3JVNA

Crystal structure of the acetyltransferase vf_1542 from vibrio fischeri, northeast structural genomics consortium target vfr136
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
134
structure length
122
Chain Sequence
PVIRRAKEIDLYCLNSLMYKLHDEHHQQCPDEKSIARYLDDPECMVYVAEMDDVIIGFITGHFCELISTVSKLVMMATIDELYIEKEYRREGVAEQLMMRIEQELKDYGVKEIFVEVWNKGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase
publication title Northeast Structural Genomics Consortium Target VfR136
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 26
structure length 122
sequence length 134
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3jvnA00
1K4JA 2PRBA 2Q04A 3G3SA 4UWIA 4NXYA 4KUBA 2B3UA 3TE4A 2AJ6A 2VQYA 2VBQA 2JDDA 2ATRA 1QSNA 1CJWA 1BO4A 1QSMA 2Q44A 3JVNA 4CAWA 1S7KA 3PZJA 3KKWA 3SXOA 4KLVA 2Q0YA 4M85A 4L89A 2QECA 3VWDA 3D3SA 1MJ9A 3TO9A 4Y49C 3TO7A 3DR8A 2Q7BA 2NMTA 3TT2A 4QBJA 1Z9UA 3LD2A 5C88A 5EC4A 5F47A 2OZGA 2X7BA 2I00A 3FBUA 1VHSA 2FCKA 1NE9A 3LODA 2FIAA 2CNSA 3W6SA 3CXQA 1YVKA 2JDCA 3ZZIA 4KOUA 2ZW4A 4AG9A 3D2PA 2CY2A 2B5GA 3K9UA 1QSTA 2H5MA 5IX3A 1FY7A 4XNHC 2Z11A 2OU2A 2A4NA 1R57A 2R98A 3CXPA 4K30A 4PK3A 1PU9A 2C27A 2J8MA 2GANA 3N7ZA 3D2MA 1WWZA 3R9EA 4R3KA 4H6UA 1IB1E 2VXKA 3I9SA 1NMTA 4JD6A 4MY0A 3EC4A 1KUXA 2R8VA 3S6FA 3TFYA 4E8OA 4GS4A 5H86A 1QSRA 5F46A 1KUVA 2REFA 1Z4EA 5KTAA 2JEVA 2PQ8A 4LUAA 4E0AA 5ISVA 3F8KA 2JLMA 4MI4A 2G3TA 4NEXA 4XPLA 2B4DB 1IYKA 2J8RA 4KLWA 3ZJ0A 2P6FA 2CNTA 3CXSA 4UWJA 4JXQA 1V0CA 2EUIA 4KOTA 4AB7A 4KOSA 1YVOA 4HKFA 4YGOA 1S3ZA 2DXQA 2KCWA 1LRZA 2PDOA 4KZTA 3TCVA 3FRMA 4QB9A 4MHDA 2VI7A 3FNCA 1XE4A 3DDDA 1NSLA 4KOWA 3RYOA 5J8FA 2Q4YA 4F0YA 4KOXA 2Z0ZA 3W6XA 1MJBA 3R9FA 4XPDB 3W91A 3DNSA 1M4GA 4NF1A 2BL1A 3P2HA 4U9ZA 2BSWA 4RS2A 1YREA 2B4DA 3MGDA 2FIWA 4JWPA 1XMTA 3T90A 3B8GA 4MY3A 4CS0B 3FXTA 4ORFA 2GIVA 4E2AA 3F5BA 3UY5A 1YGHA 1OZPA 1I12A 2P0WA 1BOBA 4U9YA 1MJAA 4NCZA 4QUSA 1YK3A 3BJ7A 1I21A 3F0AA 3GKRA 4R87A 3SHPA 2Z10A 2ZW6A 5H84A 1UFHA 3EY5A 4AG7A 2ZW7A 2P6EA 4PV6A 3G8WA 3P2FA 4PSWA 1U6MA 1M1DA 4JLYA 3EO4A 5HMNA 2D4OA 2FS5A 4X5KA 4DNCA 2B58A 2D4PA 4NSQA 5JQ4A 4OLLA 5EBVA 5CNPA 2PC1A 4FD4A 4JXRA 5FVJA 2ZPAA 1Q2CA 3EXNA 5IB0A 4FD7A 2CNMA 3TOAA 2K5TA 4KVME 3GYAA 5F48A 3EFAA 2G3AA 4FD6A 2I79A 3H4QA 4H6ZA 3QAHA 2PR8A 5E96A 4B5PB 1S5KA 3NE7A 1XEBA 1B6BA 4B5OA 2HUZA 4CRZB 3D8PA 4U5YA 1M4IA 1J4JA 3BJ8A 4FD5A 1TIQA 4QVTA 3V8IA 1B87A 1P4NA 2EVNA 3S6GA 4YRHA 2VZZA 1GHEA 1M4DA 3BLNA 1KZFA 4KVXA 4CRYB 2IL4A 1S7LA 1KUYA 1PUAA 4XPDC 1YR0A 3TOBA 4JJXA 4ONUA 4R9MA 1M44A 2HQYA 2VZYA 2FXFA 3I3GA 3S6KA 5IV0A 2FL4A 3SXNA 4IF5A 4ZBGA 1Q2YA 5DWNA 2WPWA 5KTDA 1YLEA 2OB0A 1P0HA 5JPHA 3R9GA 1RO5A 2RC4A 4QC6A 1IIDA 4AVBA 1ON0A 2QIRA 3T9YA 5HH1A 4B5PA 4AVAA 3C26A 4Y49B 2FSRA 2AE6A 1S60A 2Y0MA 3JUWA 4H89A 2ARHA 1N71A 2R7HA 3FYNA 1IYLA 5F49A 4LX9A 3OWCA 4L8AA 4R3LA 3PP9A 4II9A 3R1KA 2PR1A 5KTCA 4PSXA 5GCNA 3TO6A 1I1DA 2GE3A 2FE7A 2HV2A 5I0CA 4XNHB 3R96A 1S7FA 2WPXA 2REEA 1MK4A 4KOYA 1Y9KA 4KUAA 1WK4A 1Q2DA 3FIXA 1Z4RA 4I49A 2PSWA 2OZHA 3S6HA 2BUEA 4IUSA 4BMHA 1IICA 2O28A 3TTHA 2B4BA 4OADA 4HNYB 3IWGA 4F6AA 5J8CA 5DWMA 2QMLA 4KOVA 3IGRA 2FT0A 3GY9A 4MBUA 4J3GA 3DSBA 4R57A 2R1IA 2VEZA 3PGPA 4CAVA 2ZW5A 1XF8A 3WR7A 2ZXVA 2BEIA 2J8NA 1Y7RA 4PK2A 4YFJA 2F5IA 4MJ8A 1YX0A 3VWEA 3QB8A 3FB3A 5C82A 1Y9WA 2P6GA 4KVOE 4AVCA 1L0CA 1CM0A 2OZUA 1SQHA 4M3SA 4XPKA 3R95A 2G0BA 3E0KA 4CAXA 4HNWB 2Q4VA 2OH1A 4EVYA 1VKCA 4UBRA 4HNXB 4RI1A 1RXTA 3DR6A 1XIXA 4KORA 1S7NA 1QSOA 2B5GB 2B3VA 4OAEA 4UA3A
chains in the Genus database with same CATH superfamily
3TC8A 1K4JA 2PRBA 4OC3A 1F2PA 2Q04A 2YNEA 3G3SA 4UWIA 4NXYA 4KUBA 2B3UA 3TE4A 4BD9A 3H8EA 2AJ6A 2VQYA 2VBQA 4UIBA 2JDDA 3KQZA 5EMIA 2ATRA 1QSNA 4C68A 2G9DA 1CJWA 3N5FA 4A31A 1YSJA 1BO4A 1QSMA 2Q44A 1QQ9A 2V8VA 3CPAA 3JVNA 4R76A 4CAWA 4Q7AA 1CP6A 1S7KA 3PZJA 1ZLHA 3KKWA 3SXOA 3RAMA 4KLVA 2Q0YA 4RUHA 4M85A 4L89A 1IU8A 2QECA 3VWDA 4B6ZA 4A32A 3D3SA 4MXUA 4CGMA 3WC7A 2CTCA 4W9YA 1MJ9A 4MCPA 3TO9A 4Y49C 3TO7A 2EK8A 4UFVA 3DR8A 2Q7BA 2NMTA 2Z3OA 3TT2A 2PE3A 2RFHA 4QBJA 1Z9UA 3LD2A 4C2ZA 5C88A 3IC1A 5EC4A 5F47A 2OZGA 2X7BA 2I00A 3D7GA 3FBUA 3IIBA 3KR5A 4OIWA 1VHSA 5LRKA 2FCKA 3H5ZA 3HUVA 1NE9A 1TKHA 1XBUA 3LODA 3NA6A 3CPXA 2FIAA 2CNSA 4M6HA 3W6SA 2IJZA 4B11A 3CXQA 4CPAA 1YVKA 2JDCA 2PJ8A 3ZZIA 2GLJA 4UEFA 5F09A 4KOUA 4LQGA 2ZW4A 4AG9A 3D2PA 3MN8A 2CY2A 2B5GA 4B13A 1Y7EA 3K9UA 1DTDA 1QSTA 2H5MA 4A94A 5IX3A 4LQ6A 2JBJA 1FY7A 4XNHC 3B3CA 4CGNA 2QVPA 3SI2A 2Z11A 2IMOA 2OR4A 2OU2A 2A4NA 4TWEA 1R57A 2R98A 3CXPA 4K30A 4PK3A 1PU9A 3D7HA 3FEEA 4M6IA 5LYDA 2C27A 2F7VA 2J8MA 2PJAA 2PJ7A 3NH5A 4IK2A 3LWUA 4F8ZA 2GANA 3N7ZA 1X10A 2AFOA 2YNDA 3D2MA 1WWZA 4CGLA 3R9EA 4R3KA 4OC1A 4H6UA 4MCRA 1IB1E 2VXKA 3I9SA 1IY7A 3IWEA 4MMOA 1M4LA 1NMTA 4OC0A 4JD6A 3B35A 1BPMA 4MY0A 3EC4A 4C2YA 5A27A 1KUXA 4YWYA 3S9LA 2R8VA 1LAMA 3S6FA 4IAVA 2CXAA 4E8OA 3TFYA 3NFZA 4GS4A 2F8HA 1BLLE 1QSRA 2PJBA 5H86A 4CYNA 3GB0A 4JYWA 5F46A 1KUVA 2EWBA 2REFA 4HPSA 2O4HA 4NJQA 1Z4EA 5JM6A 3SJFA 1Z8WA 1RTQA 2YNCA 2Q43A 5KTAA 2JEVA 1XFOA 2PQ8A 4LUAA 4P4FA 5K8OA 3A9LA 4E0AA 5ISVA 3F8KA 3IJ3A 2JLMA 4MI4A 4BBHA 2ZEGA 2G3TA 3B7IA 2J9AA 1Y0YA 4NEXA 3NH4A 4XPLA 5G22A 2B4DB 1IYKA 2J8RA 4KLWA 3ZJ0A 3PFEA 2P6FA 5THWA 1F57A 1X12A 2CNTA 3KHZA 3CXSA 4UWJA 3KL9A 4JXQA 3S9NA 4P4EA 1V0CA 2EUIA 4KOTA 4Q38A 4OC2A 4A30A 3PB6X 1Z8XA 2XEFA 2Z3LA 5J1QA 5G1ZA 2DEAA 1JWQA 1CG2A 2PIYA 3BI1A 4KOSA 3I1UA 4P4BA 3RBUA 4AB7A 1YVOA 1ELMP 3SI0A 4HKFA 4YGOA 1S3ZA 1CPSA 2DXQA 2KCWA 1LRZA 2PDOA 4KZTA 1HDUA 4H2KA 3KI9A 3TCVA 3FRMA 3FH4A 2Z3PA 4QB9A 4B14A 2XEIA 4PQAA 4MHDA 6CPAA 2VI7A 3FNCA 4CAEA 5G21A 5JH9A 1XE4A 1EE3P 2IQ6A 3DDDA 1YMEA 3IU1A 3KQXA 4KOWA 4R6TA 1NSLA 3WT4A 1ZG8A 1IOFA 3NH8A 2EBJA 3RYOA 5J8FA 2Q4YA 4OC5A 4F0YA 4KOXA 2Z0ZA 2V8HA 3W6XA 2C1CA 4NGQA 2ZELA 1MJBA 2ZOFA 3R9FA 4DYOA 2FVGA 1A2ZA 2V8DA 2WYRA 4O23A 4XPDB 3W91A 3DNSA 3WC6A 4A2ZA 1M4GA 4NF1A 1XMBA 2BL1A 2CTBA 1CP7A 5I4MA 4WJBA 3P2HA 4U9ZA 4WWVA 4JZ0A 2BSWA 2Q4ZA 4ONWA 3VARA 1LCPA 4RS2A 5AGEA 1YREA 2B4DA 3JTKA 3MGDA 5K8PA 2FIWA 4JWPA 1XMTA 3T90A 3V38A 4ZI6A 5HVGA 2BO9A 2V8GA 5IB9A 4X2TA 3H8GA 4NGRA 2AFWA 2YNCC 3B8GA 4MFQA 4MY3A 1ARLA 4MHYA 4UFWA 2ZEDA 4NGTA 4PPZA 4CS0B 3FXTA 1H8LA 2GIVA 1YQEA 4ORFA 2C6GA 3F5BA 4E2AA 2PJ2A 1VHOA 2DPSA 4UIAA 3UY5A 1YGHA 7CPAA 4F0XA 1OZPA 1TKFA 1Z8TA 1I12A 2P0WA 3D7DA 2ANPA 1BOBA 4U9YA 4A38A 4MHNA 1MJAA 4NCZA 2PRQA 4QUSA 1YK3A 4FBEA 4R7MA 2EO8A 2DF5A 2AFXA 3B3SA 1R3NA 2JEWA 3BJ7A 1TXRA 1PCAA 1I21A 3F0AA 4C2XA 5LYFA 5HXDA 3GKRA 4R87A 2AFUA 3SHPA 4MFKA 2Z10A 2O53A 2BOAA 2ZW6A 5H84A 1UFHA 3EY5A 4MFLA 4AG7A 3SJXA 2ZW7A 2P6EA 2Q51A 4PV6A 3G8WA 4TNUA 3P2FA 4PSWA 5HVHA 3IWWA 1U6MA 3IU2A 4GXHA 5AG4A 1HEEA 1M1DA 4JLYA 3CZXA 3EO4A 3L2NA 5CPAA 5HMNA 2D4OA 2FS5A 4X5KA 2I3CA 4DNCA 1F2OA 4P44A 2B58A 2D4PA 4NSQA 2ZOGA 4UCMA 3FEDA 5JQ4A 2GREA 4OLLA 2Z3MA 5EBVA 3FECA 5CNPA 2PC1A 4MCSA 4FD4A 4B12A 4JXRA 1XRYA 3HLPA 4UF4A 1CBXA 3B3TA 3BI0A 4AXVA 5FVJA 5LRJA 1YW4A 4CYOA 2ZPAA 1Q2CA 3EXNA 4P4DA 1IGBA 4PXCA 4MHZA 4UCNA 5IB0A 3JRUA 1VHEA 4FD7A 2CNMA 2PJCA 3TOAA 3FMCA 2K5TA 3H8FA 4KVME 3GYAA 1TKJA 3KHXA 5F48A 4C7IA 3EFAA 4NJRA 3LACA 3WABA 3PFOA 4A33A 3FX6A 2G3AA 4FD6A 2I79A 3H4QA 4EWTA 4H6ZA 3BXMA 2JBKA 4C7HA 1ARMA 3QAHA 2GLFA 2PR8A 3DLJA 3PB4X 3KASA 1S5KA 5E96A 4B5PB 4CGOA 3NE7A 1XEBA 1B6BA 1XJOA 2PJ3A 5AG5A 4PXEA 4B5OA 4A37A 4EMEA 4ZYQA 2HUZA 2AFZA 2WUUA 4CRZB 8CPAA 3D8PA 2GFQA 4U5YA 1GYTA 3PBEA 1M4IA 4UEZA 3SI1A 3GUXA 1J4JA 3BJ8A 3CDXA 3KR4A 2ODFA 4KSFA 4FD5A 1TIQA 4QVTA 3V8IA 2PJ6A 4UFXA 1B87A 1P4NA 2EK9A 2EVNA 4ZY2A 4YRHA 3S6GA 1Z5RA 2VZZA 3QAYA 1GHEA 1M4DA 2Z3NA 3BLNA 3LMSA 1KZFA 4KVXA 4CRYB 2CIJA 2IL4A 4B10A 1S7LA 2PJ0A 4PXBA 4KSAA 5A28A 4OIDA 5DS0A 2AFMA 2PVWA 2DPTA 1KUYA 3IFEA 1PUAA 4XPDC 1YR0A 3TOBA 4JJXA 4ONUA 4R9MA 4DJLA 1M44A 4A95A 2HQYA 2VZYA 1AYEA 2FXFA 3I3GA 5BWAB 5LYIA 4A39A 4M6GA 3S6KA 5IV0A 3PBBA 2FL4A 4MFPA 3ISXA 3SXNA 2OOTA 3D4UA 3BHXA 4IF5A 4ZBGA 1Q2YA 3PB9X 1LAPA 4PXDA 4Z65A 5DWNA 2WPWA 5KTDA 1TF8A 2OB0A 1YLEA 1P0HA 1BPNA 2POKA 5JPHA 5LRGA 2WSAA 3R9GA 1RO5A 1DE4C 1AUGA 4G1PA 3T8WA 2QYVA 2RC4A 4QC6A 4ZX9A 1OBRA 4UCPA 2QJ8A 1IIDA 2ZEPA 4AVBA 1TF9A 1ZLIA 1BAVA 1ON0A 4RN7A 2QIRA 3PEIA 4P10A 3T9YA 4FAIA 3RZAA 5HH1A 4B5PA 1IOIA 4AVAA 3C26A 4FWUA 1CX8A 3B3WA 4Y49B 3VH9A 4OC4A 2FSRA 2AE6A 1Z2LA 1S60A 3NE8A 4CYPA 2Y0MA 3JUWA 4H89A 4DUKA 2YGWA 4MFZA 2PCUA 2ARHA 2V77A 1N71A 2R7HA 3FYNA 1IYLA 1YW6A 2ZEFA 3KGQA 3RO0A 3VATA 5F49A 1PYTB 5HVFA 3RNZA 2ZENA 2HB6A 2ABZA 5AG7A 1JQGA 4LX9A 1ZO0A 3OWCA 4L8AA 4R3LA 4OMEA 3PP9A 1LOKA 3B3VA 3PB8X 4II9A 3R1KA 4F9UA 2PR1A 5KTCA 4PSXA 3D7FA 3FVLA 2PJ1A 1VIXA 1UWYA 3K2KA 5GCNA 4X3RA 4KSIA 3TO6A 1I1DA 2GE3A 4X8IA 1LFWA 3FF3A 2FE7A 2HV2A 4KS9A 5I0CA 4XNHB 3R96A 1R43A 4NGSA 1CPXA 1S7FA 2WPXA 2REEA 1ZG9A 2NYQA 1MK4A 4KOYA 4NFRA 1Y9KA 4KUAA 4ZGYB 1WK4A 1Q2DA 3FIXA 1Z4RA 4I49A 5K8MA 2PSWA 4ZY1A 2OZHA 3S6HA 2BUEA 4IUSA 4BMHA 4CYQA 2VL1A 1IICA 2C6PA 2O28A 4OP4A 3TTHA 2B4BA 1FNOA 5CBMA 3GIUA 4OADA 5AG6A 4BINA 4HNYB 4EFDA 4MRIA 4IHMA 3IWGA 4F6AA 5J8CA 1YLOA 4K3NA 4MCQA 2QMLA 4KOVA 2GU2A 5DWMA 1ZG7A 3IGRA 2FT0A 2PIZA 3GY9A 2CF4A 3IEHA 3QNVA 4MBUA 4J3GA 3DSBA 4OKOA 5ELYA 4R57A 2R1IA 4GM5A 5JGFA 3D68A 5D29A 2WZNA 5LYLA 2VEZA 3PGPA 3K9TA 4CAVA 1FT7A 3S9MA 2ZW5A 1XF8A 3WR7A 2ZXVA 4CAFA 2BEIA 2HC9A 2J8NA 1KWMA 1Y7RA 2PJ5A 1HDQA 2PJ9A 2PVVA 2RB7A 1AMPA 2ZEEA 3ISZA 4MFJA 1Q7LA 4NGPA 4NGNA 4PK2A 3TX8A 5D8NA 3IO1A 4YFJA 2NSMA 1LANA 3B2YA 3PRTA 1ELLP 4Q36A 1NSAA 2F5IA 1Z8LA 1YX0A 3D67A 4MJ8A 4P4JA 3VWEA 2PJ4A 3QB8A 3FB3A 4F9VA 5C82A 1Y9WA 3V7ZA 2P6GA 4P4IA 4KVOE 4AVCA 1L0CA 1Y0RA 3KZWA 1CM0A 2OZUA 2ZEMA 4P45A 2BCOA 4YU9A 2ZEOA 3DGVA 1VGYA 5G20A 3WC5A 1XOVA 1SQHA 3PB7X 4M3SA 4XPKA 3R95A 2G0BA 3E0KA 4P6YA 4CGPA 4CAXA 2Z3KA 3MRUA 2XEGA 2Q4VA 2OH1A 2AFSA 4HNWB 4MHPA 1VKCA 3SJGA 2ZEHA 4UBRA 4EVYA 2XEJA 4NGMA 4HNXB 2C6CA 4RI1A 4ZX8A 4FUUA 1RXTA 3DR6A 1XIXA 3FJUA 4ZY0A 3GLJA 4KORA 1S7NA 2Q7SA 1QMUA 1QSOA 4R8FA 4UEEA 2B5GB 2B3VA 3CT9A 3D66A 4OAEA 5K8NA 3SJEA 4UA3A
chains in the Genus database with same CATH topology
1K4JA 2PRBA 2Q04A 2YNEA 3G3SA 4UWIA 4NXYA 4KUBA 2B3UA 3TE4A 2AJ6A 2VQYA 2VBQA 2JDDA 2ATRA 1QSNA 4C68A 1CJWA 4A31A 1BO4A 1QSMA 2Q44A 3JVNA 4CAWA 1S7KA 3PZJA 3KKWA 3SXOA 4KLVA 2Q0YA 4M85A 4L89A 2QECA 3VWDA 4A32A 3D3SA 4CGMA 1MJ9A 3TO9A 4Y49C 3TO7A 4UFVA 3DR8A 2Q7BA 2NMTA 2Z3OA 3TT2A 4QBJA 1Z9UA 3LD2A 4C2ZA 5C88A 5EC4A 5F47A 2OZGA 2X7BA 2I00A 3FBUA 1VHSA 2FCKA 3H5ZA 1NE9A 3LODA 2FIAA 2CNSA 3W6SA 4B11A 3CXQA 1YVKA 2JDCA 3ZZIA 4KOUA 2ZW4A 4AG9A 3D2PA 2CY2A 2B5GA 4B13A 3K9UA 1QSTA 2H5MA 5IX3A 1FY7A 4XNHC 4CGNA 2Z11A 2OU2A 2A4NA 1R57A 3CXPA 2R98A 4K30A 4PK3A 1PU9A 2C27A 2J8MA 2GANA 3N7ZA 2YNDA 3D2MA 1WWZA 4CGLA 3R9EA 4R3KA 4H6UA 1IB1E 2VXKA 3I9SA 3IWEA 1NMTA 4JD6A 4MY0A 3EC4A 4C2YA 5A27A 1KUXA 2R8VA 3S6FA 3TFYA 2CXAA 4E8OA 4GS4A 5H86A 1QSRA 4CYNA 5F46A 1KUVA 2REFA 1Z4EA 2YNCA 5KTAA 2JEVA 2PQ8A 4LUAA 3A9LA 4E0AA 5ISVA 3F8KA 2JLMA 4MI4A 4BBHA 2G3TA 4NEXA 4XPLA 5G22A 2B4DB 1IYKA 2J8RA 4KLWA 3ZJ0A 2P6FA 2CNTA 3CXSA 4UWJA 4JXQA 1V0CA 2EUIA 4KOTA 4Q38A 4A30A 2Z3LA 5G1ZA 4AB7A 4KOSA 1YVOA 4HKFA 4YGOA 1S3ZA 2DXQA 2KCWA 1LRZA 2PDOA 4KZTA 3TCVA 3FRMA 2Z3PA 4QB9A 4B14A 4MHDA 2VI7A 3FNCA 4CAEA 5G21A 1XE4A 3DDDA 3IU1A 1NSLA 4KOWA 3RYOA 5J8FA 2Q4YA 4F0YA 4KOXA 2Z0ZA 3W6XA 1MJBA 3R9FA 4XPDB 3W91A 3DNSA 4A2ZA 1M4GA 4NF1A 2BL1A 3P2HA 4U9ZA 2BSWA 4RS2A 5AGEA 1YREA 2B4DA 3JTKA 3MGDA 2FIWA 4JWPA 1XMTA 3T90A 2YNCC 3B8GA 4MFQA 4MY3A 4UFWA 4CS0B 3FXTA 4ORFA 2GIVA 4E2AA 3F5BA 2DPSA 3UY5A 1YGHA 4F0XA 1OZPA 1I12A 2P0WA 1BOBA 4U9YA 1MJAA 4NCZA 4QUSA 1YK3A 3BJ7A 1I21A 3F0AA 4C2XA 3GKRA 4R87A 3SHPA 4MFKA 2Z10A 2ZW6A 5H84A 1UFHA 3EY5A 4MFLA 4AG7A 2ZW7A 2P6EA 4PV6A 3G8WA 3P2FA 4PSWA 1U6MA 3IU2A 5AG4A 1M1DA 4JLYA 3EO4A 5HMNA 2D4OA 2FS5A 4X5KA 4DNCA 2B58A 2D4PA 4NSQA 4UCMA 5JQ4A 4OLLA 2Z3MA 5EBVA 5CNPA 2PC1A 4FD4A 4B12A 4JXRA 5FVJA 4CYOA 2ZPAA 1Q2CA 3EXNA 4UCNA 5IB0A 4FD7A 2CNMA 3TOAA 2K5TA 4KVME 3GYAA 5F48A 4C7IA 3EFAA 4A33A 2G3AA 4FD6A 2I79A 3H4QA 4H6ZA 4C7HA 3QAHA 2PR8A 4CGOA 5E96A 4B5PB 1S5KA 3NE7A 1XEBA 1B6BA 5AG5A 4B5OA 2HUZA 2WUUA 4CRZB 3D8PA 4U5YA 1M4IA 1J4JA 3BJ8A 4KSFA 4FD5A 1TIQA 4QVTA 3V8IA 4UFXA 1B87A 1P4NA 2EVNA 3S6GA 4YRHA 2VZZA 1GHEA 1M4DA 2Z3NA 3BLNA 1KZFA 4KVXA 4CRYB 2IL4A 4B10A 1S7LA 4KSAA 5A28A 2DPTA 1KUYA 1PUAA 4XPDC 1YR0A 3TOBA 4JJXA 4ONUA 4R9MA 1M44A 4A95A 2HQYA 2VZYA 2FXFA 3I3GA 5BWAB 3S6KA 5IV0A 2FL4A 4MFPA 3SXNA 4IF5A 4ZBGA 1Q2YA 5DWNA 2WPWA 5KTDA 1YLEA 2OB0A 1P0HA 5JPHA 2WSAA 3R9GA 1RO5A 2RC4A 4QC6A 4UCPA 1IIDA 4AVBA 1ON0A 2QIRA 3T9YA 5HH1A 4B5PA 4AVAA 3C26A 4Y49B 2FSRA 2AE6A 1S60A 4CYPA 2Y0MA 3JUWA 4H89A 2YGWA 4MFZA 2ARHA 1N71A 2R7HA 3FYNA 1IYLA 5F49A 5AG7A 4LX9A 1ZO0A 3OWCA 4L8AA 4R3LA 3PP9A 4II9A 3R1KA 2PR1A 5KTCA 4PSXA 5GCNA 3TO6A 1I1DA 2GE3A 2FE7A 2HV2A 4KS9A 5I0CA 4XNHB 3R96A 1S7FA 2WPXA 2REEA 1MK4A 4KOYA 1Y9KA 4KUAA 4ZGYB 1WK4A 1Q2DA 3FIXA 1Z4RA 4I49A 2PSWA 2OZHA 3S6HA 2BUEA 4IUSA 4BMHA 4CYQA 1IICA 2O28A 3TTHA 2B4BA 4OADA 5AG6A 4HNYB 3IWGA 4F6AA 5J8CA 5DWMA 2QMLA 4KOVA 3IGRA 2FT0A 3GY9A 4MBUA 4J3GA 3DSBA 4R57A 2R1IA 2VEZA 3PGPA 4CAVA 2ZW5A 1XF8A 3WR7A 2ZXVA 4CAFA 2BEIA 2J8NA 1Y7RA 4MFJA 4PK2A 4YFJA 4Q36A 2F5IA 4MJ8A 1YX0A 3VWEA 3QB8A 3FB3A 5C82A 1Y9WA 2P6GA 4KVOE 4AVCA 1L0CA 1CM0A 2OZUA 5G20A 1SQHA 4M3SA 4XPKA 3R95A 2G0BA 3E0KA 4CGPA 4CAXA 2Z3KA 4HNWB 2Q4VA 2OH1A 4EVYA 1VKCA 4UBRA 4HNXB 4RI1A 1RXTA 3DR6A 1XIXA 4KORA 1S7NA 1QSOA 2B5GB 2B3VA 4OAEA 4UA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4J A;  2PRB A;  2Q04 A;  3G3S A;  4UWI A;  4NXY A;  4KUB A;  2B3U A;  3TE4 A;  2AJ6 A;  2VQY A;  2VBQ A;  2JDD A;  2ATR A;  1QSN A;  1CJW A;  1BO4 A;  1QSM A;  2Q44 A;  3JVN A;  4CAW A;  1S7K A;  3PZJ A;  3KKW A;  3SXO A;  4KLV A;  2Q0Y A;  4M85 A;  4L89 A;  2QEC A;  3VWD A;  3D3S A;  1MJ9 A;  3TO9 A;  4Y49 C;  3TO7 A;  3DR8 A;  2Q7B A;  2NMT A;  3TT2 A;  4QBJ A;  1Z9U A;  3LD2 A;  5C88 A;  5EC4 A;  5F47 A;  2OZG A;  2X7B A;  2I00 A;  3FBU A;  1VHS A;  2FCK A;  1NE9 A;  3LOD A;  2FIA A;  2CNS A;  3W6S A;  3CXQ A;  1YVK A;  2JDC A;  3ZZI A;  4KOU A;  2ZW4 A;  4AG9 A;  3D2P A;  2CY2 A;  2B5G A;  3K9U A;  1QST A;  2H5M A;  5IX3 A;  1FY7 A;  4XNH C;  2Z11 A;  2OU2 A;  2A4N A;  1R57 A;  2R98 A;  3CXP A;  4K30 A;  4PK3 A;  1PU9 A;  2C27 A;  2J8M A;  2GAN A;  3N7Z A;  3D2M A;  1WWZ A;  3R9E A;  4R3K A;  4H6U A;  1IB1 E;  2VXK A;  3I9S A;  1NMT A;  4JD6 A;  4MY0 A;  3EC4 A;  1KUX A;  2R8V A;  3S6F A;  3TFY A;  4E8O A;  4GS4 A;  5H86 A;  1QSR A;  5F46 A;  1KUV A;  2REF A;  1Z4E A;  5KTA A;  2JEV A;  2PQ8 A;  4LUA A;  4E0A A;  5ISV A;  3F8K A;  2JLM A;  4MI4 A;  2G3T A;  4NEX A;  4XPL A;  2B4D B;  1IYK A;  2J8R A;  4KLW A;  3ZJ0 A;  2P6F A;  2CNT A;  3CXS A;  4UWJ A;  4JXQ A;  1V0C A;  2EUI A;  4KOT A;  4AB7 A;  4KOS A;  1YVO A;  4HKF A;  4YGO A;  1S3Z A;  2DXQ A;  2KCW A;  1LRZ A;  2PDO A;  4KZT A;  3TCV A;  3FRM A;  4QB9 A;  4MHD A;  2VI7 A;  3FNC A;  1XE4 A;  3DDD A;  1NSL A;  4KOW A;  3RYO A;  5J8F A;  2Q4Y A;  4F0Y A;  4KOX A;  2Z0Z A;  3W6X A;  1MJB A;  3R9F A;  4XPD B;  3W91 A;  3DNS A;  1M4G A;  4NF1 A;  2BL1 A;  3P2H A;  4U9Z A;  2BSW A;  4RS2 A;  1YRE A;  2B4D A;  3MGD A;  2FIW A;  4JWP A;  1XMT A;  3T90 A;  3B8G A;  4MY3 A;  4CS0 B;  3FXT A;  4ORF A;  2GIV A;  4E2A A;  3F5B A;  3UY5 A;  1YGH A;  1OZP A;  1I12 A;  2P0W A;  1BOB A;  4U9Y A;  1MJA A;  4NCZ A;  4QUS A;  1YK3 A;  3BJ7 A;  1I21 A;  3F0A A;  3GKR A;  4R87 A;  3SHP A;  2Z10 A;  2ZW6 A;  5H84 A;  1UFH A;  3EY5 A;  4AG7 A;  2ZW7 A;  2P6E A;  4PV6 A;  3G8W A;  3P2F A;  4PSW A;  1U6M A;  1M1D A;  4JLY A;  3EO4 A;  5HMN A;  2D4O A;  2FS5 A;  4X5K A;  4DNC A;  2B58 A;  2D4P A;  4NSQ A;  5JQ4 A;  4OLL A;  5EBV A;  5CNP A;  2PC1 A;  4FD4 A;  4JXR A;  5FVJ A;  2ZPA A;  1Q2C A;  3EXN A;  5IB0 A;  4FD7 A;  2CNM A;  3TOA A;  2K5T A;  4KVM E;  3GYA A;  5F48 A;  3EFA A;  2G3A A;  4FD6 A;  2I79 A;  3H4Q A;  4H6Z A;  3QAH A;  2PR8 A;  5E96 A;  4B5P B;  1S5K A;  3NE7 A;  1XEB A;  1B6B A;  4B5O A;  2HUZ A;  4CRZ B;  3D8P A;  4U5Y A;  1M4I A;  1J4J A;  3BJ8 A;  4FD5 A;  1TIQ A;  4QVT A;  3V8I A;  1B87 A;  1P4N A;  2EVN A;  3S6G A;  4YRH A;  2VZZ A;  1GHE A;  1M4D A;  3BLN A;  1KZF A;  4KVX A;  4CRY B;  2IL4 A;  1S7L A;  1KUY A;  1PUA A;  4XPD C;  1YR0 A;  3TOB A;  4JJX A;  4ONU A;  4R9M A;  1M44 A;  2HQY A;  2VZY A;  2FXF A;  3I3G A;  3S6K A;  5IV0 A;  2FL4 A;  3SXN A;  4IF5 A;  4ZBG A;  1Q2Y A;  5DWN A;  2WPW A;  5KTD A;  1YLE A;  2OB0 A;  1P0H A;  5JPH A;  3R9G A;  1RO5 A;  2RC4 A;  4QC6 A;  1IID A;  4AVB A;  1ON0 A;  2QIR A;  3T9Y A;  5HH1 A;  4B5P A;  4AVA A;  3C26 A;  4Y49 B;  2FSR A;  2AE6 A;  1S60 A;  2Y0M A;  3JUW A;  4H89 A;  2ARH A;  1N71 A;  2R7H A;  3FYN A;  1IYL A;  5F49 A;  4LX9 A;  3OWC A;  4L8A A;  4R3L A;  3PP9 A;  4II9 A;  3R1K A;  2PR1 A;  5KTC A;  4PSX A;  5GCN A;  3TO6 A;  1I1D A;  2GE3 A;  2FE7 A;  2HV2 A;  5I0C A;  4XNH B;  3R96 A;  1S7F A;  2WPX A;  2REE A;  1MK4 A;  4KOY A;  1Y9K A;  4KUA A;  1WK4 A;  1Q2D A;  3FIX A;  1Z4R A;  4I49 A;  2PSW A;  2OZH A;  3S6H A;  2BUE A;  4IUS A;  4BMH A;  1IIC A;  2O28 A;  3TTH A;  2B4B A;  4OAD A;  4HNY B;  3IWG A;  4F6A A;  5J8C A;  5DWM A;  2QML A;  4KOV A;  3IGR A;  2FT0 A;  3GY9 A;  4MBU A;  4J3G A;  3DSB A;  4R57 A;  2R1I A;  2VEZ A;  3PGP A;  4CAV A;  2ZW5 A;  1XF8 A;  3WR7 A;  2ZXV A;  2BEI A;  2J8N A;  1Y7R A;  4PK2 A;  4YFJ A;  2F5I A;  4MJ8 A;  1YX0 A;  3VWE A;  3QB8 A;  3FB3 A;  5C82 A;  1Y9W A;  2P6G A;  4KVO E;  4AVC A;  1L0C A;  1CM0 A;  2OZU A;  1SQH A;  4M3S A;  4XPK A;  3R95 A;  2G0B A;  3E0K A;  4CAX A;  4HNW B;  2Q4V A;  2OH1 A;  4EVY A;  1VKC A;  4UBR A;  4HNX B;  4RI1 A;  1RXT A;  3DR6 A;  1XIX A;  4KOR A;  1S7N A;  1QSO A;  2B5G B;  2B3V A;  4OAE A;  4UA3 A; 
#chains in the Genus database with same CATH topology
 3TC8 A;  1K4J A;  2PRB A;  4OC3 A;  1F2P A;  2Q04 A;  2YNE A;  3G3S A;  4UWI A;  4NXY A;  4KUB A;  2B3U A;  3TE4 A;  4BD9 A;  3H8E A;  2AJ6 A;  2VQY A;  2VBQ A;  4UIB A;  2JDD A;  3KQZ A;  5EMI A;  2ATR A;  1QSN A;  4C68 A;  2G9D A;  1CJW A;  3N5F A;  4A31 A;  1YSJ A;  1BO4 A;  1QSM A;  2Q44 A;  1QQ9 A;  2V8V A;  3CPA A;  3JVN A;  4R76 A;  4CAW A;  4Q7A A;  1CP6 A;  1S7K A;  3PZJ A;  1ZLH A;  3KKW A;  3SXO A;  3RAM A;  4KLV A;  2Q0Y A;  4RUH A;  4M85 A;  4L89 A;  1IU8 A;  2QEC A;  3VWD A;  4B6Z A;  4A32 A;  3D3S A;  4MXU A;  4CGM A;  3WC7 A;  2CTC A;  4W9Y A;  1MJ9 A;  4MCP A;  3TO9 A;  4Y49 C;  3TO7 A;  2EK8 A;  4UFV A;  3DR8 A;  2Q7B A;  2NMT A;  2Z3O A;  3TT2 A;  2PE3 A;  2RFH A;  4QBJ A;  1Z9U A;  3LD2 A;  4C2Z A;  5C88 A;  3IC1 A;  5EC4 A;  5F47 A;  2OZG A;  2X7B A;  2I00 A;  3D7G A;  3FBU A;  3IIB A;  3KR5 A;  4OIW A;  1VHS A;  5LRK A;  2FCK A;  3H5Z A;  3HUV A;  1NE9 A;  1TKH A;  1XBU A;  3LOD A;  3NA6 A;  3CPX A;  2FIA A;  2CNS A;  4M6H A;  3W6S A;  2IJZ A;  4B11 A;  3CXQ A;  4CPA A;  1YVK A;  2JDC A;  2PJ8 A;  3ZZI A;  2GLJ A;  4UEF A;  5F09 A;  4KOU A;  4LQG A;  2ZW4 A;  4AG9 A;  3D2P A;  3MN8 A;  2CY2 A;  2B5G A;  4B13 A;  1Y7E A;  3K9U A;  1DTD A;  1QST A;  2H5M A;  4A94 A;  5IX3 A;  4LQ6 A;  2JBJ A;  1FY7 A;  4XNH C;  3B3C A;  4CGN A;  2QVP A;  3SI2 A;  2Z11 A;  2IMO A;  2OR4 A;  2OU2 A;  2A4N A;  4TWE A;  1R57 A;  2R98 A;  3CXP A;  4K30 A;  4PK3 A;  1PU9 A;  3D7H A;  3FEE A;  4M6I A;  5LYD A;  2C27 A;  2F7V A;  2J8M A;  2PJA A;  2PJ7 A;  3NH5 A;  4IK2 A;  3LWU A;  4F8Z A;  2GAN A;  3N7Z A;  1X10 A;  2AFO A;  2YND A;  3D2M A;  1WWZ A;  4CGL A;  3R9E A;  4R3K A;  4OC1 A;  4H6U A;  4MCR A;  1IB1 E;  2VXK A;  3I9S A;  1IY7 A;  3IWE A;  4MMO A;  1M4L A;  1NMT A;  4OC0 A;  4JD6 A;  3B35 A;  1BPM A;  4MY0 A;  3EC4 A;  4C2Y A;  5A27 A;  1KUX A;  4YWY A;  3S9L A;  2R8V A;  1LAM A;  3S6F A;  4IAV A;  2CXA A;  4E8O A;  3TFY A;  3NFZ A;  4GS4 A;  2F8H A;  1BLL E;  1QSR A;  2PJB A;  5H86 A;  4CYN A;  3GB0 A;  4JYW A;  5F46 A;  1KUV A;  2EWB A;  2REF A;  4HPS A;  2O4H A;  4NJQ A;  1Z4E A;  5JM6 A;  3SJF A;  1Z8W A;  1RTQ A;  2YNC A;  2Q43 A;  5KTA A;  2JEV A;  1XFO A;  2PQ8 A;  4LUA A;  4P4F A;  5K8O A;  3A9L A;  4E0A A;  5ISV A;  3F8K A;  3IJ3 A;  2JLM A;  4MI4 A;  4BBH A;  2ZEG A;  2G3T A;  3B7I A;  2J9A A;  1Y0Y A;  4NEX A;  3NH4 A;  4XPL A;  5G22 A;  2B4D B;  1IYK A;  2J8R A;  4KLW A;  3ZJ0 A;  3PFE A;  2P6F A;  5THW A;  1F57 A;  1X12 A;  2CNT A;  3KHZ A;  3CXS A;  4UWJ A;  3KL9 A;  4JXQ A;  3S9N A;  4P4E A;  1V0C A;  2EUI A;  4KOT A;  4Q38 A;  4OC2 A;  4A30 A;  3PB6 X;  1Z8X A;  2XEF A;  2Z3L A;  5J1Q A;  5G1Z A;  2DEA A;  1JWQ A;  1CG2 A;  2PIY A;  3BI1 A;  4KOS A;  3I1U A;  4P4B A;  3RBU A;  4AB7 A;  1YVO A;  1ELM P;  3SI0 A;  4HKF A;  4YGO A;  1S3Z A;  1CPS A;  2DXQ A;  2KCW A;  1LRZ A;  2PDO A;  4KZT A;  1HDU A;  4H2K A;  3KI9 A;  3TCV A;  3FRM A;  3FH4 A;  2Z3P A;  4QB9 A;  4B14 A;  2XEI A;  4PQA A;  4MHD A;  6CPA A;  2VI7 A;  3FNC A;  4CAE A;  5G21 A;  5JH9 A;  1XE4 A;  1EE3 P;  2IQ6 A;  3DDD A;  1YME A;  3IU1 A;  3KQX A;  4KOW A;  4R6T A;  1NSL A;  3WT4 A;  1ZG8 A;  1IOF A;  3NH8 A;  2EBJ A;  3RYO A;  5J8F A;  2Q4Y A;  4OC5 A;  4F0Y A;  4KOX A;  2Z0Z A;  2V8H A;  3W6X A;  2C1C A;  4NGQ A;  2ZEL A;  1MJB A;  2ZOF A;  3R9F A;  4DYO A;  2FVG A;  1A2Z A;  2V8D A;  2WYR A;  4O23 A;  4XPD B;  3W91 A;  3DNS A;  3WC6 A;  4A2Z A;  1M4G A;  4NF1 A;  1XMB A;  2BL1 A;  2CTB A;  1CP7 A;  5I4M A;  4WJB A;  3P2H A;  4U9Z A;  4WWV A;  4JZ0 A;  2BSW A;  2Q4Z A;  4ONW A;  3VAR A;  1LCP A;  4RS2 A;  5AGE A;  1YRE A;  2B4D A;  3JTK A;  3MGD A;  5K8P A;  2FIW A;  4JWP A;  1XMT A;  3T90 A;  3V38 A;  4ZI6 A;  5HVG A;  2BO9 A;  2V8G A;  5IB9 A;  4X2T A;  3H8G A;  4NGR A;  2AFW A;  2YNC C;  3B8G A;  4MFQ A;  4MY3 A;  1ARL A;  4MHY A;  4UFW A;  2ZED A;  4NGT A;  4PPZ A;  4CS0 B;  3FXT A;  1H8L A;  2GIV A;  1YQE A;  4ORF A;  2C6G A;  3F5B A;  4E2A A;  2PJ2 A;  1VHO A;  2DPS A;  4UIA A;  3UY5 A;  1YGH A;  7CPA A;  4F0X A;  1OZP A;  1TKF A;  1Z8T A;  1I12 A;  2P0W A;  3D7D A;  2ANP A;  1BOB A;  4U9Y A;  4A38 A;  4MHN A;  1MJA A;  4NCZ A;  2PRQ A;  4QUS A;  1YK3 A;  4FBE A;  4R7M A;  2EO8 A;  2DF5 A;  2AFX A;  3B3S A;  1R3N A;  2JEW A;  3BJ7 A;  1TXR A;  1PCA A;  1I21 A;  3F0A A;  4C2X A;  5LYF A;  5HXD A;  3GKR A;  4R87 A;  2AFU A;  3SHP A;  4MFK A;  2Z10 A;  2O53 A;  2BOA A;  2ZW6 A;  5H84 A;  1UFH A;  3EY5 A;  4MFL A;  4AG7 A;  3SJX A;  2ZW7 A;  2P6E A;  2Q51 A;  4PV6 A;  3G8W A;  4TNU A;  3P2F A;  4PSW A;  5HVH A;  3IWW A;  1U6M A;  3IU2 A;  4GXH A;  5AG4 A;  1HEE A;  1M1D A;  4JLY A;  3CZX A;  3EO4 A;  3L2N A;  5CPA A;  5HMN A;  2D4O A;  2FS5 A;  4X5K A;  2I3C A;  4DNC A;  1F2O A;  4P44 A;  2B58 A;  2D4P A;  4NSQ A;  2ZOG A;  4UCM A;  3FED A;  5JQ4 A;  2GRE A;  4OLL A;  2Z3M A;  5EBV A;  3FEC A;  5CNP A;  2PC1 A;  4MCS A;  4FD4 A;  4B12 A;  4JXR A;  1XRY A;  3HLP A;  4UF4 A;  1CBX A;  3B3T A;  3BI0 A;  4AXV A;  5FVJ A;  5LRJ A;  1YW4 A;  4CYO A;  2ZPA A;  1Q2C A;  3EXN A;  4P4D A;  1IGB A;  4PXC A;  4MHZ A;  4UCN A;  5IB0 A;  3JRU A;  1VHE A;  4FD7 A;  2CNM A;  2PJC A;  3TOA A;  3FMC A;  2K5T A;  3H8F A;  4KVM E;  3GYA A;  1TKJ A;  3KHX A;  5F48 A;  4C7I A;  3EFA A;  4NJR A;  3LAC A;  3WAB A;  3PFO A;  4A33 A;  3FX6 A;  2G3A A;  4FD6 A;  2I79 A;  3H4Q A;  4EWT A;  4H6Z A;  3BXM A;  2JBK A;  4C7H A;  1ARM A;  3QAH A;  2GLF A;  2PR8 A;  3DLJ A;  3PB4 X;  3KAS A;  1S5K A;  5E96 A;  4B5P B;  4CGO A;  3NE7 A;  1XEB A;  1B6B A;  1XJO A;  2PJ3 A;  5AG5 A;  4PXE A;  4B5O A;  4A37 A;  4EME A;  4ZYQ A;  2HUZ A;  2AFZ A;  2WUU A;  4CRZ B;  8CPA A;  3D8P A;  2GFQ A;  4U5Y A;  1GYT A;  3PBE A;  1M4I A;  4UEZ A;  3SI1 A;  3GUX A;  1J4J A;  3BJ8 A;  3CDX A;  3KR4 A;  2ODF A;  4KSF A;  4FD5 A;  1TIQ A;  4QVT A;  3V8I A;  2PJ6 A;  4UFX A;  1B87 A;  1P4N A;  2EK9 A;  2EVN A;  4ZY2 A;  4YRH A;  3S6G A;  1Z5R A;  2VZZ A;  3QAY A;  1GHE A;  1M4D A;  2Z3N A;  3BLN A;  3LMS A;  1KZF A;  4KVX A;  4CRY B;  2CIJ A;  2IL4 A;  4B10 A;  1S7L A;  2PJ0 A;  4PXB A;  4KSA A;  5A28 A;  4OID A;  5DS0 A;  2AFM A;  2PVW A;  2DPT A;  1KUY A;  3IFE A;  1PUA A;  4XPD C;  1YR0 A;  3TOB A;  4JJX A;  4ONU A;  4R9M A;  4DJL A;  1M44 A;  4A95 A;  2HQY A;  2VZY A;  1AYE A;  2FXF A;  3I3G A;  5BWA B;  5LYI A;  4A39 A;  4M6G A;  3S6K A;  5IV0 A;  3PBB A;  2FL4 A;  4MFP A;  3ISX A;  3SXN A;  2OOT A;  3D4U A;  3BHX A;  4IF5 A;  4ZBG A;  1Q2Y A;  3PB9 X;  1LAP A;  4PXD A;  4Z65 A;  5DWN A;  2WPW A;  5KTD A;  1TF8 A;  2OB0 A;  1YLE A;  1P0H A;  1BPN A;  2POK A;  5JPH A;  5LRG A;  2WSA A;  3R9G A;  1RO5 A;  1DE4 C;  1AUG A;  4G1P A;  3T8W A;  2QYV A;  2RC4 A;  4QC6 A;  4ZX9 A;  1OBR A;  4UCP A;  2QJ8 A;  1IID A;  2ZEP A;  4AVB A;  1TF9 A;  1ZLI A;  1BAV A;  1ON0 A;  4RN7 A;  2QIR A;  3PEI A;  4P10 A;  3T9Y A;  4FAI A;  3RZA A;  5HH1 A;  4B5P A;  1IOI A;  4AVA A;  3C26 A;  4FWU A;  1CX8 A;  3B3W A;  4Y49 B;  3VH9 A;  4OC4 A;  2FSR A;  2AE6 A;  1Z2L A;  1S60 A;  3NE8 A;  4CYP A;  2Y0M A;  3JUW A;  4H89 A;  4DUK A;  2YGW A;  4MFZ A;  2PCU A;  2ARH A;  2V77 A;  1N71 A;  2R7H A;  3FYN A;  1IYL A;  1YW6 A;  2ZEF A;  3KGQ A;  3RO0 A;  3VAT A;  5F49 A;  1PYT B;  5HVF A;  3RNZ A;  2ZEN A;  2HB6 A;  2ABZ A;  5AG7 A;  1JQG A;  4LX9 A;  1ZO0 A;  3OWC A;  4L8A A;  4R3L A;  4OME A;  3PP9 A;  1LOK A;  3B3V A;  3PB8 X;  4II9 A;  3R1K A;  4F9U A;  2PR1 A;  5KTC A;  4PSX A;  3D7F A;  3FVL A;  2PJ1 A;  1VIX A;  1UWY A;  3K2K A;  5GCN A;  4X3R A;  4KSI A;  3TO6 A;  1I1D A;  2GE3 A;  4X8I A;  1LFW A;  3FF3 A;  2FE7 A;  2HV2 A;  4KS9 A;  5I0C A;  4XNH B;  3R96 A;  1R43 A;  4NGS A;  1CPX A;  1S7F A;  2WPX A;  2REE A;  1ZG9 A;  2NYQ A;  1MK4 A;  4KOY A;  4NFR A;  1Y9K A;  4KUA A;  4ZGY B;  1WK4 A;  1Q2D A;  3FIX A;  1Z4R A;  4I49 A;  5K8M A;  2PSW A;  4ZY1 A;  2OZH A;  3S6H A;  2BUE A;  4IUS A;  4BMH A;  4CYQ A;  2VL1 A;  1IIC A;  2C6P A;  2O28 A;  4OP4 A;  3TTH A;  2B4B A;  1FNO A;  5CBM A;  3GIU A;  4OAD A;  5AG6 A;  4BIN A;  4HNY B;  4EFD A;  4MRI A;  4IHM A;  3IWG A;  4F6A A;  5J8C A;  1YLO A;  4K3N A;  4MCQ A;  2QML A;  4KOV A;  2GU2 A;  5DWM A;  1ZG7 A;  3IGR A;  2FT0 A;  2PIZ A;  3GY9 A;  2CF4 A;  3IEH A;  3QNV A;  4MBU A;  4J3G A;  3DSB A;  4OKO A;  5ELY A;  4R57 A;  2R1I A;  4GM5 A;  5JGF A;  3D68 A;  5D29 A;  2WZN A;  5LYL A;  2VEZ A;  3PGP A;  3K9T A;  4CAV A;  1FT7 A;  3S9M A;  2ZW5 A;  1XF8 A;  3WR7 A;  2ZXV A;  4CAF A;  2BEI A;  2HC9 A;  2J8N A;  1KWM A;  1Y7R A;  2PJ5 A;  1HDQ A;  2PJ9 A;  2PVV A;  2RB7 A;  1AMP A;  2ZEE A;  3ISZ A;  4MFJ A;  1Q7L A;  4NGP A;  4NGN A;  4PK2 A;  3TX8 A;  5D8N A;  3IO1 A;  4YFJ A;  2NSM A;  1LAN A;  3B2Y A;  3PRT A;  1ELL P;  4Q36 A;  1NSA A;  2F5I A;  1Z8L A;  1YX0 A;  3D67 A;  4MJ8 A;  4P4J A;  3VWE A;  2PJ4 A;  3QB8 A;  3FB3 A;  4F9V A;  5C82 A;  1Y9W A;  3V7Z A;  2P6G A;  4P4I A;  4KVO E;  4AVC A;  1L0C A;  1Y0R A;  3KZW A;  1CM0 A;  2OZU A;  2ZEM A;  4P45 A;  2BCO A;  4YU9 A;  2ZEO A;  3DGV A;  1VGY A;  5G20 A;  3WC5 A;  1XOV A;  1SQH A;  3PB7 X;  4M3S A;  4XPK A;  3R95 A;  2G0B A;  3E0K A;  4P6Y A;  4CGP A;  4CAX A;  2Z3K A;  3MRU A;  2XEG A;  2Q4V A;  2OH1 A;  2AFS A;  4HNW B;  4MHP A;  1VKC A;  3SJG A;  2ZEH A;  4UBR A;  4EVY A;  2XEJ A;  4NGM A;  4HNX B;  2C6C A;  4RI1 A;  4ZX8 A;  4FUU A;  1RXT A;  3DR6 A;  1XIX A;  3FJU A;  4ZY0 A;  3GLJ A;  4KOR A;  1S7N A;  2Q7S A;  1QMU A;  1QSO A;  4R8F A;  4UEE A;  2B5G B;  2B3V A;  3CT9 A;  3D66 A;  4OAE A;  5K8N A;  3SJE A;  4UA3 A; 
#chains in the Genus database with same CATH homology
 1K4J A;  2PRB A;  2Q04 A;  2YNE A;  3G3S A;  4UWI A;  4NXY A;  4KUB A;  2B3U A;  3TE4 A;  2AJ6 A;  2VQY A;  2VBQ A;  2JDD A;  2ATR A;  1QSN A;  4C68 A;  1CJW A;  4A31 A;  1BO4 A;  1QSM A;  2Q44 A;  3JVN A;  4CAW A;  1S7K A;  3PZJ A;  3KKW A;  3SXO A;  4KLV A;  2Q0Y A;  4M85 A;  4L89 A;  2QEC A;  3VWD A;  4A32 A;  3D3S A;  4CGM A;  1MJ9 A;  3TO9 A;  4Y49 C;  3TO7 A;  4UFV A;  3DR8 A;  2Q7B A;  2NMT A;  2Z3O A;  3TT2 A;  4QBJ A;  1Z9U A;  3LD2 A;  4C2Z A;  5C88 A;  5EC4 A;  5F47 A;  2OZG A;  2X7B A;  2I00 A;  3FBU A;  1VHS A;  2FCK A;  3H5Z A;  1NE9 A;  3LOD A;  2FIA A;  2CNS A;  3W6S A;  4B11 A;  3CXQ A;  1YVK A;  2JDC A;  3ZZI A;  4KOU A;  2ZW4 A;  4AG9 A;  3D2P A;  2CY2 A;  2B5G A;  4B13 A;  3K9U A;  1QST A;  2H5M A;  5IX3 A;  1FY7 A;  4XNH C;  4CGN A;  2Z11 A;  2OU2 A;  2A4N A;  1R57 A;  3CXP A;  2R98 A;  4K30 A;  4PK3 A;  1PU9 A;  2C27 A;  2J8M A;  2GAN A;  3N7Z A;  2YND A;  3D2M A;  1WWZ A;  4CGL A;  3R9E A;  4R3K A;  4H6U A;  1IB1 E;  2VXK A;  3I9S A;  3IWE A;  1NMT A;  4JD6 A;  4MY0 A;  3EC4 A;  4C2Y A;  5A27 A;  1KUX A;  2R8V A;  3S6F A;  3TFY A;  2CXA A;  4E8O A;  4GS4 A;  5H86 A;  1QSR A;  4CYN A;  5F46 A;  1KUV A;  2REF A;  1Z4E A;  2YNC A;  5KTA A;  2JEV A;  2PQ8 A;  4LUA A;  3A9L A;  4E0A A;  5ISV A;  3F8K A;  2JLM A;  4MI4 A;  4BBH A;  2G3T A;  4NEX A;  4XPL A;  5G22 A;  2B4D B;  1IYK A;  2J8R A;  4KLW A;  3ZJ0 A;  2P6F A;  2CNT A;  3CXS A;  4UWJ A;  4JXQ A;  1V0C A;  2EUI A;  4KOT A;  4Q38 A;  4A30 A;  2Z3L A;  5G1Z A;  4AB7 A;  4KOS A;  1YVO A;  4HKF A;  4YGO A;  1S3Z A;  2DXQ A;  2KCW A;  1LRZ A;  2PDO A;  4KZT A;  3TCV A;  3FRM A;  2Z3P A;  4QB9 A;  4B14 A;  4MHD A;  2VI7 A;  3FNC A;  4CAE A;  5G21 A;  1XE4 A;  3DDD A;  3IU1 A;  1NSL A;  4KOW A;  3RYO A;  5J8F A;  2Q4Y A;  4F0Y A;  4KOX A;  2Z0Z A;  3W6X A;  1MJB A;  3R9F A;  4XPD B;  3W91 A;  3DNS A;  4A2Z A;  1M4G A;  4NF1 A;  2BL1 A;  3P2H A;  4U9Z A;  2BSW A;  4RS2 A;  5AGE A;  1YRE A;  2B4D A;  3JTK A;  3MGD A;  2FIW A;  4JWP A;  1XMT A;  3T90 A;  2YNC C;  3B8G A;  4MFQ A;  4MY3 A;  4UFW A;  4CS0 B;  3FXT A;  4ORF A;  2GIV A;  4E2A A;  3F5B A;  2DPS A;  3UY5 A;  1YGH A;  4F0X A;  1OZP A;  1I12 A;  2P0W A;  1BOB A;  4U9Y A;  1MJA A;  4NCZ A;  4QUS A;  1YK3 A;  3BJ7 A;  1I21 A;  3F0A A;  4C2X A;  3GKR A;  4R87 A;  3SHP A;  4MFK A;  2Z10 A;  2ZW6 A;  5H84 A;  1UFH A;  3EY5 A;  4MFL A;  4AG7 A;  2ZW7 A;  2P6E A;  4PV6 A;  3G8W A;  3P2F A;  4PSW A;  1U6M A;  3IU2 A;  5AG4 A;  1M1D A;  4JLY A;  3EO4 A;  5HMN A;  2D4O A;  2FS5 A;  4X5K A;  4DNC A;  2B58 A;  2D4P A;  4NSQ A;  4UCM A;  5JQ4 A;  4OLL A;  2Z3M A;  5EBV A;  5CNP A;  2PC1 A;  4FD4 A;  4B12 A;  4JXR A;  5FVJ A;  4CYO A;  2ZPA A;  1Q2C A;  3EXN A;  4UCN A;  5IB0 A;  4FD7 A;  2CNM A;  3TOA A;  2K5T A;  4KVM E;  3GYA A;  5F48 A;  4C7I A;  3EFA A;  4A33 A;  2G3A A;  4FD6 A;  2I79 A;  3H4Q A;  4H6Z A;  4C7H A;  3QAH A;  2PR8 A;  4CGO A;  5E96 A;  4B5P B;  1S5K A;  3NE7 A;  1XEB A;  1B6B A;  5AG5 A;  4B5O A;  2HUZ A;  2WUU A;  4CRZ B;  3D8P A;  4U5Y A;  1M4I A;  1J4J A;  3BJ8 A;  4KSF A;  4FD5 A;  1TIQ A;  4QVT A;  3V8I A;  4UFX A;  1B87 A;  1P4N A;  2EVN A;  3S6G A;  4YRH A;  2VZZ A;  1GHE A;  1M4D A;  2Z3N A;  3BLN A;  1KZF A;  4KVX A;  4CRY B;  2IL4 A;  4B10 A;  1S7L A;  4KSA A;  5A28 A;  2DPT A;  1KUY A;  1PUA A;  4XPD C;  1YR0 A;  3TOB A;  4JJX A;  4ONU A;  4R9M A;  1M44 A;  4A95 A;  2HQY A;  2VZY A;  2FXF A;  3I3G A;  5BWA B;  3S6K A;  5IV0 A;  2FL4 A;  4MFP A;  3SXN A;  4IF5 A;  4ZBG A;  1Q2Y A;  5DWN A;  2WPW A;  5KTD A;  1YLE A;  2OB0 A;  1P0H A;  5JPH A;  2WSA A;  3R9G A;  1RO5 A;  2RC4 A;  4QC6 A;  4UCP A;  1IID A;  4AVB A;  1ON0 A;  2QIR A;  3T9Y A;  5HH1 A;  4B5P A;  4AVA A;  3C26 A;  4Y49 B;  2FSR A;  2AE6 A;  1S60 A;  4CYP A;  2Y0M A;  3JUW A;  4H89 A;  2YGW A;  4MFZ A;  2ARH A;  1N71 A;  2R7H A;  3FYN A;  1IYL A;  5F49 A;  5AG7 A;  4LX9 A;  1ZO0 A;  3OWC A;  4L8A A;  4R3L A;  3PP9 A;  4II9 A;  3R1K A;  2PR1 A;  5KTC A;  4PSX A;  5GCN A;  3TO6 A;  1I1D A;  2GE3 A;  2FE7 A;  2HV2 A;  4KS9 A;  5I0C A;  4XNH B;  3R96 A;  1S7F A;  2WPX A;  2REE A;  1MK4 A;  4KOY A;  1Y9K A;  4KUA A;  4ZGY B;  1WK4 A;  1Q2D A;  3FIX A;  1Z4R A;  4I49 A;  2PSW A;  2OZH A;  3S6H A;  2BUE A;  4IUS A;  4BMH A;  4CYQ A;  1IIC A;  2O28 A;  3TTH A;  2B4B A;  4OAD A;  5AG6 A;  4HNY B;  3IWG A;  4F6A A;  5J8C A;  5DWM A;  2QML A;  4KOV A;  3IGR A;  2FT0 A;  3GY9 A;  4MBU A;  4J3G A;  3DSB A;  4R57 A;  2R1I A;  2VEZ A;  3PGP A;  4CAV A;  2ZW5 A;  1XF8 A;  3WR7 A;  2ZXV A;  4CAF A;  2BEI A;  2J8N A;  1Y7R A;  4MFJ A;  4PK2 A;  4YFJ A;  4Q36 A;  2F5I A;  4MJ8 A;  1YX0 A;  3VWE A;  3QB8 A;  3FB3 A;  5C82 A;  1Y9W A;  2P6G A;  4KVO E;  4AVC A;  1L0C A;  1CM0 A;  2OZU A;  5G20 A;  1SQH A;  4M3S A;  4XPK A;  3R95 A;  2G0B A;  3E0K A;  4CGP A;  4CAX A;  2Z3K A;  4HNW B;  2Q4V A;  2OH1 A;  4EVY A;  1VKC A;  4UBR A;  4HNX B;  4RI1 A;  1RXT A;  3DR6 A;  1XIX A;  4KOR A;  1S7N A;  1QSO A;  2B5G B;  2B3V A;  4OAE A;  4UA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...