1QSNA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and histone h3 peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TGCN5 HISTONE ACETYL TRANSFERASE
publication title Structure of Tetrahymena GCN5 bound to coenzyme A and a histone H3 peptide.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 43
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsnA00
2OU2A 2GIVA 2A4NA 2ZW6A 3WR7A 3DNSA 1NSLA 4H89A 1IYLA 1N71A 3E0KA 5ISVA 2J8RA 2I00A 2KCWA 1MK4A 3IGRA 3PZJA 3W91A 3CXSA 2OZUA 2ZPAA 3G3SA 4PV6A 5I0CA 2G0BA 1Y9WA 4NSQA 2R1IA 1M4IA 1Z4EA 3FB3A 2B3UA 1YX0A 4KOVA 1XIXA 2OH1A 2BUEA 2QMLA 1M1DA 1YK3A 1SQHA 2B5GB 3BJ8A 4YGOA 5IV0A 4PK2A 4UWJA 2CNSA 2H5MA 4R9MA 1TIQA 4IUSA 3LODA 5F47A 2JDCA 2QIRA 1YLEA 4XPLA 2PQ8A 1QSMA 3I3GA 4KUBA 2ATRA 3P2FA 4Y49B 2R8VA 3VWDA 4QBJA 4X5KA 3FYNA 1QSRA 1ON0A 1QSOA 3KKWA 4PK3A 2WPXA 4RI1A 2B3VA 4CRZB 3JUWA 3UY5A 4AB7A 1B87A 2J8NA 2VZZA 3TE4A 1KUXA 4U9ZA 1YGHA 3S6GA 2P6GA 2Q4YA 3S6HA 1BO4A 4Y49C 5E96A 2P0WA 1I21A 5F48A 4E0AA 1S7NA 3BJ7A 2BL1A 4PSXA 4EVYA 4I49A 4XNHB 4NCZA 3S6FA 2VEZA 2C27A 3LD2A 4UBRA 4FD4A 2REEA 5EBVA 3R96A 5H86A 3EY5A 2ARHA 1QSNA 2NMTA 3ZZIA 2DXQA 4II9A 4QC6A 4XNHC 4NF1A 2CY2A 4UA3A 2PC1A 2VZYA 1XF8A 3TOAA 4KOYA 4DNCA 3R9GA 3R9EA 2B4BA 5KTAA 5J8CA 4OADA 1J4JA 1OZPA 2FSRA 4KVOE 3EFAA 4XPDB 4KOTA 2FE7A 2J8MA 4LX9A 2B58A 4H6ZA 4ZBGA 4CS0B 3S6KA 4R3LA 3NE7A 4JD6A 2VI7A 2F5IA 3TFYA 2ZW7A 1Z9UA 4PSWA 3CXQA 4CAVA 4XPDC 3G8WA 2FCKA 4JWPA 4KOXA 4L8AA 5DWNA 3FNCA 4F6AA 4U5YA 1M44A 1S7KA 2IL4A 2JDDA 5JQ4A 1WK4A 4ONUA 2B4DA 3BLNA 1S60A 4E2AA 4QB9A 1P4NA 2K5TA 1K4JA 3TO6A 4B5PA 4KLVA 3B8GA 2REFA 2FL4A 4HNWB 4CRYB 4CAWA 2JEVA 2D4PA 4MJ8A 2FIWA 4UWIA 3K9UA 1YREA 3GKRA 2Q4VA 1M4DA 5F46A 1KZFA 4MBUA 4KZTA 2ZXVA 2P6FA 2RC4A 4HNYB 4KLWA 3I9SA 3D3SA 4FD5A 1P0HA 4NEXA 5KTCA 4R57A 2VQYA 5GCNA 3MGDA 2HUZA 4AVBA 4OAEA 1RXTA 4FD6A 3D8PA 1MJBA 4IF5A 3VWEA 2PRBA 5IB0A 2Z11A 4RS2A 3EO4A 1YR0A 4KVXA 4KOWA 4FD7A 3EXNA 1KUVA 5H84A 5KTDA 2X7BA 1VKCA 2R98A 3SHPA 3T90A 1XMTA 3FIXA 4R87A 4AG7A 1PU9A 1NE9A 2Y0MA 3N7ZA 2GE3A 2VBQA 2D4OA 3PGPA 3QAHA 3TO7A 5EC4A 3ZJ0A 4F0YA 3FBUA 1CJWA 4J3GA 3GY9A 2CNTA 2OZHA 4ORFA 2OZGA 1IB1E 3FRMA 3IWGA 4L89A 2PSWA 2Z0ZA 3TOBA 3TTHA 4R3KA 2OB0A 3JVNA 4KUAA 4M85A 4HKFA 2Q44A 1S5KA 3SXNA 1XEBA 1CM0A 3F8KA 1GHEA 3DR6A 3R95A 1UFHA 1L0CA 3CXPA 1MJAA 5C88A 2BSWA 1BOBA 3QB8A 2I79A 5J8FA 3H4QA 1S7LA 4JXRA 4KORA 4AVCA 1Y9KA 1NMTA 3GYAA 2FIAA 4HNXB 1FY7A 4MY3A 4YRHA 4LUAA 4OLLA 3R9FA 3F5BA 2ZW4A 2P6EA 2Q04A 5C82A 3TO9A 4K30A 1V0CA 2B4DB 2ZW5A 1S7FA 5DWMA 1IIDA 3TT2A 4E8OA 1IICA 2G3TA 4U9YA 1Q2CA 4B5PB 1B6BA 5CNPA 1VHSA 4JXQA 1Q2DA 3W6XA 2BEIA 2B5GA 3W6SA 3C26A 4BMHA 4YFJA 1R57A 2G3AA 4M3SA 1Y7RA 3F0AA 1Q2YA 3V8IA 3DDDA 2AJ6A 2Q0YA 1IYKA 2Q7BA 4QUSA 3DR8A 4B5OA 2EUIA 5HH1A 1I12A 1U6MA 4JLYA 4KOUA 5FVJA 2FXFA 1RO5A 2GANA 5JPHA 4NXYA 2O28A 4KVME 3P2HA 3OWCA 2AE6A 2PR8A 1I1DA 3R1KA 3D2PA 1MJ9A 4KOSA 1QSTA 1Z4RA 4AG9A 3TCVA 3FXTA 3SXOA 3D2MA 4MY0A 2R7HA 1PUAA 2Z10A 3T9YA 2PDOA 5F49A 4XPKA 4JJXA 2VXKA 3PP9A 1WWZA 5IX3A 2FS5A 1LRZA 1M4GA 1XE4A 1YVOA 2QECA 4MHDA 4MI4A 4QVTA 2PR1A 2WPWA 1KUYA 3EC4A 2HV2A 2FT0A 2CNMA 1YVKA 4AVAA 1S3ZA 2HQYA 3RYOA 4H6UA 4CAXA 5HMNA 2JLMA 2EVNA 3DSBA 4GS4A
chains in the Genus database with same CATH superfamily
2OU2A 2DEAA 1LAPA 1VHOA 2GIVA 4F0XA 4UFWA 1VIXA 1VHEA 2A4NA 1R43A 2ZW6A 3WR7A 2ZEPA 3DNSA 2V77A 1NSLA 4H89A 1IYLA 1N71A 3E0KA 3H8EA 2J8RA 2I00A 2KCWA 1MK4A 5ISVA 3PB9X 3IGRA 3VH9A 3PZJA 3W91A 5I4MA 5G21A 3CXSA 2OZUA 1EE3P 2ZPAA 4MCQA 3HUVA 2C1CA 3G3SA 4PV6A 4M6GA 1F57A 5I0CA 3KASA 3SI1A 2G0BA 3KZWA 5AG4A 1Y9WA 2C6PA 4NSQA 2R1IA 1M4LA 5CBMA 1M4IA 4FAIA 2ZEMA 3KR4A 1Z4EA 3D7HA 1ELMP 2PJCA 3FB3A 2B3UA 2PJBA 4Q38A 2V8HA 2C6CA 1YX0A 4OIDA 5LYDA 1DTDA 4KOVA 2ANPA 4A30A 1XIXA 5HVFA 2IMOA 4UFXA 2OH1A 2BUEA 3V7ZA 3CT9A 4YWYA 4MFZA 1TF9A 2QMLA 1M1DA 3IJ3A 2BO9A 1YK3A 1SQHA 2B5GB 3BJ8A 4YGOA 4MHYA 4CGNA 4PK2A 4UWJA 5IV0A 2CNSA 3S9NA 2H5MA 2NSMA 1TIQA 2ZELA 3KQZA 4R9MA 4IUSA 5K8OA 3LODA 5F47A 2JDCA 3D67A 2QIRA 2OOTA 1YLEA 3WABA 3KR5A 2GREA 1LOKA 4PXBA 4XPLA 2PQ8A 1QSMA 5LYFA 3I3GA 4KUBA 2ATRA 2BOAA 3P2FA 5ELYA 4Y49B 2R8VA 2FVGA 4P45A 5THWA 2JBJA 3VWDA 5F09A 4QBJA 1CP6A 4GM5A 3FYNA 4X5KA 2F8HA 1QSRA 1ON0A 1QSOA 3KQXA 5DS0A 3KKWA 4PK3A 4OC1A 2WPXA 4RI1A 1Z8XA 2B3VA 3D68A 3IFEA 4OC3A 4CRZB 1Z8LA 3DLJA 2PJ4A 3JUWA 5D29A 3UY5A 4P4IA 1LCPA 4AB7A 5LRJA 1B87A 1HEEA 2AFWA 2J8NA 2VZZA 3TE4A 4A2ZA 1KUXA 2ZEOA 4U9ZA 1YGHA 1HDUA 3S6GA 1XRYA 2P6GA 1CPSA 3IU2A 2Q4YA 3S6HA 1BO4A 4P4JA 3TX8A 3B3VA 4Y49C 4MFKA 5E96A 4R7MA 2P0WA 1I21A 2YNCA 2JBKA 4WWVA 5EMIA 5F48A 3H8GA 3N5FA 4E0AA 1S7NA 3BJ7A 3RO0A 1ZG9A 2BL1A 3SJGA 4NGMA 4PSXA 5BWAB 4H2KA 2EWBA 4EVYA 4I49A 4XNHB 4NCZA 2O4HA 3S6FA 2VEZA 4PXCA 2DPTA 2C27A 3LD2A 4RN7A 2ZEGA 3D7GA 5LYLA 4UBRA 3IU1A 2ZEEA 4CGOA 2ZENA 2WSAA 4FD4A 2REEA 1AUGA 1LAMA 5EBVA 3RBUA 4B10A 4B13A 4Z65A 3R96A 3RZAA 5H86A 2GLFA 2XEIA 3EY5A 2OR4A 2ARHA 2PJ5A 2Z3KA 1QSNA 2AFOA 2NMTA 3PBBA 4UF4A 8CPAA 1TKFA 3ZZIA 2DXQA 3IO1A 4II9A 2Z3OA 3MN8A 4QC6A 3BHXA 2PJ8A 4XNHC 4NF1A 4IHMA 4ZX8A 2CY2A 4IAVA 4UA3A 1CPXA 2PC1A 2VZYA 1XF8A 5G1ZA 3TOAA 4W9YA 4KOYA 4CYQA 4DNCA 2QJ8A 4MCRA 3R9GA 2PVWA 3R9EA 1F2OA 2G9DA 2B4BA 4NGPA 2QYVA 3QNVA 4A33A 2CIJA 5KTAA 5J8CA 4OADA 1J4JA 1OZPA 2FSRA 4MCSA 4KVOE 3EFAA 4ZY1A 4XPDB 1ZO0A 2IJZA 4OMEA 3PEIA 4KOTA 2FE7A 2J8MA 4LX9A 2B58A 3NH4A 4H6ZA 4ZBGA 4CS0B 2PVVA 4DUKA 1IGBA 3ISZA 3S6KA 4BINA 4R3LA 2EBJA 3PBEA 2PJ6A 3NE7A 4P44A 2POKA 4JD6A 4NJQA 2XEFA 4NJRA 3PFEA 4KSIA 1ZG8A 2VI7A 2F5IA 2PJ7A 3TFYA 4P6YA 2ZW7A 4UEZA 3CDXA 4PQAA 1Z9UA 2XEJA 2F7VA 4PSWA 4C68A 3CXQA 4CAVA 4XPDC 1JQGA 3G8WA 1AMPA 4ZGYB 4K3NA 1BLLE 2FCKA 4JWPA 2AFUA 4KOXA 3BI1A 4OC5A 4L8AA 4CAFA 5DWNA 3FNCA 3V38A 3QAYA 4PXDA 4F8ZA 4A31A 1CX8A 2GFQA 2WYRA 2ZEFA 4F6AA 1A2ZA 4U5YA 1M44A 4JZ0A 4IK2A 1S7KA 2IL4A 4EMEA 1ARLA 2JDDA 5AGEA 5JQ4A 3B35A 1HDQA 2WUUA 4NGQA 6CPAA 1WK4A 4ONUA 2I3CA 4P4EA 2B4DA 4C2ZA 3BLNA 3CPAA 3PB7X 1S60A 4E2AA 1Z8TA 4QB9A 3S9LA 1P4NA 2K5TA 2YNDA 5A28A 1K4JA 4TNUA 3TO6A 4B5PA 4A38A 2DPSA 4KLVA 3B8GA 1XMBA 2REFA 2FL4A 3BI0A 4HNWB 4OC2A 1ZG7A 4CRYB 4CAWA 4C7IA 4F9UA 4CYOA 4UFVA 3PB6X 2JEVA 4EWTA 1YMEA 3IEHA 3GUXA 2D4PA 4X8IA 4RUHA 2CF4A 1OBRA 4R8FA 5HXDA 4MJ8A 2FIWA 1FT7A 2PJ3A 4UWIA 4ZX9A 3K9UA 4NFRA 1YREA 3GKRA 2Q4VA 4CGMA 5K8NA 1M4DA 3CZXA 2Q51A 4A39A 3JRUA 3B3CA 1Q7LA 4P4BA 5AG7A 5F46A 4M6HA 3SI0A 2EK9A 1KZFA 4MBUA 4OP4A 3DGVA 3FMCA 2PJ2A 1Z5RA 4KZTA 2ZXVA 2P6FA 2RC4A 3FF3A 4HNYB 4KLWA 3I9SA 4KSFA 3D3SA 4FD5A 3SJFA 3GB0A 4CGPA 3GLJA 5LRGA 3B3WA 1P0HA 4NEXA 5AG5A 5A27A 5KTCA 4EFDA 2ZEDA 1TF8A 3FX6A 3K9TA 4R57A 2VQYA 4P10A 5GCNA 1ELLP 3MGDA 1XOVA 2HUZA 4AVBA 3HLPA 3IC1A 4UIBA 4OAEA 1RXTA 4FD6A 3D8PA 1MJBA 4IF5A 4B12A 3VWEA 2PRBA 1NSAA 5IB0A 2Z11A 4UIAA 4MHZA 4RS2A 3EO4A 1YR0A 3B7IA 4KVXA 4KOWA 4FD7A 3EXNA 3FEEA 1KUVA 2AFSA 2YNCC 2VL1A 5H84A 4NGRA 5KTDA 2X7BA 2O53A 1VKCA 1XFOA 2R98A 3SHPA 3T90A 4MFQA 5HVHA 4PPZA 1XMTA 4B11A 1UWYA 2PIYA 3FIXA 4P4DA 4R87A 4AG7A 1PU9A 1NE9A 3NA6A 2Z3LA 4HPSA 2Y0MA 3D4UA 1LANA 3N7ZA 3RAMA 2GE3A 4C2YA 2VBQA 2D4OA 3FJUA 3PGPA 3QAHA 5EC4A 3TO7A 3ZJ0A 4F0YA 5JM6A 4CGLA 3FBUA 3A9LA 1CJWA 3NE8A 4J3GA 3GY9A 4ZY0A 1KWMA 3B3TA 2PCUA 2CNTA 2OZHA 4ORFA 2OZGA 1IB1E 2C6GA 3FRMA 3JTKA 1LFWA 3IWGA 4L89A 2PIZA 4UEEA 5LYIA 4BD9A 5AG6A 2PSWA 2Z0ZA 4DJLA 3TOBA 4FWUA 3TTHA 3S9MA 1X12A 3PB8X 4R3KA 2OB0A 3IWWA 3JVNA 4CYPA 3MRUA 4KUAA 1AYEA 2PJ9A 4HKFA 4M85A 4WJBA 1DE4C 4FBEA 5LRKA 2Q44A 1S5KA 5G20A 3SXNA 1XEBA 1CM0A 3F8KA 1QMUA 1GHEA 1GYTA 3B3SA 3DR6A 3R95A 7CPAA 1UFHA 4TWEA 4MFLA 1Y7EA 1L0CA 3CXPA 2HC9A 4OC0A 4A94A 1MJAA 2RFHA 1PCAA 5C88A 2BSWA 2AFXA 1BOBA 2AFMA 1BPMA 3FECA 3QB8A 2I79A 2ZEHA 1QQ9A 5J8FA 4KS9A 2JEWA 3H4QA 1S7LA 1TKJA 4JXRA 3WC5A 4F9VA 4KORA 4R76A 4AVCA 5CPAA 4X3RA 4A37A 1Y9KA 1NMTA 3GYAA 2FIAA 1TXRA 4HNXB 1FY7A 3NH8A 1H8LA 4LQ6A 4MFJA 4MY3A 4OIWA 4ZI6A 4YRHA 4LUAA 3H8FA 4NGSA 2EO8A 4OLLA 2V8DA 1Y0RA 4Q7AA 2Z3PA 2XEGA 3F5BA 1RTQA 2ZW4A 3R9FA 1YW4A 3TC8A 4B6ZA 2P6EA 2Q04A 5C82A 3D7DA 3TO9A 4K30A 1V0CA 2B4DB 2ZW5A 1YW6A 1S7FA 5DWMA 1IIDA 4NGNA 2IQ6A 1Z2LA 1CP7A 1IICA 3KGQA 3LWUA 3TT2A 2G3TA 4U9YA 3WT4A 4DYOA 1Q2CA 5HVGA 4OKOA 4KSAA 2HB6A 4B5PB 1ZLHA 1B6BA 5CNPA 1VHSA 2CXAA 4JXQA 4A32A 1Q2DA 1XJOA 4GXHA 3W6XA 3WC7A 2BEIA 4B14A 5D8NA 1YLOA 2B5GA 4MMOA 2WZNA 4P4FA 2YGWA 5J1QA 3W6SA 1CG2A 2PJ0A 2PE3A 2J9AA 3C26A 4BMHA 4YFJA 1F2PA 1R57A 2G3AA 2V8VA 4M3SA 1Y7RA 4M6IA 3F0AA 1IOIA 4Q36A 4X2TA 1Q2YA 3V8IA 4O23A 3DDDA 3FVLA 2AJ6A 1IOFA 3K2KA 2Q0YA 1IYKA 3I1UA 4MXUA 2Q7BA 4QUSA 2ZOFA 4UCNA 2Q43A 3DR8A 3NFZA 4PXEA 2CTBA 4B5OA 3NH5A 2EUIA 4AXVA 4FUUA 2GLJA 3IIBA 3PRTA 5HH1A 5IB9A 2Q7SA 1X10A 1FNOA 1I12A 1TKHA 1U6MA 2BCOA 2RB7A 3H5ZA 4JLYA 4KOUA 4UEFA 3LMSA 5FVJA 4ZY2A 1PYTB 2PJ1A 1XBUA 4MHPA 4C2XA 4JYWA 2FXFA 2CTCA 3B2YA 1RO5A 1Y0YA 2QVPA 2GANA 4OC4A 4CAEA 5JH9A 2AFZA 3SJXA 5JPHA 3BXMA 4NXYA 2O28A 4MHNA 5K8MA 4KVME 3P2HA 1R3NA 1ZLIA 2Z3NA 3OWCA 2AE6A 2PR8A 1I1DA 3L2NA 3LACA 3D2PA 1MJ9A 3R1KA 4G1PA 4KOSA 3VATA 4CPAA 4A95A 1QSTA 3WC6A 1IU8A 1Z4RA 2ZOGA 5JGFA 4AG9A 1YSJA 4BBHA 2V8GA 2PRQA 3FXTA 3KL9A 4UCPA 3RNZA 3SXOA 3D2MA 3TCVA 4ONWA 3D66A 3KI9A 4UCMA 4MY0A 4E8OA 2R7HA 4LQGA 4C7HA 1PUAA 3T8WA 3KHZA 3IWEA 2Z10A 2EK8A 2PJAA 5G22A 3T9YA 2GU2A 2PDOA 1BPNA 3FH4A 2ODFA 5K8PA 5F49A 3SJEA 4XPKA 1BAVA 1JWQA 4MRIA 4JJXA 3PB4X 2VXKA 3PP9A 1WWZA 5IX3A 3SI2A 4ZYQA 4R6TA 2FS5A 4NGTA 2YNEA 1LRZA 1M4GA 1XE4A 1YVOA 1Z8WA 3GIUA 1YQEA 2NYQA 3VARA 4CYNA 3D7FA 2QECA 1IY7A 4MHDA 1ARMA 4YU9A 4MCPA 3ISXA 2Q4ZA 4MI4A 4QVTA 2PR1A 2WPWA 1KUYA 3EC4A 2HV2A 2FT0A 2CNMA 3PFOA 1YVKA 4MFPA 4AVAA 1S3ZA 2HQYA 2Z3MA 3CPXA 3KHXA 3RYOA 4H6UA 4CAXA 5HMNA 2JLMA 1CBXA 2DF5A 1VGYA 2ABZA 2EVNA 3DSBA 4GS4A 3FEDA
chains in the Genus database with same CATH topology
2OU2A 2GIVA 4F0XA 4UFWA 2A4NA 2ZW6A 3WR7A 3DNSA 1NSLA 4H89A 1IYLA 1N71A 3E0KA 5ISVA 2J8RA 2I00A 2KCWA 1MK4A 3IGRA 3PZJA 3W91A 5G21A 3CXSA 2OZUA 2ZPAA 3G3SA 4PV6A 5I0CA 2G0BA 5AG4A 1Y9WA 4NSQA 2R1IA 1M4IA 1Z4EA 3FB3A 2B3UA 4Q38A 1YX0A 4KOVA 4A30A 1XIXA 4UFXA 2OH1A 2BUEA 4MFZA 2QMLA 1M1DA 1YK3A 1SQHA 2B5GB 3BJ8A 4YGOA 4CGNA 5IV0A 4PK2A 4UWJA 2CNSA 2H5MA 4R9MA 1TIQA 4IUSA 3LODA 5F47A 2JDCA 2QIRA 1YLEA 4XPLA 2PQ8A 1QSMA 3I3GA 4KUBA 2ATRA 3P2FA 4Y49B 2R8VA 3VWDA 4QBJA 4X5KA 3FYNA 1QSRA 1ON0A 1QSOA 3KKWA 4PK3A 2WPXA 4RI1A 2B3VA 4CRZB 3JUWA 3UY5A 4AB7A 1B87A 2J8NA 2VZZA 3TE4A 4A2ZA 1KUXA 4U9ZA 1YGHA 3S6GA 2P6GA 3IU2A 2Q4YA 3S6HA 1BO4A 4Y49C 4MFKA 5E96A 2P0WA 1I21A 2YNCA 5F48A 4E0AA 1S7NA 3BJ7A 2BL1A 4PSXA 5BWAB 4EVYA 4I49A 4XNHB 4NCZA 3S6FA 2VEZA 2DPTA 2C27A 3LD2A 4UBRA 3IU1A 4CGOA 2WSAA 4FD4A 2REEA 5EBVA 4B10A 4B13A 3R96A 5H86A 3EY5A 2ARHA 2Z3KA 1QSNA 2NMTA 3ZZIA 2DXQA 4II9A 2Z3OA 4QC6A 4XNHC 4NF1A 2CY2A 4UA3A 2PC1A 2VZYA 1XF8A 5G1ZA 3TOAA 4KOYA 4CYQA 4DNCA 3R9GA 3R9EA 2B4BA 4A33A 5KTAA 5J8CA 4OADA 1J4JA 1OZPA 2FSRA 4KVOE 3EFAA 4XPDB 1ZO0A 4KOTA 2FE7A 2J8MA 4LX9A 2B58A 4H6ZA 4ZBGA 4CS0B 3S6KA 4R3LA 3NE7A 4JD6A 2VI7A 2F5IA 3TFYA 2ZW7A 1Z9UA 4PSWA 4C68A 3CXQA 4CAVA 4XPDC 3G8WA 4ZGYB 2FCKA 4JWPA 4KOXA 4CAFA 4L8AA 5DWNA 3FNCA 4A31A 4F6AA 4U5YA 1M44A 1S7KA 2IL4A 2JDDA 5AGEA 5JQ4A 2WUUA 1WK4A 4ONUA 2B4DA 4C2ZA 3BLNA 1S60A 4E2AA 4QB9A 1P4NA 2K5TA 2YNDA 5A28A 1K4JA 3TO6A 4B5PA 2DPSA 4KLVA 3B8GA 2REFA 2FL4A 4HNWB 4CRYB 4CAWA 4C7IA 4CYOA 4UFVA 2JEVA 2D4PA 4MJ8A 2FIWA 4UWIA 3K9UA 1YREA 3GKRA 2Q4VA 4CGMA 1M4DA 5AG7A 5F46A 1KZFA 4MBUA 4KZTA 2ZXVA 2P6FA 2RC4A 4HNYB 4KLWA 3I9SA 4KSFA 3D3SA 4FD5A 4CGPA 1P0HA 4NEXA 5AG5A 5A27A 5KTCA 4R57A 2VQYA 5GCNA 3MGDA 2HUZA 4AVBA 4OAEA 1RXTA 4FD6A 3D8PA 1MJBA 4IF5A 4B12A 3VWEA 2PRBA 5IB0A 2Z11A 4RS2A 3EO4A 1YR0A 4KVXA 4KOWA 4FD7A 3EXNA 1KUVA 2YNCC 5H84A 5KTDA 2X7BA 1VKCA 2R98A 3SHPA 3T90A 4MFQA 1XMTA 4B11A 3FIXA 4R87A 4AG7A 1PU9A 1NE9A 2Z3LA 2Y0MA 3N7ZA 4C2YA 2GE3A 2VBQA 2D4OA 3PGPA 3QAHA 3TO7A 5EC4A 3ZJ0A 4F0YA 4CGLA 3FBUA 3A9LA 1CJWA 4J3GA 3GY9A 2CNTA 2OZHA 4ORFA 2OZGA 1IB1E 3FRMA 3JTKA 3IWGA 4L89A 5AG6A 2PSWA 2Z0ZA 3TOBA 3TTHA 4R3KA 2OB0A 3JVNA 4CYPA 4KUAA 4M85A 4HKFA 2Q44A 1S5KA 5G20A 3SXNA 1XEBA 1CM0A 3F8KA 1GHEA 3DR6A 3R95A 1UFHA 4MFLA 1L0CA 3CXPA 1MJAA 5C88A 2BSWA 1BOBA 3QB8A 2I79A 5J8FA 4KS9A 3H4QA 1S7LA 4JXRA 4KORA 4AVCA 1Y9KA 1NMTA 3GYAA 2FIAA 4HNXB 1FY7A 4MY3A 4MFJA 4YRHA 4LUAA 4OLLA 2Z3PA 3R9FA 3F5BA 2ZW4A 2P6EA 2Q04A 5C82A 3TO9A 4K30A 1V0CA 2B4DB 2ZW5A 1S7FA 5DWMA 1IIDA 3TT2A 4E8OA 1IICA 2G3TA 4U9YA 1Q2CA 4KSAA 4B5PB 1B6BA 5CNPA 1VHSA 2CXAA 4JXQA 4A32A 1Q2DA 3W6XA 2BEIA 4B14A 2B5GA 2YGWA 3W6SA 3C26A 4BMHA 4YFJA 1R57A 2G3AA 4M3SA 4Q36A 1Y7RA 3F0AA 1Q2YA 3V8IA 3DDDA 2AJ6A 2Q0YA 1IYKA 2Q7BA 4QUSA 4UCNA 3DR8A 4B5OA 2EUIA 5HH1A 1I12A 1U6MA 3H5ZA 4JLYA 4KOUA 5FVJA 4C2XA 2FXFA 1RO5A 4CAEA 2GANA 5JPHA 4NXYA 2O28A 4KVME 3P2HA 2Z3NA 3OWCA 2AE6A 2PR8A 1I1DA 3R1KA 3D2PA 1MJ9A 4KOSA 4A95A 1QSTA 1Z4RA 4AG9A 4BBHA 4UCPA 3TCVA 3FXTA 3SXOA 3D2MA 4UCMA 4MY0A 2R7HA 4C7HA 1PUAA 3IWEA 2Z10A 3T9YA 5G22A 2PDOA 5F49A 4XPKA 4JJXA 2VXKA 3PP9A 1WWZA 5IX3A 2FS5A 2YNEA 1LRZA 1M4GA 1XE4A 1YVOA 4CYNA 2QECA 4MHDA 4MI4A 4QVTA 2PR1A 2WPWA 1KUYA 3EC4A 2HV2A 2FT0A 2CNMA 1YVKA 4MFPA 4AVAA 1S3ZA 2HQYA 2Z3MA 3RYOA 4H6UA 4CAXA 5HMNA 2JLMA 2EVNA 3DSBA 4GS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU2 A;  2GIV A;  2A4N A;  2ZW6 A;  3WR7 A;  3DNS A;  1NSL A;  4H89 A;  1IYL A;  1N71 A;  3E0K A;  5ISV A;  2J8R A;  2I00 A;  2KCW A;  1MK4 A;  3IGR A;  3PZJ A;  3W91 A;  3CXS A;  2OZU A;  2ZPA A;  3G3S A;  4PV6 A;  5I0C A;  2G0B A;  1Y9W A;  4NSQ A;  2R1I A;  1M4I A;  1Z4E A;  3FB3 A;  2B3U A;  1YX0 A;  4KOV A;  1XIX A;  2OH1 A;  2BUE A;  2QML A;  1M1D A;  1YK3 A;  1SQH A;  2B5G B;  3BJ8 A;  4YGO A;  5IV0 A;  4PK2 A;  4UWJ A;  2CNS A;  2H5M A;  4R9M A;  1TIQ A;  4IUS A;  3LOD A;  5F47 A;  2JDC A;  2QIR A;  1YLE A;  4XPL A;  2PQ8 A;  1QSM A;  3I3G A;  4KUB A;  2ATR A;  3P2F A;  4Y49 B;  2R8V A;  3VWD A;  4QBJ A;  4X5K A;  3FYN A;  1QSR A;  1ON0 A;  1QSO A;  3KKW A;  4PK3 A;  2WPX A;  4RI1 A;  2B3V A;  4CRZ B;  3JUW A;  3UY5 A;  4AB7 A;  1B87 A;  2J8N A;  2VZZ A;  3TE4 A;  1KUX A;  4U9Z A;  1YGH A;  3S6G A;  2P6G A;  2Q4Y A;  3S6H A;  1BO4 A;  4Y49 C;  5E96 A;  2P0W A;  1I21 A;  5F48 A;  4E0A A;  1S7N A;  3BJ7 A;  2BL1 A;  4PSX A;  4EVY A;  4I49 A;  4XNH B;  4NCZ A;  3S6F A;  2VEZ A;  2C27 A;  3LD2 A;  4UBR A;  4FD4 A;  2REE A;  5EBV A;  3R96 A;  5H86 A;  3EY5 A;  2ARH A;  1QSN A;  2NMT A;  3ZZI A;  2DXQ A;  4II9 A;  4QC6 A;  4XNH C;  4NF1 A;  2CY2 A;  4UA3 A;  2PC1 A;  2VZY A;  1XF8 A;  3TOA A;  4KOY A;  4DNC A;  3R9G A;  3R9E A;  2B4B A;  5KTA A;  5J8C A;  4OAD A;  1J4J A;  1OZP A;  2FSR A;  4KVO E;  3EFA A;  4XPD B;  4KOT A;  2FE7 A;  2J8M A;  4LX9 A;  2B58 A;  4H6Z A;  4ZBG A;  4CS0 B;  3S6K A;  4R3L A;  3NE7 A;  4JD6 A;  2VI7 A;  2F5I A;  3TFY A;  2ZW7 A;  1Z9U A;  4PSW A;  3CXQ A;  4CAV A;  4XPD C;  3G8W A;  2FCK A;  4JWP A;  4KOX A;  4L8A A;  5DWN A;  3FNC A;  4F6A A;  4U5Y A;  1M44 A;  1S7K A;  2IL4 A;  2JDD A;  5JQ4 A;  1WK4 A;  4ONU A;  2B4D A;  3BLN A;  1S60 A;  4E2A A;  4QB9 A;  1P4N A;  2K5T A;  1K4J A;  3TO6 A;  4B5P A;  4KLV A;  3B8G A;  2REF A;  2FL4 A;  4HNW B;  4CRY B;  4CAW A;  2JEV A;  2D4P A;  4MJ8 A;  2FIW A;  4UWI A;  3K9U A;  1YRE A;  3GKR A;  2Q4V A;  1M4D A;  5F46 A;  1KZF A;  4MBU A;  4KZT A;  2ZXV A;  2P6F A;  2RC4 A;  4HNY B;  4KLW A;  3I9S A;  3D3S A;  4FD5 A;  1P0H A;  4NEX A;  5KTC A;  4R57 A;  2VQY A;  5GCN A;  3MGD A;  2HUZ A;  4AVB A;  4OAE A;  1RXT A;  4FD6 A;  3D8P A;  1MJB A;  4IF5 A;  3VWE A;  2PRB A;  5IB0 A;  2Z11 A;  4RS2 A;  3EO4 A;  1YR0 A;  4KVX A;  4KOW A;  4FD7 A;  3EXN A;  1KUV A;  5H84 A;  5KTD A;  2X7B A;  1VKC A;  2R98 A;  3SHP A;  3T90 A;  1XMT A;  3FIX A;  4R87 A;  4AG7 A;  1PU9 A;  1NE9 A;  2Y0M A;  3N7Z A;  2GE3 A;  2VBQ A;  2D4O A;  3PGP A;  3QAH A;  3TO7 A;  5EC4 A;  3ZJ0 A;  4F0Y A;  3FBU A;  1CJW A;  4J3G A;  3GY9 A;  2CNT A;  2OZH A;  4ORF A;  2OZG A;  1IB1 E;  3FRM A;  3IWG A;  4L89 A;  2PSW A;  2Z0Z A;  3TOB A;  3TTH A;  4R3K A;  2OB0 A;  3JVN A;  4KUA A;  4M85 A;  4HKF A;  2Q44 A;  1S5K A;  3SXN A;  1XEB A;  1CM0 A;  3F8K A;  1GHE A;  3DR6 A;  3R95 A;  1UFH A;  1L0C A;  3CXP A;  1MJA A;  5C88 A;  2BSW A;  1BOB A;  3QB8 A;  2I79 A;  5J8F A;  3H4Q A;  1S7L A;  4JXR A;  4KOR A;  4AVC A;  1Y9K A;  1NMT A;  3GYA A;  2FIA A;  4HNX B;  1FY7 A;  4MY3 A;  4YRH A;  4LUA A;  4OLL A;  3R9F A;  3F5B A;  2ZW4 A;  2P6E A;  2Q04 A;  5C82 A;  3TO9 A;  4K30 A;  1V0C A;  2B4D B;  2ZW5 A;  1S7F A;  5DWM A;  1IID A;  3TT2 A;  4E8O A;  1IIC A;  2G3T A;  4U9Y A;  1Q2C A;  4B5P B;  1B6B A;  5CNP A;  1VHS A;  4JXQ A;  1Q2D A;  3W6X A;  2BEI A;  2B5G A;  3W6S A;  3C26 A;  4BMH A;  4YFJ A;  1R57 A;  2G3A A;  4M3S A;  1Y7R A;  3F0A A;  1Q2Y A;  3V8I A;  3DDD A;  2AJ6 A;  2Q0Y A;  1IYK A;  2Q7B A;  4QUS A;  3DR8 A;  4B5O A;  2EUI A;  5HH1 A;  1I12 A;  1U6M A;  4JLY A;  4KOU A;  5FVJ A;  2FXF A;  1RO5 A;  2GAN A;  5JPH A;  4NXY A;  2O28 A;  4KVM E;  3P2H A;  3OWC A;  2AE6 A;  2PR8 A;  1I1D A;  3R1K A;  3D2P A;  1MJ9 A;  4KOS A;  1QST A;  1Z4R A;  4AG9 A;  3TCV A;  3FXT A;  3SXO A;  3D2M A;  4MY0 A;  2R7H A;  1PUA A;  2Z10 A;  3T9Y A;  2PDO A;  5F49 A;  4XPK A;  4JJX A;  2VXK A;  3PP9 A;  1WWZ A;  5IX3 A;  2FS5 A;  1LRZ A;  1M4G A;  1XE4 A;  1YVO A;  2QEC A;  4MHD A;  4MI4 A;  4QVT A;  2PR1 A;  2WPW A;  1KUY A;  3EC4 A;  2HV2 A;  2FT0 A;  2CNM A;  1YVK A;  4AVA A;  1S3Z A;  2HQY A;  3RYO A;  4H6U A;  4CAX A;  5HMN A;  2JLM A;  2EVN A;  3DSB A;  4GS4 A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  2DEA A;  1LAP A;  1VHO A;  2GIV A;  4F0X A;  4UFW A;  1VIX A;  1VHE A;  2A4N A;  1R43 A;  2ZW6 A;  3WR7 A;  2ZEP A;  3DNS A;  2V77 A;  1NSL A;  4H89 A;  1IYL A;  1N71 A;  3E0K A;  3H8E A;  2J8R A;  2I00 A;  2KCW A;  1MK4 A;  5ISV A;  3PB9 X;  3IGR A;  3VH9 A;  3PZJ A;  3W91 A;  5I4M A;  5G21 A;  3CXS A;  2OZU A;  1EE3 P;  2ZPA A;  4MCQ A;  3HUV A;  2C1C A;  3G3S A;  4PV6 A;  4M6G A;  1F57 A;  5I0C A;  3KAS A;  3SI1 A;  2G0B A;  3KZW A;  5AG4 A;  1Y9W A;  2C6P A;  4NSQ A;  2R1I A;  1M4L A;  5CBM A;  1M4I A;  4FAI A;  2ZEM A;  3KR4 A;  1Z4E A;  3D7H A;  1ELM P;  2PJC A;  3FB3 A;  2B3U A;  2PJB A;  4Q38 A;  2V8H A;  2C6C A;  1YX0 A;  4OID A;  5LYD A;  1DTD A;  4KOV A;  2ANP A;  4A30 A;  1XIX A;  5HVF A;  2IMO A;  4UFX A;  2OH1 A;  2BUE A;  3V7Z A;  3CT9 A;  4YWY A;  4MFZ A;  1TF9 A;  2QML A;  1M1D A;  3IJ3 A;  2BO9 A;  1YK3 A;  1SQH A;  2B5G B;  3BJ8 A;  4YGO A;  4MHY A;  4CGN A;  4PK2 A;  4UWJ A;  5IV0 A;  2CNS A;  3S9N A;  2H5M A;  2NSM A;  1TIQ A;  2ZEL A;  3KQZ A;  4R9M A;  4IUS A;  5K8O A;  3LOD A;  5F47 A;  2JDC A;  3D67 A;  2QIR A;  2OOT A;  1YLE A;  3WAB A;  3KR5 A;  2GRE A;  1LOK A;  4PXB A;  4XPL A;  2PQ8 A;  1QSM A;  5LYF A;  3I3G A;  4KUB A;  2ATR A;  2BOA A;  3P2F A;  5ELY A;  4Y49 B;  2R8V A;  2FVG A;  4P45 A;  5THW A;  2JBJ A;  3VWD A;  5F09 A;  4QBJ A;  1CP6 A;  4GM5 A;  3FYN A;  4X5K A;  2F8H A;  1QSR A;  1ON0 A;  1QSO A;  3KQX A;  5DS0 A;  3KKW A;  4PK3 A;  4OC1 A;  2WPX A;  4RI1 A;  1Z8X A;  2B3V A;  3D68 A;  3IFE A;  4OC3 A;  4CRZ B;  1Z8L A;  3DLJ A;  2PJ4 A;  3JUW A;  5D29 A;  3UY5 A;  4P4I A;  1LCP A;  4AB7 A;  5LRJ A;  1B87 A;  1HEE A;  2AFW A;  2J8N A;  2VZZ A;  3TE4 A;  4A2Z A;  1KUX A;  2ZEO A;  4U9Z A;  1YGH A;  1HDU A;  3S6G A;  1XRY A;  2P6G A;  1CPS A;  3IU2 A;  2Q4Y A;  3S6H A;  1BO4 A;  4P4J A;  3TX8 A;  3B3V A;  4Y49 C;  4MFK A;  5E96 A;  4R7M A;  2P0W A;  1I21 A;  2YNC A;  2JBK A;  4WWV A;  5EMI A;  5F48 A;  3H8G A;  3N5F A;  4E0A A;  1S7N A;  3BJ7 A;  3RO0 A;  1ZG9 A;  2BL1 A;  3SJG A;  4NGM A;  4PSX A;  5BWA B;  4H2K A;  2EWB A;  4EVY A;  4I49 A;  4XNH B;  4NCZ A;  2O4H A;  3S6F A;  2VEZ A;  4PXC A;  2DPT A;  2C27 A;  3LD2 A;  4RN7 A;  2ZEG A;  3D7G A;  5LYL A;  4UBR A;  3IU1 A;  2ZEE A;  4CGO A;  2ZEN A;  2WSA A;  4FD4 A;  2REE A;  1AUG A;  1LAM A;  5EBV A;  3RBU A;  4B10 A;  4B13 A;  4Z65 A;  3R96 A;  3RZA A;  5H86 A;  2GLF A;  2XEI A;  3EY5 A;  2OR4 A;  2ARH A;  2PJ5 A;  2Z3K A;  1QSN A;  2AFO A;  2NMT A;  3PBB A;  4UF4 A;  8CPA A;  1TKF A;  3ZZI A;  2DXQ A;  3IO1 A;  4II9 A;  2Z3O A;  3MN8 A;  4QC6 A;  3BHX A;  2PJ8 A;  4XNH C;  4NF1 A;  4IHM A;  4ZX8 A;  2CY2 A;  4IAV A;  4UA3 A;  1CPX A;  2PC1 A;  2VZY A;  1XF8 A;  5G1Z A;  3TOA A;  4W9Y A;  4KOY A;  4CYQ A;  4DNC A;  2QJ8 A;  4MCR A;  3R9G A;  2PVW A;  3R9E A;  1F2O A;  2G9D A;  2B4B A;  4NGP A;  2QYV A;  3QNV A;  4A33 A;  2CIJ A;  5KTA A;  5J8C A;  4OAD A;  1J4J A;  1OZP A;  2FSR A;  4MCS A;  4KVO E;  3EFA A;  4ZY1 A;  4XPD B;  1ZO0 A;  2IJZ A;  4OME A;  3PEI A;  4KOT A;  2FE7 A;  2J8M A;  4LX9 A;  2B58 A;  3NH4 A;  4H6Z A;  4ZBG A;  4CS0 B;  2PVV A;  4DUK A;  1IGB A;  3ISZ A;  3S6K A;  4BIN A;  4R3L A;  2EBJ A;  3PBE A;  2PJ6 A;  3NE7 A;  4P44 A;  2POK A;  4JD6 A;  4NJQ A;  2XEF A;  4NJR A;  3PFE A;  4KSI A;  1ZG8 A;  2VI7 A;  2F5I A;  2PJ7 A;  3TFY A;  4P6Y A;  2ZW7 A;  4UEZ A;  3CDX A;  4PQA A;  1Z9U A;  2XEJ A;  2F7V A;  4PSW A;  4C68 A;  3CXQ A;  4CAV A;  4XPD C;  1JQG A;  3G8W A;  1AMP A;  4ZGY B;  4K3N A;  1BLL E;  2FCK A;  4JWP A;  2AFU A;  4KOX A;  3BI1 A;  4OC5 A;  4L8A A;  4CAF A;  5DWN A;  3FNC A;  3V38 A;  3QAY A;  4PXD A;  4F8Z A;  4A31 A;  1CX8 A;  2GFQ A;  2WYR A;  2ZEF A;  4F6A A;  1A2Z A;  4U5Y A;  1M44 A;  4JZ0 A;  4IK2 A;  1S7K A;  2IL4 A;  4EME A;  1ARL A;  2JDD A;  5AGE A;  5JQ4 A;  3B35 A;  1HDQ A;  2WUU A;  4NGQ A;  6CPA A;  1WK4 A;  4ONU A;  2I3C A;  4P4E A;  2B4D A;  4C2Z A;  3BLN A;  3CPA A;  3PB7 X;  1S60 A;  4E2A A;  1Z8T A;  4QB9 A;  3S9L A;  1P4N A;  2K5T A;  2YND A;  5A28 A;  1K4J A;  4TNU A;  3TO6 A;  4B5P A;  4A38 A;  2DPS A;  4KLV A;  3B8G A;  1XMB A;  2REF A;  2FL4 A;  3BI0 A;  4HNW B;  4OC2 A;  1ZG7 A;  4CRY B;  4CAW A;  4C7I A;  4F9U A;  4CYO A;  4UFV A;  3PB6 X;  2JEV A;  4EWT A;  1YME A;  3IEH A;  3GUX A;  2D4P A;  4X8I A;  4RUH A;  2CF4 A;  1OBR A;  4R8F A;  5HXD A;  4MJ8 A;  2FIW A;  1FT7 A;  2PJ3 A;  4UWI A;  4ZX9 A;  3K9U A;  4NFR A;  1YRE A;  3GKR A;  2Q4V A;  4CGM A;  5K8N A;  1M4D A;  3CZX A;  2Q51 A;  4A39 A;  3JRU A;  3B3C A;  1Q7L A;  4P4B A;  5AG7 A;  5F46 A;  4M6H A;  3SI0 A;  2EK9 A;  1KZF A;  4MBU A;  4OP4 A;  3DGV A;  3FMC A;  2PJ2 A;  1Z5R A;  4KZT A;  2ZXV A;  2P6F A;  2RC4 A;  3FF3 A;  4HNY B;  4KLW A;  3I9S A;  4KSF A;  3D3S A;  4FD5 A;  3SJF A;  3GB0 A;  4CGP A;  3GLJ A;  5LRG A;  3B3W A;  1P0H A;  4NEX A;  5AG5 A;  5A27 A;  5KTC A;  4EFD A;  2ZED A;  1TF8 A;  3FX6 A;  3K9T A;  4R57 A;  2VQY A;  4P10 A;  5GCN A;  1ELL P;  3MGD A;  1XOV A;  2HUZ A;  4AVB A;  3HLP A;  3IC1 A;  4UIB A;  4OAE A;  1RXT A;  4FD6 A;  3D8P A;  1MJB A;  4IF5 A;  4B12 A;  3VWE A;  2PRB A;  1NSA A;  5IB0 A;  2Z11 A;  4UIA A;  4MHZ A;  4RS2 A;  3EO4 A;  1YR0 A;  3B7I A;  4KVX A;  4KOW A;  4FD7 A;  3EXN A;  3FEE A;  1KUV A;  2AFS A;  2YNC C;  2VL1 A;  5H84 A;  4NGR A;  5KTD A;  2X7B A;  2O53 A;  1VKC A;  1XFO A;  2R98 A;  3SHP A;  3T90 A;  4MFQ A;  5HVH A;  4PPZ A;  1XMT A;  4B11 A;  1UWY A;  2PIY A;  3FIX A;  4P4D A;  4R87 A;  4AG7 A;  1PU9 A;  1NE9 A;  3NA6 A;  2Z3L A;  4HPS A;  2Y0M A;  3D4U A;  1LAN A;  3N7Z A;  3RAM A;  2GE3 A;  4C2Y A;  2VBQ A;  2D4O A;  3FJU A;  3PGP A;  3QAH A;  5EC4 A;  3TO7 A;  3ZJ0 A;  4F0Y A;  5JM6 A;  4CGL A;  3FBU A;  3A9L A;  1CJW A;  3NE8 A;  4J3G A;  3GY9 A;  4ZY0 A;  1KWM A;  3B3T A;  2PCU A;  2CNT A;  2OZH A;  4ORF A;  2OZG A;  1IB1 E;  2C6G A;  3FRM A;  3JTK A;  1LFW A;  3IWG A;  4L89 A;  2PIZ A;  4UEE A;  5LYI A;  4BD9 A;  5AG6 A;  2PSW A;  2Z0Z A;  4DJL A;  3TOB A;  4FWU A;  3TTH A;  3S9M A;  1X12 A;  3PB8 X;  4R3K A;  2OB0 A;  3IWW A;  3JVN A;  4CYP A;  3MRU A;  4KUA A;  1AYE A;  2PJ9 A;  4HKF A;  4M85 A;  4WJB A;  1DE4 C;  4FBE A;  5LRK A;  2Q44 A;  1S5K A;  5G20 A;  3SXN A;  1XEB A;  1CM0 A;  3F8K A;  1QMU A;  1GHE A;  1GYT A;  3B3S A;  3DR6 A;  3R95 A;  7CPA A;  1UFH A;  4TWE A;  4MFL A;  1Y7E A;  1L0C A;  3CXP A;  2HC9 A;  4OC0 A;  4A94 A;  1MJA A;  2RFH A;  1PCA A;  5C88 A;  2BSW A;  2AFX A;  1BOB A;  2AFM A;  1BPM A;  3FEC A;  3QB8 A;  2I79 A;  2ZEH A;  1QQ9 A;  5J8F A;  4KS9 A;  2JEW A;  3H4Q A;  1S7L A;  1TKJ A;  4JXR A;  3WC5 A;  4F9V A;  4KOR A;  4R76 A;  4AVC A;  5CPA A;  4X3R A;  4A37 A;  1Y9K A;  1NMT A;  3GYA A;  2FIA A;  1TXR A;  4HNX B;  1FY7 A;  3NH8 A;  1H8L A;  4LQ6 A;  4MFJ A;  4MY3 A;  4OIW A;  4ZI6 A;  4YRH A;  4LUA A;  3H8F A;  4NGS A;  2EO8 A;  4OLL A;  2V8D A;  1Y0R A;  4Q7A A;  2Z3P A;  2XEG A;  3F5B A;  1RTQ A;  2ZW4 A;  3R9F A;  1YW4 A;  3TC8 A;  4B6Z A;  2P6E A;  2Q04 A;  5C82 A;  3D7D A;  3TO9 A;  4K30 A;  1V0C A;  2B4D B;  2ZW5 A;  1YW6 A;  1S7F A;  5DWM A;  1IID A;  4NGN A;  2IQ6 A;  1Z2L A;  1CP7 A;  1IIC A;  3KGQ A;  3LWU A;  3TT2 A;  2G3T A;  4U9Y A;  3WT4 A;  4DYO A;  1Q2C A;  5HVG A;  4OKO A;  4KSA A;  2HB6 A;  4B5P B;  1ZLH A;  1B6B A;  5CNP A;  1VHS A;  2CXA A;  4JXQ A;  4A32 A;  1Q2D A;  1XJO A;  4GXH A;  3W6X A;  3WC7 A;  2BEI A;  4B14 A;  5D8N A;  1YLO A;  2B5G A;  4MMO A;  2WZN A;  4P4F A;  2YGW A;  5J1Q A;  3W6S A;  1CG2 A;  2PJ0 A;  2PE3 A;  2J9A A;  3C26 A;  4BMH A;  4YFJ A;  1F2P A;  1R57 A;  2G3A A;  2V8V A;  4M3S A;  1Y7R A;  4M6I A;  3F0A A;  1IOI A;  4Q36 A;  4X2T A;  1Q2Y A;  3V8I A;  4O23 A;  3DDD A;  3FVL A;  2AJ6 A;  1IOF A;  3K2K A;  2Q0Y A;  1IYK A;  3I1U A;  4MXU A;  2Q7B A;  4QUS A;  2ZOF A;  4UCN A;  2Q43 A;  3DR8 A;  3NFZ A;  4PXE A;  2CTB A;  4B5O A;  3NH5 A;  2EUI A;  4AXV A;  4FUU A;  2GLJ A;  3IIB A;  3PRT A;  5HH1 A;  5IB9 A;  2Q7S A;  1X10 A;  1FNO A;  1I12 A;  1TKH A;  1U6M A;  2BCO A;  2RB7 A;  3H5Z A;  4JLY A;  4KOU A;  4UEF A;  3LMS A;  5FVJ A;  4ZY2 A;  1PYT B;  2PJ1 A;  1XBU A;  4MHP A;  4C2X A;  4JYW A;  2FXF A;  2CTC A;  3B2Y A;  1RO5 A;  1Y0Y A;  2QVP A;  2GAN A;  4OC4 A;  4CAE A;  5JH9 A;  2AFZ A;  3SJX A;  5JPH A;  3BXM A;  4NXY A;  2O28 A;  4MHN A;  5K8M A;  4KVM E;  3P2H A;  1R3N A;  1ZLI A;  2Z3N A;  3OWC A;  2AE6 A;  2PR8 A;  1I1D A;  3L2N A;  3LAC A;  3D2P A;  1MJ9 A;  3R1K A;  4G1P A;  4KOS A;  3VAT A;  4CPA A;  4A95 A;  1QST A;  3WC6 A;  1IU8 A;  1Z4R A;  2ZOG A;  5JGF A;  4AG9 A;  1YSJ A;  4BBH A;  2V8G A;  2PRQ A;  3FXT A;  3KL9 A;  4UCP A;  3RNZ A;  3SXO A;  3D2M A;  3TCV A;  4ONW A;  3D66 A;  3KI9 A;  4UCM A;  4MY0 A;  4E8O A;  2R7H A;  4LQG A;  4C7H A;  1PUA A;  3T8W A;  3KHZ A;  3IWE A;  2Z10 A;  2EK8 A;  2PJA A;  5G22 A;  3T9Y A;  2GU2 A;  2PDO A;  1BPN A;  3FH4 A;  2ODF A;  5K8P A;  5F49 A;  3SJE A;  4XPK A;  1BAV A;  1JWQ A;  4MRI A;  4JJX A;  3PB4 X;  2VXK A;  3PP9 A;  1WWZ A;  5IX3 A;  3SI2 A;  4ZYQ A;  4R6T A;  2FS5 A;  4NGT A;  2YNE A;  1LRZ A;  1M4G A;  1XE4 A;  1YVO A;  1Z8W A;  3GIU A;  1YQE A;  2NYQ A;  3VAR A;  4CYN A;  3D7F A;  2QEC A;  1IY7 A;  4MHD A;  1ARM A;  4YU9 A;  4MCP A;  3ISX A;  2Q4Z A;  4MI4 A;  4QVT A;  2PR1 A;  2WPW A;  1KUY A;  3EC4 A;  2HV2 A;  2FT0 A;  2CNM A;  3PFO A;  1YVK A;  4MFP A;  4AVA A;  1S3Z A;  2HQY A;  2Z3M A;  3CPX A;  3KHX A;  3RYO A;  4H6U A;  4CAX A;  5HMN A;  2JLM A;  1CBX A;  2DF5 A;  1VGY A;  2ABZ A;  2EVN A;  3DSB A;  4GS4 A;  3FED A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  2GIV A;  4F0X A;  4UFW A;  2A4N A;  2ZW6 A;  3WR7 A;  3DNS A;  1NSL A;  4H89 A;  1IYL A;  1N71 A;  3E0K A;  5ISV A;  2J8R A;  2I00 A;  2KCW A;  1MK4 A;  3IGR A;  3PZJ A;  3W91 A;  5G21 A;  3CXS A;  2OZU A;  2ZPA A;  3G3S A;  4PV6 A;  5I0C A;  2G0B A;  5AG4 A;  1Y9W A;  4NSQ A;  2R1I A;  1M4I A;  1Z4E A;  3FB3 A;  2B3U A;  4Q38 A;  1YX0 A;  4KOV A;  4A30 A;  1XIX A;  4UFX A;  2OH1 A;  2BUE A;  4MFZ A;  2QML A;  1M1D A;  1YK3 A;  1SQH A;  2B5G B;  3BJ8 A;  4YGO A;  4CGN A;  5IV0 A;  4PK2 A;  4UWJ A;  2CNS A;  2H5M A;  4R9M A;  1TIQ A;  4IUS A;  3LOD A;  5F47 A;  2JDC A;  2QIR A;  1YLE A;  4XPL A;  2PQ8 A;  1QSM A;  3I3G A;  4KUB A;  2ATR A;  3P2F A;  4Y49 B;  2R8V A;  3VWD A;  4QBJ A;  4X5K A;  3FYN A;  1QSR A;  1ON0 A;  1QSO A;  3KKW A;  4PK3 A;  2WPX A;  4RI1 A;  2B3V A;  4CRZ B;  3JUW A;  3UY5 A;  4AB7 A;  1B87 A;  2J8N A;  2VZZ A;  3TE4 A;  4A2Z A;  1KUX A;  4U9Z A;  1YGH A;  3S6G A;  2P6G A;  3IU2 A;  2Q4Y A;  3S6H A;  1BO4 A;  4Y49 C;  4MFK A;  5E96 A;  2P0W A;  1I21 A;  2YNC A;  5F48 A;  4E0A A;  1S7N A;  3BJ7 A;  2BL1 A;  4PSX A;  5BWA B;  4EVY A;  4I49 A;  4XNH B;  4NCZ A;  3S6F A;  2VEZ A;  2DPT A;  2C27 A;  3LD2 A;  4UBR A;  3IU1 A;  4CGO A;  2WSA A;  4FD4 A;  2REE A;  5EBV A;  4B10 A;  4B13 A;  3R96 A;  5H86 A;  3EY5 A;  2ARH A;  2Z3K A;  1QSN A;  2NMT A;  3ZZI A;  2DXQ A;  4II9 A;  2Z3O A;  4QC6 A;  4XNH C;  4NF1 A;  2CY2 A;  4UA3 A;  2PC1 A;  2VZY A;  1XF8 A;  5G1Z A;  3TOA A;  4KOY A;  4CYQ A;  4DNC A;  3R9G A;  3R9E A;  2B4B A;  4A33 A;  5KTA A;  5J8C A;  4OAD A;  1J4J A;  1OZP A;  2FSR A;  4KVO E;  3EFA A;  4XPD B;  1ZO0 A;  4KOT A;  2FE7 A;  2J8M A;  4LX9 A;  2B58 A;  4H6Z A;  4ZBG A;  4CS0 B;  3S6K A;  4R3L A;  3NE7 A;  4JD6 A;  2VI7 A;  2F5I A;  3TFY A;  2ZW7 A;  1Z9U A;  4PSW A;  4C68 A;  3CXQ A;  4CAV A;  4XPD C;  3G8W A;  4ZGY B;  2FCK A;  4JWP A;  4KOX A;  4CAF A;  4L8A A;  5DWN A;  3FNC A;  4A31 A;  4F6A A;  4U5Y A;  1M44 A;  1S7K A;  2IL4 A;  2JDD A;  5AGE A;  5JQ4 A;  2WUU A;  1WK4 A;  4ONU A;  2B4D A;  4C2Z A;  3BLN A;  1S60 A;  4E2A A;  4QB9 A;  1P4N A;  2K5T A;  2YND A;  5A28 A;  1K4J A;  3TO6 A;  4B5P A;  2DPS A;  4KLV A;  3B8G A;  2REF A;  2FL4 A;  4HNW B;  4CRY B;  4CAW A;  4C7I A;  4CYO A;  4UFV A;  2JEV A;  2D4P A;  4MJ8 A;  2FIW A;  4UWI A;  3K9U A;  1YRE A;  3GKR A;  2Q4V A;  4CGM A;  1M4D A;  5AG7 A;  5F46 A;  1KZF A;  4MBU A;  4KZT A;  2ZXV A;  2P6F A;  2RC4 A;  4HNY B;  4KLW A;  3I9S A;  4KSF A;  3D3S A;  4FD5 A;  4CGP A;  1P0H A;  4NEX A;  5AG5 A;  5A27 A;  5KTC A;  4R57 A;  2VQY A;  5GCN A;  3MGD A;  2HUZ A;  4AVB A;  4OAE A;  1RXT A;  4FD6 A;  3D8P A;  1MJB A;  4IF5 A;  4B12 A;  3VWE A;  2PRB A;  5IB0 A;  2Z11 A;  4RS2 A;  3EO4 A;  1YR0 A;  4KVX A;  4KOW A;  4FD7 A;  3EXN A;  1KUV A;  2YNC C;  5H84 A;  5KTD A;  2X7B A;  1VKC A;  2R98 A;  3SHP A;  3T90 A;  4MFQ A;  1XMT A;  4B11 A;  3FIX A;  4R87 A;  4AG7 A;  1PU9 A;  1NE9 A;  2Z3L A;  2Y0M A;  3N7Z A;  4C2Y A;  2GE3 A;  2VBQ A;  2D4O A;  3PGP A;  3QAH A;  3TO7 A;  5EC4 A;  3ZJ0 A;  4F0Y A;  4CGL A;  3FBU A;  3A9L A;  1CJW A;  4J3G A;  3GY9 A;  2CNT A;  2OZH A;  4ORF A;  2OZG A;  1IB1 E;  3FRM A;  3JTK A;  3IWG A;  4L89 A;  5AG6 A;  2PSW A;  2Z0Z A;  3TOB A;  3TTH A;  4R3K A;  2OB0 A;  3JVN A;  4CYP A;  4KUA A;  4M85 A;  4HKF A;  2Q44 A;  1S5K A;  5G20 A;  3SXN A;  1XEB A;  1CM0 A;  3F8K A;  1GHE A;  3DR6 A;  3R95 A;  1UFH A;  4MFL A;  1L0C A;  3CXP A;  1MJA A;  5C88 A;  2BSW A;  1BOB A;  3QB8 A;  2I79 A;  5J8F A;  4KS9 A;  3H4Q A;  1S7L A;  4JXR A;  4KOR A;  4AVC A;  1Y9K A;  1NMT A;  3GYA A;  2FIA A;  4HNX B;  1FY7 A;  4MY3 A;  4MFJ A;  4YRH A;  4LUA A;  4OLL A;  2Z3P A;  3R9F A;  3F5B A;  2ZW4 A;  2P6E A;  2Q04 A;  5C82 A;  3TO9 A;  4K30 A;  1V0C A;  2B4D B;  2ZW5 A;  1S7F A;  5DWM A;  1IID A;  3TT2 A;  4E8O A;  1IIC A;  2G3T A;  4U9Y A;  1Q2C A;  4KSA A;  4B5P B;  1B6B A;  5CNP A;  1VHS A;  2CXA A;  4JXQ A;  4A32 A;  1Q2D A;  3W6X A;  2BEI A;  4B14 A;  2B5G A;  2YGW A;  3W6S A;  3C26 A;  4BMH A;  4YFJ A;  1R57 A;  2G3A A;  4M3S A;  4Q36 A;  1Y7R A;  3F0A A;  1Q2Y A;  3V8I A;  3DDD A;  2AJ6 A;  2Q0Y A;  1IYK A;  2Q7B A;  4QUS A;  4UCN A;  3DR8 A;  4B5O A;  2EUI A;  5HH1 A;  1I12 A;  1U6M A;  3H5Z A;  4JLY A;  4KOU A;  5FVJ A;  4C2X A;  2FXF A;  1RO5 A;  4CAE A;  2GAN A;  5JPH A;  4NXY A;  2O28 A;  4KVM E;  3P2H A;  2Z3N A;  3OWC A;  2AE6 A;  2PR8 A;  1I1D A;  3R1K A;  3D2P A;  1MJ9 A;  4KOS A;  4A95 A;  1QST A;  1Z4R A;  4AG9 A;  4BBH A;  4UCP A;  3TCV A;  3FXT A;  3SXO A;  3D2M A;  4UCM A;  4MY0 A;  2R7H A;  4C7H A;  1PUA A;  3IWE A;  2Z10 A;  3T9Y A;  5G22 A;  2PDO A;  5F49 A;  4XPK A;  4JJX A;  2VXK A;  3PP9 A;  1WWZ A;  5IX3 A;  2FS5 A;  2YNE A;  1LRZ A;  1M4G A;  1XE4 A;  1YVO A;  4CYN A;  2QEC A;  4MHD A;  4MI4 A;  4QVT A;  2PR1 A;  2WPW A;  1KUY A;  3EC4 A;  2HV2 A;  2FT0 A;  2CNM A;  1YVK A;  4MFP A;  4AVA A;  1S3Z A;  2HQY A;  2Z3M A;  3RYO A;  4H6U A;  4CAX A;  5HMN A;  2JLM A;  2EVN A;  3DSB A;  4GS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...