4XPDC

Crystal structure of yeast n-terminal acetyltransferase nate (ppgpp) in complex with a bisubstrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
155
Chain Sequence
RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDVHFTQMAYYSEIPVGGLVAKLVPLSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast N-terminal acetyltransferase NatE (ppGpp) in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
total genus 39
structure length 155
sequence length 174
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xpdC00
2H5MA 1NSLA 4B5PA 4UWJA 3EC4A 2QECA 4OAEA 4QUSA 4QBJA 3TO6A 1FY7A 2WPXA 3FNCA 3QAHA 2ZW5A 1M4GA 4K30A 5J8CA 2ZW7A 4RS2A 2ZPAA 3SXNA 1L0CA 2FS5A 4CAVA 4PSXA 2I79A 2Z11A 1KZFA 4YGOA 4GS4A 2K5TA 4E0AA 5KTAA 3CXPA 1OZPA 3FB3A 4MJ8A 2X7BA 1XE4A 2PRBA 1Y9WA 3PGPA 3DNSA 2B4BA 3D2PA 3I3GA 1Q2YA 4KOSA 2OZGA 4KZTA 4FD6A 1V0CA 2JDDA 4E8OA 4F0YA 4YFJA 2ATRA 2PR1A 2VBQA 4JXQA 1S7LA 1I12A 4KOWA 3G8WA 3TO9A 1BOBA 2R98A 3TO7A 2FXFA 2VZZA 4JLYA 3TE4A 1YR0A 2CNMA 1M4DA 1YGHA 4IF5A 2BEIA 3DR8A 2CNTA 3R96A 5J8FA 3S6HA 2PC1A 4H6ZA 2NMTA 2FT0A 4U5YA 3H4QA 1B87A 1Z4RA 3LD2A 3RYOA 2HUZA 1M1DA 4AB7A 4QB9A 4R57A 2QIRA 5GCNA 3K9UA 2GANA 4ORFA 4KOTA 1I1DA 4U9YA 5EBVA 3TOBA 3TTHA 3F5BA 4MY0A 1MK4A 1S7NA 2R1IA 3EXNA 2OZUA 1R57A 4KUBA 5F47A 2REEA 2FCKA 4NF1A 2AJ6A 2B4DB 2EUIA 2P6GA 4M3SA 2I00A 1SQHA 2CY2A 2HV2A 4ONUA 3W6SA 4AVAA 4QC6A 4PSWA 1Z9UA 4MHDA 3BJ7A 1YX0A 4YRHA 2JEVA 4CRZB 2VXKA 3DDDA 3GY9A 2PSWA 4AG9A 3T90A 2ZW6A 1Y9KA 2FSRA 4HKFA 4FD4A 3IGRA 5E96A 2BSWA 4E2AA 4KOYA 2PDOA 1S5KA 2GE3A 4XNHB 3F0AA 4FD7A 4DNCA 4U9ZA 4PK3A 4JJXA 3S6KA 4R3LA 3TFYA 5IV0A 3R9FA 4NEXA 3JUWA 1RXTA 2B3UA 3D2MA 2Q0YA 1CM0A 4AVCA 1WWZA 2RC4A 2AE6A 3EFAA 4AG7A 1TIQA 2DXQA 4I49A 3W91A 4JD6A 4KOVA 5CNPA 3VWEA 4OLLA 1M4IA 2FIWA 1Z4EA 1WK4A 1Y7RA 2Q04A 1KUXA 5EC4A 5IB0A 3BJ8A 1IYKA 2PQ8A 1Q2CA 2FIAA 1QSRA 2B58A 4B5PB 3PZJA 4H89A 1S7KA 1S60A 3QB8A 3TCVA 2ZXVA 2Z0ZA 2FE7A 5C82A 2B5GA 1MJBA 3BLNA 4BMHA 5IX3A 2R7HA 4EVYA 1IIDA 1VKCA 4HNWB 4LX9A 3P2HA 1ON0A 4ZBGA 3SHPA 3DR6A 3E0KA 4UBRA 2FL4A 5ISVA 4QVTA 1IYLA 2VI7A 4FD5A 4X5KA 4KLVA 2REFA 4XPLA 1YK3A 4MY3A 2P0WA 4R9MA 3B8GA 5HH1A 4HNYB 2EVNA 3FBUA 3FIXA 2VQYA 1XF8A 3C26A 3S6FA 5JPHA 1YVOA 3EY5A 2JDCA 1S3ZA 5DWMA 5JQ4A 4HNXB 4NSQA 2OU2A 3D8PA 1YREA 1J4JA 3FYNA 1QSNA 4AVBA 3VWDA 2OB0A 2Q4VA 5H84A 3R1KA 2OZHA 3R9GA 3I9SA 4KVME 1XMTA 5I0CA 1KUYA 1NE9A 5C88A 2QMLA 4KVXA 4XPKA 2O28A 4KOXA 2J8MA 2ARHA 1K4JA 1PU9A 2B4DA 3N7ZA 3TOAA 4UWIA 3CXQA 2P6EA 4J3GA 5FVJA 3S6GA 3IWGA 2G3TA 3F8KA 4H6UA 2BL1A 1QSMA 2C27A 2F5IA 4XNHC 4CS0B 2Q44A 2G0BA 2R8VA 5F46A 4PV6A 1PUAA 2GIVA 3SXOA 4XPDC 2A4NA 2VEZA 2J8RA 3ZZIA 3FRMA 5HMNA 3TT2A 2BUEA 5F48A 2B5GB 2G3AA 4KVOE 4JWPA 5KTDA 1IB1E 1RO5A 2KCWA 3DSBA 2D4PA 3R9EA 4UA3A 4CAXA 1U6MA 4R87A 2Q7BA 1XEBA 2VZYA 1P4NA 2OH1A 1VHSA 3G3SA 2PR8A 1YVKA 1YLEA 3P2FA 1Q2DA 5DWNA 1I21A 5H86A 4KLWA 3MGDA 4MBUA 1KUVA 3JVNA 1NMTA 1B6BA 3T9YA 2WPWA 4KUAA 2JLMA 4R3KA 3R95A 1QSOA 3GKRA 4OADA 4Y49C 3OWCA 3KKWA 1BO4A 1XIXA 4PK2A 1P0HA 3V8IA 4M85A 4JXRA 1UFHA 4CAWA 4CRYB 2CNSA 1QSTA 4LUAA 3WR7A 4L89A 3GYAA 1LRZA 3UY5A 4B5OA 1N71A 2HQYA 4RI1A 2Y0MA 2J8NA 2Z10A 3LODA 4KORA 1GHEA 4NXYA 2P6FA 1MJ9A 5F49A 3CXSA 3EO4A 4Y49B 4KOUA 4II9A 2B3VA 1MJAA 4F6AA 4XPDB 3ZJ0A 2ZW4A 2Q4YA 4IUSA 4MI4A 1S7FA 3FXTA 5KTCA 1IICA 4L8AA 1CJWA 4NCZA 3W6XA 2IL4A 2D4OA 3D3SA 3PP9A 1M44A 3NE7A
chains in the Genus database with same CATH superfamily
1VGYA 5LRGA 2H5MA 3JTKA 1TKFA 3KR5A 1NSLA 4B5PA 5JH9A 1CX8A 5G22A 4UWJA 3EC4A 2QECA 4OAEA 4OIWA 4QUSA 4QBJA 1TXRA 1CPXA 3V38A 3TO6A 1YQEA 1FY7A 4UCNA 3TC8A 2WPXA 3FNCA 3QAHA 2ZW5A 1M4GA 3RNZA 3K2KA 4K30A 5J8CA 5LYDA 4JZ0A 4P4FA 4OC4A 2ZW7A 4RS2A 1JQGA 2ZPAA 3SXNA 1L0CA 4X3RA 2FS5A 4CAVA 5ELYA 4PSXA 2I79A 2Z11A 7CPAA 1KZFA 4DYOA 2CTBA 1ARLA 4YGOA 4GS4A 2K5TA 4UEFA 4E0AA 4PXCA 5KTAA 3CXPA 1AYEA 5G20A 1OZPA 1TKJA 3FB3A 4MJ8A 3QNVA 2X7BA 3WC5A 4A32A 1XE4A 4C7HA 2NYQA 3BI1A 3D7HA 3GLJA 1IU8A 1LFWA 4NJRA 1YW4A 4P6YA 2PRBA 4OC5A 1Y9WA 3PGPA 4PXDA 5AG5A 4K3NA 3DNSA 4P4BA 2B4BA 3D2PA 3I3GA 1Q2YA 4KOSA 1IOFA 3RAMA 4FWUA 5G1ZA 4EMEA 2OZGA 4KZTA 4RN7A 4FD6A 4MCSA 4EFDA 3GUXA 2C1CA 1V0CA 2JDDA 4E8OA 4F0YA 4YFJA 2ATRA 2WZNA 2PR1A 2IMOA 2VBQA 4CYQA 4JXQA 1S7LA 5G21A 1I12A 4TNUA 4KOWA 1AUGA 5HVHA 3G8WA 1GYTA 1ARMA 3TO9A 4YWYA 5HXDA 1ELLP 5LRKA 2GLJA 4B12A 1BOBA 1FT7A 2PVWA 2R98A 3TO7A 2FXFA 2VZZA 4JLYA 4MHPA 3FECA 3TE4A 1YR0A 1IGBA 2IQ6A 2CNMA 1M4DA 1YGHA 2ZOGA 4IF5A 2WYRA 1CP7A 4OC3A 2BEIA 1BAVA 3DR8A 3WC6A 5LYFA 2YNCC 4GM5A 2CNTA 3H5ZA 4HPSA 3R96A 4X8IA 5J8FA 3S6HA 2ZELA 3NA6A 2PC1A 3CPXA 2NMTA 4H6ZA 4P10A 4CYPA 4M6HA 2FT0A 2PJAA 4MFQA 1ZLIA 5JM6A 4U5YA 3H4QA 1B87A 1Z4RA 3LD2A 2PJ0A 3PB6X 2HUZA 3D7FA 3RYOA 1M1DA 4AB7A 4BD9A 3HUVA 5AGEA 4CGMA 4QB9A 4R7MA 3PB9X 4EWTA 4R57A 4MFPA 2QIRA 4O23A 3FVLA 5GCNA 4A2ZA 1TKHA 3K9UA 3I1UA 2GANA 5D8NA 2QJ8A 4ORFA 3IWWA 1FNOA 1I1DA 4KOTA 4U9YA 5EBVA 3V7ZA 3CPAA 1ZG9A 3TOBA 2F7VA 3WC7A 3TTHA 2PJ5A 3JRUA 3F5BA 1PYTB 3SJEA 4B6ZA 3D67A 4MY0A 5CPAA 1X12A 1Z8WA 1MK4A 3LACA 1S7NA 2R1IA 1XOVA 3EXNA 2OZUA 1R57A 4A95A 4KUBA 3H8GA 2REEA 5F47A 2FCKA 2GREA 4Q38A 4NF1A 1A2ZA 4ZY0A 2AJ6A 2B4DB 2OOTA 3IWEA 2BO9A 2EUIA 2P6GA 2PJ3A 2I00A 4M3SA 4OMEA 4BBHA 4RUHA 3PB8X 1SQHA 1HDUA 1Y0YA 2CY2A 2DF5A 2HV2A 2Z3OA 4M6GA 2PJ4A 4MFJA 3IC1A 3NH8A 4ONUA 3W6SA 4AVAA 2AFMA 1RTQA 4PSWA 4QC6A 3PBEA 1Z9UA 4MHDA 1VHEA 3BJ7A 1YX0A 4YRHA 4MFZA 2JEVA 4M6IA 4CRZB 1XRYA 2VXKA 3DDDA 1DTDA 2PJ2A 3GY9A 2PSWA 4AG9A 4A38A 3T90A 1LAPA 2ZW6A 4C68A 5JGFA 3B3VA 1Y9KA 4MHNA 1XFOA 4ZGYB 2FSRA 4HKFA 4FD4A 2HC9A 2EK8A 3IGRA 5E96A 4CGOA 2BSWA 1LANA 4P4EA 4E2AA 4KOYA 3SI0A 2PDOA 2PJ9A 4FUUA 1ZG7A 2EWBA 1S5KA 1IY7A 1QMUA 2WSAA 3WT4A 4ZY1A 2GE3A 3FEDA 2ZENA 4CYOA 4XNHB 3F0AA 4FD7A 4DNCA 4F9VA 1XBUA 4U9ZA 3KI9A 4PK3A 3L2NA 2ZEOA 4JJXA 3S6KA 2VL1A 3LWUA 4R3LA 4R76A 2GLFA 2C6CA 1BPNA 3SJGA 4OC0A 3TFYA 1JWQA 5K8OA 5IV0A 2RB7A 4UEZA 4ZYQA 1XJOA 4UCPA 4YU9A 1HDQA 3SI1A 5K8PA 1Z2LA 3R9FA 5AG7A 2Z3NA 4NEXA 2Z3MA 3JUWA 1RXTA 2XEGA 1VHOA 2B3UA 3WABA 3B3WA 3D2MA 4KS9A 4TWEA 2Q0YA 1F2OA 4A37A 3B35A 1YSJA 2JBJA 2O53A 4CYNA 1CM0A 4AVCA 2Q51A 4OKOA 1WWZA 5EMIA 3FF3A 2QYVA 2RC4A 3H8EA 1ZG8A 2PIZA 4MXUA 1YMEA 2AE6A 2DPSA 3PFEA 3EFAA 1CBXA 3FMCA 4AG7A 2AFWA 1TIQA 2DXQA 4I49A 3KASA 4DUKA 2EBJA 2XEFA 3W91A 4JD6A 1CP6A 4KOVA 8CPAA 1CG2A 1TF8A 4IK2A 5CNPA 3VWEA 4C2YA 5AG4A 4OLLA 2RFHA 4C7IA 4BINA 3DGVA 1M4IA 4OIDA 1LAMA 2Q7SA 4B14A 2FIWA 4P44A 1Z4EA 4GXHA 1WK4A 1Y7RA 2Q04A 1KUXA 5EC4A 5IB0A 3VH9A 3BJ8A 1IYKA 2PQ8A 1Q2CA 2FIAA 1QSRA 3PEIA 2B58A 3BI0A 1BLLE 1ELMP 4B5PB 3TX8A 3PZJA 2V8HA 4H89A 4IAVA 3CDXA 1S7KA 2PVVA 1Z5RA 2QVPA 1PCAA 1S60A 2Q4ZA 3BHXA 3GIUA 1KWMA 4PPZA 3QB8A 3B3TA 3TCVA 2ZXVA 2JEWA 2CIJA 2FE7A 2Z0ZA 3DLJA 5C82A 2AFXA 2B5GA 1MJBA 3BLNA 4BMHA 1YW6A 2ANPA 5IX3A 2R7HA 4EVYA 1IIDA 1VKCA 1ZO0A 4UF4A 1IOIA 4HNWB 4LX9A 3P2HA 3B3SA 1ON0A 4ZBGA 3SHPA 5CBMA 3DR6A 3E0KA 4UBRA 3NH4A 4ZY2A 2PRQA 2FL4A 5ISVA 4QVTA 3KL9A 1IYLA 2VI7A 4OC1A 3KR4A 4UCMA 4F9UA 4FAIA 4FD5A 4A31A 2V8VA 4X5KA 4KLVA 2REFA 4XPLA 3A9LA 1YK3A 4OC2A 3D66A 4MY3A 2P0WA 3IJ3A 4R9MA 2WUUA 3B8GA 2YNDA 3H8FA 2ZEPA 1CPSA 3QAYA 1H8LA 5HH1A 2GU2A 3PFOA 4HNYB 5D29A 3S9LA 1LOKA 2EVNA 4PXBA 4R6TA 3PRTA 3GB0A 4NGMA 3SJFA 3FBUA 4UFVA 3FIXA 2Z3KA 2VQYA 1XF8A 3C26A 4NGTA 3S6FA 2ABZA 5JPHA 4CAEA 4ONWA 3FJUA 4KSIA 4P4IA 3MN8A 1YVOA 1AMPA 1HEEA 4B13A 3EY5A 2JDCA 1S3ZA 2PJ8A 2XEJA 3ISZA 3PB7X 2J9AA 4UFWA 5DWMA 5JQ4A 4HNXB 4NSQA 2G9DA 4MCPA 2OU2A 4PXEA 2V77A 2Z3LA 4ZX9A 1YLOA 3D8PA 4JYWA 1YREA 1J4JA 5F09A 2PE3A 3IFEA 3FYNA 4NGQA 1QSNA 4AVBA 2DPTA 3VWDA 2OB0A 3T8WA 2Q4VA 5H84A 3R1KA 2OZHA 3R9GA 1ZLHA 3I9SA 4NGPA 2BCOA 2ZOFA 4KVME 4MHZA 1XMTA 5AG6A 1Y0RA 2CF4A 4LQGA 5I0CA 2IJZA 1KUYA 1NE9A 5LYLA 4B11A 1QQ9A 2FVGA 5C88A 3VARA 4C2XA 2QMLA 4KVXA 4Q7AA 2O28A 4XPKA 4NGSA 4KOXA 2J8MA 2ARHA 3B2YA 3HLPA 1K4JA 2C6PA 1PU9A 2B4DA 3KHXA 2PJBA 3N7ZA 2PJ1A 4P4JA 4H2KA 4UWIA 3CXQA 2ZEDA 3TOAA 2JBKA 2P6EA 2ZEEA 2CTCA 4J3GA 4OP4A 1BPMA 1R43A 5FVJA 3S6GA 3IWGA 2AFUA 2G3TA 4NGRA 3F8KA 4H6UA 4R8FA 3SJXA 3MRUA 4NFRA 2GFQA 2BL1A 3S9MA 1QSMA 2C27A 2F5IA 1TF9A 4XNHC 4CS0B 2YGWA 5THWA 2OR4A 2Q44A 1Z8XA 2G0BA 1Y7EA 4UIAA 2V8GA 5K8NA 3CT9A 2YNEA 3LMSA 2R8VA 2C6GA 5F46A 4PV6A 1PUAA 1UWYA 2GIVA 3SXOA 4Z65A 4CGNA 4XPDC 2A4NA 4WJBA 2VEZA 2J8RA 2F8HA 3NFZA 5J1QA 3ZZIA 3FRMA 4C2ZA 4F8ZA 5HMNA 3TT2A 1Z8LA 4MCRA 2BUEA 2EO8A 5F48A 2B5GB 4MMOA 1M4LA 2G3AA 3PBBA 4JWPA 4KVOE 5KTDA 1IB1E 4Q36A 1RO5A 2NSMA 2KCWA 3DSBA 2D4PA 4UFXA 3B3CA 3R9EA 3KZWA 4W9YA 3RO0A 4UA3A 4CAXA 1U6MA 6CPAA 5HVGA 4R87A 2AFZA 2Q7BA 1XEBA 1LCPA 2ODFA 1F57A 1P4NA 2CXAA 2OH1A 1VHSA 2VZYA 3D7GA 1VIXA 3G3SA 3RZAA 2PR8A 4CGLA 1YVKA 1YLEA 2PJ7A 4MHYA 2V8DA 3P2FA 5A27A 4WWVA 2PJCA 4FBEA 1Q2DA 4AXVA 3IU1A 5DWNA 1I21A 2O4HA 4LQ6A 5H86A 3IIBA 4KLWA 4ZI6A 3MGDA 3NH5A 4MBUA 4X2TA 3IEHA 3D7DA 1KUVA 5DS0A 3FH4A 3ISXA 3JVNA 1NMTA 2Z3PA 2AFOA 2ZEHA 4B10A 4CPAA 2POKA 2PCUA 2YNCA 1B6BA 3KQZA 1EE3P 4A39A 3T9YA 2AFSA 2WPWA 4KUAA 2JLMA 4R3KA 4A33A 5HVFA 3R95A 1QSOA 3GKRA 4A30A 4OADA 4Y49C 3OWCA 3KKWA 1F2PA 3K9TA 4KSFA 3RBUA 4PQAA 1BO4A 1XIXA 3KHZA 1P0HA 3IO1A 4PK2A 5LRJA 3V8IA 4M85A 4MCQA 4MFKA 3VATA 1DE4C 4CGPA 2ZEFA 4JXRA 1UFHA 4CAWA 2HB6A 4KSAA 3NE8A 4NJQA 4CRYB 2CNSA 4IHMA 1QSTA 3B7IA 2Q43A 4LUAA 4L89A 3WR7A 1NSAA 3D4UA 2ZEGA 5BWAB 3GYAA 1LRZA 4NGNA 3UY5A 4ZX8A 5IB9A 3PB4X 1N71A 2HQYA 4B5OA 4P4DA 4RI1A 2Y0MA 4DJLA 3FX6A 1R3NA 2J8NA 2Z10A 3FEEA 3KQXA 4UIBA 4MFLA 1Q7LA 3D68A 3CZXA 5I4MA 3SI2A 3BXMA 3LODA 4KORA 1GHEA 4NXYA 5K8MA 2EK9A 2P6FA 1MJ9A 5F49A 4CAFA 3CXSA 3EO4A 4Y49B 1X10A 4KOUA 2I3CA 4II9A 4F0XA 2B3VA 2XEIA 1XMBA 1MJAA 2DEAA 4F6AA 5A28A 4XPDB 3ZJ0A 2BOAA 4P45A 2ZW4A 2Q4YA 2ZEMA 3KGQA 4IUSA 4MI4A 4A94A 1S7FA 1OBRA 2PIYA 1Z8TA 1IICA 3FXTA 1CJWA 3IU2A 4G1PA 4L8AA 4NCZA 5KTCA 2PJ6A 4MRIA 2IL4A 2D4OA 3W6XA 4UEEA 3S9NA 5LYIA 3D3SA 3N5FA 3PP9A 1M44A 3NE7A
chains in the Genus database with same CATH topology
2H5MA 3JTKA 1NSLA 4B5PA 5G22A 4UWJA 3EC4A 2QECA 4OAEA 4QUSA 4QBJA 3TO6A 1FY7A 4UCNA 2WPXA 3FNCA 3QAHA 2ZW5A 1M4GA 4K30A 5J8CA 2ZW7A 4RS2A 2ZPAA 3SXNA 1L0CA 2FS5A 4CAVA 4PSXA 2I79A 2Z11A 1KZFA 4YGOA 4GS4A 2K5TA 4E0AA 5KTAA 3CXPA 5G20A 1OZPA 3FB3A 4MJ8A 2X7BA 4A32A 1XE4A 4C7HA 2PRBA 1Y9WA 3PGPA 5AG5A 3DNSA 2B4BA 3D2PA 3I3GA 1Q2YA 4KOSA 5G1ZA 2OZGA 4KZTA 4FD6A 1V0CA 2JDDA 4E8OA 4F0YA 4YFJA 2ATRA 2PR1A 2VBQA 4CYQA 4JXQA 1S7LA 5G21A 1I12A 4KOWA 3G8WA 3TO9A 4B12A 1BOBA 2R98A 3TO7A 2FXFA 2VZZA 4JLYA 3TE4A 1YR0A 2CNMA 1M4DA 1YGHA 4IF5A 2BEIA 3DR8A 2YNCC 2CNTA 3H5ZA 3R96A 5J8FA 3S6HA 2PC1A 4H6ZA 2NMTA 4CYPA 2FT0A 4MFQA 4U5YA 3H4QA 1B87A 1Z4RA 3LD2A 3RYOA 2HUZA 1M1DA 4AB7A 5AGEA 4CGMA 4QB9A 4R57A 4MFPA 2QIRA 5GCNA 4A2ZA 3K9UA 2GANA 4ORFA 4KOTA 1I1DA 4U9YA 5EBVA 3TOBA 3TTHA 3F5BA 4MY0A 1MK4A 1S7NA 2R1IA 3EXNA 2OZUA 1R57A 4A95A 4KUBA 5F47A 2REEA 2FCKA 4Q38A 4NF1A 2AJ6A 2B4DB 3IWEA 2EUIA 2P6GA 4M3SA 2I00A 4BBHA 1SQHA 2CY2A 2HV2A 4MFJA 2Z3OA 4ONUA 3W6SA 4AVAA 4QC6A 4PSWA 1Z9UA 4MHDA 3BJ7A 1YX0A 4YRHA 4MFZA 2JEVA 4CRZB 2VXKA 3DDDA 3GY9A 2PSWA 4AG9A 3T90A 2ZW6A 4C68A 1Y9KA 4ZGYB 2FSRA 4HKFA 4FD4A 3IGRA 5E96A 4CGOA 2BSWA 4E2AA 4KOYA 2PDOA 1S5KA 2WSAA 2GE3A 4CYOA 4XNHB 3F0AA 4FD7A 4DNCA 4U9ZA 4PK3A 4JJXA 3S6KA 4R3LA 3TFYA 5IV0A 4UCPA 3R9FA 5AG7A 2Z3NA 4NEXA 2Z3MA 3JUWA 1RXTA 2B3UA 3D2MA 4KS9A 2Q0YA 4CYNA 1CM0A 4AVCA 1WWZA 2RC4A 2AE6A 2DPSA 3EFAA 4AG7A 1TIQA 2DXQA 4I49A 3W91A 4JD6A 4KOVA 5CNPA 5AG4A 3VWEA 4C2YA 4OLLA 4C7IA 1M4IA 4B14A 2FIWA 1Z4EA 1WK4A 1Y7RA 2Q04A 1KUXA 5EC4A 5IB0A 3BJ8A 1IYKA 2PQ8A 1Q2CA 2FIAA 1QSRA 2B58A 4B5PB 3PZJA 4H89A 1S7KA 1S60A 3QB8A 3TCVA 2ZXVA 2Z0ZA 2FE7A 5C82A 2B5GA 1MJBA 3BLNA 4BMHA 5IX3A 2R7HA 4EVYA 1IIDA 1VKCA 1ZO0A 4HNWB 4LX9A 3P2HA 1ON0A 4ZBGA 3SHPA 3DR6A 3E0KA 4UBRA 2FL4A 5ISVA 4QVTA 1IYLA 2VI7A 4UCMA 4FD5A 4A31A 4X5KA 4KLVA 2REFA 4XPLA 3A9LA 1YK3A 4MY3A 2P0WA 4R9MA 2WUUA 3B8GA 2YNDA 5HH1A 4HNYB 2EVNA 3FBUA 4UFVA 3FIXA 2Z3KA 2VQYA 1XF8A 3C26A 3S6FA 5JPHA 4CAEA 4B13A 1YVOA 3EY5A 2JDCA 1S3ZA 4UFWA 5DWMA 5JQ4A 4HNXB 4NSQA 2OU2A 2Z3LA 3D8PA 1YREA 1J4JA 3FYNA 1QSNA 4AVBA 2DPTA 3VWDA 2OB0A 2Q4VA 5H84A 3R1KA 2OZHA 3R9GA 3I9SA 4KVME 1XMTA 5AG6A 5I0CA 1KUYA 1NE9A 4B11A 5C88A 4C2XA 2QMLA 4KVXA 4XPKA 2O28A 4KOXA 2J8MA 2ARHA 1K4JA 1PU9A 2B4DA 3N7ZA 3TOAA 4UWIA 3CXQA 2P6EA 4J3GA 5FVJA 3S6GA 3IWGA 2G3TA 3F8KA 4H6UA 2BL1A 1QSMA 2C27A 2F5IA 4XNHC 4CS0B 2YGWA 2Q44A 2G0BA 2YNEA 2R8VA 5F46A 4PV6A 1PUAA 2GIVA 3SXOA 4CGNA 4XPDC 2A4NA 2VEZA 2J8RA 3ZZIA 3FRMA 4C2ZA 5HMNA 3TT2A 2BUEA 5F48A 2B5GB 2G3AA 4KVOE 4JWPA 5KTDA 1IB1E 4Q36A 1RO5A 2KCWA 3DSBA 2D4PA 4UFXA 3R9EA 4UA3A 4CAXA 1U6MA 4R87A 2Q7BA 1XEBA 2VZYA 1P4NA 2CXAA 2OH1A 1VHSA 3G3SA 2PR8A 4CGLA 1YVKA 1YLEA 3P2FA 5A27A 1Q2DA 3IU1A 5DWNA 1I21A 5H86A 4KLWA 3MGDA 4MBUA 1KUVA 3JVNA 1NMTA 2Z3PA 4B10A 2YNCA 1B6BA 3T9YA 2WPWA 4KUAA 2JLMA 4R3KA 4A33A 3R95A 1QSOA 3GKRA 4A30A 4OADA 4Y49C 3OWCA 3KKWA 4KSFA 1BO4A 1XIXA 4PK2A 1P0HA 3V8IA 4M85A 4CGPA 4MFKA 4JXRA 1UFHA 4CAWA 4KSAA 4CRYB 2CNSA 1QSTA 4LUAA 3WR7A 4L89A 5BWAB 3GYAA 1LRZA 3UY5A 4B5OA 1N71A 2HQYA 4RI1A 2Y0MA 2J8NA 2Z10A 4MFLA 3LODA 4KORA 1GHEA 4NXYA 2P6FA 1MJ9A 5F49A 4CAFA 3CXSA 3EO4A 4Y49B 4KOUA 4II9A 4F0XA 2B3VA 1MJAA 4F6AA 5A28A 4XPDB 3ZJ0A 2ZW4A 2Q4YA 4IUSA 4MI4A 1S7FA 3FXTA 3IU2A 1IICA 4L8AA 1CJWA 5KTCA 4NCZA 3W6XA 2IL4A 2D4OA 3D3SA 3PP9A 1M44A 3NE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5M A;  1NSL A;  4B5P A;  4UWJ A;  3EC4 A;  2QEC A;  4OAE A;  4QUS A;  4QBJ A;  3TO6 A;  1FY7 A;  2WPX A;  3FNC A;  3QAH A;  2ZW5 A;  1M4G A;  4K30 A;  5J8C A;  2ZW7 A;  4RS2 A;  2ZPA A;  3SXN A;  1L0C A;  2FS5 A;  4CAV A;  4PSX A;  2I79 A;  2Z11 A;  1KZF A;  4YGO A;  4GS4 A;  2K5T A;  4E0A A;  5KTA A;  3CXP A;  1OZP A;  3FB3 A;  4MJ8 A;  2X7B A;  1XE4 A;  2PRB A;  1Y9W A;  3PGP A;  3DNS A;  2B4B A;  3D2P A;  3I3G A;  1Q2Y A;  4KOS A;  2OZG A;  4KZT A;  4FD6 A;  1V0C A;  2JDD A;  4E8O A;  4F0Y A;  4YFJ A;  2ATR A;  2PR1 A;  2VBQ A;  4JXQ A;  1S7L A;  1I12 A;  4KOW A;  3G8W A;  3TO9 A;  1BOB A;  2R98 A;  3TO7 A;  2FXF A;  2VZZ A;  4JLY A;  3TE4 A;  1YR0 A;  2CNM A;  1M4D A;  1YGH A;  4IF5 A;  2BEI A;  3DR8 A;  2CNT A;  3R96 A;  5J8F A;  3S6H A;  2PC1 A;  4H6Z A;  2NMT A;  2FT0 A;  4U5Y A;  3H4Q A;  1B87 A;  1Z4R A;  3LD2 A;  3RYO A;  2HUZ A;  1M1D A;  4AB7 A;  4QB9 A;  4R57 A;  2QIR A;  5GCN A;  3K9U A;  2GAN A;  4ORF A;  4KOT A;  1I1D A;  4U9Y A;  5EBV A;  3TOB A;  3TTH A;  3F5B A;  4MY0 A;  1MK4 A;  1S7N A;  2R1I A;  3EXN A;  2OZU A;  1R57 A;  4KUB A;  5F47 A;  2REE A;  2FCK A;  4NF1 A;  2AJ6 A;  2B4D B;  2EUI A;  2P6G A;  4M3S A;  2I00 A;  1SQH A;  2CY2 A;  2HV2 A;  4ONU A;  3W6S A;  4AVA A;  4QC6 A;  4PSW A;  1Z9U A;  4MHD A;  3BJ7 A;  1YX0 A;  4YRH A;  2JEV A;  4CRZ B;  2VXK A;  3DDD A;  3GY9 A;  2PSW A;  4AG9 A;  3T90 A;  2ZW6 A;  1Y9K A;  2FSR A;  4HKF A;  4FD4 A;  3IGR A;  5E96 A;  2BSW A;  4E2A A;  4KOY A;  2PDO A;  1S5K A;  2GE3 A;  4XNH B;  3F0A A;  4FD7 A;  4DNC A;  4U9Z A;  4PK3 A;  4JJX A;  3S6K A;  4R3L A;  3TFY A;  5IV0 A;  3R9F A;  4NEX A;  3JUW A;  1RXT A;  2B3U A;  3D2M A;  2Q0Y A;  1CM0 A;  4AVC A;  1WWZ A;  2RC4 A;  2AE6 A;  3EFA A;  4AG7 A;  1TIQ A;  2DXQ A;  4I49 A;  3W91 A;  4JD6 A;  4KOV A;  5CNP A;  3VWE A;  4OLL A;  1M4I A;  2FIW A;  1Z4E A;  1WK4 A;  1Y7R A;  2Q04 A;  1KUX A;  5EC4 A;  5IB0 A;  3BJ8 A;  1IYK A;  2PQ8 A;  1Q2C A;  2FIA A;  1QSR A;  2B58 A;  4B5P B;  3PZJ A;  4H89 A;  1S7K A;  1S60 A;  3QB8 A;  3TCV A;  2ZXV A;  2Z0Z A;  2FE7 A;  5C82 A;  2B5G A;  1MJB A;  3BLN A;  4BMH A;  5IX3 A;  2R7H A;  4EVY A;  1IID A;  1VKC A;  4HNW B;  4LX9 A;  3P2H A;  1ON0 A;  4ZBG A;  3SHP A;  3DR6 A;  3E0K A;  4UBR A;  2FL4 A;  5ISV A;  4QVT A;  1IYL A;  2VI7 A;  4FD5 A;  4X5K A;  4KLV A;  2REF A;  4XPL A;  1YK3 A;  4MY3 A;  2P0W A;  4R9M A;  3B8G A;  5HH1 A;  4HNY B;  2EVN A;  3FBU A;  3FIX A;  2VQY A;  1XF8 A;  3C26 A;  3S6F A;  5JPH A;  1YVO A;  3EY5 A;  2JDC A;  1S3Z A;  5DWM A;  5JQ4 A;  4HNX B;  4NSQ A;  2OU2 A;  3D8P A;  1YRE A;  1J4J A;  3FYN A;  1QSN A;  4AVB A;  3VWD A;  2OB0 A;  2Q4V A;  5H84 A;  3R1K A;  2OZH A;  3R9G A;  3I9S A;  4KVM E;  1XMT A;  5I0C A;  1KUY A;  1NE9 A;  5C88 A;  2QML A;  4KVX A;  4XPK A;  2O28 A;  4KOX A;  2J8M A;  2ARH A;  1K4J A;  1PU9 A;  2B4D A;  3N7Z A;  3TOA A;  4UWI A;  3CXQ A;  2P6E A;  4J3G A;  5FVJ A;  3S6G A;  3IWG A;  2G3T A;  3F8K A;  4H6U A;  2BL1 A;  1QSM A;  2C27 A;  2F5I A;  4XNH C;  4CS0 B;  2Q44 A;  2G0B A;  2R8V A;  5F46 A;  4PV6 A;  1PUA A;  2GIV A;  3SXO A;  4XPD C;  2A4N A;  2VEZ A;  2J8R A;  3ZZI A;  3FRM A;  5HMN A;  3TT2 A;  2BUE A;  5F48 A;  2B5G B;  2G3A A;  4KVO E;  4JWP A;  5KTD A;  1IB1 E;  1RO5 A;  2KCW A;  3DSB A;  2D4P A;  3R9E A;  4UA3 A;  4CAX A;  1U6M A;  4R87 A;  2Q7B A;  1XEB A;  2VZY A;  1P4N A;  2OH1 A;  1VHS A;  3G3S A;  2PR8 A;  1YVK A;  1YLE A;  3P2F A;  1Q2D A;  5DWN A;  1I21 A;  5H86 A;  4KLW A;  3MGD A;  4MBU A;  1KUV A;  3JVN A;  1NMT A;  1B6B A;  3T9Y A;  2WPW A;  4KUA A;  2JLM A;  4R3K A;  3R95 A;  1QSO A;  3GKR A;  4OAD A;  4Y49 C;  3OWC A;  3KKW A;  1BO4 A;  1XIX A;  4PK2 A;  1P0H A;  3V8I A;  4M85 A;  4JXR A;  1UFH A;  4CAW A;  4CRY B;  2CNS A;  1QST A;  4LUA A;  3WR7 A;  4L89 A;  3GYA A;  1LRZ A;  3UY5 A;  4B5O A;  1N71 A;  2HQY A;  4RI1 A;  2Y0M A;  2J8N A;  2Z10 A;  3LOD A;  4KOR A;  1GHE A;  4NXY A;  2P6F A;  1MJ9 A;  5F49 A;  3CXS A;  3EO4 A;  4Y49 B;  4KOU A;  4II9 A;  2B3V A;  1MJA A;  4F6A A;  4XPD B;  3ZJ0 A;  2ZW4 A;  2Q4Y A;  4IUS A;  4MI4 A;  1S7F A;  3FXT A;  5KTC A;  1IIC A;  4L8A A;  1CJW A;  4NCZ A;  3W6X A;  2IL4 A;  2D4O A;  3D3S A;  3PP9 A;  1M44 A;  3NE7 A; 
#chains in the Genus database with same CATH topology
 1VGY A;  5LRG A;  2H5M A;  3JTK A;  1TKF A;  3KR5 A;  1NSL A;  4B5P A;  5JH9 A;  1CX8 A;  5G22 A;  4UWJ A;  3EC4 A;  2QEC A;  4OAE A;  4OIW A;  4QUS A;  4QBJ A;  1TXR A;  1CPX A;  3V38 A;  3TO6 A;  1YQE A;  1FY7 A;  4UCN A;  3TC8 A;  2WPX A;  3FNC A;  3QAH A;  2ZW5 A;  1M4G A;  3RNZ A;  3K2K A;  4K30 A;  5J8C A;  5LYD A;  4JZ0 A;  4P4F A;  4OC4 A;  2ZW7 A;  4RS2 A;  1JQG A;  2ZPA A;  3SXN A;  1L0C A;  4X3R A;  2FS5 A;  4CAV A;  5ELY A;  4PSX A;  2I79 A;  2Z11 A;  7CPA A;  1KZF A;  4DYO A;  2CTB A;  1ARL A;  4YGO A;  4GS4 A;  2K5T A;  4UEF A;  4E0A A;  4PXC A;  5KTA A;  3CXP A;  1AYE A;  5G20 A;  1OZP A;  1TKJ A;  3FB3 A;  4MJ8 A;  3QNV A;  2X7B A;  3WC5 A;  4A32 A;  1XE4 A;  4C7H A;  2NYQ A;  3BI1 A;  3D7H A;  3GLJ A;  1IU8 A;  1LFW A;  4NJR A;  1YW4 A;  4P6Y A;  2PRB A;  4OC5 A;  1Y9W A;  3PGP A;  4PXD A;  5AG5 A;  4K3N A;  3DNS A;  4P4B A;  2B4B A;  3D2P A;  3I3G A;  1Q2Y A;  4KOS A;  1IOF A;  3RAM A;  4FWU A;  5G1Z A;  4EME A;  2OZG A;  4KZT A;  4RN7 A;  4FD6 A;  4MCS A;  4EFD A;  3GUX A;  2C1C A;  1V0C A;  2JDD A;  4E8O A;  4F0Y A;  4YFJ A;  2ATR A;  2WZN A;  2PR1 A;  2IMO A;  2VBQ A;  4CYQ A;  4JXQ A;  1S7L A;  5G21 A;  1I12 A;  4TNU A;  4KOW A;  1AUG A;  5HVH A;  3G8W A;  1GYT A;  1ARM A;  3TO9 A;  4YWY A;  5HXD A;  1ELL P;  5LRK A;  2GLJ A;  4B12 A;  1BOB A;  1FT7 A;  2PVW A;  2R98 A;  3TO7 A;  2FXF A;  2VZZ A;  4JLY A;  4MHP A;  3FEC A;  3TE4 A;  1YR0 A;  1IGB A;  2IQ6 A;  2CNM A;  1M4D A;  1YGH A;  2ZOG A;  4IF5 A;  2WYR A;  1CP7 A;  4OC3 A;  2BEI A;  1BAV A;  3DR8 A;  3WC6 A;  5LYF A;  2YNC C;  4GM5 A;  2CNT A;  3H5Z A;  4HPS A;  3R96 A;  4X8I A;  5J8F A;  3S6H A;  2ZEL A;  3NA6 A;  2PC1 A;  3CPX A;  2NMT A;  4H6Z A;  4P10 A;  4CYP A;  4M6H A;  2FT0 A;  2PJA A;  4MFQ A;  1ZLI A;  5JM6 A;  4U5Y A;  3H4Q A;  1B87 A;  1Z4R A;  3LD2 A;  2PJ0 A;  3PB6 X;  2HUZ A;  3D7F A;  3RYO A;  1M1D A;  4AB7 A;  4BD9 A;  3HUV A;  5AGE A;  4CGM A;  4QB9 A;  4R7M A;  3PB9 X;  4EWT A;  4R57 A;  4MFP A;  2QIR A;  4O23 A;  3FVL A;  5GCN A;  4A2Z A;  1TKH A;  3K9U A;  3I1U A;  2GAN A;  5D8N A;  2QJ8 A;  4ORF A;  3IWW A;  1FNO A;  1I1D A;  4KOT A;  4U9Y A;  5EBV A;  3V7Z A;  3CPA A;  1ZG9 A;  3TOB A;  2F7V A;  3WC7 A;  3TTH A;  2PJ5 A;  3JRU A;  3F5B A;  1PYT B;  3SJE A;  4B6Z A;  3D67 A;  4MY0 A;  5CPA A;  1X12 A;  1Z8W A;  1MK4 A;  3LAC A;  1S7N A;  2R1I A;  1XOV A;  3EXN A;  2OZU A;  1R57 A;  4A95 A;  4KUB A;  3H8G A;  2REE A;  5F47 A;  2FCK A;  2GRE A;  4Q38 A;  4NF1 A;  1A2Z A;  4ZY0 A;  2AJ6 A;  2B4D B;  2OOT A;  3IWE A;  2BO9 A;  2EUI A;  2P6G A;  2PJ3 A;  2I00 A;  4M3S A;  4OME A;  4BBH A;  4RUH A;  3PB8 X;  1SQH A;  1HDU A;  1Y0Y A;  2CY2 A;  2DF5 A;  2HV2 A;  2Z3O A;  4M6G A;  2PJ4 A;  4MFJ A;  3IC1 A;  3NH8 A;  4ONU A;  3W6S A;  4AVA A;  2AFM A;  1RTQ A;  4PSW A;  4QC6 A;  3PBE A;  1Z9U A;  4MHD A;  1VHE A;  3BJ7 A;  1YX0 A;  4YRH A;  4MFZ A;  2JEV A;  4M6I A;  4CRZ B;  1XRY A;  2VXK A;  3DDD A;  1DTD A;  2PJ2 A;  3GY9 A;  2PSW A;  4AG9 A;  4A38 A;  3T90 A;  1LAP A;  2ZW6 A;  4C68 A;  5JGF A;  3B3V A;  1Y9K A;  4MHN A;  1XFO A;  4ZGY B;  2FSR A;  4HKF A;  4FD4 A;  2HC9 A;  2EK8 A;  3IGR A;  5E96 A;  4CGO A;  2BSW A;  1LAN A;  4P4E A;  4E2A A;  4KOY A;  3SI0 A;  2PDO A;  2PJ9 A;  4FUU A;  1ZG7 A;  2EWB A;  1S5K A;  1IY7 A;  1QMU A;  2WSA A;  3WT4 A;  4ZY1 A;  2GE3 A;  3FED A;  2ZEN A;  4CYO A;  4XNH B;  3F0A A;  4FD7 A;  4DNC A;  4F9V A;  1XBU A;  4U9Z A;  3KI9 A;  4PK3 A;  3L2N A;  2ZEO A;  4JJX A;  3S6K A;  2VL1 A;  3LWU A;  4R3L A;  4R76 A;  2GLF A;  2C6C A;  1BPN A;  3SJG A;  4OC0 A;  3TFY A;  1JWQ A;  5K8O A;  5IV0 A;  2RB7 A;  4UEZ A;  4ZYQ A;  1XJO A;  4UCP A;  4YU9 A;  1HDQ A;  3SI1 A;  5K8P A;  1Z2L A;  3R9F A;  5AG7 A;  2Z3N A;  4NEX A;  2Z3M A;  3JUW A;  1RXT A;  2XEG A;  1VHO A;  2B3U A;  3WAB A;  3B3W A;  3D2M A;  4KS9 A;  4TWE A;  2Q0Y A;  1F2O A;  4A37 A;  3B35 A;  1YSJ A;  2JBJ A;  2O53 A;  4CYN A;  1CM0 A;  4AVC A;  2Q51 A;  4OKO A;  1WWZ A;  5EMI A;  3FF3 A;  2QYV A;  2RC4 A;  3H8E A;  1ZG8 A;  2PIZ A;  4MXU A;  1YME A;  2AE6 A;  2DPS A;  3PFE A;  3EFA A;  1CBX A;  3FMC A;  4AG7 A;  2AFW A;  1TIQ A;  2DXQ A;  4I49 A;  3KAS A;  4DUK A;  2EBJ A;  2XEF A;  3W91 A;  4JD6 A;  1CP6 A;  4KOV A;  8CPA A;  1CG2 A;  1TF8 A;  4IK2 A;  5CNP A;  3VWE A;  4C2Y A;  5AG4 A;  4OLL A;  2RFH A;  4C7I A;  4BIN A;  3DGV A;  1M4I A;  4OID A;  1LAM A;  2Q7S A;  4B14 A;  2FIW A;  4P44 A;  1Z4E A;  4GXH A;  1WK4 A;  1Y7R A;  2Q04 A;  1KUX A;  5EC4 A;  5IB0 A;  3VH9 A;  3BJ8 A;  1IYK A;  2PQ8 A;  1Q2C A;  2FIA A;  1QSR A;  3PEI A;  2B58 A;  3BI0 A;  1BLL E;  1ELM P;  4B5P B;  3TX8 A;  3PZJ A;  2V8H A;  4H89 A;  4IAV A;  3CDX A;  1S7K A;  2PVV A;  1Z5R A;  2QVP A;  1PCA A;  1S60 A;  2Q4Z A;  3BHX A;  3GIU A;  1KWM A;  4PPZ A;  3QB8 A;  3B3T A;  3TCV A;  2ZXV A;  2JEW A;  2CIJ A;  2FE7 A;  2Z0Z A;  3DLJ A;  5C82 A;  2AFX A;  2B5G A;  1MJB A;  3BLN A;  4BMH A;  1YW6 A;  2ANP A;  5IX3 A;  2R7H A;  4EVY A;  1IID A;  1VKC A;  1ZO0 A;  4UF4 A;  1IOI A;  4HNW B;  4LX9 A;  3P2H A;  3B3S A;  1ON0 A;  4ZBG A;  3SHP A;  5CBM A;  3DR6 A;  3E0K A;  4UBR A;  3NH4 A;  4ZY2 A;  2PRQ A;  2FL4 A;  5ISV A;  4QVT A;  3KL9 A;  1IYL A;  2VI7 A;  4OC1 A;  3KR4 A;  4UCM A;  4F9U A;  4FAI A;  4FD5 A;  4A31 A;  2V8V A;  4X5K A;  4KLV A;  2REF A;  4XPL A;  3A9L A;  1YK3 A;  4OC2 A;  3D66 A;  4MY3 A;  2P0W A;  3IJ3 A;  4R9M A;  2WUU A;  3B8G A;  2YND A;  3H8F A;  2ZEP A;  1CPS A;  3QAY A;  1H8L A;  5HH1 A;  2GU2 A;  3PFO A;  4HNY B;  5D29 A;  3S9L A;  1LOK A;  2EVN A;  4PXB A;  4R6T A;  3PRT A;  3GB0 A;  4NGM A;  3SJF A;  3FBU A;  4UFV A;  3FIX A;  2Z3K A;  2VQY A;  1XF8 A;  3C26 A;  4NGT A;  3S6F A;  2ABZ A;  5JPH A;  4CAE A;  4ONW A;  3FJU A;  4KSI A;  4P4I A;  3MN8 A;  1YVO A;  1AMP A;  1HEE A;  4B13 A;  3EY5 A;  2JDC A;  1S3Z A;  2PJ8 A;  2XEJ A;  3ISZ A;  3PB7 X;  2J9A A;  4UFW A;  5DWM A;  5JQ4 A;  4HNX B;  4NSQ A;  2G9D A;  4MCP A;  2OU2 A;  4PXE A;  2V77 A;  2Z3L A;  4ZX9 A;  1YLO A;  3D8P A;  4JYW A;  1YRE A;  1J4J A;  5F09 A;  2PE3 A;  3IFE A;  3FYN A;  4NGQ A;  1QSN A;  4AVB A;  2DPT A;  3VWD A;  2OB0 A;  3T8W A;  2Q4V A;  5H84 A;  3R1K A;  2OZH A;  3R9G A;  1ZLH A;  3I9S A;  4NGP A;  2BCO A;  2ZOF A;  4KVM E;  4MHZ A;  1XMT A;  5AG6 A;  1Y0R A;  2CF4 A;  4LQG A;  5I0C A;  2IJZ A;  1KUY A;  1NE9 A;  5LYL A;  4B11 A;  1QQ9 A;  2FVG A;  5C88 A;  3VAR A;  4C2X A;  2QML A;  4KVX A;  4Q7A A;  2O28 A;  4XPK A;  4NGS A;  4KOX A;  2J8M A;  2ARH A;  3B2Y A;  3HLP A;  1K4J A;  2C6P A;  1PU9 A;  2B4D A;  3KHX A;  2PJB A;  3N7Z A;  2PJ1 A;  4P4J A;  4H2K A;  4UWI A;  3CXQ A;  2ZED A;  3TOA A;  2JBK A;  2P6E A;  2ZEE A;  2CTC A;  4J3G A;  4OP4 A;  1BPM A;  1R43 A;  5FVJ A;  3S6G A;  3IWG A;  2AFU A;  2G3T A;  4NGR A;  3F8K A;  4H6U A;  4R8F A;  3SJX A;  3MRU A;  4NFR A;  2GFQ A;  2BL1 A;  3S9M A;  1QSM A;  2C27 A;  2F5I A;  1TF9 A;  4XNH C;  4CS0 B;  2YGW A;  5THW A;  2OR4 A;  2Q44 A;  1Z8X A;  2G0B A;  1Y7E A;  4UIA A;  2V8G A;  5K8N A;  3CT9 A;  2YNE A;  3LMS A;  2R8V A;  2C6G A;  5F46 A;  4PV6 A;  1PUA A;  1UWY A;  2GIV A;  3SXO A;  4Z65 A;  4CGN A;  4XPD C;  2A4N A;  4WJB A;  2VEZ A;  2J8R A;  2F8H A;  3NFZ A;  5J1Q A;  3ZZI A;  3FRM A;  4C2Z A;  4F8Z A;  5HMN A;  3TT2 A;  1Z8L A;  4MCR A;  2BUE A;  2EO8 A;  5F48 A;  2B5G B;  4MMO A;  1M4L A;  2G3A A;  3PBB A;  4JWP A;  4KVO E;  5KTD A;  1IB1 E;  4Q36 A;  1RO5 A;  2NSM A;  2KCW A;  3DSB A;  2D4P A;  4UFX A;  3B3C A;  3R9E A;  3KZW A;  4W9Y A;  3RO0 A;  4UA3 A;  4CAX A;  1U6M A;  6CPA A;  5HVG A;  4R87 A;  2AFZ A;  2Q7B A;  1XEB A;  1LCP A;  2ODF A;  1F57 A;  1P4N A;  2CXA A;  2OH1 A;  1VHS A;  2VZY A;  3D7G A;  1VIX A;  3G3S A;  3RZA A;  2PR8 A;  4CGL A;  1YVK A;  1YLE A;  2PJ7 A;  4MHY A;  2V8D A;  3P2F A;  5A27 A;  4WWV A;  2PJC A;  4FBE A;  1Q2D A;  4AXV A;  3IU1 A;  5DWN A;  1I21 A;  2O4H A;  4LQ6 A;  5H86 A;  3IIB A;  4KLW A;  4ZI6 A;  3MGD A;  3NH5 A;  4MBU A;  4X2T A;  3IEH A;  3D7D A;  1KUV A;  5DS0 A;  3FH4 A;  3ISX A;  3JVN A;  1NMT A;  2Z3P A;  2AFO A;  2ZEH A;  4B10 A;  4CPA A;  2POK A;  2PCU A;  2YNC A;  1B6B A;  3KQZ A;  1EE3 P;  4A39 A;  3T9Y A;  2AFS A;  2WPW A;  4KUA A;  2JLM A;  4R3K A;  4A33 A;  5HVF A;  3R95 A;  1QSO A;  3GKR A;  4A30 A;  4OAD A;  4Y49 C;  3OWC A;  3KKW A;  1F2P A;  3K9T A;  4KSF A;  3RBU A;  4PQA A;  1BO4 A;  1XIX A;  3KHZ A;  1P0H A;  3IO1 A;  4PK2 A;  5LRJ A;  3V8I A;  4M85 A;  4MCQ A;  4MFK A;  3VAT A;  1DE4 C;  4CGP A;  2ZEF A;  4JXR A;  1UFH A;  4CAW A;  2HB6 A;  4KSA A;  3NE8 A;  4NJQ A;  4CRY B;  2CNS A;  4IHM A;  1QST A;  3B7I A;  2Q43 A;  4LUA A;  4L89 A;  3WR7 A;  1NSA A;  3D4U A;  2ZEG A;  5BWA B;  3GYA A;  1LRZ A;  4NGN A;  3UY5 A;  4ZX8 A;  5IB9 A;  3PB4 X;  1N71 A;  2HQY A;  4B5O A;  4P4D A;  4RI1 A;  2Y0M A;  4DJL A;  3FX6 A;  1R3N A;  2J8N A;  2Z10 A;  3FEE A;  3KQX A;  4UIB A;  4MFL A;  1Q7L A;  3D68 A;  3CZX A;  5I4M A;  3SI2 A;  3BXM A;  3LOD A;  4KOR A;  1GHE A;  4NXY A;  5K8M A;  2EK9 A;  2P6F A;  1MJ9 A;  5F49 A;  4CAF A;  3CXS A;  3EO4 A;  4Y49 B;  1X10 A;  4KOU A;  2I3C A;  4II9 A;  4F0X A;  2B3V A;  2XEI A;  1XMB A;  1MJA A;  2DEA A;  4F6A A;  5A28 A;  4XPD B;  3ZJ0 A;  2BOA A;  4P45 A;  2ZW4 A;  2Q4Y A;  2ZEM A;  3KGQ A;  4IUS A;  4MI4 A;  4A94 A;  1S7F A;  1OBR A;  2PIY A;  1Z8T A;  1IIC A;  3FXT A;  1CJW A;  3IU2 A;  4G1P A;  4L8A A;  4NCZ A;  5KTC A;  2PJ6 A;  4MRI A;  2IL4 A;  2D4O A;  3W6X A;  4UEE A;  3S9N A;  5LYI A;  3D3S A;  3N5F A;  3PP9 A;  1M44 A;  3NE7 A; 
#chains in the Genus database with same CATH homology
 2H5M A;  3JTK A;  1NSL A;  4B5P A;  5G22 A;  4UWJ A;  3EC4 A;  2QEC A;  4OAE A;  4QUS A;  4QBJ A;  3TO6 A;  1FY7 A;  4UCN A;  2WPX A;  3FNC A;  3QAH A;  2ZW5 A;  1M4G A;  4K30 A;  5J8C A;  2ZW7 A;  4RS2 A;  2ZPA A;  3SXN A;  1L0C A;  2FS5 A;  4CAV A;  4PSX A;  2I79 A;  2Z11 A;  1KZF A;  4YGO A;  4GS4 A;  2K5T A;  4E0A A;  5KTA A;  3CXP A;  5G20 A;  1OZP A;  3FB3 A;  4MJ8 A;  2X7B A;  4A32 A;  1XE4 A;  4C7H A;  2PRB A;  1Y9W A;  3PGP A;  5AG5 A;  3DNS A;  2B4B A;  3D2P A;  3I3G A;  1Q2Y A;  4KOS A;  5G1Z A;  2OZG A;  4KZT A;  4FD6 A;  1V0C A;  2JDD A;  4E8O A;  4F0Y A;  4YFJ A;  2ATR A;  2PR1 A;  2VBQ A;  4CYQ A;  4JXQ A;  1S7L A;  5G21 A;  1I12 A;  4KOW A;  3G8W A;  3TO9 A;  4B12 A;  1BOB A;  2R98 A;  3TO7 A;  2FXF A;  2VZZ A;  4JLY A;  3TE4 A;  1YR0 A;  2CNM A;  1M4D A;  1YGH A;  4IF5 A;  2BEI A;  3DR8 A;  2YNC C;  2CNT A;  3H5Z A;  3R96 A;  5J8F A;  3S6H A;  2PC1 A;  4H6Z A;  2NMT A;  4CYP A;  2FT0 A;  4MFQ A;  4U5Y A;  3H4Q A;  1B87 A;  1Z4R A;  3LD2 A;  3RYO A;  2HUZ A;  1M1D A;  4AB7 A;  5AGE A;  4CGM A;  4QB9 A;  4R57 A;  4MFP A;  2QIR A;  5GCN A;  4A2Z A;  3K9U A;  2GAN A;  4ORF A;  4KOT A;  1I1D A;  4U9Y A;  5EBV A;  3TOB A;  3TTH A;  3F5B A;  4MY0 A;  1MK4 A;  1S7N A;  2R1I A;  3EXN A;  2OZU A;  1R57 A;  4A95 A;  4KUB A;  5F47 A;  2REE A;  2FCK A;  4Q38 A;  4NF1 A;  2AJ6 A;  2B4D B;  3IWE A;  2EUI A;  2P6G A;  4M3S A;  2I00 A;  4BBH A;  1SQH A;  2CY2 A;  2HV2 A;  4MFJ A;  2Z3O A;  4ONU A;  3W6S A;  4AVA A;  4QC6 A;  4PSW A;  1Z9U A;  4MHD A;  3BJ7 A;  1YX0 A;  4YRH A;  4MFZ A;  2JEV A;  4CRZ B;  2VXK A;  3DDD A;  3GY9 A;  2PSW A;  4AG9 A;  3T90 A;  2ZW6 A;  4C68 A;  1Y9K A;  4ZGY B;  2FSR A;  4HKF A;  4FD4 A;  3IGR A;  5E96 A;  4CGO A;  2BSW A;  4E2A A;  4KOY A;  2PDO A;  1S5K A;  2WSA A;  2GE3 A;  4CYO A;  4XNH B;  3F0A A;  4FD7 A;  4DNC A;  4U9Z A;  4PK3 A;  4JJX A;  3S6K A;  4R3L A;  3TFY A;  5IV0 A;  4UCP A;  3R9F A;  5AG7 A;  2Z3N A;  4NEX A;  2Z3M A;  3JUW A;  1RXT A;  2B3U A;  3D2M A;  4KS9 A;  2Q0Y A;  4CYN A;  1CM0 A;  4AVC A;  1WWZ A;  2RC4 A;  2AE6 A;  2DPS A;  3EFA A;  4AG7 A;  1TIQ A;  2DXQ A;  4I49 A;  3W91 A;  4JD6 A;  4KOV A;  5CNP A;  5AG4 A;  3VWE A;  4C2Y A;  4OLL A;  4C7I A;  1M4I A;  4B14 A;  2FIW A;  1Z4E A;  1WK4 A;  1Y7R A;  2Q04 A;  1KUX A;  5EC4 A;  5IB0 A;  3BJ8 A;  1IYK A;  2PQ8 A;  1Q2C A;  2FIA A;  1QSR A;  2B58 A;  4B5P B;  3PZJ A;  4H89 A;  1S7K A;  1S60 A;  3QB8 A;  3TCV A;  2ZXV A;  2Z0Z A;  2FE7 A;  5C82 A;  2B5G A;  1MJB A;  3BLN A;  4BMH A;  5IX3 A;  2R7H A;  4EVY A;  1IID A;  1VKC A;  1ZO0 A;  4HNW B;  4LX9 A;  3P2H A;  1ON0 A;  4ZBG A;  3SHP A;  3DR6 A;  3E0K A;  4UBR A;  2FL4 A;  5ISV A;  4QVT A;  1IYL A;  2VI7 A;  4UCM A;  4FD5 A;  4A31 A;  4X5K A;  4KLV A;  2REF A;  4XPL A;  3A9L A;  1YK3 A;  4MY3 A;  2P0W A;  4R9M A;  2WUU A;  3B8G A;  2YND A;  5HH1 A;  4HNY B;  2EVN A;  3FBU A;  4UFV A;  3FIX A;  2Z3K A;  2VQY A;  1XF8 A;  3C26 A;  3S6F A;  5JPH A;  4CAE A;  4B13 A;  1YVO A;  3EY5 A;  2JDC A;  1S3Z A;  4UFW A;  5DWM A;  5JQ4 A;  4HNX B;  4NSQ A;  2OU2 A;  2Z3L A;  3D8P A;  1YRE A;  1J4J A;  3FYN A;  1QSN A;  4AVB A;  2DPT A;  3VWD A;  2OB0 A;  2Q4V A;  5H84 A;  3R1K A;  2OZH A;  3R9G A;  3I9S A;  4KVM E;  1XMT A;  5AG6 A;  5I0C A;  1KUY A;  1NE9 A;  4B11 A;  5C88 A;  4C2X A;  2QML A;  4KVX A;  4XPK A;  2O28 A;  4KOX A;  2J8M A;  2ARH A;  1K4J A;  1PU9 A;  2B4D A;  3N7Z A;  3TOA A;  4UWI A;  3CXQ A;  2P6E A;  4J3G A;  5FVJ A;  3S6G A;  3IWG A;  2G3T A;  3F8K A;  4H6U A;  2BL1 A;  1QSM A;  2C27 A;  2F5I A;  4XNH C;  4CS0 B;  2YGW A;  2Q44 A;  2G0B A;  2YNE A;  2R8V A;  5F46 A;  4PV6 A;  1PUA A;  2GIV A;  3SXO A;  4CGN A;  4XPD C;  2A4N A;  2VEZ A;  2J8R A;  3ZZI A;  3FRM A;  4C2Z A;  5HMN A;  3TT2 A;  2BUE A;  5F48 A;  2B5G B;  2G3A A;  4KVO E;  4JWP A;  5KTD A;  1IB1 E;  4Q36 A;  1RO5 A;  2KCW A;  3DSB A;  2D4P A;  4UFX A;  3R9E A;  4UA3 A;  4CAX A;  1U6M A;  4R87 A;  2Q7B A;  1XEB A;  2VZY A;  1P4N A;  2CXA A;  2OH1 A;  1VHS A;  3G3S A;  2PR8 A;  4CGL A;  1YVK A;  1YLE A;  3P2F A;  5A27 A;  1Q2D A;  3IU1 A;  5DWN A;  1I21 A;  5H86 A;  4KLW A;  3MGD A;  4MBU A;  1KUV A;  3JVN A;  1NMT A;  2Z3P A;  4B10 A;  2YNC A;  1B6B A;  3T9Y A;  2WPW A;  4KUA A;  2JLM A;  4R3K A;  4A33 A;  3R95 A;  1QSO A;  3GKR A;  4A30 A;  4OAD A;  4Y49 C;  3OWC A;  3KKW A;  4KSF A;  1BO4 A;  1XIX A;  4PK2 A;  1P0H A;  3V8I A;  4M85 A;  4CGP A;  4MFK A;  4JXR A;  1UFH A;  4CAW A;  4KSA A;  4CRY B;  2CNS A;  1QST A;  4LUA A;  3WR7 A;  4L89 A;  5BWA B;  3GYA A;  1LRZ A;  3UY5 A;  4B5O A;  1N71 A;  2HQY A;  4RI1 A;  2Y0M A;  2J8N A;  2Z10 A;  4MFL A;  3LOD A;  4KOR A;  1GHE A;  4NXY A;  2P6F A;  1MJ9 A;  5F49 A;  4CAF A;  3CXS A;  3EO4 A;  4Y49 B;  4KOU A;  4II9 A;  4F0X A;  2B3V A;  1MJA A;  4F6A A;  5A28 A;  4XPD B;  3ZJ0 A;  2ZW4 A;  2Q4Y A;  4IUS A;  4MI4 A;  1S7F A;  3FXT A;  3IU2 A;  1IIC A;  4L8A A;  1CJW A;  5KTC A;  4NCZ A;  3W6X A;  2IL4 A;  2D4O A;  3D3S A;  3PP9 A;  1M44 A;  3NE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...