3B3SA

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 119
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3sA00
3IJ3A 1IY7A 2PJ3A 4P4IA 1YW4A 3IIBA 5I4MA 2OOTA 4Q7AA 5DS0A 2POKA 3V38A 3H8EA 1HDUA 3LMSA 2F7VA 4PXCA 1YLOA 2AFOA 7CPAA 3IC1A 1JQGA 5LRJA 2PJ1A 1UWYA 2PCUA 4PQAA 5D29A 4AXVA 3MRUA 4OIWA 1ELMP 5CPAA 3KASA 4PXEA 1CP6A 2V8HA 2J9AA 5K8PA 4A38A 3D7HA 2QJ8A 3ISZA 2Q4ZA 2C6GA 3D7DA 4H2KA 2ZENA 3D7FA 3S9LA 3B2YA 1Z5RA 3PRTA 3QNVA 5HVHA 4IHMA 4ZI6A 2FVGA 1M4LA 2VL1A 1CPXA 2BCOA 3GLJA 3KQZA 4OC0A 2XEIA 1ZG7A 4R8FA 1Q7LA 2HC9A 3DLJA 4IAVA 3NH4A 3JRUA 4R6TA 3SJFA 1XBUA 3SI0A 4OKOA 5F09A 1FNOA 1Z8LA 3KI9A 5HXDA 1HEEA 4NFRA 4NGPA 3VARA 1ARLA 2ZEHA 4P10A 1YSJA 2F8HA 2CTBA 1XFOA 2JBKA 3SI2A 4EWTA 4P6YA 2NSMA 1Y0RA 4F9VA 2O53A 4JYWA 3NH5A 3FX6A 2RB7A 3PFEA 1BPNA 4KSIA 2V8VA 3HLPA 4MHPA 2BOAA 2V77A 4WJBA 2ABZA 2XEFA 3FVLA 1FT7A 1LAMA 4O23A 2G9DA 4X3RA 4WWVA 2AFWA 3PB9X 5K8MA 3BI1A 2ZEEA 3PFOA 3K2KA 1ZLHA 3B7IA 1BPMA 1CG2A 1XJOA 1YW6A 1YMEA 4OMEA 3I1UA 2WYRA 4FWUA 1RTQA 4UIBA 4FUUA 3WC7A 2C6PA 1DTDA 4ZX8A 4TWEA 2JEWA 2HB6A 3B3SA 3B3CA 4MCQA 2AFSA 1CX8A 3S9NA 5LYIA 3PBBA 3B3WA 2CIJA 5ELYA 1H8LA 3D67A 1F2PA 4YWYA 3DGVA 3WABA 5LYFA 3FEDA 1ARMA 2ZOFA 1VHOA 2CTCA 2EK8A 4A39A 3FF3A 2PIYA 4JZ0A 1LANA 1PYTB 4UEZA 4FAIA 1QMUA 4MHYA 1R3NA 1VIXA 2PJ9A 3V7ZA 4MXUA 3FEEA 3ISXA 2JBJA 4OC3A 1CPSA 1XRYA 4ZYQA 2IMOA 3RAMA 2GLFA 3NH8A 4LQGA 4NJRA 1TKHA 2PE3A 2AFZA 3L2NA 3GB0A 4MHZA 2V8DA 4W9YA 4TNUA 4GM5A 4F9UA 1VGYA 3FJUA 4OC4A 2EK9A 3SJEA 1HDQA 1BAVA 4DJLA 4CPAA 4NGQA 4NGNA 5IB9A 3WT4A 2OR4A 3D4UA 1QQ9A 3KR5A 3VH9A 3PB7X 2ZEFA 4NGSA 5JGFA 1TF9A 4P4DA 2ZEGA 5CBMA 2PJ2A 2WZNA 5D8NA 4FBEA 4RUHA 3RBUA 2PJCA 5HVFA 2PJ5A 3WC6A 1AYEA 2DEAA 2PJ4A 3PB6X 1AMPA 4F8ZA 1TKFA 2GREA 3KL9A 2GLJA 4ZY1A 3D7GA 4B6ZA 4YU9A 2QYVA 2ZEMA 2I3CA 3SI1A 1CBXA 3KQXA 4PXBA 4ZY2A 3BI0A 3IFEA 4EFDA 3D68A 3N5FA 4P4EA 1GYTA 4MCPA 1F57A 3BHXA 2ANPA 3H8GA 4ONWA 2AFMA 1ZG8A 2ZELA 4P4FA 2Q51A 1LAPA 4UIAA 3RZAA 8CPAA 3NA6A 2NYQA 2Q43A 2RFHA 3IEHA 4PPZA 2GU2A 1LOKA 4P45A 3FMCA 3GUXA 2PJAA 4PXDA 2ZOGA 4MHNA 1TKJA 2PJ6A 1OBRA 2AFXA 4DUKA 4P4BA 4ZX9A 5LYDA 5JH9A 5LRKA 4OC1A 4R76A 4BD9A 3B35A 2PJ8A 5LRGA 5HVGA 1VHEA 2IQ6A 1Y7EA 1LFWA 1NSAA 3IO1A 5K8OA 3PBEA 4OP4A 2PJ7A 4EMEA 3S9MA 4MCSA 3KR4A 3WC5A 2C6CA 4X2TA 4G1PA 3MN8A 2PIZA 3IWWA 3KHZA 3PEIA 1PCAA 3K9TA 3PB4X 2EWBA 4P44A 4OC5A 4DYOA 2V8GA 2BO9A 4UEEA 3CT9A 4NGTA 2ZEPA 5K8NA 3KHXA 2IJZA 4R7MA 2PJBA 6CPAA 2C1CA 2PJ0A 4Z65A 2PVVA 4P4JA 4MRIA 5THWA 3B3VA 3PB8X 4OIDA 4NGMA 3TC8A 2ZEDA 3CDXA 3T8WA 1ZLIA 1CP7A 3NFZA 5J1QA 2CF4A 4UEFA 4MMOA 1Y0YA 5JM6A 3D66A 1LCPA 4X8IA 3CPAA 1TXRA 3TX8A 4OC2A 3BXMA 1XMBA 3KZWA 5LYLA 3B3TA 4ZY0A 2ZEOA 2O4HA 2QVPA 1TF8A 1Z2LA 1F2OA 1KWMA 3FH4A 1EE3P 1ELLP 3SJGA 3CPXA 3H8FA 4NGRA 4MCRA 3VATA 4A94A 2AFUA 4A37A 2PRQA 1IGBA 3SJXA 3FECA 1R43A 2XEGA 1DE4C 3KGQA 2PVWA 2XEJA 3HUVA 3LWUA 4IK2A 1BLLE 4UF4A 4NJQA 4K3NA 1ZG9A
chains in the Genus database with same CATH superfamily
4MFJA 4L89A 5G1ZA 3IJ3A 1IY7A 2PJ3A 4P4IA 1YW4A 3IIBA 4CAEA 5I4MA 1YVKA 4QB9A 2OOTA 1TIQA 4CRYB 4I49A 4Q7AA 5DS0A 2POKA 3V38A 2OU2A 3IU1A 3H8EA 2R8VA 3BJ7A 1HDUA 3LMSA 2KCWA 2ZW5A 2F7VA 2GANA 4PV6A 4PXCA 4KVXA 1YLOA 2AFOA 7CPAA 3IC1A 1JQGA 2FXFA 3LD2A 5LRJA 4R3KA 2PJ1A 1UWYA 2PCUA 4PQAA 4DNCA 5D29A 4HNXB 5EBVA 4AXVA 2R98A 3MRUA 2CY2A 5H86A 4QUSA 4OIWA 1KUYA 1ELMP 5CPAA 3KASA 4PXEA 1CP6A 2V8HA 2J9AA 2OZUA 2RC4A 3FYNA 4MHDA 1UFHA 5K8PA 4A38A 1WWZA 3SXNA 1R57A 4MBUA 1ZO0A 3D7HA 2QJ8A 3ISZA 4AG7A 2Q4ZA 4KVME 5I0CA 4H89A 2Z3NA 3TE4A 2C6GA 4B13A 3D7DA 4PSWA 3QAHA 4KUBA 4UCPA 1RO5A 1GHEA 4H2KA 2QECA 4KOYA 4Q36A 2ZENA 3D7FA 4XPKA 3S9LA 3B2YA 4C7HA 1PU9A 1Z5RA 1MK4A 3KKWA 3PRTA 2R7HA 3TOAA 2HQYA 2Q0YA 3W6XA 3QNVA 1Z9UA 3SXOA 4AVBA 1MJ9A 5HVHA 2J8RA 4IHMA 4ZI6A 5J8CA 5KTAA 5ISVA 2VEZA 3CXPA 1P0HA 2FVGA 4H6UA 3G8WA 1M4LA 2EO8A 2VL1A 1CPXA 1RXTA 2BCOA 2Q4YA 3GLJA 3KQZA 4OC0A 4F6AA 2XEIA 4A2ZA 4F0XA 2GIVA 1NSLA 1ZG7A 4R3LA 2BUEA 4MY0A 2Z3OA 4NSQA 4R8FA 3QB8A 1Q7LA 2HC9A 3DLJA 4IAVA 3NH4A 4II9A 4B11A 1Y7RA 3JRUA 4L8AA 4R6TA 4F0YA 3SJFA 1XBUA 1Z4RA 3SI0A 1IICA 4OKOA 2DPTA 1OZPA 4LUAA 1YLEA 1ON0A 5F09A 1FNOA 1Z8LA 4KOWA 5AG6A 1YK3A 2FIAA 3KI9A 1QSRA 5HXDA 1HEEA 2BSWA 3D2PA 2B5GB 1WK4A 5F49A 2ARHA 4NF1A 3TCVA 4NFRA 1YX0A 4NGPA 3VARA 1ARLA 4U5YA 2ZEHA 4LX9A 4P10A 1YSJA 2F8HA 4CYNA 2CTBA 5A28A 4XPDC 4C68A 2ZW6A 1XFOA 2JBKA 5AGEA 2PR8A 3SI2A 4EWTA 2Z3MA 2ZW7A 4JJXA 2NSMA 4P6YA 4Q38A 5EMIA 1Y0RA 4F9VA 2O53A 4JYWA 3NH5A 3FX6A 4UCNA 4PK2A 2RB7A 3PFEA 1BPNA 5IB0A 4FD5A 2FSRA 1S7KA 4KSIA 2V8VA 3EO4A 3HLPA 4MHPA 2Q04A 2O28A 2VZYA 3DDDA 2BOAA 4CAVA 3FXTA 5H84A 2V77A 4WJBA 3TFYA 2ABZA 2XEFA 3TOBA 4EVYA 3FVLA 4KUAA 1FT7A 3CXSA 1SQHA 1LAMA 4O23A 2K5TA 2G9DA 3EXNA 4X3RA 4WWVA 2AFWA 3DNSA 3PB9X 1M1DA 2PDOA 5K8MA 4XNHB 4KS9A 3BI1A 2ZEEA 3PFOA 3I3GA 1ZLHA 3K2KA 3B7IA 4HNYB 4KZTA 4UFXA 1BPMA 4CGNA 1CG2A 3GYAA 1XJOA 1YW6A 2PSWA 2J8MA 3DR6A 2HUZA 3W6SA 3EY5A 3GIUA 1Q2DA 4C7IA 1YGHA 1YMEA 1XE4A 4M85A 4OMEA 4B10A 4BINA 4XPLA 4FD6A 2Q4VA 3I1UA 3QAYA 2WYRA 4YFJA 4FWUA 1RTQA 1Z8XA 4FUUA 4UIBA 3WC7A 2C6PA 1DTDA 1QSTA 2Y0MA 3OWCA 4ZX8A 3T90A 4BMHA 4UFWA 2VI7A 4TWEA 1M44A 2JEWA 4KOSA 1CM0A 2OZHA 1QSNA 3DR8A 2HB6A 4IUSA 3R9EA 1X12A 3B3SA 2P6EA 4GS4A 3V8IA 4CGMA 4FD4A 4A30A 2Z3KA 4FD7A 3B3CA 4CYQA 4ORFA 1BO4A 2Z0ZA 2VBQA 4MCQA 2AFSA 3F0AA 1CX8A 2FL4A 4AVAA 2CNTA 4B5PA 5LYIA 3PBBA 3S9NA 2JLMA 1I12A 3B3WA 2CIJA 4GXHA 1PUAA 4UWJA 4RS2A 4J3GA 5ELYA 1H8LA 3D67A 2JEVA 3JVNA 5IX3A 4QVTA 5DWMA 1F2PA 5FVJA 4YWYA 1J4JA 3DGVA 5G20A 2DPSA 3WABA 4CGPA 5BWAB 5LYFA 3FEDA 4M3SA 1ARMA 2ZOFA 4YGOA 4PSXA 2I00A 1VHOA 4KOTA 2CTCA 2JDDA 3S6GA 2EK8A 2P0WA 3UY5A 1QSOA 3D2MA 1B87A 4OADA 4A95A 4B5PB 4A39A 3WR7A 3FF3A 1AUGA 1XIXA 2PIYA 3GKRA 4JZ0A 1Q2YA 3LACA 2VQYA 1LANA 1PYTB 1X10A 2ATRA 4UEZA 4FAIA 5G22A 1QMUA 2F5IA 4MHYA 1R3NA 3PP9A 2AE6A 1VKCA 3R95A 3RO0A 1VIXA 3S6HA 3CXQA 2PJ9A 3ZZIA 3BJ8A 3V7ZA 4MXUA 1NMTA 3FEEA 5JPHA 3CZXA 3ISXA 1KUVA 4CAFA 3FB3A 2JBJA 2ZPAA 4CYOA 4OAEA 4OC3A 1LRZA 1CPSA 1XRYA 2Z3PA 4ZYQA 1I21A 2IMOA 3K9UA 5G21A 2GLFA 3RAMA 1S7LA 3NH8A 4LQGA 4NJRA 1XEBA 1IOIA 1Q2CA 1TKHA 4U9ZA 2PE3A 3TO6A 4JLYA 2YNCC 1M4GA 2AFZA 4A31A 4KVOE 4PK3A 3L2NA 2WPWA 3GB0A 4MHZA 2V8DA 4W9YA 4M6IA 4CYPA 4CS0B 1YQEA 3F5BA 5KTDA 4KSAA 4A33A 4TNUA 2R1IA 4GM5A 4F9UA 4QBJA 1VGYA 3FJUA 1P4NA 3FRMA 4JXQA 4OC4A 2B3VA 2EK9A 3B8GA 4HKFA 3SJEA 1HDQA 5AG5A 1BAVA 4JXRA 1YVOA 4DJLA 2B4BA 4K30A 3EC4A 4CPAA 2YNDA 4NGQA 4NGNA 5IB9A 4U9YA 3WT4A 4JWPA 1JWQA 1Y9WA 5F47A 2OR4A 3D4UA 1MJAA 1QQ9A 3KR5A 1KZFA 4MJ8A 4M6HA 2ODFA 3PB7X 4Y49C 1K4JA 3E0KA 3VH9A 2ZEFA 4NGSA 3FBUA 5JGFA 4X5KA 1TF9A 2WSAA 1S60A 2OB0A 5IV0A 3NE7A 2P6GA 2A4NA 2ZEGA 4P4DA 4B12A 5CBMA 2PJ2A 2WZNA 4R87A 5D8NA 5EC4A 4FBEA 4RUHA 1QSMA 5E96A 3RBUA 3TT2A 3TTHA 2PJCA 4KOUA 2OZGA 2VXKA 5HVFA 4CAXA 5JQ4A 2PJ5A 3WC6A 1AYEA 2DEAA 2FS5A 2PJ4A 5F46A 3PB6X 2Q7SA 1AMPA 1S3ZA 4F8ZA 1MJBA 3N7ZA 1IB1E 3GY9A 1CJWA 5F48A 1M4DA 2FIWA 1TKFA 2GREA 4HNWB 3KL9A 3IWEA 2GLJA 4CAWA 3D3SA 4ZY1A 3D7GA 3PZJA 3NE8A 3RNZA 3I9SA 4YU9A 2QYVA 2ZEMA 4B6ZA 2I3CA 2WUUA 1V0CA 4MFLA 3SI1A 3FIXA 1CBXA 3KQXA 4PXBA 5AG7A 3BI0A 4ZY2A 4E2AA 4ZGYB 3IFEA 4EFDA 5HH1A 3D68A 4NCZA 3N5FA 4P4EA 4KOXA 1GYTA 2G3AA 2I79A 3P2FA 4MCPA 1F57A 3BHXA 3S6KA 2ANPA 3H8GA 4ONWA 2AFMA 1ZG8A 2ZELA 4P4FA 2Q44A 4UA3A 3PGPA 4UCMA 4UWIA 4CGOA 2Q51A 1LAPA 1N71A 4UIAA 3RZAA 8CPAA 3NA6A 2NYQA 2Q43A 3R96A 4XPDB 2RFHA 3IEHA 4PPZA 2GU2A 4C2YA 1LOKA 2NMTA 4MY3A 4P45A 2CXAA 3FMCA 3GUXA 2PJAA 4PXDA 2ZOGA 4NXYA 4Y49B 2CNMA 3JTKA 2ZW4A 4MHNA 3IGRA 4R57A 4A32A 1TKJA 1A2ZA 2PJ6A 5AG4A 2Z3LA 3LODA 4LQ6A 1OBRA 2AFXA 4B5OA 4DUKA 4P4BA 5C88A 4ZX9A 5LYDA 1IIDA 5JH9A 5LRKA 4OC1A 4MFKA 3DSBA 4R76A 2EUIA 2EBJA 4ZBGA 4BD9A 1IYKA 3B35A 2D4PA 5J8FA 2PJ8A 1XMTA 2GFQA 4KORA 5LRGA 2G3TA 2YGWA 4CRZB 4M6GA 2GE3A 4AG9A 1FY7A 1VHEA 2REFA 2IQ6A 5HVGA 1Y7EA 1LFWA 1Z8WA 3H5ZA 1NSAA 3IO1A 5K8OA 3PBEA 4OP4A 1M4IA 2PJ7A 4EMEA 3S9MA 4MCSA 3KR4A 3WC5A 2BEIA 2C6CA 4G1PA 4MFPA 4X2TA 3MN8A 4HPSA 4C2XA 1VHSA 2PIZA 3FNCA 2C27A 3IWWA 3KHZA 3PEIA 3S6FA 3P2HA 4MI4A 1PCAA 3K9TA 3PB4X 4ONUA 4E0AA 1IYLA 4NEXA 2EWBA 4OLLA 1NE9A 2YNEA 4MFQA 4P44A 5C82A 3R1KA 3F8KA 4H6ZA 4OC5A 4DYOA 2V8GA 2FE7A 2BO9A 4UEEA 3CT9A 4NGTA 4B14A 2EVNA 4RI1A 2FCKA 2PR1A 1KUXA 2QIRA 2OH1A 2ZEPA 4MFZA 5K8NA 3KHXA 2IJZA 2PC1A 4R7MA 2DXQA 2PJBA 5CNPA 6CPAA 2J8NA 2C1CA 2PJ0A 2BL1A 3SHPA 4Z65A 3JUWA 2PVVA 3TO7A 4P4JA 4MRIA 1XF8A 4C2ZA 5THWA 1Z4EA 3B3VA 3EFAA 3PB8X 4OIDA 1Z8TA 4CGLA 4NGMA 3TC8A 2ZEDA 2B5GA 3CDXA 3T8WA 1BOBA 1ZLIA 1CP7A 3NFZA 5J1QA 4XNHC 5DWNA 2CF4A 4UEFA 4MMOA 4UFVA 4UBRA 3H4QA 2AJ6A 1Y0YA 4YRHA 3VWDA 5JM6A 1S7FA 2Q7BA 2P6FA 1S5KA 3W91A 4AB7A 3VWEA 5GCNA 2PRBA 4RN7A 3D66A 1LCPA 4X8IA 3CPAA 2QMLA 1I1DA 1TXRA 3TX8A 4OC2A 2B3UA 1YR0A 3BXMA 2YNCA 4E8OA 1XMBA 4KLWA 3KZWA 5LYLA 3B3TA 4ZY0A 2VZZA 5HMNA 2ZEOA 1IU8A 2HV2A 2O4HA 1U6MA 1TF8A 2QVPA 1B6BA 1XOVA 1Z2LA 3R9GA 2D4OA 1F2OA 3C26A 1KWMA 3A9LA 3G3SA 4R9MA 2X7BA 3FH4A 4AVCA 1EE3P 2B58A 3T9YA 2REEA 4BBHA 1ELLP 3SJGA 2ZXVA 3CPXA 3H8FA 4NGRA 5KTCA 1YREA 3MGDA 4KSFA 5A27A 2B4DA 2WPXA 4MCRA 3VATA 1Y9KA 4A94A 4KLVA 2AFUA 4KOVA 4QC6A 4A37A 2PRQA 1IGBA 3SJXA 3FECA 2H5MA 3D8PA 1R43A 2XEGA 3IWGA 1DE4C 3KGQA 2G0BA 2JDCA 2PVWA 2IL4A 4IF5A 1L0CA 3RYOA 2XEJA 3HUVA 3ZJ0A 3LWUA 1IOFA 2Z11A 1S7NA 4IK2A 3TO9A 1BLLE 2PQ8A 4JD6A 3IU2A 2FT0A 4UF4A 2DF5A 4NJQA 3R9FA 2B4DB 3BLNA 2Z10A 4K3NA 1ZG9A 2CNSA
chains in the Genus database with same CATH topology
3IJ3A 1IY7A 2PJ3A 4P4IA 1YW4A 3IIBA 5I4MA 2OOTA 4Q7AA 5DS0A 2POKA 3V38A 3H8EA 1HDUA 3LMSA 2F7VA 4PXCA 1YLOA 2AFOA 7CPAA 3IC1A 1JQGA 5LRJA 2PJ1A 1UWYA 2PCUA 4PQAA 5D29A 4AXVA 3MRUA 4OIWA 1ELMP 5CPAA 3KASA 4PXEA 1CP6A 2V8HA 2J9AA 5K8PA 4A38A 3D7HA 2QJ8A 3ISZA 2Q4ZA 2C6GA 3D7DA 4H2KA 2ZENA 3D7FA 3S9LA 3B2YA 1Z5RA 3PRTA 3QNVA 5HVHA 4IHMA 4ZI6A 2FVGA 1M4LA 2VL1A 1CPXA 2BCOA 3GLJA 3KQZA 4OC0A 2XEIA 1ZG7A 4R8FA 1Q7LA 2HC9A 3DLJA 4IAVA 3NH4A 3JRUA 4R6TA 3SJFA 1XBUA 3SI0A 4OKOA 5F09A 1FNOA 1Z8LA 3KI9A 5HXDA 1HEEA 4NFRA 4NGPA 3VARA 1ARLA 2ZEHA 4P10A 1YSJA 2F8HA 2CTBA 1XFOA 2JBKA 3SI2A 4EWTA 4P6YA 2NSMA 1Y0RA 4F9VA 2O53A 4JYWA 3NH5A 3FX6A 2RB7A 3PFEA 1BPNA 4KSIA 2V8VA 3HLPA 4MHPA 2BOAA 2V77A 4WJBA 2ABZA 2XEFA 3FVLA 1FT7A 1LAMA 4O23A 2G9DA 4X3RA 4WWVA 2AFWA 3PB9X 5K8MA 3BI1A 2ZEEA 3PFOA 3K2KA 1ZLHA 3B7IA 1BPMA 1CG2A 1XJOA 1YW6A 1YMEA 4OMEA 3I1UA 2WYRA 4FWUA 1RTQA 4UIBA 4FUUA 3WC7A 2C6PA 1DTDA 4ZX8A 4TWEA 2JEWA 2HB6A 3B3SA 3B3CA 4MCQA 2AFSA 1CX8A 3S9NA 5LYIA 3PBBA 3B3WA 2CIJA 5ELYA 1H8LA 3D67A 1F2PA 4YWYA 3DGVA 3WABA 5LYFA 3FEDA 1ARMA 2ZOFA 1VHOA 2CTCA 2EK8A 4A39A 3FF3A 2PIYA 4JZ0A 1LANA 1PYTB 4UEZA 4FAIA 1QMUA 4MHYA 1R3NA 1VIXA 2PJ9A 3V7ZA 4MXUA 3FEEA 3ISXA 2JBJA 4OC3A 1CPSA 1XRYA 4ZYQA 2IMOA 3RAMA 2GLFA 3NH8A 4LQGA 4NJRA 1TKHA 2PE3A 2AFZA 3L2NA 3GB0A 4MHZA 2V8DA 4W9YA 4TNUA 4GM5A 4F9UA 1VGYA 3FJUA 4OC4A 2EK9A 3SJEA 1HDQA 1BAVA 4DJLA 4CPAA 4NGQA 4NGNA 5IB9A 3WT4A 2OR4A 3D4UA 1QQ9A 3KR5A 3VH9A 3PB7X 2ZEFA 4NGSA 5JGFA 1TF9A 4P4DA 2ZEGA 5CBMA 2PJ2A 2WZNA 5D8NA 4FBEA 4RUHA 3RBUA 2PJCA 5HVFA 2PJ5A 3WC6A 1AYEA 2DEAA 2PJ4A 3PB6X 1AMPA 4F8ZA 1TKFA 2GREA 3KL9A 2GLJA 4ZY1A 3D7GA 4B6ZA 4YU9A 2QYVA 2ZEMA 2I3CA 3SI1A 1CBXA 3KQXA 4PXBA 4ZY2A 3BI0A 3IFEA 4EFDA 3D68A 3N5FA 4P4EA 1GYTA 4MCPA 1F57A 3BHXA 2ANPA 3H8GA 4ONWA 2AFMA 1ZG8A 2ZELA 4P4FA 2Q51A 1LAPA 4UIAA 3RZAA 8CPAA 3NA6A 2NYQA 2Q43A 2RFHA 3IEHA 4PPZA 2GU2A 1LOKA 4P45A 3FMCA 3GUXA 2PJAA 4PXDA 2ZOGA 4MHNA 1TKJA 2PJ6A 1OBRA 2AFXA 4DUKA 4P4BA 4ZX9A 5LYDA 5JH9A 5LRKA 4OC1A 4R76A 4BD9A 3B35A 2PJ8A 5LRGA 5HVGA 1VHEA 2IQ6A 1Y7EA 1LFWA 1NSAA 3IO1A 5K8OA 3PBEA 4OP4A 2PJ7A 4EMEA 3S9MA 4MCSA 3KR4A 3WC5A 2C6CA 4X2TA 4G1PA 3MN8A 2PIZA 3IWWA 3KHZA 3PEIA 1PCAA 3K9TA 3PB4X 2EWBA 4P44A 4OC5A 4DYOA 2V8GA 2BO9A 4UEEA 3CT9A 4NGTA 2ZEPA 5K8NA 3KHXA 2IJZA 4R7MA 2PJBA 6CPAA 2C1CA 2PJ0A 4Z65A 2PVVA 4P4JA 4MRIA 5THWA 3B3VA 3PB8X 4OIDA 4NGMA 3TC8A 2ZEDA 3CDXA 3T8WA 1ZLIA 1CP7A 3NFZA 5J1QA 2CF4A 4UEFA 4MMOA 1Y0YA 5JM6A 3D66A 1LCPA 4X8IA 3CPAA 1TXRA 3TX8A 4OC2A 3BXMA 1XMBA 3KZWA 5LYLA 3B3TA 4ZY0A 2ZEOA 2O4HA 2QVPA 1TF8A 1Z2LA 1F2OA 1KWMA 3FH4A 1EE3P 1ELLP 3SJGA 3CPXA 3H8FA 4NGRA 4MCRA 3VATA 4A94A 2AFUA 4A37A 2PRQA 1IGBA 3SJXA 3FECA 1R43A 2XEGA 1DE4C 3KGQA 2PVWA 2XEJA 3HUVA 3LWUA 4IK2A 1BLLE 4UF4A 4NJQA 4K3NA 1ZG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ3 A;  1IY7 A;  2PJ3 A;  4P4I A;  1YW4 A;  3IIB A;  5I4M A;  2OOT A;  4Q7A A;  5DS0 A;  2POK A;  3V38 A;  3H8E A;  1HDU A;  3LMS A;  2F7V A;  4PXC A;  1YLO A;  2AFO A;  7CPA A;  3IC1 A;  1JQG A;  5LRJ A;  2PJ1 A;  1UWY A;  2PCU A;  4PQA A;  5D29 A;  4AXV A;  3MRU A;  4OIW A;  1ELM P;  5CPA A;  3KAS A;  4PXE A;  1CP6 A;  2V8H A;  2J9A A;  5K8P A;  4A38 A;  3D7H A;  2QJ8 A;  3ISZ A;  2Q4Z A;  2C6G A;  3D7D A;  4H2K A;  2ZEN A;  3D7F A;  3S9L A;  3B2Y A;  1Z5R A;  3PRT A;  3QNV A;  5HVH A;  4IHM A;  4ZI6 A;  2FVG A;  1M4L A;  2VL1 A;  1CPX A;  2BCO A;  3GLJ A;  3KQZ A;  4OC0 A;  2XEI A;  1ZG7 A;  4R8F A;  1Q7L A;  2HC9 A;  3DLJ A;  4IAV A;  3NH4 A;  3JRU A;  4R6T A;  3SJF A;  1XBU A;  3SI0 A;  4OKO A;  5F09 A;  1FNO A;  1Z8L A;  3KI9 A;  5HXD A;  1HEE A;  4NFR A;  4NGP A;  3VAR A;  1ARL A;  2ZEH A;  4P10 A;  1YSJ A;  2F8H A;  2CTB A;  1XFO A;  2JBK A;  3SI2 A;  4EWT A;  4P6Y A;  2NSM A;  1Y0R A;  4F9V A;  2O53 A;  4JYW A;  3NH5 A;  3FX6 A;  2RB7 A;  3PFE A;  1BPN A;  4KSI A;  2V8V A;  3HLP A;  4MHP A;  2BOA A;  2V77 A;  4WJB A;  2ABZ A;  2XEF A;  3FVL A;  1FT7 A;  1LAM A;  4O23 A;  2G9D A;  4X3R A;  4WWV A;  2AFW A;  3PB9 X;  5K8M A;  3BI1 A;  2ZEE A;  3PFO A;  3K2K A;  1ZLH A;  3B7I A;  1BPM A;  1CG2 A;  1XJO A;  1YW6 A;  1YME A;  4OME A;  3I1U A;  2WYR A;  4FWU A;  1RTQ A;  4UIB A;  4FUU A;  3WC7 A;  2C6P A;  1DTD A;  4ZX8 A;  4TWE A;  2JEW A;  2HB6 A;  3B3S A;  3B3C A;  4MCQ A;  2AFS A;  1CX8 A;  3S9N A;  5LYI A;  3PBB A;  3B3W A;  2CIJ A;  5ELY A;  1H8L A;  3D67 A;  1F2P A;  4YWY A;  3DGV A;  3WAB A;  5LYF A;  3FED A;  1ARM A;  2ZOF A;  1VHO A;  2CTC A;  2EK8 A;  4A39 A;  3FF3 A;  2PIY A;  4JZ0 A;  1LAN A;  1PYT B;  4UEZ A;  4FAI A;  1QMU A;  4MHY A;  1R3N A;  1VIX A;  2PJ9 A;  3V7Z A;  4MXU A;  3FEE A;  3ISX A;  2JBJ A;  4OC3 A;  1CPS A;  1XRY A;  4ZYQ A;  2IMO A;  3RAM A;  2GLF A;  3NH8 A;  4LQG A;  4NJR A;  1TKH A;  2PE3 A;  2AFZ A;  3L2N A;  3GB0 A;  4MHZ A;  2V8D A;  4W9Y A;  4TNU A;  4GM5 A;  4F9U A;  1VGY A;  3FJU A;  4OC4 A;  2EK9 A;  3SJE A;  1HDQ A;  1BAV A;  4DJL A;  4CPA A;  4NGQ A;  4NGN A;  5IB9 A;  3WT4 A;  2OR4 A;  3D4U A;  1QQ9 A;  3KR5 A;  3VH9 A;  3PB7 X;  2ZEF A;  4NGS A;  5JGF A;  1TF9 A;  4P4D A;  2ZEG A;  5CBM A;  2PJ2 A;  2WZN A;  5D8N A;  4FBE A;  4RUH A;  3RBU A;  2PJC A;  5HVF A;  2PJ5 A;  3WC6 A;  1AYE A;  2DEA A;  2PJ4 A;  3PB6 X;  1AMP A;  4F8Z A;  1TKF A;  2GRE A;  3KL9 A;  2GLJ A;  4ZY1 A;  3D7G A;  4B6Z A;  4YU9 A;  2QYV A;  2ZEM A;  2I3C A;  3SI1 A;  1CBX A;  3KQX A;  4PXB A;  4ZY2 A;  3BI0 A;  3IFE A;  4EFD A;  3D68 A;  3N5F A;  4P4E A;  1GYT A;  4MCP A;  1F57 A;  3BHX A;  2ANP A;  3H8G A;  4ONW A;  2AFM A;  1ZG8 A;  2ZEL A;  4P4F A;  2Q51 A;  1LAP A;  4UIA A;  3RZA A;  8CPA A;  3NA6 A;  2NYQ A;  2Q43 A;  2RFH A;  3IEH A;  4PPZ A;  2GU2 A;  1LOK A;  4P45 A;  3FMC A;  3GUX A;  2PJA A;  4PXD A;  2ZOG A;  4MHN A;  1TKJ A;  2PJ6 A;  1OBR A;  2AFX A;  4DUK A;  4P4B A;  4ZX9 A;  5LYD A;  5JH9 A;  5LRK A;  4OC1 A;  4R76 A;  4BD9 A;  3B35 A;  2PJ8 A;  5LRG A;  5HVG A;  1VHE A;  2IQ6 A;  1Y7E A;  1LFW A;  1NSA A;  3IO1 A;  5K8O A;  3PBE A;  4OP4 A;  2PJ7 A;  4EME A;  3S9M A;  4MCS A;  3KR4 A;  3WC5 A;  2C6C A;  4X2T A;  4G1P A;  3MN8 A;  2PIZ A;  3IWW A;  3KHZ A;  3PEI A;  1PCA A;  3K9T A;  3PB4 X;  2EWB A;  4P44 A;  4OC5 A;  4DYO A;  2V8G A;  2BO9 A;  4UEE A;  3CT9 A;  4NGT A;  2ZEP A;  5K8N A;  3KHX A;  2IJZ A;  4R7M A;  2PJB A;  6CPA A;  2C1C A;  2PJ0 A;  4Z65 A;  2PVV A;  4P4J A;  4MRI A;  5THW A;  3B3V A;  3PB8 X;  4OID A;  4NGM A;  3TC8 A;  2ZED A;  3CDX A;  3T8W A;  1ZLI A;  1CP7 A;  3NFZ A;  5J1Q A;  2CF4 A;  4UEF A;  4MMO A;  1Y0Y A;  5JM6 A;  3D66 A;  1LCP A;  4X8I A;  3CPA A;  1TXR A;  3TX8 A;  4OC2 A;  3BXM A;  1XMB A;  3KZW A;  5LYL A;  3B3T A;  4ZY0 A;  2ZEO A;  2O4H A;  2QVP A;  1TF8 A;  1Z2L A;  1F2O A;  1KWM A;  3FH4 A;  1EE3 P;  1ELL P;  3SJG A;  3CPX A;  3H8F A;  4NGR A;  4MCR A;  3VAT A;  4A94 A;  2AFU A;  4A37 A;  2PRQ A;  1IGB A;  3SJX A;  3FEC A;  1R43 A;  2XEG A;  1DE4 C;  3KGQ A;  2PVW A;  2XEJ A;  3HUV A;  3LWU A;  4IK2 A;  1BLL E;  4UF4 A;  4NJQ A;  4K3N A;  1ZG9 A; 
#chains in the Genus database with same CATH topology
 4MFJ A;  4L89 A;  5G1Z A;  3IJ3 A;  1IY7 A;  2PJ3 A;  4P4I A;  1YW4 A;  3IIB A;  4CAE A;  5I4M A;  1YVK A;  4QB9 A;  2OOT A;  1TIQ A;  4CRY B;  4I49 A;  4Q7A A;  5DS0 A;  2POK A;  3V38 A;  2OU2 A;  3IU1 A;  3H8E A;  2R8V A;  3BJ7 A;  1HDU A;  3LMS A;  2KCW A;  2ZW5 A;  2F7V A;  2GAN A;  4PV6 A;  4PXC A;  4KVX A;  1YLO A;  2AFO A;  7CPA A;  3IC1 A;  1JQG A;  2FXF A;  3LD2 A;  5LRJ A;  4R3K A;  2PJ1 A;  1UWY A;  2PCU A;  4PQA A;  4DNC A;  5D29 A;  4HNX B;  5EBV A;  4AXV A;  2R98 A;  3MRU A;  2CY2 A;  5H86 A;  4QUS A;  4OIW A;  1KUY A;  1ELM P;  5CPA A;  3KAS A;  4PXE A;  1CP6 A;  2V8H A;  2J9A A;  2OZU A;  2RC4 A;  3FYN A;  4MHD A;  1UFH A;  5K8P A;  4A38 A;  1WWZ A;  3SXN A;  1R57 A;  4MBU A;  1ZO0 A;  3D7H A;  2QJ8 A;  3ISZ A;  4AG7 A;  2Q4Z A;  4KVM E;  5I0C A;  4H89 A;  2Z3N A;  3TE4 A;  2C6G A;  4B13 A;  3D7D A;  4PSW A;  3QAH A;  4KUB A;  4UCP A;  1RO5 A;  1GHE A;  4H2K A;  2QEC A;  4KOY A;  4Q36 A;  2ZEN A;  3D7F A;  4XPK A;  3S9L A;  3B2Y A;  4C7H A;  1PU9 A;  1Z5R A;  1MK4 A;  3KKW A;  3PRT A;  2R7H A;  3TOA A;  2HQY A;  2Q0Y A;  3W6X A;  3QNV A;  1Z9U A;  3SXO A;  4AVB A;  1MJ9 A;  5HVH A;  2J8R A;  4IHM A;  4ZI6 A;  5J8C A;  5KTA A;  5ISV A;  2VEZ A;  3CXP A;  1P0H A;  2FVG A;  4H6U A;  3G8W A;  1M4L A;  2EO8 A;  2VL1 A;  1CPX A;  1RXT A;  2BCO A;  2Q4Y A;  3GLJ A;  3KQZ A;  4OC0 A;  4F6A A;  2XEI A;  4A2Z A;  4F0X A;  2GIV A;  1NSL A;  1ZG7 A;  4R3L A;  2BUE A;  4MY0 A;  2Z3O A;  4NSQ A;  4R8F A;  3QB8 A;  1Q7L A;  2HC9 A;  3DLJ A;  4IAV A;  3NH4 A;  4II9 A;  4B11 A;  1Y7R A;  3JRU A;  4L8A A;  4R6T A;  4F0Y A;  3SJF A;  1XBU A;  1Z4R A;  3SI0 A;  1IIC A;  4OKO A;  2DPT A;  1OZP A;  4LUA A;  1YLE A;  1ON0 A;  5F09 A;  1FNO A;  1Z8L A;  4KOW A;  5AG6 A;  1YK3 A;  2FIA A;  3KI9 A;  1QSR A;  5HXD A;  1HEE A;  2BSW A;  3D2P A;  2B5G B;  1WK4 A;  5F49 A;  2ARH A;  4NF1 A;  3TCV A;  4NFR A;  1YX0 A;  4NGP A;  3VAR A;  1ARL A;  4U5Y A;  2ZEH A;  4LX9 A;  4P10 A;  1YSJ A;  2F8H A;  4CYN A;  2CTB A;  5A28 A;  4XPD C;  4C68 A;  2ZW6 A;  1XFO A;  2JBK A;  5AGE A;  2PR8 A;  3SI2 A;  4EWT A;  2Z3M A;  2ZW7 A;  4JJX A;  2NSM A;  4P6Y A;  4Q38 A;  5EMI A;  1Y0R A;  4F9V A;  2O53 A;  4JYW A;  3NH5 A;  3FX6 A;  4UCN A;  4PK2 A;  2RB7 A;  3PFE A;  1BPN A;  5IB0 A;  4FD5 A;  2FSR A;  1S7K A;  4KSI A;  2V8V A;  3EO4 A;  3HLP A;  4MHP A;  2Q04 A;  2O28 A;  2VZY A;  3DDD A;  2BOA A;  4CAV A;  3FXT A;  5H84 A;  2V77 A;  4WJB A;  3TFY A;  2ABZ A;  2XEF A;  3TOB A;  4EVY A;  3FVL A;  4KUA A;  1FT7 A;  3CXS A;  1SQH A;  1LAM A;  4O23 A;  2K5T A;  2G9D A;  3EXN A;  4X3R A;  4WWV A;  2AFW A;  3DNS A;  3PB9 X;  1M1D A;  2PDO A;  5K8M A;  4XNH B;  4KS9 A;  3BI1 A;  2ZEE A;  3PFO A;  3I3G A;  1ZLH A;  3K2K A;  3B7I A;  4HNY B;  4KZT A;  4UFX A;  1BPM A;  4CGN A;  1CG2 A;  3GYA A;  1XJO A;  1YW6 A;  2PSW A;  2J8M A;  3DR6 A;  2HUZ A;  3W6S A;  3EY5 A;  3GIU A;  1Q2D A;  4C7I A;  1YGH A;  1YME A;  1XE4 A;  4M85 A;  4OME A;  4B10 A;  4BIN A;  4XPL A;  4FD6 A;  2Q4V A;  3I1U A;  3QAY A;  2WYR A;  4YFJ A;  4FWU A;  1RTQ A;  1Z8X A;  4FUU A;  4UIB A;  3WC7 A;  2C6P A;  1DTD A;  1QST A;  2Y0M A;  3OWC A;  4ZX8 A;  3T90 A;  4BMH A;  4UFW A;  2VI7 A;  4TWE A;  1M44 A;  2JEW A;  4KOS A;  1CM0 A;  2OZH A;  1QSN A;  3DR8 A;  2HB6 A;  4IUS A;  3R9E A;  1X12 A;  3B3S A;  2P6E A;  4GS4 A;  3V8I A;  4CGM A;  4FD4 A;  4A30 A;  2Z3K A;  4FD7 A;  3B3C A;  4CYQ A;  4ORF A;  1BO4 A;  2Z0Z A;  2VBQ A;  4MCQ A;  2AFS A;  3F0A A;  1CX8 A;  2FL4 A;  4AVA A;  2CNT A;  4B5P A;  5LYI A;  3PBB A;  3S9N A;  2JLM A;  1I12 A;  3B3W A;  2CIJ A;  4GXH A;  1PUA A;  4UWJ A;  4RS2 A;  4J3G A;  5ELY A;  1H8L A;  3D67 A;  2JEV A;  3JVN A;  5IX3 A;  4QVT A;  5DWM A;  1F2P A;  5FVJ A;  4YWY A;  1J4J A;  3DGV A;  5G20 A;  2DPS A;  3WAB A;  4CGP A;  5BWA B;  5LYF A;  3FED A;  4M3S A;  1ARM A;  2ZOF A;  4YGO A;  4PSX A;  2I00 A;  1VHO A;  4KOT A;  2CTC A;  2JDD A;  3S6G A;  2EK8 A;  2P0W A;  3UY5 A;  1QSO A;  3D2M A;  1B87 A;  4OAD A;  4A95 A;  4B5P B;  4A39 A;  3WR7 A;  3FF3 A;  1AUG A;  1XIX A;  2PIY A;  3GKR A;  4JZ0 A;  1Q2Y A;  3LAC A;  2VQY A;  1LAN A;  1PYT B;  1X10 A;  2ATR A;  4UEZ A;  4FAI A;  5G22 A;  1QMU A;  2F5I A;  4MHY A;  1R3N A;  3PP9 A;  2AE6 A;  1VKC A;  3R95 A;  3RO0 A;  1VIX A;  3S6H A;  3CXQ A;  2PJ9 A;  3ZZI A;  3BJ8 A;  3V7Z A;  4MXU A;  1NMT A;  3FEE A;  5JPH A;  3CZX A;  3ISX A;  1KUV A;  4CAF A;  3FB3 A;  2JBJ A;  2ZPA A;  4CYO A;  4OAE A;  4OC3 A;  1LRZ A;  1CPS A;  1XRY A;  2Z3P A;  4ZYQ A;  1I21 A;  2IMO A;  3K9U A;  5G21 A;  2GLF A;  3RAM A;  1S7L A;  3NH8 A;  4LQG A;  4NJR A;  1XEB A;  1IOI A;  1Q2C A;  1TKH A;  4U9Z A;  2PE3 A;  3TO6 A;  4JLY A;  2YNC C;  1M4G A;  2AFZ A;  4A31 A;  4KVO E;  4PK3 A;  3L2N A;  2WPW A;  3GB0 A;  4MHZ A;  2V8D A;  4W9Y A;  4M6I A;  4CYP A;  4CS0 B;  1YQE A;  3F5B A;  5KTD A;  4KSA A;  4A33 A;  4TNU A;  2R1I A;  4GM5 A;  4F9U A;  4QBJ A;  1VGY A;  3FJU A;  1P4N A;  3FRM A;  4JXQ A;  4OC4 A;  2B3V A;  2EK9 A;  3B8G A;  4HKF A;  3SJE A;  1HDQ A;  5AG5 A;  1BAV A;  4JXR A;  1YVO A;  4DJL A;  2B4B A;  4K30 A;  3EC4 A;  4CPA A;  2YND A;  4NGQ A;  4NGN A;  5IB9 A;  4U9Y A;  3WT4 A;  4JWP A;  1JWQ A;  1Y9W A;  5F47 A;  2OR4 A;  3D4U A;  1MJA A;  1QQ9 A;  3KR5 A;  1KZF A;  4MJ8 A;  4M6H A;  2ODF A;  3PB7 X;  4Y49 C;  1K4J A;  3E0K A;  3VH9 A;  2ZEF A;  4NGS A;  3FBU A;  5JGF A;  4X5K A;  1TF9 A;  2WSA A;  1S60 A;  2OB0 A;  5IV0 A;  3NE7 A;  2P6G A;  2A4N A;  2ZEG A;  4P4D A;  4B12 A;  5CBM A;  2PJ2 A;  2WZN A;  4R87 A;  5D8N A;  5EC4 A;  4FBE A;  4RUH A;  1QSM A;  5E96 A;  3RBU A;  3TT2 A;  3TTH A;  2PJC A;  4KOU A;  2OZG A;  2VXK A;  5HVF A;  4CAX A;  5JQ4 A;  2PJ5 A;  3WC6 A;  1AYE A;  2DEA A;  2FS5 A;  2PJ4 A;  5F46 A;  3PB6 X;  2Q7S A;  1AMP A;  1S3Z A;  4F8Z A;  1MJB A;  3N7Z A;  1IB1 E;  3GY9 A;  1CJW A;  5F48 A;  1M4D A;  2FIW A;  1TKF A;  2GRE A;  4HNW B;  3KL9 A;  3IWE A;  2GLJ A;  4CAW A;  3D3S A;  4ZY1 A;  3D7G A;  3PZJ A;  3NE8 A;  3RNZ A;  3I9S A;  4YU9 A;  2QYV A;  2ZEM A;  4B6Z A;  2I3C A;  2WUU A;  1V0C A;  4MFL A;  3SI1 A;  3FIX A;  1CBX A;  3KQX A;  4PXB A;  5AG7 A;  3BI0 A;  4ZY2 A;  4E2A A;  4ZGY B;  3IFE A;  4EFD A;  5HH1 A;  3D68 A;  4NCZ A;  3N5F A;  4P4E A;  4KOX A;  1GYT A;  2G3A A;  2I79 A;  3P2F A;  4MCP A;  1F57 A;  3BHX A;  3S6K A;  2ANP A;  3H8G A;  4ONW A;  2AFM A;  1ZG8 A;  2ZEL A;  4P4F A;  2Q44 A;  4UA3 A;  3PGP A;  4UCM A;  4UWI A;  4CGO A;  2Q51 A;  1LAP A;  1N71 A;  4UIA A;  3RZA A;  8CPA A;  3NA6 A;  2NYQ A;  2Q43 A;  3R96 A;  4XPD B;  2RFH A;  3IEH A;  4PPZ A;  2GU2 A;  4C2Y A;  1LOK A;  2NMT A;  4MY3 A;  4P45 A;  2CXA A;  3FMC A;  3GUX A;  2PJA A;  4PXD A;  2ZOG A;  4NXY A;  4Y49 B;  2CNM A;  3JTK A;  2ZW4 A;  4MHN A;  3IGR A;  4R57 A;  4A32 A;  1TKJ A;  1A2Z A;  2PJ6 A;  5AG4 A;  2Z3L A;  3LOD A;  4LQ6 A;  1OBR A;  2AFX A;  4B5O A;  4DUK A;  4P4B A;  5C88 A;  4ZX9 A;  5LYD A;  1IID A;  5JH9 A;  5LRK A;  4OC1 A;  4MFK A;  3DSB A;  4R76 A;  2EUI A;  2EBJ A;  4ZBG A;  4BD9 A;  1IYK A;  3B35 A;  2D4P A;  5J8F A;  2PJ8 A;  1XMT A;  2GFQ A;  4KOR A;  5LRG A;  2G3T A;  2YGW A;  4CRZ B;  4M6G A;  2GE3 A;  4AG9 A;  1FY7 A;  1VHE A;  2REF A;  2IQ6 A;  5HVG A;  1Y7E A;  1LFW A;  1Z8W A;  3H5Z A;  1NSA A;  3IO1 A;  5K8O A;  3PBE A;  4OP4 A;  1M4I A;  2PJ7 A;  4EME A;  3S9M A;  4MCS A;  3KR4 A;  3WC5 A;  2BEI A;  2C6C A;  4G1P A;  4MFP A;  4X2T A;  3MN8 A;  4HPS A;  4C2X A;  1VHS A;  2PIZ A;  3FNC A;  2C27 A;  3IWW A;  3KHZ A;  3PEI A;  3S6F A;  3P2H A;  4MI4 A;  1PCA A;  3K9T A;  3PB4 X;  4ONU A;  4E0A A;  1IYL A;  4NEX A;  2EWB A;  4OLL A;  1NE9 A;  2YNE A;  4MFQ A;  4P44 A;  5C82 A;  3R1K A;  3F8K A;  4H6Z A;  4OC5 A;  4DYO A;  2V8G A;  2FE7 A;  2BO9 A;  4UEE A;  3CT9 A;  4NGT A;  4B14 A;  2EVN A;  4RI1 A;  2FCK A;  2PR1 A;  1KUX A;  2QIR A;  2OH1 A;  2ZEP A;  4MFZ A;  5K8N A;  3KHX A;  2IJZ A;  2PC1 A;  4R7M A;  2DXQ A;  2PJB A;  5CNP A;  6CPA A;  2J8N A;  2C1C A;  2PJ0 A;  2BL1 A;  3SHP A;  4Z65 A;  3JUW A;  2PVV A;  3TO7 A;  4P4J A;  4MRI A;  1XF8 A;  4C2Z A;  5THW A;  1Z4E A;  3B3V A;  3EFA A;  3PB8 X;  4OID A;  1Z8T A;  4CGL A;  4NGM A;  3TC8 A;  2ZED A;  2B5G A;  3CDX A;  3T8W A;  1BOB A;  1ZLI A;  1CP7 A;  3NFZ A;  5J1Q A;  4XNH C;  5DWN A;  2CF4 A;  4UEF A;  4MMO A;  4UFV A;  4UBR A;  3H4Q A;  2AJ6 A;  1Y0Y A;  4YRH A;  3VWD A;  5JM6 A;  1S7F A;  2Q7B A;  2P6F A;  1S5K A;  3W91 A;  4AB7 A;  3VWE A;  5GCN A;  2PRB A;  4RN7 A;  3D66 A;  1LCP A;  4X8I A;  3CPA A;  2QML A;  1I1D A;  1TXR A;  3TX8 A;  4OC2 A;  2B3U A;  1YR0 A;  3BXM A;  2YNC A;  4E8O A;  1XMB A;  4KLW A;  3KZW A;  5LYL A;  3B3T A;  4ZY0 A;  2VZZ A;  5HMN A;  2ZEO A;  1IU8 A;  2HV2 A;  2O4H A;  1U6M A;  1TF8 A;  2QVP A;  1B6B A;  1XOV A;  1Z2L A;  3R9G A;  2D4O A;  1F2O A;  3C26 A;  1KWM A;  3A9L A;  3G3S A;  4R9M A;  2X7B A;  3FH4 A;  4AVC A;  1EE3 P;  2B58 A;  3T9Y A;  2REE A;  4BBH A;  1ELL P;  3SJG A;  2ZXV A;  3CPX A;  3H8F A;  4NGR A;  5KTC A;  1YRE A;  3MGD A;  4KSF A;  5A27 A;  2B4D A;  2WPX A;  4MCR A;  3VAT A;  1Y9K A;  4A94 A;  4KLV A;  2AFU A;  4KOV A;  4QC6 A;  4A37 A;  2PRQ A;  1IGB A;  3SJX A;  3FEC A;  2H5M A;  3D8P A;  1R43 A;  2XEG A;  3IWG A;  1DE4 C;  3KGQ A;  2G0B A;  2JDC A;  2PVW A;  2IL4 A;  4IF5 A;  1L0C A;  3RYO A;  2XEJ A;  3HUV A;  3ZJ0 A;  3LWU A;  1IOF A;  2Z11 A;  1S7N A;  4IK2 A;  3TO9 A;  1BLL E;  2PQ8 A;  4JD6 A;  3IU2 A;  2FT0 A;  4UF4 A;  2DF5 A;  4NJQ A;  3R9F A;  2B4D B;  3BLN A;  2Z10 A;  4K3N A;  1ZG9 A;  2CNS A; 
#chains in the Genus database with same CATH homology
 3IJ3 A;  1IY7 A;  2PJ3 A;  4P4I A;  1YW4 A;  3IIB A;  5I4M A;  2OOT A;  4Q7A A;  5DS0 A;  2POK A;  3V38 A;  3H8E A;  1HDU A;  3LMS A;  2F7V A;  4PXC A;  1YLO A;  2AFO A;  7CPA A;  3IC1 A;  1JQG A;  5LRJ A;  2PJ1 A;  1UWY A;  2PCU A;  4PQA A;  5D29 A;  4AXV A;  3MRU A;  4OIW A;  1ELM P;  5CPA A;  3KAS A;  4PXE A;  1CP6 A;  2V8H A;  2J9A A;  5K8P A;  4A38 A;  3D7H A;  2QJ8 A;  3ISZ A;  2Q4Z A;  2C6G A;  3D7D A;  4H2K A;  2ZEN A;  3D7F A;  3S9L A;  3B2Y A;  1Z5R A;  3PRT A;  3QNV A;  5HVH A;  4IHM A;  4ZI6 A;  2FVG A;  1M4L A;  2VL1 A;  1CPX A;  2BCO A;  3GLJ A;  3KQZ A;  4OC0 A;  2XEI A;  1ZG7 A;  4R8F A;  1Q7L A;  2HC9 A;  3DLJ A;  4IAV A;  3NH4 A;  3JRU A;  4R6T A;  3SJF A;  1XBU A;  3SI0 A;  4OKO A;  5F09 A;  1FNO A;  1Z8L A;  3KI9 A;  5HXD A;  1HEE A;  4NFR A;  4NGP A;  3VAR A;  1ARL A;  2ZEH A;  4P10 A;  1YSJ A;  2F8H A;  2CTB A;  1XFO A;  2JBK A;  3SI2 A;  4EWT A;  4P6Y A;  2NSM A;  1Y0R A;  4F9V A;  2O53 A;  4JYW A;  3NH5 A;  3FX6 A;  2RB7 A;  3PFE A;  1BPN A;  4KSI A;  2V8V A;  3HLP A;  4MHP A;  2BOA A;  2V77 A;  4WJB A;  2ABZ A;  2XEF A;  3FVL A;  1FT7 A;  1LAM A;  4O23 A;  2G9D A;  4X3R A;  4WWV A;  2AFW A;  3PB9 X;  5K8M A;  3BI1 A;  2ZEE A;  3PFO A;  3K2K A;  1ZLH A;  3B7I A;  1BPM A;  1CG2 A;  1XJO A;  1YW6 A;  1YME A;  4OME A;  3I1U A;  2WYR A;  4FWU A;  1RTQ A;  4UIB A;  4FUU A;  3WC7 A;  2C6P A;  1DTD A;  4ZX8 A;  4TWE A;  2JEW A;  2HB6 A;  3B3S A;  3B3C A;  4MCQ A;  2AFS A;  1CX8 A;  3S9N A;  5LYI A;  3PBB A;  3B3W A;  2CIJ A;  5ELY A;  1H8L A;  3D67 A;  1F2P A;  4YWY A;  3DGV A;  3WAB A;  5LYF A;  3FED A;  1ARM A;  2ZOF A;  1VHO A;  2CTC A;  2EK8 A;  4A39 A;  3FF3 A;  2PIY A;  4JZ0 A;  1LAN A;  1PYT B;  4UEZ A;  4FAI A;  1QMU A;  4MHY A;  1R3N A;  1VIX A;  2PJ9 A;  3V7Z A;  4MXU A;  3FEE A;  3ISX A;  2JBJ A;  4OC3 A;  1CPS A;  1XRY A;  4ZYQ A;  2IMO A;  3RAM A;  2GLF A;  3NH8 A;  4LQG A;  4NJR A;  1TKH A;  2PE3 A;  2AFZ A;  3L2N A;  3GB0 A;  4MHZ A;  2V8D A;  4W9Y A;  4TNU A;  4GM5 A;  4F9U A;  1VGY A;  3FJU A;  4OC4 A;  2EK9 A;  3SJE A;  1HDQ A;  1BAV A;  4DJL A;  4CPA A;  4NGQ A;  4NGN A;  5IB9 A;  3WT4 A;  2OR4 A;  3D4U A;  1QQ9 A;  3KR5 A;  3VH9 A;  3PB7 X;  2ZEF A;  4NGS A;  5JGF A;  1TF9 A;  4P4D A;  2ZEG A;  5CBM A;  2PJ2 A;  2WZN A;  5D8N A;  4FBE A;  4RUH A;  3RBU A;  2PJC A;  5HVF A;  2PJ5 A;  3WC6 A;  1AYE A;  2DEA A;  2PJ4 A;  3PB6 X;  1AMP A;  4F8Z A;  1TKF A;  2GRE A;  3KL9 A;  2GLJ A;  4ZY1 A;  3D7G A;  4B6Z A;  4YU9 A;  2QYV A;  2ZEM A;  2I3C A;  3SI1 A;  1CBX A;  3KQX A;  4PXB A;  4ZY2 A;  3BI0 A;  3IFE A;  4EFD A;  3D68 A;  3N5F A;  4P4E A;  1GYT A;  4MCP A;  1F57 A;  3BHX A;  2ANP A;  3H8G A;  4ONW A;  2AFM A;  1ZG8 A;  2ZEL A;  4P4F A;  2Q51 A;  1LAP A;  4UIA A;  3RZA A;  8CPA A;  3NA6 A;  2NYQ A;  2Q43 A;  2RFH A;  3IEH A;  4PPZ A;  2GU2 A;  1LOK A;  4P45 A;  3FMC A;  3GUX A;  2PJA A;  4PXD A;  2ZOG A;  4MHN A;  1TKJ A;  2PJ6 A;  1OBR A;  2AFX A;  4DUK A;  4P4B A;  4ZX9 A;  5LYD A;  5JH9 A;  5LRK A;  4OC1 A;  4R76 A;  4BD9 A;  3B35 A;  2PJ8 A;  5LRG A;  5HVG A;  1VHE A;  2IQ6 A;  1Y7E A;  1LFW A;  1NSA A;  3IO1 A;  5K8O A;  3PBE A;  4OP4 A;  2PJ7 A;  4EME A;  3S9M A;  4MCS A;  3KR4 A;  3WC5 A;  2C6C A;  4X2T A;  4G1P A;  3MN8 A;  2PIZ A;  3IWW A;  3KHZ A;  3PEI A;  1PCA A;  3K9T A;  3PB4 X;  2EWB A;  4P44 A;  4OC5 A;  4DYO A;  2V8G A;  2BO9 A;  4UEE A;  3CT9 A;  4NGT A;  2ZEP A;  5K8N A;  3KHX A;  2IJZ A;  4R7M A;  2PJB A;  6CPA A;  2C1C A;  2PJ0 A;  4Z65 A;  2PVV A;  4P4J A;  4MRI A;  5THW A;  3B3V A;  3PB8 X;  4OID A;  4NGM A;  3TC8 A;  2ZED A;  3CDX A;  3T8W A;  1ZLI A;  1CP7 A;  3NFZ A;  5J1Q A;  2CF4 A;  4UEF A;  4MMO A;  1Y0Y A;  5JM6 A;  3D66 A;  1LCP A;  4X8I A;  3CPA A;  1TXR A;  3TX8 A;  4OC2 A;  3BXM A;  1XMB A;  3KZW A;  5LYL A;  3B3T A;  4ZY0 A;  2ZEO A;  2O4H A;  2QVP A;  1TF8 A;  1Z2L A;  1F2O A;  1KWM A;  3FH4 A;  1EE3 P;  1ELL P;  3SJG A;  3CPX A;  3H8F A;  4NGR A;  4MCR A;  3VAT A;  4A94 A;  2AFU A;  4A37 A;  2PRQ A;  1IGB A;  3SJX A;  3FEC A;  1R43 A;  2XEG A;  1DE4 C;  3KGQ A;  2PVW A;  2XEJ A;  3HUV A;  3LWU A;  4IK2 A;  1BLL E;  4UF4 A;  4NJQ A;  4K3N A;  1ZG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...