1QSNA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and histone h3 peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TGCN5 HISTONE ACETYL TRANSFERASE
publication title Structure of Tetrahymena GCN5 bound to coenzyme A and a histone H3 peptide.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
total genus 43
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsnA00
4L8AA 1S7KA 5ISVA 4JXRA 1YVKA 4J3GA 4DNCA 1Z4EA 2VBQA 3R9EA 4IUSA 4KOWA 4CAVA 3S6GA 4AG7A 3P2FA 3G3SA 4KOVA 2B4DB 1Y7RA 3D2PA 4LX9A 2ATRA 4NSQA 3SXNA 4AG9A 2PR8A 3OWCA 1QSOA 4KVOE 3R9GA 2A4NA 4F0YA 4KOXA 4PK2A 1YGHA 3TO6A 1XMTA 3S6FA 1GHEA 1QSNA 1NSLA 2B5GB 1WWZA 1QSRA 4R87A 5DWMA 1Q2CA 4CAWA 2R1IA 4ZBGA 3R9FA 2HQYA 3G8WA 3H4QA 2OB0A 1P0HA 4UBRA 3FRMA 3QAHA 1MK4A 3BLNA 2FIAA 4MY3A 3JVNA 4PK3A 1VKCA 2WPXA 1IYKA 2FS5A 5HH1A 4OADA 4UWJA 3P2HA 1IIDA 4MI4A 2OZHA 2B4DA 2B58A 2QMLA 1S60A 4HNWB 5F47A 1VHSA 4E0AA 1FY7A 2FIWA 4FD7A 1J4JA 4KOYA 1S7FA 2J8MA 1NMTA 2EUIA 5JPHA 3KKWA 5J8FA 5IX3A 5KTCA 4KVME 2JDCA 4CS0B 3DDDA 2B4BA 4KVXA 2PC1A 4KZTA 3VWEA 1YR0A 2HUZA 2Q4VA 3QB8A 2IL4A 2PDOA 2FCKA 2R7HA 2F5IA 1N71A 1YK3A 1RXTA 1RO5A 5C88A 2BL1A 1IB1E 2JDDA 4HNXB 3DSBA 3FXTA 1KUXA 3K9UA 1UFHA 2QIRA 4KORA 2REFA 2GIVA 2PRBA 1S3ZA 4UA3A 1LRZA 3PZJA 1QSTA 3UY5A 2FE7A 2B3VA 2OZGA 4R3LA 3WR7A 1XIXA 3TO7A 4PV6A 1I21A 3JUWA 4MY0A 4KLVA 4K30A 4PSWA 3FB3A 2ZPAA 4NCZA 3D3SA 2KCWA 3W6XA 2VEZA 4QB9A 2I00A 4OAEA 1B6BA 1BO4A 2B3UA 1SQHA 2AJ6A 4H89A 2WPWA 2FSRA 2ZW6A 3D8PA 5F49A 3TE4A 1KUYA 1M4GA 4XPDC 1XEBA 1YREA 5C82A 2H5MA 2P0WA 4JWPA 2P6GA 3V8IA 2PQ8A 3C26A 1CJWA 2QECA 4NXYA 1QSMA 2D4PA 4L89A 2RC4A 2C27A 4H6ZA 2GANA 1U6MA 2G3TA 3F5BA 2R8VA 5GCNA 1Q2DA 2Z10A 4QUSA 4B5PA 3F8KA 3GYAA 4AB7A 4FD6A 3LD2A 5J8CA 3T9YA 4ORFA 1V0CA 3DR8A 4RS2A 3LODA 1Z4RA 2VZZA 4U5YA 1Y9WA 3CXSA 2VI7A 3T90A 1KUVA 1PUAA 2CNTA 4XPDB 2JLMA 4JD6A 4M85A 4UWIA 5E96A 5HMNA 1KZFA 2Y0MA 3N7ZA 1L0CA 1Q2YA 2ZW7A 3TCVA 3FBUA 2Q7BA 2FXFA 2HV2A 4KUAA 5EC4A 2Z11A 1I12A 4AVCA 1K4JA 1IYLA 5F46A 4HKFA 1NE9A 4H6UA 2Q4YA 3W91A 5EBVA 5KTDA 3D2MA 4MJ8A 3PP9A 3NE7A 3FNCA 4HNYB 4B5OA 2I79A 2Q44A 3EO4A 4AVBA 4EVYA 1Y9KA 4E2AA 2ZW5A 4CRZB 5CNPA 3GKRA 1M4DA 3MGDA 4KOUA 2ARHA 2CNSA 3SXOA 1YX0A 3SHPA 3EC4A 5H86A 3W6SA 2AE6A 2K5TA 2ZXVA 3B8GA 4QBJA 2BSWA 4B5PB 5DWNA 4NEXA 4YFJA 1S5KA 3TFYA 2PSWA 5KTAA 1XE4A 1ON0A 2P6EA 4MBUA 1M44A 3R95A 1OZPA 3DNSA 4R57A 5H84A 4XNHC 1YLEA 4QVTA 2Q0YA 3FYNA 4XPKA 3TT2A 4M3SA 3I3GA 3S6HA 4E8OA 4FD5A 2FT0A 3TOAA 2R98A 2X7BA 1YVOA 2G0BA 3IGRA 4BMHA 4KLWA 1MJAA 3I9SA 4YGOA 2BUEA 1B87A 4NF1A 5I0CA 2G3AA 4FD4A 3ZZIA 2PR1A 3TTHA 4CAXA 4R3KA 1M1DA 4KUBA 2NMTA 2Q04A 4OLLA 3S6KA 2CNMA 1P4NA 2VXKA 3CXPA 3EY5A 4XPLA 1TIQA 2OZUA 2J8NA 5IB0A 4XNHB 2BEIA 2VZYA 4F6AA 1S7NA 3TO9A 1WK4A 3BJ7A 1S7LA 2CY2A 2OH1A 1PU9A 3IWGA 4Y49C 4JLYA 2FL4A 2J8RA 4KOTA 4X5KA 2B5GA 2JEVA 3EXNA 2DXQA 3RYOA 3CXQA 1I1DA 2VQYA 5F48A 4YRHA 1BOBA 3PGPA 1XF8A 2GE3A 3EFAA 3F0AA 4RI1A 4CRYB 4R9MA 3ZJ0A 3DR6A 4PSXA 4GS4A 1M4IA 2D4OA 2REEA 5FVJA 2ZW4A 3R1KA 4IF5A 1CM0A 4MHDA 3E0KA 2OU2A 3VWDA 5JQ4A 4QC6A 1Z9UA 1MJ9A 3FIXA 1R57A 4I49A 4JXQA 1IICA 4ONUA 3BJ8A 4U9ZA 3TOBA 2P6FA 4Y49B 4LUAA 3GY9A 4U9YA 2O28A 3R96A 2Z0ZA 2EVNA 4AVAA 5IV0A 4II9A 4JJXA 4KOSA 1MJBA
chains in the Genus database with same CATH superfamily
2Q51A 4L8AA 2PVWA 1S7KA 2ZENA 1Z8WA 3D7GA 1Q7LA 1YVKA 4J3GA 4JXRA 5ISVA 4DNCA 4Q36A 3TC8A 4P45A 1Z4EA 1M4LA 4MCRA 2VBQA 4NGNA 3R9EA 4IUSA 4KOWA 4CAVA 3B3VA 3S6GA 3P2FA 3G3SA 4MFKA 4AG7A 5I4MA 4X3RA 3S9NA 3B3WA 4KOVA 2B4DB 2ZOFA 1Y7RA 2GLFA 2Q4ZA 2ATRA 3D2PA 4LX9A 3D7DA 4NSQA 4P4DA 3SXNA 4AG9A 2EO8A 3NE8A 2PR8A 5JPHA 3OWCA 1QSOA 4KVOE 2ZEFA 3R9GA 4F0XA 2A4NA 4F0YA 2BOAA 2Z3PA 4KOXA 4PK2A 1YGHA 3TO6A 1XMTA 3S6FA 1GHEA 3IEHA 2C6CA 1QSNA 4JYWA 3PEIA 4MXUA 4X8IA 1NSLA 2B5GB 1WWZA 1YSJA 1QSRA 4R87A 4UF4A 4GXHA 5DWMA 1Q2CA 3RZAA 5LYIA 4CAWA 2R1IA 4ZBGA 3R9FA 4A2ZA 1BPMA 1XOVA 2HQYA 1QQ9A 4UCPA 3G8WA 2Z3NA 3H4QA 1F2PA 2OB0A 3KI9A 3D4UA 4EMEA 1P0HA 3NA6A 4UBRA 3FRMA 2G9DA 3QAHA 1MK4A 3BLNA 2FIAA 3CPXA 3JTKA 4MRIA 3IIBA 4MY3A 1ARMA 4ZY1A 1ZO0A 1TF8A 3JVNA 4PK3A 1VKCA 2WPXA 3VARA 5HVGA 1IYKA 2FS5A 1DTDA 5HH1A 2ZEGA 1VIXA 4OADA 4UWJA 2PJ7A 3FVLA 5CPAA 3FEDA 4NGTA 3P2HA 1IIDA 2ZEPA 3D7FA 3PFOA 4MI4A 3WT4A 2AFMA 2OZHA 4EWTA 4B14A 3PB6X 5BWAB 1Z8TA 2B4DA 3KR4A 2B58A 2EBJA 2PE3A 4R8FA 2QMLA 1S60A 3KQXA 4HNWB 1XBUA 1VHSA 5F47A 4E0AA 1FY7A 3H5ZA 2FIWA 3VATA 4FD7A 4B10A 1J4JA 5HVHA 4KOYA 3KQZA 3VH9A 3IWEA 1ZLIA 1S7FA 4WJBA 4A30A 2Z3KA 2J8MA 2PJ9A 1NMTA 2BO9A 2EUIA 2O4HA 3FH4A 3KKWA 2CIJA 3PBEA 4GM5A 4KSAA 4UFVA 5J8FA 5IX3A 4PXEA 4MFQA 5KTCA 1LFWA 1GYTA 1Y7EA 1HEEA 2ZOGA 4KVME 2JDCA 4CS0B 3DDDA 2B4BA 2PJ6A 4KVXA 1TF9A 5AG7A 4C7HA 2PC1A 4KZTA 5LYDA 4OKOA 4F8ZA 3VWEA 1YR0A 2HUZA 2Q4VA 3QB8A 2WZNA 4OMEA 4C2ZA 1BLLE 5K8OA 2IL4A 2PDOA 2FCKA 2R7HA 4C7IA 2F5IA 2Z3MA 1N71A 1YK3A 4OC0A 1RXTA 1CPXA 3D68A 1RO5A 1IY7A 2V8DA 5LYLA 5ELYA 5C88A 3GIUA 2BL1A 1IB1E 2JDDA 3ISXA 4B13A 4HNXB 4M6GA 3DSBA 3FXTA 1KUXA 2ZEDA 3K9UA 3LACA 4C2XA 1UFHA 2QIRA 1Z2LA 3H8FA 3IJ3A 4KORA 4NGQA 4B6ZA 1IU8A 2REFA 2GIVA 4A95A 2YNEA 4H2KA 7CPAA 4IK2A 2PRBA 2F7VA 4UEFA 1S3ZA 4KSFA 3HUVA 4UA3A 4JZ0A 4R76A 2ZEOA 3I1UA 1LRZA 3PZJA 1QSTA 3UY5A 2FE7A 2B3VA 2OZGA 4R3LA 5D29A 1R3NA 3WR7A 1XIXA 3TO7A 2DF5A 2PJ2A 1HDUA 4PV6A 1I21A 1Y0RA 4OC5A 4A38A 2PVVA 3JUWA 4MY0A 4FUUA 4MHZA 1AUGA 3KR5A 4KLVA 2V8GA 4K30A 1X12A 3FB3A 2CTCA 4PSWA 2ZPAA 2PJBA 3MRUA 5DS0A 5A27A 4NCZA 3D3SA 3FECA 3QAYA 5JH9A 1IGBA 3PBBA 1TKJA 4P6YA 4IHMA 4UCMA 1TXRA 4OC3A 1Y0YA 3H8EA 1LAPA 2KCWA 3W6XA 4CGPA 2VEZA 4QB9A 2I00A 4OAEA 5G21A 5AGEA 1B6BA 2ANPA 1BO4A 2FVGA 4CGMA 5AG6A 1XMBA 3RAMA 4R7MA 3RBUA 3ISZA 3PB8X 3CDXA 2B3UA 1SQHA 2AJ6A 4H89A 4UFWA 2ODFA 2WPWA 2FSRA 5G1ZA 3PFEA 2GLJA 1BPNA 2ZW6A 3D8PA 3WABA 1XRYA 1LOKA 5F49A 3TE4A 3NH5A 3WC6A 2AFOA 4ZY2A 1KUYA 3RO0A 2XEFA 4A39A 2PCUA 2PJ4A 1M4GA 3DLJA 3B3SA 4XPDC 1XEBA 1YREA 2IJZA 3JRUA 1LCPA 3LWUA 5C82A 2H5MA 1AMPA 4HPSA 2P0WA 3FX6A 4JWPA 2P6GA 3V8IA 4PXBA 2PQ8A 3C26A 1CPSA 1CJWA 3GUXA 2QECA 3B35A 4KS9A 4OC1A 2PRQA 4NXYA 1QSMA 2D4PA 1PYTB 4A33A 3KHXA 4PQAA 4L89A 3FMCA 2CTBA 2RC4A 3KL9A 2C27A 4H6ZA 2GANA 1U6MA 2ZEEA 2G3TA 3F5BA 4WWVA 2R8VA 4UIAA 5GCNA 1Q2DA 3FJUA 5LYFA 5IB9A 4AXVA 4W9YA 2Z10A 2V77A 4QUSA 1Z5RA 4NFRA 3F8KA 4B5PA 4ZI6A 2EWBA 3GYAA 4AB7A 1CBXA 5K8PA 3N5FA 4OIWA 4FD6A 3LD2A 5J8CA 3T9YA 4ORFA 1V0CA 3SJFA 4DJLA 1FT7A 3IWWA 1H8LA 3DR8A 1LAMA 2ABZA 1CG2A 5D8NA 4P4JA 3WC7A 2AFZA 4RS2A 2GU2A 3LODA 4FAIA 4RN7A 4CYQA 4CYOA 1Z4RA 2JBJA 2VZZA 4U5YA 1Y9WA 3CXSA 2VI7A 1HDQA 4KSIA 4UIBA 2Z3LA 4YU9A 3T90A 4Q7AA 1YQEA 1KUVA 1PUAA 2CNTA 4XPDB 5LRKA 2JLMA 2I3CA 2YNCC 4JD6A 4ZGYB 1VHEA 3SJEA 4M85A 4UWIA 4NGSA 5E96A 1ZG7A 5HMNA 1KZFA 4NGPA 2Y0MA 4CYPA 3N7ZA 4P4BA 1L0CA 3B3CA 1Q2YA 2ZW7A 1JWQA 5JGFA 3DGVA 3TCVA 5A28A 2BCOA 2AFXA 2QVPA 1DE4C 4LQ6A 3SI2A 3FBUA 2V8VA 2Q7BA 4OC4A 3WC5A 5JM6A 4YWYA 3T8WA 2FXFA 4P4IA 4NJQA 2DEAA 2HV2A 4KUAA 1EE3P 5EC4A 4A37A 2Z11A 1I12A 4AVCA 4B12A 2ZEHA 1K4JA 1IYLA 3MN8A 5F46A 4HKFA 1NE9A 4H6UA 3CPAA 2Q4YA 4MFPA 3W91A 3B3TA 5EBVA 5KTDA 4FBEA 3D2MA 4MFJA 3PP9A 4MJ8A 3IFEA 3NE7A 4R6TA 3FNCA 4HNYB 4B5OA 2I79A 2Q44A 5G20A 4EFDA 3EO4A 2IQ6A 4CAFA 4AVBA 1ZG8A 3A9LA 1PCAA 4EVYA 5EMIA 2V8HA 1Y9KA 6CPAA 4E2AA 3V7ZA 2JEWA 2OOTA 5K8NA 1TKHA 2O53A 2ZW5A 3PB4X 4CYNA 4UCNA 2QYVA 5CNPA 4CRZB 3PB9X 5F09A 3GKRA 4ZY0A 3K9TA 5AG4A 1M4DA 1ELMP 3MGDA 4KOSA 4KOUA 3GB0A 4ZX8A 1ARLA 2ARHA 2CNSA 2WSAA 4TNUA 3KZWA 1YX0A 3SXOA 4C2YA 3SHPA 2HC9A 3EC4A 5H86A 3W6SA 3CZXA 4DYOA 2AE6A 4P10A 1YW6A 2K5TA 4TWEA 3NFZA 2ZXVA 3B8GA 4QBJA 5J1QA 2BSWA 4MMOA 1IOIA 1JQGA 1BAVA 2Q43A 3RNZA 4B5PB 5CBMA 2YNDA 2VL1A 3V38A 1IOFA 1NSAA 1X10A 2DPSA 4NEXA 5DWNA 4BBHA 4MFZA 3H8GA 4YFJA 1S5KA 2PJ5A 3KASA 3TFYA 2PSWA 5KTAA 1LANA 1XE4A 1XJOA 2CXAA 4X2TA 2YGWA 1ON0A 2P6EA 4MBUA 4C68A 1M44A 4LQGA 4NGRA 4DUKA 3R95A 1OZPA 3DNSA 3IU1A 4R57A 5H84A 1ZG9A 3NH4A 4XNHC 1YLEA 4QVTA 4PXCA 4MHNA 1FNOA 4PXDA 2Q0YA 2PIYA 3FYNA 3NH8A 4P44A 4XPKA 3TT2A 4M3SA 3IC1A 3S9MA 3I3GA 3S6HA 4E8OA 4FD5A 2FT0A 3SJGA 1Z8XA 2R98A 2X7BA 1YVOA 2G0BA 3TOAA 3IGRA 3GLJA 4BMHA 4KLWA 2PIZA 1MJAA 2Z3OA 4FWUA 3I9SA 3SJXA 4YGOA 2CF4A 4ZX9A 3PB7X 3IO1A 2BUEA 3D66A 4MHPA 1B87A 4NF1A 1F57A 4F9UA 5I0CA 2G3AA 3L2NA 3SI1A 4MHYA 4FD4A 3ZZIA 1Z8LA 4BD9A 2PJAA 2PR1A 3D67A 3TTHA 4CAXA 4OC2A 4R3KA 1TKFA 3BI1A 1M1DA 1CP6A 2NMTA 4KUBA 4Q38A 2YNCA 2Q04A 4K3NA 2AFUA 2POKA 4OLLA 2F8HA 3S6KA 2CNMA 2NSMA 4IAVA 1RTQA 1P4NA 2IMOA 3KGQA 3SI0A 3BHXA 2VXKA 2AFSA 1ZLHA 3FF3A 3CXPA 3EY5A 2ZELA 4F9VA 4XPLA 1TIQA 1CP7A 5FVJA 3B2YA 2OZUA 2J8NA 5IB0A 4O23A 4A32A 4XNHB 2BEIA 5AG5A 2VZYA 3PRTA 4F6AA 1S7NA 3TO9A 1WK4A 2QJ8A 2PJ3A 3BJ7A 3D7HA 1S7LA 2CY2A 1VGYA 1YMEA 2OH1A 1PU9A 4UEEA 3CT9A 3HLPA 3IWGA 4Y49C 2DPTA 1YLOA 4RUHA 1KWMA 4JLYA 4NGMA 1AYEA 2RB7A 4UFXA 1VHOA 2C1CA 2OR4A 2FL4A 2C6PA 4P4EA 2WUUA 2J8RA 4ZYQA 4A94A 3BI0A 4KOTA 2GREA 2AFWA 4PPZA 4B11A 2JBKA 2PJ0A 4X5KA 2B5GA 2JEVA 2Q7SA 3K2KA 2PJ1A 1CX8A 3EXNA 2DXQA 3RYOA 3CXQA 1I1DA 2VQYA 5F48A 4YRHA 2EK9A 4M6IA 3KHZA 2RFHA 1A2ZA 2HB6A 1BOBA 2XEGA 1XF8A 3PGPA 5THWA 2GE3A 4OIDA 5G22A 3EFAA 3F0AA 4RI1A 8CPAA 3S9LA 4CGNA 1OBRA 5LRGA 4CRYB 4CGOA 4BINA 4R9MA 3ZJ0A 4NJRA 3DR6A 2PJCA 2GFQA 4PSXA 5HXDA 4GS4A 5K8MA 1M4IA 2PJ8A 2XEIA 3FEEA 4G1PA 4CPAA 4MCSA 1YW4A 2D4OA 1XFOA 2REEA 2WYRA 4M6HA 3B7IA 4UEZA 2ZW4A 3R1KA 4IF5A 1CM0A 1R43A 2NYQA 4MHDA 3E0KA 2OU2A 3QNVA 3VWDA 5JQ4A 4CGLA 4ONWA 4QC6A 1Z9UA 5HVFA 1MJ9A 4OP4A 3FIXA 1R57A 4I49A 4JXQA 1IICA 2C6GA 4ONUA 3BJ8A 4U9ZA 3TOBA 2ZEMA 1QMUA 2P6FA 4MFLA 2J9AA 3LMSA 4CAEA 2XEJA 1UWYA 4Y49B 4MCQA 3TX8A 3GY9A 4LUAA 4U9YA 4Z65A 2O28A 3R96A 2Z0ZA 3BXMA 2EK8A 2EVNA 4AVAA 5IV0A 4II9A 5LRJA 3IU2A 4P4FA 4JJXA 1ELLP 1F2OA 1MJBA 4MCPA 4A31A
chains in the Genus database with same CATH topology
4L8AA 1S7KA 5ISVA 4JXRA 1YVKA 4J3GA 4DNCA 4Q36A 1Z4EA 2VBQA 3R9EA 4IUSA 4KOWA 4CAVA 3S6GA 4AG7A 3P2FA 3G3SA 4MFKA 4KOVA 2B4DB 1Y7RA 3D2PA 4LX9A 2ATRA 4NSQA 3SXNA 4AG9A 2PR8A 3OWCA 1QSOA 4KVOE 3R9GA 4F0XA 2A4NA 4F0YA 2Z3PA 4KOXA 4PK2A 1YGHA 3TO6A 1XMTA 3S6FA 1GHEA 1QSNA 1NSLA 2B5GB 1WWZA 1QSRA 4R87A 5DWMA 1Q2CA 4CAWA 2R1IA 4ZBGA 3R9FA 4A2ZA 2HQYA 4UCPA 3G8WA 2Z3NA 3H4QA 2OB0A 1P0HA 4UBRA 3FRMA 3QAHA 1MK4A 3BLNA 2FIAA 3JTKA 4MY3A 1ZO0A 3JVNA 4PK3A 1VKCA 2WPXA 1IYKA 2FS5A 5HH1A 4OADA 4UWJA 3P2HA 1IIDA 4MI4A 2OZHA 4B14A 5BWAB 2B4DA 2B58A 2QMLA 1S60A 4HNWB 5F47A 1VHSA 4E0AA 1FY7A 3H5ZA 2FIWA 4FD7A 4B10A 1J4JA 4KOYA 3IWEA 1S7FA 4A30A 2Z3KA 2J8MA 1NMTA 2EUIA 4KSAA 4UFVA 5JPHA 3KKWA 5J8FA 5IX3A 5KTCA 4MFQA 4KVME 2JDCA 4CS0B 3DDDA 2B4BA 4KVXA 5AG7A 4C7HA 2PC1A 4KZTA 3VWEA 1YR0A 2HUZA 2Q4VA 3QB8A 4C2ZA 2IL4A 2PDOA 2FCKA 2R7HA 4C7IA 2F5IA 2Z3MA 1N71A 1YK3A 1RXTA 1RO5A 5C88A 4B13A 2BL1A 1IB1E 2JDDA 4HNXB 3DSBA 3FXTA 1KUXA 3K9UA 4C2XA 1UFHA 2QIRA 4KORA 2REFA 2GIVA 4A95A 2YNEA 2PRBA 1S3ZA 4KSFA 4UA3A 1LRZA 3PZJA 1QSTA 3UY5A 2FE7A 2B3VA 2OZGA 4R3LA 3WR7A 1XIXA 3TO7A 4PV6A 1I21A 3JUWA 4MY0A 4KLVA 4K30A 4PSWA 3FB3A 5A27A 2ZPAA 4NCZA 3D3SA 4UCMA 2KCWA 3W6XA 4CGPA 2VEZA 4QB9A 2I00A 4OAEA 5G21A 5AGEA 1B6BA 1BO4A 4CGMA 5AG6A 2B3UA 1SQHA 2AJ6A 4H89A 4UFWA 5G1ZA 2WPWA 2FSRA 2ZW6A 3D8PA 5F49A 3TE4A 1KUYA 1M4GA 4XPDC 1XEBA 1YREA 5C82A 2H5MA 2P0WA 4JWPA 2P6GA 3V8IA 2PQ8A 3C26A 1CJWA 2QECA 4KS9A 4NXYA 1QSMA 2D4PA 4A33A 4L89A 2RC4A 2C27A 4H6ZA 2GANA 1U6MA 2G3TA 3F5BA 2R8VA 5GCNA 1Q2DA 2Z10A 4QUSA 4B5PA 3F8KA 3GYAA 4AB7A 4FD6A 3LD2A 5J8CA 3T9YA 4ORFA 1V0CA 3DR8A 4RS2A 3LODA 4CYQA 4CYOA 1Z4RA 2VZZA 4U5YA 1Y9WA 3CXSA 2VI7A 3T90A 2Z3LA 1KUVA 1PUAA 2CNTA 4XPDB 2JLMA 2YNCC 4JD6A 4ZGYB 4M85A 4UWIA 5E96A 5HMNA 1KZFA 2Y0MA 4CYPA 3N7ZA 1L0CA 1Q2YA 2ZW7A 3TCVA 5A28A 3FBUA 2Q7BA 2FXFA 2HV2A 4KUAA 5EC4A 2Z11A 1I12A 4AVCA 4B12A 1K4JA 1IYLA 5F46A 4HKFA 1NE9A 4H6UA 2Q4YA 4MFPA 3W91A 5EBVA 5KTDA 3D2MA 4MFJA 3PP9A 4MJ8A 3NE7A 3FNCA 4HNYB 4B5OA 2I79A 2Q44A 5G20A 3EO4A 4CAFA 4AVBA 3A9LA 4EVYA 1Y9KA 4E2AA 2ZW5A 4CYNA 4UCNA 4CRZB 5CNPA 3GKRA 5AG4A 1M4DA 3MGDA 4KOUA 2WSAA 2ARHA 2CNSA 3SXOA 1YX0A 4C2YA 3SHPA 3EC4A 5H86A 3W6SA 2AE6A 2K5TA 2ZXVA 3B8GA 4QBJA 2BSWA 4B5PB 2YNDA 2DPSA 4BBHA 5DWNA 4NEXA 4MFZA 4YFJA 1S5KA 3TFYA 2PSWA 5KTAA 1XE4A 2CXAA 2YGWA 1ON0A 2P6EA 4MBUA 4C68A 1M44A 3R95A 1OZPA 3DNSA 3IU1A 4R57A 5H84A 4XNHC 1YLEA 4QVTA 2Q0YA 3FYNA 4XPKA 3TT2A 4M3SA 3I3GA 3S6HA 4E8OA 4FD5A 2FT0A 3TOAA 2R98A 2X7BA 1YVOA 2G0BA 3IGRA 4BMHA 4KLWA 1MJAA 2Z3OA 3I9SA 4YGOA 2BUEA 1B87A 4NF1A 5I0CA 2G3AA 4FD4A 3ZZIA 2PR1A 3TTHA 4CAXA 4R3KA 1M1DA 4KUBA 2NMTA 4Q38A 2YNCA 2Q04A 4OLLA 3S6KA 2CNMA 1P4NA 2VXKA 3CXPA 3EY5A 4XPLA 1TIQA 2OZUA 2J8NA 5IB0A 4A32A 4XNHB 2BEIA 5AG5A 2VZYA 4F6AA 1S7NA 3TO9A 1WK4A 3BJ7A 1S7LA 2CY2A 2OH1A 1PU9A 3IWGA 4Y49C 2DPTA 4JLYA 4UFXA 2FL4A 2WUUA 2J8RA 4KOTA 4B11A 4X5KA 2B5GA 2JEVA 3EXNA 2DXQA 3RYOA 3CXQA 1I1DA 2VQYA 5F48A 4YRHA 1BOBA 3PGPA 1XF8A 2GE3A 5G22A 3EFAA 3F0AA 4RI1A 4CGNA 4CRYB 4CGOA 4R9MA 3ZJ0A 3DR6A 4PSXA 4GS4A 1M4IA 2D4OA 2REEA 5FVJA 2ZW4A 3R1KA 4IF5A 1CM0A 4MHDA 3E0KA 2OU2A 3VWDA 5JQ4A 4CGLA 4QC6A 1Z9UA 1MJ9A 3FIXA 1R57A 4I49A 4JXQA 1IICA 4ONUA 3BJ8A 4U9ZA 3TOBA 2P6FA 4MFLA 4CAEA 4Y49B 3GY9A 4LUAA 4U9YA 2O28A 3R96A 2Z0ZA 2EVNA 4AVAA 5IV0A 4II9A 3IU2A 4JJXA 4KOSA 1MJBA 4A31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8A A;  1S7K A;  5ISV A;  4JXR A;  1YVK A;  4J3G A;  4DNC A;  1Z4E A;  2VBQ A;  3R9E A;  4IUS A;  4KOW A;  4CAV A;  3S6G A;  4AG7 A;  3P2F A;  3G3S A;  4KOV A;  2B4D B;  1Y7R A;  3D2P A;  4LX9 A;  2ATR A;  4NSQ A;  3SXN A;  4AG9 A;  2PR8 A;  3OWC A;  1QSO A;  4KVO E;  3R9G A;  2A4N A;  4F0Y A;  4KOX A;  4PK2 A;  1YGH A;  3TO6 A;  1XMT A;  3S6F A;  1GHE A;  1QSN A;  1NSL A;  2B5G B;  1WWZ A;  1QSR A;  4R87 A;  5DWM A;  1Q2C A;  4CAW A;  2R1I A;  4ZBG A;  3R9F A;  2HQY A;  3G8W A;  3H4Q A;  2OB0 A;  1P0H A;  4UBR A;  3FRM A;  3QAH A;  1MK4 A;  3BLN A;  2FIA A;  4MY3 A;  3JVN A;  4PK3 A;  1VKC A;  2WPX A;  1IYK A;  2FS5 A;  5HH1 A;  4OAD A;  4UWJ A;  3P2H A;  1IID A;  4MI4 A;  2OZH A;  2B4D A;  2B58 A;  2QML A;  1S60 A;  4HNW B;  5F47 A;  1VHS A;  4E0A A;  1FY7 A;  2FIW A;  4FD7 A;  1J4J A;  4KOY A;  1S7F A;  2J8M A;  1NMT A;  2EUI A;  5JPH A;  3KKW A;  5J8F A;  5IX3 A;  5KTC A;  4KVM E;  2JDC A;  4CS0 B;  3DDD A;  2B4B A;  4KVX A;  2PC1 A;  4KZT A;  3VWE A;  1YR0 A;  2HUZ A;  2Q4V A;  3QB8 A;  2IL4 A;  2PDO A;  2FCK A;  2R7H A;  2F5I A;  1N71 A;  1YK3 A;  1RXT A;  1RO5 A;  5C88 A;  2BL1 A;  1IB1 E;  2JDD A;  4HNX B;  3DSB A;  3FXT A;  1KUX A;  3K9U A;  1UFH A;  2QIR A;  4KOR A;  2REF A;  2GIV A;  2PRB A;  1S3Z A;  4UA3 A;  1LRZ A;  3PZJ A;  1QST A;  3UY5 A;  2FE7 A;  2B3V A;  2OZG A;  4R3L A;  3WR7 A;  1XIX A;  3TO7 A;  4PV6 A;  1I21 A;  3JUW A;  4MY0 A;  4KLV A;  4K30 A;  4PSW A;  3FB3 A;  2ZPA A;  4NCZ A;  3D3S A;  2KCW A;  3W6X A;  2VEZ A;  4QB9 A;  2I00 A;  4OAE A;  1B6B A;  1BO4 A;  2B3U A;  1SQH A;  2AJ6 A;  4H89 A;  2WPW A;  2FSR A;  2ZW6 A;  3D8P A;  5F49 A;  3TE4 A;  1KUY A;  1M4G A;  4XPD C;  1XEB A;  1YRE A;  5C82 A;  2H5M A;  2P0W A;  4JWP A;  2P6G A;  3V8I A;  2PQ8 A;  3C26 A;  1CJW A;  2QEC A;  4NXY A;  1QSM A;  2D4P A;  4L89 A;  2RC4 A;  2C27 A;  4H6Z A;  2GAN A;  1U6M A;  2G3T A;  3F5B A;  2R8V A;  5GCN A;  1Q2D A;  2Z10 A;  4QUS A;  4B5P A;  3F8K A;  3GYA A;  4AB7 A;  4FD6 A;  3LD2 A;  5J8C A;  3T9Y A;  4ORF A;  1V0C A;  3DR8 A;  4RS2 A;  3LOD A;  1Z4R A;  2VZZ A;  4U5Y A;  1Y9W A;  3CXS A;  2VI7 A;  3T90 A;  1KUV A;  1PUA A;  2CNT A;  4XPD B;  2JLM A;  4JD6 A;  4M85 A;  4UWI A;  5E96 A;  5HMN A;  1KZF A;  2Y0M A;  3N7Z A;  1L0C A;  1Q2Y A;  2ZW7 A;  3TCV A;  3FBU A;  2Q7B A;  2FXF A;  2HV2 A;  4KUA A;  5EC4 A;  2Z11 A;  1I12 A;  4AVC A;  1K4J A;  1IYL A;  5F46 A;  4HKF A;  1NE9 A;  4H6U A;  2Q4Y A;  3W91 A;  5EBV A;  5KTD A;  3D2M A;  4MJ8 A;  3PP9 A;  3NE7 A;  3FNC A;  4HNY B;  4B5O A;  2I79 A;  2Q44 A;  3EO4 A;  4AVB A;  4EVY A;  1Y9K A;  4E2A A;  2ZW5 A;  4CRZ B;  5CNP A;  3GKR A;  1M4D A;  3MGD A;  4KOU A;  2ARH A;  2CNS A;  3SXO A;  1YX0 A;  3SHP A;  3EC4 A;  5H86 A;  3W6S A;  2AE6 A;  2K5T A;  2ZXV A;  3B8G A;  4QBJ A;  2BSW A;  4B5P B;  5DWN A;  4NEX A;  4YFJ A;  1S5K A;  3TFY A;  2PSW A;  5KTA A;  1XE4 A;  1ON0 A;  2P6E A;  4MBU A;  1M44 A;  3R95 A;  1OZP A;  3DNS A;  4R57 A;  5H84 A;  4XNH C;  1YLE A;  4QVT A;  2Q0Y A;  3FYN A;  4XPK A;  3TT2 A;  4M3S A;  3I3G A;  3S6H A;  4E8O A;  4FD5 A;  2FT0 A;  3TOA A;  2R98 A;  2X7B A;  1YVO A;  2G0B A;  3IGR A;  4BMH A;  4KLW A;  1MJA A;  3I9S A;  4YGO A;  2BUE A;  1B87 A;  4NF1 A;  5I0C A;  2G3A A;  4FD4 A;  3ZZI A;  2PR1 A;  3TTH A;  4CAX A;  4R3K A;  1M1D A;  4KUB A;  2NMT A;  2Q04 A;  4OLL A;  3S6K A;  2CNM A;  1P4N A;  2VXK A;  3CXP A;  3EY5 A;  4XPL A;  1TIQ A;  2OZU A;  2J8N A;  5IB0 A;  4XNH B;  2BEI A;  2VZY A;  4F6A A;  1S7N A;  3TO9 A;  1WK4 A;  3BJ7 A;  1S7L A;  2CY2 A;  2OH1 A;  1PU9 A;  3IWG A;  4Y49 C;  4JLY A;  2FL4 A;  2J8R A;  4KOT A;  4X5K A;  2B5G A;  2JEV A;  3EXN A;  2DXQ A;  3RYO A;  3CXQ A;  1I1D A;  2VQY A;  5F48 A;  4YRH A;  1BOB A;  3PGP A;  1XF8 A;  2GE3 A;  3EFA A;  3F0A A;  4RI1 A;  4CRY B;  4R9M A;  3ZJ0 A;  3DR6 A;  4PSX A;  4GS4 A;  1M4I A;  2D4O A;  2REE A;  5FVJ A;  2ZW4 A;  3R1K A;  4IF5 A;  1CM0 A;  4MHD A;  3E0K A;  2OU2 A;  3VWD A;  5JQ4 A;  4QC6 A;  1Z9U A;  1MJ9 A;  3FIX A;  1R57 A;  4I49 A;  4JXQ A;  1IIC A;  4ONU A;  3BJ8 A;  4U9Z A;  3TOB A;  2P6F A;  4Y49 B;  4LUA A;  3GY9 A;  4U9Y A;  2O28 A;  3R96 A;  2Z0Z A;  2EVN A;  4AVA A;  5IV0 A;  4II9 A;  4JJX A;  4KOS A;  1MJB A; 
#chains in the Genus database with same CATH topology
 2Q51 A;  4L8A A;  2PVW A;  1S7K A;  2ZEN A;  1Z8W A;  3D7G A;  1Q7L A;  1YVK A;  4J3G A;  4JXR A;  5ISV A;  4DNC A;  4Q36 A;  3TC8 A;  4P45 A;  1Z4E A;  1M4L A;  4MCR A;  2VBQ A;  4NGN A;  3R9E A;  4IUS A;  4KOW A;  4CAV A;  3B3V A;  3S6G A;  3P2F A;  3G3S A;  4MFK A;  4AG7 A;  5I4M A;  4X3R A;  3S9N A;  3B3W A;  4KOV A;  2B4D B;  2ZOF A;  1Y7R A;  2GLF A;  2Q4Z A;  2ATR A;  3D2P A;  4LX9 A;  3D7D A;  4NSQ A;  4P4D A;  3SXN A;  4AG9 A;  2EO8 A;  3NE8 A;  2PR8 A;  5JPH A;  3OWC A;  1QSO A;  4KVO E;  2ZEF A;  3R9G A;  4F0X A;  2A4N A;  4F0Y A;  2BOA A;  2Z3P A;  4KOX A;  4PK2 A;  1YGH A;  3TO6 A;  1XMT A;  3S6F A;  1GHE A;  3IEH A;  2C6C A;  1QSN A;  4JYW A;  3PEI A;  4MXU A;  4X8I A;  1NSL A;  2B5G B;  1WWZ A;  1YSJ A;  1QSR A;  4R87 A;  4UF4 A;  4GXH A;  5DWM A;  1Q2C A;  3RZA A;  5LYI A;  4CAW A;  2R1I A;  4ZBG A;  3R9F A;  4A2Z A;  1BPM A;  1XOV A;  2HQY A;  1QQ9 A;  4UCP A;  3G8W A;  2Z3N A;  3H4Q A;  1F2P A;  2OB0 A;  3KI9 A;  3D4U A;  4EME A;  1P0H A;  3NA6 A;  4UBR A;  3FRM A;  2G9D A;  3QAH A;  1MK4 A;  3BLN A;  2FIA A;  3CPX A;  3JTK A;  4MRI A;  3IIB A;  4MY3 A;  1ARM A;  4ZY1 A;  1ZO0 A;  1TF8 A;  3JVN A;  4PK3 A;  1VKC A;  2WPX A;  3VAR A;  5HVG A;  1IYK A;  2FS5 A;  1DTD A;  5HH1 A;  2ZEG A;  1VIX A;  4OAD A;  4UWJ A;  2PJ7 A;  3FVL A;  5CPA A;  3FED A;  4NGT A;  3P2H A;  1IID A;  2ZEP A;  3D7F A;  3PFO A;  4MI4 A;  3WT4 A;  2AFM A;  2OZH A;  4EWT A;  4B14 A;  3PB6 X;  5BWA B;  1Z8T A;  2B4D A;  3KR4 A;  2B58 A;  2EBJ A;  2PE3 A;  4R8F A;  2QML A;  1S60 A;  3KQX A;  4HNW B;  1XBU A;  1VHS A;  5F47 A;  4E0A A;  1FY7 A;  3H5Z A;  2FIW A;  3VAT A;  4FD7 A;  4B10 A;  1J4J A;  5HVH A;  4KOY A;  3KQZ A;  3VH9 A;  3IWE A;  1ZLI A;  1S7F A;  4WJB A;  4A30 A;  2Z3K A;  2J8M A;  2PJ9 A;  1NMT A;  2BO9 A;  2EUI A;  2O4H A;  3FH4 A;  3KKW A;  2CIJ A;  3PBE A;  4GM5 A;  4KSA A;  4UFV A;  5J8F A;  5IX3 A;  4PXE A;  4MFQ A;  5KTC A;  1LFW A;  1GYT A;  1Y7E A;  1HEE A;  2ZOG A;  4KVM E;  2JDC A;  4CS0 B;  3DDD A;  2B4B A;  2PJ6 A;  4KVX A;  1TF9 A;  5AG7 A;  4C7H A;  2PC1 A;  4KZT A;  5LYD A;  4OKO A;  4F8Z A;  3VWE A;  1YR0 A;  2HUZ A;  2Q4V A;  3QB8 A;  2WZN A;  4OME A;  4C2Z A;  1BLL E;  5K8O A;  2IL4 A;  2PDO A;  2FCK A;  2R7H A;  4C7I A;  2F5I A;  2Z3M A;  1N71 A;  1YK3 A;  4OC0 A;  1RXT A;  1CPX A;  3D68 A;  1RO5 A;  1IY7 A;  2V8D A;  5LYL A;  5ELY A;  5C88 A;  3GIU A;  2BL1 A;  1IB1 E;  2JDD A;  3ISX A;  4B13 A;  4HNX B;  4M6G A;  3DSB A;  3FXT A;  1KUX A;  2ZED A;  3K9U A;  3LAC A;  4C2X A;  1UFH A;  2QIR A;  1Z2L A;  3H8F A;  3IJ3 A;  4KOR A;  4NGQ A;  4B6Z A;  1IU8 A;  2REF A;  2GIV A;  4A95 A;  2YNE A;  4H2K A;  7CPA A;  4IK2 A;  2PRB A;  2F7V A;  4UEF A;  1S3Z A;  4KSF A;  3HUV A;  4UA3 A;  4JZ0 A;  4R76 A;  2ZEO A;  3I1U A;  1LRZ A;  3PZJ A;  1QST A;  3UY5 A;  2FE7 A;  2B3V A;  2OZG A;  4R3L A;  5D29 A;  1R3N A;  3WR7 A;  1XIX A;  3TO7 A;  2DF5 A;  2PJ2 A;  1HDU A;  4PV6 A;  1I21 A;  1Y0R A;  4OC5 A;  4A38 A;  2PVV A;  3JUW A;  4MY0 A;  4FUU A;  4MHZ A;  1AUG A;  3KR5 A;  4KLV A;  2V8G A;  4K30 A;  1X12 A;  3FB3 A;  2CTC A;  4PSW A;  2ZPA A;  2PJB A;  3MRU A;  5DS0 A;  5A27 A;  4NCZ A;  3D3S A;  3FEC A;  3QAY A;  5JH9 A;  1IGB A;  3PBB A;  1TKJ A;  4P6Y A;  4IHM A;  4UCM A;  1TXR A;  4OC3 A;  1Y0Y A;  3H8E A;  1LAP A;  2KCW A;  3W6X A;  4CGP A;  2VEZ A;  4QB9 A;  2I00 A;  4OAE A;  5G21 A;  5AGE A;  1B6B A;  2ANP A;  1BO4 A;  2FVG A;  4CGM A;  5AG6 A;  1XMB A;  3RAM A;  4R7M A;  3RBU A;  3ISZ A;  3PB8 X;  3CDX A;  2B3U A;  1SQH A;  2AJ6 A;  4H89 A;  4UFW A;  2ODF A;  2WPW A;  2FSR A;  5G1Z A;  3PFE A;  2GLJ A;  1BPN A;  2ZW6 A;  3D8P A;  3WAB A;  1XRY A;  1LOK A;  5F49 A;  3TE4 A;  3NH5 A;  3WC6 A;  2AFO A;  4ZY2 A;  1KUY A;  3RO0 A;  2XEF A;  4A39 A;  2PCU A;  2PJ4 A;  1M4G A;  3DLJ A;  3B3S A;  4XPD C;  1XEB A;  1YRE A;  2IJZ A;  3JRU A;  1LCP A;  3LWU A;  5C82 A;  2H5M A;  1AMP A;  4HPS A;  2P0W A;  3FX6 A;  4JWP A;  2P6G A;  3V8I A;  4PXB A;  2PQ8 A;  3C26 A;  1CPS A;  1CJW A;  3GUX A;  2QEC A;  3B35 A;  4KS9 A;  4OC1 A;  2PRQ A;  4NXY A;  1QSM A;  2D4P A;  1PYT B;  4A33 A;  3KHX A;  4PQA A;  4L89 A;  3FMC A;  2CTB A;  2RC4 A;  3KL9 A;  2C27 A;  4H6Z A;  2GAN A;  1U6M A;  2ZEE A;  2G3T A;  3F5B A;  4WWV A;  2R8V A;  4UIA A;  5GCN A;  1Q2D A;  3FJU A;  5LYF A;  5IB9 A;  4AXV A;  4W9Y A;  2Z10 A;  2V77 A;  4QUS A;  1Z5R A;  4NFR A;  3F8K A;  4B5P A;  4ZI6 A;  2EWB A;  3GYA A;  4AB7 A;  1CBX A;  5K8P A;  3N5F A;  4OIW A;  4FD6 A;  3LD2 A;  5J8C A;  3T9Y A;  4ORF A;  1V0C A;  3SJF A;  4DJL A;  1FT7 A;  3IWW A;  1H8L A;  3DR8 A;  1LAM A;  2ABZ A;  1CG2 A;  5D8N A;  4P4J A;  3WC7 A;  2AFZ A;  4RS2 A;  2GU2 A;  3LOD A;  4FAI A;  4RN7 A;  4CYQ A;  4CYO A;  1Z4R A;  2JBJ A;  2VZZ A;  4U5Y A;  1Y9W A;  3CXS A;  2VI7 A;  1HDQ A;  4KSI A;  4UIB A;  2Z3L A;  4YU9 A;  3T90 A;  4Q7A A;  1YQE A;  1KUV A;  1PUA A;  2CNT A;  4XPD B;  5LRK A;  2JLM A;  2I3C A;  2YNC C;  4JD6 A;  4ZGY B;  1VHE A;  3SJE A;  4M85 A;  4UWI A;  4NGS A;  5E96 A;  1ZG7 A;  5HMN A;  1KZF A;  4NGP A;  2Y0M A;  4CYP A;  3N7Z A;  4P4B A;  1L0C A;  3B3C A;  1Q2Y A;  2ZW7 A;  1JWQ A;  5JGF A;  3DGV A;  3TCV A;  5A28 A;  2BCO A;  2AFX A;  2QVP A;  1DE4 C;  4LQ6 A;  3SI2 A;  3FBU A;  2V8V A;  2Q7B A;  4OC4 A;  3WC5 A;  5JM6 A;  4YWY A;  3T8W A;  2FXF A;  4P4I A;  4NJQ A;  2DEA A;  2HV2 A;  4KUA A;  1EE3 P;  5EC4 A;  4A37 A;  2Z11 A;  1I12 A;  4AVC A;  4B12 A;  2ZEH A;  1K4J A;  1IYL A;  3MN8 A;  5F46 A;  4HKF A;  1NE9 A;  4H6U A;  3CPA A;  2Q4Y A;  4MFP A;  3W91 A;  3B3T A;  5EBV A;  5KTD A;  4FBE A;  3D2M A;  4MFJ A;  3PP9 A;  4MJ8 A;  3IFE A;  3NE7 A;  4R6T A;  3FNC A;  4HNY B;  4B5O A;  2I79 A;  2Q44 A;  5G20 A;  4EFD A;  3EO4 A;  2IQ6 A;  4CAF A;  4AVB A;  1ZG8 A;  3A9L A;  1PCA A;  4EVY A;  5EMI A;  2V8H A;  1Y9K A;  6CPA A;  4E2A A;  3V7Z A;  2JEW A;  2OOT A;  5K8N A;  1TKH A;  2O53 A;  2ZW5 A;  3PB4 X;  4CYN A;  4UCN A;  2QYV A;  5CNP A;  4CRZ B;  3PB9 X;  5F09 A;  3GKR A;  4ZY0 A;  3K9T A;  5AG4 A;  1M4D A;  1ELM P;  3MGD A;  4KOS A;  4KOU A;  3GB0 A;  4ZX8 A;  1ARL A;  2ARH A;  2CNS A;  2WSA A;  4TNU A;  3KZW A;  1YX0 A;  3SXO A;  4C2Y A;  3SHP A;  2HC9 A;  3EC4 A;  5H86 A;  3W6S A;  3CZX A;  4DYO A;  2AE6 A;  4P10 A;  1YW6 A;  2K5T A;  4TWE A;  3NFZ A;  2ZXV A;  3B8G A;  4QBJ A;  5J1Q A;  2BSW A;  4MMO A;  1IOI A;  1JQG A;  1BAV A;  2Q43 A;  3RNZ A;  4B5P B;  5CBM A;  2YND A;  2VL1 A;  3V38 A;  1IOF A;  1NSA A;  1X10 A;  2DPS A;  4NEX A;  5DWN A;  4BBH A;  4MFZ A;  3H8G A;  4YFJ A;  1S5K A;  2PJ5 A;  3KAS A;  3TFY A;  2PSW A;  5KTA A;  1LAN A;  1XE4 A;  1XJO A;  2CXA A;  4X2T A;  2YGW A;  1ON0 A;  2P6E A;  4MBU A;  4C68 A;  1M44 A;  4LQG A;  4NGR A;  4DUK A;  3R95 A;  1OZP A;  3DNS A;  3IU1 A;  4R57 A;  5H84 A;  1ZG9 A;  3NH4 A;  4XNH C;  1YLE A;  4QVT A;  4PXC A;  4MHN A;  1FNO A;  4PXD A;  2Q0Y A;  2PIY A;  3FYN A;  3NH8 A;  4P44 A;  4XPK A;  3TT2 A;  4M3S A;  3IC1 A;  3S9M A;  3I3G A;  3S6H A;  4E8O A;  4FD5 A;  2FT0 A;  3SJG A;  1Z8X A;  2R98 A;  2X7B A;  1YVO A;  2G0B A;  3TOA A;  3IGR A;  3GLJ A;  4BMH A;  4KLW A;  2PIZ A;  1MJA A;  2Z3O A;  4FWU A;  3I9S A;  3SJX A;  4YGO A;  2CF4 A;  4ZX9 A;  3PB7 X;  3IO1 A;  2BUE A;  3D66 A;  4MHP A;  1B87 A;  4NF1 A;  1F57 A;  4F9U A;  5I0C A;  2G3A A;  3L2N A;  3SI1 A;  4MHY A;  4FD4 A;  3ZZI A;  1Z8L A;  4BD9 A;  2PJA A;  2PR1 A;  3D67 A;  3TTH A;  4CAX A;  4OC2 A;  4R3K A;  1TKF A;  3BI1 A;  1M1D A;  1CP6 A;  2NMT A;  4KUB A;  4Q38 A;  2YNC A;  2Q04 A;  4K3N A;  2AFU A;  2POK A;  4OLL A;  2F8H A;  3S6K A;  2CNM A;  2NSM A;  4IAV A;  1RTQ A;  1P4N A;  2IMO A;  3KGQ A;  3SI0 A;  3BHX A;  2VXK A;  2AFS A;  1ZLH A;  3FF3 A;  3CXP A;  3EY5 A;  2ZEL A;  4F9V A;  4XPL A;  1TIQ A;  1CP7 A;  5FVJ A;  3B2Y A;  2OZU A;  2J8N A;  5IB0 A;  4O23 A;  4A32 A;  4XNH B;  2BEI A;  5AG5 A;  2VZY A;  3PRT A;  4F6A A;  1S7N A;  3TO9 A;  1WK4 A;  2QJ8 A;  2PJ3 A;  3BJ7 A;  3D7H A;  1S7L A;  2CY2 A;  1VGY A;  1YME A;  2OH1 A;  1PU9 A;  4UEE A;  3CT9 A;  3HLP A;  3IWG A;  4Y49 C;  2DPT A;  1YLO A;  4RUH A;  1KWM A;  4JLY A;  4NGM A;  1AYE A;  2RB7 A;  4UFX A;  1VHO A;  2C1C A;  2OR4 A;  2FL4 A;  2C6P A;  4P4E A;  2WUU A;  2J8R A;  4ZYQ A;  4A94 A;  3BI0 A;  4KOT A;  2GRE A;  2AFW A;  4PPZ A;  4B11 A;  2JBK A;  2PJ0 A;  4X5K A;  2B5G A;  2JEV A;  2Q7S A;  3K2K A;  2PJ1 A;  1CX8 A;  3EXN A;  2DXQ A;  3RYO A;  3CXQ A;  1I1D A;  2VQY A;  5F48 A;  4YRH A;  2EK9 A;  4M6I A;  3KHZ A;  2RFH A;  1A2Z A;  2HB6 A;  1BOB A;  2XEG A;  1XF8 A;  3PGP A;  5THW A;  2GE3 A;  4OID A;  5G22 A;  3EFA A;  3F0A A;  4RI1 A;  8CPA A;  3S9L A;  4CGN A;  1OBR A;  5LRG A;  4CRY B;  4CGO A;  4BIN A;  4R9M A;  3ZJ0 A;  4NJR A;  3DR6 A;  2PJC A;  2GFQ A;  4PSX A;  5HXD A;  4GS4 A;  5K8M A;  1M4I A;  2PJ8 A;  2XEI A;  3FEE A;  4G1P A;  4CPA A;  4MCS A;  1YW4 A;  2D4O A;  1XFO A;  2REE A;  2WYR A;  4M6H A;  3B7I A;  4UEZ A;  2ZW4 A;  3R1K A;  4IF5 A;  1CM0 A;  1R43 A;  2NYQ A;  4MHD A;  3E0K A;  2OU2 A;  3QNV A;  3VWD A;  5JQ4 A;  4CGL A;  4ONW A;  4QC6 A;  1Z9U A;  5HVF A;  1MJ9 A;  4OP4 A;  3FIX A;  1R57 A;  4I49 A;  4JXQ A;  1IIC A;  2C6G A;  4ONU A;  3BJ8 A;  4U9Z A;  3TOB A;  2ZEM A;  1QMU A;  2P6F A;  4MFL A;  2J9A A;  3LMS A;  4CAE A;  2XEJ A;  1UWY A;  4Y49 B;  4MCQ A;  3TX8 A;  3GY9 A;  4LUA A;  4U9Y A;  4Z65 A;  2O28 A;  3R96 A;  2Z0Z A;  3BXM A;  2EK8 A;  2EVN A;  4AVA A;  5IV0 A;  4II9 A;  5LRJ A;  3IU2 A;  4P4F A;  4JJX A;  1ELL P;  1F2O A;  1MJB A;  4MCP A;  4A31 A; 
#chains in the Genus database with same CATH homology
 4L8A A;  1S7K A;  5ISV A;  4JXR A;  1YVK A;  4J3G A;  4DNC A;  4Q36 A;  1Z4E A;  2VBQ A;  3R9E A;  4IUS A;  4KOW A;  4CAV A;  3S6G A;  4AG7 A;  3P2F A;  3G3S A;  4MFK A;  4KOV A;  2B4D B;  1Y7R A;  3D2P A;  4LX9 A;  2ATR A;  4NSQ A;  3SXN A;  4AG9 A;  2PR8 A;  3OWC A;  1QSO A;  4KVO E;  3R9G A;  4F0X A;  2A4N A;  4F0Y A;  2Z3P A;  4KOX A;  4PK2 A;  1YGH A;  3TO6 A;  1XMT A;  3S6F A;  1GHE A;  1QSN A;  1NSL A;  2B5G B;  1WWZ A;  1QSR A;  4R87 A;  5DWM A;  1Q2C A;  4CAW A;  2R1I A;  4ZBG A;  3R9F A;  4A2Z A;  2HQY A;  4UCP A;  3G8W A;  2Z3N A;  3H4Q A;  2OB0 A;  1P0H A;  4UBR A;  3FRM A;  3QAH A;  1MK4 A;  3BLN A;  2FIA A;  3JTK A;  4MY3 A;  1ZO0 A;  3JVN A;  4PK3 A;  1VKC A;  2WPX A;  1IYK A;  2FS5 A;  5HH1 A;  4OAD A;  4UWJ A;  3P2H A;  1IID A;  4MI4 A;  2OZH A;  4B14 A;  5BWA B;  2B4D A;  2B58 A;  2QML A;  1S60 A;  4HNW B;  5F47 A;  1VHS A;  4E0A A;  1FY7 A;  3H5Z A;  2FIW A;  4FD7 A;  4B10 A;  1J4J A;  4KOY A;  3IWE A;  1S7F A;  4A30 A;  2Z3K A;  2J8M A;  1NMT A;  2EUI A;  4KSA A;  4UFV A;  5JPH A;  3KKW A;  5J8F A;  5IX3 A;  5KTC A;  4MFQ A;  4KVM E;  2JDC A;  4CS0 B;  3DDD A;  2B4B A;  4KVX A;  5AG7 A;  4C7H A;  2PC1 A;  4KZT A;  3VWE A;  1YR0 A;  2HUZ A;  2Q4V A;  3QB8 A;  4C2Z A;  2IL4 A;  2PDO A;  2FCK A;  2R7H A;  4C7I A;  2F5I A;  2Z3M A;  1N71 A;  1YK3 A;  1RXT A;  1RO5 A;  5C88 A;  4B13 A;  2BL1 A;  1IB1 E;  2JDD A;  4HNX B;  3DSB A;  3FXT A;  1KUX A;  3K9U A;  4C2X A;  1UFH A;  2QIR A;  4KOR A;  2REF A;  2GIV A;  4A95 A;  2YNE A;  2PRB A;  1S3Z A;  4KSF A;  4UA3 A;  1LRZ A;  3PZJ A;  1QST A;  3UY5 A;  2FE7 A;  2B3V A;  2OZG A;  4R3L A;  3WR7 A;  1XIX A;  3TO7 A;  4PV6 A;  1I21 A;  3JUW A;  4MY0 A;  4KLV A;  4K30 A;  4PSW A;  3FB3 A;  5A27 A;  2ZPA A;  4NCZ A;  3D3S A;  4UCM A;  2KCW A;  3W6X A;  4CGP A;  2VEZ A;  4QB9 A;  2I00 A;  4OAE A;  5G21 A;  5AGE A;  1B6B A;  1BO4 A;  4CGM A;  5AG6 A;  2B3U A;  1SQH A;  2AJ6 A;  4H89 A;  4UFW A;  5G1Z A;  2WPW A;  2FSR A;  2ZW6 A;  3D8P A;  5F49 A;  3TE4 A;  1KUY A;  1M4G A;  4XPD C;  1XEB A;  1YRE A;  5C82 A;  2H5M A;  2P0W A;  4JWP A;  2P6G A;  3V8I A;  2PQ8 A;  3C26 A;  1CJW A;  2QEC A;  4KS9 A;  4NXY A;  1QSM A;  2D4P A;  4A33 A;  4L89 A;  2RC4 A;  2C27 A;  4H6Z A;  2GAN A;  1U6M A;  2G3T A;  3F5B A;  2R8V A;  5GCN A;  1Q2D A;  2Z10 A;  4QUS A;  4B5P A;  3F8K A;  3GYA A;  4AB7 A;  4FD6 A;  3LD2 A;  5J8C A;  3T9Y A;  4ORF A;  1V0C A;  3DR8 A;  4RS2 A;  3LOD A;  4CYQ A;  4CYO A;  1Z4R A;  2VZZ A;  4U5Y A;  1Y9W A;  3CXS A;  2VI7 A;  3T90 A;  2Z3L A;  1KUV A;  1PUA A;  2CNT A;  4XPD B;  2JLM A;  2YNC C;  4JD6 A;  4ZGY B;  4M85 A;  4UWI A;  5E96 A;  5HMN A;  1KZF A;  2Y0M A;  4CYP A;  3N7Z A;  1L0C A;  1Q2Y A;  2ZW7 A;  3TCV A;  5A28 A;  3FBU A;  2Q7B A;  2FXF A;  2HV2 A;  4KUA A;  5EC4 A;  2Z11 A;  1I12 A;  4AVC A;  4B12 A;  1K4J A;  1IYL A;  5F46 A;  4HKF A;  1NE9 A;  4H6U A;  2Q4Y A;  4MFP A;  3W91 A;  5EBV A;  5KTD A;  3D2M A;  4MFJ A;  3PP9 A;  4MJ8 A;  3NE7 A;  3FNC A;  4HNY B;  4B5O A;  2I79 A;  2Q44 A;  5G20 A;  3EO4 A;  4CAF A;  4AVB A;  3A9L A;  4EVY A;  1Y9K A;  4E2A A;  2ZW5 A;  4CYN A;  4UCN A;  4CRZ B;  5CNP A;  3GKR A;  5AG4 A;  1M4D A;  3MGD A;  4KOU A;  2WSA A;  2ARH A;  2CNS A;  3SXO A;  1YX0 A;  4C2Y A;  3SHP A;  3EC4 A;  5H86 A;  3W6S A;  2AE6 A;  2K5T A;  2ZXV A;  3B8G A;  4QBJ A;  2BSW A;  4B5P B;  2YND A;  2DPS A;  4BBH A;  5DWN A;  4NEX A;  4MFZ A;  4YFJ A;  1S5K A;  3TFY A;  2PSW A;  5KTA A;  1XE4 A;  2CXA A;  2YGW A;  1ON0 A;  2P6E A;  4MBU A;  4C68 A;  1M44 A;  3R95 A;  1OZP A;  3DNS A;  3IU1 A;  4R57 A;  5H84 A;  4XNH C;  1YLE A;  4QVT A;  2Q0Y A;  3FYN A;  4XPK A;  3TT2 A;  4M3S A;  3I3G A;  3S6H A;  4E8O A;  4FD5 A;  2FT0 A;  3TOA A;  2R98 A;  2X7B A;  1YVO A;  2G0B A;  3IGR A;  4BMH A;  4KLW A;  1MJA A;  2Z3O A;  3I9S A;  4YGO A;  2BUE A;  1B87 A;  4NF1 A;  5I0C A;  2G3A A;  4FD4 A;  3ZZI A;  2PR1 A;  3TTH A;  4CAX A;  4R3K A;  1M1D A;  4KUB A;  2NMT A;  4Q38 A;  2YNC A;  2Q04 A;  4OLL A;  3S6K A;  2CNM A;  1P4N A;  2VXK A;  3CXP A;  3EY5 A;  4XPL A;  1TIQ A;  2OZU A;  2J8N A;  5IB0 A;  4A32 A;  4XNH B;  2BEI A;  5AG5 A;  2VZY A;  4F6A A;  1S7N A;  3TO9 A;  1WK4 A;  3BJ7 A;  1S7L A;  2CY2 A;  2OH1 A;  1PU9 A;  3IWG A;  4Y49 C;  2DPT A;  4JLY A;  4UFX A;  2FL4 A;  2WUU A;  2J8R A;  4KOT A;  4B11 A;  4X5K A;  2B5G A;  2JEV A;  3EXN A;  2DXQ A;  3RYO A;  3CXQ A;  1I1D A;  2VQY A;  5F48 A;  4YRH A;  1BOB A;  3PGP A;  1XF8 A;  2GE3 A;  5G22 A;  3EFA A;  3F0A A;  4RI1 A;  4CGN A;  4CRY B;  4CGO A;  4R9M A;  3ZJ0 A;  3DR6 A;  4PSX A;  4GS4 A;  1M4I A;  2D4O A;  2REE A;  5FVJ A;  2ZW4 A;  3R1K A;  4IF5 A;  1CM0 A;  4MHD A;  3E0K A;  2OU2 A;  3VWD A;  5JQ4 A;  4CGL A;  4QC6 A;  1Z9U A;  1MJ9 A;  3FIX A;  1R57 A;  4I49 A;  4JXQ A;  1IIC A;  4ONU A;  3BJ8 A;  4U9Z A;  3TOB A;  2P6F A;  4MFL A;  4CAE A;  4Y49 B;  3GY9 A;  4LUA A;  4U9Y A;  2O28 A;  3R96 A;  2Z0Z A;  2EVN A;  4AVA A;  5IV0 A;  4II9 A;  3IU2 A;  4JJX A;  4KOS A;  1MJB A;  4A31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...