4XPDC

Crystal structure of yeast n-terminal acetyltransferase nate (ppgpp) in complex with a bisubstrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
155
Chain Sequence
RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDVHFTQMAYYSEIPVGGLVAKLVPLSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
publication title Crystal structure of yeast N-terminal acetyltransferase NatE (ppGpp) in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 39
structure length 155
sequence length 174
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xpdC00
3TCVA 4UBRA 3C26A 3K9UA 2VQYA 3FYNA 3TE4A 3D3SA 1IB1E 2PQ8A 1VKCA 4XPLA 2OU2A 4DNCA 2OZGA 1TIQA 4H89A 5F47A 2D4OA 2VXKA 4RI1A 4CRZB 1N71A 4HKFA 2OZHA 2B3UA 2B5GB 3B8GA 3RYOA 2Q7BA 4LX9A 3MGDA 3KKWA 3BJ7A 2F5IA 5EC4A 4KUBA 4U9ZA 1IICA 5KTAA 4E2AA 1YK3A 2B3VA 4CAXA 1YVKA 2VEZA 1I12A 1UFHA 1XEBA 3F8KA 3H4QA 4XPDB 5J8FA 1IYKA 2G0BA 4JD6A 4E8OA 3D2PA 3T9YA 2R1IA 1PUAA 1S60A 1M4DA 3G8WA 5DWMA 1Y9KA 2OZUA 4E0AA 4KLVA 4UWIA 4EVYA 3TO6A 3EFAA 4MY0A 4XPDC 3SXNA 1MK4A 3D2MA 2P6FA 2IL4A 1QSNA 3DNSA 2ZW6A 4YGOA 5CNPA 3S6KA 2Q0YA 2FIAA 3CXPA 1I1DA 4KOWA 2C27A 4MI4A 1S7FA 2QECA 5GCNA 2REFA 4QB9A 5DWNA 3R9GA 3DDDA 4HNYB 4UWJA 4FD6A 1R57A 5H86A 3TO7A 1IYLA 5ISVA 2WPXA 2DXQA 1Q2DA 2R7HA 4XPKA 4UA3A 4ORFA 5HH1A 2ZPAA 2FS5A 2R98A 3S6FA 3TOBA 2FL4A 1NSLA 3DR8A 2JEVA 3ZJ0A 2KCWA 3BJ8A 3TOAA 3VWEA 1MJBA 3ZZIA 2B4DA 2FIWA 1WK4A 2OB0A 3SHPA 1NE9A 4KOYA 4RS2A 4OAEA 3TFYA 3E0KA 1ON0A 2A4NA 3EY5A 2AE6A 2D4PA 2Q4VA 3FBUA 1YR0A 3I3GA 2BL1A 3EXNA 4OLLA 4F0YA 4KORA 5KTCA 4KVXA 1Q2CA 1YGHA 2NMTA 2ARHA 1XMTA 5IV0A 4KVME 3F5BA 4PK3A 4K30A 3FNCA 4AVCA 3N7ZA 3FRMA 4MBUA 4M3SA 3P2FA 4HNWB 4CAVA 1S7LA 1NMTA 1QSOA 1B6BA 5F49A 1LRZA 2BEIA 3G3SA 4B5PB 3SXOA 4PSXA 5E96A 2QIRA 1XE4A 4FD7A 4LUAA 2Y0MA 4AG9A 1J4JA 1S5KA 3LODA 4YRHA 4BMHA 4IUSA 1KUVA 4OADA 5IX3A 2CNSA 5JPHA 4R87A 5C82A 4PSWA 1S7KA 2Z11A 5F48A 3S6GA 2HV2A 4J3GA 3R1KA 1P4NA 4II9A 3UY5A 3JUWA 2ZW5A 2I00A 1CM0A 1RXTA 2PDOA 2FE7A 4NSQA 1FY7A 2P6EA 1Z4RA 2J8MA 2EVNA 3GY9A 4KUAA 4H6ZA 5EBVA 2HQYA 1Y7RA 1YVOA 3PZJA 1M4IA 5J8CA 5F46A 4B5OA 4JXQA 3QAHA 4R9MA 2P0WA 5I0CA 2VBQA 4KVOE 2B4BA 3R96A 1YREA 1MJ9A 4IF5A 3BLNA 4Y49B 4KOVA 4YFJA 1K4JA 3FIXA 3TO9A 1WWZA 2G3TA 4NXYA 2PC1A 2PRBA 3CXSA 1V0CA 1L0CA 2ZXVA 1M4GA 4R3LA 3S6HA 2G3AA 3EC4A 2GANA 4JLYA 2RC4A 4Y49C 1BO4A 5IB0A 3OWCA 3IWGA 3W91A 2CNTA 2P6GA 4JWPA 4QVTA 2ATRA 4PV6A 1OZPA 3T90A 3FB3A 3R95A 2Z10A 4XNHB 3TTHA 3W6SA 1QSRA 4NEXA 1S3ZA 4HNXB 1M1DA 3R9FA 2ZW7A 2EUIA 2R8VA 3QB8A 2CY2A 4F6AA 3CXQA 2FT0A 2AJ6A 4AG7A 4XNHC 4M85A 1SQHA 1Z9UA 4U5YA 1CJWA 4L89A 3NE7A 3TT2A 4L8AA 2VI7A 2Z0ZA 4GS4A 4CAWA 1BOBA 2JDDA 2PR1A 2ZW4A 3V8IA 4JJXA 4MY3A 3EO4A 5HMNA 5FVJA 4NCZA 4JXRA 3IGRA 1P0HA 4AVAA 2J8NA 2B4DB 3R9EA 1KZFA 1KUYA 1I21A 4QUSA 3WR7A 1U6MA 4MHDA 1IIDA 4CRYB 1XF8A 2PR8A 2GIVA 2B5GA 2PSWA 3W6XA 4KOXA 2WPWA 4H6UA 1MJAA 3GYAA 1PU9A 2OH1A 1S7NA 4NF1A 2VZZA 4KZTA 5H84A 1QSMA 5KTDA 2JDCA 4B5PA 4KOTA 2K5TA 4FD4A 3I9SA 5JQ4A 4ONUA 2X7BA 1YX0A 1Q2YA 4I49A 2HUZA 4QC6A 2Q44A 2BUEA 1QSTA 3GKRA 4R57A 1B87A 3PP9A 4ZBGA 2BSWA 2FSRA 2O28A 4X5KA 3D8PA 2CNMA 4CS0B 2FXFA 1YLEA 3DR6A 4MJ8A 2GE3A 1XIXA 4KLWA 3P2HA 3VWDA 2JLMA 2VZYA 1M44A 2Q4YA 4R3KA 2Q04A 4AVBA 2REEA 4U9YA 2B58A 4KOSA 2FCKA 2QMLA 2J8RA 4QBJA 1GHEA 3LD2A 3FXTA 3PGPA 1Y9WA 2H5MA 1VHSA 3DSBA 1Z4EA 3F0AA 4AB7A 4PK2A 1KUXA 1RO5A 5C88A 4FD5A 3JVNA 2I79A 4KOUA
chains in the Genus database with same CATH superfamily
3TCVA 4UBRA 2PVWA 3C26A 1R3NA 1IOIA 1CPXA 3CPXA 1BLLE 1TXRA 2VQYA 3K9UA 3FYNA 5G22A 3TE4A 3D3SA 2IMOA 4OC2A 1IB1E 4HPSA 2PQ8A 4AXVA 2FVGA 3FVLA 3SI1A 1VKCA 4XPLA 5K8NA 2OU2A 3CPAA 4ZX9A 4DNCA 2OZGA 2VL1A 4UIBA 4X2TA 1TIQA 1FNOA 1BAVA 1IU8A 4H89A 2DPTA 2O4HA 5F47A 2D4OA 4CYPA 2VXKA 4ZYQA 4UEZA 4RI1A 4CRZB 1N71A 4HKFA 1ZG7A 2RB7A 4MHNA 2RFHA 4MFQA 2OZHA 1YLOA 3KZWA 3TC8A 3V38A 2B3UA 2B5GB 4PXEA 3B8GA 2DF5A 2Q7BA 3RYOA 4LX9A 2OOTA 3MGDA 1CG2A 3KKWA 4OC0A 4P6YA 3BJ7A 1PYTB 2F5IA 2PJAA 4CAFA 1RTQA 5EC4A 4KUBA 4U9ZA 1IICA 5KTAA 4E2AA 1Y7EA 1YK3A 4B13A 2B3VA 3ISZA 4CAXA 1YVKA 2VEZA 4CGOA 1I12A 3IWWA 3PEIA 2QVPA 1IY7A 1UFHA 1XEBA 3BHXA 3F8KA 4KSFA 1EE3P 4NGQA 4OIWA 1Z5RA 3H4QA 2EBJA 4XPDB 5J8FA 2HC9A 1IYKA 3IO1A 2G0BA 4JD6A 4E8OA 3FF3A 3D2PA 3T9YA 2ZEFA 4NGSA 3T8WA 2R1IA 1PUAA 4NJQA 4OC3A 2EK9A 1S60A 3B7IA 3NH5A 1M4DA 3DGVA 2C1CA 3G8WA 5DWMA 4UFVA 1Y9KA 3SJXA 2OZUA 4RUHA 4E0AA 4UF4A 1CX8A 4UFWA 3IU2A 4KLVA 1YQEA 2ZEPA 4UWIA 4EVYA 1QMUA 2QJ8A 3TO6A 3EFAA 4MCRA 4MY0A 4NGMA 4P4JA 1DE4C 3KASA 4XPDC 4EMEA 4BINA 3H8EA 3SXNA 4CPAA 1MK4A 3LWUA 2CTCA 4KSAA 3D2MA 2P6FA 2IL4A 1QSNA 3FEDA 3DNSA 2ZW6A 3KL9A 4Q38A 4YGOA 3B3TA 5CNPA 3S6KA 3RBUA 4A94A 2Q0YA 2FIAA 3CXPA 5JH9A 1I1DA 3D7FA 3FECA 4KOWA 2C27A 1Z8XA 1S7FA 4MI4A 2QECA 1HDQA 2J9AA 4Q7AA 4CYQA 4ZI6A 4CGNA 2PJ6A 5GCNA 1FT7A 3NFZA 3QNVA 2CF4A 2REFA 4QB9A 5DWNA 3R9GA 3DDDA 4HNYB 4UWJA 4FD6A 1R57A 3NH8A 5H86A 3RAMA 4WJBA 3TO7A 3WT4A 3FH4A 1IYLA 4A2ZA 5K8MA 5ISVA 2V8DA 2PIYA 4OC5A 2WPXA 2DXQA 1Q2DA 1CP7A 2R7HA 1F57A 2PJ3A 2F7VA 4XPKA 4UA3A 4ORFA 4OIDA 2CIJA 4MRIA 5HH1A 2ZPAA 4C7IA 5K8OA 2AFXA 2FS5A 3VATA 1XMBA 1Z2LA 2R98A 3S6FA 3TOBA 1LCPA 2FL4A 1NSLA 3DR8A 2JEVA 1YW4A 2Q4ZA 4K3NA 2POKA 2C6CA 4B10A 4TNUA 3ZJ0A 2KCWA 3BJ8A 3TOAA 3VWEA 5HXDA 1MJBA 3K9TA 3ZZIA 1CBXA 2B4DA 2FIWA 5EMIA 3PFOA 4DJLA 1WK4A 3IFEA 2OB0A 2XEJA 4GXHA 2EO8A 3SHPA 4PPZA 2V8VA 1NE9A 2ZEMA 4PXBA 2ZEHA 4KOYA 3NA6A 4P44A 4PQAA 2PJ7A 4OAEA 4RS2A 1Q7LA 4UFXA 1YW6A 3FJUA 2AFWA 2HB6A 3E0KA 4M6GA 4ZX8A 1ON0A 2A4NA 5D8NA 3TFYA 3EY5A 2Z3PA 4A38A 2AE6A 5LRGA 3V7ZA 2BOAA 2D4PA 2Q4VA 3FBUA 2GREA 1YR0A 3I3GA 4GM5A 4JYWA 2ZOFA 2BL1A 3EXNA 4OLLA 4F0YA 4KORA 1M4LA 2AFMA 5LRJA 5KTCA 4KVXA 5HVHA 1Q2CA 1YGHA 4NGTA 6CPAA 2NMTA 4NGRA 1TF9A 3PB7X 2ARHA 1XMTA 5IV0A 2BCOA 1AYEA 5D29A 4UCNA 4KVME 7CPAA 2XEIA 3F5BA 1X12A 4PK3A 4K30A 3FMCA 3L2NA 3FNCA 4AVCA 4CYNA 4UCMA 3N7ZA 1F2PA 3FRMA 3IWEA 2Z3OA 1XBUA 4P4BA 4MBUA 4M3SA 5J1QA 1JQGA 2ABZA 3P2FA 4HNWB 4CAVA 1S7LA 3B3WA 2PVVA 3DLJA 1NMTA 1QSOA 2Q43A 2AFOA 3WC6A 4R8FA 1B6BA 2V77A 5F49A 1LRZA 1VHEA 2BEIA 4RN7A 2GU2A 3G3SA 4B5PB 3SXOA 4PSXA 5E96A 3D7DA 2QIRA 1XE4A 4FD7A 4FWUA 2Y0MA 4LUAA 4AG9A 1J4JA 1S5KA 3LODA 4YRHA 5G20A 3IU1A 4MMOA 4BMHA 2ZEOA 4JZ0A 4IUSA 1KUVA 4OADA 5IX3A 3SJEA 2F8HA 2C6GA 2CNSA 3D4UA 3B35A 3JRUA 3K2KA 2GLJA 4R7MA 4BD9A 5JPHA 4F0XA 1Z8TA 4R87A 5C82A 4PSWA 1S7KA 2QYVA 2Z11A 4EFDA 4CGPA 5LRKA 5F48A 5G1ZA 4UEEA 4MFPA 3S6GA 2HV2A 4J3GA 1XRYA 1ZLIA 3R1KA 4F9VA 1P4NA 2PCUA 4II9A 2WUUA 2XEGA 3HLPA 3KGQA 4IK2A 3UY5A 3JUWA 3WABA 2Z3KA 2YNDA 3IJ3A 2ZW5A 2I00A 1Y0RA 2PJ2A 3D67A 3KHZA 3B3VA 1CM0A 1RXTA 2ZOGA 2PDOA 2FE7A 4NSQA 4PXCA 5AG7A 1FY7A 2P6EA 2ZENA 4P10A 1Z4RA 1OBRA 1KWMA 2J8MA 1ARLA 2EVNA 4G1PA 5AG6A 4C2XA 4FBEA 4A37A 3GLJA 4MXUA 3S9MA 3GY9A 4OKOA 2YNCC 4KUAA 3D68A 3SI0A 4H6ZA 2AFSA 2JEWA 5EBVA 2PJ5A 2CTBA 3KHXA 4A30A 4M6HA 2HQYA 4F8ZA 1Y7RA 1YVOA 3PZJA 4NJRA 4B14A 1M4IA 4Z65A 5J8CA 3IC1A 5F46A 4B5OA 2OR4A 2PJCA 2PJBA 4R76A 4W9YA 4JXQA 1HDUA 3QAHA 4R9MA 2P0WA 5I0CA 2VBQA 3BI1A 4KSIA 2JBJA 2Q51A 4KVOE 1ZLHA 2B4BA 3R96A 1YSJA 2CXAA 1YREA 2JBKA 1MJ9A 3FX6A 4IF5A 3IEHA 4MFJA 4C7HA 3BLNA 4Y49B 5BWAB 3PB4X 3RO0A 4KOVA 4YFJA 1K4JA 1TKFA 4MCSA 4UEFA 4F9UA 2PJ9A 3FIXA 3TO9A 1Y0YA 1LANA 1CP6A 1WWZA 2G3TA 4NXYA 1QQ9A 2PC1A 3B2YA 2AFZA 2PRBA 3CXSA 2BO9A 5F09A 1IGBA 5K8PA 1V0CA 1L0CA 3WC7A 5CPAA 2ZXVA 1AMPA 1M4GA 4R3LA 3S6HA 4A32A 2EK8A 2G3AA 5ELYA 4P4IA 2EWBA 3EC4A 2GANA 4ZY1A 4JLYA 2RC4A 1HEEA 4Y49C 4ZY2A 1Z8WA 1BO4A 5IB0A 3D7HA 3GIUA 3IWGA 2Q7SA 3OWCA 3W91A 1XJOA 5I4MA 5JGFA 2C6PA 2CNTA 2P6GA 2PE3A 4JWPA 4Q36A 4QVTA 2ATRA 4PV6A 3S9NA 2GLFA 1GYTA 1OZPA 3D7GA 3T90A 4X8IA 3FB3A 2NYQA 1TKHA 3H8FA 3R95A 2Z10A 4XNHB 4A31A 3TTHA 3W6SA 1QSRA 2ANPA 4NEXA 3JTKA 3KR4A 3BXMA 2DPSA 1ZG9A 1S3ZA 4HNXB 2PJ4A 3PBBA 3QAYA 1M1DA 3R9FA 2GFQA 2ZW7A 1BPNA 1CPSA 2ZEGA 2EUIA 2R8VA 3VH9A 3QB8A 3GB0A 2CY2A 1PCAA 3PFEA 4IHMA 4F6AA 3CXQA 2FT0A 5HVGA 2AJ6A 3H8GA 4C2YA 4AG7A 2PRQA 4R6TA 5AG5A 3LACA 4XNHC 2Z3NA 5CBMA 4C68A 3TX8A 4B11A 1BPMA 2ODFA 4M85A 1ELMP 4B12A 1H8LA 1SQHA 4CGLA 5LYLA 1Z9UA 8CPAA 4P45A 3IIBA 2G9DA 4MCPA 4U5YA 1CJWA 4L89A 1VGYA 4ZY0A 3NE7A 3TT2A 4L8AA 4ONWA 4MFZA 2VI7A 4YU9A 2Z0ZA 4GS4A 3SI2A 3KQXA 4DUKA 3KR5A 1UWYA 3CZXA 4YWYA 1ARMA 2PIZA 4CAWA 4EWTA 1ZG8A 3WC5A 2ZEEA 2YGWA 4OP4A 1BOBA 2JDDA 2PR1A 2ZW4A 1LFWA 3V8IA 5A28A 4JJXA 4MY3A 1ELLP 1R43A 1DTDA 3EO4A 5HMNA 1VIXA 2IQ6A 5LYIA 4A33A 4MHYA 4A39A 5FVJA 4NCZA 5AG4A 4MCQA 4JXRA 3IGRA 1P0HA 3ISXA 4AVAA 2J8NA 5IB9A 3MN8A 4PXDA 2Z3MA 3GUXA 2B4DB 3R9EA 4CAEA 1KZFA 3NH4A 5HVFA 3PBEA 1KUYA 2PJ1A 4B6ZA 4WWVA 2WSAA 1I21A 4FAIA 4QUSA 3WR7A 1ZO0A 4NFRA 4M6IA 1U6MA 2NSMA 4MHDA 1IIDA 4OC4A 4CRYB 1YMEA 1XF8A 2PJ8A 3N5FA 2PR8A 3SJGA 2GIVA 1Z8LA 2B5GA 2PSWA 3W6XA 4FUUA 4UIAA 4KOXA 4IAVA 2WPWA 4H6UA 1MJAA 3GYAA 1A2ZA 3KI9A 1PU9A 2OH1A 1S7NA 5LYFA 1IOFA 4MFKA 4LQGA 2VZZA 4NF1A 4KZTA 5H84A 1QSMA 4CGMA 2JDCA 4B5PA 3LMSA 5KTDA 4CYOA 4O23A 4MHPA 4KOTA 1XFOA 2K5TA 3I1UA 3KQZA 4C2ZA 3H5ZA 2XEFA 4FD4A 3I9SA 1LAPA 4KS9A 5JQ4A 2YNEA 4ONUA 2ZEDA 4OMEA 4P4DA 2X7BA 1YX0A 1Q2YA 4P4FA 5G21A 3A9LA 2HUZA 3CDXA 4I49A 4QC6A 2Q44A 4OC1A 2BUEA 3PRTA 1QSTA 2YNCA 3GKRA 4R57A 2I3CA 4X3RA 1VHOA 1B87A 2IJZA 3PP9A 1LOKA 4ZBGA 2BSWA 2FSRA 2O28A 4X5KA 3D8PA 2CNMA 4NGNA 5LYDA 5DS0A 5THWA 4CS0B 5JM6A 4UCPA 2FXFA 1XOVA 3RNZA 2PJ0A 1YLEA 3DR6A 1F2OA 4P4EA 2WZNA 3PB8X 1AUGA 4MJ8A 4TWEA 2V8GA 4MHZA 2GE3A 3MRUA 4MFLA 1XIXA 4KLWA 4DYOA 3P2HA 4LQ6A 3VWDA 2JLMA 3BI0A 2VZYA 1M44A 2Q4YA 4R3KA 1NSAA 2Q04A 3NE8A 4AVBA 5A27A 2REEA 3PB9X 2B58A 2WYRA 3PB6X 2FCKA 2QMLA 4KOSA 3B3CA 2J8RA 4U9YA 4QBJA 1GHEA 1TKJA 2Z3LA 1TF8A 3FXTA 3LD2A 3PGPA 4BBHA 1Y9WA 3B3SA 2AFUA 1X10A 2H5MA 1LAMA 4ZGYB 1VHSA 3DSBA 1Z4EA 2DEAA 3F0AA 3HUVA 4AB7A 4PK2A 4A95A 3VARA 3FEEA 3S9LA 1JWQA 1KUXA 1RO5A 4FD5A 3CT9A 2V8HA 3D66A 2O53A 3JVNA 3SJFA 5C88A 2I79A 5AGEA 4H2KA 3RZAA 4NGPA 4KOUA 2ZELA
chains in the Genus database with same CATH topology
3TCVA 4UBRA 3C26A 3K9UA 2VQYA 5G22A 3FYNA 3TE4A 3D3SA 1IB1E 2PQ8A 1VKCA 4XPLA 2OU2A 4DNCA 2OZGA 1TIQA 4H89A 2DPTA 5F47A 2D4OA 4CYPA 2VXKA 4RI1A 4CRZB 1N71A 4HKFA 4MFQA 2OZHA 2B3UA 2B5GB 3B8GA 3RYOA 2Q7BA 4LX9A 3MGDA 3KKWA 3BJ7A 2F5IA 4CAFA 5EC4A 4KUBA 4U9ZA 1IICA 5KTAA 4E2AA 1YK3A 4B13A 2B3VA 4CAXA 1YVKA 2VEZA 4CGOA 1I12A 1UFHA 1XEBA 3F8KA 4KSFA 3H4QA 4XPDB 5J8FA 1IYKA 2G0BA 4JD6A 4E8OA 3D2PA 3T9YA 2R1IA 1PUAA 1S60A 1M4DA 3G8WA 5DWMA 4UFVA 1Y9KA 2OZUA 4E0AA 4UFWA 3IU2A 4KLVA 4UWIA 4EVYA 3TO6A 3EFAA 4MY0A 4XPDC 3SXNA 1MK4A 4KSAA 3D2MA 2P6FA 2IL4A 1QSNA 3DNSA 2ZW6A 4Q38A 4YGOA 5CNPA 3S6KA 2Q0YA 2FIAA 3CXPA 1I1DA 4KOWA 2C27A 4MI4A 1S7FA 4CYQA 2QECA 4CGNA 5GCNA 2REFA 4QB9A 5DWNA 3R9GA 3DDDA 4HNYB 4UWJA 4FD6A 1R57A 5H86A 3TO7A 4A2ZA 1IYLA 5ISVA 2WPXA 2DXQA 1Q2DA 2R7HA 4XPKA 4UA3A 4ORFA 5HH1A 4C7IA 2ZPAA 2FS5A 2R98A 3S6FA 3TOBA 2FL4A 1NSLA 3DR8A 2JEVA 4B10A 3ZJ0A 2KCWA 3BJ8A 3TOAA 3VWEA 1MJBA 3ZZIA 2B4DA 2FIWA 1WK4A 2OB0A 3SHPA 1NE9A 4KOYA 4UFXA 4RS2A 4OAEA 3TFYA 3E0KA 1ON0A 2A4NA 3EY5A 2Z3PA 2AE6A 2D4PA 2Q4VA 3FBUA 1YR0A 3I3GA 2BL1A 3EXNA 4OLLA 4F0YA 4KORA 5KTCA 4KVXA 1Q2CA 1YGHA 2NMTA 2ARHA 1XMTA 5IV0A 4UCNA 4KVME 3F5BA 4PK3A 4K30A 3FNCA 4AVCA 4CYNA 4UCMA 3N7ZA 3FRMA 3IWEA 2Z3OA 4MBUA 4M3SA 3P2FA 4HNWB 4CAVA 1S7LA 1NMTA 1QSOA 1B6BA 5F49A 1LRZA 2BEIA 3G3SA 4B5PB 3SXOA 4PSXA 5E96A 2QIRA 1XE4A 4FD7A 4LUAA 2Y0MA 4AG9A 1J4JA 1S5KA 3LODA 4YRHA 5G20A 3IU1A 4BMHA 4IUSA 1KUVA 4OADA 5IX3A 2CNSA 5JPHA 4F0XA 4R87A 5C82A 4PSWA 1S7KA 2Z11A 4CGPA 5F48A 5G1ZA 4MFPA 3S6GA 2HV2A 4J3GA 3R1KA 1P4NA 4II9A 2WUUA 3UY5A 3JUWA 2Z3KA 2YNDA 2ZW5A 2I00A 1CM0A 1RXTA 2PDOA 2FE7A 4NSQA 5AG7A 1FY7A 2P6EA 5AG6A 1Z4RA 2J8MA 2EVNA 4C2XA 3GY9A 2YNCC 4KUAA 4H6ZA 5EBVA 4A30A 2HQYA 1Y7RA 1YVOA 3PZJA 4B14A 1M4IA 5J8CA 5F46A 4B5OA 4JXQA 3QAHA 4R9MA 2P0WA 5I0CA 2VBQA 4KVOE 2B4BA 3R96A 2CXAA 1YREA 4MFJA 1MJ9A 4IF5A 4C7HA 5BWAB 3BLNA 4Y49B 4KOVA 4YFJA 1K4JA 3FIXA 3TO9A 1WWZA 2G3TA 4NXYA 2PC1A 2PRBA 3CXSA 1V0CA 1L0CA 2ZXVA 1M4GA 4R3LA 3S6HA 4A32A 2G3AA 3EC4A 2GANA 4JLYA 2RC4A 4Y49C 1BO4A 5IB0A 3OWCA 3IWGA 3W91A 2CNTA 2P6GA 4JWPA 4Q36A 4QVTA 2ATRA 4PV6A 1OZPA 3T90A 3FB3A 3R95A 2Z10A 4XNHB 3TTHA 3W6SA 1QSRA 4NEXA 3JTKA 2DPSA 1S3ZA 4HNXB 1M1DA 3R9FA 2ZW7A 2EUIA 2R8VA 3QB8A 2CY2A 4F6AA 3CXQA 2FT0A 2AJ6A 4C2YA 4AG7A 5AG5A 4XNHC 2Z3NA 4C68A 4B11A 4M85A 4B12A 1SQHA 4CGLA 1Z9UA 4U5YA 1CJWA 4L89A 3NE7A 3TT2A 4L8AA 4MFZA 2VI7A 2Z0ZA 4GS4A 4CAWA 2YGWA 1BOBA 2JDDA 2PR1A 2ZW4A 3V8IA 5A28A 4JJXA 4MY3A 3EO4A 5HMNA 4A33A 5FVJA 4NCZA 5AG4A 4JXRA 3IGRA 1P0HA 4AVAA 2J8NA 2Z3MA 2B4DB 3R9EA 4CAEA 1KZFA 1KUYA 2WSAA 1I21A 4QUSA 3WR7A 1ZO0A 1U6MA 4MHDA 1IIDA 4CRYB 1XF8A 2PR8A 2GIVA 2B5GA 2PSWA 3W6XA 4KOXA 2WPWA 4H6UA 1MJAA 3GYAA 1PU9A 2OH1A 1S7NA 4MFKA 4NF1A 2VZZA 4KZTA 5H84A 1QSMA 4CGMA 2JDCA 4B5PA 5KTDA 4CYOA 4KOTA 2K5TA 4C2ZA 3H5ZA 4FD4A 3I9SA 4KS9A 5JQ4A 2YNEA 4ONUA 2X7BA 1YX0A 1Q2YA 5G21A 3A9LA 2HUZA 4I49A 4QC6A 2Q44A 2BUEA 1QSTA 2YNCA 3GKRA 4R57A 1B87A 3PP9A 4ZBGA 2BSWA 2FSRA 2O28A 4X5KA 3D8PA 2CNMA 4CS0B 4UCPA 2FXFA 1YLEA 3DR6A 4A31A 4MJ8A 2GE3A 4MFLA 1XIXA 4KLWA 3P2HA 3VWDA 2JLMA 2VZYA 1M44A 2Q4YA 4R3KA 2Q04A 4AVBA 5A27A 2REEA 4U9YA 2B58A 4KOSA 2FCKA 2QMLA 2J8RA 4QBJA 1GHEA 4BBHA 2Z3LA 3LD2A 3FXTA 3PGPA 1Y9WA 2H5MA 4ZGYB 1VHSA 3DSBA 1Z4EA 3F0AA 4AB7A 4PK2A 4A95A 1KUXA 1RO5A 5C88A 4FD5A 3JVNA 2I79A 5AGEA 4KOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCV A;  4UBR A;  3C26 A;  3K9U A;  2VQY A;  3FYN A;  3TE4 A;  3D3S A;  1IB1 E;  2PQ8 A;  1VKC A;  4XPL A;  2OU2 A;  4DNC A;  2OZG A;  1TIQ A;  4H89 A;  5F47 A;  2D4O A;  2VXK A;  4RI1 A;  4CRZ B;  1N71 A;  4HKF A;  2OZH A;  2B3U A;  2B5G B;  3B8G A;  3RYO A;  2Q7B A;  4LX9 A;  3MGD A;  3KKW A;  3BJ7 A;  2F5I A;  5EC4 A;  4KUB A;  4U9Z A;  1IIC A;  5KTA A;  4E2A A;  1YK3 A;  2B3V A;  4CAX A;  1YVK A;  2VEZ A;  1I12 A;  1UFH A;  1XEB A;  3F8K A;  3H4Q A;  4XPD B;  5J8F A;  1IYK A;  2G0B A;  4JD6 A;  4E8O A;  3D2P A;  3T9Y A;  2R1I A;  1PUA A;  1S60 A;  1M4D A;  3G8W A;  5DWM A;  1Y9K A;  2OZU A;  4E0A A;  4KLV A;  4UWI A;  4EVY A;  3TO6 A;  3EFA A;  4MY0 A;  4XPD C;  3SXN A;  1MK4 A;  3D2M A;  2P6F A;  2IL4 A;  1QSN A;  3DNS A;  2ZW6 A;  4YGO A;  5CNP A;  3S6K A;  2Q0Y A;  2FIA A;  3CXP A;  1I1D A;  4KOW A;  2C27 A;  4MI4 A;  1S7F A;  2QEC A;  5GCN A;  2REF A;  4QB9 A;  5DWN A;  3R9G A;  3DDD A;  4HNY B;  4UWJ A;  4FD6 A;  1R57 A;  5H86 A;  3TO7 A;  1IYL A;  5ISV A;  2WPX A;  2DXQ A;  1Q2D A;  2R7H A;  4XPK A;  4UA3 A;  4ORF A;  5HH1 A;  2ZPA A;  2FS5 A;  2R98 A;  3S6F A;  3TOB A;  2FL4 A;  1NSL A;  3DR8 A;  2JEV A;  3ZJ0 A;  2KCW A;  3BJ8 A;  3TOA A;  3VWE A;  1MJB A;  3ZZI A;  2B4D A;  2FIW A;  1WK4 A;  2OB0 A;  3SHP A;  1NE9 A;  4KOY A;  4RS2 A;  4OAE A;  3TFY A;  3E0K A;  1ON0 A;  2A4N A;  3EY5 A;  2AE6 A;  2D4P A;  2Q4V A;  3FBU A;  1YR0 A;  3I3G A;  2BL1 A;  3EXN A;  4OLL A;  4F0Y A;  4KOR A;  5KTC A;  4KVX A;  1Q2C A;  1YGH A;  2NMT A;  2ARH A;  1XMT A;  5IV0 A;  4KVM E;  3F5B A;  4PK3 A;  4K30 A;  3FNC A;  4AVC A;  3N7Z A;  3FRM A;  4MBU A;  4M3S A;  3P2F A;  4HNW B;  4CAV A;  1S7L A;  1NMT A;  1QSO A;  1B6B A;  5F49 A;  1LRZ A;  2BEI A;  3G3S A;  4B5P B;  3SXO A;  4PSX A;  5E96 A;  2QIR A;  1XE4 A;  4FD7 A;  4LUA A;  2Y0M A;  4AG9 A;  1J4J A;  1S5K A;  3LOD A;  4YRH A;  4BMH A;  4IUS A;  1KUV A;  4OAD A;  5IX3 A;  2CNS A;  5JPH A;  4R87 A;  5C82 A;  4PSW A;  1S7K A;  2Z11 A;  5F48 A;  3S6G A;  2HV2 A;  4J3G A;  3R1K A;  1P4N A;  4II9 A;  3UY5 A;  3JUW A;  2ZW5 A;  2I00 A;  1CM0 A;  1RXT A;  2PDO A;  2FE7 A;  4NSQ A;  1FY7 A;  2P6E A;  1Z4R A;  2J8M A;  2EVN A;  3GY9 A;  4KUA A;  4H6Z A;  5EBV A;  2HQY A;  1Y7R A;  1YVO A;  3PZJ A;  1M4I A;  5J8C A;  5F46 A;  4B5O A;  4JXQ A;  3QAH A;  4R9M A;  2P0W A;  5I0C A;  2VBQ A;  4KVO E;  2B4B A;  3R96 A;  1YRE A;  1MJ9 A;  4IF5 A;  3BLN A;  4Y49 B;  4KOV A;  4YFJ A;  1K4J A;  3FIX A;  3TO9 A;  1WWZ A;  2G3T A;  4NXY A;  2PC1 A;  2PRB A;  3CXS A;  1V0C A;  1L0C A;  2ZXV A;  1M4G A;  4R3L A;  3S6H A;  2G3A A;  3EC4 A;  2GAN A;  4JLY A;  2RC4 A;  4Y49 C;  1BO4 A;  5IB0 A;  3OWC A;  3IWG A;  3W91 A;  2CNT A;  2P6G A;  4JWP A;  4QVT A;  2ATR A;  4PV6 A;  1OZP A;  3T90 A;  3FB3 A;  3R95 A;  2Z10 A;  4XNH B;  3TTH A;  3W6S A;  1QSR A;  4NEX A;  1S3Z A;  4HNX B;  1M1D A;  3R9F A;  2ZW7 A;  2EUI A;  2R8V A;  3QB8 A;  2CY2 A;  4F6A A;  3CXQ A;  2FT0 A;  2AJ6 A;  4AG7 A;  4XNH C;  4M85 A;  1SQH A;  1Z9U A;  4U5Y A;  1CJW A;  4L89 A;  3NE7 A;  3TT2 A;  4L8A A;  2VI7 A;  2Z0Z A;  4GS4 A;  4CAW A;  1BOB A;  2JDD A;  2PR1 A;  2ZW4 A;  3V8I A;  4JJX A;  4MY3 A;  3EO4 A;  5HMN A;  5FVJ A;  4NCZ A;  4JXR A;  3IGR A;  1P0H A;  4AVA A;  2J8N A;  2B4D B;  3R9E A;  1KZF A;  1KUY A;  1I21 A;  4QUS A;  3WR7 A;  1U6M A;  4MHD A;  1IID A;  4CRY B;  1XF8 A;  2PR8 A;  2GIV A;  2B5G A;  2PSW A;  3W6X A;  4KOX A;  2WPW A;  4H6U A;  1MJA A;  3GYA A;  1PU9 A;  2OH1 A;  1S7N A;  4NF1 A;  2VZZ A;  4KZT A;  5H84 A;  1QSM A;  5KTD A;  2JDC A;  4B5P A;  4KOT A;  2K5T A;  4FD4 A;  3I9S A;  5JQ4 A;  4ONU A;  2X7B A;  1YX0 A;  1Q2Y A;  4I49 A;  2HUZ A;  4QC6 A;  2Q44 A;  2BUE A;  1QST A;  3GKR A;  4R57 A;  1B87 A;  3PP9 A;  4ZBG A;  2BSW A;  2FSR A;  2O28 A;  4X5K A;  3D8P A;  2CNM A;  4CS0 B;  2FXF A;  1YLE A;  3DR6 A;  4MJ8 A;  2GE3 A;  1XIX A;  4KLW A;  3P2H A;  3VWD A;  2JLM A;  2VZY A;  1M44 A;  2Q4Y A;  4R3K A;  2Q04 A;  4AVB A;  2REE A;  4U9Y A;  2B58 A;  4KOS A;  2FCK A;  2QML A;  2J8R A;  4QBJ A;  1GHE A;  3LD2 A;  3FXT A;  3PGP A;  1Y9W A;  2H5M A;  1VHS A;  3DSB A;  1Z4E A;  3F0A A;  4AB7 A;  4PK2 A;  1KUX A;  1RO5 A;  5C88 A;  4FD5 A;  3JVN A;  2I79 A;  4KOU A; 
#chains in the Genus database with same CATH topology
 3TCV A;  4UBR A;  2PVW A;  3C26 A;  1R3N A;  1IOI A;  1CPX A;  3CPX A;  1BLL E;  1TXR A;  2VQY A;  3K9U A;  3FYN A;  5G22 A;  3TE4 A;  3D3S A;  2IMO A;  4OC2 A;  1IB1 E;  4HPS A;  2PQ8 A;  4AXV A;  2FVG A;  3FVL A;  3SI1 A;  1VKC A;  4XPL A;  5K8N A;  2OU2 A;  3CPA A;  4ZX9 A;  4DNC A;  2OZG A;  2VL1 A;  4UIB A;  4X2T A;  1TIQ A;  1FNO A;  1BAV A;  1IU8 A;  4H89 A;  2DPT A;  2O4H A;  5F47 A;  2D4O A;  4CYP A;  2VXK A;  4ZYQ A;  4UEZ A;  4RI1 A;  4CRZ B;  1N71 A;  4HKF A;  1ZG7 A;  2RB7 A;  4MHN A;  2RFH A;  4MFQ A;  2OZH A;  1YLO A;  3KZW A;  3TC8 A;  3V38 A;  2B3U A;  2B5G B;  4PXE A;  3B8G A;  2DF5 A;  2Q7B A;  3RYO A;  4LX9 A;  2OOT A;  3MGD A;  1CG2 A;  3KKW A;  4OC0 A;  4P6Y A;  3BJ7 A;  1PYT B;  2F5I A;  2PJA A;  4CAF A;  1RTQ A;  5EC4 A;  4KUB A;  4U9Z A;  1IIC A;  5KTA A;  4E2A A;  1Y7E A;  1YK3 A;  4B13 A;  2B3V A;  3ISZ A;  4CAX A;  1YVK A;  2VEZ A;  4CGO A;  1I12 A;  3IWW A;  3PEI A;  2QVP A;  1IY7 A;  1UFH A;  1XEB A;  3BHX A;  3F8K A;  4KSF A;  1EE3 P;  4NGQ A;  4OIW A;  1Z5R A;  3H4Q A;  2EBJ A;  4XPD B;  5J8F A;  2HC9 A;  1IYK A;  3IO1 A;  2G0B A;  4JD6 A;  4E8O A;  3FF3 A;  3D2P A;  3T9Y A;  2ZEF A;  4NGS A;  3T8W A;  2R1I A;  1PUA A;  4NJQ A;  4OC3 A;  2EK9 A;  1S60 A;  3B7I A;  3NH5 A;  1M4D A;  3DGV A;  2C1C A;  3G8W A;  5DWM A;  4UFV A;  1Y9K A;  3SJX A;  2OZU A;  4RUH A;  4E0A A;  4UF4 A;  1CX8 A;  4UFW A;  3IU2 A;  4KLV A;  1YQE A;  2ZEP A;  4UWI A;  4EVY A;  1QMU A;  2QJ8 A;  3TO6 A;  3EFA A;  4MCR A;  4MY0 A;  4NGM A;  4P4J A;  1DE4 C;  3KAS A;  4XPD C;  4EME A;  4BIN A;  3H8E A;  3SXN A;  4CPA A;  1MK4 A;  3LWU A;  2CTC A;  4KSA A;  3D2M A;  2P6F A;  2IL4 A;  1QSN A;  3FED A;  3DNS A;  2ZW6 A;  3KL9 A;  4Q38 A;  4YGO A;  3B3T A;  5CNP A;  3S6K A;  3RBU A;  4A94 A;  2Q0Y A;  2FIA A;  3CXP A;  5JH9 A;  1I1D A;  3D7F A;  3FEC A;  4KOW A;  2C27 A;  1Z8X A;  1S7F A;  4MI4 A;  2QEC A;  1HDQ A;  2J9A A;  4Q7A A;  4CYQ A;  4ZI6 A;  4CGN A;  2PJ6 A;  5GCN A;  1FT7 A;  3NFZ A;  3QNV A;  2CF4 A;  2REF A;  4QB9 A;  5DWN A;  3R9G A;  3DDD A;  4HNY B;  4UWJ A;  4FD6 A;  1R57 A;  3NH8 A;  5H86 A;  3RAM A;  4WJB A;  3TO7 A;  3WT4 A;  3FH4 A;  1IYL A;  4A2Z A;  5K8M A;  5ISV A;  2V8D A;  2PIY A;  4OC5 A;  2WPX A;  2DXQ A;  1Q2D A;  1CP7 A;  2R7H A;  1F57 A;  2PJ3 A;  2F7V A;  4XPK A;  4UA3 A;  4ORF A;  4OID A;  2CIJ A;  4MRI A;  5HH1 A;  2ZPA A;  4C7I A;  5K8O A;  2AFX A;  2FS5 A;  3VAT A;  1XMB A;  1Z2L A;  2R98 A;  3S6F A;  3TOB A;  1LCP A;  2FL4 A;  1NSL A;  3DR8 A;  2JEV A;  1YW4 A;  2Q4Z A;  4K3N A;  2POK A;  2C6C A;  4B10 A;  4TNU A;  3ZJ0 A;  2KCW A;  3BJ8 A;  3TOA A;  3VWE A;  5HXD A;  1MJB A;  3K9T A;  3ZZI A;  1CBX A;  2B4D A;  2FIW A;  5EMI A;  3PFO A;  4DJL A;  1WK4 A;  3IFE A;  2OB0 A;  2XEJ A;  4GXH A;  2EO8 A;  3SHP A;  4PPZ A;  2V8V A;  1NE9 A;  2ZEM A;  4PXB A;  2ZEH A;  4KOY A;  3NA6 A;  4P44 A;  4PQA A;  2PJ7 A;  4OAE A;  4RS2 A;  1Q7L A;  4UFX A;  1YW6 A;  3FJU A;  2AFW A;  2HB6 A;  3E0K A;  4M6G A;  4ZX8 A;  1ON0 A;  2A4N A;  5D8N A;  3TFY A;  3EY5 A;  2Z3P A;  4A38 A;  2AE6 A;  5LRG A;  3V7Z A;  2BOA A;  2D4P A;  2Q4V A;  3FBU A;  2GRE A;  1YR0 A;  3I3G A;  4GM5 A;  4JYW A;  2ZOF A;  2BL1 A;  3EXN A;  4OLL A;  4F0Y A;  4KOR A;  1M4L A;  2AFM A;  5LRJ A;  5KTC A;  4KVX A;  5HVH A;  1Q2C A;  1YGH A;  4NGT A;  6CPA A;  2NMT A;  4NGR A;  1TF9 A;  3PB7 X;  2ARH A;  1XMT A;  5IV0 A;  2BCO A;  1AYE A;  5D29 A;  4UCN A;  4KVM E;  7CPA A;  2XEI A;  3F5B A;  1X12 A;  4PK3 A;  4K30 A;  3FMC A;  3L2N A;  3FNC A;  4AVC A;  4CYN A;  4UCM A;  3N7Z A;  1F2P A;  3FRM A;  3IWE A;  2Z3O A;  1XBU A;  4P4B A;  4MBU A;  4M3S A;  5J1Q A;  1JQG A;  2ABZ A;  3P2F A;  4HNW B;  4CAV A;  1S7L A;  3B3W A;  2PVV A;  3DLJ A;  1NMT A;  1QSO A;  2Q43 A;  2AFO A;  3WC6 A;  4R8F A;  1B6B A;  2V77 A;  5F49 A;  1LRZ A;  1VHE A;  2BEI A;  4RN7 A;  2GU2 A;  3G3S A;  4B5P B;  3SXO A;  4PSX A;  5E96 A;  3D7D A;  2QIR A;  1XE4 A;  4FD7 A;  4FWU A;  2Y0M A;  4LUA A;  4AG9 A;  1J4J A;  1S5K A;  3LOD A;  4YRH A;  5G20 A;  3IU1 A;  4MMO A;  4BMH A;  2ZEO A;  4JZ0 A;  4IUS A;  1KUV A;  4OAD A;  5IX3 A;  3SJE A;  2F8H A;  2C6G A;  2CNS A;  3D4U A;  3B35 A;  3JRU A;  3K2K A;  2GLJ A;  4R7M A;  4BD9 A;  5JPH A;  4F0X A;  1Z8T A;  4R87 A;  5C82 A;  4PSW A;  1S7K A;  2QYV A;  2Z11 A;  4EFD A;  4CGP A;  5LRK A;  5F48 A;  5G1Z A;  4UEE A;  4MFP A;  3S6G A;  2HV2 A;  4J3G A;  1XRY A;  1ZLI A;  3R1K A;  4F9V A;  1P4N A;  2PCU A;  4II9 A;  2WUU A;  2XEG A;  3HLP A;  3KGQ A;  4IK2 A;  3UY5 A;  3JUW A;  3WAB A;  2Z3K A;  2YND A;  3IJ3 A;  2ZW5 A;  2I00 A;  1Y0R A;  2PJ2 A;  3D67 A;  3KHZ A;  3B3V A;  1CM0 A;  1RXT A;  2ZOG A;  2PDO A;  2FE7 A;  4NSQ A;  4PXC A;  5AG7 A;  1FY7 A;  2P6E A;  2ZEN A;  4P10 A;  1Z4R A;  1OBR A;  1KWM A;  2J8M A;  1ARL A;  2EVN A;  4G1P A;  5AG6 A;  4C2X A;  4FBE A;  4A37 A;  3GLJ A;  4MXU A;  3S9M A;  3GY9 A;  4OKO A;  2YNC C;  4KUA A;  3D68 A;  3SI0 A;  4H6Z A;  2AFS A;  2JEW A;  5EBV A;  2PJ5 A;  2CTB A;  3KHX A;  4A30 A;  4M6H A;  2HQY A;  4F8Z A;  1Y7R A;  1YVO A;  3PZJ A;  4NJR A;  4B14 A;  1M4I A;  4Z65 A;  5J8C A;  3IC1 A;  5F46 A;  4B5O A;  2OR4 A;  2PJC A;  2PJB A;  4R76 A;  4W9Y A;  4JXQ A;  1HDU A;  3QAH A;  4R9M A;  2P0W A;  5I0C A;  2VBQ A;  3BI1 A;  4KSI A;  2JBJ A;  2Q51 A;  4KVO E;  1ZLH A;  2B4B A;  3R96 A;  1YSJ A;  2CXA A;  1YRE A;  2JBK A;  1MJ9 A;  3FX6 A;  4IF5 A;  3IEH A;  4MFJ A;  4C7H A;  3BLN A;  4Y49 B;  5BWA B;  3PB4 X;  3RO0 A;  4KOV A;  4YFJ A;  1K4J A;  1TKF A;  4MCS A;  4UEF A;  4F9U A;  2PJ9 A;  3FIX A;  3TO9 A;  1Y0Y A;  1LAN A;  1CP6 A;  1WWZ A;  2G3T A;  4NXY A;  1QQ9 A;  2PC1 A;  3B2Y A;  2AFZ A;  2PRB A;  3CXS A;  2BO9 A;  5F09 A;  1IGB A;  5K8P A;  1V0C A;  1L0C A;  3WC7 A;  5CPA A;  2ZXV A;  1AMP A;  1M4G A;  4R3L A;  3S6H A;  4A32 A;  2EK8 A;  2G3A A;  5ELY A;  4P4I A;  2EWB A;  3EC4 A;  2GAN A;  4ZY1 A;  4JLY A;  2RC4 A;  1HEE A;  4Y49 C;  4ZY2 A;  1Z8W A;  1BO4 A;  5IB0 A;  3D7H A;  3GIU A;  3IWG A;  2Q7S A;  3OWC A;  3W91 A;  1XJO A;  5I4M A;  5JGF A;  2C6P A;  2CNT A;  2P6G A;  2PE3 A;  4JWP A;  4Q36 A;  4QVT A;  2ATR A;  4PV6 A;  3S9N A;  2GLF A;  1GYT A;  1OZP A;  3D7G A;  3T90 A;  4X8I A;  3FB3 A;  2NYQ A;  1TKH A;  3H8F A;  3R95 A;  2Z10 A;  4XNH B;  4A31 A;  3TTH A;  3W6S A;  1QSR A;  2ANP A;  4NEX A;  3JTK A;  3KR4 A;  3BXM A;  2DPS A;  1ZG9 A;  1S3Z A;  4HNX B;  2PJ4 A;  3PBB A;  3QAY A;  1M1D A;  3R9F A;  2GFQ A;  2ZW7 A;  1BPN A;  1CPS A;  2ZEG A;  2EUI A;  2R8V A;  3VH9 A;  3QB8 A;  3GB0 A;  2CY2 A;  1PCA A;  3PFE A;  4IHM A;  4F6A A;  3CXQ A;  2FT0 A;  5HVG A;  2AJ6 A;  3H8G A;  4C2Y A;  4AG7 A;  2PRQ A;  4R6T A;  5AG5 A;  3LAC A;  4XNH C;  2Z3N A;  5CBM A;  4C68 A;  3TX8 A;  4B11 A;  1BPM A;  2ODF A;  4M85 A;  1ELM P;  4B12 A;  1H8L A;  1SQH A;  4CGL A;  5LYL A;  1Z9U A;  8CPA A;  4P45 A;  3IIB A;  2G9D A;  4MCP A;  4U5Y A;  1CJW A;  4L89 A;  1VGY A;  4ZY0 A;  3NE7 A;  3TT2 A;  4L8A A;  4ONW A;  4MFZ A;  2VI7 A;  4YU9 A;  2Z0Z A;  4GS4 A;  3SI2 A;  3KQX A;  4DUK A;  3KR5 A;  1UWY A;  3CZX A;  4YWY A;  1ARM A;  2PIZ A;  4CAW A;  4EWT A;  1ZG8 A;  3WC5 A;  2ZEE A;  2YGW A;  4OP4 A;  1BOB A;  2JDD A;  2PR1 A;  2ZW4 A;  1LFW A;  3V8I A;  5A28 A;  4JJX A;  4MY3 A;  1ELL P;  1R43 A;  1DTD A;  3EO4 A;  5HMN A;  1VIX A;  2IQ6 A;  5LYI A;  4A33 A;  4MHY A;  4A39 A;  5FVJ A;  4NCZ A;  5AG4 A;  4MCQ A;  4JXR A;  3IGR A;  1P0H A;  3ISX A;  4AVA A;  2J8N A;  5IB9 A;  3MN8 A;  4PXD A;  2Z3M A;  3GUX A;  2B4D B;  3R9E A;  4CAE A;  1KZF A;  3NH4 A;  5HVF A;  3PBE A;  1KUY A;  2PJ1 A;  4B6Z A;  4WWV A;  2WSA A;  1I21 A;  4FAI A;  4QUS A;  3WR7 A;  1ZO0 A;  4NFR A;  4M6I A;  1U6M A;  2NSM A;  4MHD A;  1IID A;  4OC4 A;  4CRY B;  1YME A;  1XF8 A;  2PJ8 A;  3N5F A;  2PR8 A;  3SJG A;  2GIV A;  1Z8L A;  2B5G A;  2PSW A;  3W6X A;  4FUU A;  4UIA A;  4KOX A;  4IAV A;  2WPW A;  4H6U A;  1MJA A;  3GYA A;  1A2Z A;  3KI9 A;  1PU9 A;  2OH1 A;  1S7N A;  5LYF A;  1IOF A;  4MFK A;  4LQG A;  2VZZ A;  4NF1 A;  4KZT A;  5H84 A;  1QSM A;  4CGM A;  2JDC A;  4B5P A;  3LMS A;  5KTD A;  4CYO A;  4O23 A;  4MHP A;  4KOT A;  1XFO A;  2K5T A;  3I1U A;  3KQZ A;  4C2Z A;  3H5Z A;  2XEF A;  4FD4 A;  3I9S A;  1LAP A;  4KS9 A;  5JQ4 A;  2YNE A;  4ONU A;  2ZED A;  4OME A;  4P4D A;  2X7B A;  1YX0 A;  1Q2Y A;  4P4F A;  5G21 A;  3A9L A;  2HUZ A;  3CDX A;  4I49 A;  4QC6 A;  2Q44 A;  4OC1 A;  2BUE A;  3PRT A;  1QST A;  2YNC A;  3GKR A;  4R57 A;  2I3C A;  4X3R A;  1VHO A;  1B87 A;  2IJZ A;  3PP9 A;  1LOK A;  4ZBG A;  2BSW A;  2FSR A;  2O28 A;  4X5K A;  3D8P A;  2CNM A;  4NGN A;  5LYD A;  5DS0 A;  5THW A;  4CS0 B;  5JM6 A;  4UCP A;  2FXF A;  1XOV A;  3RNZ A;  2PJ0 A;  1YLE A;  3DR6 A;  1F2O A;  4P4E A;  2WZN A;  3PB8 X;  1AUG A;  4MJ8 A;  4TWE A;  2V8G A;  4MHZ A;  2GE3 A;  3MRU A;  4MFL A;  1XIX A;  4KLW A;  4DYO A;  3P2H A;  4LQ6 A;  3VWD A;  2JLM A;  3BI0 A;  2VZY A;  1M44 A;  2Q4Y A;  4R3K A;  1NSA A;  2Q04 A;  3NE8 A;  4AVB A;  5A27 A;  2REE A;  3PB9 X;  2B58 A;  2WYR A;  3PB6 X;  2FCK A;  2QML A;  4KOS A;  3B3C A;  2J8R A;  4U9Y A;  4QBJ A;  1GHE A;  1TKJ A;  2Z3L A;  1TF8 A;  3FXT A;  3LD2 A;  3PGP A;  4BBH A;  1Y9W A;  3B3S A;  2AFU A;  1X10 A;  2H5M A;  1LAM A;  4ZGY B;  1VHS A;  3DSB A;  1Z4E A;  2DEA A;  3F0A A;  3HUV A;  4AB7 A;  4PK2 A;  4A95 A;  3VAR A;  3FEE A;  3S9L A;  1JWQ A;  1KUX A;  1RO5 A;  4FD5 A;  3CT9 A;  2V8H A;  3D66 A;  2O53 A;  3JVN A;  3SJF A;  5C88 A;  2I79 A;  5AGE A;  4H2K A;  3RZA A;  4NGP A;  4KOU A;  2ZEL A; 
#chains in the Genus database with same CATH homology
 3TCV A;  4UBR A;  3C26 A;  3K9U A;  2VQY A;  5G22 A;  3FYN A;  3TE4 A;  3D3S A;  1IB1 E;  2PQ8 A;  1VKC A;  4XPL A;  2OU2 A;  4DNC A;  2OZG A;  1TIQ A;  4H89 A;  2DPT A;  5F47 A;  2D4O A;  4CYP A;  2VXK A;  4RI1 A;  4CRZ B;  1N71 A;  4HKF A;  4MFQ A;  2OZH A;  2B3U A;  2B5G B;  3B8G A;  3RYO A;  2Q7B A;  4LX9 A;  3MGD A;  3KKW A;  3BJ7 A;  2F5I A;  4CAF A;  5EC4 A;  4KUB A;  4U9Z A;  1IIC A;  5KTA A;  4E2A A;  1YK3 A;  4B13 A;  2B3V A;  4CAX A;  1YVK A;  2VEZ A;  4CGO A;  1I12 A;  1UFH A;  1XEB A;  3F8K A;  4KSF A;  3H4Q A;  4XPD B;  5J8F A;  1IYK A;  2G0B A;  4JD6 A;  4E8O A;  3D2P A;  3T9Y A;  2R1I A;  1PUA A;  1S60 A;  1M4D A;  3G8W A;  5DWM A;  4UFV A;  1Y9K A;  2OZU A;  4E0A A;  4UFW A;  3IU2 A;  4KLV A;  4UWI A;  4EVY A;  3TO6 A;  3EFA A;  4MY0 A;  4XPD C;  3SXN A;  1MK4 A;  4KSA A;  3D2M A;  2P6F A;  2IL4 A;  1QSN A;  3DNS A;  2ZW6 A;  4Q38 A;  4YGO A;  5CNP A;  3S6K A;  2Q0Y A;  2FIA A;  3CXP A;  1I1D A;  4KOW A;  2C27 A;  4MI4 A;  1S7F A;  4CYQ A;  2QEC A;  4CGN A;  5GCN A;  2REF A;  4QB9 A;  5DWN A;  3R9G A;  3DDD A;  4HNY B;  4UWJ A;  4FD6 A;  1R57 A;  5H86 A;  3TO7 A;  4A2Z A;  1IYL A;  5ISV A;  2WPX A;  2DXQ A;  1Q2D A;  2R7H A;  4XPK A;  4UA3 A;  4ORF A;  5HH1 A;  4C7I A;  2ZPA A;  2FS5 A;  2R98 A;  3S6F A;  3TOB A;  2FL4 A;  1NSL A;  3DR8 A;  2JEV A;  4B10 A;  3ZJ0 A;  2KCW A;  3BJ8 A;  3TOA A;  3VWE A;  1MJB A;  3ZZI A;  2B4D A;  2FIW A;  1WK4 A;  2OB0 A;  3SHP A;  1NE9 A;  4KOY A;  4UFX A;  4RS2 A;  4OAE A;  3TFY A;  3E0K A;  1ON0 A;  2A4N A;  3EY5 A;  2Z3P A;  2AE6 A;  2D4P A;  2Q4V A;  3FBU A;  1YR0 A;  3I3G A;  2BL1 A;  3EXN A;  4OLL A;  4F0Y A;  4KOR A;  5KTC A;  4KVX A;  1Q2C A;  1YGH A;  2NMT A;  2ARH A;  1XMT A;  5IV0 A;  4UCN A;  4KVM E;  3F5B A;  4PK3 A;  4K30 A;  3FNC A;  4AVC A;  4CYN A;  4UCM A;  3N7Z A;  3FRM A;  3IWE A;  2Z3O A;  4MBU A;  4M3S A;  3P2F A;  4HNW B;  4CAV A;  1S7L A;  1NMT A;  1QSO A;  1B6B A;  5F49 A;  1LRZ A;  2BEI A;  3G3S A;  4B5P B;  3SXO A;  4PSX A;  5E96 A;  2QIR A;  1XE4 A;  4FD7 A;  4LUA A;  2Y0M A;  4AG9 A;  1J4J A;  1S5K A;  3LOD A;  4YRH A;  5G20 A;  3IU1 A;  4BMH A;  4IUS A;  1KUV A;  4OAD A;  5IX3 A;  2CNS A;  5JPH A;  4F0X A;  4R87 A;  5C82 A;  4PSW A;  1S7K A;  2Z11 A;  4CGP A;  5F48 A;  5G1Z A;  4MFP A;  3S6G A;  2HV2 A;  4J3G A;  3R1K A;  1P4N A;  4II9 A;  2WUU A;  3UY5 A;  3JUW A;  2Z3K A;  2YND A;  2ZW5 A;  2I00 A;  1CM0 A;  1RXT A;  2PDO A;  2FE7 A;  4NSQ A;  5AG7 A;  1FY7 A;  2P6E A;  5AG6 A;  1Z4R A;  2J8M A;  2EVN A;  4C2X A;  3GY9 A;  2YNC C;  4KUA A;  4H6Z A;  5EBV A;  4A30 A;  2HQY A;  1Y7R A;  1YVO A;  3PZJ A;  4B14 A;  1M4I A;  5J8C A;  5F46 A;  4B5O A;  4JXQ A;  3QAH A;  4R9M A;  2P0W A;  5I0C A;  2VBQ A;  4KVO E;  2B4B A;  3R96 A;  2CXA A;  1YRE A;  4MFJ A;  1MJ9 A;  4IF5 A;  4C7H A;  5BWA B;  3BLN A;  4Y49 B;  4KOV A;  4YFJ A;  1K4J A;  3FIX A;  3TO9 A;  1WWZ A;  2G3T A;  4NXY A;  2PC1 A;  2PRB A;  3CXS A;  1V0C A;  1L0C A;  2ZXV A;  1M4G A;  4R3L A;  3S6H A;  4A32 A;  2G3A A;  3EC4 A;  2GAN A;  4JLY A;  2RC4 A;  4Y49 C;  1BO4 A;  5IB0 A;  3OWC A;  3IWG A;  3W91 A;  2CNT A;  2P6G A;  4JWP A;  4Q36 A;  4QVT A;  2ATR A;  4PV6 A;  1OZP A;  3T90 A;  3FB3 A;  3R95 A;  2Z10 A;  4XNH B;  3TTH A;  3W6S A;  1QSR A;  4NEX A;  3JTK A;  2DPS A;  1S3Z A;  4HNX B;  1M1D A;  3R9F A;  2ZW7 A;  2EUI A;  2R8V A;  3QB8 A;  2CY2 A;  4F6A A;  3CXQ A;  2FT0 A;  2AJ6 A;  4C2Y A;  4AG7 A;  5AG5 A;  4XNH C;  2Z3N A;  4C68 A;  4B11 A;  4M85 A;  4B12 A;  1SQH A;  4CGL A;  1Z9U A;  4U5Y A;  1CJW A;  4L89 A;  3NE7 A;  3TT2 A;  4L8A A;  4MFZ A;  2VI7 A;  2Z0Z A;  4GS4 A;  4CAW A;  2YGW A;  1BOB A;  2JDD A;  2PR1 A;  2ZW4 A;  3V8I A;  5A28 A;  4JJX A;  4MY3 A;  3EO4 A;  5HMN A;  4A33 A;  5FVJ A;  4NCZ A;  5AG4 A;  4JXR A;  3IGR A;  1P0H A;  4AVA A;  2J8N A;  2Z3M A;  2B4D B;  3R9E A;  4CAE A;  1KZF A;  1KUY A;  2WSA A;  1I21 A;  4QUS A;  3WR7 A;  1ZO0 A;  1U6M A;  4MHD A;  1IID A;  4CRY B;  1XF8 A;  2PR8 A;  2GIV A;  2B5G A;  2PSW A;  3W6X A;  4KOX A;  2WPW A;  4H6U A;  1MJA A;  3GYA A;  1PU9 A;  2OH1 A;  1S7N A;  4MFK A;  4NF1 A;  2VZZ A;  4KZT A;  5H84 A;  1QSM A;  4CGM A;  2JDC A;  4B5P A;  5KTD A;  4CYO A;  4KOT A;  2K5T A;  4C2Z A;  3H5Z A;  4FD4 A;  3I9S A;  4KS9 A;  5JQ4 A;  2YNE A;  4ONU A;  2X7B A;  1YX0 A;  1Q2Y A;  5G21 A;  3A9L A;  2HUZ A;  4I49 A;  4QC6 A;  2Q44 A;  2BUE A;  1QST A;  2YNC A;  3GKR A;  4R57 A;  1B87 A;  3PP9 A;  4ZBG A;  2BSW A;  2FSR A;  2O28 A;  4X5K A;  3D8P A;  2CNM A;  4CS0 B;  4UCP A;  2FXF A;  1YLE A;  3DR6 A;  4A31 A;  4MJ8 A;  2GE3 A;  4MFL A;  1XIX A;  4KLW A;  3P2H A;  3VWD A;  2JLM A;  2VZY A;  1M44 A;  2Q4Y A;  4R3K A;  2Q04 A;  4AVB A;  5A27 A;  2REE A;  4U9Y A;  2B58 A;  4KOS A;  2FCK A;  2QML A;  2J8R A;  4QBJ A;  1GHE A;  4BBH A;  2Z3L A;  3LD2 A;  3FXT A;  3PGP A;  1Y9W A;  2H5M A;  4ZGY B;  1VHS A;  3DSB A;  1Z4E A;  3F0A A;  4AB7 A;  4PK2 A;  4A95 A;  1KUX A;  1RO5 A;  5C88 A;  4FD5 A;  3JVN A;  2I79 A;  5AGE A;  4KOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...