1QMUA

Duck carboxypeptidase d domain ii
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
publication title Crystal Structure of Avian Carboxypeptidase D Domain II : A Prototype for the Regulatory Metallocarboxypeptidase Subfamily
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
total genus 138
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1qmuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qmuA01
2PE3A 2ZELA 3L2NA 1Z2LA 4MHZA 1CP6A 3D4UA 3IJ3A 1LFWA 2HB6A 3I1UA 1XRYA 1ZLHA 3KI9A 5THWA 2O4HA 3MN8A 4WI0B 4PXEA 3B3VA 1R3NA 5AQ0A 1TF9A 2B59B 3WC6A 1NSAA 2PJ6A 2WYRA 2EK9A 5IB9A 2ZEFA 3HUVA 2AFMA 3SJGA 4PXBA 2CF4A 4MCQA 1XJOA 4CPAA 3IWWA 5LRJA 3GB0A 3CDXA 1ELMP 4ZX9A 3KCPA 2PIYA 4PXDA 3QNVA 3B3WA 2QJ8A 2PRQA 4IHMA 3RBUA 1YW6A 1NKGA 3PRTA 3T8WA 6CPAA 5LYLA 4MCRA 3G3LA 5F09A 3DLJA 1XFOA 2V77A 2PCUA 1AMPA 1Z5RA 1UWYA 3TC8A 4FWUA 2C6PA 3WC5A 2IMOA 3S9LA 2ZEPA 2IQ6A 2AFZA 2ZOGA 4ZY2A 1IGBA 4OC1A 3TX8A 3PB8X 4MXUA 2V8GA 2OR4A 1CPXA 3PB7X 2V8HA 4FAIA 2PJAA 2PJ3A 4YOKA 3SI2A 1H8LA 1CG2A 4P4JA 3FJUA 4Z65A 4IAVA 2FVGA 5JGFA 3KL9A 2NSMA 2QVPA 4X8IA 1QMUA 3BI0A 3NFZA 5I4MA 2ZEGA 2OOTA 3V38A 4NGNA 3V7ZA 2PJ4A 4FXTA 4KSIA 4MHPA 4R76A 3SI1A 4NGTA 5K8OA 1AYEA 2C6GA 4JYWA 4UF4A 4RUHA 4NGQA 4WJBA 4A94A 2F8HA 3KHZA 2ABZA 5K8NA 4MRIA 2CTBA 2CTCA 3PBBA 5K39B 1VGYA 4O23A 1LAPA 2CIJA 4OC4A 1F2PA 4LQGA 2RFHA 2PJ2A 1VHEA 1JQGA 4F9VA 1Y0RA 4GM5A 2Q4ZA 1Q7LA 2BO9A 2F7VA 4OIDA 3S9NA 4OC2A 3KR5A 3NA6A 3KASA 4U3SB 2XHNA 3B3CA 1ZG9A 2PJ0A 4UIBA 5K8PA 2C1CA 3B3SA 2ZOFA 3H8GA 4OC0A 2J9AA 3BHXA 4EFDA 1YLOA 2PVWA 3D68A 3KHXA 4NGSA 3PB6X 4B6ZA 3D7HA 2RB7A 1BPMA 2XEIA 2ZENA 1XBUA 5JM6A 1BPNA 1DE4C 3IFEA 4DYOA 3D7GA 3GLJA 4A38A 3VARA 2EK8A 1ZG7A 2PJBA 2JBJA 4TWEA 4BD9A 1RTQA 4P45A 2Q43A 3D66A 3KZWA 3FECA 4JZ0A 3PEIA 3PFOA 3FEDA 2XEFA 1LANA 3IC1A 4DUKA 4UIAA 4OIWA 1ARMA 4ZYQA 3IIBA 2AFSA 2GU2A 4K3NA 4NGPA 1ZLIA 4PPZA 4AXVA 2PIZA 4W9YA 1GYTA 5LRKA 3FF3A 1TF8A 2ZEMA 1BLLE 1LOKA 3E8VA 4X2TA 7CPAA 1TKFA 3D7FA 2PVVA 3PBEA 4ONWA 4P6YA 3NJXA 3WC7A 1CX8A 2ZEOA 4NGMA 3B3TA 3CPAA 4R7MA 1QQ9A 3JRUA 4A37A 3RZAA 3KR4A 2I3CA 1M4LA 5DS0A 4PQAA 1Z8LA 5LRGA 5CPAA 3WT4A 3NH8A 1VHOA 3DGVA 3LMSA 3IO1A 5D8NA 4X3RA 5HXDA 4A39A 4UEEA 3NH5A 1TKJA 3PB9X 1ARLA 1YW4A 5LYDA 3FX6A 4UEZA 3K9TA 3KQXA 4OKOA 2XEGA 4MCSA 3BI1A 1Y7EA 2Q51A 4ZI6A 2PJ1A 3KGQA 3WABA 3B7IA 1BAVA 3SJXA 4YWYA 4MMOA 4P10A 3FVLA 1FT7A 3K2KA 2JEWA 2VL1A 4NGRA 3H8FA 4NFRA 4PXCA 2EWBA 3FEEA 8CPAA 2PJCA 4EMEA 5HVGA 5G5DB 1F2OA 3ISXA 2PJ8A 2XEJA 3CT9A 4H2KA 5CBMA 5HVFA 3LWUA 1OBRA 3NH4A 4TNUA 3ISZA 1HEEA 4EWTA 3S9MA 1ELLP 2GREA 2PJ9A 2GLFA 1LAMA 3MRUA 4ZX8A 3B35A 1YMEA 3H8EA 4WWVA 5LYFA 3HLPA 3FMCA 4IK2A 3HN5A 3IEHA 4UEFA 3KQZA 1FNOA 3D67A 4P4IA 3VH9A 1TXRA 4FUUA 4NJRA 5ELYA 4DJLA 1CBXA 1LCPA 2V8VA 5J1QA 4MHYA 4FBEA 4NJQA 1HDQA 4ZY0A 1KWMA 5LYIA 2V8DA 1PYTB 1TKHA 3PB4X 3SJEA 2ZEDA 3BXMA 1F57A 4MCPA 2ZEHA 3PFEA 1IY7A 4IYKA 2IJZA 5D29A 2PJ7A 1VIXA 2POKA 3RAMA 3GUXA 4EIUA 2C6CA 4OC3A 4P4EA 4F8ZA 4OP4A 4R6TA 1DTDA 5HVHA 1YSJA 2AFWA 2JBKA 4MHNA 2O53A 3N5FA 3FH4A 1R43A 1CP7A 4P4BA 2DEAA 4F9UA 3B2YA 4YU9A 4P4DA 4R8FA 4OMEA 2QYVA 2HC9A 2G9DA 1EE3P 3NJVA 3SI0A 3D7DA 2GLJA 1ZG8A 5JH9A 2PJ5A 4FL4C 3VATA 2ANPA 1CPSA 3SJFA 1PCAA 2BOAA 2ZEEA 4P4FA 3CPXA 4Q7AA 4G1PA 4OC5A 4ZY1A 1HDUA 2AFXA 5K8MA 2WZNA 2BCOA 2AFUA 2AFOA 1Y0YA 1XMBA 4P44A 2NYQA
chains in the Genus database with same CATH superfamily
5GGRY 1O7SA 3HNSH 1L9RA 4OJEH 3ZE2F 3DROA 5FUCC 1F41A 3EIFA 4BRJA 5THWA 2P7TB 1NC2A 4JDTL 4UTBH 4UINH 4P9ML 4M5ZL 4FG2A 4I3SL 1NCDL 3GKWH 1E4WL 5ECGA 1TQVA 3D4YA 3KR3L 1NSAA 4KS9A 2NY1D 3BPNC 3G08B 2O5YH 4BH7A 3IN0A 4KUZH 1LE5B 4EIBA 4K3JL 2DBJA 5B3SB 1X4XA 2ZEFA 1Y1DA 3MV9D 4JO8A 3IYLW 1LO2H 3C09C 4NWTL 4PCYA 4RMSA 5SV4A 3H6JA 3RZCD 4PJFA 4L8CB 3RQ3A 2V6HA 4KZDH 2BC4B 3AS3A 2CF4A 1GGCH 5DHDA 3I9SA 1Z9SB 4ELKA 2BP5M 3QE5A 1LO4H 4ODTL 5LHDA 1RULH 4P2CG 1E28B 2PRQA 4WI7A 4LBAA 5F6IB 1BQ5A 4NZTH 2EDLA 2WXFA 4MQTB 4M61A 5D7IF 3QISA 3DUHA 3MA9H 4NPYA 4QAWA 4Z6AT 1ZS2A 2NY6B 3RRQA 1R1CA 5C0ND 5F3FA 2NW3A 2MOVA 2RHEA 4XOBA 4WKZA 2ERJB 4ZPTB 5JOPE 2R56H 3BQVA 3OZKA 4NQCA 5A2FA 3L4YA 2ROXA 2ZX6A 1R3IL 1XZWA 2KLSA 4KRLB 3WIIL 4HALA 4Z78A 3TO7A 3RL2B 1GIGH 3SHSA 1LO3H 1XH3A 3DJ9A 1WBZA 2C3VA 4I7ZC 3JWNG 4IBQA 2HG0A 1OW0C 3TV3L 2ADIA 4ZW8A 3IXTB 4LLAA 3SPJA 4LSVL 3VXMA 4FABL 2V8LA 1KJ2A 5IWLA 2P46B 5IMLA 4OLWH 2C5DC 5IQ7L 1KOAA 2V8GA 3UBXA 3FH7A 1E50A 1TNNA 2D2OA 4ZAKB 1A6UH 1R6VA 1QSEA 4W6YB 1FNEB 1WZ1L 2NY7H 2O72A 1S9VA 1XF3B 4KHTH 1WJ3A 4KJWC 2B1AL 3SJVE 3G9VA 5EPMB 5E99L 5DJZB 3HIZA 1BZDA 5F89A 3TA4D 1ZA6B 3L16A 4JKLA 3L3OC 2W60B 2CJTA 4HPHA 1UJTA 4Q0XL 3GSUA 4BZ1H 4MHDA 2X2JA 5C0EB 2NSMA 4OH2A 4OD2A 3TBCA 1GPOH 2CGYA 3DRQB 4KJYA 4H2AA 3VXSD 4CADA 4CN4A 4DN4L 4L8SC 1IM3B 2JF1A 4YBLB 2N1TE 5HDBF 1DQIA 5MENA 4BQBA 3NFZA 2YBRB 4WUKL 4M1GH 4NGNA 3GSOB 1KENL 2CIIB 3F5WA 4LIQL 4F0YA 4KTEH 3P3UA 1HDMB 1EZVX 2VLRE 2AEQH 5CD3B 4JL1A 3MUY1 3IDIA 5T33H 4JZJB 1YCSA 1FL6A 3HZKB 4N1EA 4Q2ZB 4Y19E 4JYWA 4M7KL 1I9IH 2WIIA 3BWSA 4XCCH 1ZMYA 5GHWH 5I2IB 3STLA 3RUGB 3OWCA 1JN6B 3DR8A 2EYTA 1HSAA 1PZ3A 2QQLH 2X7LA 5IFHL 1IJNA 2QPSA 1L3WA 2B1OA 1PJWA 4MXWH 4JPKH 1O7DC 1T5XA 1XR9B 3D39D 4ZJ9A 3UYPA 3WLWD 1FHGA 3ZDZE 1XF8A 3BUQA 3V7AE 1OSPL 2VC2L 4HUXB 4GRWF 4WI5A 3PBBA 2IOMA 2DJMA 3RY6C 3SE6A 4DQAA 1JS4A 2IBZY 3F6JA 5I1JH 3I3GA 4B13A 3HE6A 2WTRB 4GSDL 2WCSA 1YHPA 1DQDL 3TBVB 5FR3A 4LEXL 4M03A 3V4UH 2X53A 1YAZA 5DDHB 2AI0L 5ESAB 3N1MC 4K07A 3A6BH 1JI2A 4ODUA 2G5BA 1E90A 1IAOA 1PLAA 2GSIB 1KPRB 1N6UA 2AERT 2VW6A 2X4TA 4LKCB 1IT9L 4QRUA 3ZN6A 3HNVL 4IEFB 1CG9B 4ERSH 1MELA 2GAZA 2EO9A 3A23A 2HJFB 4FXLA 2ED9A 3D2UD 3U1QA 2C26A 4OCWH 4GKZB 3TN0B 2PYED 4DGYL 3WI9A 3VRJB 3KH4A 5EN3A 4EFDA 1V3MA 3PHQA 3OMIB 4PJGB 4WI3A 2LTQC 4IQHA 2HFFA 3GNMH 4WW2A 3S37L 4B9FA 1NWPA 1P7KB 2OTWA 2ZP8A 1R24A 4WWNA 1S3KL 3ZGIA 2XIDA 5HY9B 3PZJA 3T2PA 3C6LC 3QQ3A 1LK3L 5DRZB 5KVGE 2H32H 2W0LA 3PIQA 1V10A 4IBYA 4K9JA 4PRPA 5JUEL 3VI4B 1CJWA 2QFPA 4M8QB 3SIKA 3LQZA 1HSBA 4WGKA 4XNMA 4AY0A 2X4SA 3DO4A 1ZLEA 2AK4D 3DX2A 3MODL 1WGVA 4PCSA 1C7SA 4CVZB 4P2RB 3TBBA 3HG1E 4ETQA 3RWEB 3DUSA 4EI6A 3PWUB 3HR5A 4DNLA 1AGBB 1U8HB 2X41A 1DE4A 4PTTB 4UT6A 1M71A 4WV1A 3FQNB 2Q7YA 2ORBH 2FL5B 1NEZG 1AGEB 3CZNA 1J48A 3QDGE 4M3KB 3SCMA 5E96A 3IFLL 4F8TA 1JZDC 1TEYA 2Y5TB 4GG6B 1HOCA 5EBGA 4IGBB 3BPCA 5DUJA 4Z0XB 3CNKA 5BZDB 3MTRA 4JR9H 4F2ME 5F9JB 1NBVH 4UFWA 4I3GA 4U1GB 3BP4B 5TD4A 1QLEL 4F93B 4L3CB 1T7VA 3JVFC 4YEFA 1E7VA 4WU7B 2BCKA 4JJOA 1XF2B 4XBMA 4B12A 1TKFA 4R5VA 4JM2B 3WV0A 5C0DB 1TOXA 5JA9A 4QT5A 2EIZB 2AEPH 1U2YA 2DQMA 3G5YB 1DLFL 4RSVA 3AFLA 2DPKA 4YAQA 5BJTA 4F1ZA 1MEXL 4O58L 1QACA 4LOUD 1RKRA 3VRIA 5JO5B 3OG6B 4U1KA 1DCEA 3V4LA 5F72S 1B87A 3FMGH 1QVOB 5H37H 5FYKL 5HVHB 3QJSB 1RIVL 1FNSH 2Y1AA 5CPAA 1MI5D 1VHOA 3PWLA 1EUTA 5TF1H 3DXAB 2EDWA 4PRNB 4A39A 4OZ4B 2ICWB 4JKPL 3NH5A 2ZW6A 5ICYB 1AZBA 2Y69B 5J3HC 3VH8G 3T6ZA 4WNQA 2QPDB 4I88A 1TVHA 3FX6A 1MFBH 1A4JA 2BHUA 5JHDA 4DWHA 2L7JA 3CCHB 4ONFL 3ARTA 1HTYA 4IMKA 2IPTH 4MCSA 2X6BA 5I1DB 3BKJH 4I13B 4BIKA 4XO9A 2JXMA 3P4NB 4S10A 5FFLA 1FV1B 4NKIH 1TSRA 4Q4EA 4CYNA 1XIWA 2YD2A 1QSRA 3B7IA 2CK0H 4ISVB 3UJIL 1BAVA 1TIUA 3U4EA 2BM3A 4MFHA 4AG4H 2LHAA 5A16A 3DIFA 1BBDL 1FC1A 2CO4A 2B4DA 1F8TL 4FL4B 3ZKMD 5K1VA 1UJ3C 1AKJD 3F7VB 3WAKA 1MJ9A 1E27A 5ENWB 5IREA 2EXYD 4HT1H 3EO1A 2FZ3B 2C9QA 1EGJL 4H0IA 4XE0A 4YZFF 3FBUA 4X0KB 2Y22A 3QB8A 1F2XK 3GSWB 1N0XH 3ZO0A 1T7XA 4QDGA 2R1YB 4FXKC 4NM4L 2E6JA 2BK8A 5HVFA 4JS7A 5EUOA 2CJ3A 3FUDA 1JRHI 4UILL 3WIHL 1LWRA 5IT2H 1L9PA 3MRHA 1EERB 4KH9A 4PJXB 5TF0A 2X9WA 3RWIA 4Y0GA 1T1XB 1CLVA 1TZAA 1IGFH 3KLHC 4EWTA 2NW2B 1CYXA 4Z7UA 4X6CE 1DQQA 2YPVL 1HZLA 2FIWA 2H7WA 3LQAH 4FFZA 1KIUA 5DJCA 2XPYA 3L4TA 3MR9B 4L3EB 4P23A 1U3HC 4WWVA 3QDAA 4XXCC 2H2SC 3HN5A 1CDIA 1HEZB 4K30A 5E00A 4YPJA 4BUGA 3RLSA 1GHFH 2SEBB 3MLZL 1IKOP 2GITA 4A2GA 5DWNA 2C4XA 2R2HA 4Y2DA 5A1AA 3OKYA 3VDAA 1FBIL 3GLEA 1OAKL 3DJZA 4FUUA 1IGIL 1BQLL 3BDBA 4XN5A 3JTSA 4L05A 3TASA 3MV11 4PTUA 3T3MB 2PW2A 2ATRA 2V8VA 4X99B 4IHOA 1VFAA 1UCBH 2VDRH 3MLTB 5FM5M 4FYQA 3O6ML 4AT6A 3O45B 3NFNB 3LEYH 1G9HA 3FBKA 3QDJA 3VVVA 1N70A 2A4ZA 2NXYC 4JREC 1EUUA 1IC5H 4MAYA 4YFDB 2FHFA 4Y5VC 2J1KA 3FZUC 1E0OB 5KVDL 1TJIL 1HXMA 5C0CD 4G42A 1AQMA 4N0UA 3BXMA 3MOBH 3B2XA 2JE8A 4KVCH 5AAWC 1J8HA 3FTVA 4YHPB 3GT6A 2QR0A 3L9YA 4QJ3B 4IYKA 4TF4A 3GINA 4GI8A 1WBXB 4HMEA 4WHCA 1CLOH 3UZEA 3DX0A 3VNZA 4Z77A 2H47C 2RALA 3QFJB 3ZDWA 4XMLL 1U8CB 5IFAH 3LKSB 1D2PA 4PG9A 3HN8A 1U0QA 2F54A 3LDBB 5DRNB 4A2EA 3QUML 5AG4A 4NRZB 1HQRA 3DO3A 1F11B 3P30H 5TDPB 1F42A 3FOMB 1I1RA 3BAJA 1T2JA 4CGPA 3IJ9A 4UTAA 4JDEA 1IOFA 1KTLB 2X6CA 4HKZA 2HB0A 2MKWA 5DHVB 1S4IA 4NT6B 2PCPA 1TT6A 2E9GA 5KANI 5D5ME 1DYZA 1FG2B 3GXFA 1R43A 2JTDA 3CZSA 1CE1H 4P07A 4W93A 5D7KE 5DR5H 3V79C 4J23A 3HZVA 4P4DA 2JCCA 4PJCF 2IBZX 5EZIL 4H26A 1BD2E 1BZ8A 1ZHNB 1MRCH 1N2RA 5FYJE 2VB5A 4QOKA 1ZG8A 2QVIA 4OT1H 5HPOA 4UDTA 3KGUA 1SBBA 3B2VL 4JL2A 1AMXA 1BEYL 2EO1A 1AI1H 4OKVA 5LXGH 1HI6A 3HE7A 3W56A 4HUKB 2XUWA 1FCGA 1DBBH 3REVB 3GHPA 2GJZA 1Z9MA 3LPWA 5D7JB 2XYCA 3NFSH 4Z7WF 2FATL 1LEGB 5IB2A 2BY3A 4OFQA 3K6FA 5IVXE 4RWYH 2Y3NA 4P4FA 1FNGB 5GS2H 2BSEA 4UANA 1NWOA 1RERA 1NCUA 4WWKA 4RGMB 3BT2L 4JRYA 4KH2A 1CCZA 4L23A 1A0QH 3W11C 2P52A 1UD6A 1P6AB 1TYRA 3QQ9C 5EBMB 1BZ7B 3ARSA 1YA5A 2E7HA 2VZTA 4GAYA 5D7LA 4KNQA 4N26A 2XV6B 1T1WB 1TYJA 2P45B 2DF5A 2UUDK 3KWXA 2EDOA 1CP6A 1L5GA 3B5TA 4UIKH 3VXRA 2BJMH 5KSAA 1SJHB 4GPVA 4ESKA 2VE6B 1SMOA 3GHBH 1MCOH 2EIDA 4MGXA 2IBGA 3NK4A 4JPIB 1AO7D 2R8SL 4GKNA 5E2TL 3OL2A 1WA0X 4QBJA 3B9AA 5EEWA 1CTNA 1TJXA 3ZKXC 4TLTA 2V4LA 5DD0H 2GABA 4YEEA 1JWUB 3BUBA 3QJRB 4A6YH 1X4ZA 3S35X 2XTJD 2LU3A 4H0GA 5DT1L 3DIDA 4HS8L 2XN9E 3N41F 2EIMB 3MX0A 1EHLH 3INOA 2P5WB 5JQ4A 3TBSA 4NO2A 5C0BB 2AXFB 4FQCH 4R8WL 3T0ED 1G9NH 2QPEB 4QHMA 1AZCA 4OF3A 1KCVL 5EC4A 4F37K 3MLYH 4JFDA 1ZSDA 4DPCX 2XV2A 1FCCA 3DHJA 3UP6A 5C09E 5BQDA 4HCGA 1NLBL 1GHEA 3D12B 4DZ8A 1D6VH 5GRVK 3RU8H 3R06A 3WC5A 1MCPH 3S9LA 5DZJA 3MRLB 3F58H 5FF6B 4D9QD 3VB9A 3R8QA 3Q8EA 3ZDXB 1S9XA 2R7EB 3RAJL 3BH8B 4URTB 2GK2A 5E1AA 5ESVA 3WEMA 3KD4A 3LMJL 5F7EL 1RMFH 5CR1A 2CBQA 2WXNA 4P3WA 2OR4A 5BW7A 3ZGHA 1EWHA 1QA9B 2WLHA 3GZPA 2YAQA 5E8PA 3UTPD 1QLFB 1XEDA 3KXFD 3OB8A 4RZCA 4TPRH 3QWRA 5DVKA 5EEZA 4LPWA 4NQDB 3ARFC 4I0KA 5G4NA 3KL9A 4OFYA 3S3SA 4Z7NF 1ADQA 2GTWB 1KUYA 3OAZK 5J9PB 1B88A 5DXWA 2ZEGA 3OG4B 3G6DL 2OOTA 1E2ZA 3V38A 1TZHB 3CFDA 5F93C 4F8QA 4IBTA 4Q14A 4J6RL 1QYGL 2Y36H 3VFGH 4JVUA 1IILE 2ZKHL 4HOZA 1TSHA 5MEQB 3K80A 1M2VB 1B0WA 4LQFH 2IO5A 5E7FA 3QORC 2FGWL 1JG9A 3KVDD 1QI5A 2F7RA 3P0YH 4G6MH 4N9GA 3NSYA 2W9EH 4PJ8A 3UDWC 3ZE1E 2RC4A 3IDJB 3KHZA 3ZO9A 4OD3L 5C07A 5GGRB 3Q0HA 5B4MD 2QQNL 4QRQB 3RWJB 3S5YA 3DWTA 3U46B 3ULAB 5IESH 1YLEA 5F46A 4LNVA 3DYOA 1D5BA 4Z7UF 5IF0A 1YQVH 3F8KA 3PXJA 5CINH 4BKLB 4WFGE 5LQBL 1LD9B 4ZMYA 5JMRA 1MLBA 4FQXB 4TULL 5TQ0H 3EOTL 2NYKA 1AQ8A 2ZPAA 1KBKA 2AQNA 3NCWA 3AGVA 4K7PY 2Q76A 4QRAA 1G0YR 1ZHBA 2VDOL 3M1BA 3LKOB 1HIML 2HX7A 3MUGA 4HC1H 4CGMA 3F84A 3ILPB 1QTPA 4HFWB 5FPIA 2X4PA 3S5LA 1RK7A 4ZFZA 1SYVB 3O6LH 2Z0BA 4LL1A 3DNKA 5HHVL 3VFUB 1BVZA 4XNZC 4KNSA 4YGVA 3HKFA 5F1IB 1M1XA 3CDZA 3LACA 4L4TB 1UWXH 3RTQB 5C08D 2PVWA 3O0RH 3MLRH 4BHUA 2Z3PA 1Z2KA 1B4LA 2AJYH 5D1ZA 4NO5A 4I2XB 4I8DA 4L48A 1C8PA 2R2BB 3AXIA 5B8CC 4XP1H 2B3RA 3T5WA 3WKQA 3SOTA 3FT0A 3QNXA 1KXQA 3FCSB 5A27A 1KT2A 3BAIA 2NZ9D 3WUWB 5CD5C 1MFCL 1BECA 3F01A 4Y2NA 2P8PB 1VHPA 3I9PA 4F8OA 3ARBD 2Z31A 2GFQA 3E80A 3GMNA 1VFMA 3FAWA 4NLHA 4MFLA 4MXQC 3HC2A 1F4WH 4ANUA 2BOCB 2JKRM 3FB3A 43CAA 3TURA 2CTBA 2PJBA 5DJDA 3C5ZA 5DWPA 2VXTL 2CLZA 3B37A 3K6SB 4YBQC 4PJIA 3AMLA 2VLJB 2G60H 4OB5H 4YXLL 3PFOA 5C0IB 3BP6A 1SXNA 3AG1B 5L2KB 3CDFA 3KCPB 4A55A 4ZNEA 4P5TA 1E8ZA 4L9LA 4LRIC 3DIVA 4XX5A 4S0HA 2WPXA 1G7JA 4NGPA 3BSZH 4AKOA 1VACB 1PS3A 5I6XB 1WPCA 4JGNA 4AYDC 5A40E 4A95A 4Y4HB 2F7IA 3SDCB 2VOTA 3UJJL 2VI7A 3S0PA 4R87A 1KY6A 1R33A 2CM5A 5C86A 3LB6D 4U5YA 4N8CL 2ZEMA 2APVA 2JCCF 4GQ9L 2VDPH 4OCYH 2VR4A 3E8VA 4PB0L 3WY4A 2D9CA 4GMSH 3C87A 5C92A 2Q10A 2PVVA 4J6IA 1OL0A 1RZKH 4FRWA 2QSCH 3FFCA 3QJHB 5AW8B 4Z95H 4YSPA 1CX8A 3RPIB 4F7CB 4KSFA 1L9OA 4NGMA 3TA3D 1G9EA 4LPVA 1T7ZA 5L7XH 1L0YA 3QO1A 1UWFA 2CLVA 4G1MB 1UB5A 3NCJH 4N8PA 1A3LL 2J1ZA 2OL3H 3NCBB 2XQYA 2V7HB 4YSDA 2HRGA 4IRSA 12E8L 1DVFC 1ZKAA 3DX7B 4GW5A 4LCCB 4NPJA 3R7QA 5JQ6H 1JYWA 4R26L 1MW2A 4NSKB 5F1NA 3FTSA 2VDQL 1CD9B 5CP3H 5JORA 4DNCA 3U7YL 4Y9CA 3SE8H 5HXDA 4YZWA 4F9PA 4UQ9A 3QFGA 5G1ZA 1S7WB 3K2IA 4FQHB 1TKJA 1DQLL 1INQB 3RIFF 4QRPB 4DSYA 1GYUA 1AXSB 3VMOA 1RK1B 4V1DE 3RHWF 1W0VA 4JMNA 3HUJB 2X2HA 4EBQH 3UTOA 5AW4B 3F64A 4OKDA 3DSNA 2X4UA 1S7NA 2AJSL 2XEGA 4OKOA 3UZQA 1EGJA 3LN5B 2B5IB 4FQQA 4X7TA 1B9KA 4OVUA 4I89A 3GQFA 3SKMA 2X2IA 1QFWI 5E9DE 1JTOA 1WD8A 2N56A 2P5EA 3HMWL 3HPJB 4EXKA 1L9SA 1UVQA 3MA7B 3FQTB 5K39A 1KYOJ 3QI9A 2V5MA 4KKCD 5I76A 3RNZA 2XWBB 3FO0L 3SCMD 4RETB 4Z7OF 3WIHA 3ARGB 4IRJA 4E9YA 3QDME 2Z92A 4WO4C 2A9DA 2E74C 1WUNT 2J73A 4WSJA 2YD1A 1XDTT 3CN0A 5I1GH 4PYGA 4BH8A 2OBGA 4HIXL 2WTOA 4Q4IA 4NFRA 2GI7A 5F1KC 1E6OL 1WQVT 1Z0MA 5GGTH 4PXCA 1A6AB 2B5GA 4FD6A 2YPVA 3LEXB 4S1SL 1PZUB 1E3ZA 2OZ4H 4XPFL 3MRDB 2EWBA 4KITB 1J1PH 1IBGL 1ZXKA 3CXDH 1F2OA 3G5XB 4AQAA 2Y4SA 3LNGA 5CLXA 4NAJA 4TL5A 2E27L 3QUKB 4PJAA 5D6DC 3DGGA 4BEIA 3BWAB 1EIBA 1SN5A 3NCEB 4R2GC 3CVIL 3P73B 4IDJH 4RAUA 4YHZH 4R9MA 4OGYL 1JPSL 1M1SA 4FERA 3V0WH 1BMZA 1N6QH 1CO1A 3NCYS 1KTRL 2ZXCA 4JFFA 4KKBC 4MMZA 2YNCC 1V7NL 4HJUA 2PPFA 2BCMA 2XN2A 2BNRB 3W38A 2BIPA 3W82A 1FQ9C 1QRNA 4FQ1H 1NSLA 1WF5A 2AHIA 2WVUA 5D8JH 2JKJA 2XQYK 1M57B 3QULA 3H42L 3Q48A 4MDRA 2XDHA 4LQ6A 3N1GC 3FRMA 2KLRA 2ZOTA 4ICXA 4M5YL 1O5DT 4MNGA 5TE4H 4HJGB 4LLYA 5F3HA 1S8DA 4U1LA 4AVHA 4NQED 4LARL 4NN6B 3HC0A 2IQ9H 5D2LE 3SGJA 5KVFH 1LWJA 1OK0A 5I0VA 3LD8C 1HNFA 1EAPB 1K8DA 2YARA 3TWYA 2DQFA 4NJRA 5IQMA 1CBXA 3EOBA 4ZFOA 4QXUH 4TSCH 5DRXB 4GP5B 3GO1H 3WN6A 3UCQA 4EQ3A 2JDCA 4FBEA 5FGRA 1TENA 4U1NA 4G9DA 3FONA 2VQ1A 5LYIA 3EYSL 1X10A 4IIQC 4XI5C 4EEEA 3HB3D 4XH2B 2ED8A 4GP8B 3UPAA 3KJ4B 1JVOA 4ZODA 2HMID 3BEVB 3D85A 1QBLL 4PGBB 1LVEA 4JXRA 4UM9A 3ZYOA 2JJSC 4F7MB 2FEEL 3T4YB 4F0XA 3PAVA 5CHNA 5CP7A 1I8MB 3DGDA 3O2VH 4DERA 3V0JA 4AM0A 2BP0A 5C0AB 3DI2B 1RZFH 4OFVA 3QJFB 2GIVA 5E6ID 3K74B 4DZBA 3Q05A 1KB9K 4H20L 5ID0A 1JPST 4O2FB 4AG7A 2OJEA 4I5BA 4ZOEA 2EXWC 3LNIA 4BCZA 4ECNA 2PCFA 1FL3A 1JD9A 1IQDB 2RCSL 3W0WB 3TESA 2XWDA 3ZMRA 3MFFB 4LHUD 3ZTCC 1AJ7H 3N5FA 3CVDA 1HHKA 3OXSA 3Q9PA 3IVKA 3TPKA 2VMFA 3GMRB 1Q8MA 4F9UA 4JLRB 1VENA 1IM9B 1RJLB 1OY3B 5E9AA 4Y2OB 4P2QD 4XVUC 2LLNA 2J8MA 4YFJA 5KYUA 2ZWLT 3KYMA 4P23D 1RZ8B 1D6EB 1ILUA 4ZMXA 4ZXBA 4D8PB 2B1HH 1FIGL 5E8DH 3SE9L 3EDEA 3RX8A 4YDIL 1HJBC 4Z5RA 3V9EA 1T22B 3QWOA 4TOYL 4L8DB 3MRMA 4K7PX 4H8HA 1S9YB 3QJTB 4OU3A 2DXQA 2PTTA 4MYWB 4Y2DD 5AVYB 1TJHL 1OGAE 2ED6A 2J8RA 3IJEA 2OS7A 2MOQA 4ZW3A 2YPKB 4RFEB 3BGMA 2HH0H 1GKOA 3WHE1 1CDYA 4YHLH 2R1XA 1AE6H 3CLFH 4HV8A 5D4IA 1ED3B 1VLXA 4TVPH 3Q1SL 4RNRA 2XWJA 5DJYB 1IEAB 1D5ZB 1KTBA 2DTML 1DN2A 3EBAA 3EJTA 4LVNC 4G1PA 4JPVL 4MAYD 4JEGB 4W9FC 5LVEA 5EU6B 2V2TA 3AS1A 3N44F 3ZTJH 3CMOH 4KOYA 1NFDF 2GT9A 3DSFL 3VFRB 3BQUD 5HHMB 4MB4A 3CVHH 5C7ZA 3F62A 2VKXA 2R0LL 4MA3A 3BRDA 4JZOA 4M00A 3B43A 3VACA 2VZ3A 4GKSA 4E41B 4GQQA 3PF2A 4C58B 1PAZA 2Q86B 4CILA 5TE7H 2DH2A 4AWJC 3X3GL 2A77H 4YUEH 2P1YA 2MNUA 5KS9B 1XRYA 3RWFA 3QIWA 1NCCH 3OSKA 2F54D 1XTMA 1IAII 2XV0A 3EBHA 2FUTA 4GUPA 2X87A 5F7AA 2X89A 4W9KC 1Q1PA 5CIPB 2C8NA 4RBPK 3FRPB 4A1RA 2OMTB 1EO8H 2H1PH 4Y1SA 3WJJC 3HUVA 4P2OC 4R0LC 5AVZB 3SDAD 1BQKA 3QIBD 3SJGA 2CKBH 4I48B 4FQ2H 4PJBA 3DHMA 1I8IA 4M1CC 2ZSVA 3P77A 4CPAA 2IAMB 5LAXB 2UX6A 4LSDA 1JJUA 1ASOA 3G5VB 2DWEB 4I9WE 4JRXA 4N0FB 4OLXH 5D6CA 5DD6A 3U36B 5J57B 4PGEB 4NKDB 3JYCA 3K6DA 3MJGX 2W8CA 2OMXB 3EHBC 3NSXA 3QFDA 1RUPL 4O02L 3AGWA 3VMNA 1Q9LA 4XMWA 4PH8A 5E4AA 3G3LA 4XN2A 1JNLH 3X1EA 3CFEA 2WCPA 3OHXC 4L3FA 4OY9A 4TQEH 1ANUA 5KJRH 7PCYA 1SZNA 2XRAL 2PCUA 3PGFL 4HWZB 2JKSA 1MFAL 1UA6L 3BLKA 4G8GE 1T2XA 1L9MA 4Y1AE 5B1KA 3VGAB 3H3PL 1CDJA 4X9HA 5I8KL 2IQ6A 3UYRH 2WNKA 3SD2A 3RIAF 1WFJA 4FJZA 4EAEA 2BSED 2X38A 4N2OA 1U8KA 4A7TA 5FHAL 3VQMA 4WWKD 1K8IA 4POUB 3VQLA 4EDXA 2CM6A 1F56A 2XVLA 1JGDB 3MV8D 5A2CA 3IDNA 3LPOA 5L6YH 2GCYB 5BV7B 2VDNL 1OW0A 3PB7X 2FBOJ 1QBAA 4G8EA 1UH4A 4JO1H 3NA9H 4RI1A 4IRZL 4MJ5B 4H8VA 2HVKB 3QA3B 4U6TA 4B3VA 4TM9A 3ELQA 4PGDA 1BBJB 5DJ6A 5BQ7B 4P4JA 1NEZA 3VXRD 3V7MA 4PQXA 4F57L 1CFQA 5INCA 3AT8A 2UYLB 5KSAD 2YWYA 2UZIH 3BUYB 4CYOA 1MAML 2AXGB 4JMXA 4PK3A 1S7KA 1A7NL 2UWEA 5FYLL 4QTIH 5F9WB 3P2FA 2AABL 5IW6A 2DJ4A 3V7ZA 3CX5J 3ISWA 4JAMA 1KN4H 4OGAC 2I7SA 1NFIA 5I1LB 2E8YA 3NIFE 4R76A 4TUKL 1CZ8H 4XNUL 2W88A 4L8SA 1WFOA 5K9QI 2DTSA 1P4IL 3B9KB 1FE8L 1A9BA 3ETSA 1MIEL 1X6NA 2XIIA 3OF6D 5L0QC 3TIEB 4LSSL 1OWRM 1NBYB 1NCBH 4UBDD 4KTDH 1CXFA 3TT3L 4F5CE 2H4EA 4JQIA 1ITCA 2WZPA 1MCHA 2W9DH 5AVTB 5GGQH 4APQA 4LKXB 2LVEA 2VDLL 3EJCA 3PP3H 4PS8A 2WB7A 1MOEA 3ZJ0A 3S97C 2H9GA 3FO9B 5KSBA 1JZIA 3HG0A 3F0AA 1YMHA 3PHOA 4OC4A 4XWOC 2FEDC 4EI5C 4ZS7L 2J5LC 4AQEB 1VADB 2ZUWA 1FVEA 4GM5A 4GG8A 5FYJL 2GI0A 2GKIA 1QNZL 1E6JH 4QXTB 4Y4FB 1ZV2A 2CO6A 1UQSB 4YDVB 2RQ8A 3VH8A 3PQYA 4J12A 3WDHA 3R19A 5SWZA 5ES4B 1M05A 2ZUVA 3ZUCA 1BGXH 1QLRA 1EO5A 3I9IA 3MRQA 3U7WL 3NVQA 3EXNA 4KZEL 1Z0NA 3VXOB 2J8NA 4C47A 2I9TB 4NGSA 2F53E 3PGDA 2H45A 1JGUL 2BSRA 3MBEB 4PWHA 2XEIA 1PLCA 4GBXD 1J05A 3LYRA 2ZENA 3RE0A 4I49A 5I1AA 4KPHL 2YPLE 3FNKA 5H2BA 1MK4A 2IOIA 3F8UB 2NT1A 4JDVA 3JYBA 4NGHH 1S7QB 4RGOH 3ETBF 1ZLVK 3FTYA 2CQVA 1WYJA 3FUFA 3BP7A 4WEUD 2HPOA 5DK2B 3N85L 2YKLH 4ADJA 3MI6A 2P0WA 3KLKA 4NC2B 4NRYA 5AW0B 3L5IA 1N7MH 4U1HB 4LCWB 1FJ1B 4X9IA 4CJ1A 1YEGH 3U0WH 2Y2TA 3FT1A 4TQ8A 2WGNB 1F3DH 5CBAB 1U8JB 1JNJA 3Q8CA 1JXJA 5EO1A 2UXFA 1S7LA 3D2MA 1IZJA 1TMQA 4PJHA 3O81A 1T03L 2IPUG 3THMH 4BFJA 1DUZB 5KYXB 1ARMA 4PJ8D 4AGLA 5KBDA 2PO6A 1B4RA 3UBXI 5K33A 1WCBA 4HX1B 5FK9A 3IFNH 1U58B 4NN7B 4P04A 4Q36A 3F05A 5FUZL 5I66B 3OXRA 1MHEA 4OCSH 2BNQA 4WWOA 4Y5XB 3TVMA 1G9MH 3VGGA 1CL7L 5BZWB 5KVEE 2WIMA 2GJ6B 2AAAA 5BUGA 3MJ7A 2OMZB 1C16A 2FJUB 2BRRL 2W92A 1N64L 4YDLC 3ZBMA 4JKKA 1J5IA 2FH8A 1NQBA 1E30A 2J56A 4JG9A 2O5XL 1SY6H 4IU2A 4Z3TA 4QF1A 1UD8A 2VDMB 4UAOC 1RSYA 3X12B 2WXQA 2VZYA 3IKKA 5CEXB 4WK2B 4J3WA 3EXJA 3NIDF 1WO2A 1T3FB 1MJ7L 1YMMA 2EE2A 1I1AC 2V5YA 3H9YA 3RYMA 4G3YH 4UQ3A 2LQRA 4BFFA 3QC5X 4MQ7B 1E2VA 1U8PB 2W0FB 3MROB 4K73A 4F1SA 1VB9A 2CDEA 2XXFA 1S3RA 2I07B 4L37B 3LHAA 3X13B 1FRGL 1FZKB 3B56A 1HHJA 3WMPA 2G9HB 3HVDA 4FNLL 2WLKA 5C6PB 2N0KA 1IGYA 2VLRB 3O9WB 4FNSA 1BQHB 4X5RA 4EXPX 3D3VE 3C8DA 3KWVA 4Z23A 2W91A 1ET7A 1IYKA 3MRKA 4FTVB 3WNOA 3KEHA 2N7BA 2EDQA 2BNUA 3S3DB 1RPKA 3MOAH 4TRPH 4L0PB 4YPGB 3DUUA 3O4LE 3MNWB 4N90E 1OQXA 3UTSB 4Y19A 3T65B 4RISL 4S0TD 4L0YA 4ZUSB 1TTCA 2FRGP 1Y7EA 4JHBA 4ZNCD 2ZX9A 3H9SB 4Z7QE 1FY7A 4LLMB 3KGQA 2FYYA 3JWOH 3IGRA 2F5IA 5FKAA 3WN5B 4F3FA 4BGDA 3I02A 4AL8C 2ZONA 4OLYL 1L4IA 2AV1B 2ZKWA 4QD2E 4S1DD 3ECVA 1O9VA 1NMAH 3AZUA 4L4VD 4P3DA 3MV7E 3KBPA 2NY2C 2VUYA 3CZKA 5LNEA 1R0AL 1HESA 1MUJA 1XFPA 4UOQA 4XXDA 3O8XA 2XA8H 4GQPH 5F7DA 4JNXA 2AFNA 3QBTB 2WUBH 4EUPG 3C08H 1ET5A 1RCYA 4MCNA 3I6LE 2OW7A 3ARYA 4NXKA 4PJ7E 5G5DB 2P7TA 3BGFB 2HVBA 2E47A 1GZQB 1ID5I 1UJ3A 1UURA 3AQYA 3CT9A 3KPSA 2ESVD 4C2YA 3LRSB 4KK6D 4EDWH 4F27A 2NTSP 3G08A 4OCXH 1LE5A 5BS0D 3I6SA 3PL6C 1NGYB 5HHNA 5HYQB 5IHLB 4BZ2A 3UO1H 4QGTA 4PJ5D 4P9MH 4M5ZH 4GYBA 2GB2A 4HPOH 4Y1TA 4I3SH 4P4KC 1NCDH 4WTWA 3BZFB 5HI4D 2QDVA 3KR3H 2BC4A 2OMVA 1ZXQA 1JTPA 1HYSC 4OI8A 2AJ3B 3MUZ1 1Z9SA 4K3JH 4AEHH 4D0BB 3IU3B 2VMJA 3CBRA 3WL9B 1WT5C 1OB0A 2IH9A 4NWTH 4C55A 4HLZH 5IHUL 1MQ8A 4M43L 2ZCHL 4V2CB 5KOMC 2IBBA 1L0QA 4N9OB 4AGOA 2X6AA 4DVRL 1VKXA 2OK0H 5L4MA 2K8QA 4PV1C 1A7PL 2WQAA 4ZPTA 1S5HA 2F61A 4HJ1A 25C8L 1JZHA 3HG1B 3S96B 1K9TA 1U3HA 3FQUB 3ULVC 4KOTA 1OCOB 4YBHA 3RL2A 3CFTA 4N8VB 3WHE0 3FF7A 4OZGB 4BFGA 5LKNA 1FORL 2PETA 5I0WA 3MLPA 1Z8TA 3GD1C 3IXTA 1S2EA 3WIIH 5F96L 4AYMC 2OP4H 3FJTA 3QNZB 4LLUB 1D7CA 3V5KB 4F2MB 5JYMA 3SDDC 3BZDA 2FECI 3UAJC 1N10A 1WWAX 1MCIA 1YECL 3HBQA 4JPWL 4IRJD 5DSCA 1J4JA 4GO6B 2ZICA 4W4OC 1MW0A 4ZAKA 2YLHA 3L9BA 4A7GA 1OGTA 5LDUA 1FNEA 3G6JF 4FABH 2DEYX 3LN4A 1XF3A 4BRVA 1F97A 5EPMA 2YO3A 5JQIB 5DJZA 4Y5VA 3PUCA 3H56A 4N68A 2YAHA 5IQ7H 1ROCA 3SDXE 1ZA6A 3T4AC 3PWPB 1QSZA 2WUCL 1I4FA 4NIYE 1WZ1H 1OTSD 3CIAA 3QWNA 1A2YB 3KAAA 4Z3FA 5C0EA 2B1AH 3L3JB 1UXSB 1V3LA 3OWRA 4KI5E 4S11A 4CC0A 1IM3A 1H8SA 2J2ZB 4CMHC 3QQ4B 1IQWL 2ZKXA 4JFEE 4XPTL 2YBRA 2XETA 3ZTNL 4F8LA 4PVMA 1F6LL 3GSOA 2WXHA 3QUZC 2CIIA 1Q0XL 4Q0XH 2R69H 2ADJB 2C7FA 3QQDA 3HS0C 1HDMA 4RDQG 1KZQA 2R2EB 4JFFD 1QHOA 1UOLA 2H26B 3A22A 1RZGB 5CD3A 3VXTA 3FFOA 4OF8A 4AYFB 4OIIH 5DMKA 1QRND 1I9RH 1RP8A 1YC8A 3ASOB 2QYVA 1ONQB 3A6OA 4WUKH 2CCLA 3MNZB 3IN2A 4YO0A 2G9DA 1KENH 2D4FA 5I2IA 1EE3P 2YMXL 3RILA 2WBJB 1TJMA 2FX7L 3RUGA 4F33A 1JN6A 3FUHA 2WQ8A 2G5UA 3L3DB 2VZUA 5KBPA 3OAYH 4ZS6D 2WLNA 3I74A 2KMWA 3GXDA 4KAQH 4M7KH 4X8GA 3IDYC 2OMUA 4HUXA 3RZCB 1F45A 3OKNB 1I75A 2WQXA 2CHXA 4EN3C 2WTRA 3KL0A 5IFHH 4XMTA 5KBKA 3S2CA 3O4OC 1B3IA 1UFGA 3QG7H 3TBVA 3ZQ9A 1IAKB 5DS2A 5DDHA 4L1TA 2PPAA 3CC1A 4FX5A 5ESAA 3FKUS 2EE0A 1SHSA 1OSPH 2VC2H 4X83A 5LB1A 2AVFA 3V0HA 4ELMB 1BJ1H 3Q2WA 1YNKL 1P1VA 1KPRA 4X8CA 2Z91A 5IQ9A 1KJVB 4Q7AA 4IEFA 1ZVSB 1CG9A 3TO4C 1DEEB 1PD1A 1CLZL 2HJFA 2V3EA 3D6GA 1NBZB 4QRFA 4GKZA 3TN0A 2LLLA 3GI9L 3VRJA 1SDDB 5GS0L 3BC9A 4AX3A 1PZBA 2BP3A 3EH2A 2WZNA 3IWUA 1IT9H 4BSWB 4PJGA 3TE4A 4M6OH 5TDOB 1YYMH 1G87A 5GJTL 1P7QD 3LNHA 3RB5A 1P7KA 1UWGH 1KN2H 2I79A 4YHKH 3TJPA 2LOEA 4DGYH 5HHOE 5HY9A 5B3JE 1R3KB 1V05A 5IMMB 3BSHA 2YS4A 2FIKA 2B2XL 5DEFB 4KOXA 5EMIA 2QVMA 3S37H 3TNMB 1FFRA 4O02A 4MLSA 1S3KH 2K5TA 1BIIB 4YS4A 1XH1A 5FUOL 1B3JA 4E5XB 2HWZL 1LK3H 4FMFA 4E9RA 4OV6F 1QRKA 5JUEH 4CVZA 3H2QA 1CE6A 1FF5A 1PSKL 1II4E 3I3EA 2LT9A 1MHPL 1AGBA 4IOFD 3WFBH 4PTTA 3MAWA 1WZKA 2QSTA 3RI5F 3VXSB 3MODH 4KKLC 4U0RC 4Z8FH 2AEWA 1UACL 3L7FA 3CFUA 3C60B 4ZXBD 1MNUL 3FU5A 3WO4B 4GG6A 1JV2B 5HD8C 3B3WA 1PQZB 4IGBA 3I2CH 4Z0XA 5BZDA 1E9QB 3V6OE 2ALAA 1R5WB 4E9LA 4MCRA 2K7PA 3VRLE 3U1SL 2QZQA 2AQPA 4L3CA 1H3UA 3SE3A 3IFLH 4WU7A 4PJ9B 3BN3B 4GAAA 2H3NA 1J8KA 1MWAB 3D9AH 3D07A 1FYTD 2ZUYA 1XF2A 1H6UA 4X6DB 5B21A 1A65A 1VPOL 3I84A 3GK8L 4JM2A 3VWJC 5I0XA 1U6MA 5C0DA 2AFZA 3H7LA 4IK6A 3AJ7A 2EIZA 3B83A 3G5YA 2ZAGA 3AT0A 1L0XA 4OAEA 1B0GA 1IO4C 3ZTEA 5MP6H 3TJHD 1QQDB 3PB8X 1R3LB 4JHVA 5JW4M 4LRNL 2HLAB 5GZNC 5JO5A 2BHYA 5IB1B 3WSQH 1QVOA 3UJTL 4A32A 1N8ZB 1I1YB 1BOYA 1J0IA 4YDKL 3BLNA 2AW2A 1PZCA 2CPCA 2GQHA 1MEXH 5SX5K 4O58H 4HVBA 5KSVA 4MJ2A 1WEJL 5AYUL 5ADPL 2DMBA 1H8LA 4MSWB 5AL8A 3T6WA 1XBRA 2ICWA 4MAZA 2Y5QA 3JBG7 2OTUB 1GCYA 4K94L 3D2UB 1IBBA 3ZDZF 2VLKE 1AIFA 1TLMA 1J12A 3CN2A 4K2UL 3KBEA 3F7RA 4PRHD 2ID5A 4JG0L 1MCKA 1OM3H 3I6GB 1ORSA 1WLHA 3ATBA 3MV9E 2RACA 4N0CD 4OZFG 1AGDB 5HI5D 3CCHA 4JKPH 4NYLB 3PWJB 4JQVC 1SOQA 2XWXA 3HI1B 4YDMA 3G5ZB 1FC2D 2AV7B 3ARFA 1JD7A 5DA0B 5I1DA 1QSVA 2OXGB 4FXTA 2PWGA 4MHPA 3P4NA 3LNFA 1FV1A 2C6GA 1QNIA 1T21A 3HZYB 2XKSA 3IJYB 4YQXL 3WE1A 2GIMA 3UTTE 4ISVA 3V0EA 4D9LL 1E5BA 2E9BA 2A9BA 3OR6B 4GRLB 1S7SB 3US9A 5DRWB 4RAVB 2HKFL 1F3RB 1W80A 3I50H 5FGSA 2ABZA 3T9WA 1K4JA 2VLLB 1JYXA 3GTTA 5EOCL 2FZ3A 3UJIH 2BLFA 1R5IB 4X80H 4J28A 4HOXA 1CF8L 5IB3B 5E6RB 1R34A 3ML9A 2DQGL 5F9AC 5F48A 3IAQA 4I18B 1A2ZA 3GSWA 2EYSA 1F8TH 1QSMA 1UM5H 2R1YA 1T0PB 2K9FB 4NUJB 3NFPA 4GKLA 3D4ZA 5FM8A 3QHFL 1XGUB 2NY3C 1JV5B 5LAPA 2W80C 3IMVA 4PBVC 4AGMA 2Q8BL 4I77L 4PJXA 5E1IA 5B1JA 1OTTC 4KI1A 4J3UA 3HAEG 1T1XA 3B6SA 2QFRA 3QZWG 3H2WA 4WO0A 4PCKA 1JF1B 4C2ZA 4YK4C 4Q6KA 1NDGB 2VRKA 1XSOA 3D4GA 1QWHA 3IPBA 3MBWB 4XC3H 3B3SA 4UILH 2WZ5A 3TYFB 5EUKB 2QQKH 3KGSA 1KIPB 3OLDA 3DC0A 1B4JL 1WWWX 2X1QA 1NMCB 4G11A 3S34L 2N3JA 5IGXH 1ZT4A 3T0DA 2PR4L 2GJJA 1OO2A 1P6WA 5IK3B 2MCMA 4CC4A 2YPVH 3WJLA 2SEBA 3NCXA 1X5JA 1U4EA 2VISA 3MVSA 4OIFA 1ZLWK 3D0LB 5L8KB 3S8GB 4XZ4A 3TFKC 1ZIAA 2UZYB 4N2LA 5HYJD 1JTTA 1HCYA 3ZJAA 4LVHC 4E36A 1PIGA 1O6SB 1M9WA 1MI5B 1MCCA 3KPQB 4X99A 3SGEH 5CLYA 3MLTA 2F7QA 2FYVA 4JFYA 3BYYA 3KDPB 3TONA 3O45A 4H13C 1HH6B 3NFNA 4KMTL 3S4SB 1BQLH 3MPCA 2TRHA 2EH8L 4EJ1C 4K7FA 3DX1A 1H9VA 3D39E 4FHKA 3GSNB 1X5ZA 1Q9OA 3A4EA 1GR7A 5C09B 3B5GA 1BQHG 4YHPA 3LS5L 4APQD 1RZIB 3NGBC 3NQIA 5CS7A 1QW9A 5HYIA 1FH5L 1NCAL 4R96B 4E0AA 5KVDH 2A83A 3S35H 2K4WA 1U8CA 5DRNA 5C6WH 2JIXA 3W2DL 4JZNA 2NDFA 4NRZA 3NUKA 1IC7H 1JK9B 4X6EB 3EG9B 4M7LL 2Q8AL 2ENPA 1AIZA 4K5PA 1MZYA 5I74B 1KTLA 2YIHA 3CLEL 3DOIA 4XMLH 2PYEE 2C9PA 4GAFB 4HS6A 4NT6A 5DHVA 3MLUL 1QQ9A 2AJVH 2NY1C 3QUMH 3RZAA 3B2PA 3FB8B 1QX1A 5SWZD 1ICTA 3GXTA 1G7QB 1Z5HA 2JJUA 3ATFA 5GS1B 1WCQA 1OM9A 4NNYB 1PY4A 1KCRL 3VNYA 3R9EA 4FAAB 2WXMA 4X5XA 3ECUA 2JJTC 4N2IA 4P9HC 2ZG1A 2VJXA 3ZTDC 5ISZE 1OPGH 3KPRB 2BSBA 5ITBL 1OP3K 2XN1A 3IJ7A 3QXDB 2OR7A 5DC2A 5E5UB 2V8MA 5EF2A 3MDJA 3FU7B 4JFOA 1UZ8B 3CN3A 3HNTL 1W72B 3WGUB 2YD8A 3OX8B 5D7JA 1WFMA 3CZEA 2GHWB 4XRCA 4PI2A 1LEGA 4AXWB 1FIEA 4N24A 1AHWA 4U4IA 1FL5B 2XZQL 2ZXBA 2OSXA 3FQYA 1BEYH 1FNGA 4FDWA 1NPNA 3ZE1B 2OAAA 1NAKL 3QEHA 2ETWA 4NCC2 4ZT1A 5DK0A 5HGGS 4P4RB 1OK8A 4YWYA 3JWNH 2VDKL 3ZT6A 3OB0K 5J8CA 4G9FB 4HSCX 4PRAB 4ZOBA 2BVQA 4Y16B 5EZPA 1TO5A 1HX0A 4X6CF 4CUCA 3LRMA 3DTXA 3P0GB 3PUUA 4M02A 1D7DA 1T1WA 1B9ZA 3Q6FB 1LDSA 1OP4A 3QH3B 3FEEA 4BHUI 3HJEA 3QCUL 1DVTA 5D1ZI 4GJTB 4WO4A 4UNTA 3U25A 1RPUA 1BP3B 5JHAA 4JN1L 2H1LM 3ZOAA 1Z3GL 2Q3XA 4ZTEA 2JK5B 3QAYA 4F8NA 4XPAL 3ZRCC 1K2DB 1P1ZB 3S3JA 5CCGE 4JPIA 4I1PA 4H1LB 4Y49C 1UATA 1GCFA 3DYMA 3AM8C 1PEZA 1NIAA 4Z7VE 3WE6B 2X6UA 5F9OL 3IE9A 3AQDA 3BH9A 1BVLB 1XMTA 5E5MB 4OZHB 2M83A 1QSFB 3GLDA 2R8SH 4AL8L 5E2TH 2XCMC 3HMXA 3MZTA 2WLLB 3CC5B 3D5OF 1IBYA 4PP2A 1ITBB 3IMWA 4GW1B 3IDXL 4OJAA 4Q8BA 3L2LA 4TSBL 5EHFA 2P5WA 1EANA 4POYA 2CCVA 2AXFA 1UFUA 1NZRA 2AQ3A 4AMWA 4YSQA 5I1HL 4HHWA 1IICA 1CF1A 3WLWC 3PFUA 4LB8A 3N40P 5CFHA 2IADB 2Y06L 1OSEA 2DDQL 1N8OE 4X7EC 3B4NA 5E5LA 1Z5YD 1ZT7A 2ZQKA 3HTLX 2ZYSA 4R8WH 4QHPA 5CIPH 1G94A 1KCVH 3FSZA 4NJQA 2R7EA 4WF7A 3ZHNA 3CFJB 1KWMA 1FO0B 2YBGA 4Y4KD 4XVTH 4HWNA 4M9PA 3PAZA 4UOJA 4NC0B 3SJEA 5AG7A 5D5MF 2BIHA 3ZYZA 3J2PA 4ILDA 3H6AA 3OKMA 3EO0B 2QPUA 1A5FH 3RAJH 3QUXD 3HN3A 4MCYA 4MA8L 1E8WA 4BDVA 3O8XD 4I1RA 1DJYA 3QUYD 5LCVL 5F7EH 3KYNA 1I7UB 4J3OG 4NC1E 4WQOA 3GXMA 2POKA 3RAMA 4CU7A 4FMKA 4NQDA 1DJGA 2IDQA 1EJFA 4OM1L 1HZHL 2ZOKA 3ZMNA 3UAEA 3VW3L 2L7UA 5J9PA 3ULVL 3E2HC 3T6QC 3QAZB 4OZIE 5C0JA 3R1KA 1CXEA 1IIKA 3NJNA 3RDTD 3MNVB 3TYGH 4D0DA 1PDKB 4BFOA 2GUYA 1GAFL 3ZZQA 5IVXF 3B2YA 3TT1L 3AXLB 2I9LB 3ECBB 3HI5L 1YY8B 2EO8A 1LXMA 3VQ2C 2FX9H 3T77B 3S6KA 1QYGH 4P46D 5FO8B 3VSUA 1RL1A 3DX8A 4N86A 3VXUA 2UZXB 5AAMA 3IDJA 3K72B 4NZRH 4WGVB 2NY6D 1DFXA 4RFOL 5GGRA 4DEPB 2FHCA 3KPNA 3RWJA 3QYMA 2VABB 3U46A 2FGWH 4E5XG 3H9HA 1AYOA 2JKNA 4BKLA 4UZUA 4MS8D 3VATA 4HXBH 4FG6D 4HUVB 2C9SA 2GW5A 1J5OH 1HS6A 4RVBA 5TJWK 4GXVH 1QTYT 1V8HA 2P4AB 3TX4A 4ORZC 2DICA 4EIGB 4HH9B 3CSBA 3WGVB 4MB5A 4ZO8A 3A67L 3GXNA 3UZVB 2HA1A 4HFWA 5C0CE 4C68A 1JZ6A 4ODWB 4TULH 2J21A 1MRDH 1SYVA 1G1KA 1P4NA 3MXWH 5A43C 1MFEL 2Y1YA 2Y7MA 1J1OL 2FB4L 5FGCB 2VDOH 4B9YA 4AB7A 1WAPA 3BPOB 4DW2L 1ZS8A 1HIMH 4ZAKD 5F1IA 2M2DA 4LOUC 4L4TA 3QZOA 1FVDB 1GC1H 3TTSA 1OT4A 4Z3IA 2DPSA 4XN4A 5DMGD 5DYOB 1M4DA 3E8UL 4I2XA 2E9IA 5T1KD 2WZ0A 3B2UD 2R2BA 1YPZE 3GIZL 5DJXB 2RD0A 4KHXL 4JG1L 1BFOB 3TH3T 7FABL 2FGZA 3Q1EA 4CAXA 4NQTA 4RFNC 4YSEA 3FCSA 2OJ1A 2AEIT 3F04A 4M7ZB 4YHML 2R39A 1N6VA 2ZCLL 2D7QA 2P8PA 4TVPD 2W9LA 5CNHA 4GRWE 5EF3A 1JNHB 3TEZA 2XWRA 4BK8A 2EK9A 4UQBA 1XH2A 4QKTA 2WBKA 1YQ2A 4HF5L 4WNSA 4P3CH 4IBSA 5E7BA 3AXHA 2IXQB 2YXWA 5DVPA 4PW4A 4YXKH 5C0FB 4AJWA 1JHKL 3K6SA 3AG4B 3ARWA 2YGWA 4HWBL 3P3YA 3KDMB 2IVFC 1KELL 3SKNA 2VLJA 4AQ1C 4BKSC 4AVIA 3NQKA 5L2KA 3BW9B 1A3RL 3KCPA 1VRSA 3HC4L 5IHBA 5TDNB 3WJJA 2PR8A 1XMWA 3GZKA 4P2OA 3CN4A 5KOVC 4R0LA 2KERA 2VXTH 4JHWL 2J8UE 1CFVH 4LSPL 2W07A 3FCUB 4Q74A 5GRUH 3U6RB 5T3XE 3JWDC 3HR6A 3O6KL 1SM3L 4YXLH 1A7QL 1CK0L 3ZKMC 4Y4HA 3W9EB 3DLJA 7CGTA 3CMGA 3ARDC 4ANVA 3VUAA 2EXYC 3FB6B 4MJ4A 3FSVA 3US0A 2EC8A 2QADB 4IMLB 3MRCB 3KYKH 1D7BA 3Q2NA 1BFTA 5DJAB 1HVXA 1AZNA 3O3BA 3QJHA 1GZPB 1X7TA 1BZOA 1LQSR 2X0UA 3RPIA 2N1KA 2NUTB 3OHXA 5FCUH 5FM4A 1CLCA 4GSRA 4N8CH 4PRIE 1F4YL 3Q6GH 3RVXD 1QASA 1HL4A 1OSZB 2DI9A 3PV6A 4PB0H 4DCQA 3IEAA 1JHLL 1XH0A 4TV3A 2AKRB 3DX7A 4LCCA 5KYYB 4MY3A 1BYPA 1IGJB 1HCVA 1GZHC 1SJEB 1EJ6A 4FFTA 4IJ3C 3MCYA 5AG8A 3DTDA 4AVCA 3ETBJ 1H3GA 1PG7W 3OR7B 2HYMA 1U3NA 3ZKSD 1A3LH 1PLGH 3QS2A 2XY1A 4KTYA 2B9AA 2HVJA 4IAVA 4NS0A 1RZJC 4R26H 1S7WA 4N3TA 5AOJA 1INQA 1NTDA 2FJHB 2VDQH 3FUEA 4QRPA 2BVOA 5DQDL 2MHAB 2O6FA 3HUJA 2Y72A 4N2FA 4MD0A 1OCWH 2EZ0D 4ZMZA 1EDHA 2COVD 3MCKB 3GJEA 1DQLH 3WJMA 4L2LA 5DO8A 2BZCA 4P2RD 2VDMH 2FWLB 3DBSA 1TUPA 4MY0A 5CZKA 4YDJB 4PJEE 4PBDA 1G7MB 2AK1L 3CDYA 2XWBA 4JRFA 1T20B 1XL6A 1PKQB 3IDUA 1WC7B 4HQQL 3EJYD 2PWDA 3N1FC 3T0EE 1QSTA 4A33A 3S8FB 3ARZA 1DBKL 2DPTA 5AKVA 1NC4B 5DWUL 5LBVA 1ZLSL 4MRIA 1OAQL 1A6AA 4P2YA 2YD7A 4Y7MA 4ENEC 3LEXA 4ODBD 5IEKA 2WAHA 3D33A 3RWDB 3G5XA 4UCNA 1I7ZB 2JKTM 2RFHA 2VEZA 2BZ7A 5D9SB 2A9NH 3KWUA 3TXAA 2NX5E 3QUKA 1E6OH 3DDDA 2ATKB 1KB5B 2Q4ZA 4XPFH 5E2WH 3UABA 1YJDC 4OC2A 1NGXB 3HOGA 3NA6A 1OALA 4K7PH 1XF1A 4U1SA 3SZKC 1JWMB 1MCSA 3GFUA 3KVQA 4EI5A 2WYTA 1OE3A 2WNGA 1MIML 3WS3B 4G80B 3LY6A 3LH2H 5HJGA 4GY4A 4U1JA 4OGYH 2MTAA 2V9UA 1JPSH 3BD3A 4LNRB 4QMEA 1PZAA 1V7NH 2CJSA 1CD1B 3CU7A 4X6FA 3DXAD 4HJGA 1XGZA 1XR8B 4C56D 3L5JA 1IE4A 3FNCA 1I9JL 2XPGB 2MCAA 4MX7B 2IPUK 3GJFB 1EAPA 4JY6B 5H86A 3BPLB 1EJ8A 1ZGLP 4CJ0A 4G6AD 3MREB 4J8QA 1A4CA 2OMYB 3VFTB 1XE4A 4O4YH 5DEGB 4PJFE 5H35B 3APDA 5DRXA 3V10A 3PP4H 4EUPA 2WTPA 4LARH 2VSKB 2FO8A 3VARA 2BXYA 1FN4B 3ESUF 4WEBL 4LCUB 4A7UA 4N0YH 1TETL 1GYAA 1UZGA 4H4NA 1TFHA 4Q6IC 4JZ0A 2Y1ZA 2DYPB 4OFIA 3JQOB 4FLSA 3M17A 4XGZB 3GRGA 4XH2A 3BYTA 4AMXA 1EEZA 2XEFA 4LBEB 3VWDA 3TO9A 1QG3A 3PDOB 1S9WB 4PGBA 5KVGH 4WUUA 4X4XB 4F7MA 4NQCE 1TZGL 5F6HJ 4M3JA 3T4YA 2YNDA 3EYSH 1NEUA 4Y1AB 1OGPA 2ZW4A 2APSA 4QVTA 3P11L 4IW4C 3CSPA 4AXVA 4UI2A 5C0AA 2ZKYA 1DTUA 3GEWB 1FLTX 4N2AA 3LIZA 1JAEA 3K4ZA 1UT2A 4LK4A 2PR9A 2WYIA 2OCCB 4UYPA 4DH2A 4O2FA 5IJVA 1PW3A 2HFTA 3VXME 2QELA 3H1ZA 4J8RB 5JOFA 2P6EA 1JPFB 1YEEL 3CPLB 3WNPA 3W0WA 1IQDA 1HL5A 2HUHA 5E03A 3V9FA 4H88H 4GOSA 3KZ8A 2XZAL 3P54A 1C08B 4R7MA 1HE7A 1QSEE 4XAWH 5SV3A 5HYFA 5DS1A 3GMRA 4Y88A 4GXHA 4JLRA 4NO0D 4HIHB 3SE4A 2F18A 3APFA 1T0NB 1IM9A 2RCSH 1RJLA 2F8XC 5GRWA 4MHHG 3VE0A 3DVGB 1X6LA 4L3ED 2Z3FA 4UQ2B 1RZ8A 1D6EA 1A4BA 2NR6A 5CSZB 2XTJC 4D8PA 1NCGA 1F6AB 5MERB 5DO2D 5KUMA 4J5VA 5MENE 1JERA 1XT5A 1S9YA 4PVNA 3JTBA 2HN7A 4H25A 4R57A 2CHNA 2VN4A 3T0EC 5LYDA 4OF7A 2Y24A 1FIGH 4IU3B 5J12C 3TBYB 2YPKA 2F9BT 2BFGA 4RFEA 4YDIH 4ZSOB 4TOYH 3AWEA 4BCXA 1A6VH 4GXUN 5KTEL 3L3GB 1G7HB 2A9CA 4JKNA 3B1TA 1P0HA 2XKNB 1MG3C 1RJYB 1TJHH 2AVGA 1GH7A 5DJYA 2EEFA 4LSTH 1D5ZA 2JFCA 5DD5L 3VFVB 5TPWL 5LNGA 1RD6A 2CDGB 3QS3A 4X9FA 5EU6A 2ZXVA 4NENB 4TNEA 5AEAA 3TL5A 4C2XA 3VFRA 2CR0A 3TBWA 2MMXA 4HG4K 3Q1SH 3NZUA 5HDOA 4MFKA 5IROD 4M8UA 4XP4L 3EW3B 1FDLH 4NN5B 2C1OA 4N3UA 1AKPA 2HT4D 3LEVL 4A04A 4E41A 2FVNA 4P9HL 2DZEA 3FO2B 1KFAL 2ZW7A 4N87A 3DSFH 3ERXA 4M6NL 4OF6A 3QFJD 4EMEA 3CAFA 5KS9A 4GEIA 3ISXA 3WG7B 2M8XA 3MRFB 3UAAA 5D2LF 1OAYL 3ORJA 1O75A 2ZSWA 3IGLA 2F74B 4ODSL 1J9RA 1UM4L 1YN7B 1AOHA 2AF2A 4OR1A 3FAXA 3KYAA 4F7TB 3BE1L 5I1KH 2F53B 4GIOA 4OJCA 2NY5C 4W9GC 2AJZA 4LMQI 2PJ9A 1S5IL 3GS7A 2IAMA 5LAXA 5GGVL 5B38G 3PL6B 1I8UA 2DWEA 3GGWB 4N0FA 3U36A 5FV2A 1V5JA 4PGEA 3SYOA 2WPGA 4UWJA 1L6PA 4JCLA 4PRPE 5AG9A 3M6DA 1WTGT 2QGDA 4L1LA 1VGKB 2NNFA 5F8RC 3ZL4L 4KRPB 4RMUA 1XF5B 4G5ZH 1WT5A 2VRAA 1UH2A 4YH6A 5B4MC 5D7JD 3VTMA 1XSKA 4P2QB 3RY5A 4ONGL 3OKDB 5LCVA 3QYCA 4G7YL 1JXGA 3SKJH 5I6OA 4AKPA 1TVBB 2EDHA 2KZBA 3GBNL 5I6LA 3L3IB 4NO3B 4ZY0A 3PGFH 5I19L 2VITB 1MFAH 1UA6H 4JDZB 4HUWB 3VG0L 4XBEH 3VYOA 1P5UA 1GXEA 3H3PH 1PZSA 1JGDA 2OSLB 4YC2B 5I8KH 2RFXA 3E3QE 3QO0B 4FF9A 4NPKA 4F6AA 3VM5A 2OSWA 1RJZA 4MCPA 5FIEA 2XKUA 1NPJA 5FHAH 2FDBP 3OC5A 1Q0EA 1PZDA 3V4VL 4BA0A 1WV7T 3N04A 3QA3A 2ZCKL 4UT7L 3WEOA 4AEFA 5DHXB 1BBJA 1WS7A 4LEOB 3FT9A 3EJQA 4MD4B 5BQ7A 2GSGA 2W65B 4Z1PA 2VDNH 3TEWA 2Z35B 2UYLA 3BFWA 2HJLA 2VYRE 3BUYA 4WGWB 4P4EA 3BQUB 2A6DB 2AXGA 1S7VB 4MQSB 5EULV 4IRZH 1NM4A 2E8ZA 3ZZSA 3QJVB 2WLIB 1NL0H 3EYOB 5I0YA 2JNZA 3B7UX 1HT6A 3FU3A 2NZ9C 3LKPB 5AB2A 2AJXL 1ASPA 4QNPF 4QRBA 1GGTA 4GS7B 3ARBC 5I1LA 1MAMH 1MF2L 2X0VA 1A7NH 1QWUA 5DFTA 3B9KA 1LYQA 2IWFA 3GBEA 5ID1B 4WNJA 1J5CA 1P0SE 3ARXA 1MJUH 2GG1A 3V0AC 3DNSA 3FTUA 2P5WD 3V0VB 5I5MA 3FTWA 4NDMB 5C0BD 4YNYB 2OQJB 1FE8H 3KGTA 4LKXA 1MIEH 5E6YA 4PR5B 5JHDE 3O4LB 2J3SA 2ARJA 2VUOA 3SDAB 2FSEB 3EO4A 3FO9A 4RMVA 3QR0A 3PHAA 4MI4A 32C2A 4XPDC 2OR8A 2O93L 1IKFH 2L7QA 2P28B 4IHBA 4DP0X 4PWEA 2PPDA 4OCLC 5HYSB 2YEZB 2VDLH 1DO5A 1NLDL 4R83A 1U3ZA 3O0LA 2HFGL 5JW4N 2K3HA 4QXTA 4UDUB 4Y4FA 5JHLA 4AQ8A 3V0FA 2FNWA 1UQSA 3MV7B 4YDVA 3E6FB 4EN3A 4ZS7H 4KXZI 4FFWC 3BVXA 1RUAL 2DL2A 3QRGH 5EN2B 1PG7L 3TA3C 4OZFA 4X5LA 1AGFB 2A7BA 3IF1B 5FYJH 4S0SD 1QNZH 3MUJA 5I26A 2CUHA 5CLZA 1NMBL 1JDAA 1MW1A 5B7EA 1S6NA 2AFUA 5IQOA 3QWQB 2I9TA 3A21A 3QC6X 3OZ9L 4HWBA 1J18A 4CGNA 5IHZA 2M26A 1WZAA 3F6IA 4WW2C 3U7WH 1PF3A 2X4NB 4KZEH 2PXYA 4G7SB 4NQDD 3O2WL 4MZ3A 5EUOE 3ZVVA 1PYWB 1SF3A 2O4HA 4WI0B 1T2QL 4U1MB 4EPSA 2J4WL 1G6RB 4M6AA 3O6FB 1J10A 3UGXA 2X88A 1S7QA 4B9JA 5E4IA 3DX6B 2AQ2A 1LJMA 2ITCA 1SOKA 1TCRB 4M6ML 1TEGA 4Z7UE 5DK2A 3UROR 2WYRA 3N40F 5IB9A 2WQRA 2X2UA 5ETUB 2AFMA 3BZ4B 3DPDA 4UTCA 3O11A 4NFBA 2AQQA 4G8FB 4LCWA 2KT6A 2Y7NA 3RWHB 1CICD 2DIBA 2CWRA 5CM1A 1EFXB 4QHKJ 3V6ZB 1A1NB 1QPKA 1U8JA 5CBAA 4FEIA 4PPTA 3CDXA 3N85H 4G7VH 2VM4A 5FVJA 3KW8A 5KYXA 4KKCC 4WV1C 3FXTA 1HILA 1U33A 2YN5A 2R0KH 3HAEA 4KO5A 4OFPA 3SCMC 2Q1EA 1GTNA 1U58A 3QZWA 4ONHB 5DD3L 5GCNA 5C7XL 5DVLA 5E0FA 1U8NB 4D9RD 1ZGLB 2ICES 3MLXH 2HKHH 2WXKA 3EBGA 1MWOA 2VO5A 3E3QC 4Y5XA 1Y6NR 1T03H 4XZUB 5BZWA 1A1MB 1SLUA 1AMPA 2GJ6A 4LLVB 4DO6A 1CJYA 4FQXD 4H0HB 3LVEA 4WCYL 2FUQA 3TC8A 1CI3M 4ZO7A 5FUZH 3QDJE 4XODA 5F88B 4TQPA 2IWGA 4JB9L 1ULVA 4ZY2A 2ZXWB 2UXGA 5DGRA 1TQBB 4WWID 3ZXAC 4OC1A 5DLML 3GSNL 3QEUB 3X12A 2ZUUA 4HWEL 4N0UE 1C5BH 4DN3L 2EDDA 2OX5B 2BRRH 1JP5A 1N64H 1TYEB 1ZWIA 3KPLA 3U0PB 3GMMB 1J8HE 1T3FA 3BWUC 5AVRB 3W9DA 5B7MA 1FH2A 2WVSA 4AH2B 4M93C 1PY9A 3SDXB 3IM1A 1FZJB 1M3IA 5KVMC 3NIFF 2O5XH 4N2EA 1HH9B 3ZU8A 4AC4A 4L4TD 3RTQD 2DW5A 2WMPB 1U8PA 2W0FA 1X9RA 4OTXH 4PV9B 1YVLA 2FJFA 2OR9L 4S1RL 4TNWK 3UEQA 4E9TA 3VJ6A 4L37A 4J4PD 1U93B 2C3WA 2PJAA 1MJ7H 3RFZB 2F54E 4RGNB 3HRZB 3ABZA 3JWDL 5EC1B 4MTMA 5H4YA 4L1DA 2G9HA 4RMTA 5D7SL 2AJUL 4RX4A 4ZQTA 1LDPL 1P84J 4NUMA 1BQHA 5IM7A 4CAFA 1NH6A 4BWUA 4FTVA 1FRGH 3SYQA 2V2WB 2DQJH 5IOPB 2BIIA 4FYSA 3AU1B 2DMCA 4FNLH 3T65A 3UTSA 4CMMA 1XGRB 2JCCE 4GBXB 2CLRB 2QHRH 4IMKC 3BVDB 1YNTF 4LLMA 4LPCA 1UEMA 4L18A 2VLJD 4NXSA 4CAEA 4PS3A 2KH2B 5CEZD 3HG3A 3VGHA 3WN5A 4QOKE 5L2KD 5J11C 4RISH 4JQVA 1BPVA 2AV1A 5IQNA 4FI6A 3HB3C 2Y3AA 3DV6B 1NE9A 4FXGB 4YSTA 1EZLA 2HMIC 1Y18A 3Q01A 4F15B 2NNAB 1OKEA 3S9DB 1GVIA 1WS8A 3FBQA 3SDCD 4OLYH 4HJ0D 5M94B 1LAPA 3N42F 4Y5YB 4HETA 4Z7IA 1RZJL 5G5DA 1QKZL 1RK0A 5F7BA 1R0AH 2PJ2A 4DP6X 1W72H 2F08A 5E6IC 1VZHA 1E5AA 3LRSA 4OIDA 4OGXH 1PD0A 4JG5A 3X17A 5KTAA 3SSGA 3NSCA 2MOGA 5HYQA 1JCVA 1T4KA 2ZPKH 3QPXH 2H32B 2X4OB 1YX0A 1ZG9A 1KJ3L 2GUOA 4Y9GA 4OQ1A 1NBQA 4O9HL 2FCKA 3BZFA 4G72B 5D7LE 4ZMNA 2X4QA 3HLAB 3OJ2C 5F71A 5HHOB 3MACL 3BHXA 1OF0A 5I73B 3UX9B 2R29L 4CNIB 3CVBA 3VXRE 5I8EA 4UM8B 5T3ZD 4YSCA 2Z6FA 4P23C 4XNAA 4ETYA 3TWCL 4HMDA 4Z7OE 2BY2A 2EUWA 3ULVF 3ABKB 5CZXD 4MVBD 3G5WA 4K15A 1J0YA 4EKXA 5JM6A 3S96A 2WB1A 3FQUA 1TPXB 5CJOL 3DLQR 3DV4B 4Y2DC 3MHZA 4N4YB 4XB3A 4NI6A 2R0ZL 4DVRH 4OZGA 3I75B 3BZ5A 1ODUA 2PP7A 1OARL 2KPNA 1GL4B 1YJDL 1EV2E 2APBA 3BIAX 4XVJL 3SPVB 3NPSB 3ES6A 1RO5A 5J1TC 4LLQB 4Z9KB 1MFVA 4H1LH 1UD4A 3IETB 4RESB 2BWIA 4LVHB 3QNZA 4LLUA 3WBDA 2DLIA 4B95C 2CHZA 1ZEAL 3GUTB 3ARGD 3I9GL 4MAYC 1A02N 4X4YB 1Y07A 4MZ2A 5AVWB 3GBLA 4JFDE 4PBWD 1RU9L 4II9A 1I9EA 4R4FH 4IKIA 4HU2A 1YECH 4K3HA 4JPWH 4UB0L 5DHYA 4BWTA 5CLTA 3MRNB 4YGAB 3PWPA 4M3SA 4XMKL 2IPKA 1M44A 3BDXA 3LJ3A 5DJ2A 5FXCH 1S78D 3UZEC 4E68A 2ICWI 3L3JA 3ROOB 2G30A 4K55A 3S3BB 2VXVL 1IU1A 2CA4A 4L4VB 3CHSA 2LAAA 2ZEOA 5BUAA 1WITA 3VX0A 4JE4B 1P5VB 4LIQE 1HFUA 2R2EA 2OZGA 4D2NA 2O61B 2BNRD 3GIVB 4NUPA 4YSAA 2CE6A 15C8L 3ULSB 3ZKQD 1IQWH 4XPTH 1WZMA 5E0QA 3WFDL 1MN4A 3QGVA 3MLSL 1BZEA 1FO0H 1ONQA 3AUWB 3MNZA 3QIBC 1JCKA 4Z7QF 1Q0XH 2XFGB 2NDGA 2VLKB 2WBJA 2ESVB 1XCTA 5SX4I 3VD4A 3DGVA 1OF2B 1P6FA 3S2AA 4FEMA 4FKKA 1MXGA 3TCLB 4GUQA 3N91A 4N2HA 4RMWA 4X3RA 3S8WA 3BCFA 3OGCB 3RZCA 2YMXH 3OKNA 2RGSA 2FX7H 3BAYA 2QLYA 1XGQB 2ZXEB 4BSVB 4KVNL 1U2CA 1XOVA 3X3FL 5D72H 4KUAA 1IAKA 2YGNA 3HE7C 4DKDC 1ES0B 4PJ7F 3UTTB 4ELMA 3H4FA 3GKRA 1DBAH 4LVOC 4WI6A 4I0PB 3LPGA 1KJVA 4D0CA 1ZVSA 1DVYA 2FK9A 1DEEA 1BVNT 4XO8A 4LHUG 4K0OA 2PJ1A 2Q5BA 1BOBA 3UH8A 5IB5A 1DDHB 2A74C 2OXHB 3KJ6L 4WWKC 3S3PA 2NY4C 3TO6A 1HCFX 2QKIB 1MFDL 4W70A 5ILTL 5C07E 3FVLA 4HXAL 4BSWA 1COBA 3APNA 5TDOA 3NJMA 1UB6B 5FO9A 3W39B 3GI9H 2WZAA 1D5IL 3VI3B 4B50A 4P99A 4AYGA 4DEUA 3PABA 1U91A 5IMMA 5C8JA 3Q43A 1Q9KA 5DEFA 2Q7AA 3NCFB 5C97A 1VZGA 5GJTH 1GGIH 4YVNA 5KSAC 3W0WD 1BVNP 1T0MA 3L4ZA 1MHCB 4PLKC 4ALAC 4HLJA 3MJ9H 5I6PA 5CBEB 5K9KB 1CBVL 4E5XA 1JPTL 3T8MA 3IB4A 2ZYRA 3WTWA 2PF6A 2B2XH 2OCFD 4XP9L 3B7YA 1FFQA 2EUVA 4Z7AA 1CL7I 2ZXAA 5GGUB 3UP1A 1KNOB 3VXSA 1IGCL 1O0VA 4KQ3H 5IZ7A 1W16A 1TMCB 1JOIA 3APCA 2VDRB 3W1ZA 1JV2A 1PSKH 3NH7L 1PQZA 3JTTB 3II1A 1KXQE 3UTZA 2Q7NA 2WWNA 1E9QA 4B60A 2GBTA 5IMKA 1AQDB 2UXVA 2D7MA 4FA8A 4RRPM 5FW7A 3LZNA 2G2RB 2ODFA 2J6EL 3TV8A 2E56A 3VH9A 1A6WL 4DUXA 1MNUH 1SYSA 2A73A 3LZRA 4WI2A 1MWAA 3V4VA 5BVJB 3BVNB 4DJLA 4HIEB 2CO1A 4X6DA 4MJIB 4PQAA 1SHXA 5DC4B 4Q9RH 1T6WA 2I26N 4PMFA 4EVYA 4PJIE 2K70A 4A2HA 1PX4A 4YRHA 3S6FA 5I1EL 3EH1A 1HOEA 4U7KA 4ZNEE 2CBOA 4XO4A 3D18B 4ZMQA 2BOBB 2RH0A 5EU6D 1VPOH 2NY5L 1EX0A 1R3LA 3DDFA 3GK8H 3C75A 5D1QD 5EBLB 2HLAA 4OCNC 1S46A 3UL4A 4TMPA 1I3GH 5HHMD 3WTYA 1DN0B 3IJSB 1JXFA 1KCSL 3RVVD 1XCWA 4JO3L 2BH0A 5FYKE 3L9EA 3GYAA 1OE1A 2PUQT 3BD4A 4QR7A 3CZFA 5CKAA 4MFQA 1PZ2A 2X12A 4LRNH 4FNUA 3CFNA 4BD4A 3MQIA 5HYSG 2PJ7A 1VIXA 4HCRH 3OJVC 4OLUL 3J8F7 1IB5A 4KJPD 3MMEA 1RUQL 3UJTH 2OTUA 3FFCE 3D2UA 1CWVA 3VU2A 4ZMOA 4YDKH 2VXQH 1MJ8L 1WHOA 2HZHA 4PU2A 4R6TA 1DTDA 3I6GA 1D5MB 5AD0B 3ASNB 1WEJH 4KWUA 5ADPH 5AFAA 2AFWA 1AGDA 2GY7B 1EJOH 5ACZB 1SBSL 4NYLA 3U0TB 4CAVA 1OSYA 4NZUH 3G5ZA 2AV7A 3BZEA 2YQ3A 1FFTB 3EGDA 4MCZB 3MGTB 2NUPB 4JG0H 5JPMB 4E0RB 1KBGL 4OMEA 3HZYA 2QPFA 3IJYA 2J88L 4YXHL 3ZDYF 3FHQA 1VFUA 1KJ2L 1S7SA 4CS0B 3SYCA 1NGZA 4RAVA 1VAHA 2AK4A 2XN0A 3NJVA 4PSRA 5HJ3B 3V6FB 1UFHA 2PJ5A 2VLLA 4PJ8C 4ZPVB 2R7HA 3QRLA 4D9LH 1NKRA 1T83A 5IB3A 4K5NA 2DWDA 1WIUA 1JZ7A 1LMKA 4I18A 3RVWD 2HKFH 4CGTA 4TSAL 2VR6A 1OD9A 1UKTA 1LP9B 1NIBA 3M86A 5B3JF 2VKWA 2A9ML 5EA0L 2P5EE 4NUJA 3LKNB 1S7XA 4PB9L 1B4TA 1JV5A 2HTLD 1V55B 3NTCL 5TE6L 2QMLA 3REWB 3HI6L 4P06A 3RO0A 1DVQA 1M7UA 4S1QL 4S2SB 3KKWA 3AITA 1WHPA 5BOJA 3IWVA 3X1FA 3MBWA 1FYTB 3QHFH 1RH8A 2CNZA 2EDNA 4N28A 2XX0A 3TYFA 2Q8BH 1KIPA 2BCOA 1FGVL 1YEDB 4UQDA 5GQBA 5ICUA 1QFOA 2Z9TA 4NKMA 2KZWA 3BEWA 5IK3A 1MLCB 2X9ZA 1CT8B 4PJAE 5AZUA 5HVGB 5D1ZC 4KJWD 3SQOL 2EVGA 3QIUB 2CMRH 1TQUA 5KZCD 4BGLA 2DM3A 3VRLF 2HAZA 1R3NA 1J0HA 3QCVH 4YJZL 3C2AL 1BQUA 5AQ0A 4JFFE 5EMYA 5C2UB 5FLVA 2YC1B 3MBXL 1O6SA 3UERA 1MI5A 3KPQA 4R3SB 1QRNE 5DUMH 2EADA 3LRHA 5J8OA 4JXQA 1HH6A 1X5YA 4R9HA 3B9KD 3Q3GA 3HBPA 4HJJL 4HULB 3C5ZC 1BX2A 3JV5A 1DDTA 1Q1JL 4MNGE 3VWKB 1ZGLM 2PQ8A 3HPLB 4XNQB 2VZ1A 3AS0A 5AOLA 4QKXB 5IR1B 3GSNA 3QNVA 5IFJB 2WUUA 2VL5B 4LO9A 3G04B 4KMTH 5IMOB 3ZE0E 4AW7A 1RZIA 2EH8H 4L9LC 4QWWD 4S1DC 3QZNA 5FAAA 5LYLA 5B1CA 1IGMH 3ZE2B 4R96A 5ANMA 2KDYA 2OSYA 3S5ZA 1RHHB 2X1XR 4CC1A 5C82A 3K3QA 1N5YL 5ITFB 3LS5H 4UCPA 3GSXB 4JY4A 4ZBJA 3AWFA 2AXJA 3LRLA 4HPYL 3EG9A 4YVUA 3PU7A 5CMAB 1FH5H 1NCAH 1K72A 3IT8D 4DF9A 4Y4FD 1N5AA 2XNAB 5I71C 1ZANL 2IFFL 2V33A 4B10A 1AKJA 3LTVA 1I21A 5JR1L 3QG6A 4KK6C 3BIKB 1DL7L 3W2DH 2IAAC 3B8SA 3UPRB 1DVXA 1TU2A 1FVCB 2WD0A 3VXPB 1G7QA 5GS1A 5EWIL 4ZUVB 2Q8AH 4NNYA 2EVIA 2C1PB 2D3VA 3MU3A 3MLUH 3VFOB 5KYWA 5D7IB 2ADFH 1DJHA 3MBED 4XPBH 2B4BA 3GKZA 3KPRA 4YOKA 4NJ9H 4FNQA 1KCRH 3GMQB 3O3DB 3ULUD 3PGPA 4FFYL 3VG9C 3FU7A 1UZ8A 4OJFH 3MLVL 2DQEH 3L08A 4F9PC 3OX8A 1JVKA 1E7UA 2H2PC 2LABA 5E51A 5I82A 5ITBH 5K5YA 4ZTOH 4XMPL 1F1AA 4PMEA 1FL5A 2IV9A 1Q0YL 2DLFL 3JWNE 4MA1C 2GY5A 1QW8A 4LCWD 4B5OA 2MTPA 1BLNB 2PYFB 1KV3A 4A67A 2V7NB 2K1MA 4P4RA 2G75B 4NZJA