1QSNA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and histone h3 peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
b'LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TGCN5 HISTONE ACETYL TRANSFERASE
molecule tags Transferase
source organism Tetrahymena thermophila
publication title Structure of Tetrahymena GCN5 bound to coenzyme A and a histone H3 peptide.
pubmed doi rcsb
total genus 43
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsnA00
2B58A 4U9ZA 1I21A 2Q4VA 3FNCA 4GS4A 4QB9A 1LRZA 2Q04A 2QIRA 4FD6A 4CRYB 3I9SA 1Y7RA 1BOBA 2Z0ZA 1QSMA 3N7ZA 4LUAA 2VEZA 4R57A 2I79A 4KVOE 2ARHA 3FYNA 1S3ZA 4I49A 4HNWB 2PRBA 4OLLA 2X7BA 3PZJA 4H6ZA 3RYOA 3EXNA 2CNMA 3E0KA 4DNCA 1XIXA 4R3LA 2R7HA 4ORFA 2B3UA 1IIDA 2ATRA 5F48A 4KUAA 1B87A 1YVKA 2VZZA 1Z4RA 3UY5A 1S5KA 4QC6A 2BUEA 3GY9A 3R9GA 2Q0YA 3F8KA 3MGDA 1P0HA 2FS5A 2VI7A 3H4QA 1N71A 1YREA 1L0CA 1YLEA 4F6AA 3BJ8A 1KUXA 3F0AA 4JWPA 3DNSA 4PSWA 1IB1E 2C27A 3OWCA 3T90A 1S7NA 3DDDA 5CNPA 4E8OA 1Q2CA 4KOWA 1QSTA 3BJ7A 4HNXB 3KKWA 4KOSA 1SQHA 3LODA 4QUSA 4MY0A 3FRMA 3QAHA 2FE7A 3D2MA 4R9MA 1FY7A 2QECA 3EC4A 4XNHB 1VKCA 1KUVA 3D3SA 2ZPAA 4EVYA 2BSWA 2ZXVA 2Z10A 3DR6A 4JXRA 4CAXA 4B5PB 1ON0A 4XPDC 3WR7A 1Z9UA 4XPLA 4PK3A 2Z11A 5E96A 1PUAA 1U6MA 5IX3A 1IYKA 1QSRA 2OU2A 4Y49C 3JUWA 1M4IA 2QMLA 4NSQA 4ONUA 4NEXA 2EVNA 2EUIA 4QBJA 3R95A 2CNTA 3FBUA 4B5OA 2KCWA 4R87A 3SHPA 4IUSA 5KTAA 1Z4EA 5DWMA 1KZFA 1B6BA 1RO5A 3D2PA 1M4GA 4KOYA 3W6XA 2FIAA 3TO7A 5F49A 1Q2YA 3DSBA 4CRZB 3PP9A 1J4JA 4PK2A 4KORA 1YVOA 4FD5A 3CXSA 1UFHA 2ZW4A 1K4JA 3G3SA 2K5TA 1Y9WA 2PDOA 3SXOA 2O28A 3EFAA 1Q2DA 4JXQA 5GCNA 4MBUA 4UBRA 3BLNA 1R57A 5H86A 2B4DA 1OZPA 3IGRA 3GKRA 2F5IA 4MHDA 2AE6A 4U9YA 4K30A 4NF1A 4NCZA 3SXNA 3R9EA 2PR8A 3TO6A 4ZBGA 3FB3A 4KOTA 1XEBA 5EC4A 2PQ8A 4PSXA 4RI1A 3PGPA 1NE9A 4AB7A 4H89A 1S7KA 2P6GA 5EBVA 4M3SA 2FSRA 5JPHA 2REFA 4KVME 4HNYB 3S6FA 4MI4A 2ZW7A 1YK3A 3EO4A 4XNHC 1P4NA 4E2AA 2BL1A 1QSOA 2G3TA 4JLYA 4UWJA 2R98A 5F46A 4AG7A 4II9A 3P2FA 1PU9A 4KOXA 2VZYA 5IB0A 1M1DA 5DWNA 3S6KA 1NSLA 2GIVA 4NXYA 5KTCA 1IYLA 2OZHA 2JEVA 3D8PA 4J3GA 4R3KA 2P6EA 2OZUA 2OH1A 4UWIA 1M4DA 3G8WA 1WWZA 4H6UA 1XF8A 2J8NA 2B3VA 2PC1A 4L8AA 2H5MA 1QSNA 2HUZA 4YGOA 5ISVA 3TE4A 5C82A 4HKFA 4FD4A 1YR0A 2Y0MA 4BMHA 4CAVA 4JJXA 3TTHA 4JD6A 2GANA 2B4DB 2B5GB 4F0YA 1IICA 2J8RA 3TFYA 2D4OA 4KLWA 1S7LA 2JDCA 2B5GA 1KUYA 1GHEA 5IV0A 2OB0A 3JVNA 2FCKA 4AVCA 2FXFA 4XPDB 5J8FA 1MK4A 2JLMA 2PR1A 1WK4A 2G3AA 4CS0B 1BO4A 2HQYA 5I0CA 2CY2A 2R1IA 3GYAA 2FIWA 1XMTA 3VWEA 3ZZIA 2J8MA 3FXTA 3B8GA 1NMTA 4M85A 3I3GA 4AVBA 4Y49B 3NE7A 2PSWA 4XPKA 5J8CA 3C26A 1VHSA 5HH1A 3TCVA 4YFJA 1XE4A 5KTDA 2B4BA 2R8VA 4UA3A 2D4PA 2VQYA 2P0WA 5FVJA 2IL4A 3TT2A 3IWGA 3P2HA 3S6GA 2CNSA 3R9FA 3V8IA 2A4NA 4AG9A 2HV2A 1M44A 4QVTA 3QB8A 2VBQA 3F5BA 1MJ9A 3DR8A 4RS2A 3R1KA 3VWDA 3W91A 4CAWA 4PV6A 1S7FA 4MJ8A 3K9UA 2FT0A 4B5PA 3CXPA 2JDDA 3ZJ0A 5JQ4A 2Q44A 3T9YA 4OAEA 4U5YA 2ZW5A 4L89A 1I1DA 2G0BA 2VXKA 2WPWA 2Q4YA 4KZTA 2RC4A 3CXQA 3S6HA 2Q7BA 2DXQA 3FIXA 4KOUA 3R96A 4KOVA 4KVXA 4MY3A 1RXTA 1CJWA 3TOAA 5H84A 2AJ6A 4KLVA 4IF5A 1TIQA 1V0CA 2REEA 2FL4A 1MJAA 3TOBA 4LX9A 4FD7A 5HMNA 4E0AA 2OZGA 1S60A 3LD2A 2WPXA 3EY5A 3TO9A 2BEIA 5F47A 1I12A 2P6FA 1MJBA 2NMTA 5C88A 1Y9KA 2ZW6A 1CM0A 4YRHA 4X5KA 1YGHA 4KUBA 4OADA 2I00A 2GE3A 4AVAA 3W6SA 1YX0A
chains in the Genus database with same CATH superfamily
2B58A 3IEHA 4U9ZA 1I21A 2Q4VA 3FNCA 4GS4A 5HVFA 3NH5A 4QB9A 2CF4A 4YU9A 2XEGA 4PXBA 1LRZA 2AFZA 2Q04A 2QIRA 4FD6A 5G1ZA 4CRYB 5C88A 1LCPA 3I9SA 3SJEA 4BINA 1Y7RA 2DPSA 1BOBA 4CAEA 2Z0ZA 1QSMA 4CGLA 1YQEA 4C7HA 2AFUA 3N7ZA 3KGQA 4LUAA 4UCPA 3KQZA 2VEZA 4R57A 2I79A 4KVOE 3SI2A 2ARHA 3FYNA 1S3ZA 4I49A 2ZEHA 4HNWB 2PRBA 3IU2A 4OP4A 2PJ1A 2HC9A 1Z8TA 2X7BA 2C6GA 4OLLA 3PZJA 4H6ZA 4X3RA 3RYOA 1XOVA 2CNMA 3E0KA 3EXNA 4DNCA 1XIXA 1ELMP 4R3LA 2R7HA 3H5ZA 4ORFA 2B3UA 4CGNA 2AFSA 4Q36A 1AUGA 1IIDA 5LRJA 2EK8A 2ATRA 4MFZA 3PB9X 1ZG7A 5G21A 5F48A 4KUAA 1B87A 1YVKA 2VZZA 4A39A 3TC8A 3RZAA 3SJFA 4UEFA 1Z4RA 3UY5A 5AGEA 1S5KA 2Z3OA 3FVLA 2Z3MA 2PJ7A 4UCNA 4OC1A 2BUEA 4QC6A 4CGPA 5CBMA 3GY9A 4A94A 1X10A 4MCSA 2V8HA 3R9GA 3CDXA 2J9AA 3B3TA 2WSAA 2Q0YA 4GM5A 4OC0A 3F8KA 2EBJA 3MGDA 1P0HA 4A30A 2FS5A 2VI7A 3H4QA 4ZX9A 1N71A 1YREA 2ZEMA 1L0CA 1YLEA 4TNUA 5HXDA 3TX8A 4F6AA 4B6ZA 3BJ8A 2PJCA 4MFLA 1QMUA 1KUXA 2CTCA 3F0AA 4JWPA 3V38A 4BBHA 4ZY2A 3DNSA 4P6YA 2HB6A 4UIAA 2AFXA 4B12A 4WJBA 1ARMA 4RUHA 4PSWA 1IB1E 2C27A 3OWCA 3T90A 4ZI6A 1S7NA 2V8GA 3DDDA 3S9MA 4P4IA 2PJ2A 5CNPA 4E8OA 1Q2CA 4KOWA 1QSTA 3BJ7A 1HDUA 3KKWA 4HNXB 4KOSA 4M6HA 1SQHA 3LODA 3GB0A 2V77A 1VIXA 2V8DA 4MY0A 4QUSA 3FRMA 3QAHA 2FE7A 3BI1A 3CT9A 3D2MA 3KZWA 2RFHA 2BOAA 4R9MA 1FY7A 4FBEA 2QECA 3EC4A 4XNHB 1VKCA 1KUVA 3D3SA 2ZPAA 4A33A 4EVYA 2BSWA 2ZXVA 2Z10A 3BXMA 3WC7A 3DR6A 4JXRA 4CAXA 4B5PB 2O53A 2ZEEA 3NA6A 4C7IA 2IQ6A 1ON0A 2Q43A 3JRUA 4XPDC 2XEIA 2QVPA 3WR7A 3DLJA 1Z9UA 4XPLA 4PK3A 2Q7SA 4HPSA 2EO8A 2JBKA 2Z11A 4CAFA 5E96A 1PUAA 1U6MA 4GXHA 5IX3A 1IYKA 1QSRA 2OU2A 4Y49C 3JUWA 2POKA 1M4IA 2QMLA 2WYRA 4NSQA 4ONUA 2OR4A 4NEXA 2EVNA 2PJ5A 2EUIA 4CAWA 4QBJA 4C68A 3MRUA 1DE4C 3R95A 1OBRA 2CNTA 3FBUA 1R43A 2KCWA 1Y0YA 1TKJA 4B5OA 4R87A 3SHPA 4IUSA 5KTAA 1Z4EA 3KQXA 2QYVA 5DWMA 1KZFA 3GIUA 1B6BA 1RO5A 4NJQA 4MCRA 3D2PA 1M4GA 4C2XA 4KOYA 5THWA 2DEAA 3W6XA 4Z65A 3W91A 2FIAA 3TO7A 5F49A 4MHPA 1Q2YA 3DSBA 4CRZB 3JTKA 3PP9A 4UF4A 4CYNA 3RAMA 4P4EA 1J4JA 1TF9A 2BO9A 3FMCA 3LACA 2GFQA 1LOKA 2ANPA 4PK2A 4P4JA 3H8GA 4KORA 1YVOA 4EWTA 4FD5A 4PXDA 4FUUA 1CPXA 3N5FA 4P4DA 1Z5RA 4PPZA 1PCAA 1CX8A 1R3NA 2Z3LA 3CXSA 5A28A 4K3NA 1YLOA 1UFHA 2ZW4A 2Z3KA 1K4JA 1HEEA 1LAMA 5HVGA 4AXVA 3G3SA 1VHEA 1CP7A 2K5TA 4F9UA 2PJ8A 1Y9WA 2PDOA 3SXOA 1DTDA 1LAPA 2O28A 5LRKA 4MCPA 2YNCC 3KASA 3EFAA 3S9NA 2AFOA 1Q2DA 4JXQA 1VHOA 5GCNA 4MBUA 4UBRA 3VARA 3BLNA 4MRIA 4WWVA 1R57A 4UFVA 3I1UA 2B4DA 5H86A 1OZPA 3HUVA 3IGRA 3GKRA 2F5IA 2WUUA 1GYTA 4MHDA 2AE6A 4U9YA 4K30A 4NF1A 4NCZA 3SXNA 1XFOA 3R9EA 4B10A 2PR8A 3FF3A 4G1PA 3KR5A 3TO6A 5HVHA 2ODFA 1X12A 3B3VA 1XRYA 1YW6A 1ZLIA 4ZBGA 2PJAA 3FB3A 4CGOA 4KOTA 3HLPA 2XEJA 1XEBA 5EC4A 4EMEA 1CP6A 2IMOA 4CYQA 2PQ8A 3BHXA 4PSXA 4W9YA 4R7MA 4RI1A 3PGPA 1NE9A 4BD9A 3D67A 3B7IA 4H89A 4AB7A 4CYPA 8CPAA 1S7KA 3IJ3A 1YSJA 2Z3NA 2P6GA 2C6PA 4DUKA 5EBVA 4A31A 1M4LA 4M3SA 1QQ9A 1YMEA 2FSRA 2REFA 4LQ6A 2NYQA 3D7HA 3RNZA 5JPHA 4KVME 3SI1A 4HNYB 3S6FA 4MI4A 2ZW7A 2EWBA 1YK3A 3EO4A 4NGRA 4XNHC 1P4NA 4E2AA 2BL1A 1ARLA 1QSOA 1CBXA 1YW4A 2G3TA 2PCUA 2R98A 4JLYA 4JZ0A 4UWJA 5AG6A 3RBUA 1KWMA 5F46A 4AG7A 4II9A 1TXRA 3P2FA 4MMOA 1PU9A 3D66A 3D7FA 4MHNA 1A2ZA 2ZEFA 1BPMA 4OMEA 3IC1A 3PBEA 3DGVA 3B3WA 3FX6A 5G20A 1Z8LA 4KOXA 2VZYA 5IB0A 3NFZA 3K2KA 2Q51A 5D29A 1M1DA 2NSMA 5DWNA 4H2KA 2PIYA 3KHXA 3S6KA 1NSLA 2GIVA 3CZXA 4NXYA 5KTCA 1IYLA 1H8LA 3SI0A 2OZHA 2ZEDA 2JEVA 3D8PA 2PVWA 4J3GA 4R3KA 3IU1A 4KSAA 4F0XA 4OC3A 2P6EA 2PVVA 4UFXA 2OZUA 4X2TA 4LQGA 2OH1A 4UWIA 5LYIA 5JGFA 3WT4A 1M4DA 3G8WA 3KR4A 2YNEA 1WWZA 4H6UA 1XF8A 2J8NA 2B3VA 2PC1A 4L8AA 2H5MA 1QSNA 2ZEGA 1EE3P 3VATA 2PIZA 3NE8A 2HUZA 3B2YA 4FAIA 4YGOA 5I4MA 4NGMA 5ISVA 3TE4A 4B11A 2PJ0A 3B3SA 5A27A 5C82A 2F7VA 4HKFA 4FD4A 1F2OA 1YR0A 4Q38A 1UWYA 2Y0MA 4BMHA 2CXAA 4JJXA 4CAVA 1LANA 2G9DA 2ZOGA 3KL9A 4UCMA 2YNDA 3TTHA 3B35A 5K8PA 4JD6A 2GANA 3PB4X 5AG5A 2B4DB 2B5GB 4F0YA 1IICA 2EK9A 2J8RA 1XBUA 4ONWA 2ZELA 1TKHA 3TFYA 2GU2A 2D4OA 4KLWA 1S7LA 1Z8XA 4P10A 2RB7A 3A9LA 5K8NA 3PB8X 3WC6A 2JDCA 1XJOA 3BI0A 2GLFA 4A37A 4DJLA 2BCOA 2ABZA 3PEIA 2B5GA 4JYWA 2ZEPA 3SJXA 3CPAA 3WC5A 1KUYA 5JH9A 1GHEA 1RTQA 5IV0A 2OB0A 4EFDA 2ZOFA 3JVNA 2FCKA 3FJUA 4AVCA 2FXFA 3PFEA 4P4BA 1FT7A 3K9TA 4XPDB 5J8FA 1IGBA 1MK4A 2JLMA 4M6GA 4OKOA 2JBJA 2PR1A 1WK4A 4MFJA 5JM6A 3H8EA 2G3AA 4CS0B 1BO4A 2JEWA 3WABA 1IU8A 4FWUA 2PJ3A 2HQYA 2F8HA 2VL1A 5I0CA 2CTBA 2CY2A 3D4UA 3FECA 3NH4A 2C6CA 2R1IA 1VGYA 3GYAA 5DS0A 5LYDA 1JWQA 1XMTA 2DF5A 2FIWA 4B13A 3D7DA 5LYFA 4MHYA 3VWEA 4PXEA 4TWEA 1ELLP 1ZO0A 3MN8A 2J8MA 3B8GA 3FXTA 3VH9A 1NMTA 4M85A 1PYTB 3I3GA 3ZZIA 3PB6X 4AVBA 4Y49B 5K8MA 4P44A 3GLJA 4C2ZA 3NE7A 2PSWA 4R8FA 4XPKA 5G22A 2PRQA 4KSFA 4NGTA 4UEZA 3C26A 5J8CA 4P45A 4OC5A 1VHSA 5HH1A 3TCVA 4KS9A 3H8FA 3V7ZA 1XE4A 1XMBA 2B4BA 2R8VA 4YFJA 5KTDA 4UA3A 2D4PA 2VQYA 4MCQA 3KHZA 4PQAA 2P0WA 1Q7LA 5FVJA 3FEDA 2IL4A 3TT2A 4C2YA 3IWGA 2AFWA 3P2HA 2C1CA 2ZEOA 3PFOA 3S6GA 2CNSA 3FH4A 3R9FA 7CPAA 2GLJA 4IK2A 4ZY1A 4MFPA 3V8IA 2A4NA 3S9LA 5ELYA 4AG9A 2HV2A 1M44A 1Z2LA 4QVTA 4NGNA 5LRGA 3QB8A 2VBQA 1TF8A 1Y0RA 3QNVA 3F5BA 4KSIA 3D7GA 4UIBA 1MJ9A 3DR8A 4RS2A 3R1KA 3VWDA 2GREA 2PE3A 1LFWA 2Q4ZA 2ZENA 3B3CA 3L2NA 4PV6A 3FEEA 3T8WA 1S7FA 4MJ8A 5D8NA 3K9UA 2FT0A 4R6TA 1F57A 2O4HA 3CPXA 4OC4A 1IOIA 5EMIA 4B5PA 1CG2A 5BWAB 1ZG8A 1AMPA 3CXPA 2JDDA 3IIBA 3RO0A 4ZY0A 4UEEA 5F09A 5CPAA 3ZJ0A 5JQ4A 2Q44A 3NH8A 4IHMA 5AG7A 3IFEA 4NGQA 4Q7AA 2XEFA 4MHZA 2DPTA 3GUXA 1ZG9A 3T9YA 4OAEA 4U5YA 3QAYA 4A32A 1BAVA 2ZW5A 3PB7X 4L89A 4NGSA 4OIDA 4A2ZA 4CGMA 2PJ9A 1I1DA 2G0BA 4B14A 2VXKA 4CPAA 2WPWA 4F9VA 4NFRA 2PJBA 2Q4YA 1HDQA 4KZTA 4NGPA 3KI9A 2RC4A 5IB9A 3CXQA 3D68A 3S6HA 1AYEA 4MFKA 2Q7BA 2DXQA 3FIXA 4KOUA 3R96A 4OC2A 4KOVA 4KVXA 1IOFA 4MY3A 1F2PA 1RXTA 6CPAA 4A95A 4ZGYB 1CJWA 3TOAA 5H84A 5LYLA 2AJ6A 4KLVA 4IF5A 4RN7A 1TIQA 1V0CA 2CIJA 2REEA 2FL4A 2PJ4A 5K8OA 4IAVA 3ISXA 1JQGA 3PBBA 2Z3PA 1MJAA 2QJ8A 3TOBA 2YGWA 4LX9A 5J1QA 4FD7A 1NSAA 2YNCA 2OOTA 4NJRA 5AG4A 1BPNA 2PJ6A 3SJGA 4X8IA 4E0AA 5HMNA 2OZGA 1S60A 1TKFA 3LWUA 3LD2A 2WPXA 2WZNA 3EY5A 4M6IA 2I3CA 3TO9A 3PRTA 2BEIA 3IO1A 4MFQA 4O23A 5F47A 4ZYQA 1I12A 3LMSA 4OIWA 2IJZA 4UFWA 4A38A 4MXUA 2V8VA 3IWEA 1CPSA 1Y7EA 2P6FA 1MJBA 1Z8WA 2NMTA 1Y9KA 4R76A 2AFMA 4YWYA 2ZW6A 4PXCA 4DYOA 3ISZA 4ZX8A 1CM0A 4YRHA 4X5KA 2FVGA 1YGHA 4F8ZA 4KUBA 4OADA 4P4FA 4CYOA 1FNOA 3IWWA 2I00A 1ZLHA 1IY7A 2GE3A 4AVAA 3W6SA 1YX0A 1BLLE
chains in the Genus database with same CATH topology
2B58A 4U9ZA 1I21A 2Q4VA 3FNCA 4GS4A 4QB9A 1LRZA 2Q04A 2QIRA 4FD6A 5G1ZA 4CRYB 3I9SA 1Y7RA 2DPSA 1BOBA 4CAEA 2Z0ZA 1QSMA 4CGLA 4C7HA 3N7ZA 4LUAA 4UCPA 2VEZA 4R57A 2I79A 4KVOE 2ARHA 3FYNA 1S3ZA 4I49A 4HNWB 2PRBA 3IU2A 4OLLA 2X7BA 3PZJA 4H6ZA 3RYOA 3EXNA 2CNMA 3E0KA 4DNCA 1XIXA 4R3LA 2R7HA 3H5ZA 4ORFA 2B3UA 4CGNA 4Q36A 1IIDA 2ATRA 4MFZA 5G21A 5F48A 4KUAA 1B87A 1YVKA 2VZZA 1Z4RA 3UY5A 5AGEA 1S5KA 2Z3OA 2Z3MA 4UCNA 4QC6A 2BUEA 4CGPA 3GY9A 3R9GA 2WSAA 2Q0YA 3F8KA 3MGDA 1P0HA 4A30A 2FS5A 2VI7A 3H4QA 1N71A 1YREA 1L0CA 1YLEA 4F6AA 3BJ8A 4MFLA 1KUXA 3F0AA 4BBHA 4JWPA 3DNSA 4B12A 4PSWA 1IB1E 2C27A 3OWCA 3T90A 1S7NA 3DDDA 5CNPA 4E8OA 1Q2CA 4KOWA 1QSTA 3BJ7A 4HNXB 3KKWA 4KOSA 1SQHA 3LODA 4QUSA 4MY0A 3FRMA 3QAHA 2FE7A 3D2MA 4R9MA 1FY7A 2QECA 3EC4A 4XNHB 1VKCA 1KUVA 3D3SA 2ZPAA 4A33A 4EVYA 2BSWA 2ZXVA 2Z10A 3DR6A 4JXRA 4CAXA 4B5PB 4C7IA 1ON0A 4XPDC 3WR7A 1Z9UA 4XPLA 4PK3A 2Z11A 4CAFA 5E96A 1PUAA 1U6MA 5IX3A 1IYKA 1QSRA 2OU2A 4Y49C 3JUWA 1M4IA 2QMLA 4NSQA 4ONUA 4NEXA 2EVNA 2EUIA 4QBJA 4C68A 3R95A 2CNTA 3FBUA 4B5OA 2KCWA 4R87A 3SHPA 4IUSA 5KTAA 1Z4EA 5DWMA 1KZFA 1B6BA 1RO5A 3D2PA 1M4GA 4C2XA 4KOYA 3W6XA 2FIAA 3TO7A 5F49A 1Q2YA 3DSBA 4CRZB 3JTKA 3PP9A 4CYNA 1J4JA 4PK2A 4KORA 1YVOA 4FD5A 5A28A 3CXSA 2Z3LA 1UFHA 2ZW4A 2Z3KA 1K4JA 3G3SA 2K5TA 1Y9WA 2PDOA 3SXOA 2O28A 2YNCC 3EFAA 1Q2DA 4JXQA 5GCNA 4MBUA 4UBRA 3BLNA 1R57A 4UFVA 5H86A 2B4DA 1OZPA 3IGRA 3GKRA 2F5IA 2WUUA 4MHDA 2AE6A 4U9YA 4K30A 4NF1A 4NCZA 3SXNA 3R9EA 2PR8A 3TO6A 4ZBGA 3FB3A 4CGOA 4KOTA 1XEBA 5EC4A 4CYQA 2PQ8A 4PSXA 4RI1A 3PGPA 1NE9A 4AB7A 4H89A 4CYPA 1S7KA 2Z3NA 2P6GA 5EBVA 4A31A 4M3SA 2FSRA 5JPHA 2REFA 4KVME 4HNYB 3S6FA 4MI4A 2ZW7A 1YK3A 3EO4A 4XNHC 1P4NA 4E2AA 2BL1A 1QSOA 2G3TA 4JLYA 4UWJA 2R98A 5AG6A 5F46A 4AG7A 4II9A 3P2FA 1PU9A 5G20A 4KOXA 2VZYA 5IB0A 1M1DA 5DWNA 3S6KA 1NSLA 2GIVA 4NXYA 5KTCA 1IYLA 2OZHA 2JEVA 3D8PA 4J3GA 4R3KA 3IU1A 4KSAA 4F0XA 2P6EA 4UFXA 2OZUA 2OH1A 4UWIA 1M4DA 3G8WA 2YNEA 1WWZA 4H6UA 1XF8A 2J8NA 2B3VA 2PC1A 4L8AA 2H5MA 1QSNA 2HUZA 4YGOA 5ISVA 3TE4A 4B11A 5A27A 5C82A 4HKFA 4FD4A 1YR0A 4Q38A 2Y0MA 4BMHA 2CXAA 4JJXA 4CAVA 4UCMA 2YNDA 3TTHA 4JD6A 2GANA 5AG5A 2B4DB 2B5GB 4F0YA 1IICA 2J8RA 3TFYA 2D4OA 4KLWA 1S7LA 3A9LA 2JDCA 2B5GA 1KUYA 1GHEA 5IV0A 2OB0A 3JVNA 2FCKA 4AVCA 2FXFA 4XPDB 5J8FA 1MK4A 2JLMA 2PR1A 1WK4A 4MFJA 2G3AA 4CS0B 1BO4A 2HQYA 5I0CA 2CY2A 2R1IA 3GYAA 2FIWA 1XMTA 4B13A 3VWEA 1ZO0A 3ZZIA 2J8MA 3FXTA 3B8GA 1NMTA 4M85A 3I3GA 4AVBA 4Y49B 4C2ZA 3NE7A 2PSWA 4XPKA 5G22A 4KSFA 5J8CA 3C26A 1VHSA 5HH1A 3TCVA 4KS9A 4YFJA 1XE4A 5KTDA 2B4BA 2R8VA 4UA3A 2D4PA 2VQYA 2P0WA 5FVJA 2IL4A 3TT2A 4C2YA 3IWGA 3P2HA 3S6GA 2CNSA 3R9FA 4MFPA 3V8IA 2A4NA 4AG9A 2HV2A 1M44A 4QVTA 3QB8A 2VBQA 3F5BA 1MJ9A 3DR8A 4RS2A 3R1KA 3VWDA 3W91A 4CAWA 4PV6A 1S7FA 4MJ8A 3K9UA 2FT0A 4B5PA 5BWAB 3CXPA 2JDDA 3ZJ0A 5JQ4A 2Q44A 5AG7A 2DPTA 3T9YA 4OAEA 4U5YA 4A32A 2ZW5A 4L89A 4A2ZA 4CGMA 1I1DA 2G0BA 4B14A 2VXKA 2WPWA 2Q4YA 4KZTA 2RC4A 3CXQA 3S6HA 4MFKA 2Q7BA 2DXQA 3FIXA 4KOUA 3R96A 4KOVA 4KVXA 4MY3A 1RXTA 4A95A 4ZGYB 1CJWA 3TOAA 5H84A 2AJ6A 4KLVA 4IF5A 1TIQA 1V0CA 2REEA 2FL4A 2Z3PA 1MJAA 3TOBA 2YGWA 4LX9A 4FD7A 2YNCA 5AG4A 5HMNA 4E0AA 2OZGA 1S60A 3LD2A 2WPXA 3EY5A 3TO9A 2BEIA 4MFQA 5F47A 1I12A 4UFWA 3IWEA 2P6FA 1MJBA 2NMTA 4B10A 1Y9KA 5C88A 2ZW6A 1CM0A 4YRHA 4X5KA 1YGHA 4KUBA 4OADA 4CYOA 2I00A 2GE3A 4AVAA 3W6SA 1YX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B58 A;  4U9Z A;  1I21 A;  2Q4V A;  3FNC A;  4GS4 A;  4QB9 A;  1LRZ A;  2Q04 A;  2QIR A;  4FD6 A;  4CRY B;  3I9S A;  1Y7R A;  1BOB A;  2Z0Z A;  1QSM A;  3N7Z A;  4LUA A;  2VEZ A;  4R57 A;  2I79 A;  4KVO E;  2ARH A;  3FYN A;  1S3Z A;  4I49 A;  4HNW B;  2PRB A;  4OLL A;  2X7B A;  3PZJ A;  4H6Z A;  3RYO A;  3EXN A;  2CNM A;  3E0K A;  4DNC A;  1XIX A;  4R3L A;  2R7H A;  4ORF A;  2B3U A;  1IID A;  2ATR A;  5F48 A;  4KUA A;  1B87 A;  1YVK A;  2VZZ A;  1Z4R A;  3UY5 A;  1S5K A;  4QC6 A;  2BUE A;  3GY9 A;  3R9G A;  2Q0Y A;  3F8K A;  3MGD A;  1P0H A;  2FS5 A;  2VI7 A;  3H4Q A;  1N71 A;  1YRE A;  1L0C A;  1YLE A;  4F6A A;  3BJ8 A;  1KUX A;  3F0A A;  4JWP A;  3DNS A;  4PSW A;  1IB1 E;  2C27 A;  3OWC A;  3T90 A;  1S7N A;  3DDD A;  5CNP A;  4E8O A;  1Q2C A;  4KOW A;  1QST A;  3BJ7 A;  4HNX B;  3KKW A;  4KOS A;  1SQH A;  3LOD A;  4QUS A;  4MY0 A;  3FRM A;  3QAH A;  2FE7 A;  3D2M A;  4R9M A;  1FY7 A;  2QEC A;  3EC4 A;  4XNH B;  1VKC A;  1KUV A;  3D3S A;  2ZPA A;  4EVY A;  2BSW A;  2ZXV A;  2Z10 A;  3DR6 A;  4JXR A;  4CAX A;  4B5P B;  1ON0 A;  4XPD C;  3WR7 A;  1Z9U A;  4XPL A;  4PK3 A;  2Z11 A;  5E96 A;  1PUA A;  1U6M A;  5IX3 A;  1IYK A;  1QSR A;  2OU2 A;  4Y49 C;  3JUW A;  1M4I A;  2QML A;  4NSQ A;  4ONU A;  4NEX A;  2EVN A;  2EUI A;  4QBJ A;  3R95 A;  2CNT A;  3FBU A;  4B5O A;  2KCW A;  4R87 A;  3SHP A;  4IUS A;  5KTA A;  1Z4E A;  5DWM A;  1KZF A;  1B6B A;  1RO5 A;  3D2P A;  1M4G A;  4KOY A;  3W6X A;  2FIA A;  3TO7 A;  5F49 A;  1Q2Y A;  3DSB A;  4CRZ B;  3PP9 A;  1J4J A;  4PK2 A;  4KOR A;  1YVO A;  4FD5 A;  3CXS A;  1UFH A;  2ZW4 A;  1K4J A;  3G3S A;  2K5T A;  1Y9W A;  2PDO A;  3SXO A;  2O28 A;  3EFA A;  1Q2D A;  4JXQ A;  5GCN A;  4MBU A;  4UBR A;  3BLN A;  1R57 A;  5H86 A;  2B4D A;  1OZP A;  3IGR A;  3GKR A;  2F5I A;  4MHD A;  2AE6 A;  4U9Y A;  4K30 A;  4NF1 A;  4NCZ A;  3SXN A;  3R9E A;  2PR8 A;  3TO6 A;  4ZBG A;  3FB3 A;  4KOT A;  1XEB A;  5EC4 A;  2PQ8 A;  4PSX A;  4RI1 A;  3PGP A;  1NE9 A;  4AB7 A;  4H89 A;  1S7K A;  2P6G A;  5EBV A;  4M3S A;  2FSR A;  5JPH A;  2REF A;  4KVM E;  4HNY B;  3S6F A;  4MI4 A;  2ZW7 A;  1YK3 A;  3EO4 A;  4XNH C;  1P4N A;  4E2A A;  2BL1 A;  1QSO A;  2G3T A;  4JLY A;  4UWJ A;  2R98 A;  5F46 A;  4AG7 A;  4II9 A;  3P2F A;  1PU9 A;  4KOX A;  2VZY A;  5IB0 A;  1M1D A;  5DWN A;  3S6K A;  1NSL A;  2GIV A;  4NXY A;  5KTC A;  1IYL A;  2OZH A;  2JEV A;  3D8P A;  4J3G A;  4R3K A;  2P6E A;  2OZU A;  2OH1 A;  4UWI A;  1M4D A;  3G8W A;  1WWZ A;  4H6U A;  1XF8 A;  2J8N A;  2B3V A;  2PC1 A;  4L8A A;  2H5M A;  1QSN A;  2HUZ A;  4YGO A;  5ISV A;  3TE4 A;  5C82 A;  4HKF A;  4FD4 A;  1YR0 A;  2Y0M A;  4BMH A;  4CAV A;  4JJX A;  3TTH A;  4JD6 A;  2GAN A;  2B4D B;  2B5G B;  4F0Y A;  1IIC A;  2J8R A;  3TFY A;  2D4O A;  4KLW A;  1S7L A;  2JDC A;  2B5G A;  1KUY A;  1GHE A;  5IV0 A;  2OB0 A;  3JVN A;  2FCK A;  4AVC A;  2FXF A;  4XPD B;  5J8F A;  1MK4 A;  2JLM A;  2PR1 A;  1WK4 A;  2G3A A;  4CS0 B;  1BO4 A;  2HQY A;  5I0C A;  2CY2 A;  2R1I A;  3GYA A;  2FIW A;  1XMT A;  3VWE A;  3ZZI A;  2J8M A;  3FXT A;  3B8G A;  1NMT A;  4M85 A;  3I3G A;  4AVB A;  4Y49 B;  3NE7 A;  2PSW A;  4XPK A;  5J8C A;  3C26 A;  1VHS A;  5HH1 A;  3TCV A;  4YFJ A;  1XE4 A;  5KTD A;  2B4B A;  2R8V A;  4UA3 A;  2D4P A;  2VQY A;  2P0W A;  5FVJ A;  2IL4 A;  3TT2 A;  3IWG A;  3P2H A;  3S6G A;  2CNS A;  3R9F A;  3V8I A;  2A4N A;  4AG9 A;  2HV2 A;  1M44 A;  4QVT A;  3QB8 A;  2VBQ A;  3F5B A;  1MJ9 A;  3DR8 A;  4RS2 A;  3R1K A;  3VWD A;  3W91 A;  4CAW A;  4PV6 A;  1S7F A;  4MJ8 A;  3K9U A;  2FT0 A;  4B5P A;  3CXP A;  2JDD A;  3ZJ0 A;  5JQ4 A;  2Q44 A;  3T9Y A;  4OAE A;  4U5Y A;  2ZW5 A;  4L89 A;  1I1D A;  2G0B A;  2VXK A;  2WPW A;  2Q4Y A;  4KZT A;  2RC4 A;  3CXQ A;  3S6H A;  2Q7B A;  2DXQ A;  3FIX A;  4KOU A;  3R96 A;  4KOV A;  4KVX A;  4MY3 A;  1RXT A;  1CJW A;  3TOA A;  5H84 A;  2AJ6 A;  4KLV A;  4IF5 A;  1TIQ A;  1V0C A;  2REE A;  2FL4 A;  1MJA A;  3TOB A;  4LX9 A;  4FD7 A;  5HMN A;  4E0A A;  2OZG A;  1S60 A;  3LD2 A;  2WPX A;  3EY5 A;  3TO9 A;  2BEI A;  5F47 A;  1I12 A;  2P6F A;  1MJB A;  2NMT A;  5C88 A;  1Y9K A;  2ZW6 A;  1CM0 A;  4YRH A;  4X5K A;  1YGH A;  4KUB A;  4OAD A;  2I00 A;  2GE3 A;  4AVA A;  3W6S A;  1YX0 A; 
#chains in the Genus database with same CATH topology
 2B58 A;  3IEH A;  4U9Z A;  1I21 A;  2Q4V A;  3FNC A;  4GS4 A;  5HVF A;  3NH5 A;  4QB9 A;  2CF4 A;  4YU9 A;  2XEG A;  4PXB A;  1LRZ A;  2AFZ A;  2Q04 A;  2QIR A;  4FD6 A;  5G1Z A;  4CRY B;  5C88 A;  1LCP A;  3I9S A;  3SJE A;  4BIN A;  1Y7R A;  2DPS A;  1BOB A;  4CAE A;  2Z0Z A;  1QSM A;  4CGL A;  1YQE A;  4C7H A;  2AFU A;  3N7Z A;  3KGQ A;  4LUA A;  4UCP A;  3KQZ A;  2VEZ A;  4R57 A;  2I79 A;  4KVO E;  3SI2 A;  2ARH A;  3FYN A;  1S3Z A;  4I49 A;  2ZEH A;  4HNW B;  2PRB A;  3IU2 A;  4OP4 A;  2PJ1 A;  2HC9 A;  1Z8T A;  2X7B A;  2C6G A;  4OLL A;  3PZJ A;  4H6Z A;  4X3R A;  3RYO A;  1XOV A;  2CNM A;  3E0K A;  3EXN A;  4DNC A;  1XIX A;  1ELM P;  4R3L A;  2R7H A;  3H5Z A;  4ORF A;  2B3U A;  4CGN A;  2AFS A;  4Q36 A;  1AUG A;  1IID A;  5LRJ A;  2EK8 A;  2ATR A;  4MFZ A;  3PB9 X;  1ZG7 A;  5G21 A;  5F48 A;  4KUA A;  1B87 A;  1YVK A;  2VZZ A;  4A39 A;  3TC8 A;  3RZA A;  3SJF A;  4UEF A;  1Z4R A;  3UY5 A;  5AGE A;  1S5K A;  2Z3O A;  3FVL A;  2Z3M A;  2PJ7 A;  4UCN A;  4OC1 A;  2BUE A;  4QC6 A;  4CGP A;  5CBM A;  3GY9 A;  4A94 A;  1X10 A;  4MCS A;  2V8H A;  3R9G A;  3CDX A;  2J9A A;  3B3T A;  2WSA A;  2Q0Y A;  4GM5 A;  4OC0 A;  3F8K A;  2EBJ A;  3MGD A;  1P0H A;  4A30 A;  2FS5 A;  2VI7 A;  3H4Q A;  4ZX9 A;  1N71 A;  1YRE A;  2ZEM A;  1L0C A;  1YLE A;  4TNU A;  5HXD A;  3TX8 A;  4F6A A;  4B6Z A;  3BJ8 A;  2PJC A;  4MFL A;  1QMU A;  1KUX A;  2CTC A;  3F0A A;  4JWP A;  3V38 A;  4BBH A;  4ZY2 A;  3DNS A;  4P6Y A;  2HB6 A;  4UIA A;  2AFX A;  4B12 A;  4WJB A;  1ARM A;  4RUH A;  4PSW A;  1IB1 E;  2C27 A;  3OWC A;  3T90 A;  4ZI6 A;  1S7N A;  2V8G A;  3DDD A;  3S9M A;  4P4I A;  2PJ2 A;  5CNP A;  4E8O A;  1Q2C A;  4KOW A;  1QST A;  3BJ7 A;  1HDU A;  3KKW A;  4HNX B;  4KOS A;  4M6H A;  1SQH A;  3LOD A;  3GB0 A;  2V77 A;  1VIX A;  2V8D A;  4MY0 A;  4QUS A;  3FRM A;  3QAH A;  2FE7 A;  3BI1 A;  3CT9 A;  3D2M A;  3KZW A;  2RFH A;  2BOA A;  4R9M A;  1FY7 A;  4FBE A;  2QEC A;  3EC4 A;  4XNH B;  1VKC A;  1KUV A;  3D3S A;  2ZPA A;  4A33 A;  4EVY A;  2BSW A;  2ZXV A;  2Z10 A;  3BXM A;  3WC7 A;  3DR6 A;  4JXR A;  4CAX A;  4B5P B;  2O53 A;  2ZEE A;  3NA6 A;  4C7I A;  2IQ6 A;  1ON0 A;  2Q43 A;  3JRU A;  4XPD C;  2XEI A;  2QVP A;  3WR7 A;  3DLJ A;  1Z9U A;  4XPL A;  4PK3 A;  2Q7S A;  4HPS A;  2EO8 A;  2JBK A;  2Z11 A;  4CAF A;  5E96 A;  1PUA A;  1U6M A;  4GXH A;  5IX3 A;  1IYK A;  1QSR A;  2OU2 A;  4Y49 C;  3JUW A;  2POK A;  1M4I A;  2QML A;  2WYR A;  4NSQ A;  4ONU A;  2OR4 A;  4NEX A;  2EVN A;  2PJ5 A;  2EUI A;  4CAW A;  4QBJ A;  4C68 A;  3MRU A;  1DE4 C;  3R95 A;  1OBR A;  2CNT A;  3FBU A;  1R43 A;  2KCW A;  1Y0Y A;  1TKJ A;  4B5O A;  4R87 A;  3SHP A;  4IUS A;  5KTA A;  1Z4E A;  3KQX A;  2QYV A;  5DWM A;  1KZF A;  3GIU A;  1B6B A;  1RO5 A;  4NJQ A;  4MCR A;  3D2P A;  1M4G A;  4C2X A;  4KOY A;  5THW A;  2DEA A;  3W6X A;  4Z65 A;  3W91 A;  2FIA A;  3TO7 A;  5F49 A;  4MHP A;  1Q2Y A;  3DSB A;  4CRZ B;  3JTK A;  3PP9 A;  4UF4 A;  4CYN A;  3RAM A;  4P4E A;  1J4J A;  1TF9 A;  2BO9 A;  3FMC A;  3LAC A;  2GFQ A;  1LOK A;  2ANP A;  4PK2 A;  4P4J A;  3H8G A;  4KOR A;  1YVO A;  4EWT A;  4FD5 A;  4PXD A;  4FUU A;  1CPX A;  3N5F A;  4P4D A;  1Z5R A;  4PPZ A;  1PCA A;  1CX8 A;  1R3N A;  2Z3L A;  3CXS A;  5A28 A;  4K3N A;  1YLO A;  1UFH A;  2ZW4 A;  2Z3K A;  1K4J A;  1HEE A;  1LAM A;  5HVG A;  4AXV A;  3G3S A;  1VHE A;  1CP7 A;  2K5T A;  4F9U A;  2PJ8 A;  1Y9W A;  2PDO A;  3SXO A;  1DTD A;  1LAP A;  2O28 A;  5LRK A;  4MCP A;  2YNC C;  3KAS A;  3EFA A;  3S9N A;  2AFO A;  1Q2D A;  4JXQ A;  1VHO A;  5GCN A;  4MBU A;  4UBR A;  3VAR A;  3BLN A;  4MRI A;  4WWV A;  1R57 A;  4UFV A;  3I1U A;  2B4D A;  5H86 A;  1OZP A;  3HUV A;  3IGR A;  3GKR A;  2F5I A;  2WUU A;  1GYT A;  4MHD A;  2AE6 A;  4U9Y A;  4K30 A;  4NF1 A;  4NCZ A;  3SXN A;  1XFO A;  3R9E A;  4B10 A;  2PR8 A;  3FF3 A;  4G1P A;  3KR5 A;  3TO6 A;  5HVH A;  2ODF A;  1X12 A;  3B3V A;  1XRY A;  1YW6 A;  1ZLI A;  4ZBG A;  2PJA A;  3FB3 A;  4CGO A;  4KOT A;  3HLP A;  2XEJ A;  1XEB A;  5EC4 A;  4EME A;  1CP6 A;  2IMO A;  4CYQ A;  2PQ8 A;  3BHX A;  4PSX A;  4W9Y A;  4R7M A;  4RI1 A;  3PGP A;  1NE9 A;  4BD9 A;  3D67 A;  3B7I A;  4H89 A;  4AB7 A;  4CYP A;  8CPA A;  1S7K A;  3IJ3 A;  1YSJ A;  2Z3N A;  2P6G A;  2C6P A;  4DUK A;  5EBV A;  4A31 A;  1M4L A;  4M3S A;  1QQ9 A;  1YME A;  2FSR A;  2REF A;  4LQ6 A;  2NYQ A;  3D7H A;  3RNZ A;  5JPH A;  4KVM E;  3SI1 A;  4HNY B;  3S6F A;  4MI4 A;  2ZW7 A;  2EWB A;  1YK3 A;  3EO4 A;  4NGR A;  4XNH C;  1P4N A;  4E2A A;  2BL1 A;  1ARL A;  1QSO A;  1CBX A;  1YW4 A;  2G3T A;  2PCU A;  2R98 A;  4JLY A;  4JZ0 A;  4UWJ A;  5AG6 A;  3RBU A;  1KWM A;  5F46 A;  4AG7 A;  4II9 A;  1TXR A;  3P2F A;  4MMO A;  1PU9 A;  3D66 A;  3D7F A;  4MHN A;  1A2Z A;  2ZEF A;  1BPM A;  4OME A;  3IC1 A;  3PBE A;  3DGV A;  3B3W A;  3FX6 A;  5G20 A;  1Z8L A;  4KOX A;  2VZY A;  5IB0 A;  3NFZ A;  3K2K A;  2Q51 A;  5D29 A;  1M1D A;  2NSM A;  5DWN A;  4H2K A;  2PIY A;  3KHX A;  3S6K A;  1NSL A;  2GIV A;  3CZX A;  4NXY A;  5KTC A;  1IYL A;  1H8L A;  3SI0 A;  2OZH A;  2ZED A;  2JEV A;  3D8P A;  2PVW A;  4J3G A;  4R3K A;  3IU1 A;  4KSA A;  4F0X A;  4OC3 A;  2P6E A;  2PVV A;  4UFX A;  2OZU A;  4X2T A;  4LQG A;  2OH1 A;  4UWI A;  5LYI A;  5JGF A;  3WT4 A;  1M4D A;  3G8W A;  3KR4 A;  2YNE A;  1WWZ A;  4H6U A;  1XF8 A;  2J8N A;  2B3V A;  2PC1 A;  4L8A A;  2H5M A;  1QSN A;  2ZEG A;  1EE3 P;  3VAT A;  2PIZ A;  3NE8 A;  2HUZ A;  3B2Y A;  4FAI A;  4YGO A;  5I4M A;  4NGM A;  5ISV A;  3TE4 A;  4B11 A;  2PJ0 A;  3B3S A;  5A27 A;  5C82 A;  2F7V A;  4HKF A;  4FD4 A;  1F2O A;  1YR0 A;  4Q38 A;  1UWY A;  2Y0M A;  4BMH A;  2CXA A;  4JJX A;  4CAV A;  1LAN A;  2G9D A;  2ZOG A;  3KL9 A;  4UCM A;  2YND A;  3TTH A;  3B35 A;  5K8P A;  4JD6 A;  2GAN A;  3PB4 X;  5AG5 A;  2B4D B;  2B5G B;  4F0Y A;  1IIC A;  2EK9 A;  2J8R A;  1XBU A;  4ONW A;  2ZEL A;  1TKH A;  3TFY A;  2GU2 A;  2D4O A;  4KLW A;  1S7L A;  1Z8X A;  4P10 A;  2RB7 A;  3A9L A;  5K8N A;  3PB8 X;  3WC6 A;  2JDC A;  1XJO A;  3BI0 A;  2GLF A;  4A37 A;  4DJL A;  2BCO A;  2ABZ A;  3PEI A;  2B5G A;  4JYW A;  2ZEP A;  3SJX A;  3CPA A;  3WC5 A;  1KUY A;  5JH9 A;  1GHE A;  1RTQ A;  5IV0 A;  2OB0 A;  4EFD A;  2ZOF A;  3JVN A;  2FCK A;  3FJU A;  4AVC A;  2FXF A;  3PFE A;  4P4B A;  1FT7 A;  3K9T A;  4XPD B;  5J8F A;  1IGB A;  1MK4 A;  2JLM A;  4M6G A;  4OKO A;  2JBJ A;  2PR1 A;  1WK4 A;  4MFJ A;  5JM6 A;  3H8E A;  2G3A A;  4CS0 B;  1BO4 A;  2JEW A;  3WAB A;  1IU8 A;  4FWU A;  2PJ3 A;  2HQY A;  2F8H A;  2VL1 A;  5I0C A;  2CTB A;  2CY2 A;  3D4U A;  3FEC A;  3NH4 A;  2C6C A;  2R1I A;  1VGY A;  3GYA A;  5DS0 A;  5LYD A;  1JWQ A;  1XMT A;  2DF5 A;  2FIW A;  4B13 A;  3D7D A;  5LYF A;  4MHY A;  3VWE A;  4PXE A;  4TWE A;  1ELL P;  1ZO0 A;  3MN8 A;  2J8M A;  3B8G A;  3FXT A;  3VH9 A;  1NMT A;  4M85 A;  1PYT B;  3I3G A;  3ZZI A;  3PB6 X;  4AVB A;  4Y49 B;  5K8M A;  4P44 A;  3GLJ A;  4C2Z A;  3NE7 A;  2PSW A;  4R8F A;  4XPK A;  5G22 A;  2PRQ A;  4KSF A;  4NGT A;  4UEZ A;  3C26 A;  5J8C A;  4P45 A;  4OC5 A;  1VHS A;  5HH1 A;  3TCV A;  4KS9 A;  3H8F A;  3V7Z A;  1XE4 A;  1XMB A;  2B4B A;  2R8V A;  4YFJ A;  5KTD A;  4UA3 A;  2D4P A;  2VQY A;  4MCQ A;  3KHZ A;  4PQA A;  2P0W A;  1Q7L A;  5FVJ A;  3FED A;  2IL4 A;  3TT2 A;  4C2Y A;  3IWG A;  2AFW A;  3P2H A;  2C1C A;  2ZEO A;  3PFO A;  3S6G A;  2CNS A;  3FH4 A;  3R9F A;  7CPA A;  2GLJ A;  4IK2 A;  4ZY1 A;  4MFP A;  3V8I A;  2A4N A;  3S9L A;  5ELY A;  4AG9 A;  2HV2 A;  1M44 A;  1Z2L A;  4QVT A;  4NGN A;  5LRG A;  3QB8 A;  2VBQ A;  1TF8 A;  1Y0R A;  3QNV A;  3F5B A;  4KSI A;  3D7G A;  4UIB A;  1MJ9 A;  3DR8 A;  4RS2 A;  3R1K A;  3VWD A;  2GRE A;  2PE3 A;  1LFW A;  2Q4Z A;  2ZEN A;  3B3C A;  3L2N A;  4PV6 A;  3FEE A;  3T8W A;  1S7F A;  4MJ8 A;  5D8N A;  3K9U A;  2FT0 A;  4R6T A;  1F57 A;  2O4H A;  3CPX A;  4OC4 A;  1IOI A;  5EMI A;  4B5P A;  1CG2 A;  5BWA B;  1ZG8 A;  1AMP A;  3CXP A;  2JDD A;  3IIB A;  3RO0 A;  4ZY0 A;  4UEE A;  5F09 A;  5CPA A;  3ZJ0 A;  5JQ4 A;  2Q44 A;  3NH8 A;  4IHM A;  5AG7 A;  3IFE A;  4NGQ A;  4Q7A A;  2XEF A;  4MHZ A;  2DPT A;  3GUX A;  1ZG9 A;  3T9Y A;  4OAE A;  4U5Y A;  3QAY A;  4A32 A;  1BAV A;  2ZW5 A;  3PB7 X;  4L89 A;  4NGS A;  4OID A;  4A2Z A;  4CGM A;  2PJ9 A;  1I1D A;  2G0B A;  4B14 A;  2VXK A;  4CPA A;  2WPW A;  4F9V A;  4NFR A;  2PJB A;  2Q4Y A;  1HDQ A;  4KZT A;  4NGP A;  3KI9 A;  2RC4 A;  5IB9 A;  3CXQ A;  3D68 A;  3S6H A;  1AYE A;  4MFK A;  2Q7B A;  2DXQ A;  3FIX A;  4KOU A;  3R96 A;  4OC2 A;  4KOV A;  4KVX A;  1IOF A;  4MY3 A;  1F2P A;  1RXT A;  6CPA A;  4A95 A;  4ZGY B;  1CJW A;  3TOA A;  5H84 A;  5LYL A;  2AJ6 A;  4KLV A;  4IF5 A;  4RN7 A;  1TIQ A;  1V0C A;  2CIJ A;  2REE A;  2FL4 A;  2PJ4 A;  5K8O A;  4IAV A;  3ISX A;  1JQG A;  3PBB A;  2Z3P A;  1MJA A;  2QJ8 A;  3TOB A;  2YGW A;  4LX9 A;  5J1Q A;  4FD7 A;  1NSA A;  2YNC A;  2OOT A;  4NJR A;  5AG4 A;  1BPN A;  2PJ6 A;  3SJG A;  4X8I A;  4E0A A;  5HMN A;  2OZG A;  1S60 A;  1TKF A;  3LWU A;  3LD2 A;  2WPX A;  2WZN A;  3EY5 A;  4M6I A;  2I3C A;  3TO9 A;  3PRT A;  2BEI A;  3IO1 A;  4MFQ A;  4O23 A;  5F47 A;  4ZYQ A;  1I12 A;  3LMS A;  4OIW A;  2IJZ A;  4UFW A;  4A38 A;  4MXU A;  2V8V A;  3IWE A;  1CPS A;  1Y7E A;  2P6F A;  1MJB A;  1Z8W A;  2NMT A;  1Y9K A;  4R76 A;  2AFM A;  4YWY A;  2ZW6 A;  4PXC A;  4DYO A;  3ISZ A;  4ZX8 A;  1CM0 A;  4YRH A;  4X5K A;  2FVG A;  1YGH A;  4F8Z A;  4KUB A;  4OAD A;  4P4F A;  4CYO A;  1FNO A;  3IWW A;  2I00 A;  1ZLH A;  1IY7 A;  2GE3 A;  4AVA A;  3W6S A;  1YX0 A;  1BLL E; 
#chains in the Genus database with same CATH homology
 2B58 A;  4U9Z A;  1I21 A;  2Q4V A;  3FNC A;  4GS4 A;  4QB9 A;  1LRZ A;  2Q04 A;  2QIR A;  4FD6 A;  5G1Z A;  4CRY B;  3I9S A;  1Y7R A;  2DPS A;  1BOB A;  4CAE A;  2Z0Z A;  1QSM A;  4CGL A;  4C7H A;  3N7Z A;  4LUA A;  4UCP A;  2VEZ A;  4R57 A;  2I79 A;  4KVO E;  2ARH A;  3FYN A;  1S3Z A;  4I49 A;  4HNW B;  2PRB A;  3IU2 A;  4OLL A;  2X7B A;  3PZJ A;  4H6Z A;  3RYO A;  3EXN A;  2CNM A;  3E0K A;  4DNC A;  1XIX A;  4R3L A;  2R7H A;  3H5Z A;  4ORF A;  2B3U A;  4CGN A;  4Q36 A;  1IID A;  2ATR A;  4MFZ A;  5G21 A;  5F48 A;  4KUA A;  1B87 A;  1YVK A;  2VZZ A;  1Z4R A;  3UY5 A;  5AGE A;  1S5K A;  2Z3O A;  2Z3M A;  4UCN A;  4QC6 A;  2BUE A;  4CGP A;  3GY9 A;  3R9G A;  2WSA A;  2Q0Y A;  3F8K A;  3MGD A;  1P0H A;  4A30 A;  2FS5 A;  2VI7 A;  3H4Q A;  1N71 A;  1YRE A;  1L0C A;  1YLE A;  4F6A A;  3BJ8 A;  4MFL A;  1KUX A;  3F0A A;  4BBH A;  4JWP A;  3DNS A;  4B12 A;  4PSW A;  1IB1 E;  2C27 A;  3OWC A;  3T90 A;  1S7N A;  3DDD A;  5CNP A;  4E8O A;  1Q2C A;  4KOW A;  1QST A;  3BJ7 A;  4HNX B;  3KKW A;  4KOS A;  1SQH A;  3LOD A;  4QUS A;  4MY0 A;  3FRM A;  3QAH A;  2FE7 A;  3D2M A;  4R9M A;  1FY7 A;  2QEC A;  3EC4 A;  4XNH B;  1VKC A;  1KUV A;  3D3S A;  2ZPA A;  4A33 A;  4EVY A;  2BSW A;  2ZXV A;  2Z10 A;  3DR6 A;  4JXR A;  4CAX A;  4B5P B;  4C7I A;  1ON0 A;  4XPD C;  3WR7 A;  1Z9U A;  4XPL A;  4PK3 A;  2Z11 A;  4CAF A;  5E96 A;  1PUA A;  1U6M A;  5IX3 A;  1IYK A;  1QSR A;  2OU2 A;  4Y49 C;  3JUW A;  1M4I A;  2QML A;  4NSQ A;  4ONU A;  4NEX A;  2EVN A;  2EUI A;  4QBJ A;  4C68 A;  3R95 A;  2CNT A;  3FBU A;  4B5O A;  2KCW A;  4R87 A;  3SHP A;  4IUS A;  5KTA A;  1Z4E A;  5DWM A;  1KZF A;  1B6B A;  1RO5 A;  3D2P A;  1M4G A;  4C2X A;  4KOY A;  3W6X A;  2FIA A;  3TO7 A;  5F49 A;  1Q2Y A;  3DSB A;  4CRZ B;  3JTK A;  3PP9 A;  4CYN A;  1J4J A;  4PK2 A;  4KOR A;  1YVO A;  4FD5 A;  5A28 A;  3CXS A;  2Z3L A;  1UFH A;  2ZW4 A;  2Z3K A;  1K4J A;  3G3S A;  2K5T A;  1Y9W A;  2PDO A;  3SXO A;  2O28 A;  2YNC C;  3EFA A;  1Q2D A;  4JXQ A;  5GCN A;  4MBU A;  4UBR A;  3BLN A;  1R57 A;  4UFV A;  5H86 A;  2B4D A;  1OZP A;  3IGR A;  3GKR A;  2F5I A;  2WUU A;  4MHD A;  2AE6 A;  4U9Y A;  4K30 A;  4NF1 A;  4NCZ A;  3SXN A;  3R9E A;  2PR8 A;  3TO6 A;  4ZBG A;  3FB3 A;  4CGO A;  4KOT A;  1XEB A;  5EC4 A;  4CYQ A;  2PQ8 A;  4PSX A;  4RI1 A;  3PGP A;  1NE9 A;  4AB7 A;  4H89 A;  4CYP A;  1S7K A;  2Z3N A;  2P6G A;  5EBV A;  4A31 A;  4M3S A;  2FSR A;  5JPH A;  2REF A;  4KVM E;  4HNY B;  3S6F A;  4MI4 A;  2ZW7 A;  1YK3 A;  3EO4 A;  4XNH C;  1P4N A;  4E2A A;  2BL1 A;  1QSO A;  2G3T A;  4JLY A;  4UWJ A;  2R98 A;  5AG6 A;  5F46 A;  4AG7 A;  4II9 A;  3P2F A;  1PU9 A;  5G20 A;  4KOX A;  2VZY A;  5IB0 A;  1M1D A;  5DWN A;  3S6K A;  1NSL A;  2GIV A;  4NXY A;  5KTC A;  1IYL A;  2OZH A;  2JEV A;  3D8P A;  4J3G A;  4R3K A;  3IU1 A;  4KSA A;  4F0X A;  2P6E A;  4UFX A;  2OZU A;  2OH1 A;  4UWI A;  1M4D A;  3G8W A;  2YNE A;  1WWZ A;  4H6U A;  1XF8 A;  2J8N A;  2B3V A;  2PC1 A;  4L8A A;  2H5M A;  1QSN A;  2HUZ A;  4YGO A;  5ISV A;  3TE4 A;  4B11 A;  5A27 A;  5C82 A;  4HKF A;  4FD4 A;  1YR0 A;  4Q38 A;  2Y0M A;  4BMH A;  2CXA A;  4JJX A;  4CAV A;  4UCM A;  2YND A;  3TTH A;  4JD6 A;  2GAN A;  5AG5 A;  2B4D B;  2B5G B;  4F0Y A;  1IIC A;  2J8R A;  3TFY A;  2D4O A;  4KLW A;  1S7L A;  3A9L A;  2JDC A;  2B5G A;  1KUY A;  1GHE A;  5IV0 A;  2OB0 A;  3JVN A;  2FCK A;  4AVC A;  2FXF A;  4XPD B;  5J8F A;  1MK4 A;  2JLM A;  2PR1 A;  1WK4 A;  4MFJ A;  2G3A A;  4CS0 B;  1BO4 A;  2HQY A;  5I0C A;  2CY2 A;  2R1I A;  3GYA A;  2FIW A;  1XMT A;  4B13 A;  3VWE A;  1ZO0 A;  3ZZI A;  2J8M A;  3FXT A;  3B8G A;  1NMT A;  4M85 A;  3I3G A;  4AVB A;  4Y49 B;  4C2Z A;  3NE7 A;  2PSW A;  4XPK A;  5G22 A;  4KSF A;  5J8C A;  3C26 A;  1VHS A;  5HH1 A;  3TCV A;  4KS9 A;  4YFJ A;  1XE4 A;  5KTD A;  2B4B A;  2R8V A;  4UA3 A;  2D4P A;  2VQY A;  2P0W A;  5FVJ A;  2IL4 A;  3TT2 A;  4C2Y A;  3IWG A;  3P2H A;  3S6G A;  2CNS A;  3R9F A;  4MFP A;  3V8I A;  2A4N A;  4AG9 A;  2HV2 A;  1M44 A;  4QVT A;  3QB8 A;  2VBQ A;  3F5B A;  1MJ9 A;  3DR8 A;  4RS2 A;  3R1K A;  3VWD A;  3W91 A;  4CAW A;  4PV6 A;  1S7F A;  4MJ8 A;  3K9U A;  2FT0 A;  4B5P A;  5BWA B;  3CXP A;  2JDD A;  3ZJ0 A;  5JQ4 A;  2Q44 A;  5AG7 A;  2DPT A;  3T9Y A;  4OAE A;  4U5Y A;  4A32 A;  2ZW5 A;  4L89 A;  4A2Z A;  4CGM A;  1I1D A;  2G0B A;  4B14 A;  2VXK A;  2WPW A;  2Q4Y A;  4KZT A;  2RC4 A;  3CXQ A;  3S6H A;  4MFK A;  2Q7B A;  2DXQ A;  3FIX A;  4KOU A;  3R96 A;  4KOV A;  4KVX A;  4MY3 A;  1RXT A;  4A95 A;  4ZGY B;  1CJW A;  3TOA A;  5H84 A;  2AJ6 A;  4KLV A;  4IF5 A;  1TIQ A;  1V0C A;  2REE A;  2FL4 A;  2Z3P A;  1MJA A;  3TOB A;  2YGW A;  4LX9 A;  4FD7 A;  2YNC A;  5AG4 A;  5HMN A;  4E0A A;  2OZG A;  1S60 A;  3LD2 A;  2WPX A;  3EY5 A;  3TO9 A;  2BEI A;  4MFQ A;  5F47 A;  1I12 A;  4UFW A;  3IWE A;  2P6F A;  1MJB A;  2NMT A;  4B10 A;  1Y9K A;  5C88 A;  2ZW6 A;  1CM0 A;  4YRH A;  4X5K A;  1YGH A;  4KUB A;  4OAD A;  4CYO A;  2I00 A;  2GE3 A;  4AVA A;  3W6S A;  1YX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...