4XPDC

Crystal structure of yeast n-terminal acetyltransferase nate (ppgpp) in complex with a bisubstrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
155
Chain Sequence
RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDVHFTQMAYYSEIPVGGLVAKLVPLSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
publication title Crystal structure of yeast N-terminal acetyltransferase NatE (ppGpp) in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 39
structure length 155
sequence length 174
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xpdC00
4M3SA 4NF1A 3V8IA 4MHDA 2PR1A 2G0BA 1Q2CA 2Q4YA 3F8KA 3P2FA 5HH1A 3TTHA 4F6AA 2FSRA 2G3TA 3G8WA 5F49A 3SXNA 2J8NA 4H6ZA 3JUWA 1CM0A 4QVTA 4L89A 3R95A 4EVYA 4JLYA 1I21A 4Y49C 3EO4A 3FYNA 4I49A 1WK4A 3R9FA 3FRMA 3IGRA 2B5GA 2WPWA 2Z11A 2QIRA 1XIXA 5FVJA 4M85A 1M44A 4YFJA 3SXOA 3S6KA 2BL1A 5H84A 4XNHC 1XE4A 1U6MA 4KLVA 2JEVA 4FD7A 1P4NA 3ZJ0A 2I79A 2ZXVA 1IYLA 3QB8A 3F0AA 4XPDC 3R9EA 4H6UA 1YVOA 1S7FA 4U9ZA 1IIDA 4NEXA 4UWJA 3T90A 4RS2A 2OZUA 3CXSA 4KUBA 2Y0MA 3T9YA 3EY5A 4HNXB 4MY3A 1N71A 5DWMA 1BOBA 4KOWA 4R3LA 2PRBA 4YGOA 4YRHA 4JXQA 2PSWA 2JDCA 3D2PA 2D4OA 5IV0A 3TOAA 2ARHA 4KOYA 3UY5A 1VHSA 1XF8A 4U9YA 2FCKA 1S7KA 2CY2A 5C82A 4R87A 3TO7A 3BJ8A 2PQ8A 1IYKA 3CXQA 3D8PA 2CNSA 5ISVA 3C26A 2FIAA 2OZGA 2VXKA 5EBVA 2PDOA 5DWNA 4KOUA 3E0KA 1YX0A 1M1DA 2Q7BA 2B58A 2GANA 2OZHA 3BJ7A 4AG9A 4KOTA 5JQ4A 4QB9A 3IWGA 3WR7A 1P0HA 3DNSA 2FE7A 2HQYA 4H89A 4HNYB 2B3UA 4KVXA 3EFAA 4MBUA 2ZW5A 3RYOA 5I0CA 2REFA 1MJBA 3I9SA 4F0YA 3PGPA 2KCWA 1CJWA 4FD4A 3TCVA 4IUSA 3D2MA 1S3ZA 1NE9A 4PK2A 4LX9A 4JWPA 3P2HA 2FXFA 2Q4VA 3FXTA 4E2AA 1J4JA 1SQHA 3TE4A 3FNCA 4MJ8A 5IX3A 4R57A 2ATRA 3EC4A 3DR8A 1OZPA 1S5KA 4KVOE 3VWDA 1RO5A 4AB7A 1BO4A 4X5KA 3S6FA 2JLMA 3F5BA 4ORFA 5HMNA 1IB1E 1Q2YA 3FBUA 1S7LA 4FD6A 4IF5A 4KORA 2FT0A 4R9MA 1WWZA 4XPKA 2QMLA 1LRZA 5EC4A 1L0CA 3W6XA 4L8AA 1PUAA 1YVKA 1ON0A 4UA3A 2ZPAA 4Y49B 3TT2A 3PP9A 4ZBGA 2BSWA 3B8GA 2CNMA 4CRYB 3TO9A 1QSMA 5GCNA 2O28A 1M4DA 2EVNA 2ZW6A 4KOSA 2VQYA 1KUXA 5KTCA 3QAHA 1NSLA 4R3KA 1M4GA 3LD2A 4CAWA 4RI1A 5KTDA 2G3AA 2B3VA 4XPLA 1Z4RA 4XNHB 3OWCA 3R1KA 2HUZA 2VZZA 5JPHA 2OB0A 4QBJA 3EXNA 1Y9KA 1VKCA 2X7BA 4KZTA 3N7ZA 2P6GA 1YK3A 2Z10A 2Q44A 1MK4A 4B5OA 4XPDB 1Y7RA 3LODA 1IICA 4B5PB 1FY7A 4HKFA 1QSTA 1XEBA 2PR8A 4OAEA 1K4JA 4II9A 5F47A 3TFYA 4CAVA 1Z9UA 1YLEA 4NXYA 1XMTA 3FIXA 1KUVA 2GIVA 5E96A 2VZYA 3VWEA 2P6FA 1RXTA 4LUAA 3R9GA 1Y9WA 4UWIA 2FL4A 1I12A 4KOXA 4AVAA 4DNCA 2QECA 5J8FA 3K9UA 1B6BA 4BMHA 5H86A 3G3SA 2F5IA 2HV2A 2Q04A 1YR0A 2J8MA 2B4DB 2P0WA 4AVCA 4KLWA 4UBRA 2EUIA 1MJAA 4JD6A 4KOVA 3DSBA 1Q2DA 1YGHA 4GS4A 1V0CA 3GY9A 2K5TA 4JJXA 2C27A 4AVBA 4KVME 4MI4A 1MJ9A 5CNPA 1UFHA 2ZW7A 2D4PA 2J8RA 4PSWA 3TOBA 2R1IA 2R8VA 1NMTA 1QSRA 4E0AA 1GHEA 4PV6A 4CAXA 4K30A 1KUYA 2AE6A 1Z4EA 2OH1A 2B4DA 4QUSA 1TIQA 1QSNA 2AJ6A 2NMTA 3W6SA 3BLNA 3NE7A 2B4BA 2VBQA 2H5MA 2R7HA 3DR6A 3SHPA 4AG7A 2BEIA 1S7NA 3S6GA 5F46A 3H4QA 3KKWA 1B87A 1KZFA 2GE3A 5J8CA 1I1DA 3FB3A 4FD5A 3GKRA 2FIWA 2OU2A 5C88A 2REEA 2WPXA 2VI7A 3W91A 2VEZA 5KTAA 2BUEA 2R98A 2IL4A 3D3SA 3I3GA 1YREA 4U5YA 4HNWB 4CRZB 2DXQA 4MY0A 4ONUA 3S6HA 4KUAA 3GYAA 2PC1A 1M4IA 4E8OA 2CNTA 4CS0B 3R96A 2JDDA 3PZJA 1S60A 5IB0A 5F48A 4PK3A 1QSOA 2Z0ZA 2ZW4A 4J3GA 2RC4A 4OLLA 3TO6A 2FS5A 1PU9A 3JVNA 3DDDA 2I00A 4NCZA 4OADA 2Q0YA 1R57A 2P6EA 3CXPA 3MGDA 3ZZIA 4QC6A 2A4NA 4B5PA 4PSXA 4NSQA 4JXRA 2B5GB
chains in the Genus database with same CATH superfamily
2YNDA 2CTBA 4M3SA 4A39A 4BD9A 2Z3OA 2ZEOA 4NF1A 2PJ5A 3PB9X 3V8IA 2J9AA 4FAIA 2IQ6A 2PJBA 4C7IA 4MHDA 2PR1A 4P6YA 4TNUA 4WWVA 2G0BA 5LRGA 3IIBA 1Q2CA 4NGRA 2Q4YA 3F8KA 1BLLE 1XMBA 5DS0A 3P2FA 4ONWA 5HH1A 2Q7SA 3TTHA 4F6AA 3CZXA 5I4MA 2FSRA 2G3TA 3RNZA 4K3NA 3KHZA 3G8WA 5F49A 4F8ZA 3KI9A 3SXNA 4MHYA 2J8NA 2V77A 4H6ZA 3JUWA 2CIJA 3V38A 1TF9A 1CM0A 2RFHA 7CPAA 4QVTA 1LAMA 2BCOA 5F09A 4L89A 2XEGA 3R95A 3IWWA 4EVYA 4JLYA 1I21A 4Y49C 4PPZA 3EO4A 1EE3P 1Y0RA 2ZEEA 3KR4A 3FYNA 3KZWA 2Q43A 4PQAA 4H2KA 4C2XA 4YWYA 3RZAA 4TWEA 4I49A 1WK4A 4EFDA 5AGEA 3R9FA 3FRMA 4RUHA 3IGRA 2B5GA 3FEDA 2WPWA 2XEJA 2Z11A 3B3CA 2WUUA 2QIRA 1XIXA 4C2YA 1ZG7A 5FVJA 1XOVA 4MXUA 3L2NA 3D7GA 4M85A 1M44A 3SI1A 4UFXA 4YFJA 4CYNA 2CTCA 3SXOA 3S6KA 5K8MA 2BL1A 3IFEA 5H84A 4XNHC 1XE4A 2PJ3A 3KR5A 1U6MA 1Y7EA 4KLVA 1TKJA 2JEVA 4FD7A 1P4NA 2PIYA 3KQZA 4UEZA 2I79A 2ZXVA 3ZJ0A 4ZX9A 3DGVA 3T8WA 3NA6A 1IYLA 1AYEA 2GU2A 3S9LA 3QB8A 4UCNA 4NFRA 3F0AA 4XPDC 3R9EA 4H6UA 1YVOA 1LCPA 2ZEPA 4MFKA 1S7FA 2C1CA 4U9ZA 5AG5A 1IIDA 4NEXA 1UWYA 2Z3PA 3KGQA 4IAVA 4B14A 1JWQA 2V8VA 2ZENA 4R7MA 4UWJA 4RS2A 3T90A 2YNEA 2OZUA 4LQ6A 1DE4C 4CYQA 4ZYQA 5K8NA 3CXSA 4KUBA 2PE3A 2Y0MA 4R76A 3T9YA 3EY5A 4HNXB 4MY3A 1N71A 5DWMA 1BOBA 4KOWA 4R3LA 2PRBA 4YGOA 3D68A 4JXQA 2PSWA 4YRHA 2JDCA 3D2PA 2D4OA 4A94A 2PJ1A 5IV0A 3TOAA 2EO8A 4A32A 2ARHA 4KOYA 3UY5A 4CGNA 3K9TA 1VHSA 3WT4A 1XF8A 4U9YA 1M4LA 4P4IA 4BBHA 2FCKA 1S7KA 2CY2A 1ZLIA 5C82A 4R87A 3LACA 3TO7A 3BJ8A 3FF3A 2PQ8A 3D7FA 2NYQA 4ZI6A 1IYKA 3CXQA 5HVGA 3D8PA 5K8OA 2Q4ZA 2CNSA 1IOIA 1AMPA 3RBUA 4NJRA 5ISVA 1XRYA 2PVVA 3C26A 2FIAA 2OZGA 2VXKA 5EBVA 2OR4A 1H8LA 3NFZA 2PDOA 5DWNA 4KOUA 4UFVA 4CGLA 3E0KA 5JM6A 5HVHA 1YX0A 1M1DA 3KHXA 2V8GA 2Q7BA 1HEEA 3SI2A 2PJ2A 1Z8TA 3KQXA 3PRTA 2B58A 3MN8A 2C6CA 4OC5A 4OC2A 1BPMA 3IWEA 2GANA 2OZHA 3BJ7A 4AG9A 4KOTA 2PJ0A 4CPAA 4QB9A 5JQ4A 3IWGA 3WR7A 1P0HA 3DNSA 2FE7A 2HQYA 4H89A 4HNYB 1BPNA 4YU9A 2B3UA 4KVXA 4A31A 3EFAA 4FBEA 2Z3MA 4MBUA 2ZW5A 2EWBA 3RYOA 4C68A 4IK2A 5I0CA 1TKHA 4C7HA 1IOFA 1MJBA 2REFA 2YNCA 3I9SA 2CF4A 3WC7A 4F0YA 3PGPA 4PXCA 2Z3NA 2KCWA 1CJWA 3GUXA 1QMUA 1XFOA 3IJ3A 4KSAA 4FD4A 1ARMA 4B12A 3PFOA 3TCVA 4IUSA 4MHPA 4F9UA 2G9DA 3D2MA 1S3ZA 4NGQA 2VL1A 1NE9A 1NSAA 4OMEA 4PK2A 4LX9A 4JWPA 4CGMA 3D4UA 3HUVA 5JGFA 3P2HA 2FXFA 2Q4VA 3FXTA 4MHZA 4ZY2A 3PB6X 2OOTA 1J4JA 4A38A 1SQHA 4E2AA 3TE4A 4MCQA 4FWUA 3FNCA 2GLJA 3CPAA 1CG2A 2PJ9A 3TC8A 4MJ8A 2IMOA 2V8HA 3SJEA 5IX3A 4R57A 1RTQA 4ZY0A 2ATRA 2NSMA 3EC4A 3DR8A 3PBBA 5AG4A 1OZPA 1S5KA 4KVOE 3VWDA 2C6PA 2JBKA 4IHMA 1RO5A 4AB7A 4DJLA 1BO4A 3MRUA 2AFSA 4X5KA 1X10A 2JLMA 3NE8A 3S6FA 3F5BA 4ORFA 1TF8A 1IB1E 1FNOA 2AFZA 5HMNA 4P4JA 1HDUA 1Q2YA 3FBUA 3CPXA 1S7LA 3HLPA 4FD6A 4IF5A 4P4DA 1ZO0A 2C6GA 2FT0A 4KORA 4R9MA 1WWZA 4RN7A 1ZG8A 1YLOA 3QNVA 5HVFA 4XPKA 2QMLA 1LRZA 1Z8LA 5EC4A 3QAYA 4M6GA 1VHEA 1L0CA 2IJZA 3W6XA 1JQGA 4L8AA 4WJBA 5HXDA 1PUAA 4MMOA 1YQEA 1YVKA 3VARA 3H8EA 4NGSA 1ON0A 4OIWA 4UA3A 2PJ4A 1GYTA 2ZPAA 4Y49B 3ISZA 1QQ9A 3TT2A 3PP9A 4P4EA 4ZBGA 4DYOA 2BSWA 5CBMA 3B8GA 2CNMA 4CAEA 4CRYB 3TO9A 1QSMA 3B7IA 5GCNA 2O28A 2ZELA 4UEEA 1M4DA 2EVNA 2FVGA 2JBJA 4MFPA 5AG7A 5D8NA 2F8HA 2ZW6A 5G1ZA 3RAMA 4KOSA 2VQYA 4C2ZA 1KUXA 5KTCA 3QAHA 1NSLA 4R3KA 1M4GA 3LD2A 3D7DA 4HPSA 4CAWA 2YNCC 4RI1A 5KTDA 3PBEA 6CPAA 4CAFA 4UIBA 2G3AA 2AFOA 2B3VA 3IO1A 4NGPA 4XPLA 1ZLHA 4UF4A 1Z4RA 4XNHB 2ZOFA 4OC0A 3OWCA 3R1KA 1Y0YA 2AFXA 1F57A 2HUZA 2VZZA 5JPHA 3LWUA 4NGTA 2OB0A 3K2KA 4JYWA 4QBJA 3ISXA 3EXNA 1Y9KA 2GREA 5BWAB 4X3RA 1VKCA 2CXAA 2X7BA 4KZTA 3N7ZA 4A95A 2P6GA 1YK3A 1R43A 2Z10A 2Q44A 1MK4A 4B5OA 1CPXA 4OIDA 3IU1A 4XPDB 1Y7RA 3LODA 1IICA 4B5PB 1A2ZA 1FY7A 4HKFA 1QSTA 3FX6A 4FUUA 1ZG9A 1XEBA 3WC5A 2PR8A 4OAEA 4UCPA 1K4JA 2DEAA 3H5ZA 4II9A 5F47A 3TFYA 4CAVA 1Z9UA 1YLEA 3B3SA 4NXYA 1LANA 1XMTA 4NGMA 1OBRA 2HB6A 4B13A 3FIXA 2Z3LA 5AG6A 3SJFA 1KUVA 3B35A 2GIVA 3JTKA 3CT9A 2ZOGA 4JZ0A 4A33A 5E96A 2PRQA 2VZYA 4PXBA 3VWEA 1TXRA 3NH8A 2P6FA 4ZY1A 1RXTA 2RB7A 4LUAA 3R9GA 3BI1A 1CX8A 2PVWA 3LMSA 1Y9WA 4MFLA 4UWIA 2FL4A 2WSAA 4M6IA 1I12A 4KOXA 2ODFA 4AVAA 2Z3KA 4NGNA 4X8IA 2WZNA 1ELMP 3B3WA 2QECA 4DNCA 3A9LA 1B6BA 3K9UA 2PJCA 4BMHA 5J8FA 2PJAA 5H86A 3G3SA 2F5IA 2AFMA 2O4HA 2EK8A 5IB9A 4P44A 5LYLA 1F2PA 3BXMA 4B11A 4M6HA 1CP6A 2XEFA 2DF5A 1Q7LA 2HV2A 4OC4A 2Q04A 1IGBA 3D66A 4UCMA 1YR0A 2J8MA 2B4DB 3SJGA 1LAPA 1ELLP 2P0WA 2ZEDA 1VGYA 1XJOA 4MFQA 3V7ZA 4AVCA 4B6ZA 5G21A 3KL9A 4KLWA 4UBRA 2EUIA 3PB4X 2ZEGA 1MJAA 4MCSA 4X2TA 4JD6A 4A30A 3B3TA 3KASA 4KOVA 3DSBA 1Q2DA 1YGHA 4GS4A 4AXVA 1V0CA 2PJ7A 2JEWA 3B3VA 5K8PA 3GY9A 2K5TA 4NJQA 4OKOA 4DUKA 5J1QA 3WABA 4JJXA 2C27A 5JH9A 1Z8XA 3BHXA 2PIZA 2PJ8A 4CYOA 4AVBA 1HDQA 4KVME 2PCUA 4MI4A 1KWMA 1MJ9A 5CNPA 1UFHA 2ZW7A 4ZGYB 2D4PA 2DPSA 2J8RA 4PSWA 1AUGA 3PB8X 4MFJA 4Q7AA 3PB7X 3TOBA 4LQGA 3SJXA 5A27A 2R1IA 2ZEHA 3IU2A 2XEIA 3N5FA 4O23A 4Q38A 2R8VA 4P10A 4GM5A 1VIXA 2WYRA 1LFWA 3DLJA 1NMTA 1QSRA 3WC6A 4E0AA 2ZEFA 1GHEA 4PV6A 4P4BA 4EWTA 4CAXA 4F9VA 4K30A 1KUYA 2AE6A 2EK9A 1Z4EA 2OH1A 1X12A 1PYTB 2B4DA 4KSIA 4QUSA 1TIQA 3VATA 1QSNA 1VHOA 3I1UA 2AJ6A 4KSFA 1CPSA 2NMTA 4UEFA 3BLNA 3NE7A 3FECA 3NH5A 3W6SA 2AFWA 4CYPA 4P4FA 1YW6A 5LYIA 4BINA 1LOKA 2B4BA 2VBQA 4A37A 1BAVA 3PFEA 4Q36A 2ABZA 2I3CA 3CDXA 2V8DA 2H5MA 2R7HA 3DR6A 3NH4A 3B2YA 5LYFA 3SHPA 4AG7A 3FVLA 2F7VA 3GLJA 2BEIA 1S7NA 3PEIA 5CPAA 4MFZA 1IY7A 1YMEA 1F2OA 3S6GA 5F46A 3H4QA 4GXHA 4MCRA 2DPTA 1YW4A 5LRJA 3KKWA 2PJ6A 4R6TA 1B87A 1KZFA 2GE3A 5J8CA 1I1DA 3FJUA 3FB3A 5THWA 1PCAA 2BO9A 1Z2LA 4FD5A 3GKRA 5G20A 4F0XA 3RO0A 4Z65A 1CBXA 2FIWA 2HC9A 2YGWA 2OU2A 3TX8A 1CP7A 3FEEA 5C88A 2O53A 2QJ8A 2REEA 2WPXA 5LRKA 2VI7A 2ZEMA 3W91A 2GLFA 2VEZA 5KTAA 2BUEA 2Q51A 2R98A 4A2ZA 5D29A 2IL4A 3D3SA 4ZX8A 3GIUA 3I3GA 3D7HA 1YREA 4U5YA 4UIAA 4HNWB 4CRZB 3D67A 2DXQA 3IC1A 1IU8A 4MRIA 4MY0A 3BI0A 1YSJA 4ONUA 3VH9A 2EBJA 1ARLA 1R3NA 3H8FA 1Z8WA 3S6HA 4KUAA 4G1PA 3FMCA 3GYAA 2PC1A 1M4IA 1Z5RA 3FH4A 4E8OA 2CNTA 3GB0A 4CS0B 3R96A 1FT7A 2JDDA 3PZJA 1S60A 5IB0A 5F48A 2ANPA 5EMIA 5ELYA 4PXDA 4CGPA 4MCPA 4PK3A 1QSOA 4P45A 2Z0ZA 2ZW4A 4J3GA 4KS9A 4MHNA 4W9YA 2GFQA 2BOAA 2RC4A 2AFUA 1TKFA 4OC1A 5LYDA 4OLLA 4B10A 3TO6A 2FS5A 1PU9A 4EMEA 3SI0A 4PXEA 3JVNA 3DDDA 5A28A 2I00A 4NCZA 3S9NA 4OADA 5G22A 2Q0YA 4CGOA 1R57A 2P6EA 2QYVA 3CXPA 4OC3A 3MGDA 3H8GA 8CPAA 4OP4A 2QVPA 3ZZIA 1XBUA 4UFWA 4QC6A 2A4NA 4R8FA 2POKA 4B5PA 4PSXA 3S9MA 4NSQA 3JRUA 4JXRA 2B5GB 3IEHA 1DTDA
chains in the Genus database with same CATH topology
2YNDA 4M3SA 2Z3OA 4NF1A 3V8IA 4C7IA 4MHDA 2PR1A 2G0BA 1Q2CA 2Q4YA 3F8KA 3P2FA 5HH1A 3TTHA 4F6AA 2FSRA 2G3TA 3G8WA 5F49A 3SXNA 2J8NA 4H6ZA 3JUWA 1CM0A 4QVTA 4L89A 3R95A 4EVYA 4JLYA 1I21A 4Y49C 3EO4A 3FYNA 4C2XA 4I49A 1WK4A 5AGEA 3R9FA 3FRMA 3IGRA 2B5GA 2WPWA 2Z11A 2WUUA 2QIRA 1XIXA 4C2YA 5FVJA 4M85A 1M44A 4YFJA 4UFXA 4CYNA 3SXOA 3S6KA 2BL1A 5H84A 4XNHC 1XE4A 1U6MA 4KLVA 2JEVA 4FD7A 1P4NA 3ZJ0A 2I79A 2ZXVA 1IYLA 3QB8A 4UCNA 3F0AA 4XPDC 3R9EA 4H6UA 1YVOA 4MFKA 1S7FA 4U9ZA 5AG5A 1IIDA 4NEXA 2Z3PA 4B14A 4UWJA 3T90A 4RS2A 2YNEA 2OZUA 4CYQA 3CXSA 4KUBA 2Y0MA 3T9YA 3EY5A 4HNXB 4MY3A 1N71A 5DWMA 1BOBA 4KOWA 4R3LA 2PRBA 4YGOA 4YRHA 4JXQA 2PSWA 2JDCA 3D2PA 2D4OA 5IV0A 3TOAA 4A32A 2ARHA 4KOYA 3UY5A 4CGNA 1VHSA 1XF8A 4U9YA 4BBHA 2FCKA 1S7KA 2CY2A 5C82A 4R87A 3TO7A 3BJ8A 2PQ8A 1IYKA 3CXQA 3D8PA 2CNSA 5ISVA 3C26A 2FIAA 2OZGA 2VXKA 5EBVA 2PDOA 5DWNA 4KOUA 4UFVA 4CGLA 3E0KA 1YX0A 1M1DA 2Q7BA 2B58A 3IWEA 2GANA 2OZHA 3BJ7A 4AG9A 4KOTA 5JQ4A 4QB9A 3IWGA 3WR7A 1P0HA 3DNSA 2FE7A 2HQYA 4H89A 4HNYB 2B3UA 4KVXA 4A31A 3EFAA 2Z3MA 4MBUA 2ZW5A 3RYOA 4C68A 5I0CA 4C7HA 2REFA 1MJBA 2YNCA 3I9SA 4F0YA 3PGPA 2Z3NA 2KCWA 1CJWA 4KSAA 4FD4A 4B12A 3TCVA 4IUSA 3D2MA 1S3ZA 1NE9A 4PK2A 4LX9A 4JWPA 4CGMA 3P2HA 2FXFA 2Q4VA 3FXTA 4E2AA 1J4JA 1SQHA 3TE4A 3FNCA 4MJ8A 5IX3A 4R57A 2ATRA 3EC4A 3DR8A 5AG4A 1OZPA 1S5KA 4KVOE 3VWDA 1RO5A 4AB7A 1BO4A 4X5KA 3S6FA 2JLMA 3F5BA 4ORFA 5HMNA 1IB1E 1Q2YA 3FBUA 1S7LA 4IF5A 4FD6A 1ZO0A 2FT0A 4KORA 4R9MA 1WWZA 4XPKA 2QMLA 1LRZA 5EC4A 1L0CA 3W6XA 4L8AA 1PUAA 1YVKA 1ON0A 4UA3A 2ZPAA 4Y49B 3TT2A 3PP9A 4ZBGA 2BSWA 3B8GA 2CNMA 4CAEA 4CRYB 3TO9A 1QSMA 5GCNA 2O28A 5AG7A 1M4DA 2EVNA 4MFPA 5G1ZA 4ZGYB 2ZW6A 4KOSA 2VQYA 4C2ZA 1KUXA 5KTCA 3QAHA 1NSLA 4R3KA 1M4GA 3LD2A 4CAWA 2YNCC 4RI1A 5KTDA 4CAFA 2G3AA 2B3VA 4XPLA 1Z4RA 4XNHB 3OWCA 3R1KA 2HUZA 2VZZA 5JPHA 2OB0A 4QBJA 3EXNA 1Y9KA 5BWAB 1VKCA 2CXAA 2X7BA 4KZTA 3N7ZA 4A95A 2P6GA 1YK3A 2Z10A 2Q44A 1MK4A 4B5OA 3IU1A 4XPDB 1Y7RA 3LODA 1IICA 4B5PB 1FY7A 4HKFA 1QSTA 1XEBA 2PR8A 4OAEA 4UCPA 1K4JA 4II9A 3H5ZA 5F47A 3TFYA 4CAVA 1Z9UA 1YLEA 4NXYA 1XMTA 4B13A 3FIXA 2Z3LA 5AG6A 1KUVA 3JTKA 2GIVA 4A33A 5E96A 2VZYA 3VWEA 2P6FA 1RXTA 4LUAA 3R9GA 1Y9WA 4MFLA 4UWIA 2FL4A 2WSAA 1I12A 4KOXA 4AVAA 2Z3KA 4DNCA 2QECA 5J8FA 3A9LA 1B6BA 3K9UA 4BMHA 5H86A 3G3SA 2F5IA 4B11A 2HV2A 2Q04A 4UCMA 1YR0A 2J8MA 2B4DB 2P0WA 4MFQA 4AVCA 5G21A 4KLWA 4UBRA 2EUIA 1MJAA 4JD6A 4A30A 4KOVA 3DSBA 1Q2DA 1YGHA 4GS4A 1V0CA 3GY9A 2K5TA 4JJXA 2C27A 4CYOA 4AVBA 4KVME 4MI4A 1MJ9A 5CNPA 1UFHA 2ZW7A 2D4PA 2DPSA 2J8RA 4PSWA 4MFJA 3TOBA 5A27A 2R1IA 3IU2A 4Q38A 2R8VA 1NMTA 1QSRA 4E0AA 1GHEA 4PV6A 4CAXA 4K30A 1KUYA 2AE6A 1Z4EA 2OH1A 2B4DA 4QUSA 1TIQA 1QSNA 4KSFA 2AJ6A 2NMTA 3W6SA 3BLNA 3NE7A 4CYPA 2B4BA 2VBQA 4Q36A 2H5MA 2R7HA 3DR6A 3SHPA 4AG7A 2BEIA 1S7NA 4MFZA 3S6GA 5F46A 3H4QA 2DPTA 3KKWA 1B87A 1KZFA 2GE3A 5J8CA 1I1DA 3FB3A 4FD5A 3GKRA 5G20A 4F0XA 2FIWA 2YGWA 2OU2A 5C88A 2REEA 2WPXA 2VI7A 3W91A 2VEZA 5KTAA 2BUEA 2R98A 4A2ZA 2IL4A 3D3SA 3I3GA 1YREA 4U5YA 4HNWB 4CRZB 2DXQA 4MY0A 4ONUA 3S6HA 4KUAA 3GYAA 2PC1A 1M4IA 4E8OA 2CNTA 4CS0B 3R96A 2JDDA 3PZJA 1S60A 5IB0A 5F48A 4CGPA 4PK3A 1QSOA 2Z0ZA 2ZW4A 4J3GA 4KS9A 2RC4A 4OLLA 4B10A 3TO6A 2FS5A 1PU9A 3JVNA 3DDDA 5A28A 2I00A 4NCZA 4OADA 5G22A 2Q0YA 4CGOA 1R57A 2P6EA 3CXPA 3MGDA 3ZZIA 4UFWA 4QC6A 2A4NA 4B5PA 4PSXA 4NSQA 4JXRA 2B5GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3S A;  4NF1 A;  3V8I A;  4MHD A;  2PR1 A;  2G0B A;  1Q2C A;  2Q4Y A;  3F8K A;  3P2F A;  5HH1 A;  3TTH A;  4F6A A;  2FSR A;  2G3T A;  3G8W A;  5F49 A;  3SXN A;  2J8N A;  4H6Z A;  3JUW A;  1CM0 A;  4QVT A;  4L89 A;  3R95 A;  4EVY A;  4JLY A;  1I21 A;  4Y49 C;  3EO4 A;  3FYN A;  4I49 A;  1WK4 A;  3R9F A;  3FRM A;  3IGR A;  2B5G A;  2WPW A;  2Z11 A;  2QIR A;  1XIX A;  5FVJ A;  4M85 A;  1M44 A;  4YFJ A;  3SXO A;  3S6K A;  2BL1 A;  5H84 A;  4XNH C;  1XE4 A;  1U6M A;  4KLV A;  2JEV A;  4FD7 A;  1P4N A;  3ZJ0 A;  2I79 A;  2ZXV A;  1IYL A;  3QB8 A;  3F0A A;  4XPD C;  3R9E A;  4H6U A;  1YVO A;  1S7F A;  4U9Z A;  1IID A;  4NEX A;  4UWJ A;  3T90 A;  4RS2 A;  2OZU A;  3CXS A;  4KUB A;  2Y0M A;  3T9Y A;  3EY5 A;  4HNX B;  4MY3 A;  1N71 A;  5DWM A;  1BOB A;  4KOW A;  4R3L A;  2PRB A;  4YGO A;  4YRH A;  4JXQ A;  2PSW A;  2JDC A;  3D2P A;  2D4O A;  5IV0 A;  3TOA A;  2ARH A;  4KOY A;  3UY5 A;  1VHS A;  1XF8 A;  4U9Y A;  2FCK A;  1S7K A;  2CY2 A;  5C82 A;  4R87 A;  3TO7 A;  3BJ8 A;  2PQ8 A;  1IYK A;  3CXQ A;  3D8P A;  2CNS A;  5ISV A;  3C26 A;  2FIA A;  2OZG A;  2VXK A;  5EBV A;  2PDO A;  5DWN A;  4KOU A;  3E0K A;  1YX0 A;  1M1D A;  2Q7B A;  2B58 A;  2GAN A;  2OZH A;  3BJ7 A;  4AG9 A;  4KOT A;  5JQ4 A;  4QB9 A;  3IWG A;  3WR7 A;  1P0H A;  3DNS A;  2FE7 A;  2HQY A;  4H89 A;  4HNY B;  2B3U A;  4KVX A;  3EFA A;  4MBU A;  2ZW5 A;  3RYO A;  5I0C A;  2REF A;  1MJB A;  3I9S A;  4F0Y A;  3PGP A;  2KCW A;  1CJW A;  4FD4 A;  3TCV A;  4IUS A;  3D2M A;  1S3Z A;  1NE9 A;  4PK2 A;  4LX9 A;  4JWP A;  3P2H A;  2FXF A;  2Q4V A;  3FXT A;  4E2A A;  1J4J A;  1SQH A;  3TE4 A;  3FNC A;  4MJ8 A;  5IX3 A;  4R57 A;  2ATR A;  3EC4 A;  3DR8 A;  1OZP A;  1S5K A;  4KVO E;  3VWD A;  1RO5 A;  4AB7 A;  1BO4 A;  4X5K A;  3S6F A;  2JLM A;  3F5B A;  4ORF A;  5HMN A;  1IB1 E;  1Q2Y A;  3FBU A;  1S7L A;  4FD6 A;  4IF5 A;  4KOR A;  2FT0 A;  4R9M A;  1WWZ A;  4XPK A;  2QML A;  1LRZ A;  5EC4 A;  1L0C A;  3W6X A;  4L8A A;  1PUA A;  1YVK A;  1ON0 A;  4UA3 A;  2ZPA A;  4Y49 B;  3TT2 A;  3PP9 A;  4ZBG A;  2BSW A;  3B8G A;  2CNM A;  4CRY B;  3TO9 A;  1QSM A;  5GCN A;  2O28 A;  1M4D A;  2EVN A;  2ZW6 A;  4KOS A;  2VQY A;  1KUX A;  5KTC A;  3QAH A;  1NSL A;  4R3K A;  1M4G A;  3LD2 A;  4CAW A;  4RI1 A;  5KTD A;  2G3A A;  2B3V A;  4XPL A;  1Z4R A;  4XNH B;  3OWC A;  3R1K A;  2HUZ A;  2VZZ A;  5JPH A;  2OB0 A;  4QBJ A;  3EXN A;  1Y9K A;  1VKC A;  2X7B A;  4KZT A;  3N7Z A;  2P6G A;  1YK3 A;  2Z10 A;  2Q44 A;  1MK4 A;  4B5O A;  4XPD B;  1Y7R A;  3LOD A;  1IIC A;  4B5P B;  1FY7 A;  4HKF A;  1QST A;  1XEB A;  2PR8 A;  4OAE A;  1K4J A;  4II9 A;  5F47 A;  3TFY A;  4CAV A;  1Z9U A;  1YLE A;  4NXY A;  1XMT A;  3FIX A;  1KUV A;  2GIV A;  5E96 A;  2VZY A;  3VWE A;  2P6F A;  1RXT A;  4LUA A;  3R9G A;  1Y9W A;  4UWI A;  2FL4 A;  1I12 A;  4KOX A;  4AVA A;  4DNC A;  2QEC A;  5J8F A;  3K9U A;  1B6B A;  4BMH A;  5H86 A;  3G3S A;  2F5I A;  2HV2 A;  2Q04 A;  1YR0 A;  2J8M A;  2B4D B;  2P0W A;  4AVC A;  4KLW A;  4UBR A;  2EUI A;  1MJA A;  4JD6 A;  4KOV A;  3DSB A;  1Q2D A;  1YGH A;  4GS4 A;  1V0C A;  3GY9 A;  2K5T A;  4JJX A;  2C27 A;  4AVB A;  4KVM E;  4MI4 A;  1MJ9 A;  5CNP A;  1UFH A;  2ZW7 A;  2D4P A;  2J8R A;  4PSW A;  3TOB A;  2R1I A;  2R8V A;  1NMT A;  1QSR A;  4E0A A;  1GHE A;  4PV6 A;  4CAX A;  4K30 A;  1KUY A;  2AE6 A;  1Z4E A;  2OH1 A;  2B4D A;  4QUS A;  1TIQ A;  1QSN A;  2AJ6 A;  2NMT A;  3W6S A;  3BLN A;  3NE7 A;  2B4B A;  2VBQ A;  2H5M A;  2R7H A;  3DR6 A;  3SHP A;  4AG7 A;  2BEI A;  1S7N A;  3S6G A;  5F46 A;  3H4Q A;  3KKW A;  1B87 A;  1KZF A;  2GE3 A;  5J8C A;  1I1D A;  3FB3 A;  4FD5 A;  3GKR A;  2FIW A;  2OU2 A;  5C88 A;  2REE A;  2WPX A;  2VI7 A;  3W91 A;  2VEZ A;  5KTA A;  2BUE A;  2R98 A;  2IL4 A;  3D3S A;  3I3G A;  1YRE A;  4U5Y A;  4HNW B;  4CRZ B;  2DXQ A;  4MY0 A;  4ONU A;  3S6H A;  4KUA A;  3GYA A;  2PC1 A;  1M4I A;  4E8O A;  2CNT A;  4CS0 B;  3R96 A;  2JDD A;  3PZJ A;  1S60 A;  5IB0 A;  5F48 A;  4PK3 A;  1QSO A;  2Z0Z A;  2ZW4 A;  4J3G A;  2RC4 A;  4OLL A;  3TO6 A;  2FS5 A;  1PU9 A;  3JVN A;  3DDD A;  2I00 A;  4NCZ A;  4OAD A;  2Q0Y A;  1R57 A;  2P6E A;  3CXP A;  3MGD A;  3ZZI A;  4QC6 A;  2A4N A;  4B5P A;  4PSX A;  4NSQ A;  4JXR A;  2B5G B; 
#chains in the Genus database with same CATH topology
 2YND A;  2CTB A;  4M3S A;  4A39 A;  4BD9 A;  2Z3O A;  2ZEO A;  4NF1 A;  2PJ5 A;  3PB9 X;  3V8I A;  2J9A A;  4FAI A;  2IQ6 A;  2PJB A;  4C7I A;  4MHD A;  2PR1 A;  4P6Y A;  4TNU A;  4WWV A;  2G0B A;  5LRG A;  3IIB A;  1Q2C A;  4NGR A;  2Q4Y A;  3F8K A;  1BLL E;  1XMB A;  5DS0 A;  3P2F A;  4ONW A;  5HH1 A;  2Q7S A;  3TTH A;  4F6A A;  3CZX A;  5I4M A;  2FSR A;  2G3T A;  3RNZ A;  4K3N A;  3KHZ A;  3G8W A;  5F49 A;  4F8Z A;  3KI9 A;  3SXN A;  4MHY A;  2J8N A;  2V77 A;  4H6Z A;  3JUW A;  2CIJ A;  3V38 A;  1TF9 A;  1CM0 A;  2RFH A;  7CPA A;  4QVT A;  1LAM A;  2BCO A;  5F09 A;  4L89 A;  2XEG A;  3R95 A;  3IWW A;  4EVY A;  4JLY A;  1I21 A;  4Y49 C;  4PPZ A;  3EO4 A;  1EE3 P;  1Y0R A;  2ZEE A;  3KR4 A;  3FYN A;  3KZW A;  2Q43 A;  4PQA A;  4H2K A;  4C2X A;  4YWY A;  3RZA A;  4TWE A;  4I49 A;  1WK4 A;  4EFD A;  5AGE A;  3R9F A;  3FRM A;  4RUH A;  3IGR A;  2B5G A;  3FED A;  2WPW A;  2XEJ A;  2Z11 A;  3B3C A;  2WUU A;  2QIR A;  1XIX A;  4C2Y A;  1ZG7 A;  5FVJ A;  1XOV A;  4MXU A;  3L2N A;  3D7G A;  4M85 A;  1M44 A;  3SI1 A;  4UFX A;  4YFJ A;  4CYN A;  2CTC A;  3SXO A;  3S6K A;  5K8M A;  2BL1 A;  3IFE A;  5H84 A;  4XNH C;  1XE4 A;  2PJ3 A;  3KR5 A;  1U6M A;  1Y7E A;  4KLV A;  1TKJ A;  2JEV A;  4FD7 A;  1P4N A;  2PIY A;  3KQZ A;  4UEZ A;  2I79 A;  2ZXV A;  3ZJ0 A;  4ZX9 A;  3DGV A;  3T8W A;  3NA6 A;  1IYL A;  1AYE A;  2GU2 A;  3S9L A;  3QB8 A;  4UCN A;  4NFR A;  3F0A A;  4XPD C;  3R9E A;  4H6U A;  1YVO A;  1LCP A;  2ZEP A;  4MFK A;  1S7F A;  2C1C A;  4U9Z A;  5AG5 A;  1IID A;  4NEX A;  1UWY A;  2Z3P A;  3KGQ A;  4IAV A;  4B14 A;  1JWQ A;  2V8V A;  2ZEN A;  4R7M A;  4UWJ A;  4RS2 A;  3T90 A;  2YNE A;  2OZU A;  4LQ6 A;  1DE4 C;  4CYQ A;  4ZYQ A;  5K8N A;  3CXS A;  4KUB A;  2PE3 A;  2Y0M A;  4R76 A;  3T9Y A;  3EY5 A;  4HNX B;  4MY3 A;  1N71 A;  5DWM A;  1BOB A;  4KOW A;  4R3L A;  2PRB A;  4YGO A;  3D68 A;  4JXQ A;  2PSW A;  4YRH A;  2JDC A;  3D2P A;  2D4O A;  4A94 A;  2PJ1 A;  5IV0 A;  3TOA A;  2EO8 A;  4A32 A;  2ARH A;  4KOY A;  3UY5 A;  4CGN A;  3K9T A;  1VHS A;  3WT4 A;  1XF8 A;  4U9Y A;  1M4L A;  4P4I A;  4BBH A;  2FCK A;  1S7K A;  2CY2 A;  1ZLI A;  5C82 A;  4R87 A;  3LAC A;  3TO7 A;  3BJ8 A;  3FF3 A;  2PQ8 A;  3D7F A;  2NYQ A;  4ZI6 A;  1IYK A;  3CXQ A;  5HVG A;  3D8P A;  5K8O A;  2Q4Z A;  2CNS A;  1IOI A;  1AMP A;  3RBU A;  4NJR A;  5ISV A;  1XRY A;  2PVV A;  3C26 A;  2FIA A;  2OZG A;  2VXK A;  5EBV A;  2OR4 A;  1H8L A;  3NFZ A;  2PDO A;  5DWN A;  4KOU A;  4UFV A;  4CGL A;  3E0K A;  5JM6 A;  5HVH A;  1YX0 A;  1M1D A;  3KHX A;  2V8G A;  2Q7B A;  1HEE A;  3SI2 A;  2PJ2 A;  1Z8T A;  3KQX A;  3PRT A;  2B58 A;  3MN8 A;  2C6C A;  4OC5 A;  4OC2 A;  1BPM A;  3IWE A;  2GAN A;  2OZH A;  3BJ7 A;  4AG9 A;  4KOT A;  2PJ0 A;  4CPA A;  4QB9 A;  5JQ4 A;  3IWG A;  3WR7 A;  1P0H A;  3DNS A;  2FE7 A;  2HQY A;  4H89 A;  4HNY B;  1BPN A;  4YU9 A;  2B3U A;  4KVX A;  4A31 A;  3EFA A;  4FBE A;  2Z3M A;  4MBU A;  2ZW5 A;  2EWB A;  3RYO A;  4C68 A;  4IK2 A;  5I0C A;  1TKH A;  4C7H A;  1IOF A;  1MJB A;  2REF A;  2YNC A;  3I9S A;  2CF4 A;  3WC7 A;  4F0Y A;  3PGP A;  4PXC A;  2Z3N A;  2KCW A;  1CJW A;  3GUX A;  1QMU A;  1XFO A;  3IJ3 A;  4KSA A;  4FD4 A;  1ARM A;  4B12 A;  3PFO A;  3TCV A;  4IUS A;  4MHP A;  4F9U A;  2G9D A;  3D2M A;  1S3Z A;  4NGQ A;  2VL1 A;  1NE9 A;  1NSA A;  4OME A;  4PK2 A;  4LX9 A;  4JWP A;  4CGM A;  3D4U A;  3HUV A;  5JGF A;  3P2H A;  2FXF A;  2Q4V A;  3FXT A;  4MHZ A;  4ZY2 A;  3PB6 X;  2OOT A;  1J4J A;  4A38 A;  1SQH A;  4E2A A;  3TE4 A;  4MCQ A;  4FWU A;  3FNC A;  2GLJ A;  3CPA A;  1CG2 A;  2PJ9 A;  3TC8 A;  4MJ8 A;  2IMO A;  2V8H A;  3SJE A;  5IX3 A;  4R57 A;  1RTQ A;  4ZY0 A;  2ATR A;  2NSM A;  3EC4 A;  3DR8 A;  3PBB A;  5AG4 A;  1OZP A;  1S5K A;  4KVO E;  3VWD A;  2C6P A;  2JBK A;  4IHM A;  1RO5 A;  4AB7 A;  4DJL A;  1BO4 A;  3MRU A;  2AFS A;  4X5K A;  1X10 A;  2JLM A;  3NE8 A;  3S6F A;  3F5B A;  4ORF A;  1TF8 A;  1IB1 E;  1FNO A;  2AFZ A;  5HMN A;  4P4J A;  1HDU A;  1Q2Y A;  3FBU A;  3CPX A;  1S7L A;  3HLP A;  4FD6 A;  4IF5 A;  4P4D A;  1ZO0 A;  2C6G A;  2FT0 A;  4KOR A;  4R9M A;  1WWZ A;  4RN7 A;  1ZG8 A;  1YLO A;  3QNV A;  5HVF A;  4XPK A;  2QML A;  1LRZ A;  1Z8L A;  5EC4 A;  3QAY A;  4M6G A;  1VHE A;  1L0C A;  2IJZ A;  3W6X A;  1JQG A;  4L8A A;  4WJB A;  5HXD A;  1PUA A;  4MMO A;  1YQE A;  1YVK A;  3VAR A;  3H8E A;  4NGS A;  1ON0 A;  4OIW A;  4UA3 A;  2PJ4 A;  1GYT A;  2ZPA A;  4Y49 B;  3ISZ A;  1QQ9 A;  3TT2 A;  3PP9 A;  4P4E A;  4ZBG A;  4DYO A;  2BSW A;  5CBM A;  3B8G A;  2CNM A;  4CAE A;  4CRY B;  3TO9 A;  1QSM A;  3B7I A;  5GCN A;  2O28 A;  2ZEL A;  4UEE A;  1M4D A;  2EVN A;  2FVG A;  2JBJ A;  4MFP A;  5AG7 A;  5D8N A;  2F8H A;  2ZW6 A;  5G1Z A;  3RAM A;  4KOS A;  2VQY A;  4C2Z A;  1KUX A;  5KTC A;  3QAH A;  1NSL A;  4R3K A;  1M4G A;  3LD2 A;  3D7D A;  4HPS A;  4CAW A;  2YNC C;  4RI1 A;  5KTD A;  3PBE A;  6CPA A;  4CAF A;  4UIB A;  2G3A A;  2AFO A;  2B3V A;  3IO1 A;  4NGP A;  4XPL A;  1ZLH A;  4UF4 A;  1Z4R A;  4XNH B;  2ZOF A;  4OC0 A;  3OWC A;  3R1K A;  1Y0Y A;  2AFX A;  1F57 A;  2HUZ A;  2VZZ A;  5JPH A;  3LWU A;  4NGT A;  2OB0 A;  3K2K A;  4JYW A;  4QBJ A;  3ISX A;  3EXN A;  1Y9K A;  2GRE A;  5BWA B;  4X3R A;  1VKC A;  2CXA A;  2X7B A;  4KZT A;  3N7Z A;  4A95 A;  2P6G A;  1YK3 A;  1R43 A;  2Z10 A;  2Q44 A;  1MK4 A;  4B5O A;  1CPX A;  4OID A;  3IU1 A;  4XPD B;  1Y7R A;  3LOD A;  1IIC A;  4B5P B;  1A2Z A;  1FY7 A;  4HKF A;  1QST A;  3FX6 A;  4FUU A;  1ZG9 A;  1XEB A;  3WC5 A;  2PR8 A;  4OAE A;  4UCP A;  1K4J A;  2DEA A;  3H5Z A;  4II9 A;  5F47 A;  3TFY A;  4CAV A;  1Z9U A;  1YLE A;  3B3S A;  4NXY A;  1LAN A;  1XMT A;  4NGM A;  1OBR A;  2HB6 A;  4B13 A;  3FIX A;  2Z3L A;  5AG6 A;  3SJF A;  1KUV A;  3B35 A;  2GIV A;  3JTK A;  3CT9 A;  2ZOG A;  4JZ0 A;  4A33 A;  5E96 A;  2PRQ A;  2VZY A;  4PXB A;  3VWE A;  1TXR A;  3NH8 A;  2P6F A;  4ZY1 A;  1RXT A;  2RB7 A;  4LUA A;  3R9G A;  3BI1 A;  1CX8 A;  2PVW A;  3LMS A;  1Y9W A;  4MFL A;  4UWI A;  2FL4 A;  2WSA A;  4M6I A;  1I12 A;  4KOX A;  2ODF A;  4AVA A;  2Z3K A;  4NGN A;  4X8I A;  2WZN A;  1ELM P;  3B3W A;  2QEC A;  4DNC A;  3A9L A;  1B6B A;  3K9U A;  2PJC A;  4BMH A;  5J8F A;  2PJA A;  5H86 A;  3G3S A;  2F5I A;  2AFM A;  2O4H A;  2EK8 A;  5IB9 A;  4P44 A;  5LYL A;  1F2P A;  3BXM A;  4B11 A;  4M6H A;  1CP6 A;  2XEF A;  2DF5 A;  1Q7L A;  2HV2 A;  4OC4 A;  2Q04 A;  1IGB A;  3D66 A;  4UCM A;  1YR0 A;  2J8M A;  2B4D B;  3SJG A;  1LAP A;  1ELL P;  2P0W A;  2ZED A;  1VGY A;  1XJO A;  4MFQ A;  3V7Z A;  4AVC A;  4B6Z A;  5G21 A;  3KL9 A;  4KLW A;  4UBR A;  2EUI A;  3PB4 X;  2ZEG A;  1MJA A;  4MCS A;  4X2T A;  4JD6 A;  4A30 A;  3B3T A;  3KAS A;  4KOV A;  3DSB A;  1Q2D A;  1YGH A;  4GS4 A;  4AXV A;  1V0C A;  2PJ7 A;  2JEW A;  3B3V A;  5K8P A;  3GY9 A;  2K5T A;  4NJQ A;  4OKO A;  4DUK A;  5J1Q A;  3WAB A;  4JJX A;  2C27 A;  5JH9 A;  1Z8X A;  3BHX A;  2PIZ A;  2PJ8 A;  4CYO A;  4AVB A;  1HDQ A;  4KVM E;  2PCU A;  4MI4 A;  1KWM A;  1MJ9 A;  5CNP A;  1UFH A;  2ZW7 A;  4ZGY B;  2D4P A;  2DPS A;  2J8R A;  4PSW A;  1AUG A;  3PB8 X;  4MFJ A;  4Q7A A;  3PB7 X;  3TOB A;  4LQG A;  3SJX A;  5A27 A;  2R1I A;  2ZEH A;  3IU2 A;  2XEI A;  3N5F A;  4O23 A;  4Q38 A;  2R8V A;  4P10 A;  4GM5 A;  1VIX A;  2WYR A;  1LFW A;  3DLJ A;  1NMT A;  1QSR A;  3WC6 A;  4E0A A;  2ZEF A;  1GHE A;  4PV6 A;  4P4B A;  4EWT A;  4CAX A;  4F9V A;  4K30 A;  1KUY A;  2AE6 A;  2EK9 A;  1Z4E A;  2OH1 A;  1X12 A;  1PYT B;  2B4D A;  4KSI A;  4QUS A;  1TIQ A;  3VAT A;  1QSN A;  1VHO A;  3I1U A;  2AJ6 A;  4KSF A;  1CPS A;  2NMT A;  4UEF A;  3BLN A;  3NE7 A;  3FEC A;  3NH5 A;  3W6S A;  2AFW A;  4CYP A;  4P4F A;  1YW6 A;  5LYI A;  4BIN A;  1LOK A;  2B4B A;  2VBQ A;  4A37 A;  1BAV A;  3PFE A;  4Q36 A;  2ABZ A;  2I3C A;  3CDX A;  2V8D A;  2H5M A;  2R7H A;  3DR6 A;  3NH4 A;  3B2Y A;  5LYF A;  3SHP A;  4AG7 A;  3FVL A;  2F7V A;  3GLJ A;  2BEI A;  1S7N A;  3PEI A;  5CPA A;  4MFZ A;  1IY7 A;  1YME A;  1F2O A;  3S6G A;  5F46 A;  3H4Q A;  4GXH A;  4MCR A;  2DPT A;  1YW4 A;  5LRJ A;  3KKW A;  2PJ6 A;  4R6T A;  1B87 A;  1KZF A;  2GE3 A;  5J8C A;  1I1D A;  3FJU A;  3FB3 A;  5THW A;  1PCA A;  2BO9 A;  1Z2L A;  4FD5 A;  3GKR A;  5G20 A;  4F0X A;  3RO0 A;  4Z65 A;  1CBX A;  2FIW A;  2HC9 A;  2YGW A;  2OU2 A;  3TX8 A;  1CP7 A;  3FEE A;  5C88 A;  2O53 A;  2QJ8 A;  2REE A;  2WPX A;  5LRK A;  2VI7 A;  2ZEM A;  3W91 A;  2GLF A;  2VEZ A;  5KTA A;  2BUE A;  2Q51 A;  2R98 A;  4A2Z A;  5D29 A;  2IL4 A;  3D3S A;  4ZX8 A;  3GIU A;  3I3G A;  3D7H A;  1YRE A;  4U5Y A;  4UIA A;  4HNW B;  4CRZ B;  3D67 A;  2DXQ A;  3IC1 A;  1IU8 A;  4MRI A;  4MY0 A;  3BI0 A;  1YSJ A;  4ONU A;  3VH9 A;  2EBJ A;  1ARL A;  1R3N A;  3H8F A;  1Z8W A;  3S6H A;  4KUA A;  4G1P A;  3FMC A;  3GYA A;  2PC1 A;  1M4I A;  1Z5R A;  3FH4 A;  4E8O A;  2CNT A;  3GB0 A;  4CS0 B;  3R96 A;  1FT7 A;  2JDD A;  3PZJ A;  1S60 A;  5IB0 A;  5F48 A;  2ANP A;  5EMI A;  5ELY A;  4PXD A;  4CGP A;  4MCP A;  4PK3 A;  1QSO A;  4P45 A;  2Z0Z A;  2ZW4 A;  4J3G A;  4KS9 A;  4MHN A;  4W9Y A;  2GFQ A;  2BOA A;  2RC4 A;  2AFU A;  1TKF A;  4OC1 A;  5LYD A;  4OLL A;  4B10 A;  3TO6 A;  2FS5 A;  1PU9 A;  4EME A;  3SI0 A;  4PXE A;  3JVN A;  3DDD A;  5A28 A;  2I00 A;  4NCZ A;  3S9N A;  4OAD A;  5G22 A;  2Q0Y A;  4CGO A;  1R57 A;  2P6E A;  2QYV A;  3CXP A;  4OC3 A;  3MGD A;  3H8G A;  8CPA A;  4OP4 A;  2QVP A;  3ZZI A;  1XBU A;  4UFW A;  4QC6 A;  2A4N A;  4R8F A;  2POK A;  4B5P A;  4PSX A;  3S9M A;  4NSQ A;  3JRU A;  4JXR A;  2B5G B;  3IEH A;  1DTD A; 
#chains in the Genus database with same CATH homology
 2YND A;  4M3S A;  2Z3O A;  4NF1 A;  3V8I A;  4C7I A;  4MHD A;  2PR1 A;  2G0B A;  1Q2C A;  2Q4Y A;  3F8K A;  3P2F A;  5HH1 A;  3TTH A;  4F6A A;  2FSR A;  2G3T A;  3G8W A;  5F49 A;  3SXN A;  2J8N A;  4H6Z A;  3JUW A;  1CM0 A;  4QVT A;  4L89 A;  3R95 A;  4EVY A;  4JLY A;  1I21 A;  4Y49 C;  3EO4 A;  3FYN A;  4C2X A;  4I49 A;  1WK4 A;  5AGE A;  3R9F A;  3FRM A;  3IGR A;  2B5G A;  2WPW A;  2Z11 A;  2WUU A;  2QIR A;  1XIX A;  4C2Y A;  5FVJ A;  4M85 A;  1M44 A;  4YFJ A;  4UFX A;  4CYN A;  3SXO A;  3S6K A;  2BL1 A;  5H84 A;  4XNH C;  1XE4 A;  1U6M A;  4KLV A;  2JEV A;  4FD7 A;  1P4N A;  3ZJ0 A;  2I79 A;  2ZXV A;  1IYL A;  3QB8 A;  4UCN A;  3F0A A;  4XPD C;  3R9E A;  4H6U A;  1YVO A;  4MFK A;  1S7F A;  4U9Z A;  5AG5 A;  1IID A;  4NEX A;  2Z3P A;  4B14 A;  4UWJ A;  3T90 A;  4RS2 A;  2YNE A;  2OZU A;  4CYQ A;  3CXS A;  4KUB A;  2Y0M A;  3T9Y A;  3EY5 A;  4HNX B;  4MY3 A;  1N71 A;  5DWM A;  1BOB A;  4KOW A;  4R3L A;  2PRB A;  4YGO A;  4YRH A;  4JXQ A;  2PSW A;  2JDC A;  3D2P A;  2D4O A;  5IV0 A;  3TOA A;  4A32 A;  2ARH A;  4KOY A;  3UY5 A;  4CGN A;  1VHS A;  1XF8 A;  4U9Y A;  4BBH A;  2FCK A;  1S7K A;  2CY2 A;  5C82 A;  4R87 A;  3TO7 A;  3BJ8 A;  2PQ8 A;  1IYK A;  3CXQ A;  3D8P A;  2CNS A;  5ISV A;  3C26 A;  2FIA A;  2OZG A;  2VXK A;  5EBV A;  2PDO A;  5DWN A;  4KOU A;  4UFV A;  4CGL A;  3E0K A;  1YX0 A;  1M1D A;  2Q7B A;  2B58 A;  3IWE A;  2GAN A;  2OZH A;  3BJ7 A;  4AG9 A;  4KOT A;  5JQ4 A;  4QB9 A;  3IWG A;  3WR7 A;  1P0H A;  3DNS A;  2FE7 A;  2HQY A;  4H89 A;  4HNY B;  2B3U A;  4KVX A;  4A31 A;  3EFA A;  2Z3M A;  4MBU A;  2ZW5 A;  3RYO A;  4C68 A;  5I0C A;  4C7H A;  2REF A;  1MJB A;  2YNC A;  3I9S A;  4F0Y A;  3PGP A;  2Z3N A;  2KCW A;  1CJW A;  4KSA A;  4FD4 A;  4B12 A;  3TCV A;  4IUS A;  3D2M A;  1S3Z A;  1NE9 A;  4PK2 A;  4LX9 A;  4JWP A;  4CGM A;  3P2H A;  2FXF A;  2Q4V A;  3FXT A;  4E2A A;  1J4J A;  1SQH A;  3TE4 A;  3FNC A;  4MJ8 A;  5IX3 A;  4R57 A;  2ATR A;  3EC4 A;  3DR8 A;  5AG4 A;  1OZP A;  1S5K A;  4KVO E;  3VWD A;  1RO5 A;  4AB7 A;  1BO4 A;  4X5K A;  3S6F A;  2JLM A;  3F5B A;  4ORF A;  5HMN A;  1IB1 E;  1Q2Y A;  3FBU A;  1S7L A;  4IF5 A;  4FD6 A;  1ZO0 A;  2FT0 A;  4KOR A;  4R9M A;  1WWZ A;  4XPK A;  2QML A;  1LRZ A;  5EC4 A;  1L0C A;  3W6X A;  4L8A A;  1PUA A;  1YVK A;  1ON0 A;  4UA3 A;  2ZPA A;  4Y49 B;  3TT2 A;  3PP9 A;  4ZBG A;  2BSW A;  3B8G A;  2CNM A;  4CAE A;  4CRY B;  3TO9 A;  1QSM A;  5GCN A;  2O28 A;  5AG7 A;  1M4D A;  2EVN A;  4MFP A;  5G1Z A;  4ZGY B;  2ZW6 A;  4KOS A;  2VQY A;  4C2Z A;  1KUX A;  5KTC A;  3QAH A;  1NSL A;  4R3K A;  1M4G A;  3LD2 A;  4CAW A;  2YNC C;  4RI1 A;  5KTD A;  4CAF A;  2G3A A;  2B3V A;  4XPL A;  1Z4R A;  4XNH B;  3OWC A;  3R1K A;  2HUZ A;  2VZZ A;  5JPH A;  2OB0 A;  4QBJ A;  3EXN A;  1Y9K A;  5BWA B;  1VKC A;  2CXA A;  2X7B A;  4KZT A;  3N7Z A;  4A95 A;  2P6G A;  1YK3 A;  2Z10 A;  2Q44 A;  1MK4 A;  4B5O A;  3IU1 A;  4XPD B;  1Y7R A;  3LOD A;  1IIC A;  4B5P B;  1FY7 A;  4HKF A;  1QST A;  1XEB A;  2PR8 A;  4OAE A;  4UCP A;  1K4J A;  4II9 A;  3H5Z A;  5F47 A;  3TFY A;  4CAV A;  1Z9U A;  1YLE A;  4NXY A;  1XMT A;  4B13 A;  3FIX A;  2Z3L A;  5AG6 A;  1KUV A;  3JTK A;  2GIV A;  4A33 A;  5E96 A;  2VZY A;  3VWE A;  2P6F A;  1RXT A;  4LUA A;  3R9G A;  1Y9W A;  4MFL A;  4UWI A;  2FL4 A;  2WSA A;  1I12 A;  4KOX A;  4AVA A;  2Z3K A;  4DNC A;  2QEC A;  5J8F A;  3A9L A;  1B6B A;  3K9U A;  4BMH A;  5H86 A;  3G3S A;  2F5I A;  4B11 A;  2HV2 A;  2Q04 A;  4UCM A;  1YR0 A;  2J8M A;  2B4D B;  2P0W A;  4MFQ A;  4AVC A;  5G21 A;  4KLW A;  4UBR A;  2EUI A;  1MJA A;  4JD6 A;  4A30 A;  4KOV A;  3DSB A;  1Q2D A;  1YGH A;  4GS4 A;  1V0C A;  3GY9 A;  2K5T A;  4JJX A;  2C27 A;  4CYO A;  4AVB A;  4KVM E;  4MI4 A;  1MJ9 A;  5CNP A;  1UFH A;  2ZW7 A;  2D4P A;  2DPS A;  2J8R A;  4PSW A;  4MFJ A;  3TOB A;  5A27 A;  2R1I A;  3IU2 A;  4Q38 A;  2R8V A;  1NMT A;  1QSR A;  4E0A A;  1GHE A;  4PV6 A;  4CAX A;  4K30 A;  1KUY A;  2AE6 A;  1Z4E A;  2OH1 A;  2B4D A;  4QUS A;  1TIQ A;  1QSN A;  4KSF A;  2AJ6 A;  2NMT A;  3W6S A;  3BLN A;  3NE7 A;  4CYP A;  2B4B A;  2VBQ A;  4Q36 A;  2H5M A;  2R7H A;  3DR6 A;  3SHP A;  4AG7 A;  2BEI A;  1S7N A;  4MFZ A;  3S6G A;  5F46 A;  3H4Q A;  2DPT A;  3KKW A;  1B87 A;  1KZF A;  2GE3 A;  5J8C A;  1I1D A;  3FB3 A;  4FD5 A;  3GKR A;  5G20 A;  4F0X A;  2FIW A;  2YGW A;  2OU2 A;  5C88 A;  2REE A;  2WPX A;  2VI7 A;  3W91 A;  2VEZ A;  5KTA A;  2BUE A;  2R98 A;  4A2Z A;  2IL4 A;  3D3S A;  3I3G A;  1YRE A;  4U5Y A;  4HNW B;  4CRZ B;  2DXQ A;  4MY0 A;  4ONU A;  3S6H A;  4KUA A;  3GYA A;  2PC1 A;  1M4I A;  4E8O A;  2CNT A;  4CS0 B;  3R96 A;  2JDD A;  3PZJ A;  1S60 A;  5IB0 A;  5F48 A;  4CGP A;  4PK3 A;  1QSO A;  2Z0Z A;  2ZW4 A;  4J3G A;  4KS9 A;  2RC4 A;  4OLL A;  4B10 A;  3TO6 A;  2FS5 A;  1PU9 A;  3JVN A;  3DDD A;  5A28 A;  2I00 A;  4NCZ A;  4OAD A;  5G22 A;  2Q0Y A;  4CGO A;  1R57 A;  2P6E A;  3CXP A;  3MGD A;  3ZZI A;  4UFW A;  4QC6 A;  2A4N A;  4B5P A;  4PSX A;  4NSQ A;  4JXR A;  2B5G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...