH 1A4CA 3VI4E 1HH6B 2JJTC 2X9ZA 3CZUB 2F5BL 3CSFA 4GRWB 5CO1A 1EDHA 2BNRB 3VB9A 2H7WA 2XN1A 2WINB 1RJLA 2DQCH 3QO1B 2MTAA 4Z7IA 4QHLB 3L5HA 4ZMXA 4AZUA 5CGTA 5KG9B 3HHMA 3TJPA 2BNUA 1ZWIB 3TBYB 1KN4L 1XCQB 3B5TA 3B8YA 2VL5A 1ET5A 5AYUH 4QHMA 4U6XB 5EORH 4XWGH 4K5OA 1IFRA 4P5MB 3MRNA 3PAZA 5CBAB 1PIFA 1L7IH 1KFGA 5HYJA 4L3FA 1R0AL 4OV5B 3KHZA 3BKJL 1ML0A 4JCMA 4X4KA 5EBLB 1DVTA 4PQAA 4CAEA 1A14L 2OMUB 3MV7B 5IMOA 3STBA 1HL4A 3FCSB 1FHNA 1FZMB 4E68A 5AG5A 5DVKA 4RGND 1SQHA 2H5MA 3G3LA 3KPSB 3FS9A 1P9MA 2MPAH 3QQ3A 5ELIA 2H8PB 4XT1C 5EDXA 1ZD6A 1NPJA 4MYWB 3T8MA 2G3TA 3RFZA 4J3GA 2JI2A 3WEAA 4HULB 4XCEA 5C6TH 2JLMA 1QFUL 2DN7A 2HFTA 4FLSA 4ZX5A 2EUIA 4RWYL 2H6PB 2Y36H 2ICWI 2VT0A 4AC4A 1SOKA 1KBGH 4J4PD 4HVBA 3D18A 5HJGA 2Q76A 2J6WA 5I1CL 2NY7L 3OZ9L 3FSAA 2C6PA 2E75C 3ZE1B 4OJEH 4LT7A 1X4XA 2IBBA 3LZFH 3MBXH 4N28A 3WO4B 3IMVA 4AXWB 4JJ5B 4LLQA 1CL7L 4BH7A 1XSJA 3QHFL 5EZOH 4BM7A 4CU8A 1KJ3H 4X7CC 1UJTA 1DLHB 2CKBB 4KKRA 5EN3A 1TQUA 4HOXA 2HLFC 2Y3AA 1XR8A 2OR9H 3CSGA 1LD9A 4DKEL 1KUMA 4F33B 1M4DA 4X42A 4V33A 1YEJH 3CV5A 3AWFA 3F84A 1BFVH 1EEZA 4MCPA 2NY1B 2HJLB 5D1QB 4TNEA 1L0QA 4TKWA 3BVXA 4HIIA 3U9UB 1PD1A 3GRWA 4QYAA 1AQKH 1QSEE 2E6QA 1PL3A 4HAKA 1T1WA 1AZRA 2G2RB 4M4PA 1BWWA 1KT2B 1F11B 4LEOB 1FWXA 3TBVA 4KK8D 1MJAA 5A2AA 4PJGA 1F4YL 3KYOA 1B3IA 2PYEE 5AW9B 1BMGA 2JLPA 3Q8CA 4TUKH 3UCQA 5IB2A 2Q76B 1I1AC 5TDPA 1A6AA 1CFNB 4U1KA 5B1CA 3TPUB 1OM9A 4X0NA 4A66A 1UXSB 1A1OB 1UT2A 1W0WA 2OS7A 2BSWA 2YSTA 4PJ8B 1EBAA 4MMZC 1FH5L 1VHOA 3SXNA 1HTYA 1SXSA 5FFOA 5HY9B 4NGPA 1KB9J 3M7FB 4FXKB 3WIFB 4Z77A 5IV0A 3D9AH 1QFHA 1AJ7H 1HHJA 3QQ3B 5C0FB 1ZHKA 5LGJB 2DKMA 2ITDA 1JXFA 4NXSA 1AZVA 1MHPL 3O2WH 4IRJC 4JZNB 3FRPA 2NT0A 3MREB 4PJDE 4TVPL 4N22A 3MA9H 5AAPA 1MW3A 1PTZA 1WSST 2X05A 2DMBA 3KM1A 3MRLB 3H0TA 3PEIA 4JPIB 2H6OA 5KVEH 2NSMA 5LBGA 2I7SA 4JFVA 1Q9KA 1QW8A 2A4ZA 2HJFB 2FWOA 1OQOA 2IAMC 2RQ8A 3L7EA 1A9VA 1DQJB 5F1KC 3H9SE 4N2AA 4WI7A 1FFOB 2TAAA 1SY6L 1PQZA 2C9RA 3PNRB 2EEDA 4WI2A 1BVLA 1AHWA 1QFPA 3VXME 5DJAA 4PB9H 5D1ZC 4XOAA 1OSZA 4HQQL 3SYOA 5DC4B 3ZKMD 4G43A 4PJ6A 5TQ2L 1U3YA 4IJ3B 2EYSB 1U36A 4YPGB 2J57A 4PRPB 4XPTH 4HJ0C 4TNVK 4NIKB 3DETC 5E56A 5JUEH 2ZAIA 4OMEA 4TUJB 2VDRH 2OR9L 2BP3A 2WWKT 3MLZL 4JRXB 1PG7L 1Q0YH 1TJXA 3KLSA 4H1LG 3OAYH 4KQ4L 4CDHA 4TL4A 4JY5H 1NOFA 4M00A 4D9QE 4UDTB 1BIIB 3D25A 5ISZD 2APFA 3QULA 1BZ8A 3BKCL 3OKLB 4HWNA 1PDKB 1QMUA 3KPRD 4JO1H 2OTUA 2HTKD 5EWIL 3SGDI 1VZGA 3HPJB 2F19H 3KH4A 4OY9A 4ZUUB 5I17A 5A16A 5DJXB 2YMXL 3QIWA 3ME0A 3GIZH 3GNML 4MHNA 4DEWA 1N0XL 3Q2LA 1E8ZA 2BNQD 3E7JA 3C6LA 4MLIA 1BAGA 1JZJA 4HUWA 1U8JB 2AKRB 2H26B 4R57A 5ANHA 3L3IB 2AANA 5IW3A 1U2YA 4GW4A 4IMLB 5GGUA 3PL6D 2OJZL 4MASA 4PRHB 3WNMA 1MVFA 5LGHH 5L7XH 2VXQL 4P4RA 3OLIA 1GC1H 4O4YH 1KBVA 4ES8A 3S5YA 1KB5L 5MI0C 3LKRB 3HZMB 4TRPH 3BHBA 12E8L 4P9HL 2WK2A 2NR6C 5MP6H 5EO1A 3GFUA 1G43A 1ID2A 5HDQH 4A6YA 5EZLA 3LKOB 4PJAE 1F3RB 4NDMA 4Y5VA 1PBYA 5KOVC 5TTRA 3UZEC 1P53A 5HPMB 3LIUA 4CAGA 1LLAA 4GQQA 4HUXB 3VVVA 1QABA 3I6GA 4H1LA 1FRGL 2EEBA 5E2VH 3QH3A 1RU9L 4MJHA 2CY2A 5DJDA 1OGAB 2D31B 4PS4H 1HE8A 4K2UH 1WTLA 3OM3B 1RJZB 3P3RA 2MTPA 3GLZA 2EE0A 3LCYA 2PR8A 3AMKA 2EVJA 1O6SA 1MOEA 3QQDB 3ZL4H 1YEIL 2CGRH 4XPHL 4YBLC 2JKWA 1D5MB 1JFQH 3DRTA 2FJSA 5ADOL 5BXFB 1NANH 4KK8C 1AZCA 1SDAB 8CGTA 3IJ8A 2NXYC 3ARGC 4W81A 2VRKA 5GZOA 2WBKA 2BJMH 2YOAA 5INDA 2BIMA 1H3UA 5E8OB 5C09E 4NJAL 1BLNB 3CVBA 3TONA 1VF5C 1AZUA 1NL0H 1PNDA 4QD2E 1ED3A 3BZ4A 3CZEA 4UIMB 4X6FA 4ANWA 1UOWA 2WJ7A 2CBOA 4P5TB 1KB5H 1QHOA 3PGFH 5TQ0L 4ANVA 4MBUA 2O5ZL 1S8DB 1VACB 4FHBD 2JK5B 4OIIH 3KWUA 3GBNL 3GGWA 3OKOB 4MFPA 4P5TA 2YXVA 4JHWH 2NZ9C 1ND0A 3HZ3A 2DH2A 4Y1SA 5ESQB 2WKLA 5E51A 4KZDL 1HQ4A 2CK2A 2ZNWA 4GAFB 4OZ4A 3UGUA 1CBVH 2D9QB 3HE7C 3S88L 4ZFFA 1E4KC 1AANA 3SGEI 5DLLA 4PRIB 2V5YA 3D3VB 4U1MA 4YWYA 1BBDL 2RD0A 4B13A 4HZAA 3SO3B 4YHZL 4OC5A 4IKLA 4RSYA 5AVTB 1IOFA 4R4FH 1CQYA 3WTUA 3CSYA 4UCMA 2GAZA 4NPKA 3II2A 4OJFL 4OCYH 1TCMA 1RJCA 3DGGA 3VFVB 5JYLA 3QCTL 4Y5YC 2R0LH 5D7EA 4OLXH 1YY8B 1Z9SB 1ZK5A 4MX7B 3ZHDA 5A2LH 5J6GB 4IK2A 4NGMA 5FIEA 1P5UB 3ETTA 4HH8A 5DC2A 4LEXH 5K9KB 4M3SA 2ZOGA 5AG7A 2MQ3A 4R3LA 3RX9A 5CLYA 2I27N 2QSTA 2P5WA 1WDAA 3OB0K 2V7HA 3GBML 2XKNA 2C9XA 1JJUA 3L4YA 1KYOK 3CZXA 3GKRA 2K8MA 4KHXH 1XGUB 2Z8RA 2KPNA 3SE4A 1X5JA 4FCAA 1M4KA 3ESMA 5H37A 1NE9A 3RP1A 1CP6A 3CHPA 2VLKE 1LO4L 1PKQA 4F9PA 5IB4A 4UNTA 4OCRL 1WZLA 1W9XA 4JFPB 3DTUB 4ZY1A 1C12B 1ZA3A 2FATH 2VZZA 1E5ZA 1QZ1A 5JA9A 4R4BB 4YLQT 4PD4K 4U3HA 5HGHB 4H2KA 2GSGB 3P3SA 1OAZH 1G9MC 5DRZA 3UTPE 2X6VA 1HSAB 2GTWB 2PJ0A 2HLEB 2BP0A 1TKJA 2CTBA 3DNSA 1N5YH 2X53A 2D7QA 4OGXL 4AQOA 1IC5L 1B4TA 5F7HA 3BQUD 4QWWD 3RGHA 3SYCA 4BYHA 3WDHA 5I1GL 5A3IC 1OF2B 1KJ2L 3QWQB 2D03L 5HHNB 4NENB 1QPKA 4X7TB 3T0VA 3T0EB 3UROR 4AZ8A 2EVGA 5L0QC 2AFZA 1J9SA 3JT2A 5EG6C 1QA9A 1ZXQA 3D48R 4C58B 3PJSB 3IDXH 4X5XB 4BFNA 5DT1H 1IBZA 4H2CA 4X7SH 5IB5A 1TZGL 2VDRL 2YD3A 1IU1A 3BO8A 2XPGA 3MRIB 5DHEA 3W0WD 4BZ2L 4DEPC 5CKAA 1P4IH 2K4WA 3ZQWA 1Z5RA 3VX1A 4MA1C 4LL9A 1Q72H 2CCLA 5HHMD 3MV9D 1LEGA 2JB6A 4M7JH 2QMKA 5AB9A 1NGQL 1IM3D 2XVBA 3L5XL 4BQ9A 1GIGH 2PN5A 4FMVA 3VXPB 2Y7QB 2VJ0A 5AG9A 2YKLH 1TKFA 3N42F 3EJTA 2HCZX 1GR7A 3MRPA 3P4OB 3T3MF 2ZX9A 1XB8A 2LT9A 4UYPA 1AQKL 3CHSA 1U8NA 5TDNB 3UPRA 4D0CB 3KCPA 4UBDD 3KGUA 1PKQE 4UB0H 5D1XA 3DPBB 4UQ2B 4AIOA 4CADA 4UCPA 3QUXA 3NG5A 1RH8A 5JA8B 5B3SB 1FG9C 1UGKA 4KMQA 2A73B 5LWYH 1HAUA 5F6HJ 1N0LA 3BT0A 1UCTA 3QFJE 1LWRA 3QHZH 2XN9E 5HHMB 3HC4H 5C0AA 2B5IC 2CDGA 3EBHA 5E1GA 5JXAL 4ZRGA 3OG6B 2BMKB 3WMQA 2FBOJ 4R0LA 1ETA1 4N2MA 4BDVA 2J88L 3MX0A 5KWYC 1JZ7A 1TYEB 1NFDA 4EOWL 4C7IA 4HC1L 3IU3A 2MQ0A 3T3MB 3CG8A 3VGFA 1N26A 4OIFA 5CZVH 4ZI8A 3NAAH 1AHWB 4U3CA 2ZCLH 2BSRA 1TPXC 4RLDA 4M7ZB 3QPXL 5MEOA 3M1OA 2ATAA 1F4YH 1S7UB 1ODAA 1DVXA 4WWKC 4EUPH 5T3ZD 3KQZA 5KS9B 2P43B 1XD1A 3JSSA 3ARBD 5DO8A 1PY0A 1ZJBA 2W91A 1SLUA 5CFHA 3Q6GL 3I9SA 3K1DA 3QB7C 2DMHA 3ORJA 4XP5L 3W9DA 5IMLB 2UZIL 4FKEA 4YHOL 3Q5OA 1MJ7L 1QFWL 4MMZA 2G9DA 3PB8X 4WW1A 4N0UA 4G83A 4I1PA 2WTPA 2H0JA 2ATPA 5DURB 3LEYL 4WHCA 3TO4C 1IM9D 3WLWD 3OD3A 1N3NA 4PJIE 3Q1EA 4G1EB 4HWUA 1HEEA 2NUPA 1URIA 3KS0J 3VXRB 4UNIA 4FN0A 1P0HA 3SE6A 2R1XB 4WV1A 4GG6B 2ZEEA 3WFCL 2XEJA 5BW7A 4PBVC 4UM9A 2UVEA 1OVZA 3QORB 5D7KD 3T9WA 4HV8B 2YD8A 4NYLA 4PXDA 4F2ME 4EZKA 3PV7A 4R8FA 2EDFA 3DSFH 4L8SB 1HDQA 2X4UA 5IHZA 1WV7T 1ILUA 4OKDA 2KZWA 4OR1A 4TQHA 3RB5A 3D18B 3S48A 3W6SA 2G3AA 2QHRL 1CK0H 3SKOB 4AQ8A 1G84A 1WWZA 4WO4C 3H8FA 1CGTA 5HVHC 3VFPB 1UTDA 4R7XA 4XMZA 4MD0B 1TO5A 4B50A 5F49A 3HG1E 3T4AA 1TEGA 2I07B 4FNUA 2J5LC 3HRZB 4QDGA 2YPLE 1HHGB 1YMHA 2GTZA 5EOCJ 2FSEA 3B3CA 5IB0A 3WO3B 3E3QE 4ZMNA 4U9YA 5DJCB 1E8YA 3HNTH 1XR8B 2JH2A 5LXVA 3PHQA 3TOPA 5KOMC 4QUSA 5EF2A 2E4TA 3MGTB 3RWCB 4MCQA 4OJAA 4LL4A 4GBXA 1FRGH 5E2VL 1PU9A 3QFJA 1IQWH 4KO7A 2V5SA 3NP3A 4HXBH 3V4PH 1KGIA 1MI5A 2BCMA 3K6SA 2WGNB 3P9LA 4XVUD 1UACL 1MWAH 4PJHF 3CDFA 2F5AL 1A65A 4PG9A 3ESUF 1QBAA 1XQ4A 3D51A 4DO6A 1R3LB 3NAAL 3L5WA 1GYTA 3CU7A 3RVTC 1C16A 4NZUL 3OKYA 3C2AL 1RK1B 3Q8FA 4TRPL 5D9SA 3KPPA 2P24B 3MXWH 2FK9A 3D39E 1OXYA 1F0LA 4OCXH 4ISVB 3ARBA 1NBVL 4MYPA 5IFAH 3MFFA 5C0RL 2G5BB 3G5VB 4O2FB 1N6UA 2ZKXA 1C5CL 2AXWA 4W6YB 2F8VA 2P8MB 3ARDB 4K2UL 3PF2A 1NOAA 4U3XA 2B2XL 3QNYB 1YSJA 3PU7A 2ODFA 5TPWL 3FQXA 3LDBB 1HNFA 1MXGA 3WN5C 4X5WB 5ENWA 1AQHA 1D2PA 3S6CA 3G3SA 2F7VA 3EHBD 2DTSA 1FZOA 3IETB 4PMFA 1XGZA 1CIUA 2BCKB 4N9GA 5IW1B 5MP6L 5C97A 3HI5H 4J6RH 1Q2YA 1LXMA 1NCAH 1TZIB 4GFTB 3ZDXB 3OAYK 5DF0A 4B5ZA 3KPNB 1ZCRA 4HUVA 5F3FA 4MSWA 4FNQA 3I02A 4F57H 5IBTH 3QHZL 3VTTA 3HNVL 2IAMB 3QFDB 3NJIA 5J0BA 3C6LC 1C08A 1OB1B 1Y6KR 2V2WB 5E5RB 3I2CH 4A68A 3C5JA 3D8MA 3S35L 1O7VA 4IRSD 1UWXK 3O2VH 4FZ8L 3VG9C 1HDUA 1FSKB 3G5YB 3OKMB 3UP1A 1SXBA 1FNLA 3QEQB 4FRWA 1AI1H 2V3EA 1HHKA 3AG2B 4JUSA 2YS4A 4RNRB 1HFUA 1KNOA 3H2WA 3VGHA 1ETZB 5GGSY 5BZDB 4NKOA 4N8VA 4AK2A 1QP1A 3IS0X 2EDWA 3VXMD 2QPFA 3HE7D 3LS5L 3P2DA 3QUMB 4S1SH 3KG5A 3UAJD 3WOVA 3PWPB 5DVMA 2VW4A 4ESKA 1JZ6A 1Q2CA 1ZEAL 5LB1A 1WA2X 3JUYA 1DEDA 5ABAA 3VDAA 2OTWB 4Y5XA 5AZ2H 4GMTH 1FFNB 4IRJB 3RX7A 1RURH 3BUDA 1CXFA 2ICEA 5GHWL 4F8QA 1DJXA 2H32B 2NYZA 5HVHB 5AVSB 1UC6A 1NCDH 1ZTXE 4M5ZL 5DUML 1QBLL 3FSVA 3JV0A 2Y06H 1FGNL 2ZNXA 5H37G 3WSQH 3WKQA 1JL8A 4RBPK 4LIQL 2MCMA 1U2HA 1LVEA 3VD0A 4GUCA 4WY7H 1KJ2H 2YLHA 1R75A 3LKNA 1H3GA 2APVA 5FXCH 2GU2A 4R7MA 1WAAF 1UURA 4J39A 2TRYA 2VABA 4R9HA 3WIHH 5I1JH 4HDIB 2PTTA 3OVUB 1CICB 1R3NA 3TBSA 3EUDA 3QH3B 4PV9A 5F70A 1HXMB 2WVTA 3LRMA 5TF0A 4OQTH 3ZR6A 4JRXE 2FSDA 1YUKB 3Q43A 1CICC 4UQ9A 5EU5A 1QNIA 3H7LA 3LKOA 3I3DA 2JCCE 4FJ6A 4FC3E 4Z7QE 5DD3H 1JHLL 4NXKA 5ERWA 2MPVA 4HIJA 2RAMA 3QNVA 4N1EA 5CSGA 2QR0A 3B8SA 2YRLA 1ZHNB 5TE6H 1RFDL 1VZHA 4ALAH 3HVDA 4X8IA 1RSFA 4K15A 4TQ8A 1AQDB 2C3VA 3QARA 3AG1B 5JXEA 1T7YA 3QZWA 2HFGH 4KHXL 5D4QA 4WJ5B 2F58L 4LPUA 3MJ8A 1ZV9A 3VRJB 4RZKA 1I9IL 4NNPH 1LMKA 1SF3A 5ID1A 4QLWA 5FB8A 3SBQA 1IYLA 3HZVB 4OGQC 3MAWA 2QELA 4QHKI 4R6TA 2EECA 4JGJA 3GBEA 3HFFA 4HFWB 1LGVA 3BWUC 4YFDB 5C2UB 1MFCL 1QNZL 5A2CA 3H4HA 5TF1H 1RZKL 4OIBA 1AKJB 4NEHB 1QACA 5DHDA 2XFGB 2MNUA 4KZTA 5F3BA 3RVXD 5D70H 1KWMA 2XZZA 3CZFB 5FYKU 1CD0A 3IGAB 4J3OH 4XO5A 1CDGA 2DWDA 4I9XA 3CFMA 3K4ZA 1EJ8A 4ZAKD 2DMGA 4DERA 43CAB 4HPOH 2N1TE 1GW0A 2CXKA 2W9EL 1ORQB 4R97C 2YAQA 1F2QA 4R0LB 3LKNB 4BK8A 4XVSH 3PYCA 2X6BA 4WU5B 2PUQT 1G6RB 4NQEE 2FQFA 3FT9A 1CL7H 4HIPA 3E8VA 1YY9C 2XEFA 5IJKC 3GMRB 1MREH 3S35X 3I6KB 3AITA 4CRZB 4M6OH 2UZYA 3DUHA 5I1KL 1DVFB 5EBLA 4QJ5B 5LNDA 3KJ4B 3FTGA 1CFQB 2C3XA 4P46A 2QADD 4PJ9B 3V52L 1U92B 1VADB 1UGNA 1MK4A 3NH5A 4PRPE 3G04A 1JV5A 3OKDB 4KNSA 5DR5L 2ZAGA 4D0CA 5BMFH 1GH7A 4IOFD 2EDYA 4NIYE 2XY2A 1IGJA 1X5IA 2KPWA 2NQDA 4NKOB 4RMSA 4E9SA 1F2OA 4UFVA 1PZSA 4JPSA 1NAKL 2HJFA 1ETB1 5GXBB 4NKIL 4YHIB 4E36A 1OCCB 3MLRH 3OR7B 1RQ5A 1PUAA 2NX5A 1E9OB 2VH5L 4I89A 4KK5D 2VR3A 4YXKL 1LO5B 3EGSB 5C3TA 1WD8A 3VFNA 1SYSB 1XX9C 5FYJU 4FXGB 1UCBH 4KHTL 4KJYB 4ADIA 2P5PA 4DKFL 1I3RB 2YUWA 4XMXA 1ACYH 2R7HA 1QLEH 4OLWL 3S96A 1MFNA 2R1YB 1GPOL 4L2LA 1XF2B 1DVZA 3BJ7A 5CJ5A 4P04A 4PXCA 5G55A 4FFWD 2AEQH 2PPCA 3NFSH 2PJ8A 1HHKB 1UQSB 1SDDA 2HYMA 2LFGA 5H86A 4AZ8B 1AMYA 4LHQB 2O61A 2JJTA 4XPFL 1T2XA 2W60B 3WC7A 3FTVA 4KNTA 5DJ6B 4M02A 3DO7B 2BY1A 5DZOA 3FH5A 6FABL 2WCGA 4WW2C 2OZUA 1YEHL 3BZEA 5KVDL 3IS1X 1MREL 4F1SA 4RZCA 4BV1A 1VKXB 5C2BL 3AQYA 5D6DC 4F0YA 1ZTXL 5HSFA 2GKIA 2IADA 4NCZA 2KL6A 3QORC 4LQGA 2BSED 2J8UF 3SDAA 4NKMB 4ZFZB 1DQKA 4FTVE 3U9PH 4W9JC 1FLRH 1NMAL 2VXVH 3MGTA 1M7UA 3IN0A 1MFMA 2ZKHH 2QLVB 1RY7B 2ZXCA 3RLSA 5I0CA 3NPSC 1XF1A 3GIZL 4XH2B 3HW7A 1JZ2A 3GSRA 4B9YA 3O6LH 1CICD 3OMNB 1JHKH 3TCLB 5SWSA 1XO8A 3H3PL 4GKNB 3LX9A 1FDLL 1JI2A 1QWHA 1QNZH 4LE8A 3RKPA 5IVZA 1W91A 1SQMA 3TA4D 1J12A 4LF3B 4DJLA 3WIIH 2C1OB 3P54A 2CKBH 3GM0A 4TOYH 4M6MH 4ZX9A 2BSTA 3QEUB 3N1GC 4K3DH 1RIHH 4LCWA 4RAVB 5C08E 2YNDA 5BZZA 2WWMC 1UH4A 4ZDHB 2ZW6A 2E6PA 4FLQA 2F7IA 2ZKMX 5IT2L 4NSQA 5C0GA 1IEBB 1W0VB 2YPVA 2B4CC 3CSPA 4HIXL 1MCIA 4MJIE 5GJSL 3JVNA 1HZKA 1RUPL 5KW9H 3ECQA 3PAUA 3HE7B 2M83A 2JWYA 25C8L 3HC3L 1HQRB 3UEZA 5FUOH 3LIZH 4KRLB 3QO0A 1INDL 4APQC 2BVQB 3ULVF 4UOJA 4CSPA 2GITB 4II9A 4I18A 3GXFA 1ZJAA 2NY2D 5KYWB 4GBXB 5J6HB 2FUQA 1RZ7H 2X4PA 2D0FA 2L7UA 4NQXB 1NGXA 2Q3XA 2VDRB 2YGPA 4GRLC 2AFOA 2W95A 4XVOA 1YAIA 1JWSA 2HT3D 3MJ6A 4JX0A 5C0AD 3UG3A 3UAJA 3O11A 5F6IC 4D9LH 2V8HA 2J1XA 3KLDA 3AT0A 2YN3A 3H56A 4K8RH 4M7JL 2WBJB 5D7LD 4FXLA 3Q8BA 2DEAA 4MCNA 5JW3L 3IWGA 5C09A 5CEZE 3FQTA 4X80L 1BD2A 1CGXA 5GS0H 2CUIA 4N5UA 1DN2A 1L9PA 3EZJB 1TENA 3R1KA 3ILPB 1ZGLM 4AVKA 2JCCB 1E9PA 3LZOA 5IBTL 4AYGA 1TTBA 4B60A 3V5DB 4MY3A 3O4LD 3MBXL 2NY0D 5C08A 3IPBA 2IQ9L 1BMZA 4BINA 4OM0H 2ATPB 2NDFA 5D2LA 3SOTA 4KO6A 4PJIF 3VFTA 4M43L 3IWEA 3L6FB 1EVTC 5AW6B 2ATKA 1E2WA 1UXMA 3NOIA 2QPSA 4UU9A 4ETQA 3W6XA 4EUPB 4JL1A 1U8QB 3M45A 2G4GA 1VENA 3E8UL 4PJHB 2BUEA 2FX7H 4YDJB 2BFVL 5ISVA 1HN1A 4M8QA 2W38A 3EJCA 3GS7A 1TF8A 2J1KA 3FU7A 3F83A 3HNVH 1E67A 4XO4A 3X14B 2P6FA 1BAFH 3QUKB 1A4BA 1IKNC 4PUBL 5TE7H 2E3VA 3BJ8A 6CPAA 5FCUL 2A6IA 1L9TA 1DDTA 1F41A 3QE5A 5I1LA 4ZOAA 1M1DA 2R29L 3WJJC 4AGQA 1GGCL 2X6MA 3KXFA 3FUJA 1OSPH 3BWAB 4LARH 1GY2A 4Y5VC 3UZEA 1V10A 3PXHA 4KVXA 1AHKA 2OZ4L 1BM3H 3QJUB 3QCVL 4P2AA 2MIZA 4KX8A 2F5AH 1KJMB 1B6DA 1LM8V 1NEZG 4GW1B 1KCLA 3L1GA 1T3FA 2F8HA 1YMMD 3FQ2A 3MRDB 3KLAA 1RPKA 3PGPA 1JPTH 1QHPA 4XC1L 4XCYA 1FLTX 3F7VA 2VIRB 1PF3A 3QDGA 5IMKB 3T4AC 5ID0B 2VE6B 3GI8H 3O3AB 3QRGL 2F1BA 3RBUA 4LSRL 4BRVA 4XCYB 2ZT9C 5DK2A 2FXFA 4AUJA 1NGWB 4PWKA 1S9VA 1O9ZA 2VLJB 3QUMH 2AK1H 3N9GH 3FU3A 2DM4A 3OLGA 2APBA 4NX0A 1PKQB 4PEEA 5C0CD 5JGFA 4FTDA 2P44B 2PPFA 3MKKA 1ACZA 1WEJL 3QJRB 3T8WA 4JFWA 1H6EA 1ASPA 5TQ0H 2R0LL 2P80D 1WAEA 1SXCA 3IDIA 1NPUA 1U8QA 4L1DA 4L3CA 2EVFA 3RZCD 4JLYA 4UM8B 3GI9L 2YGOA 5D72H 4A7QA 2IGFL 3F6JA 3HTLX 4HEME 2XPGB 3MRIA 3V10A 5AKTA 3MXVL 2E7CA 4GB9A 1CD1A 2MCAA 3R7RA 3W2DH 3BIKB 1KJ2B 3CMOH 1LEKA 4PU2A 1R43A 2GREA 4JR9H 3KXFE 1J8HE 4WDIB 1B9ZA 3QUYD 2Y6SC 5AVRB 2PYFA 3TN0B 2YZ1A 4JHZA 5F9OH 1XBDA 1M7DA 5DO2C 1SXAA 4PWHA 3U0WL 1D6EA 3Q1SH 5F96L 5MERA 3VXSD 2PCUA 5IB4B 1AY1L 5CUSH 4XXCC 2H2PC 2XTSA 3MUY1 1A6UH 3MO1A 3N40P 4BUQA 5EUOA 2HN7B 1RUKL 1UHVA 3AADB 4RRPG 4R97B 3BQVA 1LANA 1AGFB 4TLTA 1GYCA 1TQWA 1A5FL 3ETBF 1HSAA 2W5PA 3MV9A 3RZCB 4PGCB 3BI1A 2DTMH 1WUNT 1LWJA 4G6ML 1VAHA 3L9RA 3O9WA 3NSFA 1ON0A 2NRDA 1U3JA 3IEAA 3VVWA 3FZUD 1V55B 1BPLB 1MHEB 2ODIA 1FNAA 4PJEF 1HI6B 4PCTA 3NJJA 1O7DC 2JK5A 3VWEA 3KYOB 5I9QB 3N9GL 3PV6B 1JDAA 1HAWA 1P84J 2HWZL 2Q1EA 3ARGB 4IIQC 4G6KL 4HKXA 4NKDA 2OYKA 1WO2A 4W1TA 3LQAC 4OLYH 4RFNB 2YRPA 1FFTB 3PHOB 4YE0A 3UGXA 4YHYC 1U8HB 4I3GA 1J5OH 2IL4A 4OGYL 2H1PH 5IM7B 1BAFL 3BP6A 2V4LA 2BS9A 2XWCA 4ZXBC 3SDDA 3BSGA 5MERB 5LWYL 2EE3A 4U1MB 5C07D 1P7KA 2Y1VA 4LX9A 2CA4A 3EYOB 4JG0H 4LCYB 4W9EC 4HEMA 2Z91A 1J5DA 2R1IA 2TSBA 4N6QA 5IROC 3PL6A 4U1LB 1W8OA 4NRXB 5EIIG 3PQYA 3DGGB 3VFVA 4N3UA 2V0AA 4WQOA 3EJQA 5CEYA 1TNNA 3F7PC 3C6LD 4UQ2A 3REWB 2F19L 1J9RA 1F1AA 2Q3ZA 3MRKB 2D0GA 2UXTA 1KDJA 1VKCA 4JO1L 2ZXQA 3S2AA 2QECA 2GFBB 1I8AA 3Q7JA 3OHMB 4R96A 4FULA 1R3JB 5F8QC 5I5JA 8PAZA 3WTWA 1JRHL 1EEQA 1QZNA 5CD5D 1U3HC 2VSCA 1S3ZA 3EBAA 1BW8A 2X38A 3WEOA 2WW8A 1UZ8B 4OI9A 5AYTA 5BV7H 1PZAA 3K2UL 3T65B 1PMYA 4L1HA 3E2HB 5K9QI 3ULVD 3WKPA 2WY3B 2XTJD 2P5WE 4UV4H 5GISH 3H3KA 4LF3A 3LAFA 3I50H 1H19A 1XD0A 3PJSA 2MOQA 2OR7A 1XGYL 3KYNA 1BEYH 2LE9A 4CSSA 1NUFA 1Y18B 1MWAB 3EH3B 3VYPA 4GMSH 4GW1A 4YL4A 4ZPTA 4NRZB 5K93A 4LLVB 2FEDC 1BREA 4EJ1C 5IVOA 2I60H 3VCLA 4Y16C 5BS0A 5GS0C 3TBTA 1S7KA 4PH8A 2ATKB 2NCMA 4H7VA 3A24A 3CQPA 4QHUA 4Y49B 4EE2A 1K4CB 3K2KA 3VMPA 2OKMA 3DMMB 3B83A 4Q9BA 2VE6A 3V9EA 3X17A 5ID0A 1WFUA 1X5AA 4FFZH 3KPTA 1QEXA 2EXYD 1R47A 3BAYA 4KPHL 5D71L 5GS1B 5DZLA 1DBAL 5A27A 3B4NA 4WJKB 1DJSA 2WWMD 3V9FA 2HKHL 2V5MA 5GGUB 1OAJA 3RI5K 3F6LA 1I7UA 3Q8EA 2Y3NA 3NIFB 3VGGA 2ZP9A 3MQIA 2CTCA 5FA3A 2PW2A 1J1OL 2WKGA 3FBKA 2GTQA 2BY3A 4Q0XH 2Z31B 5KVEE 5GHWH 3EJZD 1C5DB 4MMOA 4E9WA 2X2UA 2FHFA 2AJYL 4KROB 2G0KA 4NO0D 2BY0A 4NM8H 3ZDXF 7CPAA 3W11C 5I8OL 1R6VA 3C5SB 4G8FB 2EE6A 4OCYL 2WYHA 1GGIL 1VGKB 3L54A 2DAVA 2NNXA 2GC4C 3MLVL 5E2UL 2GJ6E 4YHYB 2G75A 3MOAL 4ZS7L 5HP5A 5FM5M 2FIAA 1WVZA 3E38A 3QDAA 5D96C 3BDYL 4KGJA 1TEYA 2VDNH 2JIXB 3AW5A 1N19A 1U4FA 2DICA 1TO4A 3CVDA 4S1QL 5SWQA 2WCSA 1XEUA 4X98A 4AJ0A 4XCFL 2XXFA 5H37H 5BVPL 4GEIA 2C9AA 5D1QD 2NY1D 4IIZA 5LLIC 3LQAH 1GCYA 1S5IL 43CAA 3FFDA 4K3EH 4AIZA 2R2HB 1YREA 3VWKC 5I24A 2QKIB 1MFEH 2QGDA 1NGXB 4DNCA 1N5AA 2EDRA 1DQLH 3CFUA 1CC3A 4LCVA 3IJHA 4FD6A 4UA3A 3DUUA 1X4YA 5J12B 3ES6A 5I8CB 1NIFA 3RJDA 1JD7A 1JHTA 4YXLH 5E8EA 2D2CC 3CFTA 4NRYA 4TLSA 4V1DA 1OPOA 2XEGA 1KBKA 2NY0C 5IV2A 4KI5E 3AG3B 3LIZA 3SDCC 5A40E 2IH3B 1AIFA 1FYHB 15C8H 2HLAA 1ETJA 5J8CA 2YC1A 1FNOA 3PGCA 3UIYA 4R87A 4U0RC 1NCUA 3NIDE 5E95B 5FYKE 4P46B 3RBGA 1MLCB 3LZFL 1JGIA 3M07A 4QY8B 2P1YA 5BVJB 3ZE1E 1OY3B 1Q9KB 3CXFA 3L7EB 3WTSA 4LCWB 4DAGH 2K6YA 5T3ZL 3GYRA 4D8OA 2BSSB 4NZUH 4MJ8A 3B5GA 4YBHA 2W0PA 4H1LB 3AFLA 2XA8H 1PSKL 5GS3A 1QI3A 3HR6A 3C60A 5D5ME 5E1IA 5JPMA 1S7WA 2VLME 4PJGB 5GRXG 1RAMA 3P2FA 3UJJL 3ZE2B 1JXJA 3ZHKA 1HXMA 5JO5A 2VM9A 1VCAA 4KH2A 1XT5A 1HC1A 4NEXA 2XJKA 3IWUA 5CWSB 1SOXA 3F7RA 1JPSH 3ARZA 5JO5B 3BQUA 1MFVA 5MHSD 3TFKD 1UKSA 3WS3B 5F7UA 3KVDD 4KSAA 3PGDB 4DJMA 3MRBA 4YAQB 4C83A 3RFZB 2WTRB 1HS6A 1J7VR 3FU9A 5A7EA 2R98A 4GSDL 4RGNE 4LQ6A 3NABL 4MJ6A 1AGDA 3IDNA 1SYVA 3LXUX 2IADB 3R1GH 3EHBB 1GZPA 4WO4B 2JKSA 3W2DL 4CAVA 1KBWA 2ZEMA 4F7TA 1IGTB 5FS5A 2QADB 1CQKA 4PJ9D 3HA0A 3WXVH 4D7BA 1GTNA 4PLOB 4F93B 2GVYA 4KORA 2J88H 5F1SA 3OMIB 4MRBA 4TQPA 3VXQB 5IWLA 2J1YA 1IGJB 5DHXB 5DJ8A 4KTEH 3UTSB 4L8DA 4ZUSA 1T89A 1JVKA 3QIBB 1M4LA 1LD9B 1TITA 1DANT 1SBSH 5AB2A 2Q3AA 1B2WH 1NBQA 1E5CA 3MRUA 1A6WL 3HJ0A 1EAOA 1UZ6F 1A9EA 5MENB 1KWKA 2ABZA 3DUUB 3NSCA 5D6CA 3HCVB 1CLOH 5DMGD 4HHAB 2IQAB 2CALA 3VYNA 2RH0A 4F9UA 1KB5B 3TF4A 4Y4FB 1OARL 5IVXB 4JQXA 2BHYA 3QW9A 2XV6B 4JQIH 3V8OA 5AG6A 3RAJH 3MNMA 4I1RA 4HDIA 4ODHL 2AEPL 3DUSA 5FGBA 4J3TA 4EQ2A 2ARWA 3D39B 1OALA 4HKBA 2ZW7A 2N0KA 4N8VG 2A4CA 3OPZH 1KLGB 1DFBL 4JPWL 2RCSH 4L3AA 1JF6A 3O3EB 2OCCB 4NI6A 4Y5XC 5CP3H 3NA6A 3NE8A 4FQ1L 4G8EA 3G9AB 5I30H 1DJGA 4HX1B 3COOA 2PWFA 2WV3A 1YK3A 3FTGB 3SDDD 1GYVA 1VB9A 1BFOA 4KXAA 1YUHB 1KGUA 3GMPB 1QQ9A 4PK3A 5IQLA 3H42L 4RAUA 1J0HA 3I6KA 2DL2A 3ZVVA 2R0ZH 3FONA 2EUWA 5JW3H 3TE4A 2R15A 2VDKB 3JZ7A 1MCRA 4ZY2A 5BOPA 4JKPH 4FE9A 3IDGA 4PP2B 2GJRA 1JV5B 1ORSB 3OKDA 3QJSB 4GPVA 4L4VE 2BNUB 2NT1A 4ZAKC 4BQCA 1KXQA 4L5FH 4P46D 4IGBC 5DS1A 4UIKH 3OKMA 4OQTL 5E00B 3I75A 4BRJA 5G2NA 1FUNA 5IY5B 4OH2A 3VO0A 4M8UA 2P5EB 3INOA 5F0MB 1JGLL 5B21A 4LVHB 3CFEA 1P7HL 3BDXA 3FN0L 3IIBA 4HXAH 2XPZA 4R7LA 4MNGE 3D7FA 4HFWA 5EHFA 2QVTA 2WIMA 2PJ7A 4P9MH 1S3KL 2R1WA 3FTUA 5CM1A 2VN6A 2ZEOA 1MIEL 4P07A 4DP8X 1RZGB 2W94A 4CVWA 5HGDB 3S9MA 4QHNA 3PGCB 4GG6F 1WFIA 2YC1B 5H84A 3LZLA 4X7SL 4FXTA 5LN8A 3O6MH 4RS2A 1HXYA 2IJZA 3BQUC 4JFXA 4LEXL 4NGNA 1MWAA 3OJDA 4X4XB 3CVHH 4NQDE 4C4BA 2QR0B 4OCSL 2E9IA 3LS5H 4PSPA 2YFNA 1GOHA 3FCUB 4DPAX 2EWBA 1IICA 1FP5A 1J11A 4ZW5A 4ZFOL 3LRKA 1CB4A 1RSYA 2V7NB 4FTVA 4HGMA 4E0AA 3RWJA 1U8OB 5D2NA 1G9NL 3VRJA 2DQTL 1LJMA 2OTPA 1REIA 1PLBA 3BP4A 5CWSA 5GSVB 1EAPB 1OCZB 2AITA 5HI4D 3KW7A 1EGJA 5KS9F 3WELA 4HZ1A 4ZW6A 3TZVC 4EVYA 4FP8L 4NC0B 2VC2L 2H2SD 1WC7B 2FCKA 1L9MA 4JRYA 4AYFB 1MVYA 2FQGA 3MLTB 5DQDL 1HCYA 5AW4B 5FOBB 5HVWA 3D67A 3LACA 1NBVH 4JO5A 1RI8A 3ZTNL 2LVEA 2OM5A 2VXUH 4FI6A 5ICYA 3DX8B 3OZ9H 2MKWA 1ZGLB 2BHFA 1TF9A 5HYJD 1EXGA 5DMIL 3VSQA 4P2QE 1K85A 3O0RL 2O26U 4AWJC 4Z8FL 2MQGA 1G0YR 4CSTA 5FA4A 5GRUH 3AWGA 4A55A 1JZIA 3IMUA 3QQ9D 1NOLA 1ANUA 1FF5A 3CX5J 4G42B 4DP7X 3FO0H 3QZPA 2VB5A 1UA6H 2WUUA 1CX8A 2YUZA 1MJUH 3HI1A 5A2JH 5E8EB 3SY0B 3DKHA 3LN4B 5TH2B 2E7BA 1DBKH 3V55A 3UBXG 1WZ1L 2JFCA 4OJCA 4CMMB 4NJQA 3UJTL 2NXYB 5DFWH 2WKOF 1FNEA 3TEZA 3BH4A 1KACB 2DOCA 5DVOA 4F20A 3EO4A 4Z9KB 1A3ZA 3C5JB 2ZG2A 4IOIA 5LBSH 1UT9A 3U9PL 3CDCA 1NICA 1IFHL 2VSMB 3TA3D 1BZDA 2P8MA 2Q7YA 3GZKA 3SO5A 4KZDH 4KLVA 2L8AA 2XA8L 1Y6NR 5HDQL 3FFCA 3KMDA 1N70A 1GHFH 5BO1H 1YEHH 4TUOA 3S5LA 1I9JH 2OMBA 3DPBA 3BMWA 3IPFA 2PNDA 2FO4B 3NQKA 3QC6X 1E4HA 5E08L 3BH8A 3N7ZA 1LK3L 5HHXH 3C8HA 2EO9A 2Y1AA 3JWNH 4KJPC 1U8LA 4XOCA 4YFJA 4TNUA 4NN6C 4NO5A 3MGDA 2EJ1A 3QDHA 3PFOA 4XVSL 2F54D 4WI4A 2WXPA 3PFUA 1ADQL 1LP9B 3GSXA 3R8QA 4OC3A 2C1PA 2ZYIA 5ADOH 1RUML 3BPLC 1OQXA 2G2PA 3TYGL 1G5AA 3BDYH 1IGFL 1YEIH 3NJFA 4XPHH 4GKSA 4XNBA 3VH8A 3KJ6H 4LLUB 4NWUH 4TL5A 3WYRA 3UC2A 5C70A 1QSTA 1JFHA 1KLFB 2EXWC 2E7DA 3VXSB 2P6EA 4GIPD 3MRFB 4IKNA 5F7WC 3PB7X 5D7IB 5EO0A 3ULVL 3QIWC 4HIEA 3IFEA 4P44A 4PJBA 1A7PH 2H3NA 4OFPA 2PMZA 5JQHC 4K3EL 1TVHA 4HJTA 4JL2A 4IBSA 5DD6A 3UP6A 5IB3A 1BQUA 1OF0A 2O1AA 4PREA 4JFHE 5FYJE 1KN2L 1LRZA 5HHME 2BIPA 2AEWA 3N91A 4A7UA 3CIAA 4LSQL 1Q0XL 1EZSA 4NRXA 1TQBB 4UF4A 3QT2A 3QDME 5FW8A 4A7SA 3QGVA 4P49A 3X11A 3OKKA 4K7PH 3GEFA 2Y7LA 3L1OH 3GIVA 4JFPA 4NO0B 3VFGL 1DBKL 1U58B 1M3IA 2IDQA 4GYBA 4WW1B 2AJSL 1A7QL 3QAYA 1X5YA 1V27A 4JFYA 1CI3M 2C9SA 2DYSB 4R6UA 1UUNA 5DEFB 4P2RD 4U7MA 4KXBA 5AKVA 3WFDL 3KVQA 1IX2A 3NH8A 4I48A 1YNKH 4NGQA 5EO0B 1IM9B 1J5CA 3KXFB 1RZPA 5KEZA 1EJFA 2AJUH 4JUTA 2XXGA 5FCSH 3VQ2C 2UV3A 5L4MA 4OGAD 1CXIA 4UF7C 3Q3GA 3MA9L 4U2ZA 2BRRL 3M6DA 4LARL 5ESVA 1AG6A 4Y4HC 3GSWB 4GUOA 2NDGA 2D3LA 4Q8BA 2G60H 3CQFA 4M8QB 3US0A 2QADC 3JV4A 4KAQH 4OZGB 4WI0A 4ANXA 2E9JA 4A2GA 1ASOA 1XR9A 1FT7A 5K1NA 4WO0A 1FH5H 2DW5A 4RIRB 1G7PA 3GSUB 4UTAA 1KOAA 3VFSA 2OP4H 4LRIA 4P3DA 2OMTB 1AH1A 4AEHH 4LOUD 5FO7B 4L3EB 3GRWH 4EO5A 1U91A 2KLSA 1ZDSA 1MZZA 3N40F 2Q8BL 1RZFL 1YHPA 3MLUH 1KJ2A 2HC9A 4LHUG 1U91B 3B7RL 4N0YL 1DDHA 5F7EL 5CGMA 3RI5F 5E70A 3PB6X 1JSYA 2PIYA 2W07A 1WRFA 4JPVL 4ZQKA 2NY3D 5ACZB 2QIRA 5DRXA 2F68X 2D4FA 1NKGA 2AXGB 1LOKA 5DJZB 3T6VA 1FC2D 1PAZA 4QTIH 2MMXA 5DA0B 3KR4A 2R9HD 4L3EE 4TQEH 3WFHB 4K7PX 3ALWA 3BEVA 3QPQD 4NWTH 4OIAA 4R4NC 4OZGA 5BUPA 5LHDA 2NTSP 4ELKB 4KOYA 2F54B 4U05A 5CJOL 1H3TA 1ZS8A 2AK4B 1EMTL 4H8UA 1JG9A 5IFJA 4XPLA 5IBLC 1TJHH 3QRLA 5IESH 1YSOA 1T0PB 1NAMB 4G6KH 1N4XL 1S9XB 3STLA 5IMKA 5JLZB 2VWEE 4H8HA 2FRGP 1IO4C 4F5CE 1HVXA 2CR3A 1SFDA 4UT9A 3CSYB 3W5NA 5FDYA 4AG4H 5E9DE 1CG9B 2WZPA 1ZGLA 4Y9FA 5FYLL 1DTUA 1K4DB 1A9BB 3M8OL 1OP5H 5C0BB 5A1AA 1U8NB 5TDNA 3CDGA 3FF7A 4X7FC 4ZMQA 1Z8XA 2HTLC 1KCUH 3DIFB 1A5FH 5ANMB 3MRMA 1IEAB 5BZWB 4Q97A 3DRQA 4XMKH 5K39B 3NIGF 1E6OH 2Z65C 4YH6A 5JW4R 4F9PC 3GXIA 4ODUB 5IW6A 2YRZA 4HKJA 4LKCA 3ZTDC 5C9KA 2IOOA 3U0WH 2IH9A 5EUKB 3GMNB 4XNMB 3HPLA 5F9OL 4U4BA 2N1KA 4FQCL 2AP2A 2NZ9D 4GO8A 5CD3A 3D0VA 1BVKA 4K3DL 3LRSB 4FQHB 1WIPA 4K23L 4A6YH 3VD4A 3Q2CA 1OLZA 4PJXE 1U3HA 4Y4FD 3CH8A 3CPAA 4P10A 3ATDA 1Q9OA 1RIUH 4KI5C 4N5EC 3T0EA 2DTML 2Z31A 2C26A 4AVAA 2CUMA 2FDBP 5BRZD 1HZHH 2FAUA 3SDCD 2Q7AA 4LIQE 4M5YL 3D08A 3E9UA 1NL0L 3IRZA 1P9MC 4NP4H 3IJEB 4K73A 4O2EA 3ESNA 1QSEB 4PJIA 4UQ3A 4KUAA 3HS9A 2N7BA 4PRHA 1G1CA 2ZUWA 2J6EH 2AK1L 3PHAA 1AAJA 3DOIA 4PJFF 1AVAA 3AY4A 4ZY0A 4CILA 2AI0H 1JERA 2F7QA 2WXFA 3X1NA 1U8JA 1Y0LB 1BLIA 2QHRH 2EO8A 4FTVD 5CZXD 3QFGA 3UBGA 4POYA 5F0LB 4GY4A 2NQCA 1R0AH 1HH9A 1IU8A 5CBEB 3JV6B 3QZNA 1NLDL 4UUJA 2BP0B 4KY1H 2MWCA 1K4DA 5JPMC 4YHNA 4W4NA 5DC0A 5D7LE 1YNTF 5AVXB 5I1LB 5BMFL 2FYYA 2ETWA 4NJAH 4I3SH 4K3GA 1WZAA 3RTQD 4XP1H 4KZEL 1EVUA 2AEIT 3PDOB 1Z9SA 5F0PB 2DH3A 4OB5H 4L18A 4ODUA 5IW6B 3NABH 3VXSE 2UZIH 3D3VD 4OZIA 2GT9B 4GSUA 1CPSA 1PY9A 4ERSL 1EO7A 3EHBC 4WJG3 5DZAA 2XQBL 1II4E 2KLTA 5CEXB 3RNZA 4QXVA 4B9IA 3OHXB 5I1DB 2R4SL 4FYRA 4XMKL 5IJBC 3F0AA 2ITDB 3FTZA 1BZ7A 4KK5C 2FX7L 2BZDA 1IGIL 3BWSA 5DUJA 4KUCF 2VZOA 4OLUL 4PRPD 5TFSH 1B4JL 3P3YA 4X8XA 4CBZA 2VDMB 3IKCA 5F9JA 1KIPA 1J5HA 1ESOA 3P4NB 5DFAA 5A7BA 3BZDA 5GZNA 2H32H 2ZUQC 3HAEA 3O0RH 4X4ME 4L0PB 4CGPA 1AHMA 4KXDA 2B4CH 1U3HD 3ZHFA 3LQZA 4G7QB 1IC7L 3RL2A 2OSLA 2ZXDA 4PRIA 1ORQA 1UB6B 2A2QT 5D6CB 5DWUL 2DQGH 2Y69B 1J9CT 4ZUVB 2HUZA 4J8QA 1Z9LA 5F2FA 3ZO0A 3CBJB 4P5RA 3N0PB 2XA3A 2RALA 4XMWA 5DJAB 2O5YH 2MCPL 4JD6A 1M7XA 1VZIA 3D1MC 2XBZA 1JOIA 4B9JA 4HNYB 2FB4H 4HWEH 2YIHA 4UB0L 4MS8D 4ZTOH 3G6DL 3UZVA 1IBDA 1OANA 3B7YA 5AWNL 5I1HH 2FL4A 3QRBA 5IVZB 1U4EA 3DECA 4JFED 1HNGA 4NAQA 1MCOL 4I48B 4GRLA 4UOW1 4JFXB 1GZPB 3WJLC 4HUXA 3EBIA 4BFKA 1IC4H 1WISA 3SQBA 5I5RA 1YEGL 3O4OB 3QA3B 1PYWA 3LQAL 1ZVNA 3WTYA 4XHQA 3MLPA 2Y72A 5EEVA 3MBWB 4YHPB 4EN2A 2QL1A 1ZIAA 2F8IA 2BVPB 3MDJA 1ZLVK 1I8LC 2IPTH 2HVKB 1AQDA 4WTQA 5GS2D 4ZK8A 4CVZA 1KJVA 4L29B 4Y7OC 2M1KA 5IX3A 1A8JH 1X9LA 2BVPA 3ARQA 4A94A 4I77L 2DIJA 3S3SA 5ADPH 3FSWA 1A6AB 1L0CA 2LV4A 2QQKL 3U46A 4QEGA 4MNQB 1MDTA 4HIXH 1E4JA 3LPFA 3BSZL 3PABB 3UL4A 2VQUA 3LVEA 1KXTA 2Y06L 4F24A 2OMYA 4KVOE 1FC1A 3UTZA 3HG5A 5DJ2B 4BXSV 2PTVA 4S2SA 3WHE0 4CNIA 2FT6A 2MRYA 3BN9C 2PJAA 5G5DA 4WTZG 3PWLA 3HLKA 1LO2L 1KPVB 2HFEA 3NRFA 3W56A 3D2UA 5D7IA 3WIIL 1E90A 5DJXA 5F7DB 3WFDH 4AYEC 5ITFA 5LYIA 3ZZIA 4X6CE 2LHAA 4HU8A 5J56B 4KGLA 5JNYB 4F1ZA 5KG9A 2OI9C 4PJ5D 3SDAB 3NZHH 3TVMA 3IFLH 4C57C 5KBPA 2JJWA 2UY7B 3GO1H 3NIFE 3V6OE 3IXAA 3C8KB 4MB5A 1DLHA 4RAUB 2ZWKA 3CD4A 3AQDA 2OB0A 3UJIH 5J1AB 5LKNA 1BSIA 1YUHA 4ZFGH 2O5XL 4DGVL 3L3OA 2DQHL 3T1FB 4JKNA 2AF2A 4YHKL 3PWUB 4OUUA 4R90H 4EN3B 4GG8A 4QRBA 3B34A 4MNGA 1WITA 4QCIA 1S7VB 1I7RA 4XE0A 2RHEA 3K3QA 3RWHA 5BS0E 4K3JL 1G9NC 1N59A 3QXVA 4XI5D 2DI8A 4S1RH 5AW1B 4FQQB 4HEPA 2R8SH 4PQXA 1BAWA 1EHAA 1FNSL 4H0GA 4PJ9A 5DWNA 2WBXA 3K6OA 3D3SA 2NY5H 3LMJL 3PB4X 1L6PA 2OJEA 2MQCA 5I1CH 2HMID 3IVKA 2NNFA 3KDMB 5ICXB 5J57B 3DSBA 4B10A 2JF1A 3TIDB 2PLTA 2J8RA 4M85A 3RNQB 1I3GH 2WP3O 3HCVA 3V4LA 3DX3A 5J1TC 3QUYC 5EFIB 2IFFH 1BYOA 3IMWA 1VIWA 3BUPA 5FGBC 3ZO9A 4B7LA 1YQVL 4JZJA 4N85A 3T6WA 5LGKA 4OKOA 4L4VB 2CO1A 2JTDA 3LH8A 4WEMB 1F1GA 5DMKA 3JTKA 1IMHC 3I02B 2CBQA 4X5RA 4DKEH 3NIDF 4YSEA 4EI6A 1QSVA 3DHPA 4RDQF 4PCYA 5LG1A 2DWDB 4JG5A 4QYOA 4V2BA 3GTNA 4HCRL 4Y2DB 5FM5O 1F58H 1WWWX 4PTUA 1NGZB 3RIKA 3ZDZE 1OEZW 4PBDA 3MI6A 4QT5B 3T2NL 3DURB 3D2UB 3KHOA 1NCAL 2VQTA 3MXWL 2B4BA 4W93A 3QEGL 3SDYH 2WZPD 1UXSA 2GYSA 3V8CA 4PLKC 4DETA 3MACH 4JO4L 2R83A 2XWEA 2YNCA 2WXGA 4IBLT 4KZEH 3H8NA 3F8UB 2JJUA 2A6DA 1RHHA 2F0CA 4E9LA 1QBML 5IEHA 2VDQL 5K9OB 5FUCE 3WD5L 2ENQA 1IQWL 3HZYA 4G7RB 4HP5A 5EB9A 3WXWH 2EILB 4ZBGA 3N55A 2NY4D 3G6JF 4Z7NF 4HMEA 4HJ0D 5KYYA 1KXQE 1H6UA 4YXKH 3AS3A 3O8XC 5FHAL 4Y16D 2AGJL 4XCEB 3B2XA 3UTOA 3H5ZA 2EH7H 1NFDE 3BSHA 3C60B 1RMFH 2YQBA 5I1EH 4JRXD 1U6AL 1FFRA 2HUHA 1MRDL 3LZRA 5J12C 3KR3H 1EXHA 4GRLB 4P45A 1CF1A 4EMEA 2ZEDA 4LK4A 1Z6JT 1WAPA 5ICYB 1IZKA 3SPHA 1RP8A 2R23A 5DSCA 5LNGA 2C27A 3QG7H 4CN6A 1CZ8L 5K8OA 3RFZC 1WF5A 1N8OE 3ATAA 1WICA 3OR6B 3W1ZA 4K5NA 3OXRB 1XEBA 2HJLA 1MHHB 4HJ1A 5D1QA 1AD9A 4KJQD 1W72A 4P23D 3VDCA 1L7TL 5DWPA 4Z3JA 2OMXB 1DUZA 4Y1AA 4RGNB 4C54A 3RZCC 2CE6A 1OO2A 5C0GB 4F8TA 3N44F 4U4IA 5K39A 3ZUCA 4EI5B 4CW1A 5TE4L 2Z93B 3QUML 1A7RH 4RGNC 4QRSB 1SJHA 1JXDA 3WHXA 5C0CA 2Z3NA 4NO3A 3ZK0A 4PRAB 1YQVH 2ZKWA 3MR9A 1I53A 3BPOC 3W9EB 4EVNA 1GGUA 3AU0A 3MOAH 2AQSA 5FO9B 1KLUB 4PVMA 1PJWA 5DRXB 3OHXC 4AH2A 1KEGL 4KQ3H 4MMXC 4ZFOA 4ZSOB 1TMQA 4MMYA 1CFTB 4FKKA 4HWBA 3IYLW 4DKAA 3TJHC 4UT6A 4M6NH 1T0MA 4OCSH 1GMEA 1T80A 1OKEA 4QTHB 2PR1A 1OTSC 4YBQC 5IFHH 2J2ZB 1CU4H 1UM6L 4MHDA 5HVFA 3ZE0F 4L4TD 2AK4A 3AXHA 3CLEH 2R59A 4QAMB 5C82A 1FZKA 4OGAC 4HSCX 3WR7A 5CJQL 4FZEL 3REVB 4WFFE 4HALA 5AW7B 1JGDB 2VC2B 4X5WA 4LRIC 5J9PB 1E5BA 5LGHL 4KXCA 2FJFA 3EYUL 4N6RB 4JJOA 3ZYOA 3ARGD 4D0DA 3WNPA 3D2MA 4ZI6A 4JY4B 1B0RA 1T1YB 4BFGA 1PZ2A 3FRUA 4JFFA 5EULV 2MSPA 3E8UH 5SWZB 3L3GB 3QPXH 4FG6C 4J4PC 1DQIA 3GSQA 4WWKD 3WN6A 1CFTA 1OGAE 4JO3L 1HH6A 4QXGL 4R76A 4BDVB 1AXSA 4XNDA 1EHKB 2CRMA 2CU9A 4HWZA 4PJDA 4PV6A 2ITFA 2FGWH 1T1ZA 2KBGA 2Y6SD 1LE9A 1FIEA 3AROA 3STZB 3P9WB 1USZA 3D4CA 1OW0A 2IAMA 4IOIB 5CIPB 1CFMA 3HUJF 4JKPL 1XMWA 1JNNH 2PC1A 1NJ9A 5IHLB 1SJHB 3G6DH 4OCLC 1MJJB 4O02H 5AVZB 5FW6A 1TXRA 2BM3A 2BY2A 1TTFA 1EMTH 3IXAB 2G9HA 1CN4A 3NSXA 3O6ML 1ZE3H 2A4EA 2QDWA 5DJCA 1X5LA 2BEIA 3N1QC 1LDSA 2QGBA 1WK4A 3QIBA 2PVVA 3P30L 1YNTA 4LHJB 3VXQA 4HGKC 5BRZA 3VWKB 4CC1A 4XPBL 1N12A 1U92A 1JZ3A 4I5BA 2XYCA 2X3AA 3SPVA 2JDCA 3QS3A 3FO9A 2VLLB 3K6NA 2HRLA 3RY6C 2KCWA 4WSKA 4OF8A 2HZHA 4EDWL 1T66C 4ZMAT 4MDJA 4NUJA 3O8XD 1M2VB 1SLWA 2J7LA 3UC0H 3D33A 3VH8B 4OZFG 1S7QA 3ARBB 5I5MA 2O53A 4PR5B 4MS8C 4XPAH 3V6OC 3HC2A 5ILTL 4AIXA 1OAYH 1HL8A 3OAZK 4NNXB 2QFPA 2P8PA 3O2DA 5I8EB 4KRMB 2E9GA 2VDKL 3QJHA 1R5VA 4OCMC 1KGCD 2RJMA 1QR1B 3APNA 3CFBA 3BVWA 5LAXA 1TVHB 5E0FA 2MH4A 1CS6A 4GIOA 1HKLH 4BZ1L 1R5IB 3N42B 2K6WA 2BIOA 2G3NA 1V7NL 4WO4A 5ALCL 3DBXA 4RMUA 3AAZA 1CP7A 4U1NA 1N5YL 4BCYA 1F2PA 1TLKA 3CN2A 2J1ZA 5A6MA 2ZUSA 4G59C 4ZNEA 1IBGL 1QFUH 3X13B 2EIEA 2X4QB 4PJEA 1A7PL 4GUPA 3JYCA 5KJRH 3ROLB 3LNHA 1BF2A 32C2A 5IMLA 2ICCA 1JZ5A 1BPMA 4F92B 3FOLA 4ODHH 2FR4A 3TV3H 4P4BA 4PJAA 1V0CA 3A6BH 3ULVC 1UJ3C 5GGTL 3RFRA 4HKXB 2UWEA 1WHPA 3O41A 4FQIL 3FSZA 2KKQA 2A9CA 4FERA 1I3UA 2KS0A 1AYEA 3BGMA 3KD4A 3C2AH 3IO1A 3ZSSA 4NOFA 4JR9L 1FYTB 1PX8A 5DRNA 3MV9B 3RZCA 3OSKA 2PO6D 5EC1A 5I9QC 1L3NA 1WZKA 2E8YA 2ESVE 2J72A 3LZQA 2VABB 2GSIB 2EINB 1HZLA 5GZOC 2P0WA 4X8CA 1IRAY 2YGQA 2J21A 2LTQC 4PMEA 4LBEB 3RGVD 3DIVA 1GC1C 1MZYA 3FOMB 4XPFH 5FAAA 4IU3B 4U1HB 1TTRA 4RISH 3KWTA 3EGXB 4GKLA 2J12B 4RFEA 4WTWA 3K74B 1KCSH 3FOLB 1GA2A 5JMOC 3LEXA 3HI1B 2A73A 4G8IA 1J8HD 3CFDB 4HLJA 4XRCB 4AL8L 4LLYA 5I1EL 2WBJA 4RRPM 4BSVA 2XETA 3IMBA 4PTTB 4YDIL 3PDOA 3TURA 3N06B 3BP5B 1NZRA 2HFFB 2IWFA 2PO6B 1BJ8A 3KCPB 1VIXA 2F5IA 3LXAA 2DM7A 1U8OA 4U1NB 5D2NB 4Z3FA 3IU3B 4IKJA 1L7IL 3PB9X 1RZJC 4LDOB 2AFWA 5F3HA 2DQEH 4DH2A 3LPPA 3QI9B 1AO7B 3BRDA 4WW2F 1BG9A 1DO5A 2A5UA 1FL6A 4JO4H 2PETA 3M86A 5FYJH 5EZIL 3IDJB 4IM8A 4MAYD 2GLJA 1RUAH 4OD2A 4R7DA 3U30B 1DHKA 2G75B 2OULB 2VIRA 4M1DH 3QP3A 3MCYA 4ONGL 3VG0L 5JXAH 4ZUTA 3LPWA 1BJ1J 3LB6D 3GY9A 1MW1A 3OWEA 4H25B 3HMXA 3Q13A 1OF2A 2QMJA 1JYNA 1WYJA 4UT6L 4HS3B 1TTCA 4CAWA 4P2RB 1INEH 3DROB 3CK0L 3ZRSA 4OLVH 4JGMA 3LEVH 4JGUA 1Z4EA 3BC9A 1Y18A 2XVKA 3LHPH 1TNMA 1S7SA 1UUSA 3ABKB 3QDJE 4I3RL 4KVNL 1ZLUK 3UTZB 5SWZA 7TAAA 2XU9A 5ENWB 3ZHLA 1CLZH 4NCC2 3KL9A 5E03A 5J6GA 3EOTL 3JWNE 1TVBA 1CYXA 3H7BB 5FK9A 4LCIL 4HGWB 1S5IH 3BD3A 3WJJA 1MAML 2PJ3A 4DNLA 4FQXA 1MPAH 1OE3A 4ISVA 2OL3L 1I9IH 4X2UA 2ARJA 4BFOA 1OPGL 4G7VL 4OZHE 3SQBB 3AQZA 2WB1A 1VCBC 2WVVA 2VDML 1FZJA 3LOWA 3CN3A 4IHOA 3O3BB 4JM2A 1TETL 4UT7H 3IVKB 1IB1E 3F5BA 3RYOA 3J27A 4GBXD 4Y4HB 3MRJB 3KYMA 2BSSA 3WUWB 3V5HA 4R4BA 1X4ZA 4PJ8C 3OB0H 3RY6A 3VFRB 4Z7WB 4PP1D 4B5PB 3B7IA 3CHRA 4HK0A 3WNOA 3IKCB 5EWIH 4ALAC