2D4PA

Crystal structure of ttha1254 (wild type) from thermus thermophilus hb8
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRIEGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA1254
publication title Crystal structure of TTHA1254 (wild type) from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 36
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09390 DUF1999 Protein of unknown function (DUF1999)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2d4pA00
4JWPA 3D3SA 5KTDA 4E2AA 1IICA 1PUAA 2JLMA 4NCZA 4M3SA 1R57A 4YGOA 2R1IA 4U9YA 1XMTA 2VBQA 4UA3A 4B5PA 3DNSA 4AG7A 3FIXA 2J8MA 1Y9KA 4B5PB 4BMHA 4XPLA 1S5KA 3JUWA 3R96A 3QAHA 3FNCA 4H89A 3R9GA 2ZW7A 4R87A 2G0BA 2OZHA 2REEA 1XIXA 2C27A 4MI4A 1VKCA 2B4DB 3RYOA 2B58A 3DDDA 1K4JA 3GKRA 4KZTA 3GY9A 3I9SA 3F0AA 3IWGA 4E0AA 4KOWA 1OZPA 4PSXA 3T90A 1M4DA 1ON0A 3F8KA 3WR7A 1P0HA 3BJ7A 5E96A 5CNPA 5I0CA 2B5GB 4R9MA 3DR8A 2Q04A 1M1DA 4KUBA 2Q44A 4KLVA 4PV6A 2PR1A 3D8PA 4ONUA 3QB8A 1S7NA 4II9A 3TFYA 3TOBA 2O28A 4J3GA 2B3VA 3MGDA 2CNMA 2VZZA 4XNHB 3SXNA 4AVBA 3EXNA 4U5YA 4KOXA 4CRYB 4Y49B 5GCNA 2GANA 4UBRA 2IL4A 4MBUA 5JPHA 2JDCA 1Z4EA 4HKFA 5HMNA 1U6MA 3D2MA 2P6EA 3CXQA 3IGRA 4X5KA 5ISVA 4KORA 3SHPA 4K30A 4KOYA 5IV0A 5H84A 2G3AA 2WPXA 2GIVA 4Y49C 2BSWA 2NMTA 4EVYA 1Z4RA 2D4OA 1QSMA 2PR8A 4RS2A 1M4IA 1FY7A 1M44A 4MY0A 1QSNA 3B8GA 3BLNA 2FSRA 3I3GA 2FCKA 4OADA 2JEVA 3UY5A 3GYAA 2OB0A 2X7BA 3E0KA 2PDOA 2ZW6A 1VHSA 4AB7A 3TO6A 3G3SA 4KOSA 1MJ9A 2Z10A 2ATRA 1YVKA 3PZJA 2CY2A 4CAXA 4JJXA 3W6SA 2FT0A 2R98A 4JD6A 1RXTA 4CRZB 2OU2A 4AVCA 2AJ6A 2B4DA 4XPDC 1PU9A 2P6GA 4LX9A 4F6AA 2CNTA 1KUVA 2FE7A 2VI7A 1Y7RA 1B87A 4UWJA 2ZW5A 4QB9A 2P6FA 4PK2A 1CM0A 1N71A 4QC6A 3FXTA 2ZXVA 2B5GA 3ZJ0A 2WPWA 4KVOE 2QMLA 4XPKA 2OZUA 1M4GA 2Q7BA 2PQ8A 3LD2A 3NE7A 2PSWA 5IB0A 3TCVA 3FRMA 4FD5A 4HNXB 1Y9WA 4RI1A 1IYLA 4E8OA 1MJAA 5JQ4A 2I00A 1V0CA 2PRBA 4NF1A 3K9UA 4KVME 2Z11A 2OZGA 3LODA 4OLLA 3JVNA 4LUAA 2F5IA 5EBVA 1YR0A 4PSWA 5HH1A 1I1DA 3V8IA 1RO5A 1UFHA 2QIRA 2CNSA 1S60A 1SQHA 3P2FA 2VQYA 2BEIA 1S3ZA 4I49A 3F5BA 4KOVA 2VXKA 1YREA 3BJ8A 2Q4YA 4FD6A 4CAVA 3FYNA 2A4NA 2KCWA 1QSOA 2FL4A 2BUEA 4GS4A 3VWDA 2HUZA 4KVXA 5C82A 3W91A 1NE9A 5DWMA 3TT2A 2BL1A 2B4BA 4R3KA 4H6ZA 1IB1E 3PP9A 1QSRA 4XPDB 1S7LA 4KOTA 4AVAA 2RC4A 4ZBGA 5DWNA 3TTHA 2OH1A 4NXYA 1BOBA 1MJBA 2HV2A 2D4PA 1L0CA 4JLYA 3CXSA 3DR6A 4B5OA 5F48A 5FVJA 4KLWA 1GHEA 1YGHA 2AE6A 2G3TA 4CS0B 3ZZIA 4F0YA 1B6BA 1BO4A 4L89A 4NEXA 3G8WA 1XF8A 1KUYA 1NSLA 4H6UA 3EY5A 2Q0YA 1WK4A 1XE4A 4YFJA 5J8FA 4OAEA 5KTCA 1Q2CA 1YX0A 2R7HA 1J4JA 4JXRA 1KUXA 1WWZA 3TO7A 2J8RA 4CAWA 2GE3A 4IUSA 4HNWB 5KTAA 3D2PA 5F46A 2K5TA 4FD4A 3TOAA 3P2HA 3C26A 3FB3A 3S6GA 2ZW4A 3FBUA 1CJWA 4U9ZA 1S7FA 4AG9A 4KOUA 3EFAA 4QBJA 2ZPAA 3EO4A 1YLEA 3DSBA 2I79A 2J8NA 1KZFA 3R1KA 4L8AA 1IYKA 4UWIA 2EVNA 5F47A 3S6HA 5IX3A 2R8VA 5J8CA 3W6XA 4QUSA 4MJ8A 2ARHA 3S6KA 1LRZA 1Q2YA 2FS5A 3PGPA 4KUAA 5H86A 2VZYA 1I12A 3CXPA 2Y0MA 1YVOA 3VWEA 1YK3A 2EUIA 3SXOA 3H4QA 2FIWA 4MHDA 2B3UA 4JXQA 4ORFA 4R3LA 3R95A 2FIAA 1P4NA 1MK4A 4FD7A 2P0WA 4QVTA 4HNYB 4NSQA 4YRHA 2FXFA 4PK3A 1I21A 5F49A 1XEBA 3EC4A 2VEZA 1QSTA 2HQYA 1Z9UA 2QECA 4IF5A 1Q2DA 4XNHC 1S7KA 5C88A 1IIDA 4MY3A 3N7ZA 3OWCA 2REFA 3T9YA 4R57A 2JDDA 3R9EA 1NMTA 4M85A 3TO9A 2H5MA 3TE4A 4DNCA 2DXQA 3S6FA 2Z0ZA 5EC4A 3KKWA 1TIQA 2Q4VA 3R9FA 2PC1A
chains in the Genus database with same CATH superfamily
1RTQA 2NSMA 3D3SA 3NH5A 4JWPA 4MXUA 3VARA 5KTDA 4E2AA 2ZOFA 3BI0A 2ZOGA 4NFRA 1YLOA 4UFVA 1IICA 1PUAA 2JLMA 4UIAA 4NCZA 4B14A 4M3SA 4ZYQA 1R57A 2WUUA 1YQEA 4YGOA 2R1IA 2V77A 1HDUA 4U9YA 4AXVA 4R6TA 1XMTA 2VBQA 4NGRA 5EMIA 5HXDA 4UA3A 4B5PA 3DNSA 2QVPA 1GYTA 4AG7A 3S9NA 3FIXA 3H8GA 4B13A 2AFWA 2J8MA 1Y9KA 3HLPA 4B5PB 4BMHA 3B35A 4XPLA 1S5KA 3FECA 5IB9A 3JUWA 2BO9A 2GU2A 2ZEOA 3R96A 3QAHA 5JH9A 1ELMP 1TF8A 3FNCA 4H89A 3R9GA 2PJBA 2ZW7A 2NYQA 2G0BA 2OZHA 4OC0A 4R87A 3PBEA 3B3CA 4UEZA 4UIBA 2REEA 1XIXA 2C27A 4MI4A 1Y0YA 1VKCA 2B4DB 3RYOA 2B58A 3DDDA 3A9LA 3PBBA 1K4JA 3GKRA 3VATA 4KZTA 3GY9A 3SI2A 1M4LA 2CIJA 3F0AA 3I9SA 3IWGA 4E0AA 4KOWA 4R8FA 1CP6A 1OZPA 4PSXA 4Q7AA 3T90A 1M4DA 1VHOA 1ON0A 3IC1A 3F8KA 3K2KA 4A2ZA 1BLLE 4CYQA 3WR7A 4UCPA 1P0HA 3BJ7A 1LCPA 4ONWA 4P4EA 4YWYA 5E96A 5G1ZA 4MFPA 4CGOA 5CNPA 3RNZA 5I0CA 4C68A 2C6PA 5LRJA 2B5GB 2I3CA 3IO1A 4B10A 4MFJA 4R9MA 3DR8A 2RFHA 2ANPA 3FEEA 1LAPA 2Q04A 3DGVA 1M1DA 4KUBA 3JRUA 4FBEA 1XJOA 4P4IA 4BINA 2Q44A 4IK2A 4KLVA 2JEWA 5F09A 2ZEEA 4PV6A 2PR1A 3D8PA 4ONUA 3QB8A 3D4UA 3I1UA 4F9VA 1S7NA 3WC6A 4II9A 3TFYA 4B11A 5K8PA 2PJCA 2PCUA 5AG5A 3FEDA 2AFXA 3RZAA 3B3SA 1TKFA 1HEEA 2DF5A 3TOBA 2ZEFA 4MCPA 4GXHA 3KZWA 2AFZA 2O28A 4KS9A 4J3GA 2HB6A 5THWA 3H5ZA 2B3VA 3SJGA 3CZXA 3MGDA 2CNMA 4KSIA 2VZZA 4XNHB 1UWYA 5JGFA 2CXAA 5LYLA 2ZEHA 4ZY1A 4G1PA 2PJ2A 3TC8A 3KHXA 2FVGA 3SXNA 1R3NA 4AVBA 3EXNA 2YNCC 4U5YA 1ZG9A 2C6CA 2JBKA 1F57A 3D7HA 3ISXA 4KOXA 4CRYB 4Y49B 5GCNA 2GANA 4UFWA 5A28A 4UBRA 2YNDA 3B2YA 4R76A 4OKOA 4OC2A 2IL4A 4PXEA 4IHMA 1F2PA 4MBUA 2BCOA 5JPHA 2JDCA 2Z3KA 1Z4EA 4HKFA 5HMNA 4NGPA 1U6MA 4X3RA 1KWMA 4ZI6A 3D2MA 4CYPA 4OP4A 2O4HA 2P6EA 1XMBA 3CXQA 3IGRA 1ZO0A 4X5KA 4A30A 5ISVA 3IEHA 4KORA 3SHPA 4KSAA 4K30A 3NA6A 4KOYA 4MFKA 1TXRA 5IV0A 1VGYA 1DTDA 5H84A 3B7IA 3GLJA 2G3AA 2WPXA 2GIVA 3D7GA 4P4BA 2PE3A 3FF3A 4Y49C 4ZX9A 3NH4A 4C7HA 2BSWA 2NMTA 4EVYA 2CTBA 1Z4RA 2D4OA 3SJXA 7CPAA 1QSMA 3SJEA 2PR8A 3PRTA 4RS2A 1M4IA 2GLFA 1FY7A 1M44A 4MY0A 3KGQA 4CYNA 1QSNA 3B8GA 3CPAA 3BLNA 1QQ9A 3IJ3A 2FSRA 3I3GA 4X8IA 5LYFA 2FCKA 4LQ6A 4OADA 4NGMA 2JEVA 3LWUA 3UY5A 3GYAA 4WWVA 1TKHA 4MRIA 2OB0A 2X7BA 4EWTA 3E0KA 2PDOA 2ZW6A 1VHSA 3SJFA 4P4DA 5G20A 2VL1A 3TO6A 1F2OA 3G3SA 4AB7A 3LACA 1LAMA 1FT7A 2V8VA 3GIUA 3PB4X 5LRGA 4KOSA 1MJ9A 2Z10A 2O53A 3GUXA 2CTCA 2ATRA 3B3WA 4CGNA 1XBUA 1YVKA 3PZJA 2CY2A 4CAXA 4RUHA 2ZEDA 3VH9A 3BI1A 4JJXA 2FT0A 3W6SA 4NGQA 2R98A 4DUKA 3FVLA 4MHYA 5K8OA 4JD6A 1RXTA 2XEJA 4CRZB 1Z5RA 4MCQA 3GB0A 2OU2A 2HC9A 5ELYA 4YU9A 4AVCA 4JZ0A 2AJ6A 1A2ZA 4EFDA 5K8MA 2B4DA 4XPDC 4PXCA 1Z8XA 1PU9A 2ZELA 4ZGYB 5BWAB 2P6GA 3CDXA 3KI9A 4LX9A 4F6AA 2CNTA 4CAEA 4P10A 1KUVA 2AFOA 2FE7A 3WABA 2VI7A 1Y7RA 1B87A 3KR4A 4UWJA 3FMCA 3ISZA 2ZW5A 4QB9A 2ZEMA 2P6FA 4PK2A 1CM0A 1Z2LA 1N71A 4QC6A 3FXTA 1AUGA 2Q4ZA 3V38A 4MFQA 2ZXVA 2B5GA 4EMEA 3ZJ0A 1YMEA 2PIYA 4DYOA 2WPWA 5I4MA 4KVOE 4UFXA 2QMLA 3IU2A 3KR5A 4XPKA 2XEIA 2PJ1A 4MFZA 2OZUA 3D67A 1M4GA 2IJZA 2Q7BA 2GREA 2PQ8A 4NGSA 3LD2A 2PJ5A 3NE7A 2PSWA 5IB0A 3TCVA 2BOAA 2ODFA 3FRMA 4FD5A 4OC4A 4HNXB 1Y9WA 4RI1A 3NFZA 4UF4A 1IYLA 1CBXA 2Z3MA 4MFLA 4E8OA 1MJAA 2EO8A 5JQ4A 4P4JA 4UCMA 2I00A 1V0CA 2PJ4A 2PRBA 3HUVA 4NF1A 4P6YA 3K9UA 1CP7A 4M6HA 4KVME 5AGEA 2Z11A 4OIDA 2EK8A 2OZGA 3LODA 5JM6A 4OLLA 3D68A 3JVNA 4LUAA 4JYWA 1YW6A 2F5IA 5EBVA 4CGMA 1YR0A 4PSWA 2Q7SA 4CGPA 5HH1A 5K8NA 1I1DA 3H8EA 1H8LA 4H2KA 3BXMA 3MN8A 3V8IA 3PB9X 1RO5A 1CX8A 1UFHA 3FX6A 1Z8TA 2QIRA 3DLJA 2CNSA 1S60A 1SQHA 3D66A 1HDQA 1R43A 2PJ9A 3WC5A 3P2FA 2VQYA 5HVGA 2BEIA 1S3ZA 4I49A 4O23A 3F5BA 4KOVA 2RB7A 2VXKA 1YREA 3B3TA 4NJQA 1LOKA 3PFOA 4ZY2A 3BJ8A 2WYRA 5J1QA 2Q4YA 4OC1A 4FD6A 3RBUA 6CPAA 4CAVA 3WC7A 3PB6X 1IY7A 3FYNA 5G21A 2PIZA 2A4NA 2IQ6A 2DPTA 2KCWA 4NGNA 1QSOA 2FL4A 4M6IA 2BUEA 4GS4A 3VWDA 2HUZA 3KQXA 3LMSA 4KVXA 1NSAA 5C82A 3CT9A 3W91A 1NE9A 3SI1A 1AYEA 2JBJA 4LQGA 4NJRA 4OC3A 3L2NA 1IU8A 5DWMA 3S9MA 3TT2A 2BL1A 4MHPA 1FNOA 1BAVA 2B4BA 4R3KA 4RN7A 2PJAA 5AG6A 1JQGA 4B6ZA 4H6ZA 1IB1E 3RO0A 3PP9A 2PVWA 5LYDA 1QSRA 2OOTA 4XPDB 3H8FA 1S7LA 4MCSA 4KOTA 1Y0RA 5G22A 2RC4A 4AVAA 1Z8LA 4ZBGA 2ZENA 1Z8WA 3BHXA 5DWNA 5CBMA 3TTHA 1YSJA 2OH1A 4NXYA 1BOBA 1MJBA 1Q7LA 2HV2A 2GLJA 2D4PA 2Z3PA 1L0CA 2YNEA 2IMOA 2PJ0A 2Z3LA 3CXSA 3DR6A 3JTKA 4JLYA 2F8HA 4B5OA 1IOIA 5F48A 4MHNA 1EE3P 4Q38A 5FVJA 2V8GA 3PFEA 4KLWA 1CPXA 1GHEA 1YGHA 2AE6A 3QAYA 2G3TA 1DE4C 1XFOA 4GM5A 4CS0B 3ZZIA 3T8WA 4F0YA 4BBHA 3NH8A 4F0XA 1ZLHA 1PYTB 1B6BA 1Y7EA 1BO4A 2AFMA 4L89A 1LFWA 4NEXA 4A32A 4M6GA 4BD9A 3G8WA 2PJ3A 1XF8A 1KUYA 5HVHA 4WJBA 4H6UA 3EY5A 1NSLA 4ZY0A 2Q0YA 2PJ7A 2OR4A 1WK4A 1XE4A 1ARLA 4YFJA 4OIWA 5J8FA 3K9TA 4OAEA 3KQZA 5KTCA 1Q2CA 1XOVA 2ZEPA 1YX0A 2Q43A 3RAMA 2POKA 3FJUA 3NE8A 3SI0A 2R7HA 1J4JA 3B3VA 4JXRA 1JWQA 4NGTA 1KUXA 1WWZA 2AFSA 3TO7A 4DJLA 4FWUA 2J8RA 5D29A 2V8HA 5AG7A 1TKJA 1VIXA 4CAWA 2QYVA 4CPAA 2GE3A 4IUSA 4HNWB 4IAVA 1BPNA 4A37A 5KTAA 3D2PA 2EK9A 4HPSA 4Q36A 5A27A 5F46A 4OC5A 2K5TA 4FD4A 4UEFA 1X12A 3TOAA 2YNCA 8CPAA 3P2HA 4FAIA 3C26A 4K3NA 5HVFA 4A31A 3FB3A 3IU1A 4TWEA 1TF9A 1ZG7A 3IWEA 4PQAA 4R7MA 1AMPA 3S6GA 2QJ8A 4F8ZA 4Z65A 2ZW4A 3FBUA 4P4FA 1CJWA 4U9ZA 1S7FA 4AG9A 1QMUA 4KOUA 2DPSA 3EFAA 3MRUA 4P44A 2ZPAA 4QBJA 3PEIA 3EO4A 1YLEA 4PXBA 3DSBA 2I79A 5AG4A 2J8NA 1KZFA 2PVVA 3R1KA 4L8AA 4W9YA 1IYKA 4UEEA 5DS0A 4CAFA 4UWIA 2EVNA 3QNVA 5F47A 1CPSA 3PB8X 3S6HA 5IX3A 2GFQA 1OBRA 2R8VA 3FH4A 4KSFA 3W6XA 5J8CA 4QUSA 5LRKA 4MJ8A 2PRQA 4CYOA 3IIBA 2ARHA 2Q51A 3S6KA 1LRZA 1Q2YA 2FS5A 3PGPA 4KUAA 5H86A 2V8DA 4C7IA 2VZYA 1I12A 2Z3NA 3CXPA 4A38A 2Y0MA 1YVOA 4TNUA 4UCNA 3VWEA 2ZEGA 1YK3A 2EUIA 1X10A 2WZNA 2F7VA 3SXOA 3H4QA 2FIWA 4MHDA 2CF4A 2B3UA 2XEFA 3KASA 2XEGA 2ABZA 4JXQA 4ORFA 5LYIA 4F9UA 4R3LA 5D8NA 3R95A 3N5FA 2FIAA 1P4NA 1YW4A 2AFUA 2G9DA 4C2ZA 1MK4A 4A33A 3TX8A 4A94A 4FD7A 2P0WA 4QVTA 3D7FA 4HNYB 2PJ8A 4NSQA 5CPAA 4YRHA 4MHZA 4A39A 4FUUA 2C1CA 4X2TA 2FXFA 4PK3A 4C2XA 3V7ZA 2C6GA 2YGWA 1I21A 1ZG8A 5F49A 1XEBA 3WT4A 3EC4A 2VEZA 1PCAA 3IWWA 1QSTA 2HQYA 1Z9UA 2EBJA 1BPMA 1CG2A 3PB7X 2QECA 1ELLP 1IGBA 1Q2DA 4IF5A 4XNHC 1S7KA 4C2YA 5C88A 1IIDA 4MY3A 3N7ZA 1IOFA 4ZX8A 3OWCA 2REFA 1LANA 1ARMA 3T9YA 4R57A 2EWBA 4MMOA 4B12A 2JDDA 2WSAA 3R9EA 1NMTA 4M85A 4OMEA 3CPXA 3TO9A 1VHEA 2J9AA 1XRYA 2H5MA 3KL9A 4P45A 4CGLA 2Z3OA 3D7DA 3TE4A 4DNCA 3S9LA 2PJ6A 2DXQA 3S6FA 4PXDA 2Z0ZA 3IFEA 2DEAA 5EC4A 4MCRA 3KKWA 1TIQA 2Q4VA 1ZLIA 4A95A 4PPZA 3R9FA 2PC1A 3KHZA
chains in the Genus database with same CATH topology
4JWPA 3D3SA 5KTDA 4E2AA 4UFVA 1IICA 1PUAA 2JLMA 4NCZA 4B14A 4M3SA 1R57A 2WUUA 4YGOA 2R1IA 4U9YA 1XMTA 2VBQA 4UA3A 4B5PA 3DNSA 4AG7A 3FIXA 4B13A 2J8MA 1Y9KA 4B5PB 4BMHA 4XPLA 1S5KA 3JUWA 3R96A 3QAHA 3FNCA 4H89A 3R9GA 2ZW7A 4R87A 2G0BA 2OZHA 2REEA 1XIXA 2C27A 4MI4A 1VKCA 2B4DB 3RYOA 2B58A 3DDDA 3A9LA 1K4JA 3GKRA 4KZTA 3GY9A 3I9SA 3F0AA 3IWGA 4E0AA 4KOWA 1OZPA 4PSXA 3T90A 1M4DA 1ON0A 3F8KA 4A2ZA 4CYQA 3WR7A 4UCPA 1P0HA 3BJ7A 5E96A 5G1ZA 4MFPA 4CGOA 5CNPA 5I0CA 4C68A 2B5GB 4B10A 4MFJA 4R9MA 3DR8A 2Q04A 1M1DA 4KUBA 2Q44A 4KLVA 4PV6A 2PR1A 3D8PA 4ONUA 3QB8A 1S7NA 4II9A 3TFYA 4B11A 5AG5A 3TOBA 2O28A 4KS9A 4J3GA 3H5ZA 2B3VA 3MGDA 2CNMA 2VZZA 4XNHB 2CXAA 3SXNA 4AVBA 3EXNA 2YNCC 4U5YA 4KOXA 4CRYB 4Y49B 5GCNA 2GANA 4UFWA 5A28A 4UBRA 2YNDA 2IL4A 4MBUA 5JPHA 2JDCA 2Z3KA 1Z4EA 4HKFA 5HMNA 1U6MA 3D2MA 4CYPA 4A30A 2P6EA 3CXQA 3IGRA 1ZO0A 4X5KA 5ISVA 4KORA 3SHPA 4KSAA 4K30A 4KOYA 4MFKA 5IV0A 5H84A 2G3AA 2WPXA 2GIVA 4Y49C 4C7HA 2BSWA 2NMTA 4EVYA 1Z4RA 2D4OA 1QSMA 2PR8A 4RS2A 1M4IA 1FY7A 1M44A 4MY0A 4CYNA 1QSNA 3B8GA 3BLNA 2FSRA 3I3GA 2FCKA 4OADA 2JEVA 3UY5A 3GYAA 2OB0A 2X7BA 3E0KA 2PDOA 2ZW6A 1VHSA 5G20A 3TO6A 4AB7A 3G3SA 4KOSA 1MJ9A 2Z10A 2ATRA 4CGNA 1YVKA 3PZJA 2CY2A 4CAXA 4JJXA 3W6SA 2FT0A 2R98A 4JD6A 1RXTA 4CRZB 2OU2A 4AVCA 2AJ6A 2B4DA 4XPDC 5BWAB 1PU9A 4ZGYB 2P6GA 4LX9A 4F6AA 2CNTA 4CAEA 1KUVA 2FE7A 2VI7A 1Y7RA 1B87A 4UWJA 2ZW5A 4QB9A 2P6FA 4PK2A 1CM0A 1N71A 4QC6A 3FXTA 4MFQA 2ZXVA 2B5GA 3ZJ0A 2WPWA 4KVOE 4UFXA 2QMLA 3IU2A 4XPKA 4MFZA 2OZUA 1M4GA 2Q7BA 2PQ8A 3LD2A 3NE7A 2PSWA 5IB0A 3TCVA 3FRMA 4FD5A 4HNXB 1Y9WA 4RI1A 1IYLA 2Z3MA 4E8OA 4MFLA 1MJAA 5JQ4A 4UCMA 2I00A 1V0CA 2PRBA 4NF1A 3K9UA 4KVME 5AGEA 2Z11A 2OZGA 3LODA 4OLLA 3JVNA 4LUAA 2F5IA 5EBVA 4CGMA 1YR0A 4PSWA 4CGPA 5HH1A 1I1DA 3V8IA 1RO5A 1UFHA 2QIRA 2CNSA 1S60A 1SQHA 3P2FA 2VQYA 2BEIA 1S3ZA 4I49A 3F5BA 4KOVA 2VXKA 1YREA 3BJ8A 2Q4YA 4FD6A 4CAVA 3FYNA 5G21A 2A4NA 2DPTA 2KCWA 1QSOA 2FL4A 2BUEA 4GS4A 3VWDA 2HUZA 4KVXA 5C82A 3W91A 1NE9A 5DWMA 3TT2A 2BL1A 2B4BA 4R3KA 5AG6A 4H6ZA 1IB1E 3PP9A 1QSRA 4XPDB 1S7LA 5G22A 4KOTA 4AVAA 2RC4A 4ZBGA 5DWNA 3TTHA 2OH1A 4NXYA 1BOBA 1MJBA 2HV2A 2D4PA 2Z3PA 1L0CA 2YNEA 4JLYA 2Z3LA 3CXSA 3DR6A 3JTKA 4B5OA 5F48A 4Q38A 5FVJA 4KLWA 1GHEA 1YGHA 2AE6A 2G3TA 4CS0B 3ZZIA 4F0YA 4BBHA 4F0XA 1B6BA 1BO4A 4L89A 4NEXA 4A32A 3G8WA 1XF8A 1KUYA 1NSLA 4H6UA 3EY5A 2Q0YA 1WK4A 1XE4A 4YFJA 5J8FA 4OAEA 5KTCA 1Q2CA 1YX0A 2R7HA 1J4JA 4JXRA 1KUXA 1WWZA 3TO7A 2J8RA 5AG7A 4CAWA 2GE3A 4IUSA 4HNWB 5KTAA 3D2PA 5A27A 4Q36A 5F46A 2K5TA 4FD4A 3TOAA 2YNCA 3P2HA 3C26A 4A31A 3FB3A 3IU1A 3IWEA 3S6GA 2ZW4A 3FBUA 1CJWA 4U9ZA 1S7FA 4AG9A 4KOUA 2DPSA 3EFAA 4QBJA 2ZPAA 3EO4A 1YLEA 3DSBA 2I79A 5AG4A 2J8NA 1KZFA 3R1KA 4L8AA 1IYKA 4CAFA 4UWIA 2EVNA 5F47A 3S6HA 5IX3A 2R8VA 4KSFA 5J8CA 3W6XA 4QUSA 4MJ8A 4CYOA 2ARHA 3S6KA 1LRZA 1Q2YA 2FS5A 3PGPA 4KUAA 5H86A 4C7IA 2VZYA 1I12A 2Z3NA 3CXPA 2Y0MA 1YVOA 4UCNA 3VWEA 1YK3A 2EUIA 3SXOA 3H4QA 2FIWA 4MHDA 2B3UA 4JXQA 4ORFA 4R3LA 3R95A 2FIAA 1P4NA 4C2ZA 1MK4A 4FD7A 2P0WA 4QVTA 4A33A 4HNYB 4NSQA 4YRHA 2FXFA 4PK3A 4C2XA 2YGWA 1I21A 5F49A 1XEBA 3EC4A 2VEZA 1QSTA 2HQYA 1Z9UA 2QECA 4IF5A 1Q2DA 4XNHC 1S7KA 4C2YA 5C88A 1IIDA 4MY3A 3N7ZA 3OWCA 2REFA 3T9YA 4R57A 4B12A 2JDDA 2WSAA 3R9EA 1NMTA 4M85A 3TO9A 4CGLA 2H5MA 2Z3OA 3TE4A 4DNCA 2DXQA 3S6FA 2Z0ZA 5EC4A 3KKWA 1TIQA 2Q4VA 4A95A 3R9FA 2PC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWP A;  3D3S A;  5KTD A;  4E2A A;  1IIC A;  1PUA A;  2JLM A;  4NCZ A;  4M3S A;  1R57 A;  4YGO A;  2R1I A;  4U9Y A;  1XMT A;  2VBQ A;  4UA3 A;  4B5P A;  3DNS A;  4AG7 A;  3FIX A;  2J8M A;  1Y9K A;  4B5P B;  4BMH A;  4XPL A;  1S5K A;  3JUW A;  3R96 A;  3QAH A;  3FNC A;  4H89 A;  3R9G A;  2ZW7 A;  4R87 A;  2G0B A;  2OZH A;  2REE A;  1XIX A;  2C27 A;  4MI4 A;  1VKC A;  2B4D B;  3RYO A;  2B58 A;  3DDD A;  1K4J A;  3GKR A;  4KZT A;  3GY9 A;  3I9S A;  3F0A A;  3IWG A;  4E0A A;  4KOW A;  1OZP A;  4PSX A;  3T90 A;  1M4D A;  1ON0 A;  3F8K A;  3WR7 A;  1P0H A;  3BJ7 A;  5E96 A;  5CNP A;  5I0C A;  2B5G B;  4R9M A;  3DR8 A;  2Q04 A;  1M1D A;  4KUB A;  2Q44 A;  4KLV A;  4PV6 A;  2PR1 A;  3D8P A;  4ONU A;  3QB8 A;  1S7N A;  4II9 A;  3TFY A;  3TOB A;  2O28 A;  4J3G A;  2B3V A;  3MGD A;  2CNM A;  2VZZ A;  4XNH B;  3SXN A;  4AVB A;  3EXN A;  4U5Y A;  4KOX A;  4CRY B;  4Y49 B;  5GCN A;  2GAN A;  4UBR A;  2IL4 A;  4MBU A;  5JPH A;  2JDC A;  1Z4E A;  4HKF A;  5HMN A;  1U6M A;  3D2M A;  2P6E A;  3CXQ A;  3IGR A;  4X5K A;  5ISV A;  4KOR A;  3SHP A;  4K30 A;  4KOY A;  5IV0 A;  5H84 A;  2G3A A;  2WPX A;  2GIV A;  4Y49 C;  2BSW A;  2NMT A;  4EVY A;  1Z4R A;  2D4O A;  1QSM A;  2PR8 A;  4RS2 A;  1M4I A;  1FY7 A;  1M44 A;  4MY0 A;  1QSN A;  3B8G A;  3BLN A;  2FSR A;  3I3G A;  2FCK A;  4OAD A;  2JEV A;  3UY5 A;  3GYA A;  2OB0 A;  2X7B A;  3E0K A;  2PDO A;  2ZW6 A;  1VHS A;  4AB7 A;  3TO6 A;  3G3S A;  4KOS A;  1MJ9 A;  2Z10 A;  2ATR A;  1YVK A;  3PZJ A;  2CY2 A;  4CAX A;  4JJX A;  3W6S A;  2FT0 A;  2R98 A;  4JD6 A;  1RXT A;  4CRZ B;  2OU2 A;  4AVC A;  2AJ6 A;  2B4D A;  4XPD C;  1PU9 A;  2P6G A;  4LX9 A;  4F6A A;  2CNT A;  1KUV A;  2FE7 A;  2VI7 A;  1Y7R A;  1B87 A;  4UWJ A;  2ZW5 A;  4QB9 A;  2P6F A;  4PK2 A;  1CM0 A;  1N71 A;  4QC6 A;  3FXT A;  2ZXV A;  2B5G A;  3ZJ0 A;  2WPW A;  4KVO E;  2QML A;  4XPK A;  2OZU A;  1M4G A;  2Q7B A;  2PQ8 A;  3LD2 A;  3NE7 A;  2PSW A;  5IB0 A;  3TCV A;  3FRM A;  4FD5 A;  4HNX B;  1Y9W A;  4RI1 A;  1IYL A;  4E8O A;  1MJA A;  5JQ4 A;  2I00 A;  1V0C A;  2PRB A;  4NF1 A;  3K9U A;  4KVM E;  2Z11 A;  2OZG A;  3LOD A;  4OLL A;  3JVN A;  4LUA A;  2F5I A;  5EBV A;  1YR0 A;  4PSW A;  5HH1 A;  1I1D A;  3V8I A;  1RO5 A;  1UFH A;  2QIR A;  2CNS A;  1S60 A;  1SQH A;  3P2F A;  2VQY A;  2BEI A;  1S3Z A;  4I49 A;  3F5B A;  4KOV A;  2VXK A;  1YRE A;  3BJ8 A;  2Q4Y A;  4FD6 A;  4CAV A;  3FYN A;  2A4N A;  2KCW A;  1QSO A;  2FL4 A;  2BUE A;  4GS4 A;  3VWD A;  2HUZ A;  4KVX A;  5C82 A;  3W91 A;  1NE9 A;  5DWM A;  3TT2 A;  2BL1 A;  2B4B A;  4R3K A;  4H6Z A;  1IB1 E;  3PP9 A;  1QSR A;  4XPD B;  1S7L A;  4KOT A;  4AVA A;  2RC4 A;  4ZBG A;  5DWN A;  3TTH A;  2OH1 A;  4NXY A;  1BOB A;  1MJB A;  2HV2 A;  2D4P A;  1L0C A;  4JLY A;  3CXS A;  3DR6 A;  4B5O A;  5F48 A;  5FVJ A;  4KLW A;  1GHE A;  1YGH A;  2AE6 A;  2G3T A;  4CS0 B;  3ZZI A;  4F0Y A;  1B6B A;  1BO4 A;  4L89 A;  4NEX A;  3G8W A;  1XF8 A;  1KUY A;  1NSL A;  4H6U A;  3EY5 A;  2Q0Y A;  1WK4 A;  1XE4 A;  4YFJ A;  5J8F A;  4OAE A;  5KTC A;  1Q2C A;  1YX0 A;  2R7H A;  1J4J A;  4JXR A;  1KUX A;  1WWZ A;  3TO7 A;  2J8R A;  4CAW A;  2GE3 A;  4IUS A;  4HNW B;  5KTA A;  3D2P A;  5F46 A;  2K5T A;  4FD4 A;  3TOA A;  3P2H A;  3C26 A;  3FB3 A;  3S6G A;  2ZW4 A;  3FBU A;  1CJW A;  4U9Z A;  1S7F A;  4AG9 A;  4KOU A;  3EFA A;  4QBJ A;  2ZPA A;  3EO4 A;  1YLE A;  3DSB A;  2I79 A;  2J8N A;  1KZF A;  3R1K A;  4L8A A;  1IYK A;  4UWI A;  2EVN A;  5F47 A;  3S6H A;  5IX3 A;  2R8V A;  5J8C A;  3W6X A;  4QUS A;  4MJ8 A;  2ARH A;  3S6K A;  1LRZ A;  1Q2Y A;  2FS5 A;  3PGP A;  4KUA A;  5H86 A;  2VZY A;  1I12 A;  3CXP A;  2Y0M A;  1YVO A;  3VWE A;  1YK3 A;  2EUI A;  3SXO A;  3H4Q A;  2FIW A;  4MHD A;  2B3U A;  4JXQ A;  4ORF A;  4R3L A;  3R95 A;  2FIA A;  1P4N A;  1MK4 A;  4FD7 A;  2P0W A;  4QVT A;  4HNY B;  4NSQ A;  4YRH A;  2FXF A;  4PK3 A;  1I21 A;  5F49 A;  1XEB A;  3EC4 A;  2VEZ A;  1QST A;  2HQY A;  1Z9U A;  2QEC A;  4IF5 A;  1Q2D A;  4XNH C;  1S7K A;  5C88 A;  1IID A;  4MY3 A;  3N7Z A;  3OWC A;  2REF A;  3T9Y A;  4R57 A;  2JDD A;  3R9E A;  1NMT A;  4M85 A;  3TO9 A;  2H5M A;  3TE4 A;  4DNC A;  2DXQ A;  3S6F A;  2Z0Z A;  5EC4 A;  3KKW A;  1TIQ A;  2Q4V A;  3R9F A;  2PC1 A; 
#chains in the Genus database with same CATH topology
 1RTQ A;  2NSM A;  3D3S A;  3NH5 A;  4JWP A;  4MXU A;  3VAR A;  5KTD A;  4E2A A;  2ZOF A;  3BI0 A;  2ZOG A;  4NFR A;  1YLO A;  4UFV A;  1IIC A;  1PUA A;  2JLM A;  4UIA A;  4NCZ A;  4B14 A;  4M3S A;  4ZYQ A;  1R57 A;  2WUU A;  1YQE A;  4YGO A;  2R1I A;  2V77 A;  1HDU A;  4U9Y A;  4AXV A;  4R6T A;  1XMT A;  2VBQ A;  4NGR A;  5EMI A;  5HXD A;  4UA3 A;  4B5P A;  3DNS A;  2QVP A;  1GYT A;  4AG7 A;  3S9N A;  3FIX A;  3H8G A;  4B13 A;  2AFW A;  2J8M A;  1Y9K A;  3HLP A;  4B5P B;  4BMH A;  3B35 A;  4XPL A;  1S5K A;  3FEC A;  5IB9 A;  3JUW A;  2BO9 A;  2GU2 A;  2ZEO A;  3R96 A;  3QAH A;  5JH9 A;  1ELM P;  1TF8 A;  3FNC A;  4H89 A;  3R9G A;  2PJB A;  2ZW7 A;  2NYQ A;  2G0B A;  2OZH A;  4OC0 A;  4R87 A;  3PBE A;  3B3C A;  4UEZ A;  4UIB A;  2REE A;  1XIX A;  2C27 A;  4MI4 A;  1Y0Y A;  1VKC A;  2B4D B;  3RYO A;  2B58 A;  3DDD A;  3A9L A;  3PBB A;  1K4J A;  3GKR A;  3VAT A;  4KZT A;  3GY9 A;  3SI2 A;  1M4L A;  2CIJ A;  3F0A A;  3I9S A;  3IWG A;  4E0A A;  4KOW A;  4R8F A;  1CP6 A;  1OZP A;  4PSX A;  4Q7A A;  3T90 A;  1M4D A;  1VHO A;  1ON0 A;  3IC1 A;  3F8K A;  3K2K A;  4A2Z A;  1BLL E;  4CYQ A;  3WR7 A;  4UCP A;  1P0H A;  3BJ7 A;  1LCP A;  4ONW A;  4P4E A;  4YWY A;  5E96 A;  5G1Z A;  4MFP A;  4CGO A;  5CNP A;  3RNZ A;  5I0C A;  4C68 A;  2C6P A;  5LRJ A;  2B5G B;  2I3C A;  3IO1 A;  4B10 A;  4MFJ A;  4R9M A;  3DR8 A;  2RFH A;  2ANP A;  3FEE A;  1LAP A;  2Q04 A;  3DGV A;  1M1D A;  4KUB A;  3JRU A;  4FBE A;  1XJO A;  4P4I A;  4BIN A;  2Q44 A;  4IK2 A;  4KLV A;  2JEW A;  5F09 A;  2ZEE A;  4PV6 A;  2PR1 A;  3D8P A;  4ONU A;  3QB8 A;  3D4U A;  3I1U A;  4F9V A;  1S7N A;  3WC6 A;  4II9 A;  3TFY A;  4B11 A;  5K8P A;  2PJC A;  2PCU A;  5AG5 A;  3FED A;  2AFX A;  3RZA A;  3B3S A;  1TKF A;  1HEE A;  2DF5 A;  3TOB A;  2ZEF A;  4MCP A;  4GXH A;  3KZW A;  2AFZ A;  2O28 A;  4KS9 A;  4J3G A;  2HB6 A;  5THW A;  3H5Z A;  2B3V A;  3SJG A;  3CZX A;  3MGD A;  2CNM A;  4KSI A;  2VZZ A;  4XNH B;  1UWY A;  5JGF A;  2CXA A;  5LYL A;  2ZEH A;  4ZY1 A;  4G1P A;  2PJ2 A;  3TC8 A;  3KHX A;  2FVG A;  3SXN A;  1R3N A;  4AVB A;  3EXN A;  2YNC C;  4U5Y A;  1ZG9 A;  2C6C A;  2JBK A;  1F57 A;  3D7H A;  3ISX A;  4KOX A;  4CRY B;  4Y49 B;  5GCN A;  2GAN A;  4UFW A;  5A28 A;  4UBR A;  2YND A;  3B2Y A;  4R76 A;  4OKO A;  4OC2 A;  2IL4 A;  4PXE A;  4IHM A;  1F2P A;  4MBU A;  2BCO A;  5JPH A;  2JDC A;  2Z3K A;  1Z4E A;  4HKF A;  5HMN A;  4NGP A;  1U6M A;  4X3R A;  1KWM A;  4ZI6 A;  3D2M A;  4CYP A;  4OP4 A;  2O4H A;  2P6E A;  1XMB A;  3CXQ A;  3IGR A;  1ZO0 A;  4X5K A;  4A30 A;  5ISV A;  3IEH A;  4KOR A;  3SHP A;  4KSA A;  4K30 A;  3NA6 A;  4KOY A;  4MFK A;  1TXR A;  5IV0 A;  1VGY A;  1DTD A;  5H84 A;  3B7I A;  3GLJ A;  2G3A A;  2WPX A;  2GIV A;  3D7G A;  4P4B A;  2PE3 A;  3FF3 A;  4Y49 C;  4ZX9 A;  3NH4 A;  4C7H A;  2BSW A;  2NMT A;  4EVY A;  2CTB A;  1Z4R A;  2D4O A;  3SJX A;  7CPA A;  1QSM A;  3SJE A;  2PR8 A;  3PRT A;  4RS2 A;  1M4I A;  2GLF A;  1FY7 A;  1M44 A;  4MY0 A;  3KGQ A;  4CYN A;  1QSN A;  3B8G A;  3CPA A;  3BLN A;  1QQ9 A;  3IJ3 A;  2FSR A;  3I3G A;  4X8I A;  5LYF A;  2FCK A;  4LQ6 A;  4OAD A;  4NGM A;  2JEV A;  3LWU A;  3UY5 A;  3GYA A;  4WWV A;  1TKH A;  4MRI A;  2OB0 A;  2X7B A;  4EWT A;  3E0K A;  2PDO A;  2ZW6 A;  1VHS A;  3SJF A;  4P4D A;  5G20 A;  2VL1 A;  3TO6 A;  1F2O A;  3G3S A;  4AB7 A;  3LAC A;  1LAM A;  1FT7 A;  2V8V A;  3GIU A;  3PB4 X;  5LRG A;  4KOS A;  1MJ9 A;  2Z10 A;  2O53 A;  3GUX A;  2CTC A;  2ATR A;  3B3W A;  4CGN A;  1XBU A;  1YVK A;  3PZJ A;  2CY2 A;  4CAX A;  4RUH A;  2ZED A;  3VH9 A;  3BI1 A;  4JJX A;  2FT0 A;  3W6S A;  4NGQ A;  2R98 A;  4DUK A;  3FVL A;  4MHY A;  5K8O A;  4JD6 A;  1RXT A;  2XEJ A;  4CRZ B;  1Z5R A;  4MCQ A;  3GB0 A;  2OU2 A;  2HC9 A;  5ELY A;  4YU9 A;  4AVC A;  4JZ0 A;  2AJ6 A;  1A2Z A;  4EFD A;  5K8M A;  2B4D A;  4XPD C;  4PXC A;  1Z8X A;  1PU9 A;  2ZEL A;  4ZGY B;  5BWA B;  2P6G A;  3CDX A;  3KI9 A;  4LX9 A;  4F6A A;  2CNT A;  4CAE A;  4P10 A;  1KUV A;  2AFO A;  2FE7 A;  3WAB A;  2VI7 A;  1Y7R A;  1B87 A;  3KR4 A;  4UWJ A;  3FMC A;  3ISZ A;  2ZW5 A;  4QB9 A;  2ZEM A;  2P6F A;  4PK2 A;  1CM0 A;  1Z2L A;  1N71 A;  4QC6 A;  3FXT A;  1AUG A;  2Q4Z A;  3V38 A;  4MFQ A;  2ZXV A;  2B5G A;  4EME A;  3ZJ0 A;  1YME A;  2PIY A;  4DYO A;  2WPW A;  5I4M A;  4KVO E;  4UFX A;  2QML A;  3IU2 A;  3KR5 A;  4XPK A;  2XEI A;  2PJ1 A;  4MFZ A;  2OZU A;  3D67 A;  1M4G A;  2IJZ A;  2Q7B A;  2GRE A;  2PQ8 A;  4NGS A;  3LD2 A;  2PJ5 A;  3NE7 A;  2PSW A;  5IB0 A;  3TCV A;  2BOA A;  2ODF A;  3FRM A;  4FD5 A;  4OC4 A;  4HNX B;  1Y9W A;  4RI1 A;  3NFZ A;  4UF4 A;  1IYL A;  1CBX A;  2Z3M A;  4MFL A;  4E8O A;  1MJA A;  2EO8 A;  5JQ4 A;  4P4J A;  4UCM A;  2I00 A;  1V0C A;  2PJ4 A;  2PRB A;  3HUV A;  4NF1 A;  4P6Y A;  3K9U A;  1CP7 A;  4M6H A;  4KVM E;  5AGE A;  2Z11 A;  4OID A;  2EK8 A;  2OZG A;  3LOD A;  5JM6 A;  4OLL A;  3D68 A;  3JVN A;  4LUA A;  4JYW A;  1YW6 A;  2F5I A;  5EBV A;  4CGM A;  1YR0 A;  4PSW A;  2Q7S A;  4CGP A;  5HH1 A;  5K8N A;  1I1D A;  3H8E A;  1H8L A;  4H2K A;  3BXM A;  3MN8 A;  3V8I A;  3PB9 X;  1RO5 A;  1CX8 A;  1UFH A;  3FX6 A;  1Z8T A;  2QIR A;  3DLJ A;  2CNS A;  1S60 A;  1SQH A;  3D66 A;  1HDQ A;  1R43 A;  2PJ9 A;  3WC5 A;  3P2F A;  2VQY A;  5HVG A;  2BEI A;  1S3Z A;  4I49 A;  4O23 A;  3F5B A;  4KOV A;  2RB7 A;  2VXK A;  1YRE A;  3B3T A;  4NJQ A;  1LOK A;  3PFO A;  4ZY2 A;  3BJ8 A;  2WYR A;  5J1Q A;  2Q4Y A;  4OC1 A;  4FD6 A;  3RBU A;  6CPA A;  4CAV A;  3WC7 A;  3PB6 X;  1IY7 A;  3FYN A;  5G21 A;  2PIZ A;  2A4N A;  2IQ6 A;  2DPT A;  2KCW A;  4NGN A;  1QSO A;  2FL4 A;  4M6I A;  2BUE A;  4GS4 A;  3VWD A;  2HUZ A;  3KQX A;  3LMS A;  4KVX A;  1NSA A;  5C82 A;  3CT9 A;  3W91 A;  1NE9 A;  3SI1 A;  1AYE A;  2JBJ A;  4LQG A;  4NJR A;  4OC3 A;  3L2N A;  1IU8 A;  5DWM A;  3S9M A;  3TT2 A;  2BL1 A;  4MHP A;  1FNO A;  1BAV A;  2B4B A;  4R3K A;  4RN7 A;  2PJA A;  5AG6 A;  1JQG A;  4B6Z A;  4H6Z A;  1IB1 E;  3RO0 A;  3PP9 A;  2PVW A;  5LYD A;  1QSR A;  2OOT A;  4XPD B;  3H8F A;  1S7L A;  4MCS A;  4KOT A;  1Y0R A;  5G22 A;  2RC4 A;  4AVA A;  1Z8L A;  4ZBG A;  2ZEN A;  1Z8W A;  3BHX A;  5DWN A;  5CBM A;  3TTH A;  1YSJ A;  2OH1 A;  4NXY A;  1BOB A;  1MJB A;  1Q7L A;  2HV2 A;  2GLJ A;  2D4P A;  2Z3P A;  1L0C A;  2YNE A;  2IMO A;  2PJ0 A;  2Z3L A;  3CXS A;  3DR6 A;  3JTK A;  4JLY A;  2F8H A;  4B5O A;  1IOI A;  5F48 A;  4MHN A;  1EE3 P;  4Q38 A;  5FVJ A;  2V8G A;  3PFE A;  4KLW A;  1CPX A;  1GHE A;  1YGH A;  2AE6 A;  3QAY A;  2G3T A;  1DE4 C;  1XFO A;  4GM5 A;  4CS0 B;  3ZZI A;  3T8W A;  4F0Y A;  4BBH A;  3NH8 A;  4F0X A;  1ZLH A;  1PYT B;  1B6B A;  1Y7E A;  1BO4 A;  2AFM A;  4L89 A;  1LFW A;  4NEX A;  4A32 A;  4M6G A;  4BD9 A;  3G8W A;  2PJ3 A;  1XF8 A;  1KUY A;  5HVH A;  4WJB A;  4H6U A;  3EY5 A;  1NSL A;  4ZY0 A;  2Q0Y A;  2PJ7 A;  2OR4 A;  1WK4 A;  1XE4 A;  1ARL A;  4YFJ A;  4OIW A;  5J8F A;  3K9T A;  4OAE A;  3KQZ A;  5KTC A;  1Q2C A;  1XOV A;  2ZEP A;  1YX0 A;  2Q43 A;  3RAM A;  2POK A;  3FJU A;  3NE8 A;  3SI0 A;  2R7H A;  1J4J A;  3B3V A;  4JXR A;  1JWQ A;  4NGT A;  1KUX A;  1WWZ A;  2AFS A;  3TO7 A;  4DJL A;  4FWU A;  2J8R A;  5D29 A;  2V8H A;  5AG7 A;  1TKJ A;  1VIX A;  4CAW A;  2QYV A;  4CPA A;  2GE3 A;  4IUS A;  4HNW B;  4IAV A;  1BPN A;  4A37 A;  5KTA A;  3D2P A;  2EK9 A;  4HPS A;  4Q36 A;  5A27 A;  5F46 A;  4OC5 A;  2K5T A;  4FD4 A;  4UEF A;  1X12 A;  3TOA A;  2YNC A;  8CPA A;  3P2H A;  4FAI A;  3C26 A;  4K3N A;  5HVF A;  4A31 A;  3FB3 A;  3IU1 A;  4TWE A;  1TF9 A;  1ZG7 A;  3IWE A;  4PQA A;  4R7M A;  1AMP A;  3S6G A;  2QJ8 A;  4F8Z A;  4Z65 A;  2ZW4 A;  3FBU A;  4P4F A;  1CJW A;  4U9Z A;  1S7F A;  4AG9 A;  1QMU A;  4KOU A;  2DPS A;  3EFA A;  3MRU A;  4P44 A;  2ZPA A;  4QBJ A;  3PEI A;  3EO4 A;  1YLE A;  4PXB A;  3DSB A;  2I79 A;  5AG4 A;  2J8N A;  1KZF A;  2PVV A;  3R1K A;  4L8A A;  4W9Y A;  1IYK A;  4UEE A;  5DS0 A;  4CAF A;  4UWI A;  2EVN A;  3QNV A;  5F47 A;  1CPS A;  3PB8 X;  3S6H A;  5IX3 A;  2GFQ A;  1OBR A;  2R8V A;  3FH4 A;  4KSF A;  3W6X A;  5J8C A;  4QUS A;  5LRK A;  4MJ8 A;  2PRQ A;  4CYO A;  3IIB A;  2ARH A;  2Q51 A;  3S6K A;  1LRZ A;  1Q2Y A;  2FS5 A;  3PGP A;  4KUA A;  5H86 A;  2V8D A;  4C7I A;  2VZY A;  1I12 A;  2Z3N A;  3CXP A;  4A38 A;  2Y0M A;  1YVO A;  4TNU A;  4UCN A;  3VWE A;  2ZEG A;  1YK3 A;  2EUI A;  1X10 A;  2WZN A;  2F7V A;  3SXO A;  3H4Q A;  2FIW A;  4MHD A;  2CF4 A;  2B3U A;  2XEF A;  3KAS A;  2XEG A;  2ABZ A;  4JXQ A;  4ORF A;  5LYI A;  4F9U A;  4R3L A;  5D8N A;  3R95 A;  3N5F A;  2FIA A;  1P4N A;  1YW4 A;  2AFU A;  2G9D A;  4C2Z A;  1MK4 A;  4A33 A;  3TX8 A;  4A94 A;  4FD7 A;  2P0W A;  4QVT A;  3D7F A;  4HNY B;  2PJ8 A;  4NSQ A;  5CPA A;  4YRH A;  4MHZ A;  4A39 A;  4FUU A;  2C1C A;  4X2T A;  2FXF A;  4PK3 A;  4C2X A;  3V7Z A;  2C6G A;  2YGW A;  1I21 A;  1ZG8 A;  5F49 A;  1XEB A;  3WT4 A;  3EC4 A;  2VEZ A;  1PCA A;  3IWW A;  1QST A;  2HQY A;  1Z9U A;  2EBJ A;  1BPM A;  1CG2 A;  3PB7 X;  2QEC A;  1ELL P;  1IGB A;  1Q2D A;  4IF5 A;  4XNH C;  1S7K A;  4C2Y A;  5C88 A;  1IID A;  4MY3 A;  3N7Z A;  1IOF A;  4ZX8 A;  3OWC A;  2REF A;  1LAN A;  1ARM A;  3T9Y A;  4R57 A;  2EWB A;  4MMO A;  4B12 A;  2JDD A;  2WSA A;  3R9E A;  1NMT A;  4M85 A;  4OME A;  3CPX A;  3TO9 A;  1VHE A;  2J9A A;  1XRY A;  2H5M A;  3KL9 A;  4P45 A;  4CGL A;  2Z3O A;  3D7D A;  3TE4 A;  4DNC A;  3S9L A;  2PJ6 A;  2DXQ A;  3S6F A;  4PXD A;  2Z0Z A;  3IFE A;  2DEA A;  5EC4 A;  4MCR A;  3KKW A;  1TIQ A;  2Q4V A;  1ZLI A;  4A95 A;  4PPZ A;  3R9F A;  2PC1 A;  3KHZ A; 
#chains in the Genus database with same CATH homology
 4JWP A;  3D3S A;  5KTD A;  4E2A A;  4UFV A;  1IIC A;  1PUA A;  2JLM A;  4NCZ A;  4B14 A;  4M3S A;  1R57 A;  2WUU A;  4YGO A;  2R1I A;  4U9Y A;  1XMT A;  2VBQ A;  4UA3 A;  4B5P A;  3DNS A;  4AG7 A;  3FIX A;  4B13 A;  2J8M A;  1Y9K A;  4B5P B;  4BMH A;  4XPL A;  1S5K A;  3JUW A;  3R96 A;  3QAH A;  3FNC A;  4H89 A;  3R9G A;  2ZW7 A;  4R87 A;  2G0B A;  2OZH A;  2REE A;  1XIX A;  2C27 A;  4MI4 A;  1VKC A;  2B4D B;  3RYO A;  2B58 A;  3DDD A;  3A9L A;  1K4J A;  3GKR A;  4KZT A;  3GY9 A;  3I9S A;  3F0A A;  3IWG A;  4E0A A;  4KOW A;  1OZP A;  4PSX A;  3T90 A;  1M4D A;  1ON0 A;  3F8K A;  4A2Z A;  4CYQ A;  3WR7 A;  4UCP A;  1P0H A;  3BJ7 A;  5E96 A;  5G1Z A;  4MFP A;  4CGO A;  5CNP A;  5I0C A;  4C68 A;  2B5G B;  4B10 A;  4MFJ A;  4R9M A;  3DR8 A;  2Q04 A;  1M1D A;  4KUB A;  2Q44 A;  4KLV A;  4PV6 A;  2PR1 A;  3D8P A;  4ONU A;  3QB8 A;  1S7N A;  4II9 A;  3TFY A;  4B11 A;  5AG5 A;  3TOB A;  2O28 A;  4KS9 A;  4J3G A;  3H5Z A;  2B3V A;  3MGD A;  2CNM A;  2VZZ A;  4XNH B;  2CXA A;  3SXN A;  4AVB A;  3EXN A;  2YNC C;  4U5Y A;  4KOX A;  4CRY B;  4Y49 B;  5GCN A;  2GAN A;  4UFW A;  5A28 A;  4UBR A;  2YND A;  2IL4 A;  4MBU A;  5JPH A;  2JDC A;  2Z3K A;  1Z4E A;  4HKF A;  5HMN A;  1U6M A;  3D2M A;  4CYP A;  4A30 A;  2P6E A;  3CXQ A;  3IGR A;  1ZO0 A;  4X5K A;  5ISV A;  4KOR A;  3SHP A;  4KSA A;  4K30 A;  4KOY A;  4MFK A;  5IV0 A;  5H84 A;  2G3A A;  2WPX A;  2GIV A;  4Y49 C;  4C7H A;  2BSW A;  2NMT A;  4EVY A;  1Z4R A;  2D4O A;  1QSM A;  2PR8 A;  4RS2 A;  1M4I A;  1FY7 A;  1M44 A;  4MY0 A;  4CYN A;  1QSN A;  3B8G A;  3BLN A;  2FSR A;  3I3G A;  2FCK A;  4OAD A;  2JEV A;  3UY5 A;  3GYA A;  2OB0 A;  2X7B A;  3E0K A;  2PDO A;  2ZW6 A;  1VHS A;  5G20 A;  3TO6 A;  4AB7 A;  3G3S A;  4KOS A;  1MJ9 A;  2Z10 A;  2ATR A;  4CGN A;  1YVK A;  3PZJ A;  2CY2 A;  4CAX A;  4JJX A;  3W6S A;  2FT0 A;  2R98 A;  4JD6 A;  1RXT A;  4CRZ B;  2OU2 A;  4AVC A;  2AJ6 A;  2B4D A;  4XPD C;  5BWA B;  1PU9 A;  4ZGY B;  2P6G A;  4LX9 A;  4F6A A;  2CNT A;  4CAE A;  1KUV A;  2FE7 A;  2VI7 A;  1Y7R A;  1B87 A;  4UWJ A;  2ZW5 A;  4QB9 A;  2P6F A;  4PK2 A;  1CM0 A;  1N71 A;  4QC6 A;  3FXT A;  4MFQ A;  2ZXV A;  2B5G A;  3ZJ0 A;  2WPW A;  4KVO E;  4UFX A;  2QML A;  3IU2 A;  4XPK A;  4MFZ A;  2OZU A;  1M4G A;  2Q7B A;  2PQ8 A;  3LD2 A;  3NE7 A;  2PSW A;  5IB0 A;  3TCV A;  3FRM A;  4FD5 A;  4HNX B;  1Y9W A;  4RI1 A;  1IYL A;  2Z3M A;  4E8O A;  4MFL A;  1MJA A;  5JQ4 A;  4UCM A;  2I00 A;  1V0C A;  2PRB A;  4NF1 A;  3K9U A;  4KVM E;  5AGE A;  2Z11 A;  2OZG A;  3LOD A;  4OLL A;  3JVN A;  4LUA A;  2F5I A;  5EBV A;  4CGM A;  1YR0 A;  4PSW A;  4CGP A;  5HH1 A;  1I1D A;  3V8I A;  1RO5 A;  1UFH A;  2QIR A;  2CNS A;  1S60 A;  1SQH A;  3P2F A;  2VQY A;  2BEI A;  1S3Z A;  4I49 A;  3F5B A;  4KOV A;  2VXK A;  1YRE A;  3BJ8 A;  2Q4Y A;  4FD6 A;  4CAV A;  3FYN A;  5G21 A;  2A4N A;  2DPT A;  2KCW A;  1QSO A;  2FL4 A;  2BUE A;  4GS4 A;  3VWD A;  2HUZ A;  4KVX A;  5C82 A;  3W91 A;  1NE9 A;  5DWM A;  3TT2 A;  2BL1 A;  2B4B A;  4R3K A;  5AG6 A;  4H6Z A;  1IB1 E;  3PP9 A;  1QSR A;  4XPD B;  1S7L A;  5G22 A;  4KOT A;  4AVA A;  2RC4 A;  4ZBG A;  5DWN A;  3TTH A;  2OH1 A;  4NXY A;  1BOB A;  1MJB A;  2HV2 A;  2D4P A;  2Z3P A;  1L0C A;  2YNE A;  4JLY A;  2Z3L A;  3CXS A;  3DR6 A;  3JTK A;  4B5O A;  5F48 A;  4Q38 A;  5FVJ A;  4KLW A;  1GHE A;  1YGH A;  2AE6 A;  2G3T A;  4CS0 B;  3ZZI A;  4F0Y A;  4BBH A;  4F0X A;  1B6B A;  1BO4 A;  4L89 A;  4NEX A;  4A32 A;  3G8W A;  1XF8 A;  1KUY A;  1NSL A;  4H6U A;  3EY5 A;  2Q0Y A;  1WK4 A;  1XE4 A;  4YFJ A;  5J8F A;  4OAE A;  5KTC A;  1Q2C A;  1YX0 A;  2R7H A;  1J4J A;  4JXR A;  1KUX A;  1WWZ A;  3TO7 A;  2J8R A;  5AG7 A;  4CAW A;  2GE3 A;  4IUS A;  4HNW B;  5KTA A;  3D2P A;  5A27 A;  4Q36 A;  5F46 A;  2K5T A;  4FD4 A;  3TOA A;  2YNC A;  3P2H A;  3C26 A;  4A31 A;  3FB3 A;  3IU1 A;  3IWE A;  3S6G A;  2ZW4 A;  3FBU A;  1CJW A;  4U9Z A;  1S7F A;  4AG9 A;  4KOU A;  2DPS A;  3EFA A;  4QBJ A;  2ZPA A;  3EO4 A;  1YLE A;  3DSB A;  2I79 A;  5AG4 A;  2J8N A;  1KZF A;  3R1K A;  4L8A A;  1IYK A;  4CAF A;  4UWI A;  2EVN A;  5F47 A;  3S6H A;  5IX3 A;  2R8V A;  4KSF A;  5J8C A;  3W6X A;  4QUS A;  4MJ8 A;  4CYO A;  2ARH A;  3S6K A;  1LRZ A;  1Q2Y A;  2FS5 A;  3PGP A;  4KUA A;  5H86 A;  4C7I A;  2VZY A;  1I12 A;  2Z3N A;  3CXP A;  2Y0M A;  1YVO A;  4UCN A;  3VWE A;  1YK3 A;  2EUI A;  3SXO A;  3H4Q A;  2FIW A;  4MHD A;  2B3U A;  4JXQ A;  4ORF A;  4R3L A;  3R95 A;  2FIA A;  1P4N A;  4C2Z A;  1MK4 A;  4FD7 A;  2P0W A;  4QVT A;  4A33 A;  4HNY B;  4NSQ A;  4YRH A;  2FXF A;  4PK3 A;  4C2X A;  2YGW A;  1I21 A;  5F49 A;  1XEB A;  3EC4 A;  2VEZ A;  1QST A;  2HQY A;  1Z9U A;  2QEC A;  4IF5 A;  1Q2D A;  4XNH C;  1S7K A;  4C2Y A;  5C88 A;  1IID A;  4MY3 A;  3N7Z A;  3OWC A;  2REF A;  3T9Y A;  4R57 A;  4B12 A;  2JDD A;  2WSA A;  3R9E A;  1NMT A;  4M85 A;  3TO9 A;  4CGL A;  2H5M A;  2Z3O A;  3TE4 A;  4DNC A;  2DXQ A;  3S6F A;  2Z0Z A;  5EC4 A;  3KKW A;  1TIQ A;  2Q4V A;  4A95 A;  3R9F A;  2PC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...