4XPDC

Crystal structure of yeast n-terminal acetyltransferase nate (ppgpp) in complex with a bisubstrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
155
Chain Sequence
RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDVHFTQMAYYSEIPVGGLVAKLVPLSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
publication title Crystal structure of yeast N-terminal acetyltransferase NatE (ppGpp) in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 155
sequence length 174
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xpdC00
4XPDC 2O28A 2KCWA 2FIWA 4NEXA 1NMTA 4MY0A 1SQHA 3TO7A 2B4DA 3CXSA 2B5GA 2C27A 2J8RA 3PP9A 2GE3A 3PGPA 2FCKA 4E0AA 2X7BA 2FSRA 2QMLA 4E8OA 2ZW6A 4JWPA 2QIRA 2PQ8A 1XE4A 2R98A 2FL4A 2Q04A 4B5PB 3FRMA 4UA3A 4FD4A 3BJ8A 3IWGA 4U9YA 3DDDA 2Q4VA 1YVOA 2D4OA 3FBUA 4JJXA 3EXNA 4MJ8A 4HNYB 5KTAA 3D8PA 4J3GA 5CNPA 5C88A 3RYOA 5GCNA 2CY2A 1IB1E 2JEVA 3TCVA 1I12A 1M4GA 3R96A 2CNSA 3S6KA 5F49A 2I00A 2B3VA 4KOXA 4FD5A 1YVKA 4ZBGA 4QB9A 5IX3A 2B4BA 3NE7A 5EBVA 1P4NA 5KTCA 4KVME 4NCZA 4JXRA 2G0BA 1RO5A 3T90A 4IUSA 1I1DA 1S60A 1M4IA 3D3SA 4HNXB 2FT0A 2PR1A 4F0YA 4KLWA 3EO4A 1QSTA 1NSLA 3GKRA 3FYNA 2OH1A 2J8NA 1CJWA 4IF5A 1UFHA 2VQYA 5DWNA 3P2HA 4YRHA 3W6XA 2EVNA 5J8CA 1MJAA 2BL1A 2REFA 4NXYA 4AVAA 2OB0A 4KUBA 3QB8A 4QUSA 5H84A 2Q44A 1S7FA 4R9MA 2I79A 2NMTA 1RXTA 3FXTA 1B6BA 3JVNA 4AB7A 4UBRA 1KZFA 3IGRA 2VI7A 2PR8A 1VKCA 1VHSA 1WK4A 2RC4A 2AJ6A 3TOBA 1KUYA 3TTHA 2VEZA 3VWEA 4LUAA 5E96A 1PUAA 2BEIA 4RI1A 3LD2A 1M1DA 2HUZA 2BUEA 3SXNA 1MJ9A 3C26A 4GS4A 4QC6A 1CM0A 3BLNA 3F0AA 4KOUA 4X5KA 4ONUA 2H5MA 4KORA 4R87A 2FE7A 3ZZIA 1MK4A 2Q4YA 1YK3A 4KVOE 1BOBA 4Y49B 5IV0A 4MI4A 1XF8A 4OLLA 3R9FA 1S5KA 3LODA 1Q2DA 3SXOA 3S6FA 3D2PA 1YGHA 3D2MA 1QSNA 1N71A 2JLMA 2DXQA 4KLVA 2VXKA 2AE6A 4KOYA 1FY7A 4AVBA 4YFJA 4XPKA 4U5YA 3FIXA 4AVCA 3TO6A 3TFYA 5F48A 2ARHA 2Z11A 4II9A 4BMHA 1Z4RA 1R57A 2Q0YA 3R9EA 4KVXA 4XNHB 4R3KA 4RS2A 3W91A 3TT2A 2R8VA 2R7HA 2B3UA 1S7LA 4CRZB 1J4JA 4UWIA 2Y0MA 4UWJA 1Y9WA 4CAWA 1MJBA 4H6UA 2PDOA 4CS0B 3EY5A 3EFAA 1IICA 1Z9UA 2FS5A 2J8MA 2OZHA 4B5PA 5ISVA 5IB0A 4DNCA 4KOVA 3S6GA 4FD7A 1KUXA 2PC1A 2ZW5A 1Q2CA 3N7ZA 3G8WA 2JDCA 4R57A 1GHEA 3W6SA 4KOSA 2OZGA 2P6GA 3TE4A 4PK2A 2ZW7A 2CNMA 3T9YA 3B8GA 3TOAA 3VWDA 1YX0A 3MGDA 1XIXA 3UY5A 3CXQA 5F46A 2F5IA 1YLEA 1M44A 3FB3A 3R1KA 3I9SA 4JLYA 1I21A 4KOTA 1ON0A 1YREA 3ZJ0A 5JPHA 4KUAA 1P0HA 1S7NA 4M85A 1BO4A 4OAEA 5H86A 2Z10A 3V8IA 4KZTA 4Y49C 1OZPA 4M3SA 3JUWA 1LRZA 2K5TA 3E0KA 4EVYA 1PU9A 1XEBA 3TO9A 4ORFA 4U9ZA 4CAXA 1Q2YA 5HMNA 3PZJA 5HH1A 2BSWA 2ATRA 1V0CA 3K9UA 4NSQA 2ZPAA 4AG9A 4L89A 2G3TA 5KTDA 2WPXA 4JD6A 1IYLA 1WWZA 3F8KA 2FIAA 2JDDA 2REEA 3F5BA 3P2FA 1QSOA 5C82A 5JQ4A 2EUIA 1K4JA 2R1IA 2WPWA 4XPDB 3WR7A 3EC4A 3R9GA 2ZW4A 1M4DA 2QECA 3FNCA 4F6AA 2GANA 4FD6A 3DSBA 4XNHC 3H4QA 2P6FA 1QSRA 4NF1A 3S6HA 4XPLA 4HNWB 4PSXA 4H89A 1S3ZA 1L0CA 4E2AA 2VZYA 2G3AA 2HV2A 5EC4A 3DR8A 4PSWA 4K30A 2D4PA 4HKFA 4YGOA 3QAHA 2OU2A 3R95A 2GIVA 4CAVA 5F47A 1Y9KA 2VBQA 4H6ZA 1U6MA 1Z4EA 1YR0A 3OWCA 4MY3A 4L8AA 4R3LA 4QBJA 2B58A 3SHPA 2P6EA 1XMTA 3GY9A 4MHDA 1B87A 5FVJA 2B4DB 1IIDA 2B5GB 4B5OA 2VZZA 2PRBA 3G3SA 4QVTA 5I0CA 4MBUA 2ZXVA 4LX9A 1QSMA 4PK3A 4AG7A 4OADA 1NE9A 1TIQA 1Y7RA 3KKWA 4CRYB 3CXPA 1KUVA 2PSWA 2CNTA 4I49A 5DWMA 3DR6A 2HQYA 1IYKA 2OZUA 2IL4A 3DNSA 1S7KA 3I3GA 4JXQA 5J8FA 2P0WA 2FXFA 2Q7BA 2A4NA 2Z0ZA 4KOWA 4PV6A 3GYAA 3BJ7A
chains in the Genus database with same CATH superfamily
4XPDC 4FAIA 2O28A 1ARLA 4IAVA 3PFEA 2KCWA 2FIWA 4NEXA 1NMTA 2PJBA 4MY0A 4A31A 1SQHA 2DPTA 1CPXA 2C6CA 2F8HA 4MHYA 5EMIA 2B4DA 3CXSA 2B5GA 3TO7A 5JGFA 1YW6A 2C27A 2J8RA 3PP9A 2GE3A 3PGPA 2HC9A 2ZEDA 4P4EA 4PXDA 2C1CA 1ZG9A 1VIXA 2FCKA 4A38A 2X7BA 4E0AA 4CAEA 2FSRA 2CXAA 1TF8A 2JBJA 2XEGA 3S9NA 2QMLA 4E8OA 1UWYA 1Z8WA 2ZW6A 3NH8A 4JWPA 5CBMA 2QIRA 2PQ8A 3V7ZA 1XE4A 2R98A 1LCPA 2FL4A 3WC6A 2Q04A 4B5PB 3FRMA 4UA3A 2DF5A 3QNVA 5A27A 3LACA 1JWQA 4B12A 2VL1A 4FD4A 3VH9A 3B3CA 3BJ8A 4R8FA 5F09A 3IWGA 4U9YA 3DDDA 2Q4VA 3B7IA 1YVOA 2D4OA 3FBUA 1YMEA 4JJXA 4NGSA 2BO9A 3NH5A 3TC8A 1X12A 3EXNA 2QJ8A 3CDXA 4HNYB 4MJ8A 5KTAA 3D8PA 3PB9X 2YGWA 4J3GA 5CNPA 5C88A 3RYOA 1LAMA 5GCNA 2CY2A 2PJ7A 1IB1E 3SJXA 1ZG7A 2JEVA 3TCVA 1I12A 1M4GA 3SI1A 3R96A 2CNSA 5G1ZA 3S6KA 5F49A 2I00A 2B3VA 4KOXA 4LQGA 4FD5A 1YVKA 4ZBGA 3H8FA 2PJCA 4NGRA 1F2OA 3GIUA 2CF4A 3KR5A 1CP6A 3QAYA 4UEZA 4QB9A 5IX3A 2EK9A 2B4BA 3NE7A 5EBVA 4CGPA 1P4NA 2FVGA 3KR4A 4ZX9A 4KVME 3ISZA 3JTKA 4NCZA 4P4FA 5JM6A 5KTCA 4JXRA 3FMCA 2ZENA 2G0BA 2ZEHA 2GU2A 2CIJA 3T8WA 1RO5A 4B11A 5CPAA 4C7IA 3T90A 1VHEA 4IUSA 5HVFA 1I1DA 3B3VA 4MFKA 1AUGA 1M4IA 1S60A 1ZLIA 3D3SA 4CGMA 3GUXA 4B6ZA 1BLLE 1OBRA 4HNXB 2FT0A 2PR1A 4A2ZA 4F0YA 4KLWA 3EO4A 1QSTA 3FVLA 1NSLA 3GKRA 3FYNA 1XFOA 2OH1A 2J8NA 4OP4A 4BBHA 2PJ8A 1R43A 1CJWA 4P4DA 4IF5A 1CG2A 1UFHA 2PE3A 2VQYA 5DWNA 3P2HA 1YSJA 4YRHA 1A2ZA 2EVNA 4PPZA 1MJAA 2BL1A 2REFA 3IU1A 4NXYA 2OB0A 3D7FA 3QB8A 4KUBA 3KQXA 3BI0A 4QUSA 5H84A 2Z3OA 2F7VA 2Q44A 1S7FA 2IJZA 3BXMA 4UFWA 4BD9A 4R9MA 2PCUA 2I79A 3NA6A 4X2TA 2NMTA 2V77A 1RXTA 3FXTA 3LMSA 3NFZA 4P44A 1B6BA 3JVNA 4AB7A 3KL9A 2ANPA 4UBRA 1KZFA 4OIWA 2PIZA 5JH9A 3IGRA 2AFXA 2PR8A 2VI7A 1VKCA 2ODFA 2V8DA 1VHSA 4UFXA 2PJ5A 4CYQA 1WK4A 2C6PA 2RC4A 4ZY0A 2AJ6A 2OOTA 3SJEA 3D66A 2ZEFA 3TOBA 1VHOA 4HPSA 5A28A 3WABA 1KUYA 4OIDA 4CAFA 3TTHA 2CTBA 4OMEA 2VEZA 4C68A 4DJLA 3FF3A 3K2KA 1YLOA 3VWEA 4LUAA 5E96A 2Z3KA 1PUAA 3IC1A 2O4HA 3IFEA 2BEIA 4PQAA 4RI1A 3LD2A 4O23A 1M1DA 2HUZA 2BUEA 3SXNA 4ZY1A 1AMPA 1MJ9A 3C26A 2IQ6A 3TX8A 2GLJA 4K3NA 2DEAA 4GS4A 4MCRA 5J8CA 2WSAA 3N5FA 1CM0A 4QC6A 2NSMA 3BLNA 3F0AA 4KOUA 4R76A 4X5KA 4MCSA 4FWUA 4ONUA 1F57A 2V8HA 2Z3PA 4UEEA 2BCOA 2H5MA 3IO1A 4M6IA 1ARMA 2PJ9A 3PEIA 4KORA 4PXEA 4MHNA 4R87A 4KSAA 5AG5A 1HDQA 4MRIA 3PBBA 2FE7A 3B2YA 2RB7A 3ISXA 2PJ6A 3ZZIA 1MK4A 3KI9A 2Q4YA 1TXRA 1YK3A 1BOBA 4KVOE 4Y49B 5IV0A 3S9LA 4MI4A 1XF8A 4A95A 4OLLA 4OC2A 3R9FA 1S5KA 3LODA 1Q2DA 3SXOA 4AXVA 3D4UA 4OC1A 3S6FA 2PJ0A 3CPAA 4RN7A 2XEJA 3D2PA 2Z3MA 1XBUA 1YGHA 3S9MA 3D2MA 4UEFA 2EK8A 5K8NA 1QSNA 2WUUA 2OR4A 1CBXA 4XNHC 1ELMP 3FEDA 5DS0A 1N71A 2JLMA 2DXQA 2YNDA 4KLVA 1IOFA 4UIAA 2VXKA 4R7MA 2PVWA 6CPAA 2HB6A 3GB0A 1GYTA 2AE6A 5G21A 2ZEMA 1FY7A 2I3CA 4KOYA 4AVBA 2XEFA 4AVAA 4YFJA 1DTDA 2AFOA 4XPKA 4U5YA 3FIXA 4AVCA 3FECA 5HVHA 3TO6A 4X3RA 3TFYA 3IWEA 2ARHA 5F48A 4ZGYB 3PB7X 3PBEA 2Z11A 4W9YA 4II9A 4NGQA 4BMHA 1Z4RA 2C6GA 1R57A 1ZO0A 2Q0YA 3B3SA 3R9EA 4KVXA 1TKHA 4YU9A 4MFLA 4GXHA 4MHPA 4R3KA 4RS2A 4KS9A 4XNHB 3W91A 3JRUA 3TT2A 1PYTB 2PIYA 2R8VA 3NE8A 2R7HA 4A32A 3V38A 2B3UA 5D29A 1LANA 1S7LA 4CRZB 1J4JA 4UWIA 4DUKA 2GLFA 2Y0MA 3PRTA 4IK2A 4MCPA 3RO0A 4MFQA 4FUUA 7CPAA 4MXUA 4UWJA 5HVGA 1Y9WA 4LQ6A 4CAWA 1MJBA 4H6UA 2PDOA 4CS0B 3EY5A 5BWAB 1XMBA 3I1UA 2EWBA 3EFAA 1IICA 1Z9UA 2FS5A 5D8NA 4CGLA 2DPSA 4P4JA 5G20A 4C7HA 1ZG8A 2J8MA 2OZHA 4C2ZA 1NSAA 4F9UA 5HXDA 4ZI6A 4B5PA 4C2XA 4B14A 5ISVA 4WWVA 5IB0A 3H8GA 4DNCA 4KOVA 2YNCC 3PB6X 3S6GA 4FD7A 3IWWA 1KUXA 3CZXA 2PC1A 4OC0A 4JYWA 2ZW5A 4OC3A 1ELLP 1Q2CA 1LAPA 3N7ZA 3G8WA 4MFPA 2JDCA 4R57A 3LWUA 1ZLHA 1GHEA 2EBJA 4P4IA 3W6SA 4KOSA 2OZGA 2P6GA 3TE4A 4PK2A 2ZW7A 1IGBA 1HEEA 1CPSA 4X8IA 2CNMA 4M6GA 3B8GA 3T9YA 3TOAA 1LFWA 4Q36A 1Z8TA 3MRUA 4NGPA 1YX0A 3MGDA 4TWEA 3VWDA 1XIXA 2POKA 3UY5A 2PRQA 3CXQA 3SJGA 5I4MA 5F46A 1Z5RA 2AFZA 2F5IA 3IIBA 1CP7A 1X10A 1YLEA 1M44A 3FB3A 4KSIA 3R1KA 3I9SA 4JLYA 1I21A 4P10A 4KOTA 4P45A 1ON0A 1YREA 3D67A 3ZJ0A 5JPHA 4C2YA 4KUAA 4IHMA 1P0HA 5LRGA 1S7NA 4NGNA 4M85A 4A94A 2AFMA 1BO4A 4P6YA 4OAEA 3SI2A 5K8MA 3D7DA 5H86A 3KZWA 5LYDA 2Z10A 3V8IA 4R6TA 3W6XA 4UCMA 1TF9A 2Q51A 4A30A 4KZTA 2G9DA 4Y49C 3D7HA 3RAMA 4KSFA 1OZPA 1QMUA 4M3SA 3RNZA 4BINA 4F0XA 3JUWA 1LRZA 2K5TA 4NGTA 2ZELA 5AG6A 3E0KA 4EVYA 3FH4A 1PU9A 4CPAA 3IU2A 4F9VA 1XEBA 3TO9A 4ORFA 4PXCA 4U9ZA 4CAXA 4ZX8A 1Q2YA 5HMNA 1H8LA 1Z8LA 3PZJA 5HH1A 4A37A 2BSWA 2O53A 2NYQA 1Y0RA 2ATRA 3A9LA 1V0CA 1RTQA 3K9UA 4NSQA 4UFVA 2V8VA 3RBUA 2ZPAA 4AG9A 1TKFA 4L89A 2G3TA 2V8GA 3L2NA 5KTDA 4YWYA 2J9AA 2WPXA 4OC5A 4JD6A 1IYLA 2PVVA 1WWZA 3D7GA 2JEWA 3F8KA 2FIAA 2JDDA 2REEA 3F5BA 3P2FA 4UCNA 3KHZA 4MFZA 1QSOA 4ONWA 5C82A 2JBKA 3VARA 5JQ4A 2EUIA 3IEHA 2ABZA 4EWTA 5G22A 1K4JA 2QVPA 1F2PA 3CPXA 3DGVA 3FJUA 3WC7A 1IOIA 2AFWA 2R1IA 2WPWA 1LOKA 4XPDB 2GREA 3SJFA 2PJ4A 4TNUA 3WR7A 4A33A 3EC4A 2WYRA 2ZW4A 1M4DA 2QECA 3FNCA 2PJ1A 2ZEOA 4OKOA 3R9GA 2GANA 3B35A 2YNCA 3DSBA 4FD6A 2QYVA 4WJBA 3H4QA 2P6FA 1QSRA 4NF1A 3S6HA 4ZYQA 3H8EA 4XPLA 3DLJA 4HNWB 4RUHA 4PSXA 4H89A 1S3ZA 4CGOA 1L0CA 4E2AA 2VZYA 5AGEA 2G3AA 5LRJA 2AFUA 2HV2A 5EC4A 5ELYA 3DR8A 4Q7AA 1JQGA 4NFRA 4PSWA 1IU8A 4K30A 1AYEA 4NGMA 1BPMA 2PJ3A 2D4PA 4HKFA 4YGOA 2PJ2A 3QAHA 2OU2A 3R95A 2Z3NA 4CYPA 1R3NA 1YW4A 2GIVA 4CAVA 4MMOA 5F47A 1Y9KA 2GFQA 2VBQA 4H6ZA 2BOAA 1U6MA 1Z4EA 4MCQA 3FEEA 4CYOA 4Z65A 1YR0A 3OWCA 4F8ZA 4H2KA 1BAVA 4JZ0A 4Q38A 4MY3A 4F6AA 4L8AA 4PXBA 3FX6A 5LYFA 2PJAA 4R3LA 4QBJA 4GM5A 2B58A 4CGNA 3KQZA 3PFOA 3GLJA 2ZOGA 3SHPA 5IB9A 3BI1A 1Y0YA 2Q43A 4MFJA 5LYIA 2P6EA 1XMTA 3RZAA 1YQEA 1XJOA 4MHZA 4UF4A 3GY9A 4MHDA 1B87A 3CT9A 3NH4A 4P4BA 3HUVA 2EO8A 5LRKA 1Y7EA 5FVJA 2B4DB 5LYLA 1FT7A 1IIDA 2B5GB 5THWA 3WT4A 5AG7A 2ZEEA 2VZZA 2YNEA 4B5OA 1KWMA 2IMOA 2PRBA 4NJRA 1Z2LA 3MN8A 5AG4A 3HLPA 3G3SA 1XOVA 4NJQA 4EFDA 4QVTA 4CYNA 5I0CA 2ZEPA 2WZNA 5K8OA 1DE4C 1FNOA 3KASA 3KGQA 4MBUA 4M6HA 4DYOA 2ZXVA 3PB4X 4LX9A 2Q4ZA 1QSMA 1VGYA 4PK3A 1EE3P 4AG7A 4OADA 8CPAA 1NE9A 1TIQA 2ZEGA 1HDUA 2XEIA 1QQ9A 1Y7RA 5K8PA 4FBEA 1CX8A 3KHXA 3KKWA 3SI0A 4EMEA 4CRYB 1M4LA 3B3TA 1KUVA 2PSWA 1Q7LA 3CXPA 3WC5A 4ZY2A 2AFSA 1TKJA 2CNTA 4I49A 4OC4A 3B3WA 5DWMA 3DR6A 3IJ3A 1BPNA 2HQYA 1Z8XA 4G1PA 1IY7A 2Q7SA 1IYKA 1XRYA 2OZUA 3PB8X 2IL4A 3DNSA 3VATA 1S7KA 4B13A 3I3GA 2Z3LA 4JXQA 2P0WA 3D68A 5J8FA 2FXFA 3BHXA 5J1QA 2Q7BA 2A4NA 4UCPA 2CTCA 2RFHA 2Z0ZA 4KOWA 4PV6A 3H5ZA 2ZOFA 3GYAA 3K9TA 4B10A 1PCAA 3BJ7A 4A39A 4UIBA
chains in the Genus database with same CATH topology
4XPDC 2O28A 2KCWA 2FIWA 4NEXA 1NMTA 4MY0A 4A31A 1SQHA 2DPTA 3TO7A 2B4DA 3CXSA 2B5GA 2C27A 2J8RA 3PP9A 2GE3A 3PGPA 2FCKA 4E0AA 2X7BA 4CAEA 2FSRA 2CXAA 2QMLA 4E8OA 2ZW6A 4JWPA 2QIRA 2PQ8A 1XE4A 2R98A 2FL4A 2Q04A 4B5PB 3FRMA 4UA3A 5A27A 4B12A 4FD4A 3BJ8A 3IWGA 4U9YA 3DDDA 2Q4VA 1YVOA 2D4OA 3FBUA 4JJXA 3EXNA 4MJ8A 4HNYB 5KTAA 3D8PA 2YGWA 4J3GA 5CNPA 5C88A 3RYOA 5GCNA 2CY2A 1IB1E 2JEVA 3TCVA 1I12A 1M4GA 3R96A 2CNSA 5G1ZA 3S6KA 5F49A 2I00A 2B3VA 4KOXA 4FD5A 1YVKA 4ZBGA 4QB9A 5IX3A 2B4BA 3NE7A 5EBVA 4CGPA 1P4NA 5KTCA 4KVME 4NCZA 3JTKA 4JXRA 2G0BA 1RO5A 4B11A 4C7IA 3T90A 4IUSA 1I1DA 4MFKA 1S60A 1M4IA 4CGMA 3D3SA 4HNXB 2FT0A 2PR1A 4A2ZA 4F0YA 4KLWA 3EO4A 1QSTA 1NSLA 3GKRA 3FYNA 2OH1A 2J8NA 4BBHA 1CJWA 4IF5A 1UFHA 2VQYA 5DWNA 3P2HA 4YRHA 3W6XA 2EVNA 4A30A 5J8CA 1MJAA 2BL1A 2REFA 3IU1A 4NXYA 2OB0A 4KUBA 3QB8A 4QUSA 4AVAA 5H84A 2Z3OA 2Q44A 1S7FA 4UFWA 4R9MA 2I79A 2NMTA 1RXTA 3FXTA 1B6BA 3JVNA 4AB7A 4UBRA 1KZFA 3IGRA 2VI7A 2PR8A 1VKCA 1VHSA 4UFXA 4CYQA 1WK4A 2RC4A 2AJ6A 3TOBA 5A28A 1KUYA 4CAFA 3TTHA 4C68A 2VEZA 3VWEA 4LUAA 5E96A 2Z3KA 1PUAA 2BEIA 4RI1A 3LD2A 1M1DA 2HUZA 2BUEA 3SXNA 1MJ9A 3C26A 4GS4A 2WSAA 4QC6A 1CM0A 3BLNA 3F0AA 4KOUA 4X5KA 4ONUA 2Z3PA 2H5MA 4KORA 4R87A 5AG5A 4KSAA 2FE7A 3ZZIA 1MK4A 2Q4YA 1YK3A 4KVOE 1BOBA 4Y49B 5IV0A 4MI4A 1XF8A 4A95A 4OLLA 3R9FA 1S5KA 3LODA 1Q2DA 3SXOA 3S6FA 3D2PA 2Z3MA 1YGHA 3D2MA 1QSNA 2WUUA 1N71A 2JLMA 2DXQA 2YNDA 4KLVA 2VXKA 5G21A 2AE6A 4KOYA 1FY7A 4AVBA 4YFJA 4XPKA 4U5YA 3FIXA 4AVCA 3TO6A 3TFYA 3IWEA 2ARHA 5F48A 4ZGYB 2Z11A 4II9A 4BMHA 1Z4RA 1R57A 1ZO0A 2Q0YA 3R9EA 4KVXA 4MFLA 4R3KA 4RS2A 4XNHB 4KS9A 3W91A 3TT2A 2R8VA 4A32A 2R7HA 2B3UA 1S7LA 4CRZB 1J4JA 4UWIA 2Y0MA 4MFQA 4UWJA 1Y9WA 4CAWA 1MJBA 4H6UA 2PDOA 4CS0B 3EY5A 5BWAB 3EFAA 1IICA 1Z9UA 2FS5A 4CGLA 2DPSA 5G20A 4C7HA 2J8MA 2OZHA 4C2ZA 4B5PA 4C2XA 4B14A 5ISVA 5IB0A 4DNCA 4KOVA 2YNCC 3S6GA 4FD7A 1KUXA 2PC1A 2ZW5A 1Q2CA 3N7ZA 3G8WA 4MFPA 2JDCA 4R57A 1GHEA 3W6SA 4KOSA 2OZGA 2P6GA 3TE4A 4PK2A 2ZW7A 2CNMA 3T9YA 3B8GA 3TOAA 4Q36A 3VWDA 1YX0A 3MGDA 1XIXA 3UY5A 3CXQA 5F46A 2F5IA 1YLEA 1M44A 3FB3A 3R1KA 3I9SA 4JLYA 1I21A 4KOTA 1ON0A 1YREA 3ZJ0A 5JPHA 4C2YA 4KUAA 1P0HA 1S7NA 4M85A 1BO4A 4OAEA 5H86A 2Z10A 3V8IA 4UCMA 4KZTA 4Y49C 4KSFA 1OZPA 4F0XA 4M3SA 3JUWA 1LRZA 2K5TA 5AG6A 3E0KA 4EVYA 1PU9A 3IU2A 1XEBA 3TO9A 4ORFA 4U9ZA 4CAXA 1Q2YA 5HMNA 3PZJA 5HH1A 2BSWA 4UFVA 2ATRA 3A9LA 1V0CA 3K9UA 4NSQA 2ZPAA 4AG9A 4L89A 2G3TA 5KTDA 2WPXA 4JD6A 1IYLA 1WWZA 3F8KA 2FIAA 2JDDA 2REEA 3F5BA 3P2FA 4UCNA 4MFZA 1QSOA 5C82A 5JQ4A 2EUIA 5G22A 1K4JA 2R1IA 2WPWA 4XPDB 3WR7A 4A33A 3EC4A 3R9GA 2ZW4A 1M4DA 2QECA 3FNCA 4F6AA 4CGNA 2GANA 4FD6A 3DSBA 2YNCA 4XNHC 3H4QA 2P6FA 1QSRA 4NF1A 3S6HA 4XPLA 4HNWB 4PSXA 4H89A 1S3ZA 4CGOA 1L0CA 4E2AA 2VZYA 5AGEA 2G3AA 2HV2A 5EC4A 3DR8A 4PSWA 4K30A 2D4PA 4HKFA 4YGOA 3QAHA 2OU2A 3R95A 2Z3NA 4CYPA 2GIVA 4CAVA 5F47A 1Y9KA 2VBQA 4H6ZA 1U6MA 1Z4EA 4CYOA 1YR0A 3OWCA 4Q38A 4MY3A 4L8AA 4R3LA 4QBJA 2B58A 3SHPA 4MFJA 2P6EA 1XMTA 3GY9A 4MHDA 1B87A 5FVJA 2B4DB 1IIDA 2B5GB 5AG7A 4B5OA 2VZZA 2YNEA 2PRBA 5AG4A 3G3SA 4QVTA 4CYNA 5I0CA 4MBUA 2ZXVA 4LX9A 1QSMA 4PK3A 4AG7A 4OADA 1NE9A 1TIQA 1Y7RA 3KKWA 4CRYB 3CXPA 1KUVA 2PSWA 2CNTA 4I49A 5DWMA 3DR6A 2HQYA 1IYKA 2OZUA 2IL4A 3DNSA 1S7KA 4B13A 3I3GA 2Z3LA 4JXQA 2P0WA 5J8FA 2FXFA 2Q7BA 2A4NA 4UCPA 2Z0ZA 4KOWA 4PV6A 3H5ZA 3GYAA 4B10A 3BJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPD C;  2O28 A;  2KCW A;  2FIW A;  4NEX A;  1NMT A;  4MY0 A;  1SQH A;  3TO7 A;  2B4D A;  3CXS A;  2B5G A;  2C27 A;  2J8R A;  3PP9 A;  2GE3 A;  3PGP A;  2FCK A;  4E0A A;  2X7B A;  2FSR A;  2QML A;  4E8O A;  2ZW6 A;  4JWP A;  2QIR A;  2PQ8 A;  1XE4 A;  2R98 A;  2FL4 A;  2Q04 A;  4B5P B;  3FRM A;  4UA3 A;  4FD4 A;  3BJ8 A;  3IWG A;  4U9Y A;  3DDD A;  2Q4V A;  1YVO A;  2D4O A;  3FBU A;  4JJX A;  3EXN A;  4MJ8 A;  4HNY B;  5KTA A;  3D8P A;  4J3G A;  5CNP A;  5C88 A;  3RYO A;  5GCN A;  2CY2 A;  1IB1 E;  2JEV A;  3TCV A;  1I12 A;  1M4G A;  3R96 A;  2CNS A;  3S6K A;  5F49 A;  2I00 A;  2B3V A;  4KOX A;  4FD5 A;  1YVK A;  4ZBG A;  4QB9 A;  5IX3 A;  2B4B A;  3NE7 A;  5EBV A;  1P4N A;  5KTC A;  4KVM E;  4NCZ A;  4JXR A;  2G0B A;  1RO5 A;  3T90 A;  4IUS A;  1I1D A;  1S60 A;  1M4I A;  3D3S A;  4HNX B;  2FT0 A;  2PR1 A;  4F0Y A;  4KLW A;  3EO4 A;  1QST A;  1NSL A;  3GKR A;  3FYN A;  2OH1 A;  2J8N A;  1CJW A;  4IF5 A;  1UFH A;  2VQY A;  5DWN A;  3P2H A;  4YRH A;  3W6X A;  2EVN A;  5J8C A;  1MJA A;  2BL1 A;  2REF A;  4NXY A;  4AVA A;  2OB0 A;  4KUB A;  3QB8 A;  4QUS A;  5H84 A;  2Q44 A;  1S7F A;  4R9M A;  2I79 A;  2NMT A;  1RXT A;  3FXT A;  1B6B A;  3JVN A;  4AB7 A;  4UBR A;  1KZF A;  3IGR A;  2VI7 A;  2PR8 A;  1VKC A;  1VHS A;  1WK4 A;  2RC4 A;  2AJ6 A;  3TOB A;  1KUY A;  3TTH A;  2VEZ A;  3VWE A;  4LUA A;  5E96 A;  1PUA A;  2BEI A;  4RI1 A;  3LD2 A;  1M1D A;  2HUZ A;  2BUE A;  3SXN A;  1MJ9 A;  3C26 A;  4GS4 A;  4QC6 A;  1CM0 A;  3BLN A;  3F0A A;  4KOU A;  4X5K A;  4ONU A;  2H5M A;  4KOR A;  4R87 A;  2FE7 A;  3ZZI A;  1MK4 A;  2Q4Y A;  1YK3 A;  4KVO E;  1BOB A;  4Y49 B;  5IV0 A;  4MI4 A;  1XF8 A;  4OLL A;  3R9F A;  1S5K A;  3LOD A;  1Q2D A;  3SXO A;  3S6F A;  3D2P A;  1YGH A;  3D2M A;  1QSN A;  1N71 A;  2JLM A;  2DXQ A;  4KLV A;  2VXK A;  2AE6 A;  4KOY A;  1FY7 A;  4AVB A;  4YFJ A;  4XPK A;  4U5Y A;  3FIX A;  4AVC A;  3TO6 A;  3TFY A;  5F48 A;  2ARH A;  2Z11 A;  4II9 A;  4BMH A;  1Z4R A;  1R57 A;  2Q0Y A;  3R9E A;  4KVX A;  4XNH B;  4R3K A;  4RS2 A;  3W91 A;  3TT2 A;  2R8V A;  2R7H A;  2B3U A;  1S7L A;  4CRZ B;  1J4J A;  4UWI A;  2Y0M A;  4UWJ A;  1Y9W A;  4CAW A;  1MJB A;  4H6U A;  2PDO A;  4CS0 B;  3EY5 A;  3EFA A;  1IIC A;  1Z9U A;  2FS5 A;  2J8M A;  2OZH A;  4B5P A;  5ISV A;  5IB0 A;  4DNC A;  4KOV A;  3S6G A;  4FD7 A;  1KUX A;  2PC1 A;  2ZW5 A;  1Q2C A;  3N7Z A;  3G8W A;  2JDC A;  4R57 A;  1GHE A;  3W6S A;  4KOS A;  2OZG A;  2P6G A;  3TE4 A;  4PK2 A;  2ZW7 A;  2CNM A;  3T9Y A;  3B8G A;  3TOA A;  3VWD A;  1YX0 A;  3MGD A;  1XIX A;  3UY5 A;  3CXQ A;  5F46 A;  2F5I A;  1YLE A;  1M44 A;  3FB3 A;  3R1K A;  3I9S A;  4JLY A;  1I21 A;  4KOT A;  1ON0 A;  1YRE A;  3ZJ0 A;  5JPH A;  4KUA A;  1P0H A;  1S7N A;  4M85 A;  1BO4 A;  4OAE A;  5H86 A;  2Z10 A;  3V8I A;  4KZT A;  4Y49 C;  1OZP A;  4M3S A;  3JUW A;  1LRZ A;  2K5T A;  3E0K A;  4EVY A;  1PU9 A;  1XEB A;  3TO9 A;  4ORF A;  4U9Z A;  4CAX A;  1Q2Y A;  5HMN A;  3PZJ A;  5HH1 A;  2BSW A;  2ATR A;  1V0C A;  3K9U A;  4NSQ A;  2ZPA A;  4AG9 A;  4L89 A;  2G3T A;  5KTD A;  2WPX A;  4JD6 A;  1IYL A;  1WWZ A;  3F8K A;  2FIA A;  2JDD A;  2REE A;  3F5B A;  3P2F A;  1QSO A;  5C82 A;  5JQ4 A;  2EUI A;  1K4J A;  2R1I A;  2WPW A;  4XPD B;  3WR7 A;  3EC4 A;  3R9G A;  2ZW4 A;  1M4D A;  2QEC A;  3FNC A;  4F6A A;  2GAN A;  4FD6 A;  3DSB A;  4XNH C;  3H4Q A;  2P6F A;  1QSR A;  4NF1 A;  3S6H A;  4XPL A;  4HNW B;  4PSX A;  4H89 A;  1S3Z A;  1L0C A;  4E2A A;  2VZY A;  2G3A A;  2HV2 A;  5EC4 A;  3DR8 A;  4PSW A;  4K30 A;  2D4P A;  4HKF A;  4YGO A;  3QAH A;  2OU2 A;  3R95 A;  2GIV A;  4CAV A;  5F47 A;  1Y9K A;  2VBQ A;  4H6Z A;  1U6M A;  1Z4E A;  1YR0 A;  3OWC A;  4MY3 A;  4L8A A;  4R3L A;  4QBJ A;  2B58 A;  3SHP A;  2P6E A;  1XMT A;  3GY9 A;  4MHD A;  1B87 A;  5FVJ A;  2B4D B;  1IID A;  2B5G B;  4B5O A;  2VZZ A;  2PRB A;  3G3S A;  4QVT A;  5I0C A;  4MBU A;  2ZXV A;  4LX9 A;  1QSM A;  4PK3 A;  4AG7 A;  4OAD A;  1NE9 A;  1TIQ A;  1Y7R A;  3KKW A;  4CRY B;  3CXP A;  1KUV A;  2PSW A;  2CNT A;  4I49 A;  5DWM A;  3DR6 A;  2HQY A;  1IYK A;  2OZU A;  2IL4 A;  3DNS A;  1S7K A;  3I3G A;  4JXQ A;  5J8F A;  2P0W A;  2FXF A;  2Q7B A;  2A4N A;  2Z0Z A;  4KOW A;  4PV6 A;  3GYA A;  3BJ7 A; 
#chains in the Genus database with same CATH topology
 4XPD C;  4FAI A;  2O28 A;  1ARL A;  4IAV A;  3PFE A;  2KCW A;  2FIW A;  4NEX A;  1NMT A;  2PJB A;  4MY0 A;  4A31 A;  1SQH A;  2DPT A;  1CPX A;  2C6C A;  2F8H A;  4MHY A;  5EMI A;  2B4D A;  3CXS A;  2B5G A;  3TO7 A;  5JGF A;  1YW6 A;  2C27 A;  2J8R A;  3PP9 A;  2GE3 A;  3PGP A;  2HC9 A;  2ZED A;  4P4E A;  4PXD A;  2C1C A;  1ZG9 A;  1VIX A;  2FCK A;  4A38 A;  2X7B A;  4E0A A;  4CAE A;  2FSR A;  2CXA A;  1TF8 A;  2JBJ A;  2XEG A;  3S9N A;  2QML A;  4E8O A;  1UWY A;  1Z8W A;  2ZW6 A;  3NH8 A;  4JWP A;  5CBM A;  2QIR A;  2PQ8 A;  3V7Z A;  1XE4 A;  2R98 A;  1LCP A;  2FL4 A;  3WC6 A;  2Q04 A;  4B5P B;  3FRM A;  4UA3 A;  2DF5 A;  3QNV A;  5A27 A;  3LAC A;  1JWQ A;  4B12 A;  2VL1 A;  4FD4 A;  3VH9 A;  3B3C A;  3BJ8 A;  4R8F A;  5F09 A;  3IWG A;  4U9Y A;  3DDD A;  2Q4V A;  3B7I A;  1YVO A;  2D4O A;  3FBU A;  1YME A;  4JJX A;  4NGS A;  2BO9 A;  3NH5 A;  3TC8 A;  1X12 A;  3EXN A;  2QJ8 A;  3CDX A;  4HNY B;  4MJ8 A;  5KTA A;  3D8P A;  3PB9 X;  2YGW A;  4J3G A;  5CNP A;  5C88 A;  3RYO A;  1LAM A;  5GCN A;  2CY2 A;  2PJ7 A;  1IB1 E;  3SJX A;  1ZG7 A;  2JEV A;  3TCV A;  1I12 A;  1M4G A;  3SI1 A;  3R96 A;  2CNS A;  5G1Z A;  3S6K A;  5F49 A;  2I00 A;  2B3V A;  4KOX A;  4LQG A;  4FD5 A;  1YVK A;  4ZBG A;  3H8F A;  2PJC A;  4NGR A;  1F2O A;  3GIU A;  2CF4 A;  3KR5 A;  1CP6 A;  3QAY A;  4UEZ A;  4QB9 A;  5IX3 A;  2EK9 A;  2B4B A;  3NE7 A;  5EBV A;  4CGP A;  1P4N A;  2FVG A;  3KR4 A;  4ZX9 A;  4KVM E;  3ISZ A;  3JTK A;  4NCZ A;  4P4F A;  5JM6 A;  5KTC A;  4JXR A;  3FMC A;  2ZEN A;  2G0B A;  2ZEH A;  2GU2 A;  2CIJ A;  3T8W A;  1RO5 A;  4B11 A;  5CPA A;  4C7I A;  3T90 A;  1VHE A;  4IUS A;  5HVF A;  1I1D A;  3B3V A;  4MFK A;  1AUG A;  1M4I A;  1S60 A;  1ZLI A;  3D3S A;  4CGM A;  3GUX A;  4B6Z A;  1BLL E;  1OBR A;  4HNX B;  2FT0 A;  2PR1 A;  4A2Z A;  4F0Y A;  4KLW A;  3EO4 A;  1QST A;  3FVL A;  1NSL A;  3GKR A;  3FYN A;  1XFO A;  2OH1 A;  2J8N A;  4OP4 A;  4BBH A;  2PJ8 A;  1R43 A;  1CJW A;  4P4D A;  4IF5 A;  1CG2 A;  1UFH A;  2PE3 A;  2VQY A;  5DWN A;  3P2H A;  1YSJ A;  4YRH A;  1A2Z A;  2EVN A;  4PPZ A;  1MJA A;  2BL1 A;  2REF A;  3IU1 A;  4NXY A;  2OB0 A;  3D7F A;  3QB8 A;  4KUB A;  3KQX A;  3BI0 A;  4QUS A;  5H84 A;  2Z3O A;  2F7V A;  2Q44 A;  1S7F A;  2IJZ A;  3BXM A;  4UFW A;  4BD9 A;  4R9M A;  2PCU A;  2I79 A;  3NA6 A;  4X2T A;  2NMT A;  2V77 A;  1RXT A;  3FXT A;  3LMS A;  3NFZ A;  4P44 A;  1B6B A;  3JVN A;  4AB7 A;  3KL9 A;  2ANP A;  4UBR A;  1KZF A;  4OIW A;  2PIZ A;  5JH9 A;  3IGR A;  2AFX A;  2PR8 A;  2VI7 A;  1VKC A;  2ODF A;  2V8D A;  1VHS A;  4UFX A;  2PJ5 A;  4CYQ A;  1WK4 A;  2C6P A;  2RC4 A;  4ZY0 A;  2AJ6 A;  2OOT A;  3SJE A;  3D66 A;  2ZEF A;  3TOB A;  1VHO A;  4HPS A;  5A28 A;  3WAB A;  1KUY A;  4OID A;  4CAF A;  3TTH A;  2CTB A;  4OME A;  2VEZ A;  4C68 A;  4DJL A;  3FF3 A;  3K2K A;  1YLO A;  3VWE A;  4LUA A;  5E96 A;  2Z3K A;  1PUA A;  3IC1 A;  2O4H A;  3IFE A;  2BEI A;  4PQA A;  4RI1 A;  3LD2 A;  4O23 A;  1M1D A;  2HUZ A;  2BUE A;  3SXN A;  4ZY1 A;  1AMP A;  1MJ9 A;  3C26 A;  2IQ6 A;  3TX8 A;  2GLJ A;  4K3N A;  2DEA A;  4GS4 A;  4MCR A;  5J8C A;  2WSA A;  3N5F A;  1CM0 A;  4QC6 A;  2NSM A;  3BLN A;  3F0A A;  4KOU A;  4R76 A;  4X5K A;  4MCS A;  4FWU A;  4ONU A;  1F57 A;  2V8H A;  2Z3P A;  4UEE A;  2BCO A;  2H5M A;  3IO1 A;  4M6I A;  1ARM A;  2PJ9 A;  3PEI A;  4KOR A;  4PXE A;  4MHN A;  4R87 A;  4KSA A;  5AG5 A;  1HDQ A;  4MRI A;  3PBB A;  2FE7 A;  3B2Y A;  2RB7 A;  3ISX A;  2PJ6 A;  3ZZI A;  1MK4 A;  3KI9 A;  2Q4Y A;  1TXR A;  1YK3 A;  1BOB A;  4KVO E;  4Y49 B;  5IV0 A;  3S9L A;  4MI4 A;  1XF8 A;  4A95 A;  4OLL A;  4OC2 A;  3R9F A;  1S5K A;  3LOD A;  1Q2D A;  3SXO A;  4AXV A;  3D4U A;  4OC1 A;  3S6F A;  2PJ0 A;  3CPA A;  4RN7 A;  2XEJ A;  3D2P A;  2Z3M A;  1XBU A;  1YGH A;  3S9M A;  3D2M A;  4UEF A;  2EK8 A;  5K8N A;  1QSN A;  2WUU A;  2OR4 A;  1CBX A;  4XNH C;  1ELM P;  3FED A;  5DS0 A;  1N71 A;  2JLM A;  2DXQ A;  2YND A;  4KLV A;  1IOF A;  4UIA A;  2VXK A;  4R7M A;  2PVW A;  6CPA A;  2HB6 A;  3GB0 A;  1GYT A;  2AE6 A;  5G21 A;  2ZEM A;  1FY7 A;  2I3C A;  4KOY A;  4AVB A;  2XEF A;  4AVA A;  4YFJ A;  1DTD A;  2AFO A;  4XPK A;  4U5Y A;  3FIX A;  4AVC A;  3FEC A;  5HVH A;  3TO6 A;  4X3R A;  3TFY A;  3IWE A;  2ARH A;  5F48 A;  4ZGY B;  3PB7 X;  3PBE A;  2Z11 A;  4W9Y A;  4II9 A;  4NGQ A;  4BMH A;  1Z4R A;  2C6G A;  1R57 A;  1ZO0 A;  2Q0Y A;  3B3S A;  3R9E A;  4KVX A;  1TKH A;  4YU9 A;  4MFL A;  4GXH A;  4MHP A;  4R3K A;  4RS2 A;  4KS9 A;  4XNH B;  3W91 A;  3JRU A;  3TT2 A;  1PYT B;  2PIY A;  2R8V A;  3NE8 A;  2R7H A;  4A32 A;  3V38 A;  2B3U A;  5D29 A;  1LAN A;  1S7L A;  4CRZ B;  1J4J A;  4UWI A;  4DUK A;  2GLF A;  2Y0M A;  3PRT A;  4IK2 A;  4MCP A;  3RO0 A;  4MFQ A;  4FUU A;  7CPA A;  4MXU A;  4UWJ A;  5HVG A;  1Y9W A;  4LQ6 A;  4CAW A;  1MJB A;  4H6U A;  2PDO A;  4CS0 B;  3EY5 A;  5BWA B;  1XMB A;  3I1U A;  2EWB A;  3EFA A;  1IIC A;  1Z9U A;  2FS5 A;  5D8N A;  4CGL A;  2DPS A;  4P4J A;  5G20 A;  4C7H A;  1ZG8 A;  2J8M A;  2OZH A;  4C2Z A;  1NSA A;  4F9U A;  5HXD A;  4ZI6 A;  4B5P A;  4C2X A;  4B14 A;  5ISV A;  4WWV A;  5IB0 A;  3H8G A;  4DNC A;  4KOV A;  2YNC C;  3PB6 X;  3S6G A;  4FD7 A;  3IWW A;  1KUX A;  3CZX A;  2PC1 A;  4OC0 A;  4JYW A;  2ZW5 A;  4OC3 A;  1ELL P;  1Q2C A;  1LAP A;  3N7Z A;  3G8W A;  4MFP A;  2JDC A;  4R57 A;  3LWU A;  1ZLH A;  1GHE A;  2EBJ A;  4P4I A;  3W6S A;  4KOS A;  2OZG A;  2P6G A;  3TE4 A;  4PK2 A;  2ZW7 A;  1IGB A;  1HEE A;  1CPS A;  4X8I A;  2CNM A;  4M6G A;  3B8G A;  3T9Y A;  3TOA A;  1LFW A;  4Q36 A;  1Z8T A;  3MRU A;  4NGP A;  1YX0 A;  3MGD A;  4TWE A;  3VWD A;  1XIX A;  2POK A;  3UY5 A;  2PRQ A;  3CXQ A;  3SJG A;  5I4M A;  5F46 A;  1Z5R A;  2AFZ A;  2F5I A;  3IIB A;  1CP7 A;  1X10 A;  1YLE A;  1M44 A;  3FB3 A;  4KSI A;  3R1K A;  3I9S A;  4JLY A;  1I21 A;  4P10 A;  4KOT A;  4P45 A;  1ON0 A;  1YRE A;  3D67 A;  3ZJ0 A;  5JPH A;  4C2Y A;  4KUA A;  4IHM A;  1P0H A;  5LRG A;  1S7N A;  4NGN A;  4M85 A;  4A94 A;  2AFM A;  1BO4 A;  4P6Y A;  4OAE A;  3SI2 A;  5K8M A;  3D7D A;  5H86 A;  3KZW A;  5LYD A;  2Z10 A;  3V8I A;  4R6T A;  3W6X A;  4UCM A;  1TF9 A;  2Q51 A;  4A30 A;  4KZT A;  2G9D A;  4Y49 C;  3D7H A;  3RAM A;  4KSF A;  1OZP A;  1QMU A;  4M3S A;  3RNZ A;  4BIN A;  4F0X A;  3JUW A;  1LRZ A;  2K5T A;  4NGT A;  2ZEL A;  5AG6 A;  3E0K A;  4EVY A;  3FH4 A;  1PU9 A;  4CPA A;  3IU2 A;  4F9V A;  1XEB A;  3TO9 A;  4ORF A;  4PXC A;  4U9Z A;  4CAX A;  4ZX8 A;  1Q2Y A;  5HMN A;  1H8L A;  1Z8L A;  3PZJ A;  5HH1 A;  4A37 A;  2BSW A;  2O53 A;  2NYQ A;  1Y0R A;  2ATR A;  3A9L A;  1V0C A;  1RTQ A;  3K9U A;  4NSQ A;  4UFV A;  2V8V A;  3RBU A;  2ZPA A;  4AG9 A;  1TKF A;  4L89 A;  2G3T A;  2V8G A;  3L2N A;  5KTD A;  4YWY A;  2J9A A;  2WPX A;  4OC5 A;  4JD6 A;  1IYL A;  2PVV A;  1WWZ A;  3D7G A;  2JEW A;  3F8K A;  2FIA A;  2JDD A;  2REE A;  3F5B A;  3P2F A;  4UCN A;  3KHZ A;  4MFZ A;  1QSO A;  4ONW A;  5C82 A;  2JBK A;  3VAR A;  5JQ4 A;  2EUI A;  3IEH A;  2ABZ A;  4EWT A;  5G22 A;  1K4J A;  2QVP A;  1F2P A;  3CPX A;  3DGV A;  3FJU A;  3WC7 A;  1IOI A;  2AFW A;  2R1I A;  2WPW A;  1LOK A;  4XPD B;  2GRE A;  3SJF A;  2PJ4 A;  4TNU A;  3WR7 A;  4A33 A;  3EC4 A;  2WYR A;  2ZW4 A;  1M4D A;  2QEC A;  3FNC A;  2PJ1 A;  2ZEO A;  4OKO A;  3R9G A;  2GAN A;  3B35 A;  2YNC A;  3DSB A;  4FD6 A;  2QYV A;  4WJB A;  3H4Q A;  2P6F A;  1QSR A;  4NF1 A;  3S6H A;  4ZYQ A;  3H8E A;  4XPL A;  3DLJ A;  4HNW B;  4RUH A;  4PSX A;  4H89 A;  1S3Z A;  4CGO A;  1L0C A;  4E2A A;  2VZY A;  5AGE A;  2G3A A;  5LRJ A;  2AFU A;  2HV2 A;  5EC4 A;  5ELY A;  3DR8 A;  4Q7A A;  1JQG A;  4NFR A;  4PSW A;  1IU8 A;  4K30 A;  1AYE A;  4NGM A;  1BPM A;  2PJ3 A;  2D4P A;  4HKF A;  4YGO A;  2PJ2 A;  3QAH A;  2OU2 A;  3R95 A;  2Z3N A;  4CYP A;  1R3N A;  1YW4 A;  2GIV A;  4CAV A;  4MMO A;  5F47 A;  1Y9K A;  2GFQ A;  2VBQ A;  4H6Z A;  2BOA A;  1U6M A;  1Z4E A;  4MCQ A;  3FEE A;  4CYO A;  4Z65 A;  1YR0 A;  3OWC A;  4F8Z A;  4H2K A;  1BAV A;  4JZ0 A;  4Q38 A;  4MY3 A;  4F6A A;  4L8A A;  4PXB A;  3FX6 A;  5LYF A;  2PJA A;  4R3L A;  4QBJ A;  4GM5 A;  2B58 A;  4CGN A;  3KQZ A;  3PFO A;  3GLJ A;  2ZOG A;  3SHP A;  5IB9 A;  3BI1 A;  1Y0Y A;  2Q43 A;  4MFJ A;  5LYI A;  2P6E A;  1XMT A;  3RZA A;  1YQE A;  1XJO A;  4MHZ A;  4UF4 A;  3GY9 A;  4MHD A;  1B87 A;  3CT9 A;  3NH4 A;  4P4B A;  3HUV A;  2EO8 A;  5LRK A;  1Y7E A;  5FVJ A;  2B4D B;  5LYL A;  1FT7 A;  1IID A;  2B5G B;  5THW A;  3WT4 A;  5AG7 A;  2ZEE A;  2VZZ A;  2YNE A;  4B5O A;  1KWM A;  2IMO A;  2PRB A;  4NJR A;  1Z2L A;  3MN8 A;  5AG4 A;  3HLP A;  3G3S A;  1XOV A;  4NJQ A;  4EFD A;  4QVT A;  4CYN A;  5I0C A;  2ZEP A;  2WZN A;  5K8O A;  1DE4 C;  1FNO A;  3KAS A;  3KGQ A;  4MBU A;  4M6H A;  4DYO A;  2ZXV A;  3PB4 X;  4LX9 A;  2Q4Z A;  1QSM A;  1VGY A;  4PK3 A;  1EE3 P;  4AG7 A;  4OAD A;  8CPA A;  1NE9 A;  1TIQ A;  2ZEG A;  1HDU A;  2XEI A;  1QQ9 A;  1Y7R A;  5K8P A;  4FBE A;  1CX8 A;  3KHX A;  3KKW A;  3SI0 A;  4EME A;  4CRY B;  1M4L A;  3B3T A;  1KUV A;  2PSW A;  1Q7L A;  3CXP A;  3WC5 A;  4ZY2 A;  2AFS A;  1TKJ A;  2CNT A;  4I49 A;  4OC4 A;  3B3W A;  5DWM A;  3DR6 A;  3IJ3 A;  1BPN A;  2HQY A;  1Z8X A;  4G1P A;  1IY7 A;  2Q7S A;  1IYK A;  1XRY A;  2OZU A;  3PB8 X;  2IL4 A;  3DNS A;  3VAT A;  1S7K A;  4B13 A;  3I3G A;  2Z3L A;  4JXQ A;  2P0W A;  3D68 A;  5J8F A;  2FXF A;  3BHX A;  5J1Q A;  2Q7B A;  2A4N A;  4UCP A;  2CTC A;  2RFH A;  2Z0Z A;  4KOW A;  4PV6 A;  3H5Z A;  2ZOF A;  3GYA A;  3K9T A;  4B10 A;  1PCA A;  3BJ7 A;  4A39 A;  4UIB A; 
#chains in the Genus database with same CATH homology
 4XPD C;  2O28 A;  2KCW A;  2FIW A;  4NEX A;  1NMT A;  4MY0 A;  4A31 A;  1SQH A;  2DPT A;  3TO7 A;  2B4D A;  3CXS A;  2B5G A;  2C27 A;  2J8R A;  3PP9 A;  2GE3 A;  3PGP A;  2FCK A;  4E0A A;  2X7B A;  4CAE A;  2FSR A;  2CXA A;  2QML A;  4E8O A;  2ZW6 A;  4JWP A;  2QIR A;  2PQ8 A;  1XE4 A;  2R98 A;  2FL4 A;  2Q04 A;  4B5P B;  3FRM A;  4UA3 A;  5A27 A;  4B12 A;  4FD4 A;  3BJ8 A;  3IWG A;  4U9Y A;  3DDD A;  2Q4V A;  1YVO A;  2D4O A;  3FBU A;  4JJX A;  3EXN A;  4MJ8 A;  4HNY B;  5KTA A;  3D8P A;  2YGW A;  4J3G A;  5CNP A;  5C88 A;  3RYO A;  5GCN A;  2CY2 A;  1IB1 E;  2JEV A;  3TCV A;  1I12 A;  1M4G A;  3R96 A;  2CNS A;  5G1Z A;  3S6K A;  5F49 A;  2I00 A;  2B3V A;  4KOX A;  4FD5 A;  1YVK A;  4ZBG A;  4QB9 A;  5IX3 A;  2B4B A;  3NE7 A;  5EBV A;  4CGP A;  1P4N A;  5KTC A;  4KVM E;  4NCZ A;  3JTK A;  4JXR A;  2G0B A;  1RO5 A;  4B11 A;  4C7I A;  3T90 A;  4IUS A;  1I1D A;  4MFK A;  1S60 A;  1M4I A;  4CGM A;  3D3S A;  4HNX B;  2FT0 A;  2PR1 A;  4A2Z A;  4F0Y A;  4KLW A;  3EO4 A;  1QST A;  1NSL A;  3GKR A;  3FYN A;  2OH1 A;  2J8N A;  4BBH A;  1CJW A;  4IF5 A;  1UFH A;  2VQY A;  5DWN A;  3P2H A;  4YRH A;  3W6X A;  2EVN A;  4A30 A;  5J8C A;  1MJA A;  2BL1 A;  2REF A;  3IU1 A;  4NXY A;  2OB0 A;  4KUB A;  3QB8 A;  4QUS A;  4AVA A;  5H84 A;  2Z3O A;  2Q44 A;  1S7F A;  4UFW A;  4R9M A;  2I79 A;  2NMT A;  1RXT A;  3FXT A;  1B6B A;  3JVN A;  4AB7 A;  4UBR A;  1KZF A;  3IGR A;  2VI7 A;  2PR8 A;  1VKC A;  1VHS A;  4UFX A;  4CYQ A;  1WK4 A;  2RC4 A;  2AJ6 A;  3TOB A;  5A28 A;  1KUY A;  4CAF A;  3TTH A;  4C68 A;  2VEZ A;  3VWE A;  4LUA A;  5E96 A;  2Z3K A;  1PUA A;  2BEI A;  4RI1 A;  3LD2 A;  1M1D A;  2HUZ A;  2BUE A;  3SXN A;  1MJ9 A;  3C26 A;  4GS4 A;  2WSA A;  4QC6 A;  1CM0 A;  3BLN A;  3F0A A;  4KOU A;  4X5K A;  4ONU A;  2Z3P A;  2H5M A;  4KOR A;  4R87 A;  5AG5 A;  4KSA A;  2FE7 A;  3ZZI A;  1MK4 A;  2Q4Y A;  1YK3 A;  4KVO E;  1BOB A;  4Y49 B;  5IV0 A;  4MI4 A;  1XF8 A;  4A95 A;  4OLL A;  3R9F A;  1S5K A;  3LOD A;  1Q2D A;  3SXO A;  3S6F A;  3D2P A;  2Z3M A;  1YGH A;  3D2M A;  1QSN A;  2WUU A;  1N71 A;  2JLM A;  2DXQ A;  2YND A;  4KLV A;  2VXK A;  5G21 A;  2AE6 A;  4KOY A;  1FY7 A;  4AVB A;  4YFJ A;  4XPK A;  4U5Y A;  3FIX A;  4AVC A;  3TO6 A;  3TFY A;  3IWE A;  2ARH A;  5F48 A;  4ZGY B;  2Z11 A;  4II9 A;  4BMH A;  1Z4R A;  1R57 A;  1ZO0 A;  2Q0Y A;  3R9E A;  4KVX A;  4MFL A;  4R3K A;  4RS2 A;  4XNH B;  4KS9 A;  3W91 A;  3TT2 A;  2R8V A;  4A32 A;  2R7H A;  2B3U A;  1S7L A;  4CRZ B;  1J4J A;  4UWI A;  2Y0M A;  4MFQ A;  4UWJ A;  1Y9W A;  4CAW A;  1MJB A;  4H6U A;  2PDO A;  4CS0 B;  3EY5 A;  5BWA B;  3EFA A;  1IIC A;  1Z9U A;  2FS5 A;  4CGL A;  2DPS A;  5G20 A;  4C7H A;  2J8M A;  2OZH A;  4C2Z A;  4B5P A;  4C2X A;  4B14 A;  5ISV A;  5IB0 A;  4DNC A;  4KOV A;  2YNC C;  3S6G A;  4FD7 A;  1KUX A;  2PC1 A;  2ZW5 A;  1Q2C A;  3N7Z A;  3G8W A;  4MFP A;  2JDC A;  4R57 A;  1GHE A;  3W6S A;  4KOS A;  2OZG A;  2P6G A;  3TE4 A;  4PK2 A;  2ZW7 A;  2CNM A;  3T9Y A;  3B8G A;  3TOA A;  4Q36 A;  3VWD A;  1YX0 A;  3MGD A;  1XIX A;  3UY5 A;  3CXQ A;  5F46 A;  2F5I A;  1YLE A;  1M44 A;  3FB3 A;  3R1K A;  3I9S A;  4JLY A;  1I21 A;  4KOT A;  1ON0 A;  1YRE A;  3ZJ0 A;  5JPH A;  4C2Y A;  4KUA A;  1P0H A;  1S7N A;  4M85 A;  1BO4 A;  4OAE A;  5H86 A;  2Z10 A;  3V8I A;  4UCM A;  4KZT A;  4Y49 C;  4KSF A;  1OZP A;  4F0X A;  4M3S A;  3JUW A;  1LRZ A;  2K5T A;  5AG6 A;  3E0K A;  4EVY A;  1PU9 A;  3IU2 A;  1XEB A;  3TO9 A;  4ORF A;  4U9Z A;  4CAX A;  1Q2Y A;  5HMN A;  3PZJ A;  5HH1 A;  2BSW A;  4UFV A;  2ATR A;  3A9L A;  1V0C A;  3K9U A;  4NSQ A;  2ZPA A;  4AG9 A;  4L89 A;  2G3T A;  5KTD A;  2WPX A;  4JD6 A;  1IYL A;  1WWZ A;  3F8K A;  2FIA A;  2JDD A;  2REE A;  3F5B A;  3P2F A;  4UCN A;  4MFZ A;  1QSO A;  5C82 A;  5JQ4 A;  2EUI A;  5G22 A;  1K4J A;  2R1I A;  2WPW A;  4XPD B;  3WR7 A;  4A33 A;  3EC4 A;  3R9G A;  2ZW4 A;  1M4D A;  2QEC A;  3FNC A;  4F6A A;  4CGN A;  2GAN A;  4FD6 A;  3DSB A;  2YNC A;  4XNH C;  3H4Q A;  2P6F A;  1QSR A;  4NF1 A;  3S6H A;  4XPL A;  4HNW B;  4PSX A;  4H89 A;  1S3Z A;  4CGO A;  1L0C A;  4E2A A;  2VZY A;  5AGE A;  2G3A A;  2HV2 A;  5EC4 A;  3DR8 A;  4PSW A;  4K30 A;  2D4P A;  4HKF A;  4YGO A;  3QAH A;  2OU2 A;  3R95 A;  2Z3N A;  4CYP A;  2GIV A;  4CAV A;  5F47 A;  1Y9K A;  2VBQ A;  4H6Z A;  1U6M A;  1Z4E A;  4CYO A;  1YR0 A;  3OWC A;  4Q38 A;  4MY3 A;  4L8A A;  4R3L A;  4QBJ A;  2B58 A;  3SHP A;  4MFJ A;  2P6E A;  1XMT A;  3GY9 A;  4MHD A;  1B87 A;  5FVJ A;  2B4D B;  1IID A;  2B5G B;  5AG7 A;  4B5O A;  2VZZ A;  2YNE A;  2PRB A;  5AG4 A;  3G3S A;  4QVT A;  4CYN A;  5I0C A;  4MBU A;  2ZXV A;  4LX9 A;  1QSM A;  4PK3 A;  4AG7 A;  4OAD A;  1NE9 A;  1TIQ A;  1Y7R A;  3KKW A;  4CRY B;  3CXP A;  1KUV A;  2PSW A;  2CNT A;  4I49 A;  5DWM A;  3DR6 A;  2HQY A;  1IYK A;  2OZU A;  2IL4 A;  3DNS A;  1S7K A;  4B13 A;  3I3G A;  2Z3L A;  4JXQ A;  2P0W A;  5J8F A;  2FXF A;  2Q7B A;  2A4N A;  4UCP A;  2Z0Z A;  4KOW A;  4PV6 A;  3H5Z A;  3GYA A;  4B10 A;  3BJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...