1QSNA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and histone h3 peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tetrahymena GCN5 bound to coenzyme A and a histone H3 peptide.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
molecule keywords TGCN5 HISTONE ACETYL TRANSFERASE
total genus 43
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsnA00
1Z4EA 3LODA 1WK4A 4NXYA 4IUSA 4XNHB 2OU2A 4KOXA 5IX3A 2JDDA 3F8KA 1VKCA 4MY0A 3EFAA 2FL4A 2P6FA 1NE9A 1ON0A 4JWPA 1YR0A 3H4QA 1S7FA 5HH1A 2K5TA 3C26A 4RI1A 2FSRA 4PSXA 4KZTA 1IIDA 1XF8A 3DR6A 4ORFA 3PGPA 1YVKA 4Y49B 5C88A 3P2HA 3TO9A 1B87A 3WR7A 3S6FA 2GE3A 5GCNA 1M44A 5H84A 5HMNA 4H6ZA 2B4BA 3KKWA 2EVNA 2PSWA 4U5YA 3SXOA 3BJ8A 2QIRA 5J8CA 2C27A 4CAWA 2CNSA 2VZYA 4R9MA 1QSRA 2Q0YA 4XPKA 2CY2A 1I12A 3DR8A 3B8GA 1XMTA 4ONUA 2REEA 3I3GA 1IICA 2BSWA 4KLVA 4AB7A 2J8NA 1QSOA 1M1DA 1BOBA 3EO4A 3W6XA 4HKFA 1YK3A 4JLYA 4H6UA 2VEZA 1KUVA 3TOBA 1NMTA 4CS0B 1XEBA 4F0YA 2PRBA 1FY7A 1Z9UA 1IB1E 3G3SA 3P2FA 1SQHA 2HV2A 3ZZIA 4IF5A 2B3UA 4MI4A 4QBJA 2F5IA 3TTHA 4LX9A 5JQ4A 4NSQA 3EC4A 1NSLA 3TOAA 4KUBA 4HNXB 2PR1A 3FNCA 5EC4A 3TCVA 2J8MA 4MBUA 2I00A 3TO7A 2PR8A 4H89A 5ISVA 2G0BA 1YX0A 3FRMA 3QB8A 4PV6A 4FD4A 1OZPA 2EUIA 4B5PB 4U9ZA 3SHPA 3D2PA 2BL1A 1MJAA 4K30A 4B5OA 1KUXA 1M4DA 4R57A 1L0CA 4M3SA 2OZHA 4KOUA 1TIQA 2D4OA 1XIXA 3FIXA 4B5PA 2WPWA 2R98A 4PK2A 4JXRA 1UFHA 2OH1A 2Q4YA 2REFA 2Z11A 3R9FA 1M4GA 1KUYA 3N7ZA 2IL4A 3QAHA 2VZZA 4I49A 2P6GA 3IGRA 2ATRA 2FT0A 3PZJA 2D4PA 3FB3A 4CRZB 4NCZA 2KCWA 3W91A 2BEIA 1KZFA 3CXSA 3D3SA 1WWZA 3T90A 2AJ6A 3DNSA 3CXQA 4UBRA 4KOYA 5KTCA 4NEXA 3GYAA 1S7KA 2B4DA 5F49A 3TO6A 4KOWA 3G8WA 2VXKA 4J3GA 4HNYB 5DWMA 5IV0A 2PQ8A 2P6EA 3UY5A 1LRZA 3W6SA 4PSWA 4JD6A 1YLEA 3BLNA 2G3TA 1Y7RA 2QECA 4PK3A 1S3ZA 1U6MA 4R87A 4XNHC 1M4IA 3NE7A 3DDDA 1S60A 2WPXA 5I0CA 5CNPA 2ZW4A 4QVTA 4KLWA 3FYNA 4OLLA 3ZJ0A 3FXTA 2Q44A 2Z10A 2B5GA 3EXNA 4YRHA 2FXFA 2Q4VA 4MHDA 3TE4A 2R1IA 4BMHA 2Z0ZA 4QUSA 4UWIA 4AG7A 4MY3A 1QSNA 2NMTA 3R9EA 4XPDB 5H86A 3F5BA 4KUAA 2JLMA 4CAXA 3PP9A 2H5MA 4E0AA 2A4NA 4X5KA 2FIAA 2ZPAA 5EBVA 3TFYA 1IYLA 5F48A 1MK4A 1BO4A 4RS2A 3RYOA 4KOVA 4L8AA 4YFJA 1Y9KA 2Q7BA 4CRYB 4HNWB 1P4NA 2ZW5A 3TT2A 2CNTA 4AVAA 1IYKA 1MJBA 1Q2DA 5J8FA 4NF1A 5KTAA 2RC4A 2I79A 4FD5A 4MJ8A 5C82A 4KVOE 2Q04A 4KVXA 4YGOA 4ZBGA 2FE7A 2B5GB 4R3KA 5F46A 4XPLA 2HQYA 3R9GA 5KTDA 3I9SA 2AE6A 2X7BA 4XPDC 4AVCA 1YREA 2VBQA 3S6HA 2DXQA 2QMLA 5JPHA 3FBUA 1GHEA 5DWNA 2PDOA 1QSMA 4QB9A 2P0WA 2JDCA 2PC1A 4E2AA 4FD6A 4F6AA 2R7HA 3MGDA 1QSTA 4UWJA 3DSBA 3D8PA 5E96A 1I21A 2BUEA 1S7NA 2VQYA 1K4JA 3BJ7A 1PU9A 1XE4A 1YGHA 3SXNA 2OB0A 2J8RA 1CM0A 3D2MA 3K9UA 2OZUA 3JVNA 1S5KA 1R57A 2FS5A 4JJXA 3T9YA 3S6KA 2FIWA 4R3LA 1RXTA 3EY5A 4KOTA 3LD2A 4JXQA 1VHSA 1Q2YA 4FD7A 4EVYA 1S7LA 2B3VA 2G3AA 1V0CA 2ZXVA 1P0HA 1B6BA 3R96A 4KVME 2Y0MA 3GKRA 3R95A 1Z4RA 4U9YA 2FCKA 2HUZA 4UA3A 4E8OA 2B4DB 1Y9WA 4LUAA 4DNCA 2GIVA 3CXPA 2O28A 1Q2CA 5FVJA 3R1KA 2B58A 2R8VA 3V8IA 4II9A 3VWEA 2CNMA 4Y49C 3IWGA 4M85A 4AVBA 4KOSA 2VI7A 3F0AA 3VWDA 1I1DA 1N71A 4L89A 5F47A 1J4JA 5IB0A 3JUWA 2JEVA 4KORA 1PUAA 4OADA 4QC6A 4AG9A 2OZGA 2GANA 4GS4A 1MJ9A 1RO5A 3S6GA 3E0KA 3OWCA 2ZW6A 2ZW7A 1YVOA 2ARHA 3GY9A 1CJWA 4OAEA 4CAVA
chains in the Genus database with same CATH superfamily
1Z4EA 5D29A 1AMPA 4H2KA 3LMSA 3LODA 4YU9A 4EFDA 1R3NA 4A33A 1WK4A 3KR5A 2YNDA 4NXYA 4IUSA 4XNHB 4CYQA 1IU8A 2I3CA 2OU2A 3H8EA 1CPSA 2ZOFA 4KOXA 3GIUA 5IX3A 4FBEA 2JDDA 3SJXA 3F8KA 5LYFA 1VKCA 2V8VA 4DUKA 1LFWA 4MY0A 3EFAA 2ZELA 1ZLIA 2FL4A 2P6FA 5J1QA 1NE9A 2EWBA 3CPXA 2O53A 1ON0A 4JWPA 4P4DA 4UEZA 1YR0A 3H4QA 1S7FA 3PFOA 5AG7A 1BPMA 1YSJA 5HH1A 4P44A 2K5TA 3C26A 4MXUA 2FSRA 1X12A 4KZTA 2DPSA 1IIDA 4PSXA 3N5FA 2ZEFA 4RI1A 4A39A 5AG6A 2G9DA 1XF8A 3DR6A 4ORFA 3PGPA 3D7GA 4Z65A 3RZAA 1YVKA 2YNEA 4Y49B 5C88A 3P2HA 1CX8A 4C2YA 3TO9A 4RN7A 3ISXA 4NJQA 4UCMA 1B87A 2WYRA 2YNCA 4JZ0A 5CPAA 3WR7A 5F09A 3NE8A 3S6FA 2GE3A 1OBRA 4M6HA 5GCNA 4DYOA 1M44A 4GXHA 4PXBA 5H84A 2XEIA 4OC2A 4H6ZA 3VATA 2B4BA 3KKWA 5HMNA 4OC4A 1XMBA 1Z2LA 2EVNA 2PSWA 4U5YA 5JGFA 2PJ9A 3SXOA 2Q51A 3BJ8A 3IWWA 2QIRA 4Q38A 5J8CA 4A31A 2C27A 4CAWA 2CNSA 2VZYA 4R9MA 1QSRA 2PJ8A 3H8GA 4P10A 2Q0YA 4XPKA 2CY2A 1I12A 3DR8A 3B8GA 4G1PA 5G20A 3SI2A 1XMTA 4ONUA 2REEA 3I3GA 1IICA 2BSWA 4KLVA 1HDUA 4AB7A 2J8NA 2C1CA 1QSOA 3NH5A 5K8MA 1TF9A 1M1DA 3KQXA 2BCOA 5DS0A 2PJ3A 1Z8WA 4R6TA 4OC0A 1TKHA 2Z3PA 3D67A 3TX8A 2EO8A 1BOBA 4NGRA 4OIWA 3EO4A 3W6XA 2GLJA 4HKFA 3CZXA 1YK3A 4JLYA 4H6UA 2PJ6A 2VEZA 1KUVA 3RNZA 1NMTA 3JTKA 3TOBA 4NGSA 4CS0B 2PJ5A 1XEBA 3RBUA 4F0YA 3PBEA 3FEEA 1LOKA 2PRBA 4MCSA 2ZEGA 1FY7A 1Z9UA 1IB1E 3G3SA 3P2FA 2AFXA 4A95A 4C2XA 2J9AA 5IB9A 1SQHA 4AG9A 3IIBA 2HV2A 1LANA 3QNVA 4IF5A 3ZZIA 2B3UA 4MI4A 4AXVA 2F5IA 1VHEA 4QBJA 3TTHA 4LX9A 5JQ4A 2CF4A 2V8GA 2V8HA 4NSQA 3EC4A 1ZO0A 1NSLA 3TOAA 2AFZA 4KUBA 3KL9A 4HNXB 3K9TA 2PR1A 3FNCA 5EC4A 3TCVA 4UIAA 4MRIA 4NGQA 4R8FA 5BWAB 4CYNA 2J8MA 4MBUA 2I00A 3TO7A 6CPAA 3D66A 2PR8A 4H89A 3FJUA 5ISVA 2G0BA 4FWUA 2ZENA 1YX0A 3FRMA 3QB8A 3HLPA 4PV6A 2EK8A 4OIDA 1Z8LA 4FD4A 1OZPA 2EUIA 4RUHA 4B5PB 2EK9A 4U9ZA 4DJLA 7CPAA 4X8IA 4B11A 3DLJA 4A38A 4PXCA 3SHPA 1XBUA 3D2PA 4MCPA 3NH4A 2BL1A 1MJAA 4K30A 3WT4A 4B5OA 1KUXA 1M4DA 3H8FA 4R57A 1L0CA 3KHZA 2OZHA 4M3SA 4KOUA 1TIQA 2AFSA 2D4OA 1XIXA 3FIXA 4B5PA 4ZY1A 3HUVA 3SJGA 4ZYQA 4TNUA 4P6YA 2WPWA 3BI0A 2R98A 1Z8TA 3VARA 4PK2A 5K8NA 4UCPA 4JXRA 3PB4X 4UCNA 3B3WA 1F57A 2OOTA 2QYVA 1UFHA 2Z3LA 2ZEOA 2QVPA 3IO1A 1IY7A 1Y0RA 2OH1A 2Q4YA 2RB7A 4YWYA 2REFA 2Z11A 4Q36A 3R9FA 1M4GA 1KUYA 3DGVA 3IC1A 4F8ZA 4P4EA 1XOVA 3N7ZA 4MHZA 2IL4A 4CYPA 4IK2A 4EMEA 2DPTA 1F2OA 2VZZA 3QAHA 2CIJA 2XEGA 3SI1A 1CG2A 4C7IA 4P4BA 4I49A 4CAFA 2P6GA 4BD9A 2PIZA 3IGRA 2PJ7A 4F9UA 2ATRA 5I4MA 2FT0A 3PBBA 2D4PA 3PZJA 3FB3A 3IU1A 4NCZA 2KCWA 1YW6A 4CRZB 2CTBA 3SJFA 1UWYA 2Q4ZA 3W91A 2BEIA 4PXDA 1EE3P 3FMCA 1R43A 4NFRA 2OR4A 3SI0A 1KZFA 3BXMA 3CXSA 3I1UA 1IGBA 1Y0YA 2PJBA 3B7IA 3D3SA 3D7HA 5JH9A 1WWZA 3T90A 2AJ6A 2Z3OA 4P45A 4CAEA 2Z3KA 3CDXA 3DNSA 3CXQA 4UBRA 4KOYA 5KTCA 3WC7A 5LRJA 2GU2A 1XFOA 3PB9X 4C2ZA 3GYAA 1S7KA 4NEXA 2B4DA 2PJ0A 3D7FA 4PQAA 5F49A 3LWUA 3TO6A 4MFLA 2PJAA 2AFMA 4KOWA 3T8WA 3G8WA 3KR4A 2ABZA 2POKA 1AYEA 2VXKA 5LYIA 1DTDA 3WC5A 2ANPA 4J3GA 4CGNA 2JBJA 3RO0A 1CP7A 3FH4A 4UIBA 2PVVA 4HNYB 5DWMA 4MFQA 4BINA 3S9LA 1JQGA 4MCRA 5IV0A 2PQ8A 1CP6A 2P6EA 4OC1A 3UY5A 1LRZA 3W6SA 2CXAA 4PSWA 1Y7EA 4JD6A 1YLEA 2CTCA 3BLNA 1CPXA 2G3TA 1Y7RA 2QECA 2WSAA 1BPNA 2WUUA 2ZEEA 3K2KA 3PB7X 4PK3A 1S3ZA 4M6GA 1YQEA 4R7MA 1U6MA 4R87A 4XNHC 3JRUA 2WZNA 4W9YA 4UEEA 4K3NA 1TKFA 3B3VA 1M4IA 2IQ6A 3NE7A 1HEEA 3DDDA 4ZY2A 4ZGYB 1S60A 1AUGA 2WPXA 5CNPA 5I0CA 4MFZA 3ISZA 1JWQA 2ZW4A 4QVTA 4KLWA 2Q43A 1F2PA 3FYNA 5D8NA 1ZG8A 4OLLA 3ZJ0A 3FXTA 1X10A 2YGWA 2Q44A 2Z10A 2PVWA 3PB6X 4CGLA 3KI9A 2B5GA 3GUXA 3EXNA 4YRHA 4MFJA 1YLOA 2FXFA 2Q4VA 3WC6A 3MN8A 4MHDA 3TE4A 4KSAA 2R1IA 4BMHA 1LAMA 2Z0ZA 4QUSA 1ARLA 4EWTA 4UWIA 2Z3NA 2GREA 3S9MA 4A94A 4AG7A 3B3TA 4KSFA 4MY3A 2HC9A 1QSNA 2NMTA 2VL1A 3B2YA 5G1ZA 3R9EA 2PJCA 4XPDB 5H86A 1QMUA 3WABA 4NGNA 3F5BA 4KUAA 4MHNA 2JLMA 4NGTA 5LYLA 4CAXA 5HVGA 2DF5A 3PFEA 3PP9A 2H5MA 4OP4A 1CBXA 3B3CA 2A4NA 4E0AA 4X5KA 2FIAA 4MCQA 2ZPAA 5EBVA 3TFYA 2C6CA 4LQGA 1Z5RA 1IYLA 2JBKA 3LACA 1XJOA 4WWVA 5F48A 1MK4A 1BO4A 4RS2A 3RYOA 2DEAA 4A32A 4KOVA 4F9VA 4L8AA 5HVFA 4YFJA 1Y9KA 3FVLA 2PCUA 2Q7BA 4C68A 2JEWA 2PIYA 4CRYB 4HNWB 3CT9A 3FEDA 1P4NA 2ZW5A 2AFWA 2BOAA 3IJ3A 4MHPA 2CNTA 4PXEA 4KS9A 3TT2A 4GM5A 4TWEA 4AVAA 1ARMA 1IYKA 1ZG9A 1MJBA 3A9LA 3B3SA 1Q2DA 5J8FA 4NF1A 4ZY0A 5KTAA 2RC4A 4OC5A 2I79A 4FD5A 4MJ8A 5C82A 4KVOE 2Q04A 4MHYA 4KVXA 2Q7SA 4YGOA 2C6PA 4UF4A 4ZBGA 4CGOA 5A28A 3KZWA 4ZX8A 1KWMA 2FE7A 1ZG7A 3IU2A 4B13A 4CPAA 2B5GB 4R3KA 5F46A 5ELYA 4XPLA 2HQYA 1XRYA 4HPSA 4FUUA 4CGPA 3R9GA 4IAVA 3PB8X 5KTDA 1TXRA 2GLFA 2F7VA 1ELMP 2HB6A 3I9SA 2AE6A 2X7BA 2ZEHA 1Z8XA 4P4IA 4OMEA 1YREA 4XPDC 5THWA 4AVCA 3SJEA 3GB0A 1H8LA 2VBQA 1GYTA 2DXQA 3S6HA 1HDQA 3VH9A 2QMLA 5JPHA 1PCAA 4JYWA 1VGYA 4FAIA 1IOFA 3FBUA 1GHEA 5DWNA 8CPAA 3IEHA 2PDOA 1QSMA 4QB9A 3L2NA 4M6IA 2P0WA 2JDCA 2PC1A 4E2AA 1TKJA 2EBJA 4FD6A 4O23A 4B12A 4F6AA 3KASA 2R7HA 3MGDA 1TF8A 2IJZA 5LRKA 4ONWA 2XEFA 1QSTA 2ZEPA 3IWEA 4UWJA 3DSBA 3V38A 4CYOA 5CBMA 1LAPA 2ODFA 4MFKA 3D8PA 5E96A 1I21A 2BUEA 2GFQA 1S7NA 2VQYA 1K4JA 4BBHA 3BJ7A 1BLLE 1PU9A 2PJ1A 1XE4A 3KHXA 1YGHA 3BHXA 3SXNA 1A2ZA 2OB0A 1YW4A 2BO9A 2J8RA 3D4UA 2Z3MA 1CM0A 5LYDA 2O4HA 3D2MA 3K9UA 4X3RA 2OZUA 3JVNA 3NFZA 1S5KA 4UFVA 4B14A 1R57A 2AFUA 3KQZA 4MMOA 2FS5A 4R76A 2FVGA 4JJXA 3T9YA 3S6KA 4B10A 2C6GA 3IFEA 4UFWA 5K8PA 3GLJA 5AG4A 2FIWA 4R3LA 1RXTA 2F8HA 3FECA 3EY5A 4KOTA 3LD2A 4JXQA 3NH8A 1VHSA 3BI1A 4UFXA 4F0XA 5A27A 1Q2YA 5AG5A 3RAMA 3MRUA 4FD7A 4EVYA 1S7LA 2B3VA 2G3AA 1V0CA 3CPAA 2ZXVA 2NSMA 1P0HA 1B6BA 4MFPA 5G21A 3R96A 4KVME 2Y0MA 3GKRA 4X2TA 3R95A 1Z4RA 1M4LA 4U9YA 3NA6A 3S9NA 1YMEA 2FCKA 2HUZA 4UA3A 4E8OA 1FNOA 4IHMA 4P4JA 2B4DB 1Y9WA 4LUAA 4DNCA 3D7DA 2RFHA 2GIVA 3CXPA 1NSAA 2O28A 1Q2CA 5FVJA 3R1KA 2B58A 1FT7A 2R8VA 5LRGA 4P4FA 3V8IA 4LQ6A 4II9A 2XEJA 3VWEA 2CNMA 2ZEDA 2PE3A 4Y49C 1QQ9A 4OKOA 2V8DA 3IWGA 4M85A 4Q7AA 4A30A 4AVBA 2PRQA 4KOSA 5HVHA 2VI7A 3F0AA 3VWDA 3V7ZA 4OC3A 2NYQA 1I1DA 1N71A 4L89A 5F47A 3B35A 4A37A 1J4JA 5K8OA 2QJ8A 3QAYA 5IB0A 3TC8A 5JM6A 4KSIA 4UEFA 3FX6A 4NGPA 3JUWA 2JEVA 3FF3A 4KORA 2PJ4A 1PUAA 1VIXA 2AFOA 2ZEMA 1IOIA 2IMOA 4NJRA 4OADA 1DE4C 4QC6A 2OZGA 1Q7LA 3KGQA 3PRTA 5AGEA 4C7HA 2GANA 4GS4A 4WJBA 1MJ9A 1PYTB 3D68A 1RO5A 3S6GA 4ZI6A 3E0KA 5HXDA 4NGMA 3OWCA 1VHOA 1ZLHA 3H5ZA 4PPZA 2ZW6A 2ZW7A 1LCPA 1RTQA 1YVOA 2ARHA 2YNCC 3GY9A 3PEIA 2PJ2A 1BAVA 1CJWA 4A2ZA 4OAEA 4CGMA 2V77A 5G22A 4ZX9A 4B6ZA 2ZOGA 1ELLP 5EMIA 4CAVA
chains in the Genus database with same CATH topology
1Z4EA 3LODA 4A33A 1WK4A 2YNDA 4NXYA 4IUSA 4XNHB 4CYQA 2OU2A 4KOXA 5IX3A 2JDDA 3F8KA 1VKCA 4MY0A 3EFAA 2FL4A 2P6FA 1NE9A 1ON0A 4JWPA 1YR0A 3H4QA 1S7FA 5AG7A 5HH1A 2K5TA 3C26A 4RI1A 2FSRA 4PSXA 4KZTA 2DPSA 1IIDA 5AG6A 1XF8A 3DR6A 4ORFA 3PGPA 1YVKA 2YNEA 4Y49B 5C88A 3P2HA 4C2YA 3TO9A 4UCMA 1B87A 2YNCA 3WR7A 3S6FA 2GE3A 5GCNA 1M44A 5H84A 5HMNA 4H6ZA 2B4BA 3KKWA 2EVNA 2PSWA 4U5YA 3SXOA 3BJ8A 2QIRA 4Q38A 5J8CA 4A31A 2C27A 4CAWA 2CNSA 2VZYA 4R9MA 1QSRA 2Q0YA 4XPKA 2CY2A 1I12A 3DR8A 3B8GA 5G20A 1XMTA 4ONUA 2REEA 3I3GA 1IICA 2BSWA 4KLVA 4AB7A 2J8NA 1QSOA 1M1DA 2Z3PA 1BOBA 3EO4A 3W6XA 4HKFA 1YK3A 4JLYA 4H6UA 2VEZA 1KUVA 3TOBA 1NMTA 3JTKA 4CS0B 1XEBA 4F0YA 2PRBA 1FY7A 1Z9UA 1IB1E 3G3SA 3P2FA 4A95A 4C2XA 1SQHA 2HV2A 3ZZIA 4IF5A 2B3UA 4MI4A 4QBJA 2F5IA 3TTHA 4LX9A 5JQ4A 4NSQA 3EC4A 1ZO0A 1NSLA 3TOAA 4KUBA 4HNXB 2PR1A 3FNCA 5EC4A 3TCVA 5BWAB 4CYNA 2J8MA 4MBUA 2I00A 3TO7A 2PR8A 4H89A 5ISVA 2G0BA 1YX0A 3FRMA 3QB8A 4PV6A 4FD4A 1OZPA 2EUIA 4B5PB 4U9ZA 4B11A 3SHPA 3D2PA 2BL1A 1MJAA 4K30A 4B5OA 1KUXA 1M4DA 4R57A 1L0CA 4M3SA 2OZHA 4KOUA 1TIQA 2D4OA 1XIXA 3FIXA 4B5PA 2WPWA 2R98A 4PK2A 4UCPA 4JXRA 4UCNA 1UFHA 2Z3LA 2OH1A 2Q4YA 2REFA 2Z11A 4Q36A 3R9FA 1M4GA 1KUYA 3N7ZA 2IL4A 4CYPA 2DPTA 3QAHA 2VZZA 4C7IA 4I49A 4CAFA 2P6GA 3IGRA 2ATRA 2FT0A 3PZJA 2D4PA 3FB3A 3IU1A 4NCZA 2KCWA 4CRZB 3W91A 2BEIA 1KZFA 3CXSA 3D3SA 1WWZA 3T90A 2AJ6A 2Z3OA 4CAEA 2Z3KA 3DNSA 3CXQA 4UBRA 4KOYA 5KTCA 4C2ZA 3GYAA 1S7KA 4NEXA 2B4DA 5F49A 3TO6A 4MFLA 4KOWA 3G8WA 2VXKA 4J3GA 4CGNA 4HNYB 5DWMA 4MFQA 5IV0A 2PQ8A 2P6EA 3UY5A 1LRZA 3W6SA 2CXAA 4PSWA 4JD6A 1YLEA 3BLNA 2G3TA 1Y7RA 2QECA 2WSAA 2WUUA 4PK3A 1S3ZA 1U6MA 4R87A 4XNHC 1M4IA 3NE7A 3DDDA 4ZGYB 1S60A 2WPXA 5I0CA 5CNPA 4MFZA 2ZW4A 4QVTA 4KLWA 3FYNA 4OLLA 3ZJ0A 3FXTA 2YGWA 2Q44A 2Z10A 4CGLA 2B5GA 3EXNA 4YRHA 4MFJA 2FXFA 2Q4VA 4MHDA 3TE4A 4KSAA 2R1IA 4BMHA 2Z0ZA 4QUSA 4UWIA 2Z3NA 4AG7A 4KSFA 4MY3A 1QSNA 2NMTA 3R9EA 5G1ZA 4XPDB 5H86A 3F5BA 4KUAA 2JLMA 4CAXA 3PP9A 2H5MA 4E0AA 2A4NA 4X5KA 2FIAA 2ZPAA 5EBVA 3TFYA 1IYLA 5F48A 1MK4A 1BO4A 4RS2A 3RYOA 4A32A 4KOVA 4L8AA 4YFJA 1Y9KA 2Q7BA 4C68A 4CRYB 4HNWB 1P4NA 2ZW5A 3TT2A 2CNTA 4AVAA 4KS9A 1IYKA 3A9LA 1MJBA 1Q2DA 5J8FA 4NF1A 5KTAA 2RC4A 2I79A 4FD5A 4MJ8A 5C82A 4KVOE 2Q04A 4KVXA 4YGOA 4ZBGA 5A28A 4CGOA 2FE7A 3IU2A 4B13A 2B5GB 4R3KA 5F46A 4XPLA 2HQYA 4CGPA 3R9GA 5KTDA 3I9SA 2AE6A 2X7BA 4XPDC 4AVCA 1YREA 2VBQA 3S6HA 2DXQA 2QMLA 5JPHA 3FBUA 1GHEA 5DWNA 2PDOA 1QSMA 4QB9A 2P0WA 2JDCA 2PC1A 4E2AA 4FD6A 4B12A 4F6AA 2R7HA 3MGDA 1QSTA 3IWEA 4UWJA 3DSBA 4CYOA 4MFKA 3D8PA 5E96A 1I21A 2BUEA 1S7NA 2VQYA 1K4JA 4BBHA 3BJ7A 1PU9A 1XE4A 1YGHA 3SXNA 2OB0A 2J8RA 2Z3MA 1CM0A 3D2MA 3K9UA 2OZUA 3JVNA 4UFVA 1S5KA 4B14A 1R57A 2FS5A 4JJXA 3T9YA 3S6KA 4B10A 4UFWA 5AG4A 2FIWA 4R3LA 1RXTA 3EY5A 4KOTA 3LD2A 4JXQA 4UFXA 1VHSA 4F0XA 5A27A 1Q2YA 5AG5A 4FD7A 4EVYA 1S7LA 2B3VA 2G3AA 1V0CA 2ZXVA 1P0HA 1B6BA 4MFPA 5G21A 3R96A 4KVME 2Y0MA 3GKRA 3R95A 1Z4RA 4U9YA 2FCKA 2HUZA 4UA3A 4E8OA 2B4DB 1Y9WA 4LUAA 4DNCA 2GIVA 3CXPA 2O28A 1Q2CA 5FVJA 3R1KA 2B58A 2R8VA 3V8IA 4II9A 3VWEA 2CNMA 4Y49C 3IWGA 4M85A 4A30A 4AVBA 4KOSA 2VI7A 3F0AA 3VWDA 1I1DA 1N71A 4L89A 5F47A 1J4JA 5IB0A 3JUWA 2JEVA 4KORA 1PUAA 4OADA 4QC6A 4AG9A 5AGEA 2OZGA 4C7HA 2GANA 4GS4A 1MJ9A 1RO5A 3S6GA 3E0KA 3OWCA 3H5ZA 2ZW6A 2ZW7A 1YVOA 2ARHA 2YNCC 3GY9A 1CJWA 4A2ZA 4OAEA 4CGMA 5G22A 4CAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4E A;  3LOD A;  1WK4 A;  4NXY A;  4IUS A;  4XNH B;  2OU2 A;  4KOX A;  5IX3 A;  2JDD A;  3F8K A;  1VKC A;  4MY0 A;  3EFA A;  2FL4 A;  2P6F A;  1NE9 A;  1ON0 A;  4JWP A;  1YR0 A;  3H4Q A;  1S7F A;  5HH1 A;  2K5T A;  3C26 A;  4RI1 A;  2FSR A;  4PSX A;  4KZT A;  1IID A;  1XF8 A;  3DR6 A;  4ORF A;  3PGP A;  1YVK A;  4Y49 B;  5C88 A;  3P2H A;  3TO9 A;  1B87 A;  3WR7 A;  3S6F A;  2GE3 A;  5GCN A;  1M44 A;  5H84 A;  5HMN A;  4H6Z A;  2B4B A;  3KKW A;  2EVN A;  2PSW A;  4U5Y A;  3SXO A;  3BJ8 A;  2QIR A;  5J8C A;  2C27 A;  4CAW A;  2CNS A;  2VZY A;  4R9M A;  1QSR A;  2Q0Y A;  4XPK A;  2CY2 A;  1I12 A;  3DR8 A;  3B8G A;  1XMT A;  4ONU A;  2REE A;  3I3G A;  1IIC A;  2BSW A;  4KLV A;  4AB7 A;  2J8N A;  1QSO A;  1M1D A;  1BOB A;  3EO4 A;  3W6X A;  4HKF A;  1YK3 A;  4JLY A;  4H6U A;  2VEZ A;  1KUV A;  3TOB A;  1NMT A;  4CS0 B;  1XEB A;  4F0Y A;  2PRB A;  1FY7 A;  1Z9U A;  1IB1 E;  3G3S A;  3P2F A;  1SQH A;  2HV2 A;  3ZZI A;  4IF5 A;  2B3U A;  4MI4 A;  4QBJ A;  2F5I A;  3TTH A;  4LX9 A;  5JQ4 A;  4NSQ A;  3EC4 A;  1NSL A;  3TOA A;  4KUB A;  4HNX B;  2PR1 A;  3FNC A;  5EC4 A;  3TCV A;  2J8M A;  4MBU A;  2I00 A;  3TO7 A;  2PR8 A;  4H89 A;  5ISV A;  2G0B A;  1YX0 A;  3FRM A;  3QB8 A;  4PV6 A;  4FD4 A;  1OZP A;  2EUI A;  4B5P B;  4U9Z A;  3SHP A;  3D2P A;  2BL1 A;  1MJA A;  4K30 A;  4B5O A;  1KUX A;  1M4D A;  4R57 A;  1L0C A;  4M3S A;  2OZH A;  4KOU A;  1TIQ A;  2D4O A;  1XIX A;  3FIX A;  4B5P A;  2WPW A;  2R98 A;  4PK2 A;  4JXR A;  1UFH A;  2OH1 A;  2Q4Y A;  2REF A;  2Z11 A;  3R9F A;  1M4G A;  1KUY A;  3N7Z A;  2IL4 A;  3QAH A;  2VZZ A;  4I49 A;  2P6G A;  3IGR A;  2ATR A;  2FT0 A;  3PZJ A;  2D4P A;  3FB3 A;  4CRZ B;  4NCZ A;  2KCW A;  3W91 A;  2BEI A;  1KZF A;  3CXS A;  3D3S A;  1WWZ A;  3T90 A;  2AJ6 A;  3DNS A;  3CXQ A;  4UBR A;  4KOY A;  5KTC A;  4NEX A;  3GYA A;  1S7K A;  2B4D A;  5F49 A;  3TO6 A;  4KOW A;  3G8W A;  2VXK A;  4J3G A;  4HNY B;  5DWM A;  5IV0 A;  2PQ8 A;  2P6E A;  3UY5 A;  1LRZ A;  3W6S A;  4PSW A;  4JD6 A;  1YLE A;  3BLN A;  2G3T A;  1Y7R A;  2QEC A;  4PK3 A;  1S3Z A;  1U6M A;  4R87 A;  4XNH C;  1M4I A;  3NE7 A;  3DDD A;  1S60 A;  2WPX A;  5I0C A;  5CNP A;  2ZW4 A;  4QVT A;  4KLW A;  3FYN A;  4OLL A;  3ZJ0 A;  3FXT A;  2Q44 A;  2Z10 A;  2B5G A;  3EXN A;  4YRH A;  2FXF A;  2Q4V A;  4MHD A;  3TE4 A;  2R1I A;  4BMH A;  2Z0Z A;  4QUS A;  4UWI A;  4AG7 A;  4MY3 A;  1QSN A;  2NMT A;  3R9E A;  4XPD B;  5H86 A;  3F5B A;  4KUA A;  2JLM A;  4CAX A;  3PP9 A;  2H5M A;  4E0A A;  2A4N A;  4X5K A;  2FIA A;  2ZPA A;  5EBV A;  3TFY A;  1IYL A;  5F48 A;  1MK4 A;  1BO4 A;  4RS2 A;  3RYO A;  4KOV A;  4L8A A;  4YFJ A;  1Y9K A;  2Q7B A;  4CRY B;  4HNW B;  1P4N A;  2ZW5 A;  3TT2 A;  2CNT A;  4AVA A;  1IYK A;  1MJB A;  1Q2D A;  5J8F A;  4NF1 A;  5KTA A;  2RC4 A;  2I79 A;  4FD5 A;  4MJ8 A;  5C82 A;  4KVO E;  2Q04 A;  4KVX A;  4YGO A;  4ZBG A;  2FE7 A;  2B5G B;  4R3K A;  5F46 A;  4XPL A;  2HQY A;  3R9G A;  5KTD A;  3I9S A;  2AE6 A;  2X7B A;  4XPD C;  4AVC A;  1YRE A;  2VBQ A;  3S6H A;  2DXQ A;  2QML A;  5JPH A;  3FBU A;  1GHE A;  5DWN A;  2PDO A;  1QSM A;  4QB9 A;  2P0W A;  2JDC A;  2PC1 A;  4E2A A;  4FD6 A;  4F6A A;  2R7H A;  3MGD A;  1QST A;  4UWJ A;  3DSB A;  3D8P A;  5E96 A;  1I21 A;  2BUE A;  1S7N A;  2VQY A;  1K4J A;  3BJ7 A;  1PU9 A;  1XE4 A;  1YGH A;  3SXN A;  2OB0 A;  2J8R A;  1CM0 A;  3D2M A;  3K9U A;  2OZU A;  3JVN A;  1S5K A;  1R57 A;  2FS5 A;  4JJX A;  3T9Y A;  3S6K A;  2FIW A;  4R3L A;  1RXT A;  3EY5 A;  4KOT A;  3LD2 A;  4JXQ A;  1VHS A;  1Q2Y A;  4FD7 A;  4EVY A;  1S7L A;  2B3V A;  2G3A A;  1V0C A;  2ZXV A;  1P0H A;  1B6B A;  3R96 A;  4KVM E;  2Y0M A;  3GKR A;  3R95 A;  1Z4R A;  4U9Y A;  2FCK A;  2HUZ A;  4UA3 A;  4E8O A;  2B4D B;  1Y9W A;  4LUA A;  4DNC A;  2GIV A;  3CXP A;  2O28 A;  1Q2C A;  5FVJ A;  3R1K A;  2B58 A;  2R8V A;  3V8I A;  4II9 A;  3VWE A;  2CNM A;  4Y49 C;  3IWG A;  4M85 A;  4AVB A;  4KOS A;  2VI7 A;  3F0A A;  3VWD A;  1I1D A;  1N71 A;  4L89 A;  5F47 A;  1J4J A;  5IB0 A;  3JUW A;  2JEV A;  4KOR A;  1PUA A;  4OAD A;  4QC6 A;  4AG9 A;  2OZG A;  2GAN A;  4GS4 A;  1MJ9 A;  1RO5 A;  3S6G A;  3E0K A;  3OWC A;  2ZW6 A;  2ZW7 A;  1YVO A;  2ARH A;  3GY9 A;  1CJW A;  4OAE A;  4CAV A; 
#chains in the Genus database with same CATH topology
 1Z4E A;  5D29 A;  1AMP A;  4H2K A;  3LMS A;  3LOD A;  4YU9 A;  4EFD A;  1R3N A;  4A33 A;  1WK4 A;  3KR5 A;  2YND A;  4NXY A;  4IUS A;  4XNH B;  4CYQ A;  1IU8 A;  2I3C A;  2OU2 A;  3H8E A;  1CPS A;  2ZOF A;  4KOX A;  3GIU A;  5IX3 A;  4FBE A;  2JDD A;  3SJX A;  3F8K A;  5LYF A;  1VKC A;  2V8V A;  4DUK A;  1LFW A;  4MY0 A;  3EFA A;  2ZEL A;  1ZLI A;  2FL4 A;  2P6F A;  5J1Q A;  1NE9 A;  2EWB A;  3CPX A;  2O53 A;  1ON0 A;  4JWP A;  4P4D A;  4UEZ A;  1YR0 A;  3H4Q A;  1S7F A;  3PFO A;  5AG7 A;  1BPM A;  1YSJ A;  5HH1 A;  4P44 A;  2K5T A;  3C26 A;  4MXU A;  2FSR A;  1X12 A;  4KZT A;  2DPS A;  1IID A;  4PSX A;  3N5F A;  2ZEF A;  4RI1 A;  4A39 A;  5AG6 A;  2G9D A;  1XF8 A;  3DR6 A;  4ORF A;  3PGP A;  3D7G A;  4Z65 A;  3RZA A;  1YVK A;  2YNE A;  4Y49 B;  5C88 A;  3P2H A;  1CX8 A;  4C2Y A;  3TO9 A;  4RN7 A;  3ISX A;  4NJQ A;  4UCM A;  1B87 A;  2WYR A;  2YNC A;  4JZ0 A;  5CPA A;  3WR7 A;  5F09 A;  3NE8 A;  3S6F A;  2GE3 A;  1OBR A;  4M6H A;  5GCN A;  4DYO A;  1M44 A;  4GXH A;  4PXB A;  5H84 A;  2XEI A;  4OC2 A;  4H6Z A;  3VAT A;  2B4B A;  3KKW A;  5HMN A;  4OC4 A;  1XMB A;  1Z2L A;  2EVN A;  2PSW A;  4U5Y A;  5JGF A;  2PJ9 A;  3SXO A;  2Q51 A;  3BJ8 A;  3IWW A;  2QIR A;  4Q38 A;  5J8C A;  4A31 A;  2C27 A;  4CAW A;  2CNS A;  2VZY A;  4R9M A;  1QSR A;  2PJ8 A;  3H8G A;  4P10 A;  2Q0Y A;  4XPK A;  2CY2 A;  1I12 A;  3DR8 A;  3B8G A;  4G1P A;  5G20 A;  3SI2 A;  1XMT A;  4ONU A;  2REE A;  3I3G A;  1IIC A;  2BSW A;  4KLV A;  1HDU A;  4AB7 A;  2J8N A;  2C1C A;  1QSO A;  3NH5 A;  5K8M A;  1TF9 A;  1M1D A;  3KQX A;  2BCO A;  5DS0 A;  2PJ3 A;  1Z8W A;  4R6T A;  4OC0 A;  1TKH A;  2Z3P A;  3D67 A;  3TX8 A;  2EO8 A;  1BOB A;  4NGR A;  4OIW A;  3EO4 A;  3W6X A;  2GLJ A;  4HKF A;  3CZX A;  1YK3 A;  4JLY A;  4H6U A;  2PJ6 A;  2VEZ A;  1KUV A;  3RNZ A;  1NMT A;  3JTK A;  3TOB A;  4NGS A;  4CS0 B;  2PJ5 A;  1XEB A;  3RBU A;  4F0Y A;  3PBE A;  3FEE A;  1LOK A;  2PRB A;  4MCS A;  2ZEG A;  1FY7 A;  1Z9U A;  1IB1 E;  3G3S A;  3P2F A;  2AFX A;  4A95 A;  4C2X A;  2J9A A;  5IB9 A;  1SQH A;  4AG9 A;  3IIB A;  2HV2 A;  1LAN A;  3QNV A;  4IF5 A;  3ZZI A;  2B3U A;  4MI4 A;  4AXV A;  2F5I A;  1VHE A;  4QBJ A;  3TTH A;  4LX9 A;  5JQ4 A;  2CF4 A;  2V8G A;  2V8H A;  4NSQ A;  3EC4 A;  1ZO0 A;  1NSL A;  3TOA A;  2AFZ A;  4KUB A;  3KL9 A;  4HNX B;  3K9T A;  2PR1 A;  3FNC A;  5EC4 A;  3TCV A;  4UIA A;  4MRI A;  4NGQ A;  4R8F A;  5BWA B;  4CYN A;  2J8M A;  4MBU A;  2I00 A;  3TO7 A;  6CPA A;  3D66 A;  2PR8 A;  4H89 A;  3FJU A;  5ISV A;  2G0B A;  4FWU A;  2ZEN A;  1YX0 A;  3FRM A;  3QB8 A;  3HLP A;  4PV6 A;  2EK8 A;  4OID A;  1Z8L A;  4FD4 A;  1OZP A;  2EUI A;  4RUH A;  4B5P B;  2EK9 A;  4U9Z A;  4DJL A;  7CPA A;  4X8I A;  4B11 A;  3DLJ A;  4A38 A;  4PXC A;  3SHP A;  1XBU A;  3D2P A;  4MCP A;  3NH4 A;  2BL1 A;  1MJA A;  4K30 A;  3WT4 A;  4B5O A;  1KUX A;  1M4D A;  3H8F A;  4R57 A;  1L0C A;  3KHZ A;  2OZH A;  4M3S A;  4KOU A;  1TIQ A;  2AFS A;  2D4O A;  1XIX A;  3FIX A;  4B5P A;  4ZY1 A;  3HUV A;  3SJG A;  4ZYQ A;  4TNU A;  4P6Y A;  2WPW A;  3BI0 A;  2R98 A;  1Z8T A;  3VAR A;  4PK2 A;  5K8N A;  4UCP A;  4JXR A;  3PB4 X;  4UCN A;  3B3W A;  1F57 A;  2OOT A;  2QYV A;  1UFH A;  2Z3L A;  2ZEO A;  2QVP A;  3IO1 A;  1IY7 A;  1Y0R A;  2OH1 A;  2Q4Y A;  2RB7 A;  4YWY A;  2REF A;  2Z11 A;  4Q36 A;  3R9F A;  1M4G A;  1KUY A;  3DGV A;  3IC1 A;  4F8Z A;  4P4E A;  1XOV A;  3N7Z A;  4MHZ A;  2IL4 A;  4CYP A;  4IK2 A;  4EME A;  2DPT A;  1F2O A;  2VZZ A;  3QAH A;  2CIJ A;  2XEG A;  3SI1 A;  1CG2 A;  4C7I A;  4P4B A;  4I49 A;  4CAF A;  2P6G A;  4BD9 A;  2PIZ A;  3IGR A;  2PJ7 A;  4F9U A;  2ATR A;  5I4M A;  2FT0 A;  3PBB A;  2D4P A;  3PZJ A;  3FB3 A;  3IU1 A;  4NCZ A;  2KCW A;  1YW6 A;  4CRZ B;  2CTB A;  3SJF A;  1UWY A;  2Q4Z A;  3W91 A;  2BEI A;  4PXD A;  1EE3 P;  3FMC A;  1R43 A;  4NFR A;  2OR4 A;  3SI0 A;  1KZF A;  3BXM A;  3CXS A;  3I1U A;  1IGB A;  1Y0Y A;  2PJB A;  3B7I A;  3D3S A;  3D7H A;  5JH9 A;  1WWZ A;  3T90 A;  2AJ6 A;  2Z3O A;  4P45 A;  4CAE A;  2Z3K A;  3CDX A;  3DNS A;  3CXQ A;  4UBR A;  4KOY A;  5KTC A;  3WC7 A;  5LRJ A;  2GU2 A;  1XFO A;  3PB9 X;  4C2Z A;  3GYA A;  1S7K A;  4NEX A;  2B4D A;  2PJ0 A;  3D7F A;  4PQA A;  5F49 A;  3LWU A;  3TO6 A;  4MFL A;  2PJA A;  2AFM A;  4KOW A;  3T8W A;  3G8W A;  3KR4 A;  2ABZ A;  2POK A;  1AYE A;  2VXK A;  5LYI A;  1DTD A;  3WC5 A;  2ANP A;  4J3G A;  4CGN A;  2JBJ A;  3RO0 A;  1CP7 A;  3FH4 A;  4UIB A;  2PVV A;  4HNY B;  5DWM A;  4MFQ A;  4BIN A;  3S9L A;  1JQG A;  4MCR A;  5IV0 A;  2PQ8 A;  1CP6 A;  2P6E A;  4OC1 A;  3UY5 A;  1LRZ A;  3W6S A;  2CXA A;  4PSW A;  1Y7E A;  4JD6 A;  1YLE A;  2CTC A;  3BLN A;  1CPX A;  2G3T A;  1Y7R A;  2QEC A;  2WSA A;  1BPN A;  2WUU A;  2ZEE A;  3K2K A;  3PB7 X;  4PK3 A;  1S3Z A;  4M6G A;  1YQE A;  4R7M A;  1U6M A;  4R87 A;  4XNH C;  3JRU A;  2WZN A;  4W9Y A;  4UEE A;  4K3N A;  1TKF A;  3B3V A;  1M4I A;  2IQ6 A;  3NE7 A;  1HEE A;  3DDD A;  4ZY2 A;  4ZGY B;  1S60 A;  1AUG A;  2WPX A;  5CNP A;  5I0C A;  4MFZ A;  3ISZ A;  1JWQ A;  2ZW4 A;  4QVT A;  4KLW A;  2Q43 A;  1F2P A;  3FYN A;  5D8N A;  1ZG8 A;  4OLL A;  3ZJ0 A;  3FXT A;  1X10 A;  2YGW A;  2Q44 A;  2Z10 A;  2PVW A;  3PB6 X;  4CGL A;  3KI9 A;  2B5G A;  3GUX A;  3EXN A;  4YRH A;  4MFJ A;  1YLO A;  2FXF A;  2Q4V A;  3WC6 A;  3MN8 A;  4MHD A;  3TE4 A;  4KSA A;  2R1I A;  4BMH A;  1LAM A;  2Z0Z A;  4QUS A;  1ARL A;  4EWT A;  4UWI A;  2Z3N A;  2GRE A;  3S9M A;  4A94 A;  4AG7 A;  3B3T A;  4KSF A;  4MY3 A;  2HC9 A;  1QSN A;  2NMT A;  2VL1 A;  3B2Y A;  5G1Z A;  3R9E A;  2PJC A;  4XPD B;  5H86 A;  1QMU A;  3WAB A;  4NGN A;  3F5B A;  4KUA A;  4MHN A;  2JLM A;  4NGT A;  5LYL A;  4CAX A;  5HVG A;  2DF5 A;  3PFE A;  3PP9 A;  2H5M A;  4OP4 A;  1CBX A;  3B3C A;  2A4N A;  4E0A A;  4X5K A;  2FIA A;  4MCQ A;  2ZPA A;  5EBV A;  3TFY A;  2C6C A;  4LQG A;  1Z5R A;  1IYL A;  2JBK A;  3LAC A;  1XJO A;  4WWV A;  5F48 A;  1MK4 A;  1BO4 A;  4RS2 A;  3RYO A;  2DEA A;  4A32 A;  4KOV A;  4F9V A;  4L8A A;  5HVF A;  4YFJ A;  1Y9K A;  3FVL A;  2PCU A;  2Q7B A;  4C68 A;  2JEW A;  2PIY A;  4CRY B;  4HNW B;  3CT9 A;  3FED A;  1P4N A;  2ZW5 A;  2AFW A;  2BOA A;  3IJ3 A;  4MHP A;  2CNT A;  4PXE A;  4KS9 A;  3TT2 A;  4GM5 A;  4TWE A;  4AVA A;  1ARM A;  1IYK A;  1ZG9 A;  1MJB A;  3A9L A;  3B3S A;  1Q2D A;  5J8F A;  4NF1 A;  4ZY0 A;  5KTA A;  2RC4 A;  4OC5 A;  2I79 A;  4FD5 A;  4MJ8 A;  5C82 A;  4KVO E;  2Q04 A;  4MHY A;  4KVX A;  2Q7S A;  4YGO A;  2C6P A;  4UF4 A;  4ZBG A;  4CGO A;  5A28 A;  3KZW A;  4ZX8 A;  1KWM A;  2FE7 A;  1ZG7 A;  3IU2 A;  4B13 A;  4CPA A;  2B5G B;  4R3K A;  5F46 A;  5ELY A;  4XPL A;  2HQY A;  1XRY A;  4HPS A;  4FUU A;  4CGP A;  3R9G A;  4IAV A;  3PB8 X;  5KTD A;  1TXR A;  2GLF A;  2F7V A;  1ELM P;  2HB6 A;  3I9S A;  2AE6 A;  2X7B A;  2ZEH A;  1Z8X A;  4P4I A;  4OME A;  1YRE A;  4XPD C;  5THW A;  4AVC A;  3SJE A;  3GB0 A;  1H8L A;  2VBQ A;  1GYT A;  2DXQ A;  3S6H A;  1HDQ A;  3VH9 A;  2QML A;  5JPH A;  1PCA A;  4JYW A;  1VGY A;  4FAI A;  1IOF A;  3FBU A;  1GHE A;  5DWN A;  8CPA A;  3IEH A;  2PDO A;  1QSM A;  4QB9 A;  3L2N A;  4M6I A;  2P0W A;  2JDC A;  2PC1 A;  4E2A A;  1TKJ A;  2EBJ A;  4FD6 A;  4O23 A;  4B12 A;  4F6A A;  3KAS A;  2R7H A;  3MGD A;  1TF8 A;  2IJZ A;  5LRK A;  4ONW A;  2XEF A;  1QST A;  2ZEP A;  3IWE A;  4UWJ A;  3DSB A;  3V38 A;  4CYO A;  5CBM A;  1LAP A;  2ODF A;  4MFK A;  3D8P A;  5E96 A;  1I21 A;  2BUE A;  2GFQ A;  1S7N A;  2VQY A;  1K4J A;  4BBH A;  3BJ7 A;  1BLL E;  1PU9 A;  2PJ1 A;  1XE4 A;  3KHX A;  1YGH A;  3BHX A;  3SXN A;  1A2Z A;  2OB0 A;  1YW4 A;  2BO9 A;  2J8R A;  3D4U A;  2Z3M A;  1CM0 A;  5LYD A;  2O4H A;  3D2M A;  3K9U A;  4X3R A;  2OZU A;  3JVN A;  3NFZ A;  1S5K A;  4UFV A;  4B14 A;  1R57 A;  2AFU A;  3KQZ A;  4MMO A;  2FS5 A;  4R76 A;  2FVG A;  4JJX A;  3T9Y A;  3S6K A;  4B10 A;  2C6G A;  3IFE A;  4UFW A;  5K8P A;  3GLJ A;  5AG4 A;  2FIW A;  4R3L A;  1RXT A;  2F8H A;  3FEC A;  3EY5 A;  4KOT A;  3LD2 A;  4JXQ A;  3NH8 A;  1VHS A;  3BI1 A;  4UFX A;  4F0X A;  5A27 A;  1Q2Y A;  5AG5 A;  3RAM A;  3MRU A;  4FD7 A;  4EVY A;  1S7L A;  2B3V A;  2G3A A;  1V0C A;  3CPA A;  2ZXV A;  2NSM A;  1P0H A;  1B6B A;  4MFP A;  5G21 A;  3R96 A;  4KVM E;  2Y0M A;  3GKR A;  4X2T A;  3R95 A;  1Z4R A;  1M4L A;  4U9Y A;  3NA6 A;  3S9N A;  1YME A;  2FCK A;  2HUZ A;  4UA3 A;  4E8O A;  1FNO A;  4IHM A;  4P4J A;  2B4D B;  1Y9W A;  4LUA A;  4DNC A;  3D7D A;  2RFH A;  2GIV A;  3CXP A;  1NSA A;  2O28 A;  1Q2C A;  5FVJ A;  3R1K A;  2B58 A;  1FT7 A;  2R8V A;  5LRG A;  4P4F A;  3V8I A;  4LQ6 A;  4II9 A;  2XEJ A;  3VWE A;  2CNM A;  2ZED A;  2PE3 A;  4Y49 C;  1QQ9 A;  4OKO A;  2V8D A;  3IWG A;  4M85 A;  4Q7A A;  4A30 A;  4AVB A;  2PRQ A;  4KOS A;  5HVH A;  2VI7 A;  3F0A A;  3VWD A;  3V7Z A;  4OC3 A;  2NYQ A;  1I1D A;  1N71 A;  4L89 A;  5F47 A;  3B35 A;  4A37 A;  1J4J A;  5K8O A;  2QJ8 A;  3QAY A;  5IB0 A;  3TC8 A;  5JM6 A;  4KSI A;  4UEF A;  3FX6 A;  4NGP A;  3JUW A;  2JEV A;  3FF3 A;  4KOR A;  2PJ4 A;  1PUA A;  1VIX A;  2AFO A;  2ZEM A;  1IOI A;  2IMO A;  4NJR A;  4OAD A;  1DE4 C;  4QC6 A;  2OZG A;  1Q7L A;  3KGQ A;  3PRT A;  5AGE A;  4C7H A;  2GAN A;  4GS4 A;  4WJB A;  1MJ9 A;  1PYT B;  3D68 A;  1RO5 A;  3S6G A;  4ZI6 A;  3E0K A;  5HXD A;  4NGM A;  3OWC A;  1VHO A;  1ZLH A;  3H5Z A;  4PPZ A;  2ZW6 A;  2ZW7 A;  1LCP A;  1RTQ A;  1YVO A;  2ARH A;  2YNC C;  3GY9 A;  3PEI A;  2PJ2 A;  1BAV A;  1CJW A;  4A2Z A;  4OAE A;  4CGM A;  2V77 A;  5G22 A;  4ZX9 A;  4B6Z A;  2ZOG A;  1ELL P;  5EMI A;  4CAV A; 
#chains in the Genus database with same CATH homology
 1Z4E A;  3LOD A;  4A33 A;  1WK4 A;  2YND A;  4NXY A;  4IUS A;  4XNH B;  4CYQ A;  2OU2 A;  4KOX A;  5IX3 A;  2JDD A;  3F8K A;  1VKC A;  4MY0 A;  3EFA A;  2FL4 A;  2P6F A;  1NE9 A;  1ON0 A;  4JWP A;  1YR0 A;  3H4Q A;  1S7F A;  5AG7 A;  5HH1 A;  2K5T A;  3C26 A;  4RI1 A;  2FSR A;  4PSX A;  4KZT A;  2DPS A;  1IID A;  5AG6 A;  1XF8 A;  3DR6 A;  4ORF A;  3PGP A;  1YVK A;  2YNE A;  4Y49 B;  5C88 A;  3P2H A;  4C2Y A;  3TO9 A;  4UCM A;  1B87 A;  2YNC A;  3WR7 A;  3S6F A;  2GE3 A;  5GCN A;  1M44 A;  5H84 A;  5HMN A;  4H6Z A;  2B4B A;  3KKW A;  2EVN A;  2PSW A;  4U5Y A;  3SXO A;  3BJ8 A;  2QIR A;  4Q38 A;  5J8C A;  4A31 A;  2C27 A;  4CAW A;  2CNS A;  2VZY A;  4R9M A;  1QSR A;  2Q0Y A;  4XPK A;  2CY2 A;  1I12 A;  3DR8 A;  3B8G A;  5G20 A;  1XMT A;  4ONU A;  2REE A;  3I3G A;  1IIC A;  2BSW A;  4KLV A;  4AB7 A;  2J8N A;  1QSO A;  1M1D A;  2Z3P A;  1BOB A;  3EO4 A;  3W6X A;  4HKF A;  1YK3 A;  4JLY A;  4H6U A;  2VEZ A;  1KUV A;  3TOB A;  1NMT A;  3JTK A;  4CS0 B;  1XEB A;  4F0Y A;  2PRB A;  1FY7 A;  1Z9U A;  1IB1 E;  3G3S A;  3P2F A;  4A95 A;  4C2X A;  1SQH A;  2HV2 A;  3ZZI A;  4IF5 A;  2B3U A;  4MI4 A;  4QBJ A;  2F5I A;  3TTH A;  4LX9 A;  5JQ4 A;  4NSQ A;  3EC4 A;  1ZO0 A;  1NSL A;  3TOA A;  4KUB A;  4HNX B;  2PR1 A;  3FNC A;  5EC4 A;  3TCV A;  5BWA B;  4CYN A;  2J8M A;  4MBU A;  2I00 A;  3TO7 A;  2PR8 A;  4H89 A;  5ISV A;  2G0B A;  1YX0 A;  3FRM A;  3QB8 A;  4PV6 A;  4FD4 A;  1OZP A;  2EUI A;  4B5P B;  4U9Z A;  4B11 A;  3SHP A;  3D2P A;  2BL1 A;  1MJA A;  4K30 A;  4B5O A;  1KUX A;  1M4D A;  4R57 A;  1L0C A;  4M3S A;  2OZH A;  4KOU A;  1TIQ A;  2D4O A;  1XIX A;  3FIX A;  4B5P A;  2WPW A;  2R98 A;  4PK2 A;  4UCP A;  4JXR A;  4UCN A;  1UFH A;  2Z3L A;  2OH1 A;  2Q4Y A;  2REF A;  2Z11 A;  4Q36 A;  3R9F A;  1M4G A;  1KUY A;  3N7Z A;  2IL4 A;  4CYP A;  2DPT A;  3QAH A;  2VZZ A;  4C7I A;  4I49 A;  4CAF A;  2P6G A;  3IGR A;  2ATR A;  2FT0 A;  3PZJ A;  2D4P A;  3FB3 A;  3IU1 A;  4NCZ A;  2KCW A;  4CRZ B;  3W91 A;  2BEI A;  1KZF A;  3CXS A;  3D3S A;  1WWZ A;  3T90 A;  2AJ6 A;  2Z3O A;  4CAE A;  2Z3K A;  3DNS A;  3CXQ A;  4UBR A;  4KOY A;  5KTC A;  4C2Z A;  3GYA A;  1S7K A;  4NEX A;  2B4D A;  5F49 A;  3TO6 A;  4MFL A;  4KOW A;  3G8W A;  2VXK A;  4J3G A;  4CGN A;  4HNY B;  5DWM A;  4MFQ A;  5IV0 A;  2PQ8 A;  2P6E A;  3UY5 A;  1LRZ A;  3W6S A;  2CXA A;  4PSW A;  4JD6 A;  1YLE A;  3BLN A;  2G3T A;  1Y7R A;  2QEC A;  2WSA A;  2WUU A;  4PK3 A;  1S3Z A;  1U6M A;  4R87 A;  4XNH C;  1M4I A;  3NE7 A;  3DDD A;  4ZGY B;  1S60 A;  2WPX A;  5I0C A;  5CNP A;  4MFZ A;  2ZW4 A;  4QVT A;  4KLW A;  3FYN A;  4OLL A;  3ZJ0 A;  3FXT A;  2YGW A;  2Q44 A;  2Z10 A;  4CGL A;  2B5G A;  3EXN A;  4YRH A;  4MFJ A;  2FXF A;  2Q4V A;  4MHD A;  3TE4 A;  4KSA A;  2R1I A;  4BMH A;  2Z0Z A;  4QUS A;  4UWI A;  2Z3N A;  4AG7 A;  4KSF A;  4MY3 A;  1QSN A;  2NMT A;  3R9E A;  5G1Z A;  4XPD B;  5H86 A;  3F5B A;  4KUA A;  2JLM A;  4CAX A;  3PP9 A;  2H5M A;  4E0A A;  2A4N A;  4X5K A;  2FIA A;  2ZPA A;  5EBV A;  3TFY A;  1IYL A;  5F48 A;  1MK4 A;  1BO4 A;  4RS2 A;  3RYO A;  4A32 A;  4KOV A;  4L8A A;  4YFJ A;  1Y9K A;  2Q7B A;  4C68 A;  4CRY B;  4HNW B;  1P4N A;  2ZW5 A;  3TT2 A;  2CNT A;  4AVA A;  4KS9 A;  1IYK A;  3A9L A;  1MJB A;  1Q2D A;  5J8F A;  4NF1 A;  5KTA A;  2RC4 A;  2I79 A;  4FD5 A;  4MJ8 A;  5C82 A;  4KVO E;  2Q04 A;  4KVX A;  4YGO A;  4ZBG A;  5A28 A;  4CGO A;  2FE7 A;  3IU2 A;  4B13 A;  2B5G B;  4R3K A;  5F46 A;  4XPL A;  2HQY A;  4CGP A;  3R9G A;  5KTD A;  3I9S A;  2AE6 A;  2X7B A;  4XPD C;  4AVC A;  1YRE A;  2VBQ A;  3S6H A;  2DXQ A;  2QML A;  5JPH A;  3FBU A;  1GHE A;  5DWN A;  2PDO A;  1QSM A;  4QB9 A;  2P0W A;  2JDC A;  2PC1 A;  4E2A A;  4FD6 A;  4B12 A;  4F6A A;  2R7H A;  3MGD A;  1QST A;  3IWE A;  4UWJ A;  3DSB A;  4CYO A;  4MFK A;  3D8P A;  5E96 A;  1I21 A;  2BUE A;  1S7N A;  2VQY A;  1K4J A;  4BBH A;  3BJ7 A;  1PU9 A;  1XE4 A;  1YGH A;  3SXN A;  2OB0 A;  2J8R A;  2Z3M A;  1CM0 A;  3D2M A;  3K9U A;  2OZU A;  3JVN A;  4UFV A;  1S5K A;  4B14 A;  1R57 A;  2FS5 A;  4JJX A;  3T9Y A;  3S6K A;  4B10 A;  4UFW A;  5AG4 A;  2FIW A;  4R3L A;  1RXT A;  3EY5 A;  4KOT A;  3LD2 A;  4JXQ A;  4UFX A;  1VHS A;  4F0X A;  5A27 A;  1Q2Y A;  5AG5 A;  4FD7 A;  4EVY A;  1S7L A;  2B3V A;  2G3A A;  1V0C A;  2ZXV A;  1P0H A;  1B6B A;  4MFP A;  5G21 A;  3R96 A;  4KVM E;  2Y0M A;  3GKR A;  3R95 A;  1Z4R A;  4U9Y A;  2FCK A;  2HUZ A;  4UA3 A;  4E8O A;  2B4D B;  1Y9W A;  4LUA A;  4DNC A;  2GIV A;  3CXP A;  2O28 A;  1Q2C A;  5FVJ A;  3R1K A;  2B58 A;  2R8V A;  3V8I A;  4II9 A;  3VWE A;  2CNM A;  4Y49 C;  3IWG A;  4M85 A;  4A30 A;  4AVB A;  4KOS A;  2VI7 A;  3F0A A;  3VWD A;  1I1D A;  1N71 A;  4L89 A;  5F47 A;  1J4J A;  5IB0 A;  3JUW A;  2JEV A;  4KOR A;  1PUA A;  4OAD A;  4QC6 A;  4AG9 A;  5AGE A;  2OZG A;  4C7H A;  2GAN A;  4GS4 A;  1MJ9 A;  1RO5 A;  3S6G A;  3E0K A;  3OWC A;  3H5Z A;  2ZW6 A;  2ZW7 A;  1YVO A;  2ARH A;  2YNC C;  3GY9 A;  1CJW A;  4A2Z A;  4OAE A;  4CGM A;  5G22 A;  4CAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...