4XPDC

Crystal structure of yeast n-terminal acetyltransferase nate (ppgpp) in complex with a bisubstrate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
155
Chain Sequence
RDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDVHFTQMAYYSEIPVGGLVAKLVPLSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast N-terminal acetyltransferase NatE (ppGpp) in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
total genus 39
structure length 155
sequence length 174
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4xpdC00
4B5PB 3QAHA 4NF1A 3ZZIA 4ONUA 4KOYA 4R9MA 5H84A 4K30A 5FVJA 2B4DB 4CAWA 1S3ZA 1I1DA 4JJXA 1S7KA 1PU9A 2I00A 5J8FA 4X5KA 4CRYB 2A4NA 4NCZA 5F49A 4EVYA 3D8PA 4QVTA 3V8IA 4YFJA 1WK4A 1MJBA 1IICA 1YR0A 1YVKA 3T9YA 4Y49C 1KUVA 3DR8A 2FCKA 3K9UA 1MJAA 2HUZA 1KUYA 2JDCA 3FRMA 3R96A 4R3LA 2Q04A 4JWPA 4JLYA 2FSRA 3I9SA 3IGRA 2AJ6A 4MY3A 2VXKA 4KVOE 5C88A 2D4OA 4CAVA 3D2MA 2BSWA 3EO4A 4KOXA 4KLWA 2P6EA 3GKRA 3S6FA 2PR8A 2Z10A 2PC1A 2F5IA 1QSRA 4E0AA 4PSXA 5HMNA 1P4NA 3G3SA 3NE7A 5KTAA 1KUXA 2REEA 3S6HA 1Z4RA 3OWCA 4MJ8A 2PDOA 2JDDA 3IWGA 1IIDA 4B5OA 4CAXA 1ON0A 1J4JA 2BEIA 3FXTA 1M1DA 2REFA 4YGOA 5DWMA 4XPKA 4UWIA 5J8CA 4QUSA 3F5BA 3R9EA 2EVNA 3PP9A 3I3GA 5DWNA 3DR6A 1U6MA 4RS2A 4E2AA 4L89A 4H6UA 2Z0ZA 4MY0A 3BJ8A 1IYLA 2DXQA 2CNSA 2CNTA 4KVXA 1S7NA 4HKFA 4R57A 5IV0A 1BOBA 4NSQA 1XMTA 3SXNA 3W6SA 3F0AA 4KLVA 1SQHA 2I79A 4CS0B 1NMTA 3G8WA 3H4QA 5EC4A 1Z4EA 3SXOA 1CJWA 3FBUA 3R95A 1M44A 2OH1A 4F0YA 3R9FA 3EC4A 3TT2A 2Q4YA 2FXFA 2FS5A 4NXYA 1BO4A 4XPLA 3TO7A 4KUAA 4KOUA 1YGHA 4H89A 5H86A 3R1KA 3FYNA 2OZGA 1YK3A 4AVAA 1YX0A 1FY7A 2R98A 2B5GB 2ZPAA 2K5TA 5F46A 4AG9A 2KCWA 3MGDA 4JXRA 4U9YA 1WWZA 3W6XA 2BL1A 1YVOA 5C82A 1Y7RA 4UBRA 2QMLA 2RC4A 2VI7A 4FD6A 2BUEA 3UY5A 3GY9A 3N7ZA 4U5YA 4XPDB 4U9ZA 3D2PA 2WPWA 4QBJA 4I49A 3CXPA 2G0BA 3LD2A 4QB9A 4B5PA 1VKCA 4M85A 4RI1A 3TOBA 5IB0A 1R57A 2VQYA 1V0CA 5E96A 5F48A 2ZW6A 2WPXA 2FT0A 3TO9A 2GE3A 2Q0YA 1QSNA 3FIXA 1S5KA 1XEBA 1QSMA 3R9GA 3TTHA 2P6GA 2Z11A 4XPDC 1RXTA 2P6FA 1Y9KA 4JXQA 2VBQA 3DDDA 2HV2A 4M3SA 4HNXB 3GYAA 2Q44A 4E8OA 3BLNA 4JD6A 4KOVA 4IF5A 2GANA 2B58A 2X7BA 3TCVA 3E0KA 1Q2DA 5KTCA 4L8AA 4R3KA 2JLMA 4AB7A 3F8KA 4IUSA 3S6GA 2Q7BA 2IL4A 3EFAA 4KVME 4XNHC 4PK2A 2G3TA 2H5MA 3B8GA 3QB8A 4ZBGA 4PSWA 1Q2YA 2ZW7A 2OB0A 2ZW5A 2ATRA 3DSBA 2B3VA 2JEVA 4H6ZA 1PUAA 3PGPA 2FIWA 2G3AA 1I12A 3BJ7A 3D3SA 2FE7A 5I0CA 2P0WA 4CRZB 1M4DA 3DNSA 4KORA 2C27A 2NMTA 4OAEA 2J8MA 2Y0MA 1Z9UA 3S6KA 2B5GA 4FD7A 2CNMA 4XNHB 5ISVA 4KUBA 4NEXA 4YRHA 4UA3A 4MHDA 2QECA 1K4JA 4PK3A 2QIRA 5IX3A 4AG7A 5CNPA 1S60A 4PV6A 4KZTA 4ORFA 2D4PA 1L0CA 2R7HA 1OZPA 3CXSA 4OLLA 1MK4A 4LUAA 3SHPA 1IB1E 2ZXVA 3PZJA 4AVBA 4HNWB 2J8RA 4FD5A 3T90A 4BMHA 2VEZA 2R1IA 1YLEA 4F6AA 3P2FA 3JUWA 1XF8A 2PR1A 1S7LA 3TFYA 1B87A 2OZHA 2B3UA 5F47A 1YREA 5KTDA 4LX9A 3LODA 5JQ4A 1IYKA 2EUIA 2Q4VA 2ZW4A 1Y9WA 1M4GA 4FD4A 4OADA 3TOAA 5GCNA 3WR7A 3TO6A 1B6BA 2VZYA 1XIXA 4II9A 2PSWA 3CXQA 5HH1A 2GIVA 2B4BA 4J3GA 2FIAA 1NE9A 3P2HA 3C26A 2AE6A 3TE4A 3FB3A 1TIQA 1MJ9A 2OU2A 4MBUA 3ZJ0A 1CM0A 4KOSA 1RO5A 1QSTA 1I21A 3EY5A 4UWJA 2OZUA 4MI4A 1QSOA 5JPHA 2ARHA 1GHEA 1NSLA 3KKWA 1KZFA 2VZZA 2R8VA 2FL4A 4QC6A 1N71A 2HQYA 3VWEA 2J8NA 3FNCA 4HNYB 5EBVA 1S7FA 4R87A 1P0HA 1M4IA 1UFHA 3EXNA 3JVNA 2O28A 1XE4A 4KOWA 3W91A 2CY2A 3RYOA 4GS4A 4DNCA 1Q2CA 2B4DA 4AVCA 2PRBA 4KOTA 1VHSA 1LRZA 3VWDA 4Y49B 2PQ8A
chains in the Genus database with same CATH superfamily
4P4BA 4B5PB 3QAHA 4K3NA 3L2NA 4H2KA 4NF1A 4NGTA 4NGQA 3ZZIA 4ONUA 4KOYA 4CAEA 4MCPA 1XJOA 4BINA 2ZEEA 4R9MA 4PXDA 4P4DA 5G1ZA 5H84A 4K30A 4WWVA 5FVJA 4X3RA 2B4DB 2V77A 1S3ZA 4CAWA 1I1DA 4P4EA 2PVVA 4JJXA 1S7KA 1PU9A 2I00A 5LYFA 5J8FA 5JM6A 5AGEA 2PJBA 4X5KA 4CRYB 2A4NA 2O4HA 2QYVA 2YNEA 4NCZA 5F49A 4EVYA 1UWYA 4P10A 3PB7X 3D8PA 4QVTA 3V8IA 1R3NA 4YFJA 1WK4A 1MJBA 1IICA 5K8MA 1YR0A 1ZLIA 1F2OA 1KWMA 1YVKA 3FH4A 3T9YA 4UF4A 2Z3NA 4Y49C 4OKOA 1KUVA 2CTCA 2PIYA 3DR8A 4MHYA 5DS0A 5THWA 3RBUA 4NGRA 2FCKA 3K9UA 1MJAA 2HUZA 2ZEPA 4OC0A 1KUYA 2JDCA 5ELYA 3FRMA 5K8OA 3R96A 3WC5A 5K8NA 1GYTA 4R3LA 3MN8A 4MCQA 2Q04A 4JWPA 4JLYA 2FSRA 4CPAA 3I9SA 2DF5A 3IGRA 4CYQA 4NGSA 4P4FA 2AJ6A 4MY3A 2VXKA 1M4LA 4UCMA 4KVOE 5C88A 2D4OA 4CAVA 3PB6X 3B7IA 5G22A 3CPXA 7CPAA 1PCAA 1JWQA 3D67A 4DJLA 3D2MA 3LWUA 4CYPA 2BSWA 2IMOA 4HPSA 4A94A 3EO4A 4KOXA 2ZEOA 2PJ3A 2ZEDA 3NH5A 4KLWA 2P6EA 4OC1A 3GKRA 1ELLP 4MFKA 2CXAA 1JQGA 3S6FA 2PR8A 3DLJA 1ZG8A 3IU1A 5D29A 3PB8X 4Z65A 2Z10A 3IFEA 2PC1A 2F5IA 1QSRA 3FEDA 4M6HA 3FECA 4E0AA 4PSXA 4MHPA 5HMNA 1P4NA 3G3SA 3NE7A 5KTAA 2PIZA 1KUXA 2REEA 1XMBA 2PJ1A 3S6HA 1Z4RA 2CTBA 3OWCA 4MJ8A 1Z8TA 4C7IA 3IWWA 2PDOA 2YNCC 3FF3A 2AFUA 1LFWA 3NH4A 2PJ9A 4Q38A 5LRGA 2JDDA 3IWGA 3B35A 3FX6A 1IIDA 2ZEGA 4B5OA 3CPAA 4CAXA 1ON0A 1J4JA 2BEIA 1CPSA 2I3CA 3B3VA 3FXTA 1M1DA 2REFA 4YGOA 3ISXA 4JZ0A 5DWMA 3RAMA 4XPKA 4F9UA 4ZY2A 4UWIA 1IOIA 3LACA 5J8CA 4QUSA 4C2ZA 4F8ZA 3F5BA 3R9EA 3N5FA 3IC1A 3WT4A 2EVNA 4GXHA 3RO0A 3PP9A 4TWEA 4MHNA 3SI1A 3I3GA 2XEJA 3I1UA 2ABZA 3DR6A 1U6MA 5DWNA 4RS2A 2HB6A 4P45A 4E2AA 4L89A 2V8GA 2Z0ZA 4H6UA 5F09A 3QAYA 4MY0A 2PCUA 3BJ8A 1IYLA 4MCSA 2DXQA 2OOTA 2CNSA 2EK9A 2CNTA 3K9TA 4KVXA 1S7NA 3IIBA 4HKFA 4R57A 1PYTB 1HEEA 2GLFA 2DEAA 5IV0A 1BOBA 4CAFA 4ZY0A 4NSQA 1XMTA 3SXNA 3W6SA 3F0AA 4BD9A 4KLVA 1SQHA 2I79A 2XEGA 4B6ZA 2JBKA 3KR4A 2POKA 4AXVA 4CS0B 1QMUA 4UCNA 1NMTA 3G8WA 2BCOA 3H4QA 5EC4A 1CP6A 1Z4EA 5JH9A 2G9DA 4A95A 4A37A 3HLPA 3SXOA 1CJWA 3V38A 2QVPA 3TX8A 3FBUA 3R95A 1M44A 1TKFA 2AFXA 2OH1A 1YQEA 3B2YA 4F0YA 1LANA 5AG7A 3R9FA 3EC4A 2ODFA 2O53A 4R76A 4ZGYB 4A38A 4NGMA 3TT2A 3SJGA 3FVLA 5LRJA 3IU2A 1LCPA 2Q4YA 2AFWA 2FXFA 2FS5A 2YNDA 4NXYA 4MMOA 5K8PA 1VHOA 5LYIA 3PB4X 2C1CA 4RUHA 1TXRA 4C2XA 4P44A 1BO4A 4XPLA 1IY7A 3TO7A 4KUAA 4RN7A 4KOUA 1YGHA 2WSAA 4H89A 3BI0A 5H86A 3R1KA 5AG4A 2FVGA 2JEWA 3FYNA 3CZXA 3SI0A 2NYQA 2OZGA 3A9LA 3D4UA 5A27A 1YK3A 2AFOA 4OMEA 4AVAA 1YX0A 1FY7A 2R98A 2PE3A 3GIUA 2EWBA 4W9YA 5EMIA 2B5GB 2ZPAA 2K5TA 3KASA 1X10A 2GLJA 4AG9A 5F46A 3WABA 2KCWA 2IQ6A 3MGDA 2PJAA 3SJEA 2XEIA 4JXRA 1IGBA 5G20A 4U9YA 4A33A 1WWZA 4ONWA 3W6XA 2GREA 1VHEA 2BL1A 4CYNA 1TF9A 1YVOA 3VARA 5C82A 4OIWA 1Y7RA 4UBRA 2QMLA 3KGQA 2RC4A 4MHZA 4CGLA 2VI7A 4FD6A 1Y0YA 2BUEA 3UY5A 3GY9A 3N7ZA 3JTKA 4U5YA 4XPDB 4U9ZA 3D2PA 2WPWA 2ZEHA 4I49A 4KSAA 4QBJA 4ZI6A 1TKJA 3CXPA 1Y7EA 2C6PA 2G0BA 3LD2A 1YMEA 2PJ7A 3NFZA 4QB9A 4P4IA 4A39A 4B5PA 2ZENA 1VKCA 4M85A 3H8EA 4RI1A 3TOBA 4C2YA 4EMEA 5IB0A 3T8WA 1R57A 3KQXA 2VQYA 1V0CA 4PXCA 4PXEA 5E96A 5F48A 4ZX8A 2ZW6A 2WPXA 3CT9A 4X2TA 2FT0A 3TO9A 2V8HA 2CIJA 2Q7SA 8CPAA 4R6TA 2GE3A 3SJFA 2CF4A 2Z3OA 5A28A 2Q0YA 1QSNA 3QNVA 3FIXA 1S5KA 3V7ZA 1XEBA 4P4JA 1QSMA 3R9GA 2PJ2A 3TTHA 2P6GA 4IK2A 1YW6A 2Z11A 4G1PA 1CX8A 3B3CA 4GM5A 1F57A 4XPDC 1RXTA 2P6FA 1Y9KA 2C6GA 4JXQA 4EFDA 1FT7A 2VBQA 3DDDA 4WJBA 5HXDA 6CPAA 2HV2A 4M3SA 4HNXB 4NGPA 3TC8A 1H8LA 3GYAA 3RZAA 5CBMA 3FJUA 2Q44A 4DUKA 4OC2A 4MFJA 2AFMA 3H8FA 4MCRA 3D7FA 4E8OA 3LMSA 2PRQA 1Y0RA 3BLNA 3ISZA 2PJ5A 4JD6A 1R43A 4Q7AA 5I4MA 4KOVA 4MRIA 4FAIA 4IF5A 2GANA 4YU9A 1CPXA 2B58A 2X7BA 3TCVA 3PBEA 3MRUA 3IJ3A 4C68A 3E0KA 1ARLA 1Q2DA 4ZX9A 3B3SA 3PEIA 5KTCA 5LYLA 4UFXA 2DPSA 3IWEA 4Q36A 4L8AA 4ZY1A 4R3KA 1BPNA 2JLMA 3DGVA 4AB7A 3S9NA 3KHZA 3F8KA 4DYOA 2RB7A 4IUSA 4KSFA 2ZELA 3S6GA 2Q7BA 1VIXA 4B13A 1DE4C 2Q51A 1OBRA 2IL4A 1BPMA 3EFAA 4F0XA 4NJRA 4UFVA 4KVME 4A32A 3S9LA 4F9VA 4XNHC 4PK2A 2ZOFA 2G3TA 2Z3LA 2H5MA 2QJ8A 3B8GA 3QB8A 4PSWA 4ZBGA 1Q2YA 2ZW7A 2OB0A 2ZW5A 5CPAA 5LRKA 2ATRA 5AG6A 4OC3A 4NGNA 3DSBA 2B3VA 1AMPA 2JEVA 4H6ZA 2ANPA 1X12A 4LQ6A 1PUAA 2Q4ZA 3HUVA 1TF8A 3PGPA 2OR4A 2FIWA 4UIAA 4UCPA 1XRYA 2G3AA 3H8GA 1I12A 2Z3PA 3KHXA 3BJ7A 1ZG9A 3PFOA 2RFHA 1HDUA 4FWUA 3KI9A 3D3SA 2FE7A 1QQ9A 1XFOA 1IU8A 1Z5RA 2HC9A 4M6IA 4LQGA 5I0CA 2P0WA 5AG5A 4CRZB 5J1QA 1M4DA 3DNSA 3JRUA 3S9MA 3VATA 4KORA 1ELMP 4B11A 2NSMA 3NH8A 2C27A 2Z3MA 2NMTA 1Z8WA 4OAEA 2J8MA 2Y0MA 1Z9UA 4IHMA 4OIDA 1AYEA 3NE8A 2B5GA 4FD7A 3S6KA 2CNMA 4XNHB 5ISVA 4KUBA 4NEXA 4YRHA 4YWYA 4UA3A 4MHDA 2QECA 1K4JA 4PK3A 3SI2A 3BI1A 1DTDA 2QIRA 2GU2A 5IX3A 5LYDA 5D8NA 4AG7A 5CNPA 1S60A 4PV6A 1Z8XA 4KZTA 4ORFA 2D4PA 3PRTA 4OP4A 1L0CA 2PJ0A 2R7HA 1OZPA 2PJ6A 3K2KA 3CXSA 1YSJA 3KQZA 2PJCA 1MK4A 4OLLA 4KS9A 1EE3P 3D7GA 1VGYA 4LUAA 3SHPA 3IO1A 1IB1E 2ZXVA 5JGFA 1CG2A 4C7HA 3PZJA 1IOFA 4AVBA 5HVHA 4HNWB 2J8RA 4FUUA 4PXBA 4FD5A 4OC4A 3T90A 4B12A 4BMHA 5HVFA 2ZEFA 2VEZA 2R1IA 1TKHA 1YLEA 3BHXA 1ZO0A 3D7DA 3P2FA 3RNZA 3JUWA 4F6AA 3B3WA 1XF8A 4PPZA 4A2ZA 2Z3KA 1ARMA 2PR1A 2IJZA 1S7LA 3FMCA 1BAVA 2PJ4A 1A2ZA 4TNUA 1B87A 1LAPA 5BWAB 3TFYA 2OZHA 1AUGA 2WUUA 2B3UA 5F47A 1YREA 5KTDA 2YNCA 4ZYQA 1F2PA 3LODA 4LX9A 4UEFA 3PFEA 5JQ4A 1IYKA 2EUIA 2Q4VA 2ZW4A 1Y9WA 3D66A 2EO8A 2EK8A 1M4GA 4CYOA 2AFZA 2F7VA 4FD4A 4OADA 2DPTA 4IAVA 3TOAA 4FBEA 2PJ8A 2YGWA 4R7MA 5GCNA 3WR7A 3TO6A 1B6BA 2VZYA 2WZNA 1Q7LA 3D7HA 4R8FA 1XIXA 2C6CA 1YW4A 5IB9A 4II9A 4NFRA 2PSWA 3IEHA 3CXQA 2XEFA 3KL9A 4MFQA 5HH1A 2GIVA 2B4BA 4J3GA 4EWTA 3PB9X 2FIAA 3BXMA 3GB0A 1NE9A 4JYWA 3H5ZA 3P2HA 1Z8LA 2JBJA 3C26A 2AE6A 4A30A 4UEZA 3TE4A 3FB3A 4O23A 1TIQA 4BBHA 1MJ9A 2OU2A 4MBUA 2BO9A 1LAMA 4B14A 3ZJ0A 1CM0A 4B10A 4KOSA 4M6GA 1XBUA 1RO5A 2PVWA 1RTQA 2WYRA 4CGNA 1QSTA 1I21A 2ZEMA 1NSAA 3EY5A 4NJQA 3CDXA 4UWJA 2OZUA 4MI4A 4OC5A 3D68A 4CGPA 5HVGA 2ZOGA 4PQAA 1XOVA 1QSOA 1ZLHA 3VH9A 5JPHA 2ARHA 1GHEA 2V8VA 1NSLA 3KZWA 3B3TA 3GLJA 2GFQA 3KKWA 1KZFA 2VZZA 4MXUA 2R8VA 2FL4A 4QC6A 1N71A 2HQYA 3VWEA 2J8NA 1CBXA 3FNCA 4HNYB 1HDQA 3PBBA 4CGOA 5EBVA 3SJXA 1S7FA 4UIBA 4R87A 1P0HA 1M4IA 1UFHA 4A31A 3EXNA 2BOAA 3JVNA 1CP7A 2Q43A 1ZG7A 3WC6A 3FEEA 3WC7A 2AFSA 1FNOA 2O28A 4UFWA 3GUXA 1XE4A 4KOWA 2J9AA 3W91A 5G21A 2CY2A 3RYOA 4GS4A 1BLLE 3NA6A 2EBJA 2VL1A 4DNCA 1Q2CA 1LOKA 2B4DA 4AVCA 2PRBA 4KOTA 4CGMA 4UEEA 1Z2LA 4P6YA 2F8HA 4X8IA 1VHSA 1LRZA 4MFLA 4MFPA 3VWDA 4Y49B 4MFZA 1YLOA 2V8DA 4KSIA 3KR5A 2PQ8A
chains in the Genus database with same CATH topology
4B5PB 3QAHA 4NF1A 3ZZIA 4ONUA 4KOYA 4CAEA 4R9MA 5G1ZA 5H84A 4K30A 5FVJA 2B4DB 4CAWA 1S3ZA 1I1DA 4JJXA 1S7KA 1PU9A 2I00A 5J8FA 5AGEA 4X5KA 4CRYB 2A4NA 4NCZA 2YNEA 5F49A 4EVYA 3D8PA 4QVTA 3V8IA 4YFJA 1WK4A 1MJBA 1IICA 1YR0A 1YVKA 3T9YA 2Z3NA 4Y49C 1KUVA 3DR8A 2FCKA 3K9UA 1MJAA 2HUZA 1KUYA 2JDCA 3FRMA 3R96A 4R3LA 2Q04A 4JWPA 4JLYA 2FSRA 3I9SA 3IGRA 4CYQA 2AJ6A 4MY3A 2VXKA 4UCMA 4KVOE 5C88A 2D4OA 4CAVA 5G22A 3D2MA 4CYPA 2BSWA 3EO4A 4KOXA 4KLWA 2P6EA 3GKRA 4MFKA 2CXAA 3S6FA 2PR8A 3IU1A 2Z10A 2PC1A 2F5IA 1QSRA 4E0AA 4PSXA 5HMNA 1P4NA 3G3SA 3NE7A 5KTAA 1KUXA 2REEA 3S6HA 1Z4RA 3OWCA 4MJ8A 4C7IA 2PDOA 2YNCC 4Q38A 2JDDA 3IWGA 1IIDA 4B5OA 4CAXA 1ON0A 1J4JA 2BEIA 3FXTA 1M1DA 2REFA 4YGOA 5DWMA 4XPKA 4UWIA 5J8CA 4QUSA 4C2ZA 3F5BA 3R9EA 2EVNA 3PP9A 3I3GA 5DWNA 3DR6A 1U6MA 4RS2A 4E2AA 4L89A 4H6UA 2Z0ZA 4MY0A 3BJ8A 1IYLA 2DXQA 2CNSA 2CNTA 4KVXA 1S7NA 4HKFA 4R57A 5IV0A 1BOBA 4CAFA 4NSQA 1XMTA 3SXNA 3W6SA 3F0AA 4KLVA 1SQHA 2I79A 4CS0B 4UCNA 1NMTA 3G8WA 3H4QA 5EC4A 1Z4EA 4A95A 3SXOA 1CJWA 3FBUA 3R95A 1M44A 2OH1A 4F0YA 5AG7A 3R9FA 3EC4A 4ZGYB 3TT2A 3IU2A 2Q4YA 2FXFA 2FS5A 2YNDA 4NXYA 4C2XA 1BO4A 4XPLA 3TO7A 4KUAA 4KOUA 1YGHA 2WSAA 4H89A 5H86A 3R1KA 5AG4A 3FYNA 5A27A 3A9LA 2OZGA 1YK3A 4AVAA 1YX0A 1FY7A 2R98A 2B5GB 2ZPAA 2K5TA 5F46A 4AG9A 2KCWA 3MGDA 4JXRA 5G20A 4U9YA 4A33A 1WWZA 3W6XA 2BL1A 4CYNA 1YVOA 5C82A 1Y7RA 4UBRA 2QMLA 2RC4A 4CGLA 2VI7A 4FD6A 2BUEA 3UY5A 3GY9A 3N7ZA 3JTKA 4U5YA 4XPDB 4U9ZA 3D2PA 2WPWA 4QBJA 4I49A 4KSAA 3CXPA 2G0BA 3LD2A 4QB9A 4B5PA 1VKCA 4M85A 4RI1A 3TOBA 4C2YA 5IB0A 1R57A 2VQYA 1V0CA 5E96A 5F48A 2ZW6A 2WPXA 2FT0A 3TO9A 2GE3A 2Z3OA 5A28A 2Q0YA 1QSNA 3FIXA 1S5KA 1XEBA 1QSMA 3R9GA 3TTHA 2P6GA 2Z11A 4XPDC 1RXTA 2P6FA 1Y9KA 4JXQA 2VBQA 3DDDA 2HV2A 4M3SA 4HNXB 3GYAA 2Q44A 4MFJA 4E8OA 3BLNA 4JD6A 4KOVA 4IF5A 2GANA 2B58A 2X7BA 3TCVA 4C68A 3E0KA 1Q2DA 5KTCA 4UFXA 2DPSA 3IWEA 4Q36A 4L8AA 4R3KA 2JLMA 4AB7A 3F8KA 4IUSA 4KSFA 3S6GA 2Q7BA 4B13A 2IL4A 3EFAA 4F0XA 4UFVA 4KVME 4A32A 4XNHC 4PK2A 2G3TA 2Z3LA 2H5MA 3B8GA 3QB8A 4ZBGA 4PSWA 1Q2YA 2ZW7A 2OB0A 2ZW5A 2ATRA 5AG6A 3DSBA 2B3VA 2JEVA 4H6ZA 1PUAA 3PGPA 2FIWA 4UCPA 2G3AA 1I12A 2Z3PA 3BJ7A 3D3SA 2FE7A 5I0CA 2P0WA 5AG5A 4CRZB 1M4DA 3DNSA 4KORA 4B11A 2C27A 2Z3MA 2NMTA 4OAEA 2J8MA 2Y0MA 1Z9UA 3S6KA 2B5GA 4FD7A 2CNMA 4XNHB 5ISVA 4KUBA 4NEXA 4YRHA 4UA3A 4MHDA 2QECA 1K4JA 4PK3A 2QIRA 5IX3A 4AG7A 5CNPA 1S60A 4PV6A 4KZTA 4ORFA 2D4PA 1L0CA 2R7HA 1OZPA 3CXSA 4OLLA 1MK4A 4KS9A 4LUAA 3SHPA 1IB1E 2ZXVA 4C7HA 3PZJA 4AVBA 4HNWB 2J8RA 4FD5A 3T90A 4B12A 4BMHA 2VEZA 2R1IA 1YLEA 4F6AA 1ZO0A 3P2FA 3JUWA 1XF8A 4A2ZA 2Z3KA 2PR1A 1S7LA 3TFYA 1B87A 5BWAB 2OZHA 2WUUA 2B3UA 5F47A 1YREA 5KTDA 2YNCA 4LX9A 3LODA 5JQ4A 1IYKA 2EUIA 2Q4VA 2ZW4A 1Y9WA 1M4GA 4CYOA 4FD4A 4OADA 2DPTA 3TOAA 2YGWA 5GCNA 3WR7A 3TO6A 1B6BA 2VZYA 1XIXA 4II9A 2PSWA 3CXQA 4MFQA 5HH1A 2GIVA 2B4BA 4J3GA 2FIAA 1NE9A 3H5ZA 3P2HA 3C26A 2AE6A 4A30A 3TE4A 3FB3A 1TIQA 4BBHA 1MJ9A 4MBUA 2OU2A 4B14A 3ZJ0A 1CM0A 4B10A 4KOSA 1RO5A 4CGNA 1QSTA 1I21A 3EY5A 4UWJA 2OZUA 4MI4A 4CGPA 1QSOA 5JPHA 2ARHA 1GHEA 1NSLA 3KKWA 1KZFA 2VZZA 2R8VA 2FL4A 4QC6A 1N71A 2HQYA 3VWEA 2J8NA 3FNCA 4HNYB 4CGOA 5EBVA 1S7FA 4R87A 1P0HA 1M4IA 1UFHA 4A31A 3EXNA 3JVNA 2O28A 4UFWA 1XE4A 4KOWA 3W91A 5G21A 2CY2A 3RYOA 4GS4A 4DNCA 1Q2CA 2B4DA 4AVCA 2PRBA 4KOTA 4CGMA 1VHSA 1LRZA 4MFLA 4MFPA 3VWDA 4Y49B 4MFZA 2PQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5P B;  3QAH A;  4NF1 A;  3ZZI A;  4ONU A;  4KOY A;  4R9M A;  5H84 A;  4K30 A;  5FVJ A;  2B4D B;  4CAW A;  1S3Z A;  1I1D A;  4JJX A;  1S7K A;  1PU9 A;  2I00 A;  5J8F A;  4X5K A;  4CRY B;  2A4N A;  4NCZ A;  5F49 A;  4EVY A;  3D8P A;  4QVT A;  3V8I A;  4YFJ A;  1WK4 A;  1MJB A;  1IIC A;  1YR0 A;  1YVK A;  3T9Y A;  4Y49 C;  1KUV A;  3DR8 A;  2FCK A;  3K9U A;  1MJA A;  2HUZ A;  1KUY A;  2JDC A;  3FRM A;  3R96 A;  4R3L A;  2Q04 A;  4JWP A;  4JLY A;  2FSR A;  3I9S A;  3IGR A;  2AJ6 A;  4MY3 A;  2VXK A;  4KVO E;  5C88 A;  2D4O A;  4CAV A;  3D2M A;  2BSW A;  3EO4 A;  4KOX A;  4KLW A;  2P6E A;  3GKR A;  3S6F A;  2PR8 A;  2Z10 A;  2PC1 A;  2F5I A;  1QSR A;  4E0A A;  4PSX A;  5HMN A;  1P4N A;  3G3S A;  3NE7 A;  5KTA A;  1KUX A;  2REE A;  3S6H A;  1Z4R A;  3OWC A;  4MJ8 A;  2PDO A;  2JDD A;  3IWG A;  1IID A;  4B5O A;  4CAX A;  1ON0 A;  1J4J A;  2BEI A;  3FXT A;  1M1D A;  2REF A;  4YGO A;  5DWM A;  4XPK A;  4UWI A;  5J8C A;  4QUS A;  3F5B A;  3R9E A;  2EVN A;  3PP9 A;  3I3G A;  5DWN A;  3DR6 A;  1U6M A;  4RS2 A;  4E2A A;  4L89 A;  4H6U A;  2Z0Z A;  4MY0 A;  3BJ8 A;  1IYL A;  2DXQ A;  2CNS A;  2CNT A;  4KVX A;  1S7N A;  4HKF A;  4R57 A;  5IV0 A;  1BOB A;  4NSQ A;  1XMT A;  3SXN A;  3W6S A;  3F0A A;  4KLV A;  1SQH A;  2I79 A;  4CS0 B;  1NMT A;  3G8W A;  3H4Q A;  5EC4 A;  1Z4E A;  3SXO A;  1CJW A;  3FBU A;  3R95 A;  1M44 A;  2OH1 A;  4F0Y A;  3R9F A;  3EC4 A;  3TT2 A;  2Q4Y A;  2FXF A;  2FS5 A;  4NXY A;  1BO4 A;  4XPL A;  3TO7 A;  4KUA A;  4KOU A;  1YGH A;  4H89 A;  5H86 A;  3R1K A;  3FYN A;  2OZG A;  1YK3 A;  4AVA A;  1YX0 A;  1FY7 A;  2R98 A;  2B5G B;  2ZPA A;  2K5T A;  5F46 A;  4AG9 A;  2KCW A;  3MGD A;  4JXR A;  4U9Y A;  1WWZ A;  3W6X A;  2BL1 A;  1YVO A;  5C82 A;  1Y7R A;  4UBR A;  2QML A;  2RC4 A;  2VI7 A;  4FD6 A;  2BUE A;  3UY5 A;  3GY9 A;  3N7Z A;  4U5Y A;  4XPD B;  4U9Z A;  3D2P A;  2WPW A;  4QBJ A;  4I49 A;  3CXP A;  2G0B A;  3LD2 A;  4QB9 A;  4B5P A;  1VKC A;  4M85 A;  4RI1 A;  3TOB A;  5IB0 A;  1R57 A;  2VQY A;  1V0C A;  5E96 A;  5F48 A;  2ZW6 A;  2WPX A;  2FT0 A;  3TO9 A;  2GE3 A;  2Q0Y A;  1QSN A;  3FIX A;  1S5K A;  1XEB A;  1QSM A;  3R9G A;  3TTH A;  2P6G A;  2Z11 A;  4XPD C;  1RXT A;  2P6F A;  1Y9K A;  4JXQ A;  2VBQ A;  3DDD A;  2HV2 A;  4M3S A;  4HNX B;  3GYA A;  2Q44 A;  4E8O A;  3BLN A;  4JD6 A;  4KOV A;  4IF5 A;  2GAN A;  2B58 A;  2X7B A;  3TCV A;  3E0K A;  1Q2D A;  5KTC A;  4L8A A;  4R3K A;  2JLM A;  4AB7 A;  3F8K A;  4IUS A;  3S6G A;  2Q7B A;  2IL4 A;  3EFA A;  4KVM E;  4XNH C;  4PK2 A;  2G3T A;  2H5M A;  3B8G A;  3QB8 A;  4ZBG A;  4PSW A;  1Q2Y A;  2ZW7 A;  2OB0 A;  2ZW5 A;  2ATR A;  3DSB A;  2B3V A;  2JEV A;  4H6Z A;  1PUA A;  3PGP A;  2FIW A;  2G3A A;  1I12 A;  3BJ7 A;  3D3S A;  2FE7 A;  5I0C A;  2P0W A;  4CRZ B;  1M4D A;  3DNS A;  4KOR A;  2C27 A;  2NMT A;  4OAE A;  2J8M A;  2Y0M A;  1Z9U A;  3S6K A;  2B5G A;  4FD7 A;  2CNM A;  4XNH B;  5ISV A;  4KUB A;  4NEX A;  4YRH A;  4UA3 A;  4MHD A;  2QEC A;  1K4J A;  4PK3 A;  2QIR A;  5IX3 A;  4AG7 A;  5CNP A;  1S60 A;  4PV6 A;  4KZT A;  4ORF A;  2D4P A;  1L0C A;  2R7H A;  1OZP A;  3CXS A;  4OLL A;  1MK4 A;  4LUA A;  3SHP A;  1IB1 E;  2ZXV A;  3PZJ A;  4AVB A;  4HNW B;  2J8R A;  4FD5 A;  3T90 A;  4BMH A;  2VEZ A;  2R1I A;  1YLE A;  4F6A A;  3P2F A;  3JUW A;  1XF8 A;  2PR1 A;  1S7L A;  3TFY A;  1B87 A;  2OZH A;  2B3U A;  5F47 A;  1YRE A;  5KTD A;  4LX9 A;  3LOD A;  5JQ4 A;  1IYK A;  2EUI A;  2Q4V A;  2ZW4 A;  1Y9W A;  1M4G A;  4FD4 A;  4OAD A;  3TOA A;  5GCN A;  3WR7 A;  3TO6 A;  1B6B A;  2VZY A;  1XIX A;  4II9 A;  2PSW A;  3CXQ A;  5HH1 A;  2GIV A;  2B4B A;  4J3G A;  2FIA A;  1NE9 A;  3P2H A;  3C26 A;  2AE6 A;  3TE4 A;  3FB3 A;  1TIQ A;  1MJ9 A;  2OU2 A;  4MBU A;  3ZJ0 A;  1CM0 A;  4KOS A;  1RO5 A;  1QST A;  1I21 A;  3EY5 A;  4UWJ A;  2OZU A;  4MI4 A;  1QSO A;  5JPH A;  2ARH A;  1GHE A;  1NSL A;  3KKW A;  1KZF A;  2VZZ A;  2R8V A;  2FL4 A;  4QC6 A;  1N71 A;  2HQY A;  3VWE A;  2J8N A;  3FNC A;  4HNY B;  5EBV A;  1S7F A;  4R87 A;  1P0H A;  1M4I A;  1UFH A;  3EXN A;  3JVN A;  2O28 A;  1XE4 A;  4KOW A;  3W91 A;  2CY2 A;  3RYO A;  4GS4 A;  4DNC A;  1Q2C A;  2B4D A;  4AVC A;  2PRB A;  4KOT A;  1VHS A;  1LRZ A;  3VWD A;  4Y49 B;  2PQ8 A; 
#chains in the Genus database with same CATH topology
 4P4B A;  4B5P B;  3QAH A;  4K3N A;  3L2N A;  4H2K A;  4NF1 A;  4NGT A;  4NGQ A;  3ZZI A;  4ONU A;  4KOY A;  4CAE A;  4MCP A;  1XJO A;  4BIN A;  2ZEE A;  4R9M A;  4PXD A;  4P4D A;  5G1Z A;  5H84 A;  4K30 A;  4WWV A;  5FVJ A;  4X3R A;  2B4D B;  2V77 A;  1S3Z A;  4CAW A;  1I1D A;  4P4E A;  2PVV A;  4JJX A;  1S7K A;  1PU9 A;  2I00 A;  5LYF A;  5J8F A;  5JM6 A;  5AGE A;  2PJB A;  4X5K A;  4CRY B;  2A4N A;  2O4H A;  2QYV A;  2YNE A;  4NCZ A;  5F49 A;  4EVY A;  1UWY A;  4P10 A;  3PB7 X;  3D8P A;  4QVT A;  3V8I A;  1R3N A;  4YFJ A;  1WK4 A;  1MJB A;  1IIC A;  5K8M A;  1YR0 A;  1ZLI A;  1F2O A;  1KWM A;  1YVK A;  3FH4 A;  3T9Y A;  4UF4 A;  2Z3N A;  4Y49 C;  4OKO A;  1KUV A;  2CTC A;  2PIY A;  3DR8 A;  4MHY A;  5DS0 A;  5THW A;  3RBU A;  4NGR A;  2FCK A;  3K9U A;  1MJA A;  2HUZ A;  2ZEP A;  4OC0 A;  1KUY A;  2JDC A;  5ELY A;  3FRM A;  5K8O A;  3R96 A;  3WC5 A;  5K8N A;  1GYT A;  4R3L A;  3MN8 A;  4MCQ A;  2Q04 A;  4JWP A;  4JLY A;  2FSR A;  4CPA A;  3I9S A;  2DF5 A;  3IGR A;  4CYQ A;  4NGS A;  4P4F A;  2AJ6 A;  4MY3 A;  2VXK A;  1M4L A;  4UCM A;  4KVO E;  5C88 A;  2D4O A;  4CAV A;  3PB6 X;  3B7I A;  5G22 A;  3CPX A;  7CPA A;  1PCA A;  1JWQ A;  3D67 A;  4DJL A;  3D2M A;  3LWU A;  4CYP A;  2BSW A;  2IMO A;  4HPS A;  4A94 A;  3EO4 A;  4KOX A;  2ZEO A;  2PJ3 A;  2ZED A;  3NH5 A;  4KLW A;  2P6E A;  4OC1 A;  3GKR A;  1ELL P;  4MFK A;  2CXA A;  1JQG A;  3S6F A;  2PR8 A;  3DLJ A;  1ZG8 A;  3IU1 A;  5D29 A;  3PB8 X;  4Z65 A;  2Z10 A;  3IFE A;  2PC1 A;  2F5I A;  1QSR A;  3FED A;  4M6H A;  3FEC A;  4E0A A;  4PSX A;  4MHP A;  5HMN A;  1P4N A;  3G3S A;  3NE7 A;  5KTA A;  2PIZ A;  1KUX A;  2REE A;  1XMB A;  2PJ1 A;  3S6H A;  1Z4R A;  2CTB A;  3OWC A;  4MJ8 A;  1Z8T A;  4C7I A;  3IWW A;  2PDO A;  2YNC C;  3FF3 A;  2AFU A;  1LFW A;  3NH4 A;  2PJ9 A;  4Q38 A;  5LRG A;  2JDD A;  3IWG A;  3B35 A;  3FX6 A;  1IID A;  2ZEG A;  4B5O A;  3CPA A;  4CAX A;  1ON0 A;  1J4J A;  2BEI A;  1CPS A;  2I3C A;  3B3V A;  3FXT A;  1M1D A;  2REF A;  4YGO A;  3ISX A;  4JZ0 A;  5DWM A;  3RAM A;  4XPK A;  4F9U A;  4ZY2 A;  4UWI A;  1IOI A;  3LAC A;  5J8C A;  4QUS A;  4C2Z A;  4F8Z A;  3F5B A;  3R9E A;  3N5F A;  3IC1 A;  3WT4 A;  2EVN A;  4GXH A;  3RO0 A;  3PP9 A;  4TWE A;  4MHN A;  3SI1 A;  3I3G A;  2XEJ A;  3I1U A;  2ABZ A;  3DR6 A;  1U6M A;  5DWN A;  4RS2 A;  2HB6 A;  4P45 A;  4E2A A;  4L89 A;  2V8G A;  2Z0Z A;  4H6U A;  5F09 A;  3QAY A;  4MY0 A;  2PCU A;  3BJ8 A;  1IYL A;  4MCS A;  2DXQ A;  2OOT A;  2CNS A;  2EK9 A;  2CNT A;  3K9T A;  4KVX A;  1S7N A;  3IIB A;  4HKF A;  4R57 A;  1PYT B;  1HEE A;  2GLF A;  2DEA A;  5IV0 A;  1BOB A;  4CAF A;  4ZY0 A;  4NSQ A;  1XMT A;  3SXN A;  3W6S A;  3F0A A;  4BD9 A;  4KLV A;  1SQH A;  2I79 A;  2XEG A;  4B6Z A;  2JBK A;  3KR4 A;  2POK A;  4AXV A;  4CS0 B;  1QMU A;  4UCN A;  1NMT A;  3G8W A;  2BCO A;  3H4Q A;  5EC4 A;  1CP6 A;  1Z4E A;  5JH9 A;  2G9D A;  4A95 A;  4A37 A;  3HLP A;  3SXO A;  1CJW A;  3V38 A;  2QVP A;  3TX8 A;  3FBU A;  3R95 A;  1M44 A;  1TKF A;  2AFX A;  2OH1 A;  1YQE A;  3B2Y A;  4F0Y A;  1LAN A;  5AG7 A;  3R9F A;  3EC4 A;  2ODF A;  2O53 A;  4R76 A;  4ZGY B;  4A38 A;  4NGM A;  3TT2 A;  3SJG A;  3FVL A;  5LRJ A;  3IU2 A;  1LCP A;  2Q4Y A;  2AFW A;  2FXF A;  2FS5 A;  2YND A;  4NXY A;  4MMO A;  5K8P A;  1VHO A;  5LYI A;  3PB4 X;  2C1C A;  4RUH A;  1TXR A;  4C2X A;  4P44 A;  1BO4 A;  4XPL A;  1IY7 A;  3TO7 A;  4KUA A;  4RN7 A;  4KOU A;  1YGH A;  2WSA A;  4H89 A;  3BI0 A;  5H86 A;  3R1K A;  5AG4 A;  2FVG A;  2JEW A;  3FYN A;  3CZX A;  3SI0 A;  2NYQ A;  2OZG A;  3A9L A;  3D4U A;  5A27 A;  1YK3 A;  2AFO A;  4OME A;  4AVA A;  1YX0 A;  1FY7 A;  2R98 A;  2PE3 A;  3GIU A;  2EWB A;  4W9Y A;  5EMI A;  2B5G B;  2ZPA A;  2K5T A;  3KAS A;  1X10 A;  2GLJ A;  4AG9 A;  5F46 A;  3WAB A;  2KCW A;  2IQ6 A;  3MGD A;  2PJA A;  3SJE A;  2XEI A;  4JXR A;  1IGB A;  5G20 A;  4U9Y A;  4A33 A;  1WWZ A;  4ONW A;  3W6X A;  2GRE A;  1VHE A;  2BL1 A;  4CYN A;  1TF9 A;  1YVO A;  3VAR A;  5C82 A;  4OIW A;  1Y7R A;  4UBR A;  2QML A;  3KGQ A;  2RC4 A;  4MHZ A;  4CGL A;  2VI7 A;  4FD6 A;  1Y0Y A;  2BUE A;  3UY5 A;  3GY9 A;  3N7Z A;  3JTK A;  4U5Y A;  4XPD B;  4U9Z A;  3D2P A;  2WPW A;  2ZEH A;  4I49 A;  4KSA A;  4QBJ A;  4ZI6 A;  1TKJ A;  3CXP A;  1Y7E A;  2C6P A;  2G0B A;  3LD2 A;  1YME A;  2PJ7 A;  3NFZ A;  4QB9 A;  4P4I A;  4A39 A;  4B5P A;  2ZEN A;  1VKC A;  4M85 A;  3H8E A;  4RI1 A;  3TOB A;  4C2Y A;  4EME A;  5IB0 A;  3T8W A;  1R57 A;  3KQX A;  2VQY A;  1V0C A;  4PXC A;  4PXE A;  5E96 A;  5F48 A;  4ZX8 A;  2ZW6 A;  2WPX A;  3CT9 A;  4X2T A;  2FT0 A;  3TO9 A;  2V8H A;  2CIJ A;  2Q7S A;  8CPA A;  4R6T A;  2GE3 A;  3SJF A;  2CF4 A;  2Z3O A;  5A28 A;  2Q0Y A;  1QSN A;  3QNV A;  3FIX A;  1S5K A;  3V7Z A;  1XEB A;  4P4J A;  1QSM A;  3R9G A;  2PJ2 A;  3TTH A;  2P6G A;  4IK2 A;  1YW6 A;  2Z11 A;  4G1P A;  1CX8 A;  3B3C A;  4GM5 A;  1F57 A;  4XPD C;  1RXT A;  2P6F A;  1Y9K A;  2C6G A;  4JXQ A;  4EFD A;  1FT7 A;  2VBQ A;  3DDD A;  4WJB A;  5HXD A;  6CPA A;  2HV2 A;  4M3S A;  4HNX B;  4NGP A;  3TC8 A;  1H8L A;  3GYA A;  3RZA A;  5CBM A;  3FJU A;  2Q44 A;  4DUK A;  4OC2 A;  4MFJ A;  2AFM A;  3H8F A;  4MCR A;  3D7F A;  4E8O A;  3LMS A;  2PRQ A;  1Y0R A;  3BLN A;  3ISZ A;  2PJ5 A;  4JD6 A;  1R43 A;  4Q7A A;  5I4M A;  4KOV A;  4MRI A;  4FAI A;  4IF5 A;  2GAN A;  4YU9 A;  1CPX A;  2B58 A;  2X7B A;  3TCV A;  3PBE A;  3MRU A;  3IJ3 A;  4C68 A;  3E0K A;  1ARL A;  1Q2D A;  4ZX9 A;  3B3S A;  3PEI A;  5KTC A;  5LYL A;  4UFX A;  2DPS A;  3IWE A;  4Q36 A;  4L8A A;  4ZY1 A;  4R3K A;  1BPN A;  2JLM A;  3DGV A;  4AB7 A;  3S9N A;  3KHZ A;  3F8K A;  4DYO A;  2RB7 A;  4IUS A;  4KSF A;  2ZEL A;  3S6G A;  2Q7B A;  1VIX A;  4B13 A;  1DE4 C;  2Q51 A;  1OBR A;  2IL4 A;  1BPM A;  3EFA A;  4F0X A;  4NJR A;  4UFV A;  4KVM E;  4A32 A;  3S9L A;  4F9V A;  4XNH C;  4PK2 A;  2ZOF A;  2G3T A;  2Z3L A;  2H5M A;  2QJ8 A;  3B8G A;  3QB8 A;  4PSW A;  4ZBG A;  1Q2Y A;  2ZW7 A;  2OB0 A;  2ZW5 A;  5CPA A;  5LRK A;  2ATR A;  5AG6 A;  4OC3 A;  4NGN A;  3DSB A;  2B3V A;  1AMP A;  2JEV A;  4H6Z A;  2ANP A;  1X12 A;  4LQ6 A;  1PUA A;  2Q4Z A;  3HUV A;  1TF8 A;  3PGP A;  2OR4 A;  2FIW A;  4UIA A;  4UCP A;  1XRY A;  2G3A A;  3H8G A;  1I12 A;  2Z3P A;  3KHX A;  3BJ7 A;  1ZG9 A;  3PFO A;  2RFH A;  1HDU A;  4FWU A;  3KI9 A;  3D3S A;  2FE7 A;  1QQ9 A;  1XFO A;  1IU8 A;  1Z5R A;  2HC9 A;  4M6I A;  4LQG A;  5I0C A;  2P0W A;  5AG5 A;  4CRZ B;  5J1Q A;  1M4D A;  3DNS A;  3JRU A;  3S9M A;  3VAT A;  4KOR A;  1ELM P;  4B11 A;  2NSM A;  3NH8 A;  2C27 A;  2Z3M A;  2NMT A;  1Z8W A;  4OAE A;  2J8M A;  2Y0M A;  1Z9U A;  4IHM A;  4OID A;  1AYE A;  3NE8 A;  2B5G A;  4FD7 A;  3S6K A;  2CNM A;  4XNH B;  5ISV A;  4KUB A;  4NEX A;  4YRH A;  4YWY A;  4UA3 A;  4MHD A;  2QEC A;  1K4J A;  4PK3 A;  3SI2 A;  3BI1 A;  1DTD A;  2QIR A;  2GU2 A;  5IX3 A;  5LYD A;  5D8N A;  4AG7 A;  5CNP A;  1S60 A;  4PV6 A;  1Z8X A;  4KZT A;  4ORF A;  2D4P A;  3PRT A;  4OP4 A;  1L0C A;  2PJ0 A;  2R7H A;  1OZP A;  2PJ6 A;  3K2K A;  3CXS A;  1YSJ A;  3KQZ A;  2PJC A;  1MK4 A;  4OLL A;  4KS9 A;  1EE3 P;  3D7G A;  1VGY A;  4LUA A;  3SHP A;  3IO1 A;  1IB1 E;  2ZXV A;  5JGF A;  1CG2 A;  4C7H A;  3PZJ A;  1IOF A;  4AVB A;  5HVH A;  4HNW B;  2J8R A;  4FUU A;  4PXB A;  4FD5 A;  4OC4 A;  3T90 A;  4B12 A;  4BMH A;  5HVF A;  2ZEF A;  2VEZ A;  2R1I A;  1TKH A;  1YLE A;  3BHX A;  1ZO0 A;  3D7D A;  3P2F A;  3RNZ A;  3JUW A;  4F6A A;  3B3W A;  1XF8 A;  4PPZ A;  4A2Z A;  2Z3K A;  1ARM A;  2PR1 A;  2IJZ A;  1S7L A;  3FMC A;  1BAV A;  2PJ4 A;  1A2Z A;  4TNU A;  1B87 A;  1LAP A;  5BWA B;  3TFY A;  2OZH A;  1AUG A;  2WUU A;  2B3U A;  5F47 A;  1YRE A;  5KTD A;  2YNC A;  4ZYQ A;  1F2P A;  3LOD A;  4LX9 A;  4UEF A;  3PFE A;  5JQ4 A;  1IYK A;  2EUI A;  2Q4V A;  2ZW4 A;  1Y9W A;  3D66 A;  2EO8 A;  2EK8 A;  1M4G A;  4CYO A;  2AFZ A;  2F7V A;  4FD4 A;  4OAD A;  2DPT A;  4IAV A;  3TOA A;  4FBE A;  2PJ8 A;  2YGW A;  4R7M A;  5GCN A;  3WR7 A;  3TO6 A;  1B6B A;  2VZY A;  2WZN A;  1Q7L A;  3D7H A;  4R8F A;  1XIX A;  2C6C A;  1YW4 A;  5IB9 A;  4II9 A;  4NFR A;  2PSW A;  3IEH A;  3CXQ A;  2XEF A;  3KL9 A;  4MFQ A;  5HH1 A;  2GIV A;  2B4B A;  4J3G A;  4EWT A;  3PB9 X;  2FIA A;  3BXM A;  3GB0 A;  1NE9 A;  4JYW A;  3H5Z A;  3P2H A;  1Z8L A;  2JBJ A;  3C26 A;  2AE6 A;  4A30 A;  4UEZ A;  3TE4 A;  3FB3 A;  4O23 A;  1TIQ A;  4BBH A;  1MJ9 A;  2OU2 A;  4MBU A;  2BO9 A;  1LAM A;  4B14 A;  3ZJ0 A;  1CM0 A;  4B10 A;  4KOS A;  4M6G A;  1XBU A;  1RO5 A;  2PVW A;  1RTQ A;  2WYR A;  4CGN A;  1QST A;  1I21 A;  2ZEM A;  1NSA A;  3EY5 A;  4NJQ A;  3CDX A;  4UWJ A;  2OZU A;  4MI4 A;  4OC5 A;  3D68 A;  4CGP A;  5HVG A;  2ZOG A;  4PQA A;  1XOV A;  1QSO A;  1ZLH A;  3VH9 A;  5JPH A;  2ARH A;  1GHE A;  2V8V A;  1NSL A;  3KZW A;  3B3T A;  3GLJ A;  2GFQ A;  3KKW A;  1KZF A;  2VZZ A;  4MXU A;  2R8V A;  2FL4 A;  4QC6 A;  1N71 A;  2HQY A;  3VWE A;  2J8N A;  1CBX A;  3FNC A;  4HNY B;  1HDQ A;  3PBB A;  4CGO A;  5EBV A;  3SJX A;  1S7F A;  4UIB A;  4R87 A;  1P0H A;  1M4I A;  1UFH A;  4A31 A;  3EXN A;  2BOA A;  3JVN A;  1CP7 A;  2Q43 A;  1ZG7 A;  3WC6 A;  3FEE A;  3WC7 A;  2AFS A;  1FNO A;  2O28 A;  4UFW A;  3GUX A;  1XE4 A;  4KOW A;  2J9A A;  3W91 A;  5G21 A;  2CY2 A;  3RYO A;  4GS4 A;  1BLL E;  3NA6 A;  2EBJ A;  2VL1 A;  4DNC A;  1Q2C A;  1LOK A;  2B4D A;  4AVC A;  2PRB A;  4KOT A;  4CGM A;  4UEE A;  1Z2L A;  4P6Y A;  2F8H A;  4X8I A;  1VHS A;  1LRZ A;  4MFL A;  4MFP A;  3VWD A;  4Y49 B;  4MFZ A;  1YLO A;  2V8D A;  4KSI A;  3KR5 A;  2PQ8 A; 
#chains in the Genus database with same CATH homology
 4B5P B;  3QAH A;  4NF1 A;  3ZZI A;  4ONU A;  4KOY A;  4CAE A;  4R9M A;  5G1Z A;  5H84 A;  4K30 A;  5FVJ A;  2B4D B;  4CAW A;  1S3Z A;  1I1D A;  4JJX A;  1S7K A;  1PU9 A;  2I00 A;  5J8F A;  5AGE A;  4X5K A;  4CRY B;  2A4N A;  4NCZ A;  2YNE A;  5F49 A;  4EVY A;  3D8P A;  4QVT A;  3V8I A;  4YFJ A;  1WK4 A;  1MJB A;  1IIC A;  1YR0 A;  1YVK A;  3T9Y A;  2Z3N A;  4Y49 C;  1KUV A;  3DR8 A;  2FCK A;  3K9U A;  1MJA A;  2HUZ A;  1KUY A;  2JDC A;  3FRM A;  3R96 A;  4R3L A;  2Q04 A;  4JWP A;  4JLY A;  2FSR A;  3I9S A;  3IGR A;  4CYQ A;  2AJ6 A;  4MY3 A;  2VXK A;  4UCM A;  4KVO E;  5C88 A;  2D4O A;  4CAV A;  5G22 A;  3D2M A;  4CYP A;  2BSW A;  3EO4 A;  4KOX A;  4KLW A;  2P6E A;  3GKR A;  4MFK A;  2CXA A;  3S6F A;  2PR8 A;  3IU1 A;  2Z10 A;  2PC1 A;  2F5I A;  1QSR A;  4E0A A;  4PSX A;  5HMN A;  1P4N A;  3G3S A;  3NE7 A;  5KTA A;  1KUX A;  2REE A;  3S6H A;  1Z4R A;  3OWC A;  4MJ8 A;  4C7I A;  2PDO A;  2YNC C;  4Q38 A;  2JDD A;  3IWG A;  1IID A;  4B5O A;  4CAX A;  1ON0 A;  1J4J A;  2BEI A;  3FXT A;  1M1D A;  2REF A;  4YGO A;  5DWM A;  4XPK A;  4UWI A;  5J8C A;  4QUS A;  4C2Z A;  3F5B A;  3R9E A;  2EVN A;  3PP9 A;  3I3G A;  5DWN A;  3DR6 A;  1U6M A;  4RS2 A;  4E2A A;  4L89 A;  4H6U A;  2Z0Z A;  4MY0 A;  3BJ8 A;  1IYL A;  2DXQ A;  2CNS A;  2CNT A;  4KVX A;  1S7N A;  4HKF A;  4R57 A;  5IV0 A;  1BOB A;  4CAF A;  4NSQ A;  1XMT A;  3SXN A;  3W6S A;  3F0A A;  4KLV A;  1SQH A;  2I79 A;  4CS0 B;  4UCN A;  1NMT A;  3G8W A;  3H4Q A;  5EC4 A;  1Z4E A;  4A95 A;  3SXO A;  1CJW A;  3FBU A;  3R95 A;  1M44 A;  2OH1 A;  4F0Y A;  5AG7 A;  3R9F A;  3EC4 A;  4ZGY B;  3TT2 A;  3IU2 A;  2Q4Y A;  2FXF A;  2FS5 A;  2YND A;  4NXY A;  4C2X A;  1BO4 A;  4XPL A;  3TO7 A;  4KUA A;  4KOU A;  1YGH A;  2WSA A;  4H89 A;  5H86 A;  3R1K A;  5AG4 A;  3FYN A;  5A27 A;  3A9L A;  2OZG A;  1YK3 A;  4AVA A;  1YX0 A;  1FY7 A;  2R98 A;  2B5G B;  2ZPA A;  2K5T A;  5F46 A;  4AG9 A;  2KCW A;  3MGD A;  4JXR A;  5G20 A;  4U9Y A;  4A33 A;  1WWZ A;  3W6X A;  2BL1 A;  4CYN A;  1YVO A;  5C82 A;  1Y7R A;  4UBR A;  2QML A;  2RC4 A;  4CGL A;  2VI7 A;  4FD6 A;  2BUE A;  3UY5 A;  3GY9 A;  3N7Z A;  3JTK A;  4U5Y A;  4XPD B;  4U9Z A;  3D2P A;  2WPW A;  4QBJ A;  4I49 A;  4KSA A;  3CXP A;  2G0B A;  3LD2 A;  4QB9 A;  4B5P A;  1VKC A;  4M85 A;  4RI1 A;  3TOB A;  4C2Y A;  5IB0 A;  1R57 A;  2VQY A;  1V0C A;  5E96 A;  5F48 A;  2ZW6 A;  2WPX A;  2FT0 A;  3TO9 A;  2GE3 A;  2Z3O A;  5A28 A;  2Q0Y A;  1QSN A;  3FIX A;  1S5K A;  1XEB A;  1QSM A;  3R9G A;  3TTH A;  2P6G A;  2Z11 A;  4XPD C;  1RXT A;  2P6F A;  1Y9K A;  4JXQ A;  2VBQ A;  3DDD A;  2HV2 A;  4M3S A;  4HNX B;  3GYA A;  2Q44 A;  4MFJ A;  4E8O A;  3BLN A;  4JD6 A;  4KOV A;  4IF5 A;  2GAN A;  2B58 A;  2X7B A;  3TCV A;  4C68 A;  3E0K A;  1Q2D A;  5KTC A;  4UFX A;  2DPS A;  3IWE A;  4Q36 A;  4L8A A;  4R3K A;  2JLM A;  4AB7 A;  3F8K A;  4IUS A;  4KSF A;  3S6G A;  2Q7B A;  4B13 A;  2IL4 A;  3EFA A;  4F0X A;  4UFV A;  4KVM E;  4A32 A;  4XNH C;  4PK2 A;  2G3T A;  2Z3L A;  2H5M A;  3B8G A;  3QB8 A;  4ZBG A;  4PSW A;  1Q2Y A;  2ZW7 A;  2OB0 A;  2ZW5 A;  2ATR A;  5AG6 A;  3DSB A;  2B3V A;  2JEV A;  4H6Z A;  1PUA A;  3PGP A;  2FIW A;  4UCP A;  2G3A A;  1I12 A;  2Z3P A;  3BJ7 A;  3D3S A;  2FE7 A;  5I0C A;  2P0W A;  5AG5 A;  4CRZ B;  1M4D A;  3DNS A;  4KOR A;  4B11 A;  2C27 A;  2Z3M A;  2NMT A;  4OAE A;  2J8M A;  2Y0M A;  1Z9U A;  3S6K A;  2B5G A;  4FD7 A;  2CNM A;  4XNH B;  5ISV A;  4KUB A;  4NEX A;  4YRH A;  4UA3 A;  4MHD A;  2QEC A;  1K4J A;  4PK3 A;  2QIR A;  5IX3 A;  4AG7 A;  5CNP A;  1S60 A;  4PV6 A;  4KZT A;  4ORF A;  2D4P A;  1L0C A;  2R7H A;  1OZP A;  3CXS A;  4OLL A;  1MK4 A;  4KS9 A;  4LUA A;  3SHP A;  1IB1 E;  2ZXV A;  4C7H A;  3PZJ A;  4AVB A;  4HNW B;  2J8R A;  4FD5 A;  3T90 A;  4B12 A;  4BMH A;  2VEZ A;  2R1I A;  1YLE A;  4F6A A;  1ZO0 A;  3P2F A;  3JUW A;  1XF8 A;  4A2Z A;  2Z3K A;  2PR1 A;  1S7L A;  3TFY A;  1B87 A;  5BWA B;  2OZH A;  2WUU A;  2B3U A;  5F47 A;  1YRE A;  5KTD A;  2YNC A;  4LX9 A;  3LOD A;  5JQ4 A;  1IYK A;  2EUI A;  2Q4V A;  2ZW4 A;  1Y9W A;  1M4G A;  4CYO A;  4FD4 A;  4OAD A;  2DPT A;  3TOA A;  2YGW A;  5GCN A;  3WR7 A;  3TO6 A;  1B6B A;  2VZY A;  1XIX A;  4II9 A;  2PSW A;  3CXQ A;  4MFQ A;  5HH1 A;  2GIV A;  2B4B A;  4J3G A;  2FIA A;  1NE9 A;  3H5Z A;  3P2H A;  3C26 A;  2AE6 A;  4A30 A;  3TE4 A;  3FB3 A;  1TIQ A;  4BBH A;  1MJ9 A;  4MBU A;  2OU2 A;  4B14 A;  3ZJ0 A;  1CM0 A;  4B10 A;  4KOS A;  1RO5 A;  4CGN A;  1QST A;  1I21 A;  3EY5 A;  4UWJ A;  2OZU A;  4MI4 A;  4CGP A;  1QSO A;  5JPH A;  2ARH A;  1GHE A;  1NSL A;  3KKW A;  1KZF A;  2VZZ A;  2R8V A;  2FL4 A;  4QC6 A;  1N71 A;  2HQY A;  3VWE A;  2J8N A;  3FNC A;  4HNY B;  4CGO A;  5EBV A;  1S7F A;  4R87 A;  1P0H A;  1M4I A;  1UFH A;  4A31 A;  3EXN A;  3JVN A;  2O28 A;  4UFW A;  1XE4 A;  4KOW A;  3W91 A;  5G21 A;  2CY2 A;  3RYO A;  4GS4 A;  4DNC A;  1Q2C A;  2B4D A;  4AVC A;  2PRB A;  4KOT A;  4CGM A;  1VHS A;  1LRZ A;  4MFL A;  4MFP A;  3VWD A;  4Y49 B;  4MFZ A;  2PQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...