3JVNA

Crystal structure of the acetyltransferase vf_1542 from vibrio fischeri, northeast structural genomics consortium target vfr136
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
134
structure length
122
Chain Sequence
PVIRRAKEIDLYCLNSLMYKLHDEHHQQCPDEKSIARYLDDPECMVYVAEMDDVIIGFITGHFCELISTVSKLVMMATIDELYIEKEYRREGVAEQLMMRIEQELKDYGVKEIFVEVWNKGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase
publication title Northeast Structural Genomics Consortium Target VfR136
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 26
structure length 122
sequence length 134
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3jvnA00
2BUEA 4PK3A 4AVAA 3S6GA 2QECA 3FNCA 4GS4A 5KTAA 3TCVA 3FYNA 1IYLA 2JEVA 2FIWA 4I49A 5KTDA 3KKWA 2Q7BA 2ZPAA 2BL1A 2C27A 4IF5A 2B4DA 3B8GA 3DNSA 4H6ZA 2G0BA 4B5PB 3BLNA 3H4QA 1XE4A 3S6HA 3FBUA 2FE7A 3F5BA 1VKCA 1S60A 2J8NA 4KVXA 3TE4A 1QSOA 2ATRA 5F48A 3C26A 3UY5A 4E8OA 2G3AA 4NSQA 1VHSA 5IB0A 1SQHA 1B6BA 5C88A 1MJAA 4HNXB 1Z9UA 1IIDA 2J8RA 3PP9A 4KVME 2J8MA 4CS0B 2ZW7A 1XEBA 3WR7A 5GCNA 3F0AA 2ZW4A 2OZUA 3CXQA 2B5GB 3DR6A 4QB9A 1OZPA 4KLVA 4R57A 1CM0A 4XPDC 4JWPA 2JDDA 3S6FA 2CNTA 2B3VA 2HUZA 2Y0MA 4QUSA 4CRZB 1MJ9A 4QBJA 1IICA 2B4DB 2FXFA 2G3TA 2FCKA 4L89A 2R8VA 4Y49B 1YX0A 2EUIA 4AVCA 4KOTA 1S7KA 5I0CA 3JUWA 2B58A 3TT2A 1I21A 2VZYA 3CXSA 1QSRA 1QSTA 4CAWA 1S7FA 2AE6A 3EC4A 4R87A 2Q0YA 2NMTA 4JJXA 3K9UA 3GKRA 3TOBA 3E0KA 1XIXA 5KTCA 4X5KA 5JPHA 5H84A 1P4NA 2VEZA 2B5GA 1S7LA 2EVNA 1M4IA 2K5TA 1NSLA 3W6XA 1YREA 1Z4RA 3R1KA 1YVKA 2ZW5A 2JDCA 4NF1A 1XMTA 3S6KA 4UBRA 2I00A 4R3KA 3I3GA 4FD4A 2B3UA 3TO7A 2Z10A 4YFJA 1L0CA 4CAVA 1IYKA 3FXTA 2WPWA 4JD6A 1KZFA 1WK4A 1YGHA 2B4BA 4HKFA 4U9YA 3R9FA 5ISVA 4PV6A 1S5KA 1M1DA 2O28A 4M85A 3TOAA 2HV2A 5J8CA 4XPDB 4KUBA 3JVNA 4YGOA 1KUXA 1YLEA 3ZJ0A 2ARHA 4MBUA 1QSMA 4FD7A 4OADA 2CNMA 3PZJA 1UFHA 2Z0ZA 2HQYA 4J3GA 1WWZA 2Q4YA 2D4OA 3GYAA 1R57A 3R9EA 4F6AA 2FSRA 2D4PA 4MHDA 3T90A 2PC1A 1Q2DA 2FT0A 1PUAA 2QIRA 4II9A 2BSWA 2DXQA 3R9GA 3IGRA 4XPLA 5HMNA 1NMTA 4LUAA 2PSWA 1I12A 2KCWA 4AG7A 2WPXA 5E96A 5F46A 3G3SA 3G8WA 5IX3A 2VBQA 1Y7RA 2REFA 4KOVA 5DWNA 4KORA 4NXYA 3IWGA 3D8PA 1U6MA 2H5MA 3SXNA 1J4JA 4XPKA 3DSBA 2PQ8A 4KLWA 3ZZIA 4AB7A 1LRZA 4QVTA 1CJWA 1BO4A 1FY7A 3TO6A 4MI4A 2P6EA 4PSWA 3FB3A 5IV0A 1Z4EA 5EC4A 5JQ4A 1V0CA 4L8AA 4PK2A 4FD6A 1TIQA 5CNPA 3LODA 4BMHA 3SXOA 1Y9KA 3D2PA 5J8FA 2AJ6A 1MK4A 2GANA 4F0YA 3DDDA 3OWCA 1ON0A 2JLMA 3W91A 4KOUA 2Q44A 5HH1A 2F5IA 2ZXVA 1S3ZA 2CY2A 3NE7A 4R3LA 2Q4VA 4UA3A 2VZZA 3VWEA 4KOXA 3N7ZA 1I1DA 2Q04A 4KOYA 2QMLA 5FVJA 2A4NA 1S7NA 3V8IA 1B87A 1RO5A 1BOBA 1M44A 2PDOA 4R9MA 3T9YA 2PR1A 4AG9A 3PGPA 5EBVA 2R98A 4XNHC 4CAXA 1NE9A 1PU9A 4ONUA 3TTHA 3SHPA 4EVYA 1M4DA 3EFAA 4NCZA 4UWJA 4K30A 3P2HA 4MJ8A 2REEA 4AVBA 1XF8A 2OZGA 2P6GA 4HNWB 1YR0A 2R7HA 4FD5A 2VI7A 2X7BA 4NEXA 4OAEA 3EY5A 3TO9A 4RI1A 1YK3A 1YVOA 3P2FA 1N71A 2OZHA 4KOWA 5F49A 2OU2A 3DR8A 4QC6A 3I9SA 2GE3A 2I79A 4CRYB 3RYOA 3D2MA 4IUSA 3W6SA 4RS2A 4KVOE 3TFYA 1IB1E 2CNSA 1MJBA 2PR8A 3D3SA 2RC4A 3F8KA 1KUYA 4PSXA 2P6FA 5C82A 4E2AA 4JXQA 3CXPA 2R1IA 3LD2A 3BJ7A 4KUAA 3R96A 1KUVA 5F47A 3BJ8A 2OB0A 5DWMA 4B5PA 2Z11A 3MGDA 2PRBA 1M4GA 2FS5A 4M3SA 1Y9WA 4HNYB 1RXTA 2VXKA 2FL4A 4MY0A 3EO4A 4JXRA 4UWIA 2P0WA 5H86A 4OLLA 4H6UA 4B5OA 1Q2CA 4DNCA 2VQYA 1K4JA 1QSNA 4KZTA 2IL4A 1GHEA 3QB8A 4ORFA 4JLYA 2ZW6A 3FRMA 4MY3A 4H89A 4E0AA 2OH1A 4Y49C 4KOSA 4ZBGA 4LX9A 4XNHB 2BEIA 2FIAA 3QAHA 3FIXA 4U5YA 4YRHA 3EXNA 2GIVA 3VWDA 1Q2YA 1P0HA 3GY9A 4U9ZA 3R95A
chains in the Genus database with same CATH superfamily
2BUEA 4KSAA 4PK3A 4AVAA 4MHZA 3S6GA 1AUGA 2QECA 4DYOA 3KASA 3FNCA 4RN7A 3QNVA 2YNDA 3D7HA 4GS4A 5KTAA 3TCVA 2XEFA 3VATA 3FYNA 1IYLA 2JEVA 4OP4A 2FIWA 4I49A 4EWTA 4Q38A 5KTDA 2GREA 3T8WA 3KKWA 2Q7BA 4MFQA 2ZPAA 4NGTA 2BL1A 1OBRA 1CBXA 2C27A 2C6PA 2PIYA 4IF5A 4CYOA 2B4DA 3B8GA 3DNSA 2YNCC 4H6ZA 1GYTA 5D29A 2G0BA 4B5PB 5K8PA 3BLNA 3NE8A 2Q7SA 3H4QA 1XE4A 3PRTA 3S6HA 5AG4A 3FBUA 4P4BA 1HEEA 3PBBA 3JRUA 2DEAA 4LQ6A 2VL1A 2FE7A 3F5BA 1VKCA 1S60A 4TWEA 4C2YA 4JYWA 2IJZA 2J8NA 2CTCA 4KVXA 3VH9A 5A27A 4WWVA 1QSOA 3TE4A 5K8OA 2ATRA 5JH9A 1KWMA 3PB4X 5F48A 3IU1A 3C26A 3UY5A 4E8OA 2XEGA 3CPAA 2G3AA 2WZNA 2JBKA 4NSQA 1VHSA 3H8GA 4ZX8A 8CPAA 5IB0A 5D8NA 1SQHA 1B6BA 2PJCA 3BI0A 2BCOA 4FWUA 3BXMA 5C88A 1MJAA 1TKJA 2NSMA 2PJ7A 4CGOA 4HNXB 1DTDA 1Z9UA 1IIDA 2J8RA 3RAMA 3PP9A 4KVME 4MHNA 5LRGA 2J8MA 2PVVA 1YMEA 2YNCA 2ZW7A 4CS0B 5I4MA 1XEBA 1Z8WA 4NGMA 4OMEA 3WR7A 4X2TA 1LFWA 4B14A 1LANA 3SI2A 1LAPA 5GCNA 3F0AA 2ZW4A 2IQ6A 2OZUA 3CXQA 4JZ0A 4HPSA 2B5GB 3DLJA 4TNUA 3KI9A 4FAIA 3DR6A 4QB9A 1OZPA 4KLVA 2O4HA 4R57A 1CM0A 3KR4A 5HVGA 4CGLA 4G1PA 4ONWA 2F8HA 4XPDC 3RNZA 3KHXA 2CF4A 4JWPA 2JDDA 3S6FA 2CNTA 2B3VA 4CYNA 2HUZA 2Y0MA 3CZXA 1XOVA 3IIBA 5CPAA 4M6HA 4QUSA 4A94A 4CRZB 1IOIA 2PJ3A 1Q7LA 1HDQA 1MJ9A 4QBJA 2O53A 1ZG9A 1IICA 2B4DB 2FXFA 2G3TA 5G20A 4R8FA 2FCKA 2PJAA 4UEZA 4OIWA 2POKA 4L89A 1Z8XA 3WC5A 2R8VA 4Y49B 3B3WA 3JTKA 1YX0A 2EUIA 2AFSA 4MFPA 4MCQA 3S9NA 3CT9A 3RO0A 5JGFA 4AVCA 1ELMP 4KOTA 4B13A 1S7KA 3BHXA 4A31A 1XMBA 1Y7EA 5I0CA 4Q7AA 3JUWA 4F9UA 3FECA 4A32A 2B58A 4M6IA 2GLFA 3NH5A 4OC1A 3FX6A 3TT2A 3NA6A 2ZEMA 5ELYA 1I21A 2NYQA 4PPZA 2VZYA 3CXSA 1QSRA 4KSFA 1QSTA 3N5FA 4CAWA 1S7FA 2AE6A 3EC4A 4R87A 5AGEA 2Q0YA 3CDXA 2NMTA 3D68A 4JJXA 4UEEA 5HXDA 4CGMA 3K9UA 3GKRA 3TOBA 3E0KA 1XIXA 5KTCA 3HLPA 4X5KA 1Y0RA 5JPHA 5H84A 4BBHA 4MCPA 1P4NA 2VEZA 4NGRA 2B5GA 1S7LA 4ZX9A 2Q51A 2EVNA 1M4IA 2K5TA 5LYDA 1HDUA 2ZENA 1NSLA 4CYQA 4MCRA 1TF8A 4B6ZA 3W6XA 1YREA 1Z4RA 3R1KA 4KSIA 4P44A 4A39A 4C7IA 1YVKA 1TKFA 3D7DA 2ZW5A 2JDCA 3SI1A 1F2PA 4NF1A 4OC4A 1XMTA 4MMOA 3CPXA 3S6KA 4UBRA 1ZLIA 2I00A 4R3KA 3I3GA 4FD4A 2B3UA 3TO7A 2Z10A 3ISZA 4YFJA 4GXHA 1L0CA 2DPTA 4CAVA 5EMIA 1IYKA 2PJBA 3FXTA 2WPWA 4MRIA 4JD6A 4ZGYB 3S9LA 4FBEA 1KZFA 1WK4A 2PJ2A 1YGHA 2B4BA 2PJ1A 4HKFA 4U9YA 4Q36A 3R9FA 5ISVA 3D67A 4PV6A 4LQGA 2WUUA 1S5KA 1ARMA 4M6GA 4UFWA 4ZY1A 4H2KA 1M1DA 2O28A 4M85A 3VARA 2XEJA 3TOAA 1LAMA 2HV2A 3NH4A 3WABA 1CX8A 4RUHA 5J8CA 4CAFA 1DE4C 4XPDB 2ZEPA 4P4JA 4KUBA 2G9DA 3IFEA 3JVNA 3SJXA 1XRYA 4GM5A 4FUUA 3KR5A 1KUXA 4YGOA 1VHEA 1YLEA 3ZJ0A 4PXDA 2ARHA 5G21A 4CYPA 4MBUA 4IAVA 1QSMA 4FD7A 1VIXA 2J9AA 4OADA 3PEIA 4P4DA 2CNMA 4W9YA 3PZJA 1UFHA 2Z0ZA 4NFRA 3FEEA 2HQYA 3KL9A 1CPSA 4J3GA 1WWZA 2I3CA 2Q4YA 4UFVA 2D4OA 3D66A 2EO8A 2GU2A 3GYAA 2WSAA 3PB6X 3S9MA 1R57A 4OC3A 3R9EA 5A28A 4F6AA 2FSRA 4F0XA 2D4PA 2PRQA 4MHDA 4NGNA 3T90A 4ZI6A 2PC1A 1Q2DA 1ARLA 3V7ZA 2FT0A 1PUAA 5K8MA 2AFMA 2QIRA 2PJ4A 2JEWA 4II9A 2BSWA 1YSJA 2DXQA 4K3NA 4B12A 3R9GA 3IGRA 4XPLA 5HMNA 1NMTA 4LUAA 4DUKA 2PSWA 1A2ZA 1I12A 3FJUA 2C6CA 4CAEA 2KCWA 4AG7A 2WPXA 4P10A 5E96A 3K2KA 6CPAA 5F46A 3G3SA 3G8WA 5IX3A 5DS0A 2VBQA 1Y7RA 2ZEEA 2REFA 4F9VA 4KOVA 7CPAA 5DWNA 4UFXA 4KORA 4NXYA 2ZEFA 3D8PA 1U6MA 1R43A 3IWGA 1TF9A 3D4UA 2H5MA 4OKOA 2HB6A 3FEDA 1IY7A 3KHZA 1FNOA 3SXNA 4MHYA 1J4JA 2F7VA 3GB0A 4XPKA 4X3RA 4ZYQA 3DSBA 4C2ZA 2AFUA 2PQ8A 4KLWA 2V8HA 4NJRA 3ZZIA 1LRZA 4IK2A 2ZEDA 4AB7A 2JBJA 4UCPA 4QVTA 5LRKA 2ZEGA 1CJWA 1UWYA 2AFXA 1BO4A 3LMSA 4R7MA 3SJEA 1FY7A 4OC0A 1F57A 4MI4A 3FH4A 3TO6A 2P6EA 4PSWA 3FB3A 5IV0A 1Z4EA 5EC4A 4A38A 2Z3LA 1BPMA 5JQ4A 4X8IA 1NSAA 1V0CA 4L8AA 1PCAA 4PK2A 1FT7A 3K9TA 4FD6A 3B35A 2CXAA 1TIQA 4WJBA 2C1CA 2Z3PA 3SJFA 2PIZA 3KQZA 3RBUA 5CNPA 3LODA 5LYFA 2XEIA 1AMPA 4BMHA 3FF3A 3SXOA 1Y9KA 3H8FA 2EBJA 5G1ZA 3D2PA 5J8FA 2AJ6A 3IC1A 1MK4A 2GANA 2ODFA 3IWWA 4F0YA 3DDDA 1IGBA 1ON0A 1Y0YA 2JLMA 3IJ3A 3OWCA 4KOUA 3W91A 1ELLP 2GFQA 2Q44A 2QJ8A 3LWUA 5HH1A 5LYIA 4PXEA 3PFOA 4ZY0A 5LYLA 2EK8A 3SI0A 1ZLHA 2EWBA 4Z65A 1Z2LA 2F5IA 4O23A 2CIJA 1VHOA 2ZXVA 1ZO0A 1S3ZA 2Q43A 2CY2A 3NE7A 4R3LA 2Q4VA 5LRJA 4UA3A 2V8DA 2VZZA 3VWEA 1BPNA 1H8LA 4KOXA 3PFEA 5AG7A 3N7ZA 1I1DA 2Q04A 2RFHA 4KOYA 2QMLA 5FVJA 4NGSA 2A4NA 4R6TA 1S7NA 1F2OA 3V8IA 1B87A 1RO5A 1QQ9A 3B2YA 3GIUA 2PJ8A 4PXBA 3B3CA 1BOBA 1M44A 4P4EA 4P4IA 2PDOA 5BWAB 3V38A 4R9MA 4EMEA 3WC7A 3T9YA 2PR1A 4OIDA 3H8EA 5THWA 2IMOA 4UCNA 2OOTA 4AG9A 4YU9A 1LCPA 5JM6A 2HC9A 1JQGA 1QMUA 3PGPA 3B3VA 3KQXA 1EE3P 5EBVA 2FVGA 4EFDA 3B3SA 3NFZA 4UCMA 2R98A 4XNHC 4UIBA 4CAXA 4KS9A 1NE9A 5J1QA 3DGVA 1PU9A 4ONUA 3TTHA 3SHPA 4EVYA 2PJ9A 2Q4ZA 3D7FA 1M4DA 1BLLE 2ZOGA 3EFAA 3L2NA 3IWEA 1YW4A 3H5ZA 4NCZA 4UWJA 4K30A 3B3TA 3P2HA 4MJ8A 3A9LA 3PB7X 4UIAA 2REEA 2ZEOA 4AVBA 1XF8A 2YGWA 2OZGA 2P6GA 4HNWB 1YR0A 2R7HA 2Z3KA 4FD5A 2VI7A 2ZEHA 3PB8X 4IHMA 2X7BA 3BI1A 3FVLA 3KZWA 4NEXA 4NGPA 3WC6A 2QYVA 1YW6A 4OAEA 1JWQA 3EY5A 3TO9A 3KGQA 4RI1A 1YLOA 1YK3A 2ANPA 4MCSA 5AG5A 3WT4A 4CPAA 4ZY2A 1YVOA 3IO1A 3P2FA 1N71A 1X12A 2ZELA 3B7IA 2OZHA 2V77A 4KOWA 1TXRA 3IEHA 5F49A 2OU2A 3DR8A 4MFKA 3MN8A 1Z8LA 4QC6A 4AXVA 3I9SA 1Z5RA 1ZG7A 1XBUA 2GE3A 4A30A 2RB7A 2I79A 1YQEA 4A2ZA 2WYRA 1CP6A 4NGQA 1ZG8A 3D2MA 4IUSA 3RYOA 4CRYB 4C7HA 3W6SA 1CG2A 1PYTB 4RS2A 4C2XA 3QAYA 4KVOE 2PJ5A 3RZAA 3TFYA 1IB1E 2CNSA 1MJBA 2PR8A 3D3SA 2RC4A 1IU8A 3FMCA 3F8KA 2YNEA 4MFJA 5HVHA 5AG6A 1KUYA 4PSXA 2AFZA 2P6FA 3ISXA 5C82A 4E2AA 3MRUA 4JXQA 4PQAA 3CXPA 4A37A 4MFZA 4CGPA 5K8NA 2GLJA 2R1IA 2PE3A 1Z8TA 1BAVA 3LD2A 3BJ7A 4KUAA 3R96A 4BD9A 1VGYA 1KUVA 2ABZA 3PB9X 4P6YA 2Z3MA 4OC2A 2AFOA 4UEFA 2PJ0A 3HUVA 5F47A 4C68A 4NJQA 3BJ8A 2OB0A 1CPXA 1CP7A 5DWMA 4B5PA 5G22A 2Z11A 4MXUA 3MGDA 2PRBA 1M4GA 1M4LA 2FS5A 4M3SA 1Y9WA 4HNYB 3TX8A 4F8ZA 5IB9A 2AFWA 2PVWA 3D7GA 3LACA 4OC5A 2C6GA 5F09A 1RXTA 4A33A 2CTBA 2VXKA 2DF5A 1AYEA 1IOFA 2FL4A 4MY0A 3EO4A 4JXRA 4UF4A 3NH8A 4UWIA 4CGNA 2P0WA 1TKHA 5H86A 4OLLA 4H6UA 4B5OA 4B10A 1LOKA 1X10A 1Q2CA 2BO9A 1XFOA 3IU2A 2V8GA 1RTQA 2ZOFA 2BOAA 4DNCA 1K4JA 1QSNA 2VQYA 5CBMA 4KZTA 2IL4A 5HVFA 1GHEA 2QVPA 3QB8A 4A95A 4DJLA 4ORFA 4JLYA 4MHPA 2ZW6A 2V8VA 2PCUA 3FRMA 2Z3OA 2PJ6A 3PBEA 2EK9A 2OR4A 1R3NA 4MY3A 4H89A 4E0AA 4PXCA 4BINA 2OH1A 3SJGA 4Y49C 3GLJA 4KOSA 4ZBGA 2DPSA 3TC8A 3I1UA 4P4FA 4LX9A 4XNHB 2BEIA 2FIAA 3QAHA 3FIXA 4U5YA 4YWYA 4B11A 1XJOA 4YRHA 2Z3NA 2GIVA 3EXNA 3GUXA 4P45A 3VWDA 4MFLA 1Q2YA 4R76A 1P0HA 3GY9A 4U9ZA 3R95A
chains in the Genus database with same CATH topology
2BUEA 4KSAA 4PK3A 4AVAA 3S6GA 2QECA 3FNCA 2YNDA 4GS4A 5KTAA 3TCVA 3FYNA 1IYLA 2JEVA 2FIWA 4I49A 4Q38A 5KTDA 3KKWA 2Q7BA 4MFQA 2ZPAA 2BL1A 2C27A 4IF5A 4CYOA 2B4DA 3B8GA 3DNSA 2YNCC 4H6ZA 2G0BA 4B5PB 3BLNA 5AG4A 3H4QA 1XE4A 3S6HA 3FBUA 2FE7A 3F5BA 1VKCA 1S60A 4C2YA 2J8NA 4KVXA 3TE4A 5A27A 1QSOA 2ATRA 5F48A 3IU1A 3C26A 3UY5A 4E8OA 2G3AA 4NSQA 1VHSA 5IB0A 1SQHA 1B6BA 5C88A 1MJAA 4CGOA 4HNXB 1Z9UA 1IIDA 2J8RA 3PP9A 4KVME 2J8MA 2YNCA 2ZW7A 4CS0B 1XEBA 3WR7A 4B14A 5GCNA 3F0AA 2ZW4A 2OZUA 3CXQA 2B5GB 3DR6A 4QB9A 1OZPA 4KLVA 4R57A 1CM0A 4CGLA 4XPDC 4JWPA 2JDDA 3S6FA 2CNTA 2B3VA 4CYNA 2HUZA 2Y0MA 4QUSA 4CRZB 1MJ9A 4QBJA 1IICA 2B4DB 2FXFA 2G3TA 5G20A 2FCKA 4L89A 2R8VA 4Y49B 3JTKA 1YX0A 2EUIA 4MFPA 4AVCA 4KOTA 4B13A 1S7KA 4A31A 5I0CA 3JUWA 4A32A 2B58A 3TT2A 1I21A 2VZYA 3CXSA 1QSRA 4KSFA 1QSTA 4CAWA 1S7FA 2AE6A 3EC4A 4R87A 5AGEA 2Q0YA 2NMTA 4JJXA 4CGMA 3K9UA 3GKRA 3TOBA 3E0KA 1XIXA 5KTCA 4X5KA 5JPHA 5H84A 4BBHA 1P4NA 2VEZA 2B5GA 1S7LA 2EVNA 1M4IA 2K5TA 1NSLA 4CYQA 3W6XA 1YREA 1Z4RA 3R1KA 4C7IA 1YVKA 2ZW5A 2JDCA 4NF1A 1XMTA 3S6KA 4UBRA 2I00A 4R3KA 3I3GA 4FD4A 2B3UA 3TO7A 2Z10A 4YFJA 1L0CA 2DPTA 4CAVA 1IYKA 3FXTA 2WPWA 4ZGYB 4JD6A 1KZFA 1WK4A 1YGHA 2B4BA 4HKFA 4U9YA 4Q36A 3R9FA 5ISVA 4PV6A 2WUUA 1S5KA 4UFWA 1M1DA 2O28A 4M85A 3TOAA 2HV2A 5J8CA 4CAFA 4XPDB 4KUBA 3JVNA 4YGOA 1KUXA 1YLEA 3ZJ0A 2ARHA 5G21A 4CYPA 4MBUA 1QSMA 4FD7A 4OADA 2CNMA 3PZJA 1UFHA 2Z0ZA 2HQYA 4J3GA 1WWZA 2Q4YA 4UFVA 2D4OA 3GYAA 2WSAA 1R57A 3R9EA 5A28A 4F6AA 2FSRA 4F0XA 2D4PA 4MHDA 3T90A 2PC1A 1Q2DA 2FT0A 1PUAA 2QIRA 4II9A 2BSWA 2DXQA 4B12A 3R9GA 3IGRA 4XPLA 5HMNA 1NMTA 4LUAA 2PSWA 1I12A 4CAEA 2KCWA 4AG7A 2WPXA 5E96A 5F46A 3G3SA 3G8WA 5IX3A 2VBQA 1Y7RA 2REFA 4KOVA 5DWNA 4UFXA 4KORA 4NXYA 3IWGA 3D8PA 1U6MA 2H5MA 3SXNA 1J4JA 4XPKA 3DSBA 4C2ZA 2PQ8A 4KLWA 3ZZIA 4AB7A 1LRZA 4UCPA 4QVTA 1CJWA 1BO4A 1FY7A 3TO6A 4MI4A 2P6EA 4PSWA 3FB3A 5IV0A 1Z4EA 5EC4A 2Z3LA 5JQ4A 1V0CA 4L8AA 4PK2A 4FD6A 2CXAA 1TIQA 2Z3PA 5CNPA 3LODA 4BMHA 3SXOA 1Y9KA 5G1ZA 3D2PA 5J8FA 2AJ6A 1MK4A 2GANA 4F0YA 3DDDA 3OWCA 1ON0A 2JLMA 3W91A 4KOUA 2Q44A 5HH1A 2F5IA 2ZXVA 1ZO0A 1S3ZA 2CY2A 3NE7A 4R3LA 2Q4VA 4UA3A 2VZZA 3VWEA 4KOXA 5AG7A 3N7ZA 1I1DA 2Q04A 4KOYA 2QMLA 5FVJA 2A4NA 1S7NA 3V8IA 1B87A 1RO5A 1BOBA 1M44A 5BWAB 2PDOA 4R9MA 3T9YA 2PR1A 4UCNA 4AG9A 3PGPA 5EBVA 4UCMA 2R98A 4XNHC 4CAXA 4KS9A 1NE9A 1PU9A 4ONUA 3TTHA 3SHPA 4EVYA 1M4DA 3EFAA 3IWEA 3H5ZA 4NCZA 4UWJA 4K30A 3P2HA 4MJ8A 3A9LA 2REEA 4AVBA 1XF8A 2YGWA 2OZGA 2P6GA 4HNWB 1YR0A 2R7HA 2Z3KA 4FD5A 2VI7A 2X7BA 4NEXA 4OAEA 3EY5A 3TO9A 4RI1A 1YK3A 5AG5A 1YVOA 3P2FA 1N71A 2OZHA 4KOWA 5F49A 2OU2A 3DR8A 4MFKA 4QC6A 3I9SA 2GE3A 4A30A 2I79A 4A2ZA 4CRYB 3RYOA 3D2MA 4IUSA 4C7HA 3W6SA 4C2XA 4RS2A 4KVOE 3TFYA 1IB1E 2CNSA 1MJBA 2PR8A 3D3SA 2RC4A 4MFJA 3F8KA 2YNEA 5AG6A 1KUYA 4PSXA 2P6FA 5C82A 4E2AA 4JXQA 3CXPA 4CGPA 4MFZA 2R1IA 3LD2A 3BJ7A 4KUAA 3R96A 1KUVA 2Z3MA 5F47A 4C68A 3BJ8A 2OB0A 5DWMA 4B5PA 5G22A 2Z11A 3MGDA 2PRBA 1M4GA 2FS5A 4M3SA 1Y9WA 4HNYB 1RXTA 4A33A 2VXKA 2FL4A 4MY0A 3EO4A 4JXRA 4UWIA 4CGNA 2P0WA 5H86A 4OLLA 4H6UA 4B5OA 4B10A 1Q2CA 3IU2A 4DNCA 2VQYA 1K4JA 1QSNA 4KZTA 2IL4A 1GHEA 3QB8A 4A95A 4ORFA 4JLYA 2ZW6A 3FRMA 2Z3OA 4MY3A 4H89A 4E0AA 2OH1A 4Y49C 4KOSA 4ZBGA 2DPSA 4LX9A 4XNHB 2BEIA 2FIAA 3QAHA 3FIXA 4U5YA 4B11A 4YRHA 2Z3NA 2GIVA 3EXNA 3VWDA 4MFLA 1Q2YA 1P0HA 3GY9A 4U9ZA 3R95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUE A;  4PK3 A;  4AVA A;  3S6G A;  2QEC A;  3FNC A;  4GS4 A;  5KTA A;  3TCV A;  3FYN A;  1IYL A;  2JEV A;  2FIW A;  4I49 A;  5KTD A;  3KKW A;  2Q7B A;  2ZPA A;  2BL1 A;  2C27 A;  4IF5 A;  2B4D A;  3B8G A;  3DNS A;  4H6Z A;  2G0B A;  4B5P B;  3BLN A;  3H4Q A;  1XE4 A;  3S6H A;  3FBU A;  2FE7 A;  3F5B A;  1VKC A;  1S60 A;  2J8N A;  4KVX A;  3TE4 A;  1QSO A;  2ATR A;  5F48 A;  3C26 A;  3UY5 A;  4E8O A;  2G3A A;  4NSQ A;  1VHS A;  5IB0 A;  1SQH A;  1B6B A;  5C88 A;  1MJA A;  4HNX B;  1Z9U A;  1IID A;  2J8R A;  3PP9 A;  4KVM E;  2J8M A;  4CS0 B;  2ZW7 A;  1XEB A;  3WR7 A;  5GCN A;  3F0A A;  2ZW4 A;  2OZU A;  3CXQ A;  2B5G B;  3DR6 A;  4QB9 A;  1OZP A;  4KLV A;  4R57 A;  1CM0 A;  4XPD C;  4JWP A;  2JDD A;  3S6F A;  2CNT A;  2B3V A;  2HUZ A;  2Y0M A;  4QUS A;  4CRZ B;  1MJ9 A;  4QBJ A;  1IIC A;  2B4D B;  2FXF A;  2G3T A;  2FCK A;  4L89 A;  2R8V A;  4Y49 B;  1YX0 A;  2EUI A;  4AVC A;  4KOT A;  1S7K A;  5I0C A;  3JUW A;  2B58 A;  3TT2 A;  1I21 A;  2VZY A;  3CXS A;  1QSR A;  1QST A;  4CAW A;  1S7F A;  2AE6 A;  3EC4 A;  4R87 A;  2Q0Y A;  2NMT A;  4JJX A;  3K9U A;  3GKR A;  3TOB A;  3E0K A;  1XIX A;  5KTC A;  4X5K A;  5JPH A;  5H84 A;  1P4N A;  2VEZ A;  2B5G A;  1S7L A;  2EVN A;  1M4I A;  2K5T A;  1NSL A;  3W6X A;  1YRE A;  1Z4R A;  3R1K A;  1YVK A;  2ZW5 A;  2JDC A;  4NF1 A;  1XMT A;  3S6K A;  4UBR A;  2I00 A;  4R3K A;  3I3G A;  4FD4 A;  2B3U A;  3TO7 A;  2Z10 A;  4YFJ A;  1L0C A;  4CAV A;  1IYK A;  3FXT A;  2WPW A;  4JD6 A;  1KZF A;  1WK4 A;  1YGH A;  2B4B A;  4HKF A;  4U9Y A;  3R9F A;  5ISV A;  4PV6 A;  1S5K A;  1M1D A;  2O28 A;  4M85 A;  3TOA A;  2HV2 A;  5J8C A;  4XPD B;  4KUB A;  3JVN A;  4YGO A;  1KUX A;  1YLE A;  3ZJ0 A;  2ARH A;  4MBU A;  1QSM A;  4FD7 A;  4OAD A;  2CNM A;  3PZJ A;  1UFH A;  2Z0Z A;  2HQY A;  4J3G A;  1WWZ A;  2Q4Y A;  2D4O A;  3GYA A;  1R57 A;  3R9E A;  4F6A A;  2FSR A;  2D4P A;  4MHD A;  3T90 A;  2PC1 A;  1Q2D A;  2FT0 A;  1PUA A;  2QIR A;  4II9 A;  2BSW A;  2DXQ A;  3R9G A;  3IGR A;  4XPL A;  5HMN A;  1NMT A;  4LUA A;  2PSW A;  1I12 A;  2KCW A;  4AG7 A;  2WPX A;  5E96 A;  5F46 A;  3G3S A;  3G8W A;  5IX3 A;  2VBQ A;  1Y7R A;  2REF A;  4KOV A;  5DWN A;  4KOR A;  4NXY A;  3IWG A;  3D8P A;  1U6M A;  2H5M A;  3SXN A;  1J4J A;  4XPK A;  3DSB A;  2PQ8 A;  4KLW A;  3ZZI A;  4AB7 A;  1LRZ A;  4QVT A;  1CJW A;  1BO4 A;  1FY7 A;  3TO6 A;  4MI4 A;  2P6E A;  4PSW A;  3FB3 A;  5IV0 A;  1Z4E A;  5EC4 A;  5JQ4 A;  1V0C A;  4L8A A;  4PK2 A;  4FD6 A;  1TIQ A;  5CNP A;  3LOD A;  4BMH A;  3SXO A;  1Y9K A;  3D2P A;  5J8F A;  2AJ6 A;  1MK4 A;  2GAN A;  4F0Y A;  3DDD A;  3OWC A;  1ON0 A;  2JLM A;  3W91 A;  4KOU A;  2Q44 A;  5HH1 A;  2F5I A;  2ZXV A;  1S3Z A;  2CY2 A;  3NE7 A;  4R3L A;  2Q4V A;  4UA3 A;  2VZZ A;  3VWE A;  4KOX A;  3N7Z A;  1I1D A;  2Q04 A;  4KOY A;  2QML A;  5FVJ A;  2A4N A;  1S7N A;  3V8I A;  1B87 A;  1RO5 A;  1BOB A;  1M44 A;  2PDO A;  4R9M A;  3T9Y A;  2PR1 A;  4AG9 A;  3PGP A;  5EBV A;  2R98 A;  4XNH C;  4CAX A;  1NE9 A;  1PU9 A;  4ONU A;  3TTH A;  3SHP A;  4EVY A;  1M4D A;  3EFA A;  4NCZ A;  4UWJ A;  4K30 A;  3P2H A;  4MJ8 A;  2REE A;  4AVB A;  1XF8 A;  2OZG A;  2P6G A;  4HNW B;  1YR0 A;  2R7H A;  4FD5 A;  2VI7 A;  2X7B A;  4NEX A;  4OAE A;  3EY5 A;  3TO9 A;  4RI1 A;  1YK3 A;  1YVO A;  3P2F A;  1N71 A;  2OZH A;  4KOW A;  5F49 A;  2OU2 A;  3DR8 A;  4QC6 A;  3I9S A;  2GE3 A;  2I79 A;  4CRY B;  3RYO A;  3D2M A;  4IUS A;  3W6S A;  4RS2 A;  4KVO E;  3TFY A;  1IB1 E;  2CNS A;  1MJB A;  2PR8 A;  3D3S A;  2RC4 A;  3F8K A;  1KUY A;  4PSX A;  2P6F A;  5C82 A;  4E2A A;  4JXQ A;  3CXP A;  2R1I A;  3LD2 A;  3BJ7 A;  4KUA A;  3R96 A;  1KUV A;  5F47 A;  3BJ8 A;  2OB0 A;  5DWM A;  4B5P A;  2Z11 A;  3MGD A;  2PRB A;  1M4G A;  2FS5 A;  4M3S A;  1Y9W A;  4HNY B;  1RXT A;  2VXK A;  2FL4 A;  4MY0 A;  3EO4 A;  4JXR A;  4UWI A;  2P0W A;  5H86 A;  4OLL A;  4H6U A;  4B5O A;  1Q2C A;  4DNC A;  2VQY A;  1K4J A;  1QSN A;  4KZT A;  2IL4 A;  1GHE A;  3QB8 A;  4ORF A;  4JLY A;  2ZW6 A;  3FRM A;  4MY3 A;  4H89 A;  4E0A A;  2OH1 A;  4Y49 C;  4KOS A;  4ZBG A;  4LX9 A;  4XNH B;  2BEI A;  2FIA A;  3QAH A;  3FIX A;  4U5Y A;  4YRH A;  3EXN A;  2GIV A;  3VWD A;  1Q2Y A;  1P0H A;  3GY9 A;  4U9Z A;  3R95 A; 
#chains in the Genus database with same CATH topology
 2BUE A;  4KSA A;  4PK3 A;  4AVA A;  4MHZ A;  3S6G A;  1AUG A;  2QEC A;  4DYO A;  3KAS A;  3FNC A;  4RN7 A;  3QNV A;  2YND A;  3D7H A;  4GS4 A;  5KTA A;  3TCV A;  2XEF A;  3VAT A;  3FYN A;  1IYL A;  2JEV A;  4OP4 A;  2FIW A;  4I49 A;  4EWT A;  4Q38 A;  5KTD A;  2GRE A;  3T8W A;  3KKW A;  2Q7B A;  4MFQ A;  2ZPA A;  4NGT A;  2BL1 A;  1OBR A;  1CBX A;  2C27 A;  2C6P A;  2PIY A;  4IF5 A;  4CYO A;  2B4D A;  3B8G A;  3DNS A;  2YNC C;  4H6Z A;  1GYT A;  5D29 A;  2G0B A;  4B5P B;  5K8P A;  3BLN A;  3NE8 A;  2Q7S A;  3H4Q A;  1XE4 A;  3PRT A;  3S6H A;  5AG4 A;  3FBU A;  4P4B A;  1HEE A;  3PBB A;  3JRU A;  2DEA A;  4LQ6 A;  2VL1 A;  2FE7 A;  3F5B A;  1VKC A;  1S60 A;  4TWE A;  4C2Y A;  4JYW A;  2IJZ A;  2J8N A;  2CTC A;  4KVX A;  3VH9 A;  5A27 A;  4WWV A;  1QSO A;  3TE4 A;  5K8O A;  2ATR A;  5JH9 A;  1KWM A;  3PB4 X;  5F48 A;  3IU1 A;  3C26 A;  3UY5 A;  4E8O A;  2XEG A;  3CPA A;  2G3A A;  2WZN A;  2JBK A;  4NSQ A;  1VHS A;  3H8G A;  4ZX8 A;  8CPA A;  5IB0 A;  5D8N A;  1SQH A;  1B6B A;  2PJC A;  3BI0 A;  2BCO A;  4FWU A;  3BXM A;  5C88 A;  1MJA A;  1TKJ A;  2NSM A;  2PJ7 A;  4CGO A;  4HNX B;  1DTD A;  1Z9U A;  1IID A;  2J8R A;  3RAM A;  3PP9 A;  4KVM E;  4MHN A;  5LRG A;  2J8M A;  2PVV A;  1YME A;  2YNC A;  2ZW7 A;  4CS0 B;  5I4M A;  1XEB A;  1Z8W A;  4NGM A;  4OME A;  3WR7 A;  4X2T A;  1LFW A;  4B14 A;  1LAN A;  3SI2 A;  1LAP A;  5GCN A;  3F0A A;  2ZW4 A;  2IQ6 A;  2OZU A;  3CXQ A;  4JZ0 A;  4HPS A;  2B5G B;  3DLJ A;  4TNU A;  3KI9 A;  4FAI A;  3DR6 A;  4QB9 A;  1OZP A;  4KLV A;  2O4H A;  4R57 A;  1CM0 A;  3KR4 A;  5HVG A;  4CGL A;  4G1P A;  4ONW A;  2F8H A;  4XPD C;  3RNZ A;  3KHX A;  2CF4 A;  4JWP A;  2JDD A;  3S6F A;  2CNT A;  2B3V A;  4CYN A;  2HUZ A;  2Y0M A;  3CZX A;  1XOV A;  3IIB A;  5CPA A;  4M6H A;  4QUS A;  4A94 A;  4CRZ B;  1IOI A;  2PJ3 A;  1Q7L A;  1HDQ A;  1MJ9 A;  4QBJ A;  2O53 A;  1ZG9 A;  1IIC A;  2B4D B;  2FXF A;  2G3T A;  5G20 A;  4R8F A;  2FCK A;  2PJA A;  4UEZ A;  4OIW A;  2POK A;  4L89 A;  1Z8X A;  3WC5 A;  2R8V A;  4Y49 B;  3B3W A;  3JTK A;  1YX0 A;  2EUI A;  2AFS A;  4MFP A;  4MCQ A;  3S9N A;  3CT9 A;  3RO0 A;  5JGF A;  4AVC A;  1ELM P;  4KOT A;  4B13 A;  1S7K A;  3BHX A;  4A31 A;  1XMB A;  1Y7E A;  5I0C A;  4Q7A A;  3JUW A;  4F9U A;  3FEC A;  4A32 A;  2B58 A;  4M6I A;  2GLF A;  3NH5 A;  4OC1 A;  3FX6 A;  3TT2 A;  3NA6 A;  2ZEM A;  5ELY A;  1I21 A;  2NYQ A;  4PPZ A;  2VZY A;  3CXS A;  1QSR A;  4KSF A;  1QST A;  3N5F A;  4CAW A;  1S7F A;  2AE6 A;  3EC4 A;  4R87 A;  5AGE A;  2Q0Y A;  3CDX A;  2NMT A;  3D68 A;  4JJX A;  4UEE A;  5HXD A;  4CGM A;  3K9U A;  3GKR A;  3TOB A;  3E0K A;  1XIX A;  5KTC A;  3HLP A;  4X5K A;  1Y0R A;  5JPH A;  5H84 A;  4BBH A;  4MCP A;  1P4N A;  2VEZ A;  4NGR A;  2B5G A;  1S7L A;  4ZX9 A;  2Q51 A;  2EVN A;  1M4I A;  2K5T A;  5LYD A;  1HDU A;  2ZEN A;  1NSL A;  4CYQ A;  4MCR A;  1TF8 A;  4B6Z A;  3W6X A;  1YRE A;  1Z4R A;  3R1K A;  4KSI A;  4P44 A;  4A39 A;  4C7I A;  1YVK A;  1TKF A;  3D7D A;  2ZW5 A;  2JDC A;  3SI1 A;  1F2P A;  4NF1 A;  4OC4 A;  1XMT A;  4MMO A;  3CPX A;  3S6K A;  4UBR A;  1ZLI A;  2I00 A;  4R3K A;  3I3G A;  4FD4 A;  2B3U A;  3TO7 A;  2Z10 A;  3ISZ A;  4YFJ A;  4GXH A;  1L0C A;  2DPT A;  4CAV A;  5EMI A;  1IYK A;  2PJB A;  3FXT A;  2WPW A;  4MRI A;  4JD6 A;  4ZGY B;  3S9L A;  4FBE A;  1KZF A;  1WK4 A;  2PJ2 A;  1YGH A;  2B4B A;  2PJ1 A;  4HKF A;  4U9Y A;  4Q36 A;  3R9F A;  5ISV A;  3D67 A;  4PV6 A;  4LQG A;  2WUU A;  1S5K A;  1ARM A;  4M6G A;  4UFW A;  4ZY1 A;  4H2K A;  1M1D A;  2O28 A;  4M85 A;  3VAR A;  2XEJ A;  3TOA A;  1LAM A;  2HV2 A;  3NH4 A;  3WAB A;  1CX8 A;  4RUH A;  5J8C A;  4CAF A;  1DE4 C;  4XPD B;  2ZEP A;  4P4J A;  4KUB A;  2G9D A;  3IFE A;  3JVN A;  3SJX A;  1XRY A;  4GM5 A;  4FUU A;  3KR5 A;  1KUX A;  4YGO A;  1VHE A;  1YLE A;  3ZJ0 A;  4PXD A;  2ARH A;  5G21 A;  4CYP A;  4MBU A;  4IAV A;  1QSM A;  4FD7 A;  1VIX A;  2J9A A;  4OAD A;  3PEI A;  4P4D A;  2CNM A;  4W9Y A;  3PZJ A;  1UFH A;  2Z0Z A;  4NFR A;  3FEE A;  2HQY A;  3KL9 A;  1CPS A;  4J3G A;  1WWZ A;  2I3C A;  2Q4Y A;  4UFV A;  2D4O A;  3D66 A;  2EO8 A;  2GU2 A;  3GYA A;  2WSA A;  3PB6 X;  3S9M A;  1R57 A;  4OC3 A;  3R9E A;  5A28 A;  4F6A A;  2FSR A;  4F0X A;  2D4P A;  2PRQ A;  4MHD A;  4NGN A;  3T90 A;  4ZI6 A;  2PC1 A;  1Q2D A;  1ARL A;  3V7Z A;  2FT0 A;  1PUA A;  5K8M A;  2AFM A;  2QIR A;  2PJ4 A;  2JEW A;  4II9 A;  2BSW A;  1YSJ A;  2DXQ A;  4K3N A;  4B12 A;  3R9G A;  3IGR A;  4XPL A;  5HMN A;  1NMT A;  4LUA A;  4DUK A;  2PSW A;  1A2Z A;  1I12 A;  3FJU A;  2C6C A;  4CAE A;  2KCW A;  4AG7 A;  2WPX A;  4P10 A;  5E96 A;  3K2K A;  6CPA A;  5F46 A;  3G3S A;  3G8W A;  5IX3 A;  5DS0 A;  2VBQ A;  1Y7R A;  2ZEE A;  2REF A;  4F9V A;  4KOV A;  7CPA A;  5DWN A;  4UFX A;  4KOR A;  4NXY A;  2ZEF A;  3D8P A;  1U6M A;  1R43 A;  3IWG A;  1TF9 A;  3D4U A;  2H5M A;  4OKO A;  2HB6 A;  3FED A;  1IY7 A;  3KHZ A;  1FNO A;  3SXN A;  4MHY A;  1J4J A;  2F7V A;  3GB0 A;  4XPK A;  4X3R A;  4ZYQ A;  3DSB A;  4C2Z A;  2AFU A;  2PQ8 A;  4KLW A;  2V8H A;  4NJR A;  3ZZI A;  1LRZ A;  4IK2 A;  2ZED A;  4AB7 A;  2JBJ A;  4UCP A;  4QVT A;  5LRK A;  2ZEG A;  1CJW A;  1UWY A;  2AFX A;  1BO4 A;  3LMS A;  4R7M A;  3SJE A;  1FY7 A;  4OC0 A;  1F57 A;  4MI4 A;  3FH4 A;  3TO6 A;  2P6E A;  4PSW A;  3FB3 A;  5IV0 A;  1Z4E A;  5EC4 A;  4A38 A;  2Z3L A;  1BPM A;  5JQ4 A;  4X8I A;  1NSA A;  1V0C A;  4L8A A;  1PCA A;  4PK2 A;  1FT7 A;  3K9T A;  4FD6 A;  3B35 A;  2CXA A;  1TIQ A;  4WJB A;  2C1C A;  2Z3P A;  3SJF A;  2PIZ A;  3KQZ A;  3RBU A;  5CNP A;  3LOD A;  5LYF A;  2XEI A;  1AMP A;  4BMH A;  3FF3 A;  3SXO A;  1Y9K A;  3H8F A;  2EBJ A;  5G1Z A;  3D2P A;  5J8F A;  2AJ6 A;  3IC1 A;  1MK4 A;  2GAN A;  2ODF A;  3IWW A;  4F0Y A;  3DDD A;  1IGB A;  1ON0 A;  1Y0Y A;  2JLM A;  3IJ3 A;  3OWC A;  4KOU A;  3W91 A;  1ELL P;  2GFQ A;  2Q44 A;  2QJ8 A;  3LWU A;  5HH1 A;  5LYI A;  4PXE A;  3PFO A;  4ZY0 A;  5LYL A;  2EK8 A;  3SI0 A;  1ZLH A;  2EWB A;  4Z65 A;  1Z2L A;  2F5I A;  4O23 A;  2CIJ A;  1VHO A;  2ZXV A;  1ZO0 A;  1S3Z A;  2Q43 A;  2CY2 A;  3NE7 A;  4R3L A;  2Q4V A;  5LRJ A;  4UA3 A;  2V8D A;  2VZZ A;  3VWE A;  1BPN A;  1H8L A;  4KOX A;  3PFE A;  5AG7 A;  3N7Z A;  1I1D A;  2Q04 A;  2RFH A;  4KOY A;  2QML A;  5FVJ A;  4NGS A;  2A4N A;  4R6T A;  1S7N A;  1F2O A;  3V8I A;  1B87 A;  1RO5 A;  1QQ9 A;  3B2Y A;  3GIU A;  2PJ8 A;  4PXB A;  3B3C A;  1BOB A;  1M44 A;  4P4E A;  4P4I A;  2PDO A;  5BWA B;  3V38 A;  4R9M A;  4EME A;  3WC7 A;  3T9Y A;  2PR1 A;  4OID A;  3H8E A;  5THW A;  2IMO A;  4UCN A;  2OOT A;  4AG9 A;  4YU9 A;  1LCP A;  5JM6 A;  2HC9 A;  1JQG A;  1QMU A;  3PGP A;  3B3V A;  3KQX A;  1EE3 P;  5EBV A;  2FVG A;  4EFD A;  3B3S A;  3NFZ A;  4UCM A;  2R98 A;  4XNH C;  4UIB A;  4CAX A;  4KS9 A;  1NE9 A;  5J1Q A;  3DGV A;  1PU9 A;  4ONU A;  3TTH A;  3SHP A;  4EVY A;  2PJ9 A;  2Q4Z A;  3D7F A;  1M4D A;  1BLL E;  2ZOG A;  3EFA A;  3L2N A;  3IWE A;  1YW4 A;  3H5Z A;  4NCZ A;  4UWJ A;  4K30 A;  3B3T A;  3P2H A;  4MJ8 A;  3A9L A;  3PB7 X;  4UIA A;  2REE A;  2ZEO A;  4AVB A;  1XF8 A;  2YGW A;  2OZG A;  2P6G A;  4HNW B;  1YR0 A;  2R7H A;  2Z3K A;  4FD5 A;  2VI7 A;  2ZEH A;  3PB8 X;  4IHM A;  2X7B A;  3BI1 A;  3FVL A;  3KZW A;  4NEX A;  4NGP A;  3WC6 A;  2QYV A;  1YW6 A;  4OAE A;  1JWQ A;  3EY5 A;  3TO9 A;  3KGQ A;  4RI1 A;  1YLO A;  1YK3 A;  2ANP A;  4MCS A;  5AG5 A;  3WT4 A;  4CPA A;  4ZY2 A;  1YVO A;  3IO1 A;  3P2F A;  1N71 A;  1X12 A;  2ZEL A;  3B7I A;  2OZH A;  2V77 A;  4KOW A;  1TXR A;  3IEH A;  5F49 A;  2OU2 A;  3DR8 A;  4MFK A;  3MN8 A;  1Z8L A;  4QC6 A;  4AXV A;  3I9S A;  1Z5R A;  1ZG7 A;  1XBU A;  2GE3 A;  4A30 A;  2RB7 A;  2I79 A;  1YQE A;  4A2Z A;  2WYR A;  1CP6 A;  4NGQ A;  1ZG8 A;  3D2M A;  4IUS A;  3RYO A;  4CRY B;  4C7H A;  3W6S A;  1CG2 A;  1PYT B;  4RS2 A;  4C2X A;  3QAY A;  4KVO E;  2PJ5 A;  3RZA A;  3TFY A;  1IB1 E;  2CNS A;  1MJB A;  2PR8 A;  3D3S A;  2RC4 A;  1IU8 A;  3FMC A;  3F8K A;  2YNE A;  4MFJ A;  5HVH A;  5AG6 A;  1KUY A;  4PSX A;  2AFZ A;  2P6F A;  3ISX A;  5C82 A;  4E2A A;  3MRU A;  4JXQ A;  4PQA A;  3CXP A;  4A37 A;  4MFZ A;  4CGP A;  5K8N A;  2GLJ A;  2R1I A;  2PE3 A;  1Z8T A;  1BAV A;  3LD2 A;  3BJ7 A;  4KUA A;  3R96 A;  4BD9 A;  1VGY A;  1KUV A;  2ABZ A;  3PB9 X;  4P6Y A;  2Z3M A;  4OC2 A;  2AFO A;  4UEF A;  2PJ0 A;  3HUV A;  5F47 A;  4C68 A;  4NJQ A;  3BJ8 A;  2OB0 A;  1CPX A;  1CP7 A;  5DWM A;  4B5P A;  5G22 A;  2Z11 A;  4MXU A;  3MGD A;  2PRB A;  1M4G A;  1M4L A;  2FS5 A;  4M3S A;  1Y9W A;  4HNY B;  3TX8 A;  4F8Z A;  5IB9 A;  2AFW A;  2PVW A;  3D7G A;  3LAC A;  4OC5 A;  2C6G A;  5F09 A;  1RXT A;  4A33 A;  2CTB A;  2VXK A;  2DF5 A;  1AYE A;  1IOF A;  2FL4 A;  4MY0 A;  3EO4 A;  4JXR A;  4UF4 A;  3NH8 A;  4UWI A;  4CGN A;  2P0W A;  1TKH A;  5H86 A;  4OLL A;  4H6U A;  4B5O A;  4B10 A;  1LOK A;  1X10 A;  1Q2C A;  2BO9 A;  1XFO A;  3IU2 A;  2V8G A;  1RTQ A;  2ZOF A;  2BOA A;  4DNC A;  1K4J A;  1QSN A;  2VQY A;  5CBM A;  4KZT A;  2IL4 A;  5HVF A;  1GHE A;  2QVP A;  3QB8 A;  4A95 A;  4DJL A;  4ORF A;  4JLY A;  4MHP A;  2ZW6 A;  2V8V A;  2PCU A;  3FRM A;  2Z3O A;  2PJ6 A;  3PBE A;  2EK9 A;  2OR4 A;  1R3N A;  4MY3 A;  4H89 A;  4E0A A;  4PXC A;  4BIN A;  2OH1 A;  3SJG A;  4Y49 C;  3GLJ A;  4KOS A;  4ZBG A;  2DPS A;  3TC8 A;  3I1U A;  4P4F A;  4LX9 A;  4XNH B;  2BEI A;  2FIA A;  3QAH A;  3FIX A;  4U5Y A;  4YWY A;  4B11 A;  1XJO A;  4YRH A;  2Z3N A;  2GIV A;  3EXN A;  3GUX A;  4P45 A;  3VWD A;  4MFL A;  1Q2Y A;  4R76 A;  1P0H A;  3GY9 A;  4U9Z A;  3R95 A; 
#chains in the Genus database with same CATH homology
 2BUE A;  4KSA A;  4PK3 A;  4AVA A;  3S6G A;  2QEC A;  3FNC A;  2YND A;  4GS4 A;  5KTA A;  3TCV A;  3FYN A;  1IYL A;  2JEV A;  2FIW A;  4I49 A;  4Q38 A;  5KTD A;  3KKW A;  2Q7B A;  4MFQ A;  2ZPA A;  2BL1 A;  2C27 A;  4IF5 A;  4CYO A;  2B4D A;  3B8G A;  3DNS A;  2YNC C;  4H6Z A;  2G0B A;  4B5P B;  3BLN A;  5AG4 A;  3H4Q A;  1XE4 A;  3S6H A;  3FBU A;  2FE7 A;  3F5B A;  1VKC A;  1S60 A;  4C2Y A;  2J8N A;  4KVX A;  3TE4 A;  5A27 A;  1QSO A;  2ATR A;  5F48 A;  3IU1 A;  3C26 A;  3UY5 A;  4E8O A;  2G3A A;  4NSQ A;  1VHS A;  5IB0 A;  1SQH A;  1B6B A;  5C88 A;  1MJA A;  4CGO A;  4HNX B;  1Z9U A;  1IID A;  2J8R A;  3PP9 A;  4KVM E;  2J8M A;  2YNC A;  2ZW7 A;  4CS0 B;  1XEB A;  3WR7 A;  4B14 A;  5GCN A;  3F0A A;  2ZW4 A;  2OZU A;  3CXQ A;  2B5G B;  3DR6 A;  4QB9 A;  1OZP A;  4KLV A;  4R57 A;  1CM0 A;  4CGL A;  4XPD C;  4JWP A;  2JDD A;  3S6F A;  2CNT A;  2B3V A;  4CYN A;  2HUZ A;  2Y0M A;  4QUS A;  4CRZ B;  1MJ9 A;  4QBJ A;  1IIC A;  2B4D B;  2FXF A;  2G3T A;  5G20 A;  2FCK A;  4L89 A;  2R8V A;  4Y49 B;  3JTK A;  1YX0 A;  2EUI A;  4MFP A;  4AVC A;  4KOT A;  4B13 A;  1S7K A;  4A31 A;  5I0C A;  3JUW A;  4A32 A;  2B58 A;  3TT2 A;  1I21 A;  2VZY A;  3CXS A;  1QSR A;  4KSF A;  1QST A;  4CAW A;  1S7F A;  2AE6 A;  3EC4 A;  4R87 A;  5AGE A;  2Q0Y A;  2NMT A;  4JJX A;  4CGM A;  3K9U A;  3GKR A;  3TOB A;  3E0K A;  1XIX A;  5KTC A;  4X5K A;  5JPH A;  5H84 A;  4BBH A;  1P4N A;  2VEZ A;  2B5G A;  1S7L A;  2EVN A;  1M4I A;  2K5T A;  1NSL A;  4CYQ A;  3W6X A;  1YRE A;  1Z4R A;  3R1K A;  4C7I A;  1YVK A;  2ZW5 A;  2JDC A;  4NF1 A;  1XMT A;  3S6K A;  4UBR A;  2I00 A;  4R3K A;  3I3G A;  4FD4 A;  2B3U A;  3TO7 A;  2Z10 A;  4YFJ A;  1L0C A;  2DPT A;  4CAV A;  1IYK A;  3FXT A;  2WPW A;  4ZGY B;  4JD6 A;  1KZF A;  1WK4 A;  1YGH A;  2B4B A;  4HKF A;  4U9Y A;  4Q36 A;  3R9F A;  5ISV A;  4PV6 A;  2WUU A;  1S5K A;  4UFW A;  1M1D A;  2O28 A;  4M85 A;  3TOA A;  2HV2 A;  5J8C A;  4CAF A;  4XPD B;  4KUB A;  3JVN A;  4YGO A;  1KUX A;  1YLE A;  3ZJ0 A;  2ARH A;  5G21 A;  4CYP A;  4MBU A;  1QSM A;  4FD7 A;  4OAD A;  2CNM A;  3PZJ A;  1UFH A;  2Z0Z A;  2HQY A;  4J3G A;  1WWZ A;  2Q4Y A;  4UFV A;  2D4O A;  3GYA A;  2WSA A;  1R57 A;  3R9E A;  5A28 A;  4F6A A;  2FSR A;  4F0X A;  2D4P A;  4MHD A;  3T90 A;  2PC1 A;  1Q2D A;  2FT0 A;  1PUA A;  2QIR A;  4II9 A;  2BSW A;  2DXQ A;  4B12 A;  3R9G A;  3IGR A;  4XPL A;  5HMN A;  1NMT A;  4LUA A;  2PSW A;  1I12 A;  4CAE A;  2KCW A;  4AG7 A;  2WPX A;  5E96 A;  5F46 A;  3G3S A;  3G8W A;  5IX3 A;  2VBQ A;  1Y7R A;  2REF A;  4KOV A;  5DWN A;  4UFX A;  4KOR A;  4NXY A;  3IWG A;  3D8P A;  1U6M A;  2H5M A;  3SXN A;  1J4J A;  4XPK A;  3DSB A;  4C2Z A;  2PQ8 A;  4KLW A;  3ZZI A;  4AB7 A;  1LRZ A;  4UCP A;  4QVT A;  1CJW A;  1BO4 A;  1FY7 A;  3TO6 A;  4MI4 A;  2P6E A;  4PSW A;  3FB3 A;  5IV0 A;  1Z4E A;  5EC4 A;  2Z3L A;  5JQ4 A;  1V0C A;  4L8A A;  4PK2 A;  4FD6 A;  2CXA A;  1TIQ A;  2Z3P A;  5CNP A;  3LOD A;  4BMH A;  3SXO A;  1Y9K A;  5G1Z A;  3D2P A;  5J8F A;  2AJ6 A;  1MK4 A;  2GAN A;  4F0Y A;  3DDD A;  3OWC A;  1ON0 A;  2JLM A;  3W91 A;  4KOU A;  2Q44 A;  5HH1 A;  2F5I A;  2ZXV A;  1ZO0 A;  1S3Z A;  2CY2 A;  3NE7 A;  4R3L A;  2Q4V A;  4UA3 A;  2VZZ A;  3VWE A;  4KOX A;  5AG7 A;  3N7Z A;  1I1D A;  2Q04 A;  4KOY A;  2QML A;  5FVJ A;  2A4N A;  1S7N A;  3V8I A;  1B87 A;  1RO5 A;  1BOB A;  1M44 A;  5BWA B;  2PDO A;  4R9M A;  3T9Y A;  2PR1 A;  4UCN A;  4AG9 A;  3PGP A;  5EBV A;  4UCM A;  2R98 A;  4XNH C;  4CAX A;  4KS9 A;  1NE9 A;  1PU9 A;  4ONU A;  3TTH A;  3SHP A;  4EVY A;  1M4D A;  3EFA A;  3IWE A;  3H5Z A;  4NCZ A;  4UWJ A;  4K30 A;  3P2H A;  4MJ8 A;  3A9L A;  2REE A;  4AVB A;  1XF8 A;  2YGW A;  2OZG A;  2P6G A;  4HNW B;  1YR0 A;  2R7H A;  2Z3K A;  4FD5 A;  2VI7 A;  2X7B A;  4NEX A;  4OAE A;  3EY5 A;  3TO9 A;  4RI1 A;  1YK3 A;  5AG5 A;  1YVO A;  3P2F A;  1N71 A;  2OZH A;  4KOW A;  5F49 A;  2OU2 A;  3DR8 A;  4MFK A;  4QC6 A;  3I9S A;  2GE3 A;  4A30 A;  2I79 A;  4A2Z A;  4CRY B;  3RYO A;  3D2M A;  4IUS A;  4C7H A;  3W6S A;  4C2X A;  4RS2 A;  4KVO E;  3TFY A;  1IB1 E;  2CNS A;  1MJB A;  2PR8 A;  3D3S A;  2RC4 A;  4MFJ A;  3F8K A;  2YNE A;  5AG6 A;  1KUY A;  4PSX A;  2P6F A;  5C82 A;  4E2A A;  4JXQ A;  3CXP A;  4CGP A;  4MFZ A;  2R1I A;  3LD2 A;  3BJ7 A;  4KUA A;  3R96 A;  1KUV A;  2Z3M A;  5F47 A;  4C68 A;  3BJ8 A;  2OB0 A;  5DWM A;  4B5P A;  5G22 A;  2Z11 A;  3MGD A;  2PRB A;  1M4G A;  2FS5 A;  4M3S A;  1Y9W A;  4HNY B;  1RXT A;  4A33 A;  2VXK A;  2FL4 A;  4MY0 A;  3EO4 A;  4JXR A;  4UWI A;  4CGN A;  2P0W A;  5H86 A;  4OLL A;  4H6U A;  4B5O A;  4B10 A;  1Q2C A;  3IU2 A;  4DNC A;  2VQY A;  1K4J A;  1QSN A;  4KZT A;  2IL4 A;  1GHE A;  3QB8 A;  4A95 A;  4ORF A;  4JLY A;  2ZW6 A;  3FRM A;  2Z3O A;  4MY3 A;  4H89 A;  4E0A A;  2OH1 A;  4Y49 C;  4KOS A;  4ZBG A;  2DPS A;  4LX9 A;  4XNH B;  2BEI A;  2FIA A;  3QAH A;  3FIX A;  4U5Y A;  4B11 A;  4YRH A;  2Z3N A;  2GIV A;  3EXN A;  3VWD A;  4MFL A;  1Q2Y A;  1P0H A;  3GY9 A;  4U9Z A;  3R95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...