3JVNA

Crystal structure of the acetyltransferase vf_1542 from vibrio fischeri, northeast structural genomics consortium target vfr136
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
134
structure length
122
Chain Sequence
PVIRRAKEIDLYCLNSLMYKLHDEHHQQCPDEKSIARYLDDPECMVYVAEMDDVIIGFITGHFCELISTVSKLVMMATIDELYIEKEYRREGVAEQLMMRIEQELKDYGVKEIFVEVWNKGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase
publication title Northeast Structural Genomics Consortium Target VfR136
rcsb
source organism Vibrio fischeri
total genus 26
structure length 122
sequence length 134
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3jvnA00
2WPXA 3TT2A 1MJ9A 4IF5A 1Z9UA 1P0HA 4KOVA 4MY3A 4UWIA 5DWNA 1Q2YA 1XIXA 1MK4A 1Z4RA 4FD5A 3FYNA 4E2AA 4XPLA 3TE4A 5JQ4A 4H89A 2FE7A 3DR6A 4KOSA 4KOTA 4L89A 2PC1A 4YRHA 3ZZIA 4M3SA 2R1IA 3F0AA 4CAWA 2B3UA 2REFA 1NE9A 4I49A 5F48A 5C82A 4F0YA 2B4DA 4OAEA 4KZTA 3CXQA 3S6KA 5F46A 2P6GA 4XNHC 4R3LA 1PUAA 4MY0A 3EY5A 2X7BA 3OWCA 2R7HA 3TOBA 2OZGA 2Q04A 2OZHA 5EC4A 2OU2A 1M4DA 2FS5A 1NSLA 1BO4A 1S60A 3BJ7A 2JLMA 4JLYA 2Z10A 3V8IA 4HNYB 4KLVA 5E96A 4L8AA 3LODA 4Y49B 5CNPA 4R87A 1M4GA 1FY7A 3D2MA 2K5TA 1KUVA 2I79A 5JPHA 2PDOA 4HKFA 4AB7A 3PGPA 4RI1A 1BOBA 1CM0A 2J8RA 4EVYA 2A4NA 4LX9A 1B87A 4BMHA 4HNXB 1QSNA 1S7KA 4KLWA 1CJWA 4AG7A 2ARHA 2Z0ZA 1XEBA 1GHEA 1WK4A 5ISVA 1Z4EA 3IWGA 1OZPA 3EC4A 3S6HA 4XPDB 2FIAA 2OZUA 4JXRA 2REEA 4AG9A 4B5PB 3S6GA 4R3KA 4E0AA 3FBUA 3NE7A 3K9UA 2R8VA 4OADA 4NCZA 5DWMA 3T9YA 4AVAA 2D4OA 3FXTA 2FCKA 2DXQA 1S7LA 2PQ8A 1WWZA 4DNCA 2GE3A 5EBVA 3R9FA 4CAXA 2IL4A 2Q7BA 4KUBA 4KVME 1IIDA 4OLLA 2G3TA 3DNSA 1YREA 2VXKA 2Y0MA 4B5PA 2Q4YA 2QMLA 1M4IA 2F5IA 2BEIA 4PSWA 4M85A 2Q4VA 4KOXA 2BSWA 4NF1A 4GS4A 1P4NA 4ONUA 4FD4A 4JD6A 2CNMA 2CNSA 2I00A 1IYKA 2Q44A 3R1KA 1Q2DA 3MGDA 3SXOA 2J8MA 1RO5A 1S7NA 2H5MA 3GY9A 3PZJA 4U9YA 5KTCA 3VWEA 5H86A 4R57A 1I21A 1MJBA 1TIQA 1R57A 3CXSA 3W91A 2AE6A 4XPDC 5C88A 1MJAA 3F8KA 1S7FA 1SQHA 1QSMA 1NMTA 4J3GA 1XMTA 2VI7A 3TTHA 3P2FA 4ORFA 1LRZA 3TFYA 4IUSA 1Y9KA 2ZW5A 5IV0A 3FB3A 3T90A 1YX0A 4CS0B 2PRBA 3D8PA 4YGOA 4KVOE 2C27A 2NMTA 3ZJ0A 1YGHA 3KKWA 4ZBGA 4CRZB 1IYLA 5F47A 1Y9WA 4UA3A 5I0CA 1QSRA 3GKRA 3G3SA 4XNHB 2JDCA 4FD7A 1QSTA 2QIRA 3JVNA 4YFJA 1YR0A 2GIVA 3TO9A 1IB1E 1QSOA 3H4QA 3WR7A 2O28A 2PR1A 2RC4A 2Q0YA 2VQYA 4NXYA 3TO6A 4NEXA 5J8CA 3FRMA 4PK3A 1RXTA 1B6BA 1UFHA 2BL1A 2FXFA 4MJ8A 3R96A 4CAVA 2ZW6A 1V0CA 3FIXA 2FSRA 1Y7RA 2P0WA 3QB8A 2ZXVA 2ATRA 3R95A 3GYAA 1YVOA 4JJXA 2J8NA 2VBQA 3SHPA 3I3GA 5IB0A 1K4JA 3R9GA 4Y49C 3SXNA 4QUSA 2HUZA 4R9MA 1Q2CA 1IICA 2EVNA 5KTDA 2B58A 2BUEA 4KOYA 2FIWA 2B4BA 1YVKA 1KZFA 3EFAA 1XF8A 4U5YA 3VWDA 2FL4A 4NSQA 1VKCA 4RS2A 3W6SA 2HV2A 1XE4A 2JDDA 2P6EA 2R98A 2B5GB 4MHDA 1N71A 4LUAA 3N7ZA 3D2PA 1I12A 2CNTA 3QAHA 3D3SA 3RYOA 4AVBA 1I1DA 4K30A 3I9SA 2ZW4A 4QB9A 3E0KA 2Z11A 1L0CA 4F6AA 4QVTA 4X5KA 3DR8A 3PP9A 1ON0A 2G0BA 1U6MA 3DSBA 3DDDA 3BJ8A 5HH1A 5FVJA 3P2HA 2WPWA 2OH1A 3TOAA 2VEZA 1S3ZA 3C26A 2PSWA 3IGRA 2PR8A 1M44A 4QBJA 4II9A 4JWPA 3JUWA 1KUYA 2AJ6A 3BLNA 1M1DA 2B5GA 4H6UA 4PV6A 2EUIA 2VZZA 5H84A 2D4PA 3FNCA 4E8OA 4UBRA 1VHSA 2QECA 4KOUA 3EO4A 3EXNA 2GANA 3G8WA 4KOWA 5GCNA 2HQYA 2G3AA 2FT0A 4HNWB 5F49A 2P6FA 2CY2A 4MI4A 3LD2A 2JEVA 1PU9A 2B3VA 4KORA 3S6FA 3R9EA 2OB0A 3UY5A 1S5KA 4KVXA 1YK3A 4XPKA 2KCWA 2ZW7A 3B8GA 3CXPA 4JXQA 4CRYB 1YLEA 3F5BA 1J4JA 5HMNA 2ZPAA 4PK2A 4MBUA 2VZYA 2B4DB 4AVCA 5J8FA 4B5OA 4FD6A 4QC6A 1KUXA 4PSXA 4UWJA 4KUAA 3TCVA 3W6XA 4H6ZA 4U9ZA 3TO7A 5IX3A 5KTAA
chains in the Genus database with same CATH superfamily
1VHEA 2WPXA 4FUUA 3TT2A 2Z3LA 3IO1A 1MJ9A 1YSJA 4IF5A 1Z9UA 1P0HA 4KOVA 4MY3A 4NGPA 4UWIA 1LOKA 4OC3A 3KR5A 5AGEA 1Q2YA 5DWNA 1XIXA 3H8EA 2V8VA 4OKOA 4KSAA 1MK4A 1Z4RA 2AFWA 1GYTA 4FD5A 3FYNA 4E2AA 4XPLA 3TE4A 5JQ4A 1LCPA 5BWAB 2PJ9A 3BI1A 4H89A 2FE7A 4MFPA 2ZEGA 2V8HA 3DR6A 2J9AA 4X8IA 1XBUA 4LQGA 4MRIA 1XOVA 4KOSA 4KOTA 1YLOA 3QNVA 4L89A 4P44A 4B12A 2PC1A 4YRHA 3ZZIA 4M3SA 4Z65A 1XRYA 2R1IA 2XEJA 2ZEFA 3F0AA 4R7MA 2B3UA 2V8GA 4UEFA 2REFA 4B13A 1NE9A 4CAWA 4I49A 5F48A 5C82A 4F0YA 2B4DA 4OAEA 4KZTA 3CXQA 3S6KA 5F46A 2P6GA 4XNHC 3S9NA 4R3LA 1YW6A 1PUAA 4B10A 2EWBA 4MY0A 4UFWA 3EY5A 1JQGA 3D7DA 3KHXA 4P4JA 4MHYA 4BD9A 2OR4A 2QYVA 4ZX8A 2X7BA 3OWCA 2R7HA 4UIBA 4CGLA 3B35A 5CBMA 3TOBA 2OZGA 4P4IA 4IAVA 4UCNA 1H8LA 4GXHA 1HDUA 2AFUA 4A94A 2Q04A 3PFOA 2OZHA 4Q38A 5LYLA 2Q43A 5EC4A 5F09A 4MFKA 2OU2A 1M4DA 2PJCA 4OC5A 2FS5A 1NSLA 2ZOGA 1BO4A 1TF8A 1S60A 3JTKA 3BJ7A 2JLMA 4JLYA 2Z10A 3V8IA 4HNYB 4KLVA 5E96A 1CPSA 4L8AA 3IU2A 3LODA 4Y49B 5CNPA 4R87A 3FVLA 3RO0A 1M4GA 4P4EA 2PJBA 3IWWA 1FY7A 3D2MA 1ZG7A 2GU2A 2K5TA 3KL9A 3KR4A 4OC2A 2BOAA 1KUVA 2I79A 3BHXA 3JRUA 4NGQA 4UCPA 5JPHA 2F8HA 3FECA 3WT4A 3B3TA 3D4UA 2PDOA 3L2NA 4HKFA 3GLJA 4AB7A 3RZAA 3PGPA 5THWA 4RI1A 1Q7LA 1BOBA 1CM0A 4OIWA 2J8RA 3IEHA 4EVYA 1QMUA 2A4NA 4LX9A 4OC1A 1B87A 4BMHA 4HNXB 1CP7A 1QSNA 5LRGA 4M6GA 2C6PA 1X12A 2G9DA 4CAEA 1S7KA 4KLWA 3NA6A 2XEGA 4UCMA 3B7IA 1CJWA 1XMBA 4AG7A 3CZXA 3FMCA 4CAFA 2PIZA 4X2TA 2ARHA 3PBBA 4K3NA 5JM6A 1Z8WA 2Z0ZA 1XEBA 4A33A 3PB8X 2PVWA 1GHEA 1WK4A 3RNZA 5ISVA 1Z4EA 3IWGA 4C2XA 2ZEMA 1OZPA 3WC6A 2WZNA 3T8WA 3EC4A 2DEAA 4XPDB 2FIAA 3S6HA 1ELLP 2OZUA 4JXRA 2CIJA 2REEA 2PJ7A 4AG9A 3S6GA 3S9MA 4B5PB 4CYOA 4R3KA 3NFZA 4E0AA 3FBUA 3NE7A 3K9UA 2R8VA 4OADA 4NCZA 5DWMA 6CPAA 3T9YA 4AVAA 4R76A 5G20A 5K8OA 2D4OA 2WYRA 3ISZA 4HPSA 5I4MA 1AMPA 4A32A 3FXTA 2FCKA 3IU1A 1IOIA 2DXQA 1F57A 1S7LA 2PQ8A 1WWZA 3V38A 4DNCA 1LAMA 4ZYQA 2ZEPA 2YNCC 2FVGA 4Q7AA 1FNOA 3FEEA 4F9UA 2YNEA 2GE3A 4UFVA 2I3CA 2IJZA 4PXBA 3GUXA 5EBVA 3R9FA 4CAXA 4Q36A 4MFQA 1VGYA 2IL4A 4KUBA 3LACA 4KVME 1IIDA 1CX8A 2Q7BA 2PVVA 4OLLA 1YW4A 3B3CA 4CGOA 2G3TA 3DNSA 5CPAA 1YREA 2HC9A 4CGNA 2VXKA 2Y0MA 2BO9A 4B5PA 2Q4YA 2QMLA 1M4IA 4WWVA 1EE3P 2F5IA 2BEIA 1Z5RA 2WUUA 5LRJA 4NGMA 2V77A 2CTCA 3K9TA 4PSWA 4M85A 3WABA 2F7VA 4UEZA 4A95A 2Q4VA 4KOXA 2BSWA 4NF1A 2ODFA 2PJ0A 1P4NA 1XFOA 4GS4A 4ONUA 4B6ZA 2PE3A 3BI0A 2WSAA 3MRUA 4FD4A 4AXVA 1KWMA 4JD6A 1BLLE 2CNMA 2CNSA 3B2YA 4JYWA 2I00A 1IYKA 2Q44A 3R1KA 1Q2DA 3MGDA 3SXOA 2J8MA 1RO5A 1S7NA 1ZLHA 5D29A 2H5MA 3GY9A 3PRTA 5LYIA 3PZJA 3D7GA 4JZ0A 4U9YA 5KTCA 1OBRA 3VWEA 4BBHA 5H86A 2PJ2A 4WJBA 4C2ZA 4R57A 4LQ6A 1VIXA 3NE8A 3PB4X 1TKHA 4C2YA 1TKFA 1I21A 1MJBA 1TIQA 3IC1A 3GB0A 1R57A 3CXSA 2O53A 4MHPA 4X3RA 4P10A 3W91A 3KASA 2AE6A 4XPDC 5C88A 1MJAA 5JH9A 4MCQA 3F8KA 1IY7A 1S7FA 4TNUA 1Z2LA 4CYQA 4DUKA 1Z8LA 2PJ8A 1SQHA 1QSMA 1QQ9A 2O4HA 1NMTA 4J3GA 1XMTA 5ELYA 4C7IA 2VI7A 3TTHA 3N5FA 2GLFA 3D7HA 3P2FA 3B3VA 2Q51A 4ORFA 2BCOA 3A9LA 1LRZA 3H8GA 3TFYA 4IUSA 1Y9KA 2ZW5A 4BINA 5IV0A 3FB3A 3T90A 1YX0A 4CS0B 2PRBA 3CT9A 4EFDA 4PXCA 1CG2A 3B3SA 4A30A 4F8ZA 2PIYA 3D8PA 2JEWA 4YGOA 4KVOE 4YU9A 2C27A 4NGTA 3PBEA 2Z3KA 2NMTA 2GREA 1CPXA 3KQZA 3ZJ0A 1YGHA 5A27A 1ZG9A 3KKWA 4ZBGA 2IMOA 4ZY2A 1BPNA 4NGNA 4CRZB 1IYLA 3DLJA 2PJ6A 4MCRA 4CPAA 5LYFA 5F47A 4ZX9A 1Y9WA 3MN8A 4UA3A 2PCUA 2PJ1A 1QSRA 3GKRA 5AG5A 3VH9A 4ZI6A 3G3SA 4MFJA 5I0CA 3KI9A 3I1UA 2Z3NA 4XNHB 4RN7A 1ZG8A 1XJOA 4F9VA 4OC4A 1HDQA 2JDCA 4FD7A 1QSTA 4MHZA 1X10A 2QIRA 1A2ZA 3JVNA 4YFJA 3GIUA 3KHZA 5D8NA 1YR0A 1TF9A 1ZO0A 2GIVA 3TO9A 1IB1E 3BXMA 1PCAA 1HEEA 1R3NA 2C6GA 5G1ZA 1DE4C 1QSOA 3HUVA 1NSAA 3H4QA 3WR7A 2O28A 1IU8A 4MFZA 2PR1A 2RC4A 1PYTB 1BPMA 2Q0YA 2VQYA 3LWUA 4UIAA 4NXYA 5G21A 3TO6A 4NEXA 3NH8A 5J8CA 3FRMA 2DPSA 1DTDA 2QVPA 4A2ZA 1Y7EA 4PK3A 1RXTA 1B6BA 1UFHA 2BL1A 2FXFA 2NSMA 4MJ8A 4DYOA 5K8MA 3R96A 4CAVA 4EWTA 2ZW6A 4TWEA 2C1CA 4UFXA 5K8PA 2ZENA 3K2KA 2ABZA 1Z8TA 1AYEA 4B11A 1V0CA 3FIXA 1ARMA 1Y7RA 2FSRA 4YWYA 2P0WA 3QB8A 4A39A 2ZXVA 1LFWA 2ATRA 3R95A 2NYQA 2V8DA 3GYAA 3KZWA 2C6CA 1YVOA 4JJXA 2J8NA 2VBQA 3SHPA 1M4LA 5EMIA 2ZEOA 3I3GA 4G1PA 5IB0A 1K4JA 3ISXA 3FH4A 3FX6A 4Y49C 3R9GA 3SXNA 1IOFA 3LMSA 4FWUA 4NFRA 2XEIA 4NJRA 2PJ3A 4P4BA 4QUSA 4MFLA 2HUZA 4IHMA 4NGSA 4R9MA 2Q7SA 1Q2CA 1TKJA 3SI1A 1IICA 2EVNA 2JBJA 4CYPA 5KTDA 2B58A 2JBKA 2DF5A 2BUEA 4KOYA 1F2OA 3FEDA 2FIWA 2B4BA 1YVKA 1KZFA 3TX8A 4KSFA 3EFAA 1TXRA 1XF8A 4U5YA 3VWDA 3B3WA 2FL4A 2IQ6A 4NSQA 1VKCA 4RS2A 2OOTA 3SI0A 3W6SA 4IK2A 4NGRA 2HV2A 4OMEA 3FJUA 1XE4A 2JDDA 2P6EA 2PJ4A 5HVFA 2ZEHA 2R98A 3SJGA 2Z3PA 1VHOA 2QJ8A 2ZELA 3KQXA 2B5GB 4F0XA 4MHDA 1N71A 4LUAA 3N7ZA 5A28A 5IB9A 4ZY1A 3D2PA 4P6YA 1I12A 3PB9X 2CNTA 2ZEDA 3QAHA 3D3SA 3RAMA 4P45A 3RYOA 4AVBA 1I1DA 5HVGA 1BAVA 3V7ZA 4K30A 2RFHA 3I9SA 4KSIA 2ZW4A 4QB9A 4H2KA 3E0KA 2Z11A 1L0CA 1FT7A 2PJAA 4CGMA 2EK9A 4QVTA 4X5KA 1CBXA 4F6AA 3DR8A 3PP9A 4P4FA 3S9LA 7CPAA 1ON0A 3RBUA 2G0BA 3D67A 1U6MA 3DSBA 3DDDA 3BJ8A 3PB6X 5HH1A 1ZLIA 4EMEA 5HXDA 4OIDA 5K8NA 5FVJA 1Z8XA 2GLJA 3P2HA 2WPWA 2YGWA 4P4DA 2OH1A 3TOAA 2VEZA 2VL1A 4GM5A 4R6TA 1S3ZA 3C26A 2PSWA 2CTBA 2PR8A 3IGRA 4NJQA 4PPZA 4CYNA 1M44A 5LRKA 3WC5A 4KS9A 1LANA 4ZGYB 4QBJA 4M6HA 5JGFA 4FBEA 4II9A 3KGQA 4JWPA 3JUWA 8CPAA 1KUYA 3IIBA 2AJ6A 2DPTA 3BLNA 4FAIA 1M1DA 4CGPA 2B5GA 4PXDA 4C7HA 2CF4A 3PEIA 4H6UA 5AG4A 1ARLA 2AFOA 4MXUA 4PV6A 4MCSA 2ZOFA 2EUIA 2VZZA 5G22A 5H84A 2D4PA 2Z3OA 3FF3A 3FNCA 3VARA 4E8OA 4OP4A 4UBRA 2PJ5A 1VHSA 2AFZA 2QECA 4KOUA 2AFSA 3EO4A 1YQEA 4R8FA 1RTQA 2AFXA 3EXNA 3CPAA 2GANA 1LAPA 3IWEA 4OC0A 1YMEA 4PXEA 4A31A 5DS0A 2YNDA 3G8WA 4DJLA 2HB6A 4KOWA 5GCNA 5HVHA 1Y0YA 3WC7A 4B14A 3NH5A 4MMOA 3SJEA 2ZEEA 4O23A 2HQYA 3VATA 2G3AA 2GFQA 5AG7A 2FT0A 4HNWB 4M6IA 5F49A 2P6FA 2CY2A 4MI4A 3LD2A 1JWQA 2JEVA 2EO8A 2Q4ZA 3H8FA 1PU9A 4A38A 2B3VA 2PRQA 4PQAA 3NH4A 4KORA 3S6FA 2YNCA 2XEFA 3R9EA 1IGBA 2POKA 2OB0A 3PB7X 4ONWA 3UY5A 1S5KA 4UEEA 3H5ZA 4KVXA 3PFEA 1Y0RA 2ANPA 1YK3A 4A37A 5J1QA 4XPKA 2KCWA 2Z3MA 3TC8A 1UWYA 2EK8A 2ZW7A 3B8GA 3CXPA 3IFEA 4JXQA 4CRYB 4RUHA 5AG6A 1ELMP 1YLEA 3D7FA 3SJFA 1F2PA 4W9YA 4C68A 3D66A 3F5BA 3D68A 1J4JA 3DGVA 5HMNA 1AUGA 2ZPAA 4PK2A 1R43A 4ZY0A 2CXAA 4MBUA 1CP6A 2VZYA 5LYDA 3SI2A 2B4DB 4AVCA 5J8FA 4B5OA 4FD6A 3SJXA 4QC6A 1KUXA 4PSXA 4UWJA 4KUAA 3QAYA 3TCVA 2EBJA 2AFMA 3HLPA 2RB7A 3IJ3A 3W6XA 4H6ZA 3CDXA 4MCPA 4U9ZA 3TO7A 4UF4A 4MHNA 5IX3A 5KTAA 3CPXA
chains in the Genus database with same CATH topology
2WPXA 3TT2A 2Z3LA 1MJ9A 4IF5A 1Z9UA 1P0HA 4KOVA 4MY3A 4UWIA 5DWNA 5AGEA 1Q2YA 1XIXA 4KSAA 1MK4A 1Z4RA 4FD5A 3FYNA 4E2AA 4XPLA 3TE4A 5JQ4A 5BWAB 4H89A 2FE7A 4MFPA 3DR6A 4KOSA 4KOTA 4L89A 4B12A 2PC1A 4YRHA 3ZZIA 4M3SA 2R1IA 3F0AA 4CAWA 2B3UA 2REFA 1NE9A 4I49A 5F48A 5C82A 4F0YA 2B4DA 4OAEA 4KZTA 3CXQA 3S6KA 5F46A 2P6GA 4XNHC 4R3LA 1PUAA 4B10A 4MY0A 4UFWA 3EY5A 2X7BA 3OWCA 2R7HA 4CGLA 3TOBA 2OZGA 4UCNA 2Q04A 4Q38A 2OZHA 5EC4A 4MFKA 2OU2A 1M4DA 2FS5A 1NSLA 1BO4A 3JTKA 1S60A 3BJ7A 2JLMA 4JLYA 2Z10A 3V8IA 4HNYB 4KLVA 5E96A 4L8AA 3IU2A 3LODA 4Y49B 5CNPA 4R87A 1M4GA 1FY7A 3D2MA 2K5TA 1KUVA 2I79A 4UCPA 5JPHA 2PDOA 4HKFA 4AB7A 3PGPA 4RI1A 1BOBA 1CM0A 2J8RA 4EVYA 2A4NA 4LX9A 1B87A 4BMHA 4HNXB 1QSNA 4CAEA 1S7KA 4KLWA 4UCMA 1CJWA 4AG7A 4CAFA 2ARHA 2Z0ZA 1XEBA 4A33A 1GHEA 1WK4A 5ISVA 1Z4EA 3IWGA 4C2XA 1OZPA 3EC4A 3S6HA 4XPDB 2FIAA 2OZUA 4JXRA 2REEA 4AG9A 4B5PB 3S6GA 4CYOA 4R3KA 4E0AA 3FBUA 3NE7A 3K9UA 2R8VA 4OADA 4NCZA 5DWMA 3T9YA 4AVAA 5G20A 2D4OA 4A32A 3FXTA 2FCKA 3IU1A 2DXQA 1S7LA 2PQ8A 1WWZA 4DNCA 2YNCC 2YNEA 2GE3A 4UFVA 5EBVA 3R9FA 4CAXA 4Q36A 4MFQA 2IL4A 2Q7BA 4KUBA 4KVME 1IIDA 4OLLA 4CGOA 2G3TA 3DNSA 1YREA 4CGNA 2VXKA 2Y0MA 4B5PA 2Q4YA 2QMLA 1M4IA 2F5IA 2BEIA 2WUUA 4PSWA 4M85A 4A95A 2Q4VA 4KOXA 2BSWA 4NF1A 4GS4A 1P4NA 4ONUA 2WSAA 4FD4A 4JD6A 2CNMA 2CNSA 2I00A 1IYKA 2Q44A 3R1KA 1Q2DA 3MGDA 3SXOA 2J8MA 1RO5A 1S7NA 2H5MA 3GY9A 3PZJA 4U9YA 5KTCA 3VWEA 4BBHA 5H86A 4C2ZA 4R57A 4C2YA 1I21A 1MJBA 1TIQA 1R57A 3CXSA 3W91A 2AE6A 4XPDC 5C88A 1MJAA 3F8KA 1S7FA 4CYQA 1SQHA 1QSMA 1NMTA 4J3GA 1XMTA 2VI7A 3TTHA 3P2FA 4ORFA 3A9LA 1LRZA 3TFYA 4IUSA 1Y9KA 2ZW5A 5IV0A 3FB3A 3T90A 1YX0A 4CS0B 2PRBA 4A30A 3D8PA 4YGOA 4KVOE 2C27A 2Z3KA 2NMTA 5A27A 3ZJ0A 1YGHA 3KKWA 4ZBGA 4CRZB 1IYLA 5F47A 1Y9WA 4UA3A 5AG5A 5I0CA 1QSRA 3GKRA 3G3SA 4MFJA 2Z3NA 4XNHB 2JDCA 4FD7A 1QSTA 2QIRA 3JVNA 4YFJA 1YR0A 2GIVA 1ZO0A 3TO9A 1IB1E 5G1ZA 1QSOA 3H4QA 3WR7A 2O28A 4MFZA 2PR1A 2RC4A 2Q0YA 2VQYA 5G21A 4NXYA 3TO6A 4NEXA 5J8CA 3FRMA 2DPSA 4A2ZA 4PK3A 1RXTA 1B6BA 1UFHA 2BL1A 2FXFA 4MJ8A 3R96A 4CAVA 2ZW6A 4UFXA 4B11A 1V0CA 3FIXA 2FSRA 1Y7RA 2P0WA 3QB8A 2ZXVA 2ATRA 3R95A 3GYAA 1YVOA 4JJXA 2J8NA 2VBQA 3SHPA 3I3GA 5IB0A 1K4JA 3R9GA 4Y49C 3SXNA 4QUSA 4MFLA 2HUZA 4R9MA 1Q2CA 1IICA 2EVNA 4CYPA 5KTDA 2B58A 2BUEA 4KOYA 2FIWA 2B4BA 1YVKA 1KZFA 4KSFA 3EFAA 1XF8A 4U5YA 3VWDA 2FL4A 4C7IA 4NSQA 1VKCA 4RS2A 3W6SA 2HV2A 1XE4A 2JDDA 2P6EA 2R98A 2Z3PA 2B5GB 4F0XA 4MHDA 1N71A 4LUAA 3N7ZA 5A28A 3D2PA 1I12A 2CNTA 3QAHA 3D3SA 3RYOA 4AVBA 1I1DA 4K30A 3I9SA 2ZW4A 4QB9A 3E0KA 2Z11A 1L0CA 4CGMA 4F6AA 4QVTA 4X5KA 3DR8A 3PP9A 1ON0A 2G0BA 1U6MA 3DSBA 3DDDA 3BJ8A 5HH1A 5FVJA 3P2HA 2WPWA 2YGWA 2OH1A 3TOAA 2VEZA 1S3ZA 3C26A 2PSWA 3IGRA 2PR8A 4CYNA 1M44A 4KS9A 4ZGYB 4QBJA 4II9A 4JWPA 3JUWA 1KUYA 2AJ6A 2DPTA 3BLNA 1M1DA 4CGPA 2B5GA 4C7HA 4H6UA 5AG4A 4PV6A 2EUIA 2VZZA 5G22A 5H84A 2D4PA 2Z3OA 3FNCA 4E8OA 4UBRA 1VHSA 2QECA 4KOUA 3EO4A 4B13A 3EXNA 2GANA 3IWEA 4A31A 2YNDA 3G8WA 4KOWA 5GCNA 4B14A 2HQYA 2G3AA 5AG7A 2FT0A 4HNWB 5F49A 2P6FA 2CY2A 4MI4A 3LD2A 2JEVA 1PU9A 2B3VA 4KORA 3S6FA 2YNCA 3R9EA 2OB0A 3UY5A 1S5KA 3H5ZA 4KVXA 1YK3A 4XPKA 2KCWA 2Z3MA 2ZW7A 3B8GA 3CXPA 4JXQA 4CRYB 5AG6A 1YLEA 4C68A 3F5BA 1J4JA 5HMNA 2ZPAA 4PK2A 2CXAA 4MBUA 2VZYA 2B4DB 4AVCA 5J8FA 4B5OA 4FD6A 4QC6A 1KUXA 4PSXA 4UWJA 4KUAA 3TCVA 3W6XA 4H6ZA 4U9ZA 3TO7A 5IX3A 5KTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPX A;  3TT2 A;  1MJ9 A;  4IF5 A;  1Z9U A;  1P0H A;  4KOV A;  4MY3 A;  4UWI A;  5DWN A;  1Q2Y A;  1XIX A;  1MK4 A;  1Z4R A;  4FD5 A;  3FYN A;  4E2A A;  4XPL A;  3TE4 A;  5JQ4 A;  4H89 A;  2FE7 A;  3DR6 A;  4KOS A;  4KOT A;  4L89 A;  2PC1 A;  4YRH A;  3ZZI A;  4M3S A;  2R1I A;  3F0A A;  4CAW A;  2B3U A;  2REF A;  1NE9 A;  4I49 A;  5F48 A;  5C82 A;  4F0Y A;  2B4D A;  4OAE A;  4KZT A;  3CXQ A;  3S6K A;  5F46 A;  2P6G A;  4XNH C;  4R3L A;  1PUA A;  4MY0 A;  3EY5 A;  2X7B A;  3OWC A;  2R7H A;  3TOB A;  2OZG A;  2Q04 A;  2OZH A;  5EC4 A;  2OU2 A;  1M4D A;  2FS5 A;  1NSL A;  1BO4 A;  1S60 A;  3BJ7 A;  2JLM A;  4JLY A;  2Z10 A;  3V8I A;  4HNY B;  4KLV A;  5E96 A;  4L8A A;  3LOD A;  4Y49 B;  5CNP A;  4R87 A;  1M4G A;  1FY7 A;  3D2M A;  2K5T A;  1KUV A;  2I79 A;  5JPH A;  2PDO A;  4HKF A;  4AB7 A;  3PGP A;  4RI1 A;  1BOB A;  1CM0 A;  2J8R A;  4EVY A;  2A4N A;  4LX9 A;  1B87 A;  4BMH A;  4HNX B;  1QSN A;  1S7K A;  4KLW A;  1CJW A;  4AG7 A;  2ARH A;  2Z0Z A;  1XEB A;  1GHE A;  1WK4 A;  5ISV A;  1Z4E A;  3IWG A;  1OZP A;  3EC4 A;  3S6H A;  4XPD B;  2FIA A;  2OZU A;  4JXR A;  2REE A;  4AG9 A;  4B5P B;  3S6G A;  4R3K A;  4E0A A;  3FBU A;  3NE7 A;  3K9U A;  2R8V A;  4OAD A;  4NCZ A;  5DWM A;  3T9Y A;  4AVA A;  2D4O A;  3FXT A;  2FCK A;  2DXQ A;  1S7L A;  2PQ8 A;  1WWZ A;  4DNC A;  2GE3 A;  5EBV A;  3R9F A;  4CAX A;  2IL4 A;  2Q7B A;  4KUB A;  4KVM E;  1IID A;  4OLL A;  2G3T A;  3DNS A;  1YRE A;  2VXK A;  2Y0M A;  4B5P A;  2Q4Y A;  2QML A;  1M4I A;  2F5I A;  2BEI A;  4PSW A;  4M85 A;  2Q4V A;  4KOX A;  2BSW A;  4NF1 A;  4GS4 A;  1P4N A;  4ONU A;  4FD4 A;  4JD6 A;  2CNM A;  2CNS A;  2I00 A;  1IYK A;  2Q44 A;  3R1K A;  1Q2D A;  3MGD A;  3SXO A;  2J8M A;  1RO5 A;  1S7N A;  2H5M A;  3GY9 A;  3PZJ A;  4U9Y A;  5KTC A;  3VWE A;  5H86 A;  4R57 A;  1I21 A;  1MJB A;  1TIQ A;  1R57 A;  3CXS A;  3W91 A;  2AE6 A;  4XPD C;  5C88 A;  1MJA A;  3F8K A;  1S7F A;  1SQH A;  1QSM A;  1NMT A;  4J3G A;  1XMT A;  2VI7 A;  3TTH A;  3P2F A;  4ORF A;  1LRZ A;  3TFY A;  4IUS A;  1Y9K A;  2ZW5 A;  5IV0 A;  3FB3 A;  3T90 A;  1YX0 A;  4CS0 B;  2PRB A;  3D8P A;  4YGO A;  4KVO E;  2C27 A;  2NMT A;  3ZJ0 A;  1YGH A;  3KKW A;  4ZBG A;  4CRZ B;  1IYL A;  5F47 A;  1Y9W A;  4UA3 A;  5I0C A;  1QSR A;  3GKR A;  3G3S A;  4XNH B;  2JDC A;  4FD7 A;  1QST A;  2QIR A;  3JVN A;  4YFJ A;  1YR0 A;  2GIV A;  3TO9 A;  1IB1 E;  1QSO A;  3H4Q A;  3WR7 A;  2O28 A;  2PR1 A;  2RC4 A;  2Q0Y A;  2VQY A;  4NXY A;  3TO6 A;  4NEX A;  5J8C A;  3FRM A;  4PK3 A;  1RXT A;  1B6B A;  1UFH A;  2BL1 A;  2FXF A;  4MJ8 A;  3R96 A;  4CAV A;  2ZW6 A;  1V0C A;  3FIX A;  2FSR A;  1Y7R A;  2P0W A;  3QB8 A;  2ZXV A;  2ATR A;  3R95 A;  3GYA A;  1YVO A;  4JJX A;  2J8N A;  2VBQ A;  3SHP A;  3I3G A;  5IB0 A;  1K4J A;  3R9G A;  4Y49 C;  3SXN A;  4QUS A;  2HUZ A;  4R9M A;  1Q2C A;  1IIC A;  2EVN A;  5KTD A;  2B58 A;  2BUE A;  4KOY A;  2FIW A;  2B4B A;  1YVK A;  1KZF A;  3EFA A;  1XF8 A;  4U5Y A;  3VWD A;  2FL4 A;  4NSQ A;  1VKC A;  4RS2 A;  3W6S A;  2HV2 A;  1XE4 A;  2JDD A;  2P6E A;  2R98 A;  2B5G B;  4MHD A;  1N71 A;  4LUA A;  3N7Z A;  3D2P A;  1I12 A;  2CNT A;  3QAH A;  3D3S A;  3RYO A;  4AVB A;  1I1D A;  4K30 A;  3I9S A;  2ZW4 A;  4QB9 A;  3E0K A;  2Z11 A;  1L0C A;  4F6A A;  4QVT A;  4X5K A;  3DR8 A;  3PP9 A;  1ON0 A;  2G0B A;  1U6M A;  3DSB A;  3DDD A;  3BJ8 A;  5HH1 A;  5FVJ A;  3P2H A;  2WPW A;  2OH1 A;  3TOA A;  2VEZ A;  1S3Z A;  3C26 A;  2PSW A;  3IGR A;  2PR8 A;  1M44 A;  4QBJ A;  4II9 A;  4JWP A;  3JUW A;  1KUY A;  2AJ6 A;  3BLN A;  1M1D A;  2B5G A;  4H6U A;  4PV6 A;  2EUI A;  2VZZ A;  5H84 A;  2D4P A;  3FNC A;  4E8O A;  4UBR A;  1VHS A;  2QEC A;  4KOU A;  3EO4 A;  3EXN A;  2GAN A;  3G8W A;  4KOW A;  5GCN A;  2HQY A;  2G3A A;  2FT0 A;  4HNW B;  5F49 A;  2P6F A;  2CY2 A;  4MI4 A;  3LD2 A;  2JEV A;  1PU9 A;  2B3V A;  4KOR A;  3S6F A;  3R9E A;  2OB0 A;  3UY5 A;  1S5K A;  4KVX A;  1YK3 A;  4XPK A;  2KCW A;  2ZW7 A;  3B8G A;  3CXP A;  4JXQ A;  4CRY B;  1YLE A;  3F5B A;  1J4J A;  5HMN A;  2ZPA A;  4PK2 A;  4MBU A;  2VZY A;  2B4D B;  4AVC A;  5J8F A;  4B5O A;  4FD6 A;  4QC6 A;  1KUX A;  4PSX A;  4UWJ A;  4KUA A;  3TCV A;  3W6X A;  4H6Z A;  4U9Z A;  3TO7 A;  5IX3 A;  5KTA A; 
#chains in the Genus database with same CATH topology
 1VHE A;  2WPX A;  4FUU A;  3TT2 A;  2Z3L A;  3IO1 A;  1MJ9 A;  1YSJ A;  4IF5 A;  1Z9U A;  1P0H A;  4KOV A;  4MY3 A;  4NGP A;  4UWI A;  1LOK A;  4OC3 A;  3KR5 A;  5AGE A;  1Q2Y A;  5DWN A;  1XIX A;  3H8E A;  2V8V A;  4OKO A;  4KSA A;  1MK4 A;  1Z4R A;  2AFW A;  1GYT A;  4FD5 A;  3FYN A;  4E2A A;  4XPL A;  3TE4 A;  5JQ4 A;  1LCP A;  5BWA B;  2PJ9 A;  3BI1 A;  4H89 A;  2FE7 A;  4MFP A;  2ZEG A;  2V8H A;  3DR6 A;  2J9A A;  4X8I A;  1XBU A;  4LQG A;  4MRI A;  1XOV A;  4KOS A;  4KOT A;  1YLO A;  3QNV A;  4L89 A;  4P44 A;  4B12 A;  2PC1 A;  4YRH A;  3ZZI A;  4M3S A;  4Z65 A;  1XRY A;  2R1I A;  2XEJ A;  2ZEF A;  3F0A A;  4R7M A;  2B3U A;  2V8G A;  4UEF A;  2REF A;  4B13 A;  1NE9 A;  4CAW A;  4I49 A;  5F48 A;  5C82 A;  4F0Y A;  2B4D A;  4OAE A;  4KZT A;  3CXQ A;  3S6K A;  5F46 A;  2P6G A;  4XNH C;  3S9N A;  4R3L A;  1YW6 A;  1PUA A;  4B10 A;  2EWB A;  4MY0 A;  4UFW A;  3EY5 A;  1JQG A;  3D7D A;  3KHX A;  4P4J A;  4MHY A;  4BD9 A;  2OR4 A;  2QYV A;  4ZX8 A;  2X7B A;  3OWC A;  2R7H A;  4UIB A;  4CGL A;  3B35 A;  5CBM A;  3TOB A;  2OZG A;  4P4I A;  4IAV A;  4UCN A;  1H8L A;  4GXH A;  1HDU A;  2AFU A;  4A94 A;  2Q04 A;  3PFO A;  2OZH A;  4Q38 A;  5LYL A;  2Q43 A;  5EC4 A;  5F09 A;  4MFK A;  2OU2 A;  1M4D A;  2PJC A;  4OC5 A;  2FS5 A;  1NSL A;  2ZOG A;  1BO4 A;  1TF8 A;  1S60 A;  3JTK A;  3BJ7 A;  2JLM A;  4JLY A;  2Z10 A;  3V8I A;  4HNY B;  4KLV A;  5E96 A;  1CPS A;  4L8A A;  3IU2 A;  3LOD A;  4Y49 B;  5CNP A;  4R87 A;  3FVL A;  3RO0 A;  1M4G A;  4P4E A;  2PJB A;  3IWW A;  1FY7 A;  3D2M A;  1ZG7 A;  2GU2 A;  2K5T A;  3KL9 A;  3KR4 A;  4OC2 A;  2BOA A;  1KUV A;  2I79 A;  3BHX A;  3JRU A;  4NGQ A;  4UCP A;  5JPH A;  2F8H A;  3FEC A;  3WT4 A;  3B3T A;  3D4U A;  2PDO A;  3L2N A;  4HKF A;  3GLJ A;  4AB7 A;  3RZA A;  3PGP A;  5THW A;  4RI1 A;  1Q7L A;  1BOB A;  1CM0 A;  4OIW A;  2J8R A;  3IEH A;  4EVY A;  1QMU A;  2A4N A;  4LX9 A;  4OC1 A;  1B87 A;  4BMH A;  4HNX B;  1CP7 A;  1QSN A;  5LRG A;  4M6G A;  2C6P A;  1X12 A;  2G9D A;  4CAE A;  1S7K A;  4KLW A;  3NA6 A;  2XEG A;  4UCM A;  3B7I A;  1CJW A;  1XMB A;  4AG7 A;  3CZX A;  3FMC A;  4CAF A;  2PIZ A;  4X2T A;  2ARH A;  3PBB A;  4K3N A;  5JM6 A;  1Z8W A;  2Z0Z A;  1XEB A;  4A33 A;  3PB8 X;  2PVW A;  1GHE A;  1WK4 A;  3RNZ A;  5ISV A;  1Z4E A;  3IWG A;  4C2X A;  2ZEM A;  1OZP A;  3WC6 A;  2WZN A;  3T8W A;  3EC4 A;  2DEA A;  4XPD B;  2FIA A;  3S6H A;  1ELL P;  2OZU A;  4JXR A;  2CIJ A;  2REE A;  2PJ7 A;  4AG9 A;  3S6G A;  3S9M A;  4B5P B;  4CYO A;  4R3K A;  3NFZ A;  4E0A A;  3FBU A;  3NE7 A;  3K9U A;  2R8V A;  4OAD A;  4NCZ A;  5DWM A;  6CPA A;  3T9Y A;  4AVA A;  4R76 A;  5G20 A;  5K8O A;  2D4O A;  2WYR A;  3ISZ A;  4HPS A;  5I4M A;  1AMP A;  4A32 A;  3FXT A;  2FCK A;  3IU1 A;  1IOI A;  2DXQ A;  1F57 A;  1S7L A;  2PQ8 A;  1WWZ A;  3V38 A;  4DNC A;  1LAM A;  4ZYQ A;  2ZEP A;  2YNC C;  2FVG A;  4Q7A A;  1FNO A;  3FEE A;  4F9U A;  2YNE A;  2GE3 A;  4UFV A;  2I3C A;  2IJZ A;  4PXB A;  3GUX A;  5EBV A;  3R9F A;  4CAX A;  4Q36 A;  4MFQ A;  1VGY A;  2IL4 A;  4KUB A;  3LAC A;  4KVM E;  1IID A;  1CX8 A;  2Q7B A;  2PVV A;  4OLL A;  1YW4 A;  3B3C A;  4CGO A;  2G3T A;  3DNS A;  5CPA A;  1YRE A;  2HC9 A;  4CGN A;  2VXK A;  2Y0M A;  2BO9 A;  4B5P A;  2Q4Y A;  2QML A;  1M4I A;  4WWV A;  1EE3 P;  2F5I A;  2BEI A;  1Z5R A;  2WUU A;  5LRJ A;  4NGM A;  2V77 A;  2CTC A;  3K9T A;  4PSW A;  4M85 A;  3WAB A;  2F7V A;  4UEZ A;  4A95 A;  2Q4V A;  4KOX A;  2BSW A;  4NF1 A;  2ODF A;  2PJ0 A;  1P4N A;  1XFO A;  4GS4 A;  4ONU A;  4B6Z A;  2PE3 A;  3BI0 A;  2WSA A;  3MRU A;  4FD4 A;  4AXV A;  1KWM A;  4JD6 A;  1BLL E;  2CNM A;  2CNS A;  3B2Y A;  4JYW A;  2I00 A;  1IYK A;  2Q44 A;  3R1K A;  1Q2D A;  3MGD A;  3SXO A;  2J8M A;  1RO5 A;  1S7N A;  1ZLH A;  5D29 A;  2H5M A;  3GY9 A;  3PRT A;  5LYI A;  3PZJ A;  3D7G A;  4JZ0 A;  4U9Y A;  5KTC A;  1OBR A;  3VWE A;  4BBH A;  5H86 A;  2PJ2 A;  4WJB A;  4C2Z A;  4R57 A;  4LQ6 A;  1VIX A;  3NE8 A;  3PB4 X;  1TKH A;  4C2Y A;  1TKF A;  1I21 A;  1MJB A;  1TIQ A;  3IC1 A;  3GB0 A;  1R57 A;  3CXS A;  2O53 A;  4MHP A;  4X3R A;  4P10 A;  3W91 A;  3KAS A;  2AE6 A;  4XPD C;  5C88 A;  1MJA A;  5JH9 A;  4MCQ A;  3F8K A;  1IY7 A;  1S7F A;  4TNU A;  1Z2L A;  4CYQ A;  4DUK A;  1Z8L A;  2PJ8 A;  1SQH A;  1QSM A;  1QQ9 A;  2O4H A;  1NMT A;  4J3G A;  1XMT A;  5ELY A;  4C7I A;  2VI7 A;  3TTH A;  3N5F A;  2GLF A;  3D7H A;  3P2F A;  3B3V A;  2Q51 A;  4ORF A;  2BCO A;  3A9L A;  1LRZ A;  3H8G A;  3TFY A;  4IUS A;  1Y9K A;  2ZW5 A;  4BIN A;  5IV0 A;  3FB3 A;  3T90 A;  1YX0 A;  4CS0 B;  2PRB A;  3CT9 A;  4EFD A;  4PXC A;  1CG2 A;  3B3S A;  4A30 A;  4F8Z A;  2PIY A;  3D8P A;  2JEW A;  4YGO A;  4KVO E;  4YU9 A;  2C27 A;  4NGT A;  3PBE A;  2Z3K A;  2NMT A;  2GRE A;  1CPX A;  3KQZ A;  3ZJ0 A;  1YGH A;  5A27 A;  1ZG9 A;  3KKW A;  4ZBG A;  2IMO A;  4ZY2 A;  1BPN A;  4NGN A;  4CRZ B;  1IYL A;  3DLJ A;  2PJ6 A;  4MCR A;  4CPA A;  5LYF A;  5F47 A;  4ZX9 A;  1Y9W A;  3MN8 A;  4UA3 A;  2PCU A;  2PJ1 A;  1QSR A;  3GKR A;  5AG5 A;  3VH9 A;  4ZI6 A;  3G3S A;  4MFJ A;  5I0C A;  3KI9 A;  3I1U A;  2Z3N A;  4XNH B;  4RN7 A;  1ZG8 A;  1XJO A;  4F9V A;  4OC4 A;  1HDQ A;  2JDC A;  4FD7 A;  1QST A;  4MHZ A;  1X10 A;  2QIR A;  1A2Z A;  3JVN A;  4YFJ A;  3GIU A;  3KHZ A;  5D8N A;  1YR0 A;  1TF9 A;  1ZO0 A;  2GIV A;  3TO9 A;  1IB1 E;  3BXM A;  1PCA A;  1HEE A;  1R3N A;  2C6G A;  5G1Z A;  1DE4 C;  1QSO A;  3HUV A;  1NSA A;  3H4Q A;  3WR7 A;  2O28 A;  1IU8 A;  4MFZ A;  2PR1 A;  2RC4 A;  1PYT B;  1BPM A;  2Q0Y A;  2VQY A;  3LWU A;  4UIA A;  4NXY A;  5G21 A;  3TO6 A;  4NEX A;  3NH8 A;  5J8C A;  3FRM A;  2DPS A;  1DTD A;  2QVP A;  4A2Z A;  1Y7E A;  4PK3 A;  1RXT A;  1B6B A;  1UFH A;  2BL1 A;  2FXF A;  2NSM A;  4MJ8 A;  4DYO A;  5K8M A;  3R96 A;  4CAV A;  4EWT A;  2ZW6 A;  4TWE A;  2C1C A;  4UFX A;  5K8P A;  2ZEN A;  3K2K A;  2ABZ A;  1Z8T A;  1AYE A;  4B11 A;  1V0C A;  3FIX A;  1ARM A;  1Y7R A;  2FSR A;  4YWY A;  2P0W A;  3QB8 A;  4A39 A;  2ZXV A;  1LFW A;  2ATR A;  3R95 A;  2NYQ A;  2V8D A;  3GYA A;  3KZW A;  2C6C A;  1YVO A;  4JJX A;  2J8N A;  2VBQ A;  3SHP A;  1M4L A;  5EMI A;  2ZEO A;  3I3G A;  4G1P A;  5IB0 A;  1K4J A;  3ISX A;  3FH4 A;  3FX6 A;  4Y49 C;  3R9G A;  3SXN A;  1IOF A;  3LMS A;  4FWU A;  4NFR A;  2XEI A;  4NJR A;  2PJ3 A;  4P4B A;  4QUS A;  4MFL A;  2HUZ A;  4IHM A;  4NGS A;  4R9M A;  2Q7S A;  1Q2C A;  1TKJ A;  3SI1 A;  1IIC A;  2EVN A;  2JBJ A;  4CYP A;  5KTD A;  2B58 A;  2JBK A;  2DF5 A;  2BUE A;  4KOY A;  1F2O A;  3FED A;  2FIW A;  2B4B A;  1YVK A;  1KZF A;  3TX8 A;  4KSF A;  3EFA A;  1TXR A;  1XF8 A;  4U5Y A;  3VWD A;  3B3W A;  2FL4 A;  2IQ6 A;  4NSQ A;  1VKC A;  4RS2 A;  2OOT A;  3SI0 A;  3W6S A;  4IK2 A;  4NGR A;  2HV2 A;  4OME A;  3FJU A;  1XE4 A;  2JDD A;  2P6E A;  2PJ4 A;  5HVF A;  2ZEH A;  2R98 A;  3SJG A;  2Z3P A;  1VHO A;  2QJ8 A;  2ZEL A;  3KQX A;  2B5G B;  4F0X A;  4MHD A;  1N71 A;  4LUA A;  3N7Z A;  5A28 A;  5IB9 A;  4ZY1 A;  3D2P A;  4P6Y A;  1I12 A;  3PB9 X;  2CNT A;  2ZED A;  3QAH A;  3D3S A;  3RAM A;  4P45 A;  3RYO A;  4AVB A;  1I1D A;  5HVG A;  1BAV A;  3V7Z A;  4K30 A;  2RFH A;  3I9S A;  4KSI A;  2ZW4 A;  4QB9 A;  4H2K A;  3E0K A;  2Z11 A;  1L0C A;  1FT7 A;  2PJA A;  4CGM A;  2EK9 A;  4QVT A;  4X5K A;  1CBX A;  4F6A A;  3DR8 A;  3PP9 A;  4P4F A;  3S9L A;  7CPA A;  1ON0 A;  3RBU A;  2G0B A;  3D67 A;  1U6M A;  3DSB A;  3DDD A;  3BJ8 A;  3PB6 X;  5HH1 A;  1ZLI A;  4EME A;  5HXD A;  4OID A;  5K8N A;  5FVJ A;  1Z8X A;  2GLJ A;  3P2H A;  2WPW A;  2YGW A;  4P4D A;  2OH1 A;  3TOA A;  2VEZ A;  2VL1 A;  4GM5 A;  4R6T A;  1S3Z A;  3C26 A;  2PSW A;  2CTB A;  2PR8 A;  3IGR A;  4NJQ A;  4PPZ A;  4CYN A;  1M44 A;  5LRK A;  3WC5 A;  4KS9 A;  1LAN A;  4ZGY B;  4QBJ A;  4M6H A;  5JGF A;  4FBE A;  4II9 A;  3KGQ A;  4JWP A;  3JUW A;  8CPA A;  1KUY A;  3IIB A;  2AJ6 A;  2DPT A;  3BLN A;  4FAI A;  1M1D A;  4CGP A;  2B5G A;  4PXD A;  4C7H A;  2CF4 A;  3PEI A;  4H6U A;  5AG4 A;  1ARL A;  2AFO A;  4MXU A;  4PV6 A;  4MCS A;  2ZOF A;  2EUI A;  2VZZ A;  5G22 A;  5H84 A;  2D4P A;  2Z3O A;  3FF3 A;  3FNC A;  3VAR A;  4E8O A;  4OP4 A;  4UBR A;  2PJ5 A;  1VHS A;  2AFZ A;  2QEC A;  4KOU A;  2AFS A;  3EO4 A;  1YQE A;  4R8F A;  1RTQ A;  2AFX A;  3EXN A;  3CPA A;  2GAN A;  1LAP A;  3IWE A;  4OC0 A;  1YME A;  4PXE A;  4A31 A;  5DS0 A;  2YND A;  3G8W A;  4DJL A;  2HB6 A;  4KOW A;  5GCN A;  5HVH A;  1Y0Y A;  3WC7 A;  4B14 A;  3NH5 A;  4MMO A;  3SJE A;  2ZEE A;  4O23 A;  2HQY A;  3VAT A;  2G3A A;  2GFQ A;  5AG7 A;  2FT0 A;  4HNW B;  4M6I A;  5F49 A;  2P6F A;  2CY2 A;  4MI4 A;  3LD2 A;  1JWQ A;  2JEV A;  2EO8 A;  2Q4Z A;  3H8F A;  1PU9 A;  4A38 A;  2B3V A;  2PRQ A;  4PQA A;  3NH4 A;  4KOR A;  3S6F A;  2YNC A;  2XEF A;  3R9E A;  1IGB A;  2POK A;  2OB0 A;  3PB7 X;  4ONW A;  3UY5 A;  1S5K A;  4UEE A;  3H5Z A;  4KVX A;  3PFE A;  1Y0R A;  2ANP A;  1YK3 A;  4A37 A;  5J1Q A;  4XPK A;  2KCW A;  2Z3M A;  3TC8 A;  1UWY A;  2EK8 A;  2ZW7 A;  3B8G A;  3CXP A;  3IFE A;  4JXQ A;  4CRY B;  4RUH A;  5AG6 A;  1ELM P;  1YLE A;  3D7F A;  3SJF A;  1F2P A;  4W9Y A;  4C68 A;  3D66 A;  3F5B A;  3D68 A;  1J4J A;  3DGV A;  5HMN A;  1AUG A;  2ZPA A;  4PK2 A;  1R43 A;  4ZY0 A;  2CXA A;  4MBU A;  1CP6 A;  2VZY A;  5LYD A;  3SI2 A;  2B4D B;  4AVC A;  5J8F A;  4B5O A;  4FD6 A;  3SJX A;  4QC6 A;  1KUX A;  4PSX A;  4UWJ A;  4KUA A;  3QAY A;  3TCV A;  2EBJ A;  2AFM A;  3HLP A;  2RB7 A;  3IJ3 A;  3W6X A;  4H6Z A;  3CDX A;  4MCP A;  4U9Z A;  3TO7 A;  4UF4 A;  4MHN A;  5IX3 A;  5KTA A;  3CPX A; 
#chains in the Genus database with same CATH homology
 2WPX A;  3TT2 A;  2Z3L A;  1MJ9 A;  4IF5 A;  1Z9U A;  1P0H A;  4KOV A;  4MY3 A;  4UWI A;  5DWN A;  5AGE A;  1Q2Y A;  1XIX A;  4KSA A;  1MK4 A;  1Z4R A;  4FD5 A;  3FYN A;  4E2A A;  4XPL A;  3TE4 A;  5JQ4 A;  5BWA B;  4H89 A;  2FE7 A;  4MFP A;  3DR6 A;  4KOS A;  4KOT A;  4L89 A;  4B12 A;  2PC1 A;  4YRH A;  3ZZI A;  4M3S A;  2R1I A;  3F0A A;  4CAW A;  2B3U A;  2REF A;  1NE9 A;  4I49 A;  5F48 A;  5C82 A;  4F0Y A;  2B4D A;  4OAE A;  4KZT A;  3CXQ A;  3S6K A;  5F46 A;  2P6G A;  4XNH C;  4R3L A;  1PUA A;  4B10 A;  4MY0 A;  4UFW A;  3EY5 A;  2X7B A;  3OWC A;  2R7H A;  4CGL A;  3TOB A;  2OZG A;  4UCN A;  2Q04 A;  4Q38 A;  2OZH A;  5EC4 A;  4MFK A;  2OU2 A;  1M4D A;  2FS5 A;  1NSL A;  1BO4 A;  3JTK A;  1S60 A;  3BJ7 A;  2JLM A;  4JLY A;  2Z10 A;  3V8I A;  4HNY B;  4KLV A;  5E96 A;  4L8A A;  3IU2 A;  3LOD A;  4Y49 B;  5CNP A;  4R87 A;  1M4G A;  1FY7 A;  3D2M A;  2K5T A;  1KUV A;  2I79 A;  4UCP A;  5JPH A;  2PDO A;  4HKF A;  4AB7 A;  3PGP A;  4RI1 A;  1BOB A;  1CM0 A;  2J8R A;  4EVY A;  2A4N A;  4LX9 A;  1B87 A;  4BMH A;  4HNX B;  1QSN A;  4CAE A;  1S7K A;  4KLW A;  4UCM A;  1CJW A;  4AG7 A;  4CAF A;  2ARH A;  2Z0Z A;  1XEB A;  4A33 A;  1GHE A;  1WK4 A;  5ISV A;  1Z4E A;  3IWG A;  4C2X A;  1OZP A;  3EC4 A;  3S6H A;  4XPD B;  2FIA A;  2OZU A;  4JXR A;  2REE A;  4AG9 A;  4B5P B;  3S6G A;  4CYO A;  4R3K A;  4E0A A;  3FBU A;  3NE7 A;  3K9U A;  2R8V A;  4OAD A;  4NCZ A;  5DWM A;  3T9Y A;  4AVA A;  5G20 A;  2D4O A;  4A32 A;  3FXT A;  2FCK A;  3IU1 A;  2DXQ A;  1S7L A;  2PQ8 A;  1WWZ A;  4DNC A;  2YNC C;  2YNE A;  2GE3 A;  4UFV A;  5EBV A;  3R9F A;  4CAX A;  4Q36 A;  4MFQ A;  2IL4 A;  2Q7B A;  4KUB A;  4KVM E;  1IID A;  4OLL A;  4CGO A;  2G3T A;  3DNS A;  1YRE A;  4CGN A;  2VXK A;  2Y0M A;  4B5P A;  2Q4Y A;  2QML A;  1M4I A;  2F5I A;  2BEI A;  2WUU A;  4PSW A;  4M85 A;  4A95 A;  2Q4V A;  4KOX A;  2BSW A;  4NF1 A;  4GS4 A;  1P4N A;  4ONU A;  2WSA A;  4FD4 A;  4JD6 A;  2CNM A;  2CNS A;  2I00 A;  1IYK A;  2Q44 A;  3R1K A;  1Q2D A;  3MGD A;  3SXO A;  2J8M A;  1RO5 A;  1S7N A;  2H5M A;  3GY9 A;  3PZJ A;  4U9Y A;  5KTC A;  3VWE A;  4BBH A;  5H86 A;  4C2Z A;  4R57 A;  4C2Y A;  1I21 A;  1MJB A;  1TIQ A;  1R57 A;  3CXS A;  3W91 A;  2AE6 A;  4XPD C;  5C88 A;  1MJA A;  3F8K A;  1S7F A;  4CYQ A;  1SQH A;  1QSM A;  1NMT A;  4J3G A;  1XMT A;  2VI7 A;  3TTH A;  3P2F A;  4ORF A;  3A9L A;  1LRZ A;  3TFY A;  4IUS A;  1Y9K A;  2ZW5 A;  5IV0 A;  3FB3 A;  3T90 A;  1YX0 A;  4CS0 B;  2PRB A;  4A30 A;  3D8P A;  4YGO A;  4KVO E;  2C27 A;  2Z3K A;  2NMT A;  5A27 A;  3ZJ0 A;  1YGH A;  3KKW A;  4ZBG A;  4CRZ B;  1IYL A;  5F47 A;  1Y9W A;  4UA3 A;  5AG5 A;  5I0C A;  1QSR A;  3GKR A;  3G3S A;  4MFJ A;  2Z3N A;  4XNH B;  2JDC A;  4FD7 A;  1QST A;  2QIR A;  3JVN A;  4YFJ A;  1YR0 A;  2GIV A;  1ZO0 A;  3TO9 A;  1IB1 E;  5G1Z A;  1QSO A;  3H4Q A;  3WR7 A;  2O28 A;  4MFZ A;  2PR1 A;  2RC4 A;  2Q0Y A;  2VQY A;  5G21 A;  4NXY A;  3TO6 A;  4NEX A;  5J8C A;  3FRM A;  2DPS A;  4A2Z A;  4PK3 A;  1RXT A;  1B6B A;  1UFH A;  2BL1 A;  2FXF A;  4MJ8 A;  3R96 A;  4CAV A;  2ZW6 A;  4UFX A;  4B11 A;  1V0C A;  3FIX A;  2FSR A;  1Y7R A;  2P0W A;  3QB8 A;  2ZXV A;  2ATR A;  3R95 A;  3GYA A;  1YVO A;  4JJX A;  2J8N A;  2VBQ A;  3SHP A;  3I3G A;  5IB0 A;  1K4J A;  3R9G A;  4Y49 C;  3SXN A;  4QUS A;  4MFL A;  2HUZ A;  4R9M A;  1Q2C A;  1IIC A;  2EVN A;  4CYP A;  5KTD A;  2B58 A;  2BUE A;  4KOY A;  2FIW A;  2B4B A;  1YVK A;  1KZF A;  4KSF A;  3EFA A;  1XF8 A;  4U5Y A;  3VWD A;  2FL4 A;  4C7I A;  4NSQ A;  1VKC A;  4RS2 A;  3W6S A;  2HV2 A;  1XE4 A;  2JDD A;  2P6E A;  2R98 A;  2Z3P A;  2B5G B;  4F0X A;  4MHD A;  1N71 A;  4LUA A;  3N7Z A;  5A28 A;  3D2P A;  1I12 A;  2CNT A;  3QAH A;  3D3S A;  3RYO A;  4AVB A;  1I1D A;  4K30 A;  3I9S A;  2ZW4 A;  4QB9 A;  3E0K A;  2Z11 A;  1L0C A;  4CGM A;  4F6A A;  4QVT A;  4X5K A;  3DR8 A;  3PP9 A;  1ON0 A;  2G0B A;  1U6M A;  3DSB A;  3DDD A;  3BJ8 A;  5HH1 A;  5FVJ A;  3P2H A;  2WPW A;  2YGW A;  2OH1 A;  3TOA A;  2VEZ A;  1S3Z A;  3C26 A;  2PSW A;  3IGR A;  2PR8 A;  4CYN A;  1M44 A;  4KS9 A;  4ZGY B;  4QBJ A;  4II9 A;  4JWP A;  3JUW A;  1KUY A;  2AJ6 A;  2DPT A;  3BLN A;  1M1D A;  4CGP A;  2B5G A;  4C7H A;  4H6U A;  5AG4 A;  4PV6 A;  2EUI A;  2VZZ A;  5G22 A;  5H84 A;  2D4P A;  2Z3O A;  3FNC A;  4E8O A;  4UBR A;  1VHS A;  2QEC A;  4KOU A;  3EO4 A;  4B13 A;  3EXN A;  2GAN A;  3IWE A;  4A31 A;  2YND A;  3G8W A;  4KOW A;  5GCN A;  4B14 A;  2HQY A;  2G3A A;  5AG7 A;  2FT0 A;  4HNW B;  5F49 A;  2P6F A;  2CY2 A;  4MI4 A;  3LD2 A;  2JEV A;  1PU9 A;  2B3V A;  4KOR A;  3S6F A;  2YNC A;  3R9E A;  2OB0 A;  3UY5 A;  1S5K A;  3H5Z A;  4KVX A;  1YK3 A;  4XPK A;  2KCW A;  2Z3M A;  2ZW7 A;  3B8G A;  3CXP A;  4JXQ A;  4CRY B;  5AG6 A;  1YLE A;  4C68 A;  3F5B A;  1J4J A;  5HMN A;  2ZPA A;  4PK2 A;  2CXA A;  4MBU A;  2VZY A;  2B4D B;  4AVC A;  5J8F A;  4B5O A;  4FD6 A;  4QC6 A;  1KUX A;  4PSX A;  4UWJ A;  4KUA A;  3TCV A;  3W6X A;  4H6Z A;  4U9Z A;  3TO7 A;  5IX3 A;  5KTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...