2D4PA

Crystal structure of ttha1254 (wild type) from thermus thermophilus hb8
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRIEGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TTHA1254
publication title Crystal structure of TTHA1254 (wild type) from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 36
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09390 DUF1999 Protein of unknown function (DUF1999)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2d4pA00
1QSTA 3PZJA 4KOSA 3IGRA 3G3SA 4HNXB 2HV2A 2JEVA 3TCVA 2PDOA 2Z0ZA 2VZYA 3RYOA 2FXFA 4JWPA 2OH1A 4MBUA 4MI4A 4UA3A 1YGHA 4PSWA 4PK3A 2P6EA 1KUXA 2VQYA 3D8PA 1BO4A 2A4NA 4E0AA 1IIDA 1V0CA 4KUAA 4R3KA 3F5BA 3R9EA 4KLVA 4KOWA 5DWMA 5JQ4A 2ATRA 1XEBA 4R9MA 3GKRA 1VKCA 4JXQA 3V8IA 4NF1A 1K4JA 1LRZA 2J8NA 2FIWA 3EO4A 3R95A 2EUIA 1IB1E 2Y0MA 4AVBA 2VXKA 4KOUA 2R8VA 2Q7BA 5J8CA 2PR1A 2FIAA 4K30A 4CAVA 5KTCA 1N71A 3CXSA 4CRYB 2D4PA 3BLNA 2F5IA 3F8KA 3D2MA 1Z4EA 4OLLA 2VBQA 3FIXA 4YRHA 3PGPA 2I00A 3JUWA 5KTDA 1CM0A 1QSNA 1J4JA 3DR8A 3S6KA 3P2FA 3VWDA 3H4QA 4H6ZA 1WWZA 1I12A 3F0AA 1OZPA 1KUVA 1WK4A 3D3SA 3R1KA 3PP9A 2P6GA 3TOBA 3UY5A 3I9SA 4CAXA 1S7LA 2Q0YA 4KLWA 4FD4A 3S6HA 2PC1A 4M85A 2ZW4A 1B6BA 3S6FA 5KTAA 4IF5A 2B3VA 1Q2CA 1M4GA 1S7NA 2IL4A 2K5TA 4KOVA 1XF8A 5EBVA 1Z9UA 1P4NA 3GYAA 2Q4YA 3DSBA 2G3TA 4XPDB 4Y49B 5ISVA 4CRZB 2FE7A 3CXPA 2P0WA 3K9UA 1B87A 1KUYA 2OB0A 3IWGA 1YVOA 2AE6A 1PUAA 4ORFA 3B8GA 4R3LA 2BUEA 2GANA 3TT2A 2G0BA 2J8MA 3C26A 5C82A 2R1IA 2VEZA 4FD6A 4ZBGA 1Z4RA 5FVJA 4M3SA 1QSRA 2VI7A 3TO9A 3SXNA 2ZW7A 2OU2A 1NSLA 4KOXA 2R7HA 2CY2A 2FSRA 3S6GA 2FT0A 5IV0A 3OWCA 1QSOA 3FBUA 4JD6A 1M4IA 4NSQA 1XIXA 4PSXA 2B4DA 2B3UA 2ZPAA 4QC6A 4R87A 4KOTA 4XPDC 4Y49C 4EVYA 5IX3A 3QAHA 3R96A 2ZW5A 2OZUA 2Q44A 4KVME 3W6SA 4KVOE 4F6AA 1XMTA 4MY0A 2HUZA 4QUSA 5CNPA 2D4OA 3KKWA 2R98A 1XE4A 4KORA 4RS2A 2G3AA 1I1DA 1I21A 1S7FA 4AG7A 1MJBA 5HH1A 4B5PB 5H84A 5EC4A 2QECA 2BSWA 5DWNA 1M1DA 1IYLA 3E0KA 4OADA 2I79A 4U5YA 2NMTA 2KCWA 2Z11A 5H86A 4UWJA 4FD7A 5F49A 2BL1A 1S5KA 1S3ZA 2B4BA 2REEA 4NXYA 4XPLA 1IICA 2B5GA 4E8OA 1S7KA 2C27A 4L89A 4AVCA 5F47A 4PK2A 4CAWA 3ZZIA 4H89A 3R9GA 5GCNA 1NE9A 3FXTA 2Q04A 4B5PA 4MJ8A 4DNCA 3LD2A 1S60A 1YR0A 3N7ZA 1CJWA 3EFAA 3ZJ0A 2ZW6A 4MY3A 3VWEA 3TFYA 4GS4A 1YLEA 2VZZA 4ONUA 4J3GA 5JPHA 1YX0A 3G8WA 2B4DB 1FY7A 1ON0A 4XNHB 4XPKA 2OZGA 2OZHA 1MK4A 3DR6A 4U9ZA 1M4DA 4YFJA 4L8AA 3CXQA 1BOBA 4IUSA 3BJ7A 4AG9A 1TIQA 2ZXVA 2P6FA 5F46A 1U6MA 4KZTA 4KVXA 3TO7A 2H5MA 3GY9A 1PU9A 3BJ8A 5F48A 2QIRA 3W91A 3TTHA 3MGDA 3DDDA 2EVNA 4NCZA 1Y9KA 5J8FA 5C88A 3FB3A 3I3GA 4QVTA 4LX9A 4CS0B 1YK3A 2B5GB 4JLYA 4XNHC 1YREA 4OAEA 3T90A 1R57A 4U9YA 4MHDA 1MJ9A 4YGOA 1YVKA 4F0YA 1NMTA 3T9YA 2JDDA 4UBRA 3R9FA 5I0CA 1Q2DA 2PQ8A 2WPWA 3EXNA 3FNCA 4NEXA 2GIVA 2O28A 2DXQA 4I49A 1SQHA 2BEIA 1GHEA 2HQYA 2RC4A 1P0HA 4R57A 3P2HA 2AJ6A 2X7BA 2CNMA 2REFA 2PSWA 4FD5A 4LUAA 2WPXA 4AVAA 5HMNA 3JVNA 4UWIA 3TOAA 4BMHA 3SXOA 2JLMA 1Y9WA 4RI1A 4KOYA 2FS5A 2PR8A 2CNTA 1MJAA 1Q2YA 3TE4A 5IB0A 2QMLA 1KZFA 1VHSA 2PRBA 3WR7A 3LODA 3QB8A 4E2AA 4X5KA 1RXTA 1IYKA 4PV6A 2JDCA 4JXRA 2ARHA 2J8RA 1UFHA 2B58A 2FCKA 4H6UA 4QBJA 5E96A 3EC4A 3W6XA 4HKFA 2CNSA 4AB7A 3SHPA 2FL4A 4KUBA 1Y7RA 1M44A 2Q4VA 4II9A 3NE7A 2Z10A 3FRMA 3TO6A 1RO5A 4HNWB 2GE3A 4JJXA 3FYNA 3DNSA 4B5OA 4HNYB 1QSMA 3D2PA 3EY5A 4QB9A 1L0CA
chains in the Genus database with same CATH superfamily
4M6IA 8CPAA 3CZXA 2Z3LA 1H8LA 1QSTA 3GUXA 3KASA 3PZJA 4KOSA 5K8PA 2PVWA 3IGRA 3G3SA 3MRUA 2C1CA 4HNXB 3PRTA 4Q36A 2HV2A 3JRUA 2JEVA 3TCVA 2ZEDA 2PDOA 2Z0ZA 4MXUA 2VZYA 3VARA 1DTDA 4CPAA 3GIUA 2FXFA 3RYOA 2Z3MA 3D7HA 3NFZA 2PE3A 4JWPA 2CF4A 2YNDA 4O23A 2OH1A 4B13A 3CPXA 4MBUA 5AG5A 4MI4A 3A9LA 3NH5A 3VATA 4UA3A 5BWAB 1YGHA 4P44A 4PSWA 5HXDA 3IC1A 1IU8A 4ONWA 2P6EA 4PK3A 4NGPA 1KUXA 2VQYA 3D8PA 1BO4A 2Z3OA 2A4NA 3FF3A 4E0AA 1PCAA 1IIDA 2AFZA 3D7FA 1CX8A 1V0CA 4YU9A 4KUAA 4R3KA 4A38A 3PFEA 2AFWA 2V8DA 3CDXA 4BD9A 4MHNA 3F5BA 3D66A 3IEHA 3D68A 3R9EA 1Y0RA 1Z2LA 2QJ8A 4KLVA 4KOWA 4OC4A 5DWMA 5JQ4A 2ATRA 1XEBA 2JBJA 4R9MA 4ZX8A 3GKRA 4C68A 5LRKA 4EWTA 3D7GA 1VKCA 4JXQA 3V8IA 4NF1A 4OC2A 2Z3NA 3PB4X 3PBEA 3N5FA 1PYTB 1K4JA 2BO9A 1YLOA 1LRZA 3B35A 2J8NA 2FIWA 3GB0A 3EO4A 5LYFA 3R95A 2EUIA 4MCPA 1HEEA 1IB1E 4KSIA 1ZLIA 2Y0MA 2BOAA 4DJLA 4AVBA 2VXKA 2V77A 4Z65A 3HLPA 4KOUA 1Y0YA 2R8VA 1QMUA 4KSFA 5CPAA 2Q7BA 3IU2A 4ZGYB 3IWEA 4OC5A 3RBUA 2I3CA 5J8CA 2PR1A 3PB9X 2FIAA 4K30A 4CAVA 2DF5A 1UWYA 5G20A 3RNZA 3CT9A 1HDQA 2EBJA 1GYTA 2EK9A 3FH4A 3FEDA 3HUVA 4UCPA 5KTCA 1N71A 1DE4C 1TXRA 4A95A 2PJ3A 4RUHA 3CXSA 2WSAA 4CRYB 2D4PA 4OIDA 2XEFA 3BLNA 2F5IA 3F8KA 2ABZA 4GXHA 3D2MA 1Z4EA 4OLLA 3NE8A 2VBQA 2WZNA 3JTKA 3FIXA 1BAVA 4YRHA 6CPAA 2GREA 3PGPA 4P4EA 2I00A 3FJUA 3JUWA 2PJ7A 5IB9A 5KTDA 4OIWA 1CM0A 3B3VA 4F9VA 1QSNA 1J4JA 3DR8A 1ZG7A 3S6KA 5CBMA 4A32A 3DGVA 4CAFA 4UCNA 2F8HA 4LQ6A 1KWMA 5LRJA 4MFKA 1A2ZA 3P2FA 3VWDA 5JM6A 3H4QA 4H2KA 4H6ZA 4JZ0A 5THWA 1WWZA 1I12A 3F0AA 4B6ZA 1OZPA 1KUVA 2G9DA 1WK4A 3D3SA 3LWUA 3R1KA 3PP9A 2P6GA 3TOBA 3UY5A 3FVLA 3I9SA 3BXMA 5AG6A 1LAMA 4CAXA 2ZEEA 1S7LA 2GLFA 2Q0YA 4TNUA 1R3NA 5LYDA 4KLWA 1TF8A 2PJ8A 4CGMA 5G22A 4FD4A 3S9NA 3S6HA 4TWEA 3NH8A 2PC1A 4M85A 2IMOA 3RZAA 2ZW4A 1B6BA 1LOKA 3S6FA 3L2NA 2PIZA 2CTBA 2OR4A 5KTAA 4BINA 4IF5A 2GU2A 2B3VA 2PVVA 4UF4A 2ZEGA 1Q2CA 4UFWA 1M4GA 1EE3P 1S7NA 2IL4A 2IJZA 2K5TA 4KOVA 1XF8A 2Q7SA 4P6YA 5J1QA 5EBVA 1Z9UA 4MFQA 1P4NA 4KS9A 3S9MA 1Z8TA 3GYAA 2Q4YA 3FEEA 3DSBA 3KR5A 2PJCA 2G3TA 4R7MA 4RN7A 4XPDB 4Y49B 1XMBA 5ISVA 3NA6A 4CRZB 2FE7A 3CXPA 2P0WA 4MMOA 3K9UA 1B87A 1KUYA 2OB0A 3IWGA 4A33A 5HVGA 2JBKA 4CAEA 1YVOA 2BCOA 4C2ZA 2AE6A 4CYQA 3LACA 1PUAA 1LANA 2ZEPA 3D4UA 3FMCA 3PB7X 4ORFA 3B8GA 4OC3A 4R3LA 5G21A 2BUEA 2GANA 2PJBA 3TT2A 4LQGA 1TF9A 5AGEA 4ZY1A 1F57A 3KL9A 3SI0A 1XRYA 3QAYA 2G0BA 2J8MA 3PB6X 3C26A 4P4FA 2C6CA 3CPAA 5C82A 4PPZA 2R1IA 2VEZA 4MFLA 3GLJA 1VHOA 2V8GA 4FD6A 4ZBGA 1Z4RA 5FVJA 4A31A 4M3SA 5A28A 1QSRA 2VI7A 1ZG9A 4NGTA 2AFSA 2PJ5A 5G1ZA 3TO9A 3FECA 1OBRA 3SJEA 3SXNA 2ZW7A 2OU2A 3DLJA 1NSLA 4KOXA 2R7HA 3SI2A 2CY2A 1Z5RA 4WWVA 2FSRA 3D67A 3S6GA 2FT0A 5IV0A 3IFEA 5K8OA 3OWCA 1QSOA 3FBUA 3H8GA 3BI1A 3LMSA 5ELYA 4CYNA 4CYPA 1XBUA 4JD6A 3B7IA 1M4IA 4CGOA 4F9UA 4R76A 1R43A 1TKJA 1LFWA 4NSQA 1RTQA 1XIXA 4MCSA 3KHXA 4PSXA 3TC8A 2ZEHA 2ZENA 2B4DA 1YW6A 2B3UA 2ZPAA 4QC6A 4KOTA 4R87A 4UIBA 4XPDC 4Y49C 4EVYA 5IX3A 4C2XA 4Q7AA 3ISZA 3QAHA 3R96A 2ZEOA 2ZW5A 2OZUA 2Q44A 4KVME 3W6SA 4OP4A 2QYVA 1F2PA 3IO1A 1NSAA 4KVOE 3SJXA 4F6AA 1XMTA 2CIJA 2O53A 2WYRA 4UFVA 5D29A 4MY0A 2HUZA 4QUSA 1JQGA 1CPXA 5CNPA 4UIAA 2D4OA 3KKWA 1XE4A 2R98A 4KORA 4RS2A 2G3AA 1I1DA 1I21A 4EFDA 4R8FA 3BHXA 1S7FA 1X12A 2PJ6A 4AG7A 2XEGA 4MFPA 1MJBA 3K2KA 4NGRA 2RB7A 4EMEA 5HH1A 4UEFA 4MHYA 4B5PB 2HB6A 2ZELA 4M6GA 4PXDA 3S9LA 3PB8X 5H84A 4JYWA 5EC4A 2QECA 1YMEA 2BSWA 2ANPA 5DWNA 2CTCA 1M1DA 1IYLA 4IK2A 3PFOA 3E0KA 1CP7A 2AFXA 7CPAA 5LYIA 4OADA 4ZI6A 2I79A 4U5YA 2NMTA 5LYLA 2RFHA 2KCWA 1AYEA 4B11A 2Z11A 5H86A 1Z8WA 2FVGA 4IHMA 4UWJA 4FD7A 2PJ9A 2PJAA 5F49A 1CPSA 4OC0A 1HDUA 2ZOGA 1LCPA 2BL1A 3SJGA 1S5KA 1IOIA 4UEZA 5JGFA 1YW4A 1S3ZA 2B4BA 2YNCA 4NGQA 1YQEA 3PBBA 2REEA 4NXYA 1CG2A 4FWUA 3B3CA 3H8EA 3RAMA 1Y7EA 4XPLA 1IICA 3H8FA 3KQZA 5JH9A 2B5GA 4E8OA 1S7KA 2C27A 3B3TA 4L89A 4ZX9A 4AVCA 5F47A 4PK2A 2AFOA 5DS0A 1Z8XA 3NH4A 4CAWA 3ZZIA 4A30A 1XJOA 4H89A 3R9GA 3SJFA 4P10A 5GCNA 1ARMA 2Z3KA 4B14A 1NE9A 3FXTA 1IOFA 2Q04A 3KGQA 4B5PA 2ZOFA 4MJ8A 2Q43A 4DNCA 3LD2A 2PRQA 3IU1A 1S60A 1YR0A 3N7ZA 1CJWA 5K8NA 3EFAA 2ODFA 3ZJ0A 2PJ0A 1AMPA 2ZW6A 4MY3A 2NYQA 1BPMA 1X10A 2DPSA 2GFQA 2Z3PA 3VWEA 3WABA 3KR4A 4NJQA 3TFYA 4GS4A 1YLEA 2VZZA 4ONUA 3WC5A 4J3GA 4M6HA 4NGNA 3QNVA 5JPHA 1YX0A 3G8WA 2B4DB 1FNOA 2NSMA 1VHEA 4PXCA 1FY7A 1ON0A 2PJ1A 4F0XA 4XNHB 4XPKA 4NFRA 2OZGA 2GLJA 2OZHA 1MK4A 3DR6A 5HVFA 4IAVA 4U9ZA 4CGNA 4YWYA 1XFOA 4MCQA 4GM5A 1M4DA 4MCRA 1FT7A 4C7HA 5A27A 4YFJA 3PEIA 4L8AA 1CP6A 3CXQA 3WT4A 1VIXA 4F8ZA 3B2YA 5AG4A 1BOBA 4IUSA 3WC7A 2PIYA 3BJ7A 4MFJA 3ISXA 4A2ZA 4AG9A 1TIQA 4WJBA 2PJ2A 3KHZA 4MHZA 2ZXVA 2P6FA 2ZEMA 5F46A 1U6MA 4KZTA 1YSJA 4KVXA 4OC1A 3TO7A 2H5MA 1TKFA 3GY9A 3IWWA 2EO8A 3VH9A 4ZY0A 5EMIA 4UEEA 1PU9A 2Q51A 4X2TA 4ZYQA 3BJ8A 5F48A 4PXEA 2QIRA 3W91A 4P4IA 4ZY2A 3MGDA 3DDDA 3TTHA 2EVNA 1AUGA 3V7ZA 4NCZA 1Y9KA 5J8FA 5C88A 1ARLA 4DYOA 1ZLHA 4X8IA 3D7DA 2WUUA 5K8MA 3FB3A 3I3GA 4P4DA 4Q38A 2PCUA 4QVTA 4LX9A 4A94A 4K3NA 4CGLA 3BI0A 4P45A 2C6PA 4CS0B 4BBHA 2DEAA 1YK3A 2B5GB 2PJ4A 2Q4ZA 3IJ3A 4JLYA 3TX8A 2EWBA 4XNHC 1BLLE 1YREA 4OAEA 3T90A 3V38A 1R57A 4U9YA 1IGBA 2QVPA 4MHDA 5F09A 1ELMP 4FUUA 5LRGA 4AXVA 4MFZA 5AG7A 4B12A 1MJ9A 4YGOA 4FAIA 1YVKA 4F0YA 4DUKA 1NMTA 1Z8LA 4UFXA 3T9YA 4MHPA 4R6TA 4CYOA 2JDDA 4UBRA 3R9FA 5I0CA 1Q2DA 2PQ8A 2WPWA 3EXNA 1QQ9A 4NJRA 4PXBA 2OOTA 1Q7LA 2XEIA 3FNCA 3MN8A 2POKA 2GIVA 4NEXA 2O28A 2DXQA 4I49A 1SQHA 2BEIA 4B10A 1GHEA 3K9TA 2HQYA 2RC4A 2YGWA 1P0HA 1ZG8A 4R57A 2O4HA 3P2HA 5HVHA 2F7VA 4W9YA 2AJ6A 2X7BA 4MRIA 2CNMA 2REFA 2PSWA 2ZEFA 4FD5A 4KSAA 4A37A 1CBXA 4LUAA 2WPXA 4G1PA 3B3SA 4AVAA 3IIBA 5HMNA 3JVNA 4UWIA 3TOAA 2V8VA 4C2YA 4BMHA 3SXOA 2JLMA 3T8WA 1Y9WA 4RI1A 4KOYA 2FS5A 2PR8A 4OKOA 2CNTA 3I1UA 1MJAA 1Q2YA 1BPNA 1ZO0A 2XEJA 5IB0A 3TE4A 2YNCC 2QMLA 5D8NA 4OMEA 2J9AA 3FX6A 5I4MA 4FBEA 1KZFA 1VHSA 2PRBA 3WR7A 3LODA 3H5ZA 3QB8A 4E2AA 4X5KA 4X3RA 1JWQA 2DPTA 2YNEA 1RXTA 1VGYA 1TKHA 1IYKA 1LAPA 2JDCA 4JXRA 4P4JA 4PV6A 2ARHA 1XOVA 2C6GA 2V8HA 2J8RA 1UFHA 2B58A 2CXAA 2VL1A 2HC9A 2FCKA 4H6UA 4QBJA 5E96A 3EC4A 3W6XA 4A39A 3WC6A 4HKFA 2CNSA 4AB7A 4NGMA 4HPSA 3SHPA 1IY7A 2FL4A 4KUBA 1Y7RA 2EK8A 4UCMA 4CGPA 1M44A 2Q4VA 3SI1A 4II9A 4P4BA 3KZWA 2AFMA 3NE7A 2Z10A 3FRMA 3KI9A 1RO5A 3TO6A 4HNWB 2IQ6A 2GE3A 2AFUA 2JEWA 1M4LA 4JJXA 4NGSA 3RO0A 3FYNA 4C7IA 3DNSA 3B3WA 4B5OA 1F2OA 4HNYB 1QSMA 1ELLP 3D2PA 3EY5A 4QB9A 3KQXA 1L0CA 4PQAA
chains in the Genus database with same CATH topology
2Z3LA 1QSTA 3PZJA 4KOSA 3IGRA 3G3SA 4HNXB 4Q36A 2HV2A 2JEVA 3TCVA 2PDOA 2Z0ZA 2VZYA 3RYOA 2FXFA 2Z3MA 4JWPA 2YNDA 2OH1A 4B13A 4MBUA 5AG5A 4MI4A 3A9LA 4UA3A 5BWAB 1YGHA 4PSWA 4PK3A 2P6EA 1KUXA 2VQYA 3D8PA 1BO4A 2Z3OA 2A4NA 4E0AA 1IIDA 1V0CA 4KUAA 4R3KA 3F5BA 3R9EA 4KLVA 4KOWA 5DWMA 5JQ4A 2ATRA 1XEBA 4R9MA 4C68A 3GKRA 1VKCA 4JXQA 3V8IA 4NF1A 2Z3NA 1K4JA 1LRZA 2J8NA 2FIWA 3EO4A 3R95A 2EUIA 1IB1E 2Y0MA 4AVBA 2VXKA 4KOUA 2R8VA 4KSFA 2Q7BA 3IU2A 4ZGYB 3IWEA 5J8CA 2PR1A 2FIAA 4K30A 4CAVA 5G20A 5KTCA 4UCPA 1N71A 4A95A 3CXSA 2WSAA 4CRYB 2D4PA 3BLNA 2F5IA 3F8KA 3D2MA 1Z4EA 4OLLA 2VBQA 3JTKA 3FIXA 4YRHA 3PGPA 2I00A 3JUWA 5KTDA 1CM0A 1QSNA 1J4JA 3DR8A 3S6KA 4A32A 4CAFA 4UCNA 4MFKA 3P2FA 3VWDA 3H4QA 4H6ZA 1WWZA 1I12A 3F0AA 1OZPA 1KUVA 1WK4A 3D3SA 3R1KA 3PP9A 2P6GA 3TOBA 3UY5A 3I9SA 5AG6A 4CAXA 1S7LA 2Q0YA 4KLWA 5G22A 4FD4A 3S6HA 2PC1A 4M85A 2ZW4A 1B6BA 3S6FA 5KTAA 4IF5A 2B3VA 1Q2CA 4UFWA 1M4GA 1S7NA 2IL4A 2K5TA 4KOVA 1XF8A 5EBVA 1Z9UA 4MFQA 1P4NA 4KS9A 3GYAA 2Q4YA 3DSBA 2G3TA 4XPDB 4Y49B 5ISVA 4CRZB 2FE7A 3CXPA 2P0WA 3K9UA 1B87A 1KUYA 2OB0A 3IWGA 4A33A 4CAEA 1YVOA 4C2ZA 2AE6A 4CYQA 1PUAA 4ORFA 5G21A 3B8GA 4R3LA 2BUEA 2GANA 3TT2A 5AGEA 2G0BA 2J8MA 3C26A 5C82A 2R1IA 2VEZA 4MFLA 4FD6A 4ZBGA 1Z4RA 5FVJA 4A31A 4M3SA 5A28A 1QSRA 2VI7A 5G1ZA 3TO9A 3SXNA 2ZW7A 2OU2A 1NSLA 4KOXA 2R7HA 2CY2A 2FSRA 3S6GA 2FT0A 5IV0A 3OWCA 1QSOA 3FBUA 4CYNA 4CYPA 4JD6A 1M4IA 4CGOA 4NSQA 1XIXA 4PSXA 2B4DA 2B3UA 2ZPAA 4QC6A 4R87A 4KOTA 4XPDC 4Y49C 4EVYA 5IX3A 4C2XA 3QAHA 3R96A 2ZW5A 2OZUA 2Q44A 4KVME 3W6SA 4KVOE 4F6AA 1XMTA 4UFVA 4MY0A 2HUZA 4QUSA 5CNPA 2D4OA 3KKWA 2R98A 1XE4A 4KORA 4RS2A 2G3AA 1I1DA 1I21A 1S7FA 4AG7A 4MFPA 1MJBA 5HH1A 4B5PB 5H84A 5EC4A 2QECA 2BSWA 5DWNA 1M1DA 1IYLA 3E0KA 4OADA 2I79A 4U5YA 2NMTA 2KCWA 4B11A 2Z11A 5H86A 4UWJA 4FD7A 5F49A 2BL1A 1S5KA 2YNCA 1S3ZA 2B4BA 2REEA 4NXYA 4XPLA 1IICA 2B5GA 4E8OA 1S7KA 2C27A 4L89A 4AVCA 5F47A 4PK2A 4CAWA 3ZZIA 4A30A 4H89A 3R9GA 5GCNA 4B14A 2Z3KA 1NE9A 3FXTA 2Q04A 4B5PA 4MJ8A 4DNCA 3LD2A 3IU1A 1S60A 1YR0A 3N7ZA 1CJWA 3EFAA 3ZJ0A 2ZW6A 4MY3A 3VWEA 4CGMA 2DPSA 2Z3PA 3TFYA 4GS4A 1YLEA 2VZZA 4ONUA 4J3GA 5JPHA 1YX0A 3G8WA 2B4DB 1FY7A 1ON0A 4F0XA 4XNHB 4XPKA 2OZGA 2OZHA 1MK4A 3DR6A 4U9ZA 4CGNA 1M4DA 4C7HA 5A27A 4YFJA 4L8AA 3CXQA 5AG4A 1BOBA 4IUSA 3BJ7A 4MFJA 4A2ZA 4AG9A 1TIQA 2ZXVA 2P6FA 5F46A 1U6MA 4KZTA 4KVXA 3TO7A 2H5MA 3GY9A 1PU9A 3BJ8A 5F48A 2QIRA 3W91A 3TTHA 3MGDA 3DDDA 2EVNA 4NCZA 1Y9KA 5J8FA 5C88A 2WUUA 3FB3A 3I3GA 4Q38A 4QVTA 4LX9A 4CGLA 4CS0B 4BBHA 1YK3A 2B5GB 4JLYA 4XNHC 1YREA 4OAEA 3T90A 1R57A 4U9YA 4MHDA 4MFZA 5AG7A 4B12A 1MJ9A 4YGOA 1YVKA 4F0YA 1NMTA 4UFXA 3T9YA 4CYOA 2JDDA 4UBRA 3R9FA 5I0CA 1Q2DA 2PQ8A 2WPWA 3EXNA 3FNCA 4NEXA 2GIVA 2O28A 2DXQA 4I49A 1SQHA 2BEIA 4B10A 1GHEA 2HQYA 2RC4A 2YGWA 1P0HA 4R57A 3P2HA 2AJ6A 2X7BA 2CNMA 2REFA 2PSWA 4FD5A 4KSAA 4LUAA 2WPXA 4AVAA 5HMNA 3JVNA 4UWIA 3TOAA 4C2YA 4BMHA 3SXOA 2JLMA 1Y9WA 4RI1A 4KOYA 2FS5A 2PR8A 2CNTA 1MJAA 1Q2YA 1ZO0A 3TE4A 5IB0A 2YNCC 2QMLA 1KZFA 1VHSA 2PRBA 3WR7A 3LODA 3H5ZA 3QB8A 4E2AA 4X5KA 2DPTA 2YNEA 1RXTA 1IYKA 4PV6A 2JDCA 4JXRA 2ARHA 2J8RA 1UFHA 2B58A 2CXAA 2FCKA 4H6UA 4QBJA 5E96A 3EC4A 3W6XA 4HKFA 2CNSA 4AB7A 3SHPA 2FL4A 4KUBA 1Y7RA 4CGPA 4UCMA 1M44A 2Q4VA 4II9A 3NE7A 2Z10A 3FRMA 3TO6A 1RO5A 4HNWB 2GE3A 4JJXA 4C7IA 3FYNA 3DNSA 4B5OA 4HNYB 1QSMA 3D2PA 3EY5A 4QB9A 1L0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QST A;  3PZJ A;  4KOS A;  3IGR A;  3G3S A;  4HNX B;  2HV2 A;  2JEV A;  3TCV A;  2PDO A;  2Z0Z A;  2VZY A;  3RYO A;  2FXF A;  4JWP A;  2OH1 A;  4MBU A;  4MI4 A;  4UA3 A;  1YGH A;  4PSW A;  4PK3 A;  2P6E A;  1KUX A;  2VQY A;  3D8P A;  1BO4 A;  2A4N A;  4E0A A;  1IID A;  1V0C A;  4KUA A;  4R3K A;  3F5B A;  3R9E A;  4KLV A;  4KOW A;  5DWM A;  5JQ4 A;  2ATR A;  1XEB A;  4R9M A;  3GKR A;  1VKC A;  4JXQ A;  3V8I A;  4NF1 A;  1K4J A;  1LRZ A;  2J8N A;  2FIW A;  3EO4 A;  3R95 A;  2EUI A;  1IB1 E;  2Y0M A;  4AVB A;  2VXK A;  4KOU A;  2R8V A;  2Q7B A;  5J8C A;  2PR1 A;  2FIA A;  4K30 A;  4CAV A;  5KTC A;  1N71 A;  3CXS A;  4CRY B;  2D4P A;  3BLN A;  2F5I A;  3F8K A;  3D2M A;  1Z4E A;  4OLL A;  2VBQ A;  3FIX A;  4YRH A;  3PGP A;  2I00 A;  3JUW A;  5KTD A;  1CM0 A;  1QSN A;  1J4J A;  3DR8 A;  3S6K A;  3P2F A;  3VWD A;  3H4Q A;  4H6Z A;  1WWZ A;  1I12 A;  3F0A A;  1OZP A;  1KUV A;  1WK4 A;  3D3S A;  3R1K A;  3PP9 A;  2P6G A;  3TOB A;  3UY5 A;  3I9S A;  4CAX A;  1S7L A;  2Q0Y A;  4KLW A;  4FD4 A;  3S6H A;  2PC1 A;  4M85 A;  2ZW4 A;  1B6B A;  3S6F A;  5KTA A;  4IF5 A;  2B3V A;  1Q2C A;  1M4G A;  1S7N A;  2IL4 A;  2K5T A;  4KOV A;  1XF8 A;  5EBV A;  1Z9U A;  1P4N A;  3GYA A;  2Q4Y A;  3DSB A;  2G3T A;  4XPD B;  4Y49 B;  5ISV A;  4CRZ B;  2FE7 A;  3CXP A;  2P0W A;  3K9U A;  1B87 A;  1KUY A;  2OB0 A;  3IWG A;  1YVO A;  2AE6 A;  1PUA A;  4ORF A;  3B8G A;  4R3L A;  2BUE A;  2GAN A;  3TT2 A;  2G0B A;  2J8M A;  3C26 A;  5C82 A;  2R1I A;  2VEZ A;  4FD6 A;  4ZBG A;  1Z4R A;  5FVJ A;  4M3S A;  1QSR A;  2VI7 A;  3TO9 A;  3SXN A;  2ZW7 A;  2OU2 A;  1NSL A;  4KOX A;  2R7H A;  2CY2 A;  2FSR A;  3S6G A;  2FT0 A;  5IV0 A;  3OWC A;  1QSO A;  3FBU A;  4JD6 A;  1M4I A;  4NSQ A;  1XIX A;  4PSX A;  2B4D A;  2B3U A;  2ZPA A;  4QC6 A;  4R87 A;  4KOT A;  4XPD C;  4Y49 C;  4EVY A;  5IX3 A;  3QAH A;  3R96 A;  2ZW5 A;  2OZU A;  2Q44 A;  4KVM E;  3W6S A;  4KVO E;  4F6A A;  1XMT A;  4MY0 A;  2HUZ A;  4QUS A;  5CNP A;  2D4O A;  3KKW A;  2R98 A;  1XE4 A;  4KOR A;  4RS2 A;  2G3A A;  1I1D A;  1I21 A;  1S7F A;  4AG7 A;  1MJB A;  5HH1 A;  4B5P B;  5H84 A;  5EC4 A;  2QEC A;  2BSW A;  5DWN A;  1M1D A;  1IYL A;  3E0K A;  4OAD A;  2I79 A;  4U5Y A;  2NMT A;  2KCW A;  2Z11 A;  5H86 A;  4UWJ A;  4FD7 A;  5F49 A;  2BL1 A;  1S5K A;  1S3Z A;  2B4B A;  2REE A;  4NXY A;  4XPL A;  1IIC A;  2B5G A;  4E8O A;  1S7K A;  2C27 A;  4L89 A;  4AVC A;  5F47 A;  4PK2 A;  4CAW A;  3ZZI A;  4H89 A;  3R9G A;  5GCN A;  1NE9 A;  3FXT A;  2Q04 A;  4B5P A;  4MJ8 A;  4DNC A;  3LD2 A;  1S60 A;  1YR0 A;  3N7Z A;  1CJW A;  3EFA A;  3ZJ0 A;  2ZW6 A;  4MY3 A;  3VWE A;  3TFY A;  4GS4 A;  1YLE A;  2VZZ A;  4ONU A;  4J3G A;  5JPH A;  1YX0 A;  3G8W A;  2B4D B;  1FY7 A;  1ON0 A;  4XNH B;  4XPK A;  2OZG A;  2OZH A;  1MK4 A;  3DR6 A;  4U9Z A;  1M4D A;  4YFJ A;  4L8A A;  3CXQ A;  1BOB A;  4IUS A;  3BJ7 A;  4AG9 A;  1TIQ A;  2ZXV A;  2P6F A;  5F46 A;  1U6M A;  4KZT A;  4KVX A;  3TO7 A;  2H5M A;  3GY9 A;  1PU9 A;  3BJ8 A;  5F48 A;  2QIR A;  3W91 A;  3TTH A;  3MGD A;  3DDD A;  2EVN A;  4NCZ A;  1Y9K A;  5J8F A;  5C88 A;  3FB3 A;  3I3G A;  4QVT A;  4LX9 A;  4CS0 B;  1YK3 A;  2B5G B;  4JLY A;  4XNH C;  1YRE A;  4OAE A;  3T90 A;  1R57 A;  4U9Y A;  4MHD A;  1MJ9 A;  4YGO A;  1YVK A;  4F0Y A;  1NMT A;  3T9Y A;  2JDD A;  4UBR A;  3R9F A;  5I0C A;  1Q2D A;  2PQ8 A;  2WPW A;  3EXN A;  3FNC A;  4NEX A;  2GIV A;  2O28 A;  2DXQ A;  4I49 A;  1SQH A;  2BEI A;  1GHE A;  2HQY A;  2RC4 A;  1P0H A;  4R57 A;  3P2H A;  2AJ6 A;  2X7B A;  2CNM A;  2REF A;  2PSW A;  4FD5 A;  4LUA A;  2WPX A;  4AVA A;  5HMN A;  3JVN A;  4UWI A;  3TOA A;  4BMH A;  3SXO A;  2JLM A;  1Y9W A;  4RI1 A;  4KOY A;  2FS5 A;  2PR8 A;  2CNT A;  1MJA A;  1Q2Y A;  3TE4 A;  5IB0 A;  2QML A;  1KZF A;  1VHS A;  2PRB A;  3WR7 A;  3LOD A;  3QB8 A;  4E2A A;  4X5K A;  1RXT A;  1IYK A;  4PV6 A;  2JDC A;  4JXR A;  2ARH A;  2J8R A;  1UFH A;  2B58 A;  2FCK A;  4H6U A;  4QBJ A;  5E96 A;  3EC4 A;  3W6X A;  4HKF A;  2CNS A;  4AB7 A;  3SHP A;  2FL4 A;  4KUB A;  1Y7R A;  1M44 A;  2Q4V A;  4II9 A;  3NE7 A;  2Z10 A;  3FRM A;  3TO6 A;  1RO5 A;  4HNW B;  2GE3 A;  4JJX A;  3FYN A;  3DNS A;  4B5O A;  4HNY B;  1QSM A;  3D2P A;  3EY5 A;  4QB9 A;  1L0C A; 
#chains in the Genus database with same CATH topology
 4M6I A;  8CPA A;  3CZX A;  2Z3L A;  1H8L A;  1QST A;  3GUX A;  3KAS A;  3PZJ A;  4KOS A;  5K8P A;  2PVW A;  3IGR A;  3G3S A;  3MRU A;  2C1C A;  4HNX B;  3PRT A;  4Q36 A;  2HV2 A;  3JRU A;  2JEV A;  3TCV A;  2ZED A;  2PDO A;  2Z0Z A;  4MXU A;  2VZY A;  3VAR A;  1DTD A;  4CPA A;  3GIU A;  2FXF A;  3RYO A;  2Z3M A;  3D7H A;  3NFZ A;  2PE3 A;  4JWP A;  2CF4 A;  2YND A;  4O23 A;  2OH1 A;  4B13 A;  3CPX A;  4MBU A;  5AG5 A;  4MI4 A;  3A9L A;  3NH5 A;  3VAT A;  4UA3 A;  5BWA B;  1YGH A;  4P44 A;  4PSW A;  5HXD A;  3IC1 A;  1IU8 A;  4ONW A;  2P6E A;  4PK3 A;  4NGP A;  1KUX A;  2VQY A;  3D8P A;  1BO4 A;  2Z3O A;  2A4N A;  3FF3 A;  4E0A A;  1PCA A;  1IID A;  2AFZ A;  3D7F A;  1CX8 A;  1V0C A;  4YU9 A;  4KUA A;  4R3K A;  4A38 A;  3PFE A;  2AFW A;  2V8D A;  3CDX A;  4BD9 A;  4MHN A;  3F5B A;  3D66 A;  3IEH A;  3D68 A;  3R9E A;  1Y0R A;  1Z2L A;  2QJ8 A;  4KLV A;  4KOW A;  4OC4 A;  5DWM A;  5JQ4 A;  2ATR A;  1XEB A;  2JBJ A;  4R9M A;  4ZX8 A;  3GKR A;  4C68 A;  5LRK A;  4EWT A;  3D7G A;  1VKC A;  4JXQ A;  3V8I A;  4NF1 A;  4OC2 A;  2Z3N A;  3PB4 X;  3PBE A;  3N5F A;  1PYT B;  1K4J A;  2BO9 A;  1YLO A;  1LRZ A;  3B35 A;  2J8N A;  2FIW A;  3GB0 A;  3EO4 A;  5LYF A;  3R95 A;  2EUI A;  4MCP A;  1HEE A;  1IB1 E;  4KSI A;  1ZLI A;  2Y0M A;  2BOA A;  4DJL A;  4AVB A;  2VXK A;  2V77 A;  4Z65 A;  3HLP A;  4KOU A;  1Y0Y A;  2R8V A;  1QMU A;  4KSF A;  5CPA A;  2Q7B A;  3IU2 A;  4ZGY B;  3IWE A;  4OC5 A;  3RBU A;  2I3C A;  5J8C A;  2PR1 A;  3PB9 X;  2FIA A;  4K30 A;  4CAV A;  2DF5 A;  1UWY A;  5G20 A;  3RNZ A;  3CT9 A;  1HDQ A;  2EBJ A;  1GYT A;  2EK9 A;  3FH4 A;  3FED A;  3HUV A;  4UCP A;  5KTC A;  1N71 A;  1DE4 C;  1TXR A;  4A95 A;  2PJ3 A;  4RUH A;  3CXS A;  2WSA A;  4CRY B;  2D4P A;  4OID A;  2XEF A;  3BLN A;  2F5I A;  3F8K A;  2ABZ A;  4GXH A;  3D2M A;  1Z4E A;  4OLL A;  3NE8 A;  2VBQ A;  2WZN A;  3JTK A;  3FIX A;  1BAV A;  4YRH A;  6CPA A;  2GRE A;  3PGP A;  4P4E A;  2I00 A;  3FJU A;  3JUW A;  2PJ7 A;  5IB9 A;  5KTD A;  4OIW A;  1CM0 A;  3B3V A;  4F9V A;  1QSN A;  1J4J A;  3DR8 A;  1ZG7 A;  3S6K A;  5CBM A;  4A32 A;  3DGV A;  4CAF A;  4UCN A;  2F8H A;  4LQ6 A;  1KWM A;  5LRJ A;  4MFK A;  1A2Z A;  3P2F A;  3VWD A;  5JM6 A;  3H4Q A;  4H2K A;  4H6Z A;  4JZ0 A;  5THW A;  1WWZ A;  1I12 A;  3F0A A;  4B6Z A;  1OZP A;  1KUV A;  2G9D A;  1WK4 A;  3D3S A;  3LWU A;  3R1K A;  3PP9 A;  2P6G A;  3TOB A;  3UY5 A;  3FVL A;  3I9S A;  3BXM A;  5AG6 A;  1LAM A;  4CAX A;  2ZEE A;  1S7L A;  2GLF A;  2Q0Y A;  4TNU A;  1R3N A;  5LYD A;  4KLW A;  1TF8 A;  2PJ8 A;  4CGM A;  5G22 A;  4FD4 A;  3S9N A;  3S6H A;  4TWE A;  3NH8 A;  2PC1 A;  4M85 A;  2IMO A;  3RZA A;  2ZW4 A;  1B6B A;  1LOK A;  3S6F A;  3L2N A;  2PIZ A;  2CTB A;  2OR4 A;  5KTA A;  4BIN A;  4IF5 A;  2GU2 A;  2B3V A;  2PVV A;  4UF4 A;  2ZEG A;  1Q2C A;  4UFW A;  1M4G A;  1EE3 P;  1S7N A;  2IL4 A;  2IJZ A;  2K5T A;  4KOV A;  1XF8 A;  2Q7S A;  4P6Y A;  5J1Q A;  5EBV A;  1Z9U A;  4MFQ A;  1P4N A;  4KS9 A;  3S9M A;  1Z8T A;  3GYA A;  2Q4Y A;  3FEE A;  3DSB A;  3KR5 A;  2PJC A;  2G3T A;  4R7M A;  4RN7 A;  4XPD B;  4Y49 B;  1XMB A;  5ISV A;  3NA6 A;  4CRZ B;  2FE7 A;  3CXP A;  2P0W A;  4MMO A;  3K9U A;  1B87 A;  1KUY A;  2OB0 A;  3IWG A;  4A33 A;  5HVG A;  2JBK A;  4CAE A;  1YVO A;  2BCO A;  4C2Z A;  2AE6 A;  4CYQ A;  3LAC A;  1PUA A;  1LAN A;  2ZEP A;  3D4U A;  3FMC A;  3PB7 X;  4ORF A;  3B8G A;  4OC3 A;  4R3L A;  5G21 A;  2BUE A;  2GAN A;  2PJB A;  3TT2 A;  4LQG A;  1TF9 A;  5AGE A;  4ZY1 A;  1F57 A;  3KL9 A;  3SI0 A;  1XRY A;  3QAY A;  2G0B A;  2J8M A;  3PB6 X;  3C26 A;  4P4F A;  2C6C A;  3CPA A;  5C82 A;  4PPZ A;  2R1I A;  2VEZ A;  4MFL A;  3GLJ A;  1VHO A;  2V8G A;  4FD6 A;  4ZBG A;  1Z4R A;  5FVJ A;  4A31 A;  4M3S A;  5A28 A;  1QSR A;  2VI7 A;  1ZG9 A;  4NGT A;  2AFS A;  2PJ5 A;  5G1Z A;  3TO9 A;  3FEC A;  1OBR A;  3SJE A;  3SXN A;  2ZW7 A;  2OU2 A;  3DLJ A;  1NSL A;  4KOX A;  2R7H A;  3SI2 A;  2CY2 A;  1Z5R A;  4WWV A;  2FSR A;  3D67 A;  3S6G A;  2FT0 A;  5IV0 A;  3IFE A;  5K8O A;  3OWC A;  1QSO A;  3FBU A;  3H8G A;  3BI1 A;  3LMS A;  5ELY A;  4CYN A;  4CYP A;  1XBU A;  4JD6 A;  3B7I A;  1M4I A;  4CGO A;  4F9U A;  4R76 A;  1R43 A;  1TKJ A;  1LFW A;  4NSQ A;  1RTQ A;  1XIX A;  4MCS A;  3KHX A;  4PSX A;  3TC8 A;  2ZEH A;  2ZEN A;  2B4D A;  1YW6 A;  2B3U A;  2ZPA A;  4QC6 A;  4KOT A;  4R87 A;  4UIB A;  4XPD C;  4Y49 C;  4EVY A;  5IX3 A;  4C2X A;  4Q7A A;  3ISZ A;  3QAH A;  3R96 A;  2ZEO A;  2ZW5 A;  2OZU A;  2Q44 A;  4KVM E;  3W6S A;  4OP4 A;  2QYV A;  1F2P A;  3IO1 A;  1NSA A;  4KVO E;  3SJX A;  4F6A A;  1XMT A;  2CIJ A;  2O53 A;  2WYR A;  4UFV A;  5D29 A;  4MY0 A;  2HUZ A;  4QUS A;  1JQG A;  1CPX A;  5CNP A;  4UIA A;  2D4O A;  3KKW A;  1XE4 A;  2R98 A;  4KOR A;  4RS2 A;  2G3A A;  1I1D A;  1I21 A;  4EFD A;  4R8F A;  3BHX A;  1S7F A;  1X12 A;  2PJ6 A;  4AG7 A;  2XEG A;  4MFP A;  1MJB A;  3K2K A;  4NGR A;  2RB7 A;  4EME A;  5HH1 A;  4UEF A;  4MHY A;  4B5P B;  2HB6 A;  2ZEL A;  4M6G A;  4PXD A;  3S9L A;  3PB8 X;  5H84 A;  4JYW A;  5EC4 A;  2QEC A;  1YME A;  2BSW A;  2ANP A;  5DWN A;  2CTC A;  1M1D A;  1IYL A;  4IK2 A;  3PFO A;  3E0K A;  1CP7 A;  2AFX A;  7CPA A;  5LYI A;  4OAD A;  4ZI6 A;  2I79 A;  4U5Y A;  2NMT A;  5LYL A;  2RFH A;  2KCW A;  1AYE A;  4B11 A;  2Z11 A;  5H86 A;  1Z8W A;  2FVG A;  4IHM A;  4UWJ A;  4FD7 A;  2PJ9 A;  2PJA A;  5F49 A;  1CPS A;  4OC0 A;  1HDU A;  2ZOG A;  1LCP A;  2BL1 A;  3SJG A;  1S5K A;  1IOI A;  4UEZ A;  5JGF A;  1YW4 A;  1S3Z A;  2B4B A;  2YNC A;  4NGQ A;  1YQE A;  3PBB A;  2REE A;  4NXY A;  1CG2 A;  4FWU A;  3B3C A;  3H8E A;  3RAM A;  1Y7E A;  4XPL A;  1IIC A;  3H8F A;  3KQZ A;  5JH9 A;  2B5G A;  4E8O A;  1S7K A;  2C27 A;  3B3T A;  4L89 A;  4ZX9 A;  4AVC A;  5F47 A;  4PK2 A;  2AFO A;  5DS0 A;  1Z8X A;  3NH4 A;  4CAW A;  3ZZI A;  4A30 A;  1XJO A;  4H89 A;  3R9G A;  3SJF A;  4P10 A;  5GCN A;  1ARM A;  2Z3K A;  4B14 A;  1NE9 A;  3FXT A;  1IOF A;  2Q04 A;  3KGQ A;  4B5P A;  2ZOF A;  4MJ8 A;  2Q43 A;  4DNC A;  3LD2 A;  2PRQ A;  3IU1 A;  1S60 A;  1YR0 A;  3N7Z A;  1CJW A;  5K8N A;  3EFA A;  2ODF A;  3ZJ0 A;  2PJ0 A;  1AMP A;  2ZW6 A;  4MY3 A;  2NYQ A;  1BPM A;  1X10 A;  2DPS A;  2GFQ A;  2Z3P A;  3VWE A;  3WAB A;  3KR4 A;  4NJQ A;  3TFY A;  4GS4 A;  1YLE A;  2VZZ A;  4ONU A;  3WC5 A;  4J3G A;  4M6H A;  4NGN A;  3QNV A;  5JPH A;  1YX0 A;  3G8W A;  2B4D B;  1FNO A;  2NSM A;  1VHE A;  4PXC A;  1FY7 A;  1ON0 A;  2PJ1 A;  4F0X A;  4XNH B;  4XPK A;  4NFR A;  2OZG A;  2GLJ A;  2OZH A;  1MK4 A;  3DR6 A;  5HVF A;  4IAV A;  4U9Z A;  4CGN A;  4YWY A;  1XFO A;  4MCQ A;  4GM5 A;  1M4D A;  4MCR A;  1FT7 A;  4C7H A;  5A27 A;  4YFJ A;  3PEI A;  4L8A A;  1CP6 A;  3CXQ A;  3WT4 A;  1VIX A;  4F8Z A;  3B2Y A;  5AG4 A;  1BOB A;  4IUS A;  3WC7 A;  2PIY A;  3BJ7 A;  4MFJ A;  3ISX A;  4A2Z A;  4AG9 A;  1TIQ A;  4WJB A;  2PJ2 A;  3KHZ A;  4MHZ A;  2ZXV A;  2P6F A;  2ZEM A;  5F46 A;  1U6M A;  4KZT A;  1YSJ A;  4KVX A;  4OC1 A;  3TO7 A;  2H5M A;  1TKF A;  3GY9 A;  3IWW A;  2EO8 A;  3VH9 A;  4ZY0 A;  5EMI A;  4UEE A;  1PU9 A;  2Q51 A;  4X2T A;  4ZYQ A;  3BJ8 A;  5F48 A;  4PXE A;  2QIR A;  3W91 A;  4P4I A;  4ZY2 A;  3MGD A;  3DDD A;  3TTH A;  2EVN A;  1AUG A;  3V7Z A;  4NCZ A;  1Y9K A;  5J8F A;  5C88 A;  1ARL A;  4DYO A;  1ZLH A;  4X8I A;  3D7D A;  2WUU A;  5K8M A;  3FB3 A;  3I3G A;  4P4D A;  4Q38 A;  2PCU A;  4QVT A;  4LX9 A;  4A94 A;  4K3N A;  4CGL A;  3BI0 A;  4P45 A;  2C6P A;  4CS0 B;  4BBH A;  2DEA A;  1YK3 A;  2B5G B;  2PJ4 A;  2Q4Z A;  3IJ3 A;  4JLY A;  3TX8 A;  2EWB A;  4XNH C;  1BLL E;  1YRE A;  4OAE A;  3T90 A;  3V38 A;  1R57 A;  4U9Y A;  1IGB A;  2QVP A;  4MHD A;  5F09 A;  1ELM P;  4FUU A;  5LRG A;  4AXV A;  4MFZ A;  5AG7 A;  4B12 A;  1MJ9 A;  4YGO A;  4FAI A;  1YVK A;  4F0Y A;  4DUK A;  1NMT A;  1Z8L A;  4UFX A;  3T9Y A;  4MHP A;  4R6T A;  4CYO A;  2JDD A;  4UBR A;  3R9F A;  5I0C A;  1Q2D A;  2PQ8 A;  2WPW A;  3EXN A;  1QQ9 A;  4NJR A;  4PXB A;  2OOT A;  1Q7L A;  2XEI A;  3FNC A;  3MN8 A;  2POK A;  2GIV A;  4NEX A;  2O28 A;  2DXQ A;  4I49 A;  1SQH A;  2BEI A;  4B10 A;  1GHE A;  3K9T A;  2HQY A;  2RC4 A;  2YGW A;  1P0H A;  1ZG8 A;  4R57 A;  2O4H A;  3P2H A;  5HVH A;  2F7V A;  4W9Y A;  2AJ6 A;  2X7B A;  4MRI A;  2CNM A;  2REF A;  2PSW A;  2ZEF A;  4FD5 A;  4KSA A;  4A37 A;  1CBX A;  4LUA A;  2WPX A;  4G1P A;  3B3S A;  4AVA A;  3IIB A;  5HMN A;  3JVN A;  4UWI A;  3TOA A;  2V8V A;  4C2Y A;  4BMH A;  3SXO A;  2JLM A;  3T8W A;  1Y9W A;  4RI1 A;  4KOY A;  2FS5 A;  2PR8 A;  4OKO A;  2CNT A;  3I1U A;  1MJA A;  1Q2Y A;  1BPN A;  1ZO0 A;  2XEJ A;  5IB0 A;  3TE4 A;  2YNC C;  2QML A;  5D8N A;  4OME A;  2J9A A;  3FX6 A;  5I4M A;  4FBE A;  1KZF A;  1VHS A;  2PRB A;  3WR7 A;  3LOD A;  3H5Z A;  3QB8 A;  4E2A A;  4X5K A;  4X3R A;  1JWQ A;  2DPT A;  2YNE A;  1RXT A;  1VGY A;  1TKH A;  1IYK A;  1LAP A;  2JDC A;  4JXR A;  4P4J A;  4PV6 A;  2ARH A;  1XOV A;  2C6G A;  2V8H A;  2J8R A;  1UFH A;  2B58 A;  2CXA A;  2VL1 A;  2HC9 A;  2FCK A;  4H6U A;  4QBJ A;  5E96 A;  3EC4 A;  3W6X A;  4A39 A;  3WC6 A;  4HKF A;  2CNS A;  4AB7 A;  4NGM A;  4HPS A;  3SHP A;  1IY7 A;  2FL4 A;  4KUB A;  1Y7R A;  2EK8 A;  4UCM A;  4CGP A;  1M44 A;  2Q4V A;  3SI1 A;  4II9 A;  4P4B A;  3KZW A;  2AFM A;  3NE7 A;  2Z10 A;  3FRM A;  3KI9 A;  1RO5 A;  3TO6 A;  4HNW B;  2IQ6 A;  2GE3 A;  2AFU A;  2JEW A;  1M4L A;  4JJX A;  4NGS A;  3RO0 A;  3FYN A;  4C7I A;  3DNS A;  3B3W A;  4B5O A;  1F2O A;  4HNY B;  1QSM A;  1ELL P;  3D2P A;  3EY5 A;  4QB9 A;  3KQX A;  1L0C A;  4PQA A; 
#chains in the Genus database with same CATH homology
 2Z3L A;  1QST A;  3PZJ A;  4KOS A;  3IGR A;  3G3S A;  4HNX B;  4Q36 A;  2HV2 A;  2JEV A;  3TCV A;  2PDO A;  2Z0Z A;  2VZY A;  3RYO A;  2FXF A;  2Z3M A;  4JWP A;  2YND A;  2OH1 A;  4B13 A;  4MBU A;  5AG5 A;  4MI4 A;  3A9L A;  4UA3 A;  5BWA B;  1YGH A;  4PSW A;  4PK3 A;  2P6E A;  1KUX A;  2VQY A;  3D8P A;  1BO4 A;  2Z3O A;  2A4N A;  4E0A A;  1IID A;  1V0C A;  4KUA A;  4R3K A;  3F5B A;  3R9E A;  4KLV A;  4KOW A;  5DWM A;  5JQ4 A;  2ATR A;  1XEB A;  4R9M A;  4C68 A;  3GKR A;  1VKC A;  4JXQ A;  3V8I A;  4NF1 A;  2Z3N A;  1K4J A;  1LRZ A;  2J8N A;  2FIW A;  3EO4 A;  3R95 A;  2EUI A;  1IB1 E;  2Y0M A;  4AVB A;  2VXK A;  4KOU A;  2R8V A;  4KSF A;  2Q7B A;  3IU2 A;  4ZGY B;  3IWE A;  5J8C A;  2PR1 A;  2FIA A;  4K30 A;  4CAV A;  5G20 A;  5KTC A;  4UCP A;  1N71 A;  4A95 A;  3CXS A;  2WSA A;  4CRY B;  2D4P A;  3BLN A;  2F5I A;  3F8K A;  3D2M A;  1Z4E A;  4OLL A;  2VBQ A;  3JTK A;  3FIX A;  4YRH A;  3PGP A;  2I00 A;  3JUW A;  5KTD A;  1CM0 A;  1QSN A;  1J4J A;  3DR8 A;  3S6K A;  4A32 A;  4CAF A;  4UCN A;  4MFK A;  3P2F A;  3VWD A;  3H4Q A;  4H6Z A;  1WWZ A;  1I12 A;  3F0A A;  1OZP A;  1KUV A;  1WK4 A;  3D3S A;  3R1K A;  3PP9 A;  2P6G A;  3TOB A;  3UY5 A;  3I9S A;  5AG6 A;  4CAX A;  1S7L A;  2Q0Y A;  4KLW A;  5G22 A;  4FD4 A;  3S6H A;  2PC1 A;  4M85 A;  2ZW4 A;  1B6B A;  3S6F A;  5KTA A;  4IF5 A;  2B3V A;  1Q2C A;  4UFW A;  1M4G A;  1S7N A;  2IL4 A;  2K5T A;  4KOV A;  1XF8 A;  5EBV A;  1Z9U A;  4MFQ A;  1P4N A;  4KS9 A;  3GYA A;  2Q4Y A;  3DSB A;  2G3T A;  4XPD B;  4Y49 B;  5ISV A;  4CRZ B;  2FE7 A;  3CXP A;  2P0W A;  3K9U A;  1B87 A;  1KUY A;  2OB0 A;  3IWG A;  4A33 A;  4CAE A;  1YVO A;  4C2Z A;  2AE6 A;  4CYQ A;  1PUA A;  4ORF A;  5G21 A;  3B8G A;  4R3L A;  2BUE A;  2GAN A;  3TT2 A;  5AGE A;  2G0B A;  2J8M A;  3C26 A;  5C82 A;  2R1I A;  2VEZ A;  4MFL A;  4FD6 A;  4ZBG A;  1Z4R A;  5FVJ A;  4A31 A;  4M3S A;  5A28 A;  1QSR A;  2VI7 A;  5G1Z A;  3TO9 A;  3SXN A;  2ZW7 A;  2OU2 A;  1NSL A;  4KOX A;  2R7H A;  2CY2 A;  2FSR A;  3S6G A;  2FT0 A;  5IV0 A;  3OWC A;  1QSO A;  3FBU A;  4CYN A;  4CYP A;  4JD6 A;  1M4I A;  4CGO A;  4NSQ A;  1XIX A;  4PSX A;  2B4D A;  2B3U A;  2ZPA A;  4QC6 A;  4R87 A;  4KOT A;  4XPD C;  4Y49 C;  4EVY A;  5IX3 A;  4C2X A;  3QAH A;  3R96 A;  2ZW5 A;  2OZU A;  2Q44 A;  4KVM E;  3W6S A;  4KVO E;  4F6A A;  1XMT A;  4UFV A;  4MY0 A;  2HUZ A;  4QUS A;  5CNP A;  2D4O A;  3KKW A;  2R98 A;  1XE4 A;  4KOR A;  4RS2 A;  2G3A A;  1I1D A;  1I21 A;  1S7F A;  4AG7 A;  4MFP A;  1MJB A;  5HH1 A;  4B5P B;  5H84 A;  5EC4 A;  2QEC A;  2BSW A;  5DWN A;  1M1D A;  1IYL A;  3E0K A;  4OAD A;  2I79 A;  4U5Y A;  2NMT A;  2KCW A;  4B11 A;  2Z11 A;  5H86 A;  4UWJ A;  4FD7 A;  5F49 A;  2BL1 A;  1S5K A;  2YNC A;  1S3Z A;  2B4B A;  2REE A;  4NXY A;  4XPL A;  1IIC A;  2B5G A;  4E8O A;  1S7K A;  2C27 A;  4L89 A;  4AVC A;  5F47 A;  4PK2 A;  4CAW A;  3ZZI A;  4A30 A;  4H89 A;  3R9G A;  5GCN A;  4B14 A;  2Z3K A;  1NE9 A;  3FXT A;  2Q04 A;  4B5P A;  4MJ8 A;  4DNC A;  3LD2 A;  3IU1 A;  1S60 A;  1YR0 A;  3N7Z A;  1CJW A;  3EFA A;  3ZJ0 A;  2ZW6 A;  4MY3 A;  3VWE A;  4CGM A;  2DPS A;  2Z3P A;  3TFY A;  4GS4 A;  1YLE A;  2VZZ A;  4ONU A;  4J3G A;  5JPH A;  1YX0 A;  3G8W A;  2B4D B;  1FY7 A;  1ON0 A;  4F0X A;  4XNH B;  4XPK A;  2OZG A;  2OZH A;  1MK4 A;  3DR6 A;  4U9Z A;  4CGN A;  1M4D A;  4C7H A;  5A27 A;  4YFJ A;  4L8A A;  3CXQ A;  5AG4 A;  1BOB A;  4IUS A;  3BJ7 A;  4MFJ A;  4A2Z A;  4AG9 A;  1TIQ A;  2ZXV A;  2P6F A;  5F46 A;  1U6M A;  4KZT A;  4KVX A;  3TO7 A;  2H5M A;  3GY9 A;  1PU9 A;  3BJ8 A;  5F48 A;  2QIR A;  3W91 A;  3TTH A;  3MGD A;  3DDD A;  2EVN A;  4NCZ A;  1Y9K A;  5J8F A;  5C88 A;  2WUU A;  3FB3 A;  3I3G A;  4Q38 A;  4QVT A;  4LX9 A;  4CGL A;  4CS0 B;  4BBH A;  1YK3 A;  2B5G B;  4JLY A;  4XNH C;  1YRE A;  4OAE A;  3T90 A;  1R57 A;  4U9Y A;  4MHD A;  4MFZ A;  5AG7 A;  4B12 A;  1MJ9 A;  4YGO A;  1YVK A;  4F0Y A;  1NMT A;  4UFX A;  3T9Y A;  4CYO A;  2JDD A;  4UBR A;  3R9F A;  5I0C A;  1Q2D A;  2PQ8 A;  2WPW A;  3EXN A;  3FNC A;  4NEX A;  2GIV A;  2O28 A;  2DXQ A;  4I49 A;  1SQH A;  2BEI A;  4B10 A;  1GHE A;  2HQY A;  2RC4 A;  2YGW A;  1P0H A;  4R57 A;  3P2H A;  2AJ6 A;  2X7B A;  2CNM A;  2REF A;  2PSW A;  4FD5 A;  4KSA A;  4LUA A;  2WPX A;  4AVA A;  5HMN A;  3JVN A;  4UWI A;  3TOA A;  4C2Y A;  4BMH A;  3SXO A;  2JLM A;  1Y9W A;  4RI1 A;  4KOY A;  2FS5 A;  2PR8 A;  2CNT A;  1MJA A;  1Q2Y A;  1ZO0 A;  3TE4 A;  5IB0 A;  2YNC C;  2QML A;  1KZF A;  1VHS A;  2PRB A;  3WR7 A;  3LOD A;  3H5Z A;  3QB8 A;  4E2A A;  4X5K A;  2DPT A;  2YNE A;  1RXT A;  1IYK A;  4PV6 A;  2JDC A;  4JXR A;  2ARH A;  2J8R A;  1UFH A;  2B58 A;  2CXA A;  2FCK A;  4H6U A;  4QBJ A;  5E96 A;  3EC4 A;  3W6X A;  4HKF A;  2CNS A;  4AB7 A;  3SHP A;  2FL4 A;  4KUB A;  1Y7R A;  4CGP A;  4UCM A;  1M44 A;  2Q4V A;  4II9 A;  3NE7 A;  2Z10 A;  3FRM A;  3TO6 A;  1RO5 A;  4HNW B;  2GE3 A;  4JJX A;  4C7I A;  3FYN A;  3DNS A;  4B5O A;  4HNY B;  1QSM A;  3D2P A;  3EY5 A;  4QB9 A;  1L0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...