3B3SA

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 119
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3sA00
3IO1A 2PJ7A 8CPAA 3BI0A 4FBEA 2XEJA 4R8FA 4WWVA 3ISXA 3FJUA 5HVGA 2NSMA 3S9MA 3B3TA 1CG2A 2AFUA 2AFXA 4P4BA 3PEIA 4NGSA 1NSAA 2PJBA 4A37A 1TKFA 4NFRA 3KQZA 5LRGA 3H8EA 5HXDA 2WZNA 4OIDA 3SJEA 4MCPA 4YWYA 1ARLA 2C6GA 2PVWA 1LAPA 3IFEA 2ZOGA 4AXVA 2GLJA 3IC1A 3NH8A 4IHMA 4O23A 2JBKA 3KI9A 1BLLE 1UWYA 3DGVA 4X8IA 5I4MA 2XEGA 1LFWA 2PJAA 3RZAA 2V77A 1IY7A 3CT9A 1VGYA 3FEEA 4ZI6A 3B3SA 3ISZA 4H2KA 3PB6X 2F8HA 4UEFA 3SJGA 4IAVA 1TKJA 3LWUA 4OC3A 2O4HA 1ZLHA 3WC6A 2ZEHA 1CP7A 3IJ3A 3GLJA 1Z5RA 2PJ3A 3PBBA 1CPSA 2ZENA 5CBMA 2PE3A 5K8OA 1CP6A 4B6ZA 2ZOFA 4PXDA 3VARA 3IEHA 3T8WA 4JYWA 2EWBA 4NGRA 1TF9A 5DS0A 4R6TA 3D68A 4MHYA 4IK2A 4NGNA 1HEEA 2CIJA 6CPAA 4F8ZA 1CX8A 3TX8A 3PFOA 2XEFA 3V7ZA 1M4LA 1Y0RA 4JZ0A 5HVFA 4ZX9A 4OMEA 2EK8A 4MCRA 4ONWA 3D66A 2PJ0A 5CPAA 1PYTB 2Q51A 4MHNA 4ZY2A 1AMPA 3K9TA 1LCPA 3IWWA 3PFEA 4OC2A 1VHOA 2CF4A 2PJ8A 4FAIA 3WC5A 2QVPA 1LANA 1Y0YA 1TXRA 3K2KA 3CDXA 4LQGA 3B35A 4FUUA 3KL9A 5K8MA 1R3NA 2PVVA 3D7GA 2BOAA 3KZWA 4Z65A 2G9DA 2GREA 3V38A 4GM5A 3FVLA 1KWMA 1RTQA 2BCOA 4PQAA 1CBXA 1Z8LA 2EK9A 3D7HA 2Q4ZA 4KSIA 3B7IA 3CPXA 2J9AA 1GYTA 4OC4A 3WC7A 3FMCA 4A94A 2HB6A 4F9VA 3KHXA 3MN8A 4NJRA 3S9NA 5JM6A 1CPXA 4NGQA 5LRKA 3KASA 3FEDA 3D7FA 2ZEFA 3FH4A 4K3NA 3DLJA 2AFWA 4P4JA 3KQXA 1JQGA 4OC5A 2FVGA 4P44A 4OC0A 4EFDA 2Q43A 3JRUA 1ELMP 4MCSA 4FWUA 4MCQA 2PIYA 4X3RA 2AFSA 4MRIA 1Y7EA 4NGPA 2PJ2A 3KR5A 2ZELA 5LYDA 3HLPA 4DUKA 2PJ9A 2HC9A 4NGMA 1HDUA 2DEAA 1HDQA 4UEEA 1ZLIA 5K8PA 1FT7A 3SI2A 2C1CA 2PJCA 3RBUA 5IB9A 1LOKA 4OC1A 1FNOA 3PBEA 4W9YA 3BI1A 1XFOA 4TNUA 3VATA 5F09A 2ZEDA 5THWA 4PXBA 3SJFA 4EMEA 3RAMA 1BAVA 4X2TA 1DTDA 1YMEA 3B2YA 3SJXA 2AFOA 3GUXA 4A38A 3I1UA 4P10A 2ZEPA 2ABZA 3B3CA 5JGFA 1F57A 2PJ6A 1BPMA 2JBJA 3PRTA 3LMSA 4PPZA 2PCUA 3SI1A 4DYOA 4F9UA 5J1QA 2PJ4A 5D8NA 2V8GA 4PXCA 2PRQA 1XJOA 3CPAA 4NGTA 4OIWA 4ZY0A 3GB0A 3VH9A 2F7VA 7CPAA 1ZG9A 3FF3A 4P4DA 4MMOA 4NJQA 3KR4A 4Q7AA 1ELLP 2CTBA 4MHZA 2C6PA 4ZY1A 2BO9A 4UEZA 3IIBA 2O53A 5LYLA 4DJLA 1XRYA 3BXMA 1QMUA 3WABA 4MHPA 2ZEOA 2V8VA 1TKHA 3D67A 1QQ9A 1YW4A 3PB9X 3PB4X 2POKA 2IQ6A 3NFZA 2ZEGA 3D4UA 1ARMA 1XBUA 4ZYQA 4OKOA 1F2PA 1AYEA 3NH5A 2WYRA 3FECA 3TC8A 5D29A 3PB8X 4PXEA 4P45A 2XEIA 3FX6A 2PJ1A 4UF4A 4R76A 5JH9A 1VHEA 4BD9A 5LYIA 5LRJA 3MRUA 1YW6A 3S9LA 4CPAA 4P4IA 5LYFA 1ZG7A 2GU2A 5ELYA 4YU9A 3H8FA 1OBRA 3B3VA 4OP4A 2IMOA 2IJZA 4P6YA 2C6CA 3SI0A 3WT4A 2AFZA 2JEWA 3B3WA 2QJ8A 2I3CA 2QYVA 2RFHA 5HVHA 2V8HA 2V8DA 4A39A 2ZEMA 1VIXA 4P4EA 4TWEA 4WJBA 2VL1A 4MXUA 3H8GA 2OR4A 3L2NA 3N5FA 1Q7LA 1EE3P 2PJ5A 2CTCA 5K8NA 2OOTA 1H8LA 2GLFA 2ZEEA 3PB7X 3KHZA 1LAMA 4EWTA 4RUHA 3QNVA 1F2OA 1TF8A 1IGBA 1R43A 1Z2LA 1DE4C 1XMBA 1YSJA 3BHXA 2AFMA 2NYQA 4P4FA 1YLOA 3NA6A 1PCAA 3D7DA 4UIBA 2ANPA 4R7MA 3NH4A 4UIAA 2PIZA 2RB7A 4ZX8A 1BPNA 1ZG8A 3KGQA 4G1PA 3HUVA
chains in the Genus database with same CATH superfamily
3TE4A 4FD7A 3IO1A 2PJ7A 8CPAA 3BI0A 1M4GA 4FBEA 2BSWA 1KUVA 2XEJA 3W91A 4R8FA 2ZW7A 4MFQA 4WWVA 3ISXA 3FJUA 4MY0A 5HVGA 2NSMA 2GANA 1QSOA 3S9MA 3B3TA 1S7FA 4B14A 1CG2A 2AFUA 2AFXA 3LODA 3PEIA 4P4BA 4X5KA 1NE9A 4NGSA 4A33A 1NSAA 2PJBA 1XEBA 1TKFA 4A37A 4KVXA 4NFRA 2B4BA 3KQZA 4QBJA 5EC4A 3JVNA 5LRGA 3H8EA 5HXDA 3G3SA 2WZNA 4MFJA 4OIDA 3SJEA 4CYOA 3JUWA 4MCPA 4AVAA 3OWCA 2J8MA 1N71A 1QSNA 4YWYA 1ARLA 2ZPAA 4M6IA 2C6GA 3W6SA 2PVWA 1LAPA 4KSFA 3IFEA 4MFKA 1IICA 2ZOGA 4KOSA 3N7ZA 2AE6A 4R87A 2GLJA 3IC1A 5GCNA 4A2ZA 4AXVA 3R95A 3NH8A 2REFA 4IHMA 4O23A 2R7HA 4U5YA 2JBKA 2HQYA 3KI9A 4AG9A 1BLLE 1UWYA 3DGVA 3FXTA 4X8IA 5I4MA 2XEGA 2B3VA 1OZPA 3P2FA 5KTAA 5KTDA 1LFWA 2PJAA 3QAYA 3RZAA 2V77A 1IY7A 3R9EA 3CT9A 1VGYA 3FEEA 4ZI6A 3B3SA 3ISZA 4XNHC 4AVCA 4H2KA 1FY7A 2F8HA 2OB0A 3PB6X 3A9LA 4H89A 4LUAA 3TOAA 3NE7A 4CYQA 4AVBA 4UEFA 3GYAA 3SJGA 4IAVA 3SXNA 3S6HA 1S5KA 1TKJA 3LWUA 4OC3A 4MY3A 3DSBA 2GFQA 2FIWA 2O4HA 3IU2A 1YR0A 1ZLHA 4XPKA 3WC6A 2ZEHA 1SQHA 1CP7A 2P0WA 4JJXA 4A32A 4B10A 3IJ3A 4QB9A 3R9FA 2Z3PA 3TTHA 3GLJA 4MFLA 2EUIA 2Q0YA 5J8CA 4YGOA 1Z5RA 2I79A 4HNWB 2PJ3A 3PBBA 1CPSA 2YNCC 4FD6A 2ZENA 5CBMA 3W6XA 2D4OA 2PE3A 1L0CA 5K8OA 1CP6A 4XNHB 4B6ZA 1I21A 3ZJ0A 1YLEA 1Z8TA 4KSAA 2ZOFA 2ZW5A 4UCPA 4A30A 1UFHA 3IWEA 3FIXA 4PXDA 2FSRA 3VARA 4PV6A 4CGNA 2Z3MA 3IEHA 4Q38A 3T8WA 4JYWA 2Z10A 2EWBA 4NGRA 1S7KA 1TF9A 4E8OA 5CNPA 1LRZA 2C27A 3QAHA 5DS0A 4R6TA 3D68A 2B3UA 4IK2A 4MHYA 1VHSA 4NGNA 1HEEA 2VQYA 2CIJA 1PU9A 2P6FA 6CPAA 4F8ZA 3WR7A 4KUAA 5IB0A 1CX8A 2WPWA 3TX8A 3PFOA 1P4NA 4IF5A 1YGHA 2XEFA 2Q44A 1M4LA 3G8WA 3V7ZA 4B5PA 2GIVA 2HV2A 4CYNA 1V0CA 4F6AA 1Y0RA 4JZ0A 5HVFA 1BOBA 4B12A 4ZX9A 4OMEA 4E2AA 2EK8A 1Z4EA 2NMTA 4MCRA 4NF1A 4ONWA 4BBHA 3D66A 2PJ0A 4GS4A 5CPAA 4KLVA 5I0CA 2D4PA 1BO4A 1PYTB 1X10A 3F8KA 2Q51A 1IYLA 2JEVA 4MHNA 4K30A 4HPSA 2DPSA 4ZY2A 1P0HA 1AMPA 1Z9UA 3K9TA 1LCPA 3IWWA 5C88A 5H86A 3PFEA 1IU8A 4OC2A 4DNCA 1VHOA 2CF4A 2PJ8A 4CRYB 3WC5A 4FAIA 2O28A 2QVPA 1LANA 1Y0YA 1A2ZA 1TXRA 3K2KA 4KS9A 3CDXA 5A28A 4R9MA 4KUBA 4LQGA 4M6GA 1X12A 3B35A 2YGWA 4FUUA 4ONUA 1B6BA 3EC4A 2VZZA 3D2MA 4UCMA 3KL9A 3VWEA 5HMNA 2J8RA 2PC1A 2A4NA 5K8MA 1R3NA 5FVJA 2PVVA 2AJ6A 4PSWA 5F49A 3DNSA 3D7GA 2BOAA 1XF8A 3KZWA 3TO7A 2G9DA 2GREA 4Y49B 3CXSA 1IIDA 4F0XA 4Z65A 4CGMA 3DR8A 4GM5A 3V38A 3KKWA 3FVLA 1KZFA 5AG5A 1KWMA 2JLMA 1IB1E 3NE8A 5F47A 1YVKA 1RTQA 4J3GA 4JLYA 4H6UA 2BCOA 1CJWA 4PQAA 4C7IA 1CBXA 1Z8XA 4I49A 1NSLA 3TFYA 2ARHA 1Z8LA 2EK9A 3D7HA 2Q4ZA 4R3KA 4KSIA 3B7IA 4BINA 2FT0A 3CPXA 3LD2A 2J9AA 2PRBA 4FD4A 1GYTA 4OC4A 3WC7A 3IGRA 2Y0MA 2B4DB 3FMCA 4A94A 4QC6A 2HB6A 4CAWA 4F9VA 4B11A 1IYKA 3KHXA 2HUZA 3MN8A 4LX9A 4MBUA 2JDCA 2ODFA 4NJRA 3S9NA 4UFVA 4RI1A 1CPXA 2JDDA 4NGQA 4A31A 5DWMA 3CXPA 3ZZIA 5JM6A 5LRKA 3KASA 3FEDA 4A95A 1Q2DA 4R57A 4Q36A 4AB7A 5G22A 4IUSA 2X7BA 3D7FA 5JQ4A 2ZEFA 3FH4A 4GXHA 4K3NA 2ZXVA 3DLJA 2AFWA 3BLNA 4P4JA 4ORFA 3KQXA 5G20A 4MFZA 1JQGA 4OC5A 1M44A 2FVGA 4P44A 4UFXA 4OC0A 2Z3KA 3DR6A 2FS5A 1Y9KA 1I1DA 1MJBA 2B4DA 4EFDA 5G21A 1XMTA 1B87A 4L89A 2Q43A 3JRUA 1ELMP 4MCSA 4FWUA 2B58A 4MCQA 3S6FA 4CGOA 2PIYA 1YQEA 2OZUA 2AFSA 4X3RA 2Q04A 2PDOA 1Y7EA 3C26A 4MRIA 3PZJA 4NGPA 5F46A 2PJ2A 1YK3A 3R96A 3KR5A 3D8PA 2ZELA 3K9UA 3HLPA 5LYDA 4B5OA 4DUKA 4II9A 2PJ9A 3D2PA 2I00A 2QMLA 4JD6A 3VWDA 2HC9A 4L8AA 4NGMA 1HDUA 2DEAA 1HDQA 4UEEA 2F5IA 2H5MA 1ZLIA 3I9SA 1WWZA 3FYNA 5K8PA 5C82A 1FT7A 1R57A 2RC4A 2BEIA 3SI2A 2C1CA 1XE4A 2PJCA 3RBUA 2CY2A 1LOKA 5IB9A 4OC1A 2R98A 2OZHA 2Q4VA 2G3AA 1FNOA 4ZGYB 3PBEA 4W9YA 4OAEA 2VXKA 3BI1A 1XFOA 2Z0ZA 4TNUA 3VATA 4NJQA 2G3TA 4UFWA 5F09A 2ZEDA 5AG7A 2R8VA 1ON0A 2VBQA 3FB3A 4PXBA 5THWA 3RYOA 3SJFA 4EMEA 3RAMA 1BAVA 3LACA 1XOVA 4X2TA 4CGPA 1DTDA 2FCKA 1Y9WA 1YMEA 3B2YA 3FRMA 3SJXA 4CGLA 2AFOA 3GUXA 4A38A 3I1UA 2KCWA 2ZEPA 4P10A 3T90A 5JPHA 2ABZA 3B3CA 2BUEA 2FXFA 1F57A 2PJ6A 3DDDA 3PGPA 4QUSA 2PQ8A 5JGFA 1BPMA 1KUYA 2JBJA 2YNCA 3PRTA 3LMSA 4PPZA 2PCUA 4KOUA 3H5ZA 3SI1A 4C2XA 2EVNA 2P6EA 3SHPA 3MGDA 1TIQA 3CXQA 4DYOA 4F9UA 5J1QA 2PJ4A 5D8NA 2V8GA 4PXCA 5DWNA 2PRQA 1XJOA 2WPXA 3CPAA 5AG4A 3EFAA 2YNDA 1JWQA 1MJAA 2CNSA 5IX3A 4NGTA 4H6ZA 2EBJA 2P6GA 3GB0A 4OIWA 2B5GB 2VI7A 3VH9A 4ZY0A 4KOXA 2F7VA 3B8GA 1YX0A 1Z4RA 5H84A 4CS0B 2OZGA 4UWIA 1QSRA 1RO5A 2IL4A 4KLWA 7CPAA 1Q2YA 1ZG9A 3FF3A 2CNMA 3I3GA 4P4DA 3EO4A 1AUGA 1PUAA 2FE7A 2Q7SA 3IU1A 3KR4A 4KOYA 4KOVA 4MMOA 1ELLP 2G0BA 4Q7AA 5G1ZA 4CAVA 2CTBA 4MHZA 2C6PA 4ZY1A 4YRHA 4BMHA 2BO9A 3GIUA 4UEZA 3IIBA 4PK3A 2O53A 2EO8A 2PSWA 5EMIA 2Q7BA 3EY5A 4DJLA 5LYLA 3BJ8A 1XRYA 3TO9A 4NCZA 2VZYA 3BXMA 1QMUA 3WABA 5F48A 4MHPA 4NEXA 4CAEA 2ZEOA 2Z3LA 4F0YA 5IV0A 2B5GA 2FL4A 1U6MA 2V8VA 1TKHA 3S6GA 1M4IA 4M85A 1CM0A 5HH1A 3TT2A 2GE3A 3D67A 1QQ9A 1YW4A 3PB9X 3PB4X 1GHEA 1XIXA 4B13A 3QB8A 2CNTA 1WK4A 4C68A 4YFJA 2POKA 4PSXA 2IQ6A 3R9GA 4CAFA 3IWGA 4MI4A 3NFZA 2ZEGA 3D4UA 3RNZA 4CYPA 1ARMA 1XBUA 4ZYQA 4OKOA 2DF5A 1F2PA 2WSAA 1AYEA 1J4JA 4RN7A 2OU2A 2QIRA 3D3SA 3NH5A 2WYRA 3FECA 2FIAA 4NXYA 3TC8A 5A27A 5AGEA 2CXAA 5D29A 1QSMA 2Z11A 3PB8X 4PXEA 3FBUA 4P45A 2XEIA 3FX6A 1S7NA 2PJ1A 4UF4A 4R76A 4CAXA 3R1KA 1NMTA 4JXQA 5J8FA 3GKRA 5JH9A 1VHEA 4BD9A 3S6KA 4UBRA 4R3LA 4KOWA 3PP9A 5LYIA 1S7LA 2YNEA 5LRJA 3MRUA 4AG7A 1YW6A 3S9LA 4KORA 4CPAA 4P4IA 1M4DA 5LYFA 4HNXB 1Y7RA 1ZG7A 2GU2A 2DPTA 5ELYA 1K4JA 4JWPA 4YU9A 2ZW4A 3H8FA 1OBRA 5KTCA 3B3VA 4OP4A 2IMOA 2IJZA 3BJ7A 2C6CA 4P6YA 3SI0A 3WT4A 2AFZA 3SXOA 2JEWA 3B3WA 2QECA 2QJ8A 2I3CA 2QYVA 4B5PB 4JXRA 2RFHA 5HVHA 4KVME 3F0AA 2Q4YA 3T9YA 1M1DA 1MK4A 4KOTA 2V8HA 4C7HA 2VEZA 2ATRA 1MJ9A 1S3ZA 2V8DA 1KUXA 3GY9A 4A39A 2ZEMA 1VIXA 4P4EA 4UA3A 4TWEA 4WJBA 2VL1A 4MXUA 1I12A 2OR4A 3CZXA 3H8GA 4MFPA 3L2NA 3N5FA 1Q7LA 3UY5A 5BWAB 1EE3P 5AG6A 4E0AA 4KZTA 2PJ5A 3JTKA 2CTCA 5K8NA 1QSTA 4XPDC 2OOTA 4CRZB 1H8LA 4NSQA 1RXTA 3FNCA 4HKFA 5E96A 4C2YA 1S60A 2GLFA 4KVOE 2ZEEA 4QVTA 4FD5A 4OADA 3TO6A 4RS2A 4M3SA 3H4QA 2R1IA 3PB7X 1YVOA 2BL1A 4EVYA 4LQ6A 3KHZA 1LAMA 1IOFA 4EWTA 2ZW6A 3QNVA 4RUHA 4U9ZA 3TOBA 1F2OA 4UWJA 4HNYB 2DXQA 3F5BA 1IOIA 1TF8A 1Q2CA 1IGBA 3V8IA 1R43A 1Z2LA 3E0KA 3P2HA 1DE4C 1XMBA 1YSJA 2PR8A 2J8NA 3BHXA 4M6HA 2PR1A 4ZBGA 1VKCA 2AFMA 1YREA 2NYQA 4P4FA 2OH1A 2REEA 2Z3NA 1YLOA 5EBVA 5ISVA 3NA6A 4Y49C 4MJ8A 3EXNA 1PCAA 3D7DA 4XPDB 2Z3OA 4UIBA 4C2ZA 4UCNA 2ANPA 4R7MA 3NH4A 4U9YA 4XPLA 4UIAA 1ZO0A 2PIZA 2RB7A 2WUUA 4ZX8A 1BPNA 1ZG8A 3KGQA 4PK2A 4MHDA 1Z8WA 4G1PA 3RO0A 3TCVA 3HUVA 4OLLA 2K5TA
chains in the Genus database with same CATH topology
3IO1A 2PJ7A 8CPAA 3BI0A 4FBEA 2XEJA 4R8FA 4WWVA 3ISXA 3FJUA 5HVGA 2NSMA 3S9MA 3B3TA 1CG2A 2AFUA 2AFXA 4P4BA 3PEIA 4NGSA 1NSAA 2PJBA 4A37A 1TKFA 4NFRA 3KQZA 5LRGA 3H8EA 5HXDA 2WZNA 4OIDA 3SJEA 4MCPA 4YWYA 1ARLA 2C6GA 2PVWA 1LAPA 3IFEA 2ZOGA 4AXVA 2GLJA 3IC1A 3NH8A 4IHMA 4O23A 2JBKA 3KI9A 1BLLE 1UWYA 3DGVA 4X8IA 5I4MA 2XEGA 1LFWA 2PJAA 3RZAA 2V77A 1IY7A 3CT9A 1VGYA 3FEEA 4ZI6A 3B3SA 3ISZA 4H2KA 3PB6X 2F8HA 4UEFA 3SJGA 4IAVA 1TKJA 3LWUA 4OC3A 2O4HA 1ZLHA 3WC6A 2ZEHA 1CP7A 3IJ3A 3GLJA 1Z5RA 2PJ3A 3PBBA 1CPSA 2ZENA 5CBMA 2PE3A 5K8OA 1CP6A 4B6ZA 2ZOFA 4PXDA 3VARA 3IEHA 3T8WA 4JYWA 2EWBA 4NGRA 1TF9A 5DS0A 4R6TA 3D68A 4MHYA 4IK2A 4NGNA 1HEEA 2CIJA 6CPAA 4F8ZA 1CX8A 3TX8A 3PFOA 2XEFA 3V7ZA 1M4LA 1Y0RA 4JZ0A 5HVFA 4ZX9A 4OMEA 2EK8A 4MCRA 4ONWA 3D66A 2PJ0A 5CPAA 1PYTB 2Q51A 4MHNA 4ZY2A 1AMPA 3K9TA 1LCPA 3IWWA 3PFEA 4OC2A 1VHOA 2CF4A 2PJ8A 4FAIA 3WC5A 2QVPA 1LANA 1Y0YA 1TXRA 3K2KA 3CDXA 4LQGA 3B35A 4FUUA 3KL9A 5K8MA 1R3NA 2PVVA 3D7GA 2BOAA 3KZWA 4Z65A 2G9DA 2GREA 3V38A 4GM5A 3FVLA 1KWMA 1RTQA 2BCOA 4PQAA 1CBXA 1Z8LA 2EK9A 3D7HA 2Q4ZA 4KSIA 3B7IA 3CPXA 2J9AA 1GYTA 4OC4A 3WC7A 3FMCA 4A94A 2HB6A 4F9VA 3KHXA 3MN8A 4NJRA 3S9NA 5JM6A 1CPXA 4NGQA 5LRKA 3KASA 3FEDA 3D7FA 2ZEFA 3FH4A 4K3NA 3DLJA 2AFWA 4P4JA 3KQXA 1JQGA 4OC5A 2FVGA 4P44A 4OC0A 4EFDA 2Q43A 3JRUA 1ELMP 4MCSA 4FWUA 4MCQA 2PIYA 4X3RA 2AFSA 4MRIA 1Y7EA 4NGPA 2PJ2A 3KR5A 2ZELA 5LYDA 3HLPA 4DUKA 2PJ9A 2HC9A 4NGMA 1HDUA 2DEAA 1HDQA 4UEEA 1ZLIA 5K8PA 1FT7A 3SI2A 2C1CA 2PJCA 3RBUA 5IB9A 1LOKA 4OC1A 1FNOA 3PBEA 4W9YA 3BI1A 1XFOA 4TNUA 3VATA 5F09A 2ZEDA 5THWA 4PXBA 3SJFA 4EMEA 3RAMA 1BAVA 4X2TA 1DTDA 1YMEA 3B2YA 3SJXA 2AFOA 3GUXA 4A38A 3I1UA 4P10A 2ZEPA 2ABZA 3B3CA 5JGFA 1F57A 2PJ6A 1BPMA 2JBJA 3PRTA 3LMSA 4PPZA 2PCUA 3SI1A 4DYOA 4F9UA 5J1QA 2PJ4A 5D8NA 2V8GA 4PXCA 2PRQA 1XJOA 3CPAA 4NGTA 4OIWA 4ZY0A 3GB0A 3VH9A 2F7VA 7CPAA 1ZG9A 3FF3A 4P4DA 4MMOA 4NJQA 3KR4A 4Q7AA 1ELLP 2CTBA 4MHZA 2C6PA 4ZY1A 2BO9A 4UEZA 3IIBA 2O53A 5LYLA 4DJLA 1XRYA 3BXMA 1QMUA 3WABA 4MHPA 2ZEOA 2V8VA 1TKHA 3D67A 1QQ9A 1YW4A 3PB9X 3PB4X 2POKA 2IQ6A 3NFZA 2ZEGA 3D4UA 1ARMA 1XBUA 4ZYQA 4OKOA 1F2PA 1AYEA 3NH5A 2WYRA 3FECA 3TC8A 5D29A 3PB8X 4PXEA 4P45A 2XEIA 3FX6A 2PJ1A 4UF4A 4R76A 5JH9A 1VHEA 4BD9A 5LYIA 5LRJA 3MRUA 1YW6A 3S9LA 4CPAA 4P4IA 5LYFA 1ZG7A 2GU2A 5ELYA 4YU9A 3H8FA 1OBRA 3B3VA 4OP4A 2IMOA 2IJZA 4P6YA 2C6CA 3SI0A 3WT4A 2AFZA 2JEWA 3B3WA 2QJ8A 2I3CA 2QYVA 2RFHA 5HVHA 2V8HA 2V8DA 4A39A 2ZEMA 1VIXA 4P4EA 4TWEA 4WJBA 2VL1A 4MXUA 3H8GA 2OR4A 3L2NA 3N5FA 1Q7LA 1EE3P 2PJ5A 2CTCA 5K8NA 2OOTA 1H8LA 2GLFA 2ZEEA 3PB7X 3KHZA 1LAMA 4EWTA 4RUHA 3QNVA 1F2OA 1TF8A 1IGBA 1R43A 1Z2LA 1DE4C 1XMBA 1YSJA 3BHXA 2AFMA 2NYQA 4P4FA 1YLOA 3NA6A 1PCAA 3D7DA 4UIBA 2ANPA 4R7MA 3NH4A 4UIAA 2PIZA 2RB7A 4ZX8A 1BPNA 1ZG8A 3KGQA 4G1PA 3HUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IO1 A;  2PJ7 A;  8CPA A;  3BI0 A;  4FBE A;  2XEJ A;  4R8F A;  4WWV A;  3ISX A;  3FJU A;  5HVG A;  2NSM A;  3S9M A;  3B3T A;  1CG2 A;  2AFU A;  2AFX A;  4P4B A;  3PEI A;  4NGS A;  1NSA A;  2PJB A;  4A37 A;  1TKF A;  4NFR A;  3KQZ A;  5LRG A;  3H8E A;  5HXD A;  2WZN A;  4OID A;  3SJE A;  4MCP A;  4YWY A;  1ARL A;  2C6G A;  2PVW A;  1LAP A;  3IFE A;  2ZOG A;  4AXV A;  2GLJ A;  3IC1 A;  3NH8 A;  4IHM A;  4O23 A;  2JBK A;  3KI9 A;  1BLL E;  1UWY A;  3DGV A;  4X8I A;  5I4M A;  2XEG A;  1LFW A;  2PJA A;  3RZA A;  2V77 A;  1IY7 A;  3CT9 A;  1VGY A;  3FEE A;  4ZI6 A;  3B3S A;  3ISZ A;  4H2K A;  3PB6 X;  2F8H A;  4UEF A;  3SJG A;  4IAV A;  1TKJ A;  3LWU A;  4OC3 A;  2O4H A;  1ZLH A;  3WC6 A;  2ZEH A;  1CP7 A;  3IJ3 A;  3GLJ A;  1Z5R A;  2PJ3 A;  3PBB A;  1CPS A;  2ZEN A;  5CBM A;  2PE3 A;  5K8O A;  1CP6 A;  4B6Z A;  2ZOF A;  4PXD A;  3VAR A;  3IEH A;  3T8W A;  4JYW A;  2EWB A;  4NGR A;  1TF9 A;  5DS0 A;  4R6T A;  3D68 A;  4MHY A;  4IK2 A;  4NGN A;  1HEE A;  2CIJ A;  6CPA A;  4F8Z A;  1CX8 A;  3TX8 A;  3PFO A;  2XEF A;  3V7Z A;  1M4L A;  1Y0R A;  4JZ0 A;  5HVF A;  4ZX9 A;  4OME A;  2EK8 A;  4MCR A;  4ONW A;  3D66 A;  2PJ0 A;  5CPA A;  1PYT B;  2Q51 A;  4MHN A;  4ZY2 A;  1AMP A;  3K9T A;  1LCP A;  3IWW A;  3PFE A;  4OC2 A;  1VHO A;  2CF4 A;  2PJ8 A;  4FAI A;  3WC5 A;  2QVP A;  1LAN A;  1Y0Y A;  1TXR A;  3K2K A;  3CDX A;  4LQG A;  3B35 A;  4FUU A;  3KL9 A;  5K8M A;  1R3N A;  2PVV A;  3D7G A;  2BOA A;  3KZW A;  4Z65 A;  2G9D A;  2GRE A;  3V38 A;  4GM5 A;  3FVL A;  1KWM A;  1RTQ A;  2BCO A;  4PQA A;  1CBX A;  1Z8L A;  2EK9 A;  3D7H A;  2Q4Z A;  4KSI A;  3B7I A;  3CPX A;  2J9A A;  1GYT A;  4OC4 A;  3WC7 A;  3FMC A;  4A94 A;  2HB6 A;  4F9V A;  3KHX A;  3MN8 A;  4NJR A;  3S9N A;  5JM6 A;  1CPX A;  4NGQ A;  5LRK A;  3KAS A;  3FED A;  3D7F A;  2ZEF A;  3FH4 A;  4K3N A;  3DLJ A;  2AFW A;  4P4J A;  3KQX A;  1JQG A;  4OC5 A;  2FVG A;  4P44 A;  4OC0 A;  4EFD A;  2Q43 A;  3JRU A;  1ELM P;  4MCS A;  4FWU A;  4MCQ A;  2PIY A;  4X3R A;  2AFS A;  4MRI A;  1Y7E A;  4NGP A;  2PJ2 A;  3KR5 A;  2ZEL A;  5LYD A;  3HLP A;  4DUK A;  2PJ9 A;  2HC9 A;  4NGM A;  1HDU A;  2DEA A;  1HDQ A;  4UEE A;  1ZLI A;  5K8P A;  1FT7 A;  3SI2 A;  2C1C A;  2PJC A;  3RBU A;  5IB9 A;  1LOK A;  4OC1 A;  1FNO A;  3PBE A;  4W9Y A;  3BI1 A;  1XFO A;  4TNU A;  3VAT A;  5F09 A;  2ZED A;  5THW A;  4PXB A;  3SJF A;  4EME A;  3RAM A;  1BAV A;  4X2T A;  1DTD A;  1YME A;  3B2Y A;  3SJX A;  2AFO A;  3GUX A;  4A38 A;  3I1U A;  4P10 A;  2ZEP A;  2ABZ A;  3B3C A;  5JGF A;  1F57 A;  2PJ6 A;  1BPM A;  2JBJ A;  3PRT A;  3LMS A;  4PPZ A;  2PCU A;  3SI1 A;  4DYO A;  4F9U A;  5J1Q A;  2PJ4 A;  5D8N A;  2V8G A;  4PXC A;  2PRQ A;  1XJO A;  3CPA A;  4NGT A;  4OIW A;  4ZY0 A;  3GB0 A;  3VH9 A;  2F7V A;  7CPA A;  1ZG9 A;  3FF3 A;  4P4D A;  4MMO A;  4NJQ A;  3KR4 A;  4Q7A A;  1ELL P;  2CTB A;  4MHZ A;  2C6P A;  4ZY1 A;  2BO9 A;  4UEZ A;  3IIB A;  2O53 A;  5LYL A;  4DJL A;  1XRY A;  3BXM A;  1QMU A;  3WAB A;  4MHP A;  2ZEO A;  2V8V A;  1TKH A;  3D67 A;  1QQ9 A;  1YW4 A;  3PB9 X;  3PB4 X;  2POK A;  2IQ6 A;  3NFZ A;  2ZEG A;  3D4U A;  1ARM A;  1XBU A;  4ZYQ A;  4OKO A;  1F2P A;  1AYE A;  3NH5 A;  2WYR A;  3FEC A;  3TC8 A;  5D29 A;  3PB8 X;  4PXE A;  4P45 A;  2XEI A;  3FX6 A;  2PJ1 A;  4UF4 A;  4R76 A;  5JH9 A;  1VHE A;  4BD9 A;  5LYI A;  5LRJ A;  3MRU A;  1YW6 A;  3S9L A;  4CPA A;  4P4I A;  5LYF A;  1ZG7 A;  2GU2 A;  5ELY A;  4YU9 A;  3H8F A;  1OBR A;  3B3V A;  4OP4 A;  2IMO A;  2IJZ A;  4P6Y A;  2C6C A;  3SI0 A;  3WT4 A;  2AFZ A;  2JEW A;  3B3W A;  2QJ8 A;  2I3C A;  2QYV A;  2RFH A;  5HVH A;  2V8H A;  2V8D A;  4A39 A;  2ZEM A;  1VIX A;  4P4E A;  4TWE A;  4WJB A;  2VL1 A;  4MXU A;  3H8G A;  2OR4 A;  3L2N A;  3N5F A;  1Q7L A;  1EE3 P;  2PJ5 A;  2CTC A;  5K8N A;  2OOT A;  1H8L A;  2GLF A;  2ZEE A;  3PB7 X;  3KHZ A;  1LAM A;  4EWT A;  4RUH A;  3QNV A;  1F2O A;  1TF8 A;  1IGB A;  1R43 A;  1Z2L A;  1DE4 C;  1XMB A;  1YSJ A;  3BHX A;  2AFM A;  2NYQ A;  4P4F A;  1YLO A;  3NA6 A;  1PCA A;  3D7D A;  4UIB A;  2ANP A;  4R7M A;  3NH4 A;  4UIA A;  2PIZ A;  2RB7 A;  4ZX8 A;  1BPN A;  1ZG8 A;  3KGQ A;  4G1P A;  3HUV A; 
#chains in the Genus database with same CATH topology
 3TE4 A;  4FD7 A;  3IO1 A;  2PJ7 A;  8CPA A;  3BI0 A;  1M4G A;  4FBE A;  2BSW A;  1KUV A;  2XEJ A;  3W91 A;  4R8F A;  2ZW7 A;  4MFQ A;  4WWV A;  3ISX A;  3FJU A;  4MY0 A;  5HVG A;  2NSM A;  2GAN A;  1QSO A;  3S9M A;  3B3T A;  1S7F A;  4B14 A;  1CG2 A;  2AFU A;  2AFX A;  3LOD A;  3PEI A;  4P4B A;  4X5K A;  1NE9 A;  4NGS A;  4A33 A;  1NSA A;  2PJB A;  1XEB A;  1TKF A;  4A37 A;  4KVX A;  4NFR A;  2B4B A;  3KQZ A;  4QBJ A;  5EC4 A;  3JVN A;  5LRG A;  3H8E A;  5HXD A;  3G3S A;  2WZN A;  4MFJ A;  4OID A;  3SJE A;  4CYO A;  3JUW A;  4MCP A;  4AVA A;  3OWC A;  2J8M A;  1N71 A;  1QSN A;  4YWY A;  1ARL A;  2ZPA A;  4M6I A;  2C6G A;  3W6S A;  2PVW A;  1LAP A;  4KSF A;  3IFE A;  4MFK A;  1IIC A;  2ZOG A;  4KOS A;  3N7Z A;  2AE6 A;  4R87 A;  2GLJ A;  3IC1 A;  5GCN A;  4A2Z A;  4AXV A;  3R95 A;  3NH8 A;  2REF A;  4IHM A;  4O23 A;  2R7H A;  4U5Y A;  2JBK A;  2HQY A;  3KI9 A;  4AG9 A;  1BLL E;  1UWY A;  3DGV A;  3FXT A;  4X8I A;  5I4M A;  2XEG A;  2B3V A;  1OZP A;  3P2F A;  5KTA A;  5KTD A;  1LFW A;  2PJA A;  3QAY A;  3RZA A;  2V77 A;  1IY7 A;  3R9E A;  3CT9 A;  1VGY A;  3FEE A;  4ZI6 A;  3B3S A;  3ISZ A;  4XNH C;  4AVC A;  4H2K A;  1FY7 A;  2F8H A;  2OB0 A;  3PB6 X;  3A9L A;  4H89 A;  4LUA A;  3TOA A;  3NE7 A;  4CYQ A;  4AVB A;  4UEF A;  3GYA A;  3SJG A;  4IAV A;  3SXN A;  3S6H A;  1S5K A;  1TKJ A;  3LWU A;  4OC3 A;  4MY3 A;  3DSB A;  2GFQ A;  2FIW A;  2O4H A;  3IU2 A;  1YR0 A;  1ZLH A;  4XPK A;  3WC6 A;  2ZEH A;  1SQH A;  1CP7 A;  2P0W A;  4JJX A;  4A32 A;  4B10 A;  3IJ3 A;  4QB9 A;  3R9F A;  2Z3P A;  3TTH A;  3GLJ A;  4MFL A;  2EUI A;  2Q0Y A;  5J8C A;  4YGO A;  1Z5R A;  2I79 A;  4HNW B;  2PJ3 A;  3PBB A;  1CPS A;  2YNC C;  4FD6 A;  2ZEN A;  5CBM A;  3W6X A;  2D4O A;  2PE3 A;  1L0C A;  5K8O A;  1CP6 A;  4XNH B;  4B6Z A;  1I21 A;  3ZJ0 A;  1YLE A;  1Z8T A;  4KSA A;  2ZOF A;  2ZW5 A;  4UCP A;  4A30 A;  1UFH A;  3IWE A;  3FIX A;  4PXD A;  2FSR A;  3VAR A;  4PV6 A;  4CGN A;  2Z3M A;  3IEH A;  4Q38 A;  3T8W A;  4JYW A;  2Z10 A;  2EWB A;  4NGR A;  1S7K A;  1TF9 A;  4E8O A;  5CNP A;  1LRZ A;  2C27 A;  3QAH A;  5DS0 A;  4R6T A;  3D68 A;  2B3U A;  4IK2 A;  4MHY A;  1VHS A;  4NGN A;  1HEE A;  2VQY A;  2CIJ A;  1PU9 A;  2P6F A;  6CPA A;  4F8Z A;  3WR7 A;  4KUA A;  5IB0 A;  1CX8 A;  2WPW A;  3TX8 A;  3PFO A;  1P4N A;  4IF5 A;  1YGH A;  2XEF A;  2Q44 A;  1M4L A;  3G8W A;  3V7Z A;  4B5P A;  2GIV A;  2HV2 A;  4CYN A;  1V0C A;  4F6A A;  1Y0R A;  4JZ0 A;  5HVF A;  1BOB A;  4B12 A;  4ZX9 A;  4OME A;  4E2A A;  2EK8 A;  1Z4E A;  2NMT A;  4MCR A;  4NF1 A;  4ONW A;  4BBH A;  3D66 A;  2PJ0 A;  4GS4 A;  5CPA A;  4KLV A;  5I0C A;  2D4P A;  1BO4 A;  1PYT B;  1X10 A;  3F8K A;  2Q51 A;  1IYL A;  2JEV A;  4MHN A;  4K30 A;  4HPS A;  2DPS A;  4ZY2 A;  1P0H A;  1AMP A;  1Z9U A;  3K9T A;  1LCP A;  3IWW A;  5C88 A;  5H86 A;  3PFE A;  1IU8 A;  4OC2 A;  4DNC A;  1VHO A;  2CF4 A;  2PJ8 A;  4CRY B;  3WC5 A;  4FAI A;  2O28 A;  2QVP A;  1LAN A;  1Y0Y A;  1A2Z A;  1TXR A;  3K2K A;  4KS9 A;  3CDX A;  5A28 A;  4R9M A;  4KUB A;  4LQG A;  4M6G A;  1X12 A;  3B35 A;  2YGW A;  4FUU A;  4ONU A;  1B6B A;  3EC4 A;  2VZZ A;  3D2M A;  4UCM A;  3KL9 A;  3VWE A;  5HMN A;  2J8R A;  2PC1 A;  2A4N A;  5K8M A;  1R3N A;  5FVJ A;  2PVV A;  2AJ6 A;  4PSW A;  5F49 A;  3DNS A;  3D7G A;  2BOA A;  1XF8 A;  3KZW A;  3TO7 A;  2G9D A;  2GRE A;  4Y49 B;  3CXS A;  1IID A;  4F0X A;  4Z65 A;  4CGM A;  3DR8 A;  4GM5 A;  3V38 A;  3KKW A;  3FVL A;  1KZF A;  5AG5 A;  1KWM A;  2JLM A;  1IB1 E;  3NE8 A;  5F47 A;  1YVK A;  1RTQ A;  4J3G A;  4JLY A;  4H6U A;  2BCO A;  1CJW A;  4PQA A;  4C7I A;  1CBX A;  1Z8X A;  4I49 A;  1NSL A;  3TFY A;  2ARH A;  1Z8L A;  2EK9 A;  3D7H A;  2Q4Z A;  4R3K A;  4KSI A;  3B7I A;  4BIN A;  2FT0 A;  3CPX A;  3LD2 A;  2J9A A;  2PRB A;  4FD4 A;  1GYT A;  4OC4 A;  3WC7 A;  3IGR A;  2Y0M A;  2B4D B;  3FMC A;  4A94 A;  4QC6 A;  2HB6 A;  4CAW A;  4F9V A;  4B11 A;  1IYK A;  3KHX A;  2HUZ A;  3MN8 A;  4LX9 A;  4MBU A;  2JDC A;  2ODF A;  4NJR A;  3S9N A;  4UFV A;  4RI1 A;  1CPX A;  2JDD A;  4NGQ A;  4A31 A;  5DWM A;  3CXP A;  3ZZI A;  5JM6 A;  5LRK A;  3KAS A;  3FED A;  4A95 A;  1Q2D A;  4R57 A;  4Q36 A;  4AB7 A;  5G22 A;  4IUS A;  2X7B A;  3D7F A;  5JQ4 A;  2ZEF A;  3FH4 A;  4GXH A;  4K3N A;  2ZXV A;  3DLJ A;  2AFW A;  3BLN A;  4P4J A;  4ORF A;  3KQX A;  5G20 A;  4MFZ A;  1JQG A;  4OC5 A;  1M44 A;  2FVG A;  4P44 A;  4UFX A;  4OC0 A;  2Z3K A;  3DR6 A;  2FS5 A;  1Y9K A;  1I1D A;  1MJB A;  2B4D A;  4EFD A;  5G21 A;  1XMT A;  1B87 A;  4L89 A;  2Q43 A;  3JRU A;  1ELM P;  4MCS A;  4FWU A;  2B58 A;  4MCQ A;  3S6F A;  4CGO A;  2PIY A;  1YQE A;  2OZU A;  2AFS A;  4X3R A;  2Q04 A;  2PDO A;  1Y7E A;  3C26 A;  4MRI A;  3PZJ A;  4NGP A;  5F46 A;  2PJ2 A;  1YK3 A;  3R96 A;  3KR5 A;  3D8P A;  2ZEL A;  3K9U A;  3HLP A;  5LYD A;  4B5O A;  4DUK A;  4II9 A;  2PJ9 A;  3D2P A;  2I00 A;  2QML A;  4JD6 A;  3VWD A;  2HC9 A;  4L8A A;  4NGM A;  1HDU A;  2DEA A;  1HDQ A;  4UEE A;  2F5I A;  2H5M A;  1ZLI A;  3I9S A;  1WWZ A;  3FYN A;  5K8P A;  5C82 A;  1FT7 A;  1R57 A;  2RC4 A;  2BEI A;  3SI2 A;  2C1C A;  1XE4 A;  2PJC A;  3RBU A;  2CY2 A;  1LOK A;  5IB9 A;  4OC1 A;  2R98 A;  2OZH A;  2Q4V A;  2G3A A;  1FNO A;  4ZGY B;  3PBE A;  4W9Y A;  4OAE A;  2VXK A;  3BI1 A;  1XFO A;  2Z0Z A;  4TNU A;  3VAT A;  4NJQ A;  2G3T A;  4UFW A;  5F09 A;  2ZED A;  5AG7 A;  2R8V A;  1ON0 A;  2VBQ A;  3FB3 A;  4PXB A;  5THW A;  3RYO A;  3SJF A;  4EME A;  3RAM A;  1BAV A;  3LAC A;  1XOV A;  4X2T A;  4CGP A;  1DTD A;  2FCK A;  1Y9W A;  1YME A;  3B2Y A;  3FRM A;  3SJX A;  4CGL A;  2AFO A;  3GUX A;  4A38 A;  3I1U A;  2KCW A;  2ZEP A;  4P10 A;  3T90 A;  5JPH A;  2ABZ A;  3B3C A;  2BUE A;  2FXF A;  1F57 A;  2PJ6 A;  3DDD A;  3PGP A;  4QUS A;  2PQ8 A;  5JGF A;  1BPM A;  1KUY A;  2JBJ A;  2YNC A;  3PRT A;  3LMS A;  4PPZ A;  2PCU A;  4KOU A;  3H5Z A;  3SI1 A;  4C2X A;  2EVN A;  2P6E A;  3SHP A;  3MGD A;  1TIQ A;  3CXQ A;  4DYO A;  4F9U A;  5J1Q A;  2PJ4 A;  5D8N A;  2V8G A;  4PXC A;  5DWN A;  2PRQ A;  1XJO A;  2WPX A;  3CPA A;  5AG4 A;  3EFA A;  2YND A;  1JWQ A;  1MJA A;  2CNS A;  5IX3 A;  4NGT A;  4H6Z A;  2EBJ A;  2P6G A;  3GB0 A;  4OIW A;  2B5G B;  2VI7 A;  3VH9 A;  4ZY0 A;  4KOX A;  2F7V A;  3B8G A;  1YX0 A;  1Z4R A;  5H84 A;  4CS0 B;  2OZG A;  4UWI A;  1QSR A;  1RO5 A;  2IL4 A;  4KLW A;  7CPA A;  1Q2Y A;  1ZG9 A;  3FF3 A;  2CNM A;  3I3G A;  4P4D A;  3EO4 A;  1AUG A;  1PUA A;  2FE7 A;  2Q7S A;  3IU1 A;  3KR4 A;  4KOY A;  4KOV A;  4MMO A;  1ELL P;  2G0B A;  4Q7A A;  5G1Z A;  4CAV A;  2CTB A;  4MHZ A;  2C6P A;  4ZY1 A;  4YRH A;  4BMH A;  2BO9 A;  3GIU A;  4UEZ A;  3IIB A;  4PK3 A;  2O53 A;  2EO8 A;  2PSW A;  5EMI A;  2Q7B A;  3EY5 A;  4DJL A;  5LYL A;  3BJ8 A;  1XRY A;  3TO9 A;  4NCZ A;  2VZY A;  3BXM A;  1QMU A;  3WAB A;  5F48 A;  4MHP A;  4NEX A;  4CAE A;  2ZEO A;  2Z3L A;  4F0Y A;  5IV0 A;  2B5G A;  2FL4 A;  1U6M A;  2V8V A;  1TKH A;  3S6G A;  1M4I A;  4M85 A;  1CM0 A;  5HH1 A;  3TT2 A;  2GE3 A;  3D67 A;  1QQ9 A;  1YW4 A;  3PB9 X;  3PB4 X;  1GHE A;  1XIX A;  4B13 A;  3QB8 A;  2CNT A;  1WK4 A;  4C68 A;  4YFJ A;  2POK A;  4PSX A;  2IQ6 A;  3R9G A;  4CAF A;  3IWG A;  4MI4 A;  3NFZ A;  2ZEG A;  3D4U A;  3RNZ A;  4CYP A;  1ARM A;  1XBU A;  4ZYQ A;  4OKO A;  2DF5 A;  1F2P A;  2WSA A;  1AYE A;  1J4J A;  4RN7 A;  2OU2 A;  2QIR A;  3D3S A;  3NH5 A;  2WYR A;  3FEC A;  2FIA A;  4NXY A;  3TC8 A;  5A27 A;  5AGE A;  2CXA A;  5D29 A;  1QSM A;  2Z11 A;  3PB8 X;  4PXE A;  3FBU A;  4P45 A;  2XEI A;  3FX6 A;  1S7N A;  2PJ1 A;  4UF4 A;  4R76 A;  4CAX A;  3R1K A;  1NMT A;  4JXQ A;  5J8F A;  3GKR A;  5JH9 A;  1VHE A;  4BD9 A;  3S6K A;  4UBR A;  4R3L A;  4KOW A;  3PP9 A;  5LYI A;  1S7L A;  2YNE A;  5LRJ A;  3MRU A;  4AG7 A;  1YW6 A;  3S9L A;  4KOR A;  4CPA A;  4P4I A;  1M4D A;  5LYF A;  4HNX B;  1Y7R A;  1ZG7 A;  2GU2 A;  2DPT A;  5ELY A;  1K4J A;  4JWP A;  4YU9 A;  2ZW4 A;  3H8F A;  1OBR A;  5KTC A;  3B3V A;  4OP4 A;  2IMO A;  2IJZ A;  3BJ7 A;  2C6C A;  4P6Y A;  3SI0 A;  3WT4 A;  2AFZ A;  3SXO A;  2JEW A;  3B3W A;  2QEC A;  2QJ8 A;  2I3C A;  2QYV A;  4B5P B;  4JXR A;  2RFH A;  5HVH A;  4KVM E;  3F0A A;  2Q4Y A;  3T9Y A;  1M1D A;  1MK4 A;  4KOT A;  2V8H A;  4C7H A;  2VEZ A;  2ATR A;  1MJ9 A;  1S3Z A;  2V8D A;  1KUX A;  3GY9 A;  4A39 A;  2ZEM A;  1VIX A;  4P4E A;  4UA3 A;  4TWE A;  4WJB A;  2VL1 A;  4MXU A;  1I12 A;  2OR4 A;  3CZX A;  3H8G A;  4MFP A;  3L2N A;  3N5F A;  1Q7L A;  3UY5 A;  5BWA B;  1EE3 P;  5AG6 A;  4E0A A;  4KZT A;  2PJ5 A;  3JTK A;  2CTC A;  5K8N A;  1QST A;  4XPD C;  2OOT A;  4CRZ B;  1H8L A;  4NSQ A;  1RXT A;  3FNC A;  4HKF A;  5E96 A;  4C2Y A;  1S60 A;  2GLF A;  4KVO E;  2ZEE A;  4QVT A;  4FD5 A;  4OAD A;  3TO6 A;  4RS2 A;  4M3S A;  3H4Q A;  2R1I A;  3PB7 X;  1YVO A;  2BL1 A;  4EVY A;  4LQ6 A;  3KHZ A;  1LAM A;  1IOF A;  4EWT A;  2ZW6 A;  3QNV A;  4RUH A;  4U9Z A;  3TOB A;  1F2O A;  4UWJ A;  4HNY B;  2DXQ A;  3F5B A;  1IOI A;  1TF8 A;  1Q2C A;  1IGB A;  3V8I A;  1R43 A;  1Z2L A;  3E0K A;  3P2H A;  1DE4 C;  1XMB A;  1YSJ A;  2PR8 A;  2J8N A;  3BHX A;  4M6H A;  2PR1 A;  4ZBG A;  1VKC A;  2AFM A;  1YRE A;  2NYQ A;  4P4F A;  2OH1 A;  2REE A;  2Z3N A;  1YLO A;  5EBV A;  5ISV A;  3NA6 A;  4Y49 C;  4MJ8 A;  3EXN A;  1PCA A;  3D7D A;  4XPD B;  2Z3O A;  4UIB A;  4C2Z A;  4UCN A;  2ANP A;  4R7M A;  3NH4 A;  4U9Y A;  4XPL A;  4UIA A;  1ZO0 A;  2PIZ A;  2RB7 A;  2WUU A;  4ZX8 A;  1BPN A;  1ZG8 A;  3KGQ A;  4PK2 A;  4MHD A;  1Z8W A;  4G1P A;  3RO0 A;  3TCV A;  3HUV A;  4OLL A;  2K5T A; 
#chains in the Genus database with same CATH homology
 3IO1 A;  2PJ7 A;  8CPA A;  3BI0 A;  4FBE A;  2XEJ A;  4R8F A;  4WWV A;  3ISX A;  3FJU A;  5HVG A;  2NSM A;  3S9M A;  3B3T A;  1CG2 A;  2AFU A;  2AFX A;  4P4B A;  3PEI A;  4NGS A;  1NSA A;  2PJB A;  4A37 A;  1TKF A;  4NFR A;  3KQZ A;  5LRG A;  3H8E A;  5HXD A;  2WZN A;  4OID A;  3SJE A;  4MCP A;  4YWY A;  1ARL A;  2C6G A;  2PVW A;  1LAP A;  3IFE A;  2ZOG A;  4AXV A;  2GLJ A;  3IC1 A;  3NH8 A;  4IHM A;  4O23 A;  2JBK A;  3KI9 A;  1BLL E;  1UWY A;  3DGV A;  4X8I A;  5I4M A;  2XEG A;  1LFW A;  2PJA A;  3RZA A;  2V77 A;  1IY7 A;  3CT9 A;  1VGY A;  3FEE A;  4ZI6 A;  3B3S A;  3ISZ A;  4H2K A;  3PB6 X;  2F8H A;  4UEF A;  3SJG A;  4IAV A;  1TKJ A;  3LWU A;  4OC3 A;  2O4H A;  1ZLH A;  3WC6 A;  2ZEH A;  1CP7 A;  3IJ3 A;  3GLJ A;  1Z5R A;  2PJ3 A;  3PBB A;  1CPS A;  2ZEN A;  5CBM A;  2PE3 A;  5K8O A;  1CP6 A;  4B6Z A;  2ZOF A;  4PXD A;  3VAR A;  3IEH A;  3T8W A;  4JYW A;  2EWB A;  4NGR A;  1TF9 A;  5DS0 A;  4R6T A;  3D68 A;  4MHY A;  4IK2 A;  4NGN A;  1HEE A;  2CIJ A;  6CPA A;  4F8Z A;  1CX8 A;  3TX8 A;  3PFO A;  2XEF A;  3V7Z A;  1M4L A;  1Y0R A;  4JZ0 A;  5HVF A;  4ZX9 A;  4OME A;  2EK8 A;  4MCR A;  4ONW A;  3D66 A;  2PJ0 A;  5CPA A;  1PYT B;  2Q51 A;  4MHN A;  4ZY2 A;  1AMP A;  3K9T A;  1LCP A;  3IWW A;  3PFE A;  4OC2 A;  1VHO A;  2CF4 A;  2PJ8 A;  4FAI A;  3WC5 A;  2QVP A;  1LAN A;  1Y0Y A;  1TXR A;  3K2K A;  3CDX A;  4LQG A;  3B35 A;  4FUU A;  3KL9 A;  5K8M A;  1R3N A;  2PVV A;  3D7G A;  2BOA A;  3KZW A;  4Z65 A;  2G9D A;  2GRE A;  3V38 A;  4GM5 A;  3FVL A;  1KWM A;  1RTQ A;  2BCO A;  4PQA A;  1CBX A;  1Z8L A;  2EK9 A;  3D7H A;  2Q4Z A;  4KSI A;  3B7I A;  3CPX A;  2J9A A;  1GYT A;  4OC4 A;  3WC7 A;  3FMC A;  4A94 A;  2HB6 A;  4F9V A;  3KHX A;  3MN8 A;  4NJR A;  3S9N A;  5JM6 A;  1CPX A;  4NGQ A;  5LRK A;  3KAS A;  3FED A;  3D7F A;  2ZEF A;  3FH4 A;  4K3N A;  3DLJ A;  2AFW A;  4P4J A;  3KQX A;  1JQG A;  4OC5 A;  2FVG A;  4P44 A;  4OC0 A;  4EFD A;  2Q43 A;  3JRU A;  1ELM P;  4MCS A;  4FWU A;  4MCQ A;  2PIY A;  4X3R A;  2AFS A;  4MRI A;  1Y7E A;  4NGP A;  2PJ2 A;  3KR5 A;  2ZEL A;  5LYD A;  3HLP A;  4DUK A;  2PJ9 A;  2HC9 A;  4NGM A;  1HDU A;  2DEA A;  1HDQ A;  4UEE A;  1ZLI A;  5K8P A;  1FT7 A;  3SI2 A;  2C1C A;  2PJC A;  3RBU A;  5IB9 A;  1LOK A;  4OC1 A;  1FNO A;  3PBE A;  4W9Y A;  3BI1 A;  1XFO A;  4TNU A;  3VAT A;  5F09 A;  2ZED A;  5THW A;  4PXB A;  3SJF A;  4EME A;  3RAM A;  1BAV A;  4X2T A;  1DTD A;  1YME A;  3B2Y A;  3SJX A;  2AFO A;  3GUX A;  4A38 A;  3I1U A;  4P10 A;  2ZEP A;  2ABZ A;  3B3C A;  5JGF A;  1F57 A;  2PJ6 A;  1BPM A;  2JBJ A;  3PRT A;  3LMS A;  4PPZ A;  2PCU A;  3SI1 A;  4DYO A;  4F9U A;  5J1Q A;  2PJ4 A;  5D8N A;  2V8G A;  4PXC A;  2PRQ A;  1XJO A;  3CPA A;  4NGT A;  4OIW A;  4ZY0 A;  3GB0 A;  3VH9 A;  2F7V A;  7CPA A;  1ZG9 A;  3FF3 A;  4P4D A;  4MMO A;  4NJQ A;  3KR4 A;  4Q7A A;  1ELL P;  2CTB A;  4MHZ A;  2C6P A;  4ZY1 A;  2BO9 A;  4UEZ A;  3IIB A;  2O53 A;  5LYL A;  4DJL A;  1XRY A;  3BXM A;  1QMU A;  3WAB A;  4MHP A;  2ZEO A;  2V8V A;  1TKH A;  3D67 A;  1QQ9 A;  1YW4 A;  3PB9 X;  3PB4 X;  2POK A;  2IQ6 A;  3NFZ A;  2ZEG A;  3D4U A;  1ARM A;  1XBU A;  4ZYQ A;  4OKO A;  1F2P A;  1AYE A;  3NH5 A;  2WYR A;  3FEC A;  3TC8 A;  5D29 A;  3PB8 X;  4PXE A;  4P45 A;  2XEI A;  3FX6 A;  2PJ1 A;  4UF4 A;  4R76 A;  5JH9 A;  1VHE A;  4BD9 A;  5LYI A;  5LRJ A;  3MRU A;  1YW6 A;  3S9L A;  4CPA A;  4P4I A;  5LYF A;  1ZG7 A;  2GU2 A;  5ELY A;  4YU9 A;  3H8F A;  1OBR A;  3B3V A;  4OP4 A;  2IMO A;  2IJZ A;  4P6Y A;  2C6C A;  3SI0 A;  3WT4 A;  2AFZ A;  2JEW A;  3B3W A;  2QJ8 A;  2I3C A;  2QYV A;  2RFH A;  5HVH A;  2V8H A;  2V8D A;  4A39 A;  2ZEM A;  1VIX A;  4P4E A;  4TWE A;  4WJB A;  2VL1 A;  4MXU A;  3H8G A;  2OR4 A;  3L2N A;  3N5F A;  1Q7L A;  1EE3 P;  2PJ5 A;  2CTC A;  5K8N A;  2OOT A;  1H8L A;  2GLF A;  2ZEE A;  3PB7 X;  3KHZ A;  1LAM A;  4EWT A;  4RUH A;  3QNV A;  1F2O A;  1TF8 A;  1IGB A;  1R43 A;  1Z2L A;  1DE4 C;  1XMB A;  1YSJ A;  3BHX A;  2AFM A;  2NYQ A;  4P4F A;  1YLO A;  3NA6 A;  1PCA A;  3D7D A;  4UIB A;  2ANP A;  4R7M A;  3NH4 A;  4UIA A;  2PIZ A;  2RB7 A;  4ZX8 A;  1BPN A;  1ZG8 A;  3KGQ A;  4G1P A;  3HUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...