3B3SA

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 119
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3sA00
1EE3P 4PXCA 1TXRA 1ZLIA 4A39A 3H8EA 2EK9A 3BXMA 3FJUA 2EK8A 1TKHA 4OC0A 3VATA 3SJEA 1YW6A 4FWUA 1XMBA 1GYTA 3KZWA 3B3WA 4R8FA 2XEGA 2IMOA 1UWYA 4CPAA 1BPNA 4F8ZA 4FUUA 1YLOA 5K8NA 1VGYA 3SJFA 2ZENA 5HXDA 3BI0A 4NJQA 1ARLA 3PEIA 2QYVA 3BHXA 3PFEA 3SJXA 3KI9A 3RZAA 3KHZA 4NFRA 2XEJA 3PRTA 1TKFA 2JBJA 1IY7A 2BO9A 2ZEOA 2WYRA 4MHZA 1R43A 5CBMA 2HB6A 4OIWA 3PB4X 4P44A 4NJRA 3V7ZA 2GU2A 5LRJA 1H8LA 3RBUA 3MRUA 4X8IA 3L2NA 2DEAA 4MHPA 3B3TA 2FVGA 4OC4A 4GM5A 4AXVA 5LYLA 1AMPA 3NH8A 2AFMA 4LQGA 5HVGA 1VIXA 3FEDA 3CDXA 4P4IA 4UEFA 3GLJA 2PVVA 4NGSA 3D68A 2CTBA 1LOKA 2PJCA 3D4UA 2O4HA 3FMCA 2F8HA 2V8VA 3D7DA 4JZ0A 4OC5A 4B6ZA 1CG2A 3ISXA 3IFEA 2C6GA 5F09A 1AYEA 3PB7X 4PXEA 2XEIA 3TX8A 1Z2LA 2PJ9A 3WC6A 5DS0A 1LCPA 8CPAA 2POKA 2XEFA 4MMOA 1BLLE 3S9NA 4PQAA 3CPAA 3B3CA 4MCRA 3PFOA 2AFZA 1XBUA 3B7IA 3B3VA 4P4BA 2V77A 2ZEEA 4EWTA 2AFOA 2AFXA 4YU9A 3CPXA 3RAMA 1LANA 3IC1A 5HVFA 4ZY2A 2O53A 2PJ8A 4WJBA 4FBEA 1PCAA 1TF9A 4OP4A 5J1QA 3WC5A 4ZX9A 2OR4A 3SI2A 4F9VA 2AFUA 4F9UA 3FH4A 3GB0A 3PBBA 1HDQA 3NH4A 5LYFA 3HLPA 4K3NA 3D7FA 3KR4A 3KHXA 1VHEA 3V38A 3SJGA 2VL1A 3DLJA 4KSIA 3LMSA 4H2KA 4Z65A 4NGMA 4OC1A 2I3CA 4UIAA 2BCOA 2ZEGA 2NYQA 3B3SA 3NA6A 3FECA 3KL9A 4NGNA 2ZOFA 4PPZA 3FF3A 4UEZA 3NFZA 2ZOGA 4G1PA 5D29A 4X2TA 1ELMP 2IQ6A 6CPAA 1KWMA 4NGRA 3KQZA 1HEEA 2ABZA 1ARMA 1Y0YA 4W9YA 3GUXA 4Q7AA 4X3RA 1TF8A 2PE3A 2V8HA 2Q4ZA 4JYWA 4ZX8A 4OC2A 4OMEA 3LWUA 4EFDA 1RTQA 2ZELA 3S9MA 4P4JA 1Y7EA 2ANPA 2PJ0A 1QQ9A 2ZEPA 4A94A 5IB9A 4P4EA 5HVHA 3VH9A 2J9AA 1R3NA 1F2OA 1PYTB 1ZG7A 5ELYA 1IGBA 1XJOA 4IHMA 2ZEHA 4IAVA 5LRGA 2PJ1A 2RB7A 2ZEFA 3TC8A 3PB9X 2ZEDA 4P10A 2Q51A 1BPMA 4DYOA 3WT4A 3KGQA 5K8PA 4R76A 2GLJA 4ZYQA 1FT7A 4PXDA 3T8WA 3QNVA 3MN8A 2ZEMA 1Y0RA 4DUKA 5LYDA 1CP7A 2RFHA 1YMEA 1XFOA 4NGTA 1NSAA 3IJ3A 2PIZA 5THWA 4BD9A 4ZY1A 1Q7LA 2QVPA 2EWBA 3IWWA 2PJ3A 3VARA 1ZG9A 3S9LA 4FAIA 3WC7A 1LFWA 2GREA 4TNUA 2Q43A 3IIBA 3FX6A 1CPXA 2CTCA 2PJ2A 2C1CA 3I1UA 3ISZA 2V8GA 3D67A 3N5FA 4WWVA 4ZY0A 1VHOA 2PVWA 3IEHA 4MXUA 5JH9A 3H8FA 5I4MA 5D8NA 2PJ4A 4OC3A 1CBXA 2JEWA 4NGQA 5LRKA 3PBEA 1F2PA 4P45A 1JQGA 2PJAA 2GLFA 5K8MA 2OOTA 4P4FA 1XRYA 4EMEA 4P4DA 3IO1A 1CX8A 4YWYA 5JM6A 4UIBA 2PCUA 1Z8LA 1BAVA 2F7VA 2JBKA 4UEEA 3FEEA 3K2KA 1OBRA 1ZLHA 3DGVA 2BOAA 4A37A 1CP6A 2PJ6A 3PB6X 4TWEA 2AFSA 2PJBA 1ZG8A 1HDUA 2C6PA 3SI1A 2CIJA 1YW4A 5CPAA 4RUHA 1QMUA 1YSJA 1DE4C 3HUVA 3D7GA 2NSMA 4MCPA 3WABA 3H8GA 4OIDA 4MCQA 4MHYA 1F57A 5LYIA 3KR5A 2IJZA 2V8DA 1FNOA 2PJ7A 4R7MA 3B2YA 3D66A 1LAPA 4O23A 2C6CA 3NH5A 2QJ8A 3B35A 7CPAA 4IK2A 2PJ5A 4UF4A 4PXBA 3D7HA 1LAMA 4R6TA 3FVLA 3SI0A 2WZNA 1ELLP 4MRIA 2CF4A 2PIYA 2G9DA 2PRQA 3KASA 2AFWA 5JGFA 4A38A 1DTDA 4MCSA 1Z5RA 1CPSA 3JRUA 3K9TA 4DJLA 3PB8X 3KQXA 5K8OA 4MHNA 2HC9A 1M4LA 3CT9A 3BI1A 4ONWA 1TKJA 4NGPA 4ZI6A 4P6YA 4OKOA
chains in the Genus database with same CATH superfamily
1EE3P 2GE3A 4UWJA 4PXCA 4AB7A 1TXRA 1ZLIA 5A27A 4MJ8A 5F48A 4B13A 4A39A 3H8EA 2EK9A 3BXMA 1QSNA 3FJUA 2EK8A 1TKHA 4OC0A 3FB3A 3VATA 2ATRA 3SJEA 1YW6A 2FSRA 3FBUA 3F5BA 2G3AA 4YRHA 1MJAA 2OZGA 1XMBA 2FT0A 4FWUA 4CYNA 1GYTA 2O28A 3KZWA 5IX3A 4CAXA 3B3WA 2Z3OA 3EFAA 4Y49C 4I49A 3LODA 4R8FA 3SXNA 2Z10A 2XEGA 2IMOA 5C88A 5E96A 1I1DA 3R96A 3W6XA 3DSBA 1UWYA 4M6HA 3SHPA 2ZPAA 4CPAA 1IOFA 1BPNA 4F8ZA 4XNHB 4FUUA 1YLOA 3D3SA 5K8NA 1VGYA 3SJFA 2Q7BA 2ZENA 5HMNA 4R9MA 1K4JA 3BI0A 5HXDA 3CXSA 3LACA 5AG5A 2AE6A 1S3ZA 1ARLA 3DR8A 3PEIA 4NJQA 3R95A 2QYVA 3TOBA 3BHXA 2FS5A 3JUWA 3PFEA 3SJXA 3KI9A 5EMIA 4AVCA 3RZAA 4CYPA 3KHZA 4GS4A 4NFRA 4AVBA 1JWQA 2XEJA 3PRTA 1TKFA 2JBJA 2VI7A 4PSWA 1IY7A 2BO9A 2ZEOA 2WYRA 4J3GA 4UCNA 4MHZA 1R43A 4RS2A 2HB6A 2ARHA 4B5PA 5CBMA 3TT2A 2ZW4A 4OIWA 3A9LA 4XPLA 4CGLA 3TOAA 1S7KA 3B8GA 3PB4X 4P44A 4NJRA 4LX9A 3V7ZA 2GU2A 2VXKA 5LRJA 1H8LA 3RBUA 1FY7A 3MRUA 4X8IA 3IWEA 3C26A 2G3TA 4CS0B 3L2NA 2ODFA 4CAFA 4H6UA 3EY5A 4PK3A 2DEAA 2J8NA 4MHPA 1VHSA 4H6ZA 3B3TA 2FVGA 4R57A 1NMTA 2I00A 1L0CA 3FRMA 1R57A 4OC4A 4II9A 2FE7A 4GM5A 4NF1A 4R87A 5FVJA 4AXVA 2QMLA 5LYLA 5AG4A 1AMPA 2IL4A 4Q38A 5IB0A 4QC6A 3NH8A 2GANA 4OLLA 4U9YA 5BWAB 5J8CA 4R3LA 2AFMA 4LQGA 1IYKA 1XEBA 2B5GA 2OZUA 4Y49B 1YK3A 2YNDA 3KKWA 4GXHA 1RO5A 4UCMA 4BBHA 5HVGA 2B4BA 2PQ8A 1B6BA 2GIVA 1VIXA 2CNTA 2B3UA 3FEDA 2D4PA 3CDXA 2CY2A 3LD2A 4KLVA 1XE4A 4P4IA 4KOXA 4UEFA 2Y0MA 5KTDA 3GLJA 2PVVA 2EUIA 5ISVA 4NGSA 3D68A 2CTBA 4EVYA 1LOKA 4M85A 2PJCA 3D4UA 2O4HA 2JDCA 3FMCA 2F8HA 2OH1A 4H89A 4CYOA 2V8VA 3D7DA 4KSFA 2BEIA 5A28A 4JZ0A 4OC5A 2R98A 1OZPA 3FIXA 4B6ZA 4BINA 1QSTA 1CG2A 2EBJA 4M6GA 4MFLA 3ISXA 3IFEA 3BLNA 3TO7A 4CRZB 4CRYB 4JD6A 1M44A 2Q04A 2C6GA 3F8KA 2P6FA 2R1IA 2VBQA 4KLWA 1TIQA 4L8AA 5F09A 1AYEA 3PB7X 1WWZA 4MFZA 4PXEA 2XEIA 3TX8A 2ZXVA 2FXFA 2I79A 4M6IA 4RN7A 2HQYA 4MY0A 1Z2LA 2PJ9A 3WC6A 5IV0A 5DS0A 1LCPA 1MJBA 2QIRA 1MJ9A 8CPAA 2P6GA 2POKA 1YREA 2B4DB 2DPTA 2Q7SA 2XEFA 4MMOA 3TO6A 1BLLE 3EO4A 3S9NA 4PQAA 2KCWA 3CPAA 4QVTA 3FYNA 3B3CA 4MCRA 3PFOA 4HPSA 1XMTA 2AFZA 1Z8XA 2P6EA 4B5OA 3IU2A 1XBUA 3B7IA 4NEXA 3B3VA 1WK4A 4P4BA 2V77A 5G20A 2ZEEA 4EWTA 2AFOA 2AFXA 4YU9A 3CPXA 4NCZA 1LANA 2PDOA 2WUUA 2ZW5A 3IC1A 5HVFA 4E8OA 3PZJA 3TFYA 4ZY2A 3P2HA 2O53A 2PJ8A 4WJBA 4OAEA 4FBEA 4F0YA 1PCAA 1TF9A 3D8PA 4FD4A 3IWGA 4ZGYB 4JJXA 1YGHA 4PV6A 3V8IA 1M4DA 4IF5A 4OP4A 3EXNA 5J1QA 3WC5A 4ZX9A 1J4JA 2OR4A 3SI2A 4F9VA 2AFUA 4F9UA 3FH4A 1X12A 3GB0A 3PBBA 1HDQA 3K9UA 3NH4A 3HLPA 1U6MA 2YNCA 4B11A 1IICA 4K3NA 5LYFA 4KVXA 4B12A 2QECA 2EVNA 3D7FA 1YQEA 4KUAA 4MFPA 2PR8A 1IIDA 3KR4A 4KOTA 3TTHA 3PP9A 3NE8A 3KHXA 4YFJA 2PSWA 1VHEA 3F0AA 5AG7A 3V38A 4A31A 3SJGA 2VL1A 3DLJA 4JXQA 3W91A 3DNSA 4KSIA 3LMSA 4H2KA 4Z65A 4ONUA 4NGMA 4OC1A 2I3CA 4UIAA 5EBVA 1YR0A 2BCOA 2ZEGA 2NYQA 2WSAA 3B3SA 3NA6A 3FECA 3KL9A 4NGNA 2DF5A 2ZOFA 1MK4A 3JTKA 2DXQA 1I12A 2PRBA 1Z4EA 2VEZA 2Z3KA 4PPZA 3FF3A 3PGPA 5I0CA 2K5TA 4UEZA 3NFZA 2ZOGA 4G1PA 5D29A 4X2TA 3ZJ0A 5G22A 3QAYA 1ELMP 2IQ6A 4CGPA 1KWMA 4R3KA 6CPAA 4E2AA 4NGRA 3W6SA 4C2XA 4C2YA 4AG9A 4F0XA 3KQZA 2H5MA 1HEEA 2JLMA 3EC4A 2ABZA 1P0HA 1ARMA 1Y0YA 3H5ZA 2JEVA 4Q36A 3GUXA 4Q7AA 4W9YA 4X3RA 1TF8A 5J8FA 1GHEA 2PE3A 2V8HA 3N7ZA 1XF8A 1Y7RA 2Q4ZA 5CNPA 4B5PB 4JYWA 2YNEA 4ZX8A 4OC2A 3E0KA 2HV2A 4OMEA 4CAVA 3LWUA 4EFDA 3CXQA 3G8WA 1RTQA 4QBJA 1Z4RA 2ZELA 3S9MA 4YGOA 5JPHA 2PR1A 3QAHA 4P4JA 1Y7EA 2ANPA 3GKRA 2PJ0A 5EC4A 1QQ9A 1V0CA 1NSLA 2PC1A 1XIXA 2ZEPA 5G1ZA 4A94A 1PUAA 2Z3LA 5IB9A 4NSQA 2OU2A 3D2PA 4P4EA 5HVHA 1QSRA 3VH9A 2J9AA 4JLYA 4ZBGA 1R3NA 1Z9UA 3I9SA 3GIUA 2NMTA 3S6GA 4A30A 1M4GA 1F2OA 1PYTB 1ZG7A 2B5GB 2OZHA 5ELYA 4CGMA 1IGBA 1XJOA 4IHMA 2ZEHA 4UFVA 4IAVA 2YGWA 5LRGA 2PJ1A 3MGDA 2RB7A 2ZEFA 5F47A 3TC8A 4CGNA 3PB9X 2ZEDA 2ZW7A 4P10A 2A4NA 4KVOE 2Q51A 1BPMA 4DYOA 5F49A 2Z3NA 1KUXA 3WT4A 4B10A 3KGQA 4UA3A 5K8PA 4R76A 2GLJA 4MBUA 4ZYQA 1FT7A 2YNCC 3OWCA 4L89A 3QNVA 4PXDA 3T8WA 4B14A 4CAWA 4UCPA 4F6AA 3MN8A 2ZEMA 2P0WA 1Y0RA 3R1KA 4DUKA 5LYDA 1CP7A 2RFHA 4XNHC 1N71A 4U5YA 1Z8TA 1YMEA 1XFOA 2Z0ZA 4NGTA 1NSAA 3IJ3A 2PIZA 2Q4YA 4KUBA 5THWA 4CYQA 4BD9A 5JQ4A 4C2ZA 5DWNA 4ZY1A 1B87A 1S60A 2BL1A 1NE9A 1Q7LA 4E0AA 2QVPA 2Z3PA 1YVOA 4UFWA 2EWBA 2CNSA 3IWWA 4X5KA 2PJ3A 1YLEA 4UWIA 3TCVA 1IB1E 3VARA 1Y9WA 4HNYB 1ZG9A 3S9LA 4FAIA 3WC7A 1LFWA 2GREA 4HKFA 4TNUA 3T9YA 2Q43A 4A32A 3IIBA 1BO4A 3FX6A 2JDDA 4LQ6A 1A2ZA 4KOVA 4NXYA 3TE4A 1CPXA 1S5KA 2CTCA 4A95A 2PJ2A 1UFHA 2C1CA 3I1UA 3FNCA 3ISZA 3RO0A 1Y9KA 2R8VA 2V8GA 3D67A 3QB8A 2RC4A 5AGEA 1X10A 3N5FA 4WWVA 5C82A 3S6HA 3RNZA 1VHOA 2PVWA 3IEHA 4MXUA 4ZY0A 5G21A 5JH9A 3H8FA 5H84A 5I4MA 4A33A 5D8NA 1VKCA 2FIAA 2Q4VA 2PJ4A 2REFA 4MFQA 1S7LA 4OC3A 1CBXA 5KTCA 2JEWA 5KTAA 4XPDC 3S6KA 4NGQA 5LRKA 2HUZA 3FXTA 3PBEA 1F2PA 1Q2CA 2B58A 4PK2A 4P45A 4C7IA 2J8MA 1JQGA 4KZTA 2GLFA 2PJAA 3VWEA 2OB0A 2R7HA 4XPKA 3BJ8A 5GCNA 5K8MA 1ZO0A 3NE7A 1KZFA 2OOTA 1RXTA 5H86A 4KOYA 4P4FA 4OADA 1XRYA 4EMEA 2J8RA 4K30A 4C7HA 4P4DA 3IO1A 1CX8A 3GY9A 4YWYA 1YX0A 5JM6A 4UIBA 1KUYA 2D4OA 2PCUA 4KOUA 3D2MA 1Z8LA 1BAVA 4IUSA 4AG7A 2C27A 2F7VA 3H4QA 2JBKA 4UEEA 4JWPA 3FEEA 3K2KA 1I21A 4MFJA 2VQYA 3I3GA 1OBRA 1QSOA 2Q0YA 1ZLHA 4DNCA 3RYOA 1AUGA 3UY5A 3DGVA 2BOAA 4QB9A 4A37A 1CP6A 5AG6A 2PJ6A 4FD5A 3PB6X 4TWEA 3R9GA 2AFSA 2PJBA 1M1DA 4C68A 1ZG8A 1HDUA 1QSMA 4CGOA 3WR7A 2C6PA 3SI1A 2CIJA 1KUVA 1YW4A 5CPAA 1Q2YA 4RUHA 1QMUA 4HNWB 2F5IA 1YSJA 2X7BA 2WPWA 1DE4C 3HUVA 4QUSA 3D7GA 2NSMA 3DDDA 4MCPA 2DPSA 1Z8WA 2VZYA 3WABA 2FL4A 2Q44A 3H8GA 1CM0A 4OIDA 4U9ZA 1S7NA 4MCQA 4MFKA 4MHYA 2AJ6A 1F57A 5LYIA 4MY3A 4MHDA 1IOIA 3KR5A 3G3SA 3DR6A 1S7FA 1SQHA 4JXRA 2IJZA 4UFXA 4FD7A 4XPDB 2V8DA 3P2FA 1FNOA 2GFQA 2PJ7A 4R7MA 2REEA 3B2YA 3D66A 3IU1A 2CXAA 4A2ZA 2BSWA 3BJ7A 1LAPA 4O23A 1M4IA 5DWMA 2BUEA 2C6CA 3NH5A 2QJ8A 3B35A 3RAMA 1LRZA 4KORA 4IK2A 7CPAA 2PJ5A 4UF4A 4PXBA 3D7HA 1LAMA 4R6TA 3FVLA 3SI0A 3T90A 2WZNA 1ELLP 4MRIA 2Z11A 4AVAA 1Q2DA 2CF4A 1CJWA 2PIYA 2Z3MA 2G9DA 4KOSA 3VWDA 3JVNA 1ON0A 1IYLA 2PRQA 3KASA 4M3SA 4PSXA 2AFWA 3TO9A 5JGFA 4A38A 1DTDA 2G0BA 4ORFA 4KVME 3CXPA 3GYAA 2B3VA 4MCSA 4UBRA 3SXOA 1Z5RA 5F46A 1CPSA 2VZZA 3JRUA 3K9TA 4DJLA 3PB8X 3KQXA 1XOVA 2B4DA 5K8OA 4KSAA 4LUAA 4MHNA 1YVKA 2EO8A 2FIWA 3R9FA 2HC9A 1M4LA 3ZZIA 3CT9A 4CAEA 1PU9A 3BI1A 2CNMA 4ONWA 4RI1A 4FD6A 5HH1A 1P4NA 3S6FA 2ZW6A 1IU8A 2WPXA 3R9EA 1TKJA 4BMHA 3CZXA 3IGRA 4KOWA 4NGPA 2FCKA 4KS9A 4HNXB 4ZI6A 1BOBA 4P6YA 4MI4A 4OKOA
chains in the Genus database with same CATH topology
1EE3P 4PXCA 1TXRA 1ZLIA 4A39A 3H8EA 2EK9A 3BXMA 3FJUA 2EK8A 1TKHA 4OC0A 3VATA 3SJEA 1YW6A 4FWUA 1XMBA 1GYTA 3KZWA 3B3WA 4R8FA 2XEGA 2IMOA 1UWYA 4CPAA 1BPNA 4F8ZA 4FUUA 1YLOA 5K8NA 1VGYA 3SJFA 2ZENA 5HXDA 3BI0A 4NJQA 1ARLA 3PEIA 2QYVA 3BHXA 3PFEA 3SJXA 3KI9A 3RZAA 3KHZA 4NFRA 2XEJA 3PRTA 1TKFA 2JBJA 1IY7A 2BO9A 2ZEOA 2WYRA 4MHZA 1R43A 5CBMA 2HB6A 4OIWA 3PB4X 4P44A 4NJRA 3V7ZA 2GU2A 5LRJA 1H8LA 3RBUA 3MRUA 4X8IA 3L2NA 2DEAA 4MHPA 3B3TA 2FVGA 4OC4A 4GM5A 4AXVA 5LYLA 1AMPA 3NH8A 2AFMA 4LQGA 5HVGA 1VIXA 3FEDA 3CDXA 4P4IA 4UEFA 3GLJA 2PVVA 4NGSA 3D68A 2CTBA 1LOKA 2PJCA 3D4UA 2O4HA 3FMCA 2F8HA 2V8VA 3D7DA 4JZ0A 4OC5A 4B6ZA 1CG2A 3ISXA 3IFEA 2C6GA 5F09A 1AYEA 3PB7X 4PXEA 2XEIA 3TX8A 1Z2LA 2PJ9A 3WC6A 5DS0A 1LCPA 8CPAA 2POKA 2XEFA 4MMOA 1BLLE 3S9NA 4PQAA 3CPAA 3B3CA 4MCRA 3PFOA 2AFZA 1XBUA 3B7IA 3B3VA 4P4BA 2V77A 2ZEEA 4EWTA 2AFOA 2AFXA 4YU9A 3CPXA 3RAMA 1LANA 3IC1A 5HVFA 4ZY2A 2O53A 2PJ8A 4WJBA 4FBEA 1PCAA 1TF9A 4OP4A 5J1QA 3WC5A 4ZX9A 2OR4A 3SI2A 4F9VA 2AFUA 4F9UA 3FH4A 3GB0A 3PBBA 1HDQA 3NH4A 5LYFA 3HLPA 4K3NA 3D7FA 3KR4A 3KHXA 1VHEA 3V38A 3SJGA 2VL1A 3DLJA 4KSIA 3LMSA 4H2KA 4Z65A 4NGMA 4OC1A 2I3CA 4UIAA 2BCOA 2ZEGA 2NYQA 3B3SA 3NA6A 3FECA 3KL9A 4NGNA 2ZOFA 4PPZA 3FF3A 4UEZA 3NFZA 2ZOGA 4G1PA 5D29A 4X2TA 1ELMP 2IQ6A 6CPAA 1KWMA 4NGRA 3KQZA 1HEEA 2ABZA 1ARMA 1Y0YA 4W9YA 3GUXA 4Q7AA 4X3RA 1TF8A 2PE3A 2V8HA 2Q4ZA 4JYWA 4ZX8A 4OC2A 4OMEA 3LWUA 4EFDA 1RTQA 2ZELA 3S9MA 4P4JA 1Y7EA 2ANPA 2PJ0A 1QQ9A 2ZEPA 4A94A 5IB9A 4P4EA 5HVHA 3VH9A 2J9AA 1R3NA 1F2OA 1PYTB 1ZG7A 5ELYA 1IGBA 1XJOA 4IHMA 2ZEHA 4IAVA 5LRGA 2PJ1A 2RB7A 2ZEFA 3TC8A 3PB9X 2ZEDA 4P10A 2Q51A 1BPMA 4DYOA 3WT4A 3KGQA 5K8PA 4R76A 2GLJA 4ZYQA 1FT7A 4PXDA 3T8WA 3QNVA 3MN8A 2ZEMA 1Y0RA 4DUKA 5LYDA 1CP7A 2RFHA 1YMEA 1XFOA 4NGTA 1NSAA 3IJ3A 2PIZA 5THWA 4BD9A 4ZY1A 1Q7LA 2QVPA 2EWBA 3IWWA 2PJ3A 3VARA 1ZG9A 3S9LA 4FAIA 3WC7A 1LFWA 2GREA 4TNUA 2Q43A 3IIBA 3FX6A 1CPXA 2CTCA 2PJ2A 2C1CA 3I1UA 3ISZA 2V8GA 3D67A 3N5FA 4WWVA 4ZY0A 1VHOA 2PVWA 3IEHA 4MXUA 5JH9A 3H8FA 5I4MA 5D8NA 2PJ4A 4OC3A 1CBXA 2JEWA 4NGQA 5LRKA 3PBEA 1F2PA 4P45A 1JQGA 2PJAA 2GLFA 5K8MA 2OOTA 4P4FA 1XRYA 4EMEA 4P4DA 3IO1A 1CX8A 4YWYA 5JM6A 4UIBA 2PCUA 1Z8LA 1BAVA 2F7VA 2JBKA 4UEEA 3FEEA 3K2KA 1OBRA 1ZLHA 3DGVA 2BOAA 4A37A 1CP6A 2PJ6A 3PB6X 4TWEA 2AFSA 2PJBA 1ZG8A 1HDUA 2C6PA 3SI1A 2CIJA 1YW4A 5CPAA 4RUHA 1QMUA 1YSJA 1DE4C 3HUVA 3D7GA 2NSMA 4MCPA 3WABA 3H8GA 4OIDA 4MCQA 4MHYA 1F57A 5LYIA 3KR5A 2IJZA 2V8DA 1FNOA 2PJ7A 4R7MA 3B2YA 3D66A 1LAPA 4O23A 2C6CA 3NH5A 2QJ8A 3B35A 7CPAA 4IK2A 2PJ5A 4UF4A 4PXBA 3D7HA 1LAMA 4R6TA 3FVLA 3SI0A 2WZNA 1ELLP 4MRIA 2CF4A 2PIYA 2G9DA 2PRQA 3KASA 2AFWA 5JGFA 4A38A 1DTDA 4MCSA 1Z5RA 1CPSA 3JRUA 3K9TA 4DJLA 3PB8X 3KQXA 5K8OA 4MHNA 2HC9A 1M4LA 3CT9A 3BI1A 4ONWA 1TKJA 4NGPA 4ZI6A 4P6YA 4OKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE3 P;  4PXC A;  1TXR A;  1ZLI A;  4A39 A;  3H8E A;  2EK9 A;  3BXM A;  3FJU A;  2EK8 A;  1TKH A;  4OC0 A;  3VAT A;  3SJE A;  1YW6 A;  4FWU A;  1XMB A;  1GYT A;  3KZW A;  3B3W A;  4R8F A;  2XEG A;  2IMO A;  1UWY A;  4CPA A;  1BPN A;  4F8Z A;  4FUU A;  1YLO A;  5K8N A;  1VGY A;  3SJF A;  2ZEN A;  5HXD A;  3BI0 A;  4NJQ A;  1ARL A;  3PEI A;  2QYV A;  3BHX A;  3PFE A;  3SJX A;  3KI9 A;  3RZA A;  3KHZ A;  4NFR A;  2XEJ A;  3PRT A;  1TKF A;  2JBJ A;  1IY7 A;  2BO9 A;  2ZEO A;  2WYR A;  4MHZ A;  1R43 A;  5CBM A;  2HB6 A;  4OIW A;  3PB4 X;  4P44 A;  4NJR A;  3V7Z A;  2GU2 A;  5LRJ A;  1H8L A;  3RBU A;  3MRU A;  4X8I A;  3L2N A;  2DEA A;  4MHP A;  3B3T A;  2FVG A;  4OC4 A;  4GM5 A;  4AXV A;  5LYL A;  1AMP A;  3NH8 A;  2AFM A;  4LQG A;  5HVG A;  1VIX A;  3FED A;  3CDX A;  4P4I A;  4UEF A;  3GLJ A;  2PVV A;  4NGS A;  3D68 A;  2CTB A;  1LOK A;  2PJC A;  3D4U A;  2O4H A;  3FMC A;  2F8H A;  2V8V A;  3D7D A;  4JZ0 A;  4OC5 A;  4B6Z A;  1CG2 A;  3ISX A;  3IFE A;  2C6G A;  5F09 A;  1AYE A;  3PB7 X;  4PXE A;  2XEI A;  3TX8 A;  1Z2L A;  2PJ9 A;  3WC6 A;  5DS0 A;  1LCP A;  8CPA A;  2POK A;  2XEF A;  4MMO A;  1BLL E;  3S9N A;  4PQA A;  3CPA A;  3B3C A;  4MCR A;  3PFO A;  2AFZ A;  1XBU A;  3B7I A;  3B3V A;  4P4B A;  2V77 A;  2ZEE A;  4EWT A;  2AFO A;  2AFX A;  4YU9 A;  3CPX A;  3RAM A;  1LAN A;  3IC1 A;  5HVF A;  4ZY2 A;  2O53 A;  2PJ8 A;  4WJB A;  4FBE A;  1PCA A;  1TF9 A;  4OP4 A;  5J1Q A;  3WC5 A;  4ZX9 A;  2OR4 A;  3SI2 A;  4F9V A;  2AFU A;  4F9U A;  3FH4 A;  3GB0 A;  3PBB A;  1HDQ A;  3NH4 A;  5LYF A;  3HLP A;  4K3N A;  3D7F A;  3KR4 A;  3KHX A;  1VHE A;  3V38 A;  3SJG A;  2VL1 A;  3DLJ A;  4KSI A;  3LMS A;  4H2K A;  4Z65 A;  4NGM A;  4OC1 A;  2I3C A;  4UIA A;  2BCO A;  2ZEG A;  2NYQ A;  3B3S A;  3NA6 A;  3FEC A;  3KL9 A;  4NGN A;  2ZOF A;  4PPZ A;  3FF3 A;  4UEZ A;  3NFZ A;  2ZOG A;  4G1P A;  5D29 A;  4X2T A;  1ELM P;  2IQ6 A;  6CPA A;  1KWM A;  4NGR A;  3KQZ A;  1HEE A;  2ABZ A;  1ARM A;  1Y0Y A;  4W9Y A;  3GUX A;  4Q7A A;  4X3R A;  1TF8 A;  2PE3 A;  2V8H A;  2Q4Z A;  4JYW A;  4ZX8 A;  4OC2 A;  4OME A;  3LWU A;  4EFD A;  1RTQ A;  2ZEL A;  3S9M A;  4P4J A;  1Y7E A;  2ANP A;  2PJ0 A;  1QQ9 A;  2ZEP A;  4A94 A;  5IB9 A;  4P4E A;  5HVH A;  3VH9 A;  2J9A A;  1R3N A;  1F2O A;  1PYT B;  1ZG7 A;  5ELY A;  1IGB A;  1XJO A;  4IHM A;  2ZEH A;  4IAV A;  5LRG A;  2PJ1 A;  2RB7 A;  2ZEF A;  3TC8 A;  3PB9 X;  2ZED A;  4P10 A;  2Q51 A;  1BPM A;  4DYO A;  3WT4 A;  3KGQ A;  5K8P A;  4R76 A;  2GLJ A;  4ZYQ A;  1FT7 A;  4PXD A;  3T8W A;  3QNV A;  3MN8 A;  2ZEM A;  1Y0R A;  4DUK A;  5LYD A;  1CP7 A;  2RFH A;  1YME A;  1XFO A;  4NGT A;  1NSA A;  3IJ3 A;  2PIZ A;  5THW A;  4BD9 A;  4ZY1 A;  1Q7L A;  2QVP A;  2EWB A;  3IWW A;  2PJ3 A;  3VAR A;  1ZG9 A;  3S9L A;  4FAI A;  3WC7 A;  1LFW A;  2GRE A;  4TNU A;  2Q43 A;  3IIB A;  3FX6 A;  1CPX A;  2CTC A;  2PJ2 A;  2C1C A;  3I1U A;  3ISZ A;  2V8G A;  3D67 A;  3N5F A;  4WWV A;  4ZY0 A;  1VHO A;  2PVW A;  3IEH A;  4MXU A;  5JH9 A;  3H8F A;  5I4M A;  5D8N A;  2PJ4 A;  4OC3 A;  1CBX A;  2JEW A;  4NGQ A;  5LRK A;  3PBE A;  1F2P A;  4P45 A;  1JQG A;  2PJA A;  2GLF A;  5K8M A;  2OOT A;  4P4F A;  1XRY A;  4EME A;  4P4D A;  3IO1 A;  1CX8 A;  4YWY A;  5JM6 A;  4UIB A;  2PCU A;  1Z8L A;  1BAV A;  2F7V A;  2JBK A;  4UEE A;  3FEE A;  3K2K A;  1OBR A;  1ZLH A;  3DGV A;  2BOA A;  4A37 A;  1CP6 A;  2PJ6 A;  3PB6 X;  4TWE A;  2AFS A;  2PJB A;  1ZG8 A;  1HDU A;  2C6P A;  3SI1 A;  2CIJ A;  1YW4 A;  5CPA A;  4RUH A;  1QMU A;  1YSJ A;  1DE4 C;  3HUV A;  3D7G A;  2NSM A;  4MCP A;  3WAB A;  3H8G A;  4OID A;  4MCQ A;  4MHY A;  1F57 A;  5LYI A;  3KR5 A;  2IJZ A;  2V8D A;  1FNO A;  2PJ7 A;  4R7M A;  3B2Y A;  3D66 A;  1LAP A;  4O23 A;  2C6C A;  3NH5 A;  2QJ8 A;  3B35 A;  7CPA A;  4IK2 A;  2PJ5 A;  4UF4 A;  4PXB A;  3D7H A;  1LAM A;  4R6T A;  3FVL A;  3SI0 A;  2WZN A;  1ELL P;  4MRI A;  2CF4 A;  2PIY A;  2G9D A;  2PRQ A;  3KAS A;  2AFW A;  5JGF A;  4A38 A;  1DTD A;  4MCS A;  1Z5R A;  1CPS A;  3JRU A;  3K9T A;  4DJL A;  3PB8 X;  3KQX A;  5K8O A;  4MHN A;  2HC9 A;  1M4L A;  3CT9 A;  3BI1 A;  4ONW A;  1TKJ A;  4NGP A;  4ZI6 A;  4P6Y A;  4OKO A; 
#chains in the Genus database with same CATH topology
 1EE3 P;  2GE3 A;  4UWJ A;  4PXC A;  4AB7 A;  1TXR A;  1ZLI A;  5A27 A;  4MJ8 A;  5F48 A;  4B13 A;  4A39 A;  3H8E A;  2EK9 A;  3BXM A;  1QSN A;  3FJU A;  2EK8 A;  1TKH A;  4OC0 A;  3FB3 A;  3VAT A;  2ATR A;  3SJE A;  1YW6 A;  2FSR A;  3FBU A;  3F5B A;  2G3A A;  4YRH A;  1MJA A;  2OZG A;  1XMB A;  2FT0 A;  4FWU A;  4CYN A;  1GYT A;  2O28 A;  3KZW A;  5IX3 A;  4CAX A;  3B3W A;  2Z3O A;  3EFA A;  4Y49 C;  4I49 A;  3LOD A;  4R8F A;  3SXN A;  2Z10 A;  2XEG A;  2IMO A;  5C88 A;  5E96 A;  1I1D A;  3R96 A;  3W6X A;  3DSB A;  1UWY A;  4M6H A;  3SHP A;  2ZPA A;  4CPA A;  1IOF A;  1BPN A;  4F8Z A;  4XNH B;  4FUU A;  1YLO A;  3D3S A;  5K8N A;  1VGY A;  3SJF A;  2Q7B A;  2ZEN A;  5HMN A;  4R9M A;  1K4J A;  3BI0 A;  5HXD A;  3CXS A;  3LAC A;  5AG5 A;  2AE6 A;  1S3Z A;  1ARL A;  3DR8 A;  3PEI A;  4NJQ A;  3R95 A;  2QYV A;  3TOB A;  3BHX A;  2FS5 A;  3JUW A;  3PFE A;  3SJX A;  3KI9 A;  5EMI A;  4AVC A;  3RZA A;  4CYP A;  3KHZ A;  4GS4 A;  4NFR A;  4AVB A;  1JWQ A;  2XEJ A;  3PRT A;  1TKF A;  2JBJ A;  2VI7 A;  4PSW A;  1IY7 A;  2BO9 A;  2ZEO A;  2WYR A;  4J3G A;  4UCN A;  4MHZ A;  1R43 A;  4RS2 A;  2HB6 A;  2ARH A;  4B5P A;  5CBM A;  3TT2 A;  2ZW4 A;  4OIW A;  3A9L A;  4XPL A;  4CGL A;  3TOA A;  1S7K A;  3B8G A;  3PB4 X;  4P44 A;  4NJR A;  4LX9 A;  3V7Z A;  2GU2 A;  2VXK A;  5LRJ A;  1H8L A;  3RBU A;  1FY7 A;  3MRU A;  4X8I A;  3IWE A;  3C26 A;  2G3T A;  4CS0 B;  3L2N A;  2ODF A;  4CAF A;  4H6U A;  3EY5 A;  4PK3 A;  2DEA A;  2J8N A;  4MHP A;  1VHS A;  4H6Z A;  3B3T A;  2FVG A;  4R57 A;  1NMT A;  2I00 A;  1L0C A;  3FRM A;  1R57 A;  4OC4 A;  4II9 A;  2FE7 A;  4GM5 A;  4NF1 A;  4R87 A;  5FVJ A;  4AXV A;  2QML A;  5LYL A;  5AG4 A;  1AMP A;  2IL4 A;  4Q38 A;  5IB0 A;  4QC6 A;  3NH8 A;  2GAN A;  4OLL A;  4U9Y A;  5BWA B;  5J8C A;  4R3L A;  2AFM A;  4LQG A;  1IYK A;  1XEB A;  2B5G A;  2OZU A;  4Y49 B;  1YK3 A;  2YND A;  3KKW A;  4GXH A;  1RO5 A;  4UCM A;  4BBH A;  5HVG A;  2B4B A;  2PQ8 A;  1B6B A;  2GIV A;  1VIX A;  2CNT A;  2B3U A;  3FED A;  2D4P A;  3CDX A;  2CY2 A;  3LD2 A;  4KLV A;  1XE4 A;  4P4I A;  4KOX A;  4UEF A;  2Y0M A;  5KTD A;  3GLJ A;  2PVV A;  2EUI A;  5ISV A;  4NGS A;  3D68 A;  2CTB A;  4EVY A;  1LOK A;  4M85 A;  2PJC A;  3D4U A;  2O4H A;  2JDC A;  3FMC A;  2F8H A;  2OH1 A;  4H89 A;  4CYO A;  2V8V A;  3D7D A;  4KSF A;  2BEI A;  5A28 A;  4JZ0 A;  4OC5 A;  2R98 A;  1OZP A;  3FIX A;  4B6Z A;  4BIN A;  1QST A;  1CG2 A;  2EBJ A;  4M6G A;  4MFL A;  3ISX A;  3IFE A;  3BLN A;  3TO7 A;  4CRZ B;  4CRY B;  4JD6 A;  1M44 A;  2Q04 A;  2C6G A;  3F8K A;  2P6F A;  2R1I A;  2VBQ A;  4KLW A;  1TIQ A;  4L8A A;  5F09 A;  1AYE A;  3PB7 X;  1WWZ A;  4MFZ A;  4PXE A;  2XEI A;  3TX8 A;  2ZXV A;  2FXF A;  2I79 A;  4M6I A;  4RN7 A;  2HQY A;  4MY0 A;  1Z2L A;  2PJ9 A;  3WC6 A;  5IV0 A;  5DS0 A;  1LCP A;  1MJB A;  2QIR A;  1MJ9 A;  8CPA A;  2P6G A;  2POK A;  1YRE A;  2B4D B;  2DPT A;  2Q7S A;  2XEF A;  4MMO A;  3TO6 A;  1BLL E;  3EO4 A;  3S9N A;  4PQA A;  2KCW A;  3CPA A;  4QVT A;  3FYN A;  3B3C A;  4MCR A;  3PFO A;  4HPS A;  1XMT A;  2AFZ A;  1Z8X A;  2P6E A;  4B5O A;  3IU2 A;  1XBU A;  3B7I A;  4NEX A;  3B3V A;  1WK4 A;  4P4B A;  2V77 A;  5G20 A;  2ZEE A;  4EWT A;  2AFO A;  2AFX A;  4YU9 A;  3CPX A;  4NCZ A;  1LAN A;  2PDO A;  2WUU A;  2ZW5 A;  3IC1 A;  5HVF A;  4E8O A;  3PZJ A;  3TFY A;  4ZY2 A;  3P2H A;  2O53 A;  2PJ8 A;  4WJB A;  4OAE A;  4FBE A;  4F0Y A;  1PCA A;  1TF9 A;  3D8P A;  4FD4 A;  3IWG A;  4ZGY B;  4JJX A;  1YGH A;  4PV6 A;  3V8I A;  1M4D A;  4IF5 A;  4OP4 A;  3EXN A;  5J1Q A;  3WC5 A;  4ZX9 A;  1J4J A;  2OR4 A;  3SI2 A;  4F9V A;  2AFU A;  4F9U A;  3FH4 A;  1X12 A;  3GB0 A;  3PBB A;  1HDQ A;  3K9U A;  3NH4 A;  3HLP A;  1U6M A;  2YNC A;  4B11 A;  1IIC A;  4K3N A;  5LYF A;  4KVX A;  4B12 A;  2QEC A;  2EVN A;  3D7F A;  1YQE A;  4KUA A;  4MFP A;  2PR8 A;  1IID A;  3KR4 A;  4KOT A;  3TTH A;  3PP9 A;  3NE8 A;  3KHX A;  4YFJ A;  2PSW A;  1VHE A;  3F0A A;  5AG7 A;  3V38 A;  4A31 A;  3SJG A;  2VL1 A;  3DLJ A;  4JXQ A;  3W91 A;  3DNS A;  4KSI A;  3LMS A;  4H2K A;  4Z65 A;  4ONU A;  4NGM A;  4OC1 A;  2I3C A;  4UIA A;  5EBV A;  1YR0 A;  2BCO A;  2ZEG A;  2NYQ A;  2WSA A;  3B3S A;  3NA6 A;  3FEC A;  3KL9 A;  4NGN A;  2DF5 A;  2ZOF A;  1MK4 A;  3JTK A;  2DXQ A;  1I12 A;  2PRB A;  1Z4E A;  2VEZ A;  2Z3K A;  4PPZ A;  3FF3 A;  3PGP A;  5I0C A;  2K5T A;  4UEZ A;  3NFZ A;  2ZOG A;  4G1P A;  5D29 A;  4X2T A;  3ZJ0 A;  5G22 A;  3QAY A;  1ELM P;  2IQ6 A;  4CGP A;  1KWM A;  4R3K A;  6CPA A;  4E2A A;  4NGR A;  3W6S A;  4C2X A;  4C2Y A;  4AG9 A;  4F0X A;  3KQZ A;  2H5M A;  1HEE A;  2JLM A;  3EC4 A;  2ABZ A;  1P0H A;  1ARM A;  1Y0Y A;  3H5Z A;  2JEV A;  4Q36 A;  3GUX A;  4Q7A A;  4W9Y A;  4X3R A;  1TF8 A;  5J8F A;  1GHE A;  2PE3 A;  2V8H A;  3N7Z A;  1XF8 A;  1Y7R A;  2Q4Z A;  5CNP A;  4B5P B;  4JYW A;  2YNE A;  4ZX8 A;  4OC2 A;  3E0K A;  2HV2 A;  4OME A;  4CAV A;  3LWU A;  4EFD A;  3CXQ A;  3G8W A;  1RTQ A;  4QBJ A;  1Z4R A;  2ZEL A;  3S9M A;  4YGO A;  5JPH A;  2PR1 A;  3QAH A;  4P4J A;  1Y7E A;  2ANP A;  3GKR A;  2PJ0 A;  5EC4 A;  1QQ9 A;  1V0C A;  1NSL A;  2PC1 A;  1XIX A;  2ZEP A;  5G1Z A;  4A94 A;  1PUA A;  2Z3L A;  5IB9 A;  4NSQ A;  2OU2 A;  3D2P A;  4P4E A;  5HVH A;  1QSR A;  3VH9 A;  2J9A A;  4JLY A;  4ZBG A;  1R3N A;  1Z9U A;  3I9S A;  3GIU A;  2NMT A;  3S6G A;  4A30 A;  1M4G A;  1F2O A;  1PYT B;  1ZG7 A;  2B5G B;  2OZH A;  5ELY A;  4CGM A;  1IGB A;  1XJO A;  4IHM A;  2ZEH A;  4UFV A;  4IAV A;  2YGW A;  5LRG A;  2PJ1 A;  3MGD A;  2RB7 A;  2ZEF A;  5F47 A;  3TC8 A;  4CGN A;  3PB9 X;  2ZED A;  2ZW7 A;  4P10 A;  2A4N A;  4KVO E;  2Q51 A;  1BPM A;  4DYO A;  5F49 A;  2Z3N A;  1KUX A;  3WT4 A;  4B10 A;  3KGQ A;  4UA3 A;  5K8P A;  4R76 A;  2GLJ A;  4MBU A;  4ZYQ A;  1FT7 A;  2YNC C;  3OWC A;  4L89 A;  3QNV A;  4PXD A;  3T8W A;  4B14 A;  4CAW A;  4UCP A;  4F6A A;  3MN8 A;  2ZEM A;  2P0W A;  1Y0R A;  3R1K A;  4DUK A;  5LYD A;  1CP7 A;  2RFH A;  4XNH C;  1N71 A;  4U5Y A;  1Z8T A;  1YME A;  1XFO A;  2Z0Z A;  4NGT A;  1NSA A;  3IJ3 A;  2PIZ A;  2Q4Y A;  4KUB A;  5THW A;  4CYQ A;  4BD9 A;  5JQ4 A;  4C2Z A;  5DWN A;  4ZY1 A;  1B87 A;  1S60 A;  2BL1 A;  1NE9 A;  1Q7L A;  4E0A A;  2QVP A;  2Z3P A;  1YVO A;  4UFW A;  2EWB A;  2CNS A;  3IWW A;  4X5K A;  2PJ3 A;  1YLE A;  4UWI A;  3TCV A;  1IB1 E;  3VAR A;  1Y9W A;  4HNY B;  1ZG9 A;  3S9L A;  4FAI A;  3WC7 A;  1LFW A;  2GRE A;  4HKF A;  4TNU A;  3T9Y A;  2Q43 A;  4A32 A;  3IIB A;  1BO4 A;  3FX6 A;  2JDD A;  4LQ6 A;  1A2Z A;  4KOV A;  4NXY A;  3TE4 A;  1CPX A;  1S5K A;  2CTC A;  4A95 A;  2PJ2 A;  1UFH A;  2C1C A;  3I1U A;  3FNC A;  3ISZ A;  3RO0 A;  1Y9K A;  2R8V A;  2V8G A;  3D67 A;  3QB8 A;  2RC4 A;  5AGE A;  1X10 A;  3N5F A;  4WWV A;  5C82 A;  3S6H A;  3RNZ A;  1VHO A;  2PVW A;  3IEH A;  4MXU A;  4ZY0 A;  5G21 A;  5JH9 A;  3H8F A;  5H84 A;  5I4M A;  4A33 A;  5D8N A;  1VKC A;  2FIA A;  2Q4V A;  2PJ4 A;  2REF A;  4MFQ A;  1S7L A;  4OC3 A;  1CBX A;  5KTC A;  2JEW A;  5KTA A;  4XPD C;  3S6K A;  4NGQ A;  5LRK A;  2HUZ A;  3FXT A;  3PBE A;  1F2P A;  1Q2C A;  2B58 A;  4PK2 A;  4P45 A;  4C7I A;  2J8M A;  1JQG A;  4KZT A;  2GLF A;  2PJA A;  3VWE A;  2OB0 A;  2R7H A;  4XPK A;  3BJ8 A;  5GCN A;  5K8M A;  1ZO0 A;  3NE7 A;  1KZF A;  2OOT A;  1RXT A;  5H86 A;  4KOY A;  4P4F A;  4OAD A;  1XRY A;  4EME A;  2J8R A;  4K30 A;  4C7H A;  4P4D A;  3IO1 A;  1CX8 A;  3GY9 A;  4YWY A;  1YX0 A;  5JM6 A;  4UIB A;  1KUY A;  2D4O A;  2PCU A;  4KOU A;  3D2M A;  1Z8L A;  1BAV A;  4IUS A;  4AG7 A;  2C27 A;  2F7V A;  3H4Q A;  2JBK A;  4UEE A;  4JWP A;  3FEE A;  3K2K A;  1I21 A;  4MFJ A;  2VQY A;  3I3G A;  1OBR A;  1QSO A;  2Q0Y A;  1ZLH A;  4DNC A;  3RYO A;  1AUG A;  3UY5 A;  3DGV A;  2BOA A;  4QB9 A;  4A37 A;  1CP6 A;  5AG6 A;  2PJ6 A;  4FD5 A;  3PB6 X;  4TWE A;  3R9G A;  2AFS A;  2PJB A;  1M1D A;  4C68 A;  1ZG8 A;  1HDU A;  1QSM A;  4CGO A;  3WR7 A;  2C6P A;  3SI1 A;  2CIJ A;  1KUV A;  1YW4 A;  5CPA A;  1Q2Y A;  4RUH A;  1QMU A;  4HNW B;  2F5I A;  1YSJ A;  2X7B A;  2WPW A;  1DE4 C;  3HUV A;  4QUS A;  3D7G A;  2NSM A;  3DDD A;  4MCP A;  2DPS A;  1Z8W A;  2VZY A;  3WAB A;  2FL4 A;  2Q44 A;  3H8G A;  1CM0 A;  4OID A;  4U9Z A;  1S7N A;  4MCQ A;  4MFK A;  4MHY A;  2AJ6 A;  1F57 A;  5LYI A;  4MY3 A;  4MHD A;  1IOI A;  3KR5 A;  3G3S A;  3DR6 A;  1S7F A;  1SQH A;  4JXR A;  2IJZ A;  4UFX A;  4FD7 A;  4XPD B;  2V8D A;  3P2F A;  1FNO A;  2GFQ A;  2PJ7 A;  4R7M A;  2REE A;  3B2Y A;  3D66 A;  3IU1 A;  2CXA A;  4A2Z A;  2BSW A;  3BJ7 A;  1LAP A;  4O23 A;  1M4I A;  5DWM A;  2BUE A;  2C6C A;  3NH5 A;  2QJ8 A;  3B35 A;  3RAM A;  1LRZ A;  4KOR A;  4IK2 A;  7CPA A;  2PJ5 A;  4UF4 A;  4PXB A;  3D7H A;  1LAM A;  4R6T A;  3FVL A;  3SI0 A;  3T90 A;  2WZN A;  1ELL P;  4MRI A;  2Z11 A;  4AVA A;  1Q2D A;  2CF4 A;  1CJW A;  2PIY A;  2Z3M A;  2G9D A;  4KOS A;  3VWD A;  3JVN A;  1ON0 A;  1IYL A;  2PRQ A;  3KAS A;  4M3S A;  4PSX A;  2AFW A;  3TO9 A;  5JGF A;  4A38 A;  1DTD A;  2G0B A;  4ORF A;  4KVM E;  3CXP A;  3GYA A;  2B3V A;  4MCS A;  4UBR A;  3SXO A;  1Z5R A;  5F46 A;  1CPS A;  2VZZ A;  3JRU A;  3K9T A;  4DJL A;  3PB8 X;  3KQX A;  1XOV A;  2B4D A;  5K8O A;  4KSA A;  4LUA A;  4MHN A;  1YVK A;  2EO8 A;  2FIW A;  3R9F A;  2HC9 A;  1M4L A;  3ZZI A;  3CT9 A;  4CAE A;  1PU9 A;  3BI1 A;  2CNM A;  4ONW A;  4RI1 A;  4FD6 A;  5HH1 A;  1P4N A;  3S6F A;  2ZW6 A;  1IU8 A;  2WPX A;  3R9E A;  1TKJ A;  4BMH A;  3CZX A;  3IGR A;  4KOW A;  4NGP A;  2FCK A;  4KS9 A;  4HNX B;  4ZI6 A;  1BOB A;  4P6Y A;  4MI4 A;  4OKO A; 
#chains in the Genus database with same CATH homology
 1EE3 P;  4PXC A;  1TXR A;  1ZLI A;  4A39 A;  3H8E A;  2EK9 A;  3BXM A;  3FJU A;  2EK8 A;  1TKH A;  4OC0 A;  3VAT A;  3SJE A;  1YW6 A;  4FWU A;  1XMB A;  1GYT A;  3KZW A;  3B3W A;  4R8F A;  2XEG A;  2IMO A;  1UWY A;  4CPA A;  1BPN A;  4F8Z A;  4FUU A;  1YLO A;  5K8N A;  1VGY A;  3SJF A;  2ZEN A;  5HXD A;  3BI0 A;  4NJQ A;  1ARL A;  3PEI A;  2QYV A;  3BHX A;  3PFE A;  3SJX A;  3KI9 A;  3RZA A;  3KHZ A;  4NFR A;  2XEJ A;  3PRT A;  1TKF A;  2JBJ A;  1IY7 A;  2BO9 A;  2ZEO A;  2WYR A;  4MHZ A;  1R43 A;  5CBM A;  2HB6 A;  4OIW A;  3PB4 X;  4P44 A;  4NJR A;  3V7Z A;  2GU2 A;  5LRJ A;  1H8L A;  3RBU A;  3MRU A;  4X8I A;  3L2N A;  2DEA A;  4MHP A;  3B3T A;  2FVG A;  4OC4 A;  4GM5 A;  4AXV A;  5LYL A;  1AMP A;  3NH8 A;  2AFM A;  4LQG A;  5HVG A;  1VIX A;  3FED A;  3CDX A;  4P4I A;  4UEF A;  3GLJ A;  2PVV A;  4NGS A;  3D68 A;  2CTB A;  1LOK A;  2PJC A;  3D4U A;  2O4H A;  3FMC A;  2F8H A;  2V8V A;  3D7D A;  4JZ0 A;  4OC5 A;  4B6Z A;  1CG2 A;  3ISX A;  3IFE A;  2C6G A;  5F09 A;  1AYE A;  3PB7 X;  4PXE A;  2XEI A;  3TX8 A;  1Z2L A;  2PJ9 A;  3WC6 A;  5DS0 A;  1LCP A;  8CPA A;  2POK A;  2XEF A;  4MMO A;  1BLL E;  3S9N A;  4PQA A;  3CPA A;  3B3C A;  4MCR A;  3PFO A;  2AFZ A;  1XBU A;  3B7I A;  3B3V A;  4P4B A;  2V77 A;  2ZEE A;  4EWT A;  2AFO A;  2AFX A;  4YU9 A;  3CPX A;  3RAM A;  1LAN A;  3IC1 A;  5HVF A;  4ZY2 A;  2O53 A;  2PJ8 A;  4WJB A;  4FBE A;  1PCA A;  1TF9 A;  4OP4 A;  5J1Q A;  3WC5 A;  4ZX9 A;  2OR4 A;  3SI2 A;  4F9V A;  2AFU A;  4F9U A;  3FH4 A;  3GB0 A;  3PBB A;  1HDQ A;  3NH4 A;  5LYF A;  3HLP A;  4K3N A;  3D7F A;  3KR4 A;  3KHX A;  1VHE A;  3V38 A;  3SJG A;  2VL1 A;  3DLJ A;  4KSI A;  3LMS A;  4H2K A;  4Z65 A;  4NGM A;  4OC1 A;  2I3C A;  4UIA A;  2BCO A;  2ZEG A;  2NYQ A;  3B3S A;  3NA6 A;  3FEC A;  3KL9 A;  4NGN A;  2ZOF A;  4PPZ A;  3FF3 A;  4UEZ A;  3NFZ A;  2ZOG A;  4G1P A;  5D29 A;  4X2T A;  1ELM P;  2IQ6 A;  6CPA A;  1KWM A;  4NGR A;  3KQZ A;  1HEE A;  2ABZ A;  1ARM A;  1Y0Y A;  4W9Y A;  3GUX A;  4Q7A A;  4X3R A;  1TF8 A;  2PE3 A;  2V8H A;  2Q4Z A;  4JYW A;  4ZX8 A;  4OC2 A;  4OME A;  3LWU A;  4EFD A;  1RTQ A;  2ZEL A;  3S9M A;  4P4J A;  1Y7E A;  2ANP A;  2PJ0 A;  1QQ9 A;  2ZEP A;  4A94 A;  5IB9 A;  4P4E A;  5HVH A;  3VH9 A;  2J9A A;  1R3N A;  1F2O A;  1PYT B;  1ZG7 A;  5ELY A;  1IGB A;  1XJO A;  4IHM A;  2ZEH A;  4IAV A;  5LRG A;  2PJ1 A;  2RB7 A;  2ZEF A;  3TC8 A;  3PB9 X;  2ZED A;  4P10 A;  2Q51 A;  1BPM A;  4DYO A;  3WT4 A;  3KGQ A;  5K8P A;  4R76 A;  2GLJ A;  4ZYQ A;  1FT7 A;  4PXD A;  3T8W A;  3QNV A;  3MN8 A;  2ZEM A;  1Y0R A;  4DUK A;  5LYD A;  1CP7 A;  2RFH A;  1YME A;  1XFO A;  4NGT A;  1NSA A;  3IJ3 A;  2PIZ A;  5THW A;  4BD9 A;  4ZY1 A;  1Q7L A;  2QVP A;  2EWB A;  3IWW A;  2PJ3 A;  3VAR A;  1ZG9 A;  3S9L A;  4FAI A;  3WC7 A;  1LFW A;  2GRE A;  4TNU A;  2Q43 A;  3IIB A;  3FX6 A;  1CPX A;  2CTC A;  2PJ2 A;  2C1C A;  3I1U A;  3ISZ A;  2V8G A;  3D67 A;  3N5F A;  4WWV A;  4ZY0 A;  1VHO A;  2PVW A;  3IEH A;  4MXU A;  5JH9 A;  3H8F A;  5I4M A;  5D8N A;  2PJ4 A;  4OC3 A;  1CBX A;  2JEW A;  4NGQ A;  5LRK A;  3PBE A;  1F2P A;  4P45 A;  1JQG A;  2PJA A;  2GLF A;  5K8M A;  2OOT A;  4P4F A;  1XRY A;  4EME A;  4P4D A;  3IO1 A;  1CX8 A;  4YWY A;  5JM6 A;  4UIB A;  2PCU A;  1Z8L A;  1BAV A;  2F7V A;  2JBK A;  4UEE A;  3FEE A;  3K2K A;  1OBR A;  1ZLH A;  3DGV A;  2BOA A;  4A37 A;  1CP6 A;  2PJ6 A;  3PB6 X;  4TWE A;  2AFS A;  2PJB A;  1ZG8 A;  1HDU A;  2C6P A;  3SI1 A;  2CIJ A;  1YW4 A;  5CPA A;  4RUH A;  1QMU A;  1YSJ A;  1DE4 C;  3HUV A;  3D7G A;  2NSM A;  4MCP A;  3WAB A;  3H8G A;  4OID A;  4MCQ A;  4MHY A;  1F57 A;  5LYI A;  3KR5 A;  2IJZ A;  2V8D A;  1FNO A;  2PJ7 A;  4R7M A;  3B2Y A;  3D66 A;  1LAP A;  4O23 A;  2C6C A;  3NH5 A;  2QJ8 A;  3B35 A;  7CPA A;  4IK2 A;  2PJ5 A;  4UF4 A;  4PXB A;  3D7H A;  1LAM A;  4R6T A;  3FVL A;  3SI0 A;  2WZN A;  1ELL P;  4MRI A;  2CF4 A;  2PIY A;  2G9D A;  2PRQ A;  3KAS A;  2AFW A;  5JGF A;  4A38 A;  1DTD A;  4MCS A;  1Z5R A;  1CPS A;  3JRU A;  3K9T A;  4DJL A;  3PB8 X;  3KQX A;  5K8O A;  4MHN A;  2HC9 A;  1M4L A;  3CT9 A;  3BI1 A;  4ONW A;  1TKJ A;  4NGP A;  4ZI6 A;  4P6Y A;  4OKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...