1XMTA

X-ray structure of gene product from arabidopsis thaliana at1g77540
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative acetyltransferase
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1xmtA00
4H6ZA 4JD6A 4HNYB 2VBQA 2IL4A 3G8WA 2ZXVA 4R3LA 1VHSA 2B5GB 2FIWA 1IYKA 2CNTA 2Q44A 2B4DA 3F8KA 4B5PA 2OZHA 2JDCA 3ZZIA 1UFHA 4JXQA 3TOBA 3ZJ0A 4I49A 2EVNA 4H89A 2VZYA 2VXKA 1YREA 2B58A 4M85A 3GKRA 3S6FA 1Q2CA 3W6XA 1Z4RA 2CNSA 4JJXA 5F47A 1QSNA 2D4PA 2B3VA 4NEXA 4L8AA 4KOVA 4AVAA 1Y7RA 4KVXA 4UBRA 4PK2A 3FBUA 3R9FA 4KORA 2FCKA 4E0AA 1M4GA 4CRYB 3PGPA 3QAHA 4UWJA 3EO4A 4KZTA 3FRMA 1IB1E 4CAXA 4NCZA 1QSTA 2VQYA 4R9MA 5ISVA 1M44A 2C27A 4ORFA 1WWZA 1P0HA 1MJ9A 4XNHC 1S5KA 3I9SA 2J8RA 2WPXA 3TOAA 2OU2A 2J8NA 3K9UA 3E0KA 1MJAA 3I3GA 2AE6A 1YVKA 2VI7A 4PK3A 4KOUA 5C88A 1N71A 2QIRA 2ARHA 2DXQA 2J8MA 2P6FA 2HV2A 2Y0MA 2FXFA 2A4NA 2R98A 3DR6A 4RI1A 3D2PA 3H4QA 4UWIA 1S7FA 4KLVA 2QECA 1Z9UA 1YK3A 2AJ6A 3WR7A 1OZPA 2D4OA 4U5YA 4OADA 1CJWA 5H86A 1KUYA 4FD5A 1VKCA 1Y9KA 1U6MA 1NE9A 2FS5A 2JLMA 2CNMA 2FT0A 1P4NA 4AB7A 3PZJA 5EBVA 3LODA 1YGHA 4QC6A 4FD7A 5F46A 3FNCA 2HUZA 2PSWA 1BOBA 2B4BA 3MGDA 2PQ8A 4BMHA 2B5GA 4ZBGA 3R1KA 4KUBA 5HMNA 4L89A 5F48A 3NE7A 1PU9A 5J8CA 1XEBA 1S3ZA 4AG7A 3P2FA 3BJ8A 3S6KA 4XPDC 1Y9WA 5CNPA 4NF1A 5J8FA 3TO9A 4QB9A 2O28A 4GS4A 2JDDA 2WPWA 5KTAA 3SXOA 4Y49C 4XPLA 4OLLA 1S7KA 2ATRA 4MY0A 3GY9A 2FL4A 4PV6A 4CAWA 3FXTA 3F5BA 2ZPAA 5DWNA 2I00A 4QUSA 4CS0B 3TE4A 5FVJA 1Q2YA 4KOTA 4E2AA 4PSWA 1IIDA 4FD6A 1XMTA 2X7BA 4LX9A 1XIXA 3EY5A 1LRZA 4R57A 5E96A 1PUAA 1B87A 5HH1A 3SXNA 3UY5A 3VWDA 2Q04A 4QVTA 4IUSA 3T9YA 2GIVA 2OZUA 4F0YA 3N7ZA 1S60A 2FIAA 4AVBA 3VWEA 1S7LA 4NSQA 4MI4A 3TO7A 2NMTA 2P0WA 3TT2A 3D2MA 1L0CA 2ZW6A 3R9EA 2I79A 1Q2DA 4MY3A 5IB0A 4QBJA 3IWGA 3LD2A 3DNSA 3DDDA 2BL1A 3JVNA 4H6UA 4JWPA 3FYNA 4KOXA 1I1DA 3S6HA 2R8VA 1M4IA 1YR0A 2B3UA 5JPHA 3FB3A 3EFAA 2PDOA 3W6SA 5KTCA 2VEZA 1GHEA 2QMLA 1BO4A 3P2HA 3T90A 5F49A 3DSBA 4HNWB 4NXYA 2Q0YA 5IX3A 2PR1A 4RS2A 2R7HA 1Z4EA 3SHPA 4EVYA 4PSXA 2OH1A 3D8PA 4YFJA 2JEVA 2PC1A 2REFA 5IV0A 1KUVA 3DR8A 2FE7A 4AG9A 2F5IA 4MJ8A 2BSWA 3S6GA 1IICA 2ZW5A 2Q7BA 2R1IA 4MHDA 2KCWA 5JQ4A 3F0AA 3TFYA 3C26A 4JXRA 3EXNA 5C82A 2RC4A 2FSRA 1YX0A 4KUAA 4X5KA 3V8IA 2ZW4A 2Z0ZA 4KVOE 3OWCA 3QB8A 2B4DB 4B5PB 5I0CA 3BLNA 2REEA 2P6GA 4K30A 4HNXB 4KVME 1YLEA 1ON0A 4KOYA 4OAEA 3CXQA 3R96A 2Q4YA 4HKFA 1R57A 4XNHB 1M1DA 2G3AA 4B5OA 1I12A 2H5MA 3B8GA 1B6BA 4M3SA 3EC4A 1YVOA 4JLYA 4CRZB 2K5TA 3GYAA 3KKWA 3D3SA 1MJBA 3PP9A 3W91A 4AVCA 2ZW7A 3CXSA 2G3TA 1XF8A 4CAVA 4IF5A 4XPKA 1QSOA 5DWMA 4KOWA 3TO6A 2BEIA 1KUXA 3CXPA 2Z10A 2OB0A 2GE3A 3TCVA 5EC4A 4J3GA 5KTDA 1CM0A 1J4JA 1KZFA 3BJ7A 1V0CA 3R95A 4E8OA 5GCNA 1XE4A 3RYOA 1RXTA 2P6EA 1QSMA 1WK4A 1K4JA 1SQHA 5H84A 3FIXA 4F6AA 4R87A 4YRHA 4U9YA 4UA3A 3R9GA 1RO5A 2PR8A 2VZZA 4YGOA 2G0BA 3JUWA 1IYLA 1TIQA 2GANA 1QSRA 1I21A 4FD4A 3IGRA 3G3SA 2CY2A 4U9ZA 1NSLA 1FY7A 4ONUA 1S7NA 4II9A 4DNCA 2HQYA 2EUIA 1MK4A 4R3KA 2Q4VA 4XPDB 2Z11A 4MBUA 3TTHA 1NMTA 1M4DA 2BUEA 2OZGA 2PRBA 4KLWA 4LUAA 4KOSA 4Y49B
chains in the Genus database with same CATH superfamily
4H6ZA 4R76A 1Z5RA 4JD6A 4UFVA 2Q7SA 2VBQA 4HNYB 2IL4A 3G8WA 2ZXVA 4MCQA 4R3LA 1VHSA 4MCRA 3SJEA 2B5GB 2FIWA 1IYKA 2CNTA 2GREA 2Q44A 2B4DA 3F8KA 4B5PA 2OZHA 3H8GA 2JDCA 3ZZIA 3IO1A 3IC1A 3RO0A 1UFHA 4A32A 3BI1A 1TF8A 2CXAA 3FMCA 3BHXA 4JXQA 4MFQA 3IU2A 3TOBA 1RTQA 2Z3LA 3ZJ0A 1HDQA 4P6YA 4C2YA 4I49A 4P4IA 2PJ4A 2EVNA 4H89A 3FECA 1XJOA 2VZYA 2ZEMA 2VXKA 1YREA 1F57A 1AUGA 2B58A 4M85A 5THWA 5LYLA 2EO8A 3GKRA 3S6FA 1Q2CA 3W6XA 1Z4RA 2CNSA 3H5ZA 4JJXA 5F47A 4CAEA 2EK8A 5AG7A 4UF4A 1QSNA 2D4PA 3D7HA 2AFUA 3IWEA 3H8FA 3NH8A 2B3VA 2BCOA 3D7FA 1CX8A 4L8AA 4NEXA 4UCNA 4KOVA 3WC6A 1Y7RA 3NE8A 4AVAA 4KVXA 4B13A 4C68A 4UBRA 4A37A 2ZOGA 2NSMA 4PK2A 3V38A 1XMBA 4OIWA 3FBUA 3R9FA 5ELYA 4RUHA 3FEDA 1OBRA 2ZELA 1AMPA 1YLOA 2YGWA 2Q4ZA 2Z3NA 1ZLHA 4KORA 2FCKA 3TC8A 4B12A 4E0AA 4EWTA 1A2ZA 1M4GA 4CRYB 1IU8A 2PJ9A 3PGPA 2IMOA 1Y0RA 1XOVA 3RNZA 2ZOFA 3QAHA 4UWJA 2V8VA 3EO4A 4KZTA 2Z3KA 3FRMA 3S9NA 1IB1E 3KQZA 4CAXA 4NCZA 1HDUA 2G9DA 5LYDA 1QSTA 2VQYA 4R9MA 2BO9A 4WJBA 5ISVA 1M44A 2C27A 4ORFA 1WWZA 4C2ZA 3KQXA 2V8HA 1P0HA 5I4MA 1Z8WA 1CPXA 1MJ9A 4CGPA 4XNHC 1S5KA 3I9SA 3L2NA 2J8RA 2WPXA 2ZEEA 3TOAA 3FH4A 2OU2A 2J8NA 3K9UA 5AGEA 1ELMP 4CYQA 3E0KA 1YW4A 4WWVA 3MRUA 1MJAA 3I3GA 3FF3A 2AE6A 1YVKA 1VHEA 2VI7A 4PK3A 1TF9A 5LRKA 2PRQA 4KOUA 5C88A 1N71A 2O4HA 3FVLA 2QIRA 3ISXA 2PJ3A 3WC7A 4A94A 2ARHA 1DTDA 2DXQA 2J8MA 2ODFA 2P6FA 2HV2A 2BOAA 4YWYA 2WSAA 2Y0MA 3PBEA 3SJGA 2FXFA 2A4NA 2R98A 3B2YA 3DR6A 4PXBA 4RI1A 4F0XA 5LRGA 4FUUA 3D2PA 3H4QA 2AFMA 3D66A 4UWIA 1S7FA 3SI2A 3PFOA 2QECA 4KLVA 1Z9UA 5A27A 2OR4A 1YK3A 4OKOA 2AJ6A 3WR7A 1OZPA 2D4OA 3SI0A 4U5YA 4OADA 1FT7A 1CJWA 2O53A 2DEAA 8CPAA 1Q7LA 2IQ6A 2Z3PA 1KUYA 5H86A 2WZNA 4A31A 3B3VA 4FD5A 2POKA 4ZX9A 4F8ZA 4ZGYB 1LAPA 1VKCA 1Y9KA 4OIDA 3CDXA 1U6MA 1NE9A 2FS5A 4OC3A 2JLMA 3A9LA 2GFQA 2CNMA 3D7DA 3NA6A 2FT0A 5LYFA 1P4NA 4AB7A 1UWYA 1LANA 3LMSA 2AFXA 3PZJA 4MRIA 5EBVA 5HVFA 4B14A 2DPTA 3LODA 4CYPA 2C6GA 3GIUA 3PB8X 1YGHA 4QC6A 2PJ5A 2AFZA 3FNCA 2HUZA 3KHZA 2PSWA 4FD7A 5A28A 5F46A 1BOBA 4ZYQA 2B4BA 2Q43A 3MGDA 2PQ8A 2QYVA 4NGRA 2RB7A 4BMHA 4X8IA 1XFOA 3B3WA 4NJQA 2B5GA 2Z3MA 4ZBGA 4F9VA 3R1KA 4Q36A 4P44A 4KUBA 2XEFA 2WUUA 5HMNA 4L89A 5F48A 2ZENA 3JTKA 1PU9A 3NE7A 4HPSA 3SI1A 3B7IA 2IJZA 1PYTB 3B35A 5J8CA 3GB0A 1XEBA 4OC2A 3PEIA 3WABA 2XEJA 4B11A 4H2KA 4ZI6A 1S3ZA 5EMIA 4TNUA 4AG7A 4PXEA 4B10A 3P2FA 4P4DA 3BJ8A 4KSIA 3S6KA 4XPDC 1BPNA 1Y9WA 4X3RA 5CNPA 4NF1A 4A38A 4UIBA 4OC4A 5J8FA 4PXCA 3JRUA 3TO9A 2CTCA 3B3TA 4Q38A 4QB9A 4DJLA 2O28A 3SJXA 2CF4A 2PJ0A 4F9UA 4NJRA 2PE3A 7CPAA 2NYQA 2PJ8A 4GS4A 2JDDA 2WPWA 2YNCA 5KTAA 1YQEA 3SXOA 3KR4A 5AG5A 4Y49C 4BD9A 4CGMA 4XPLA 4OLLA 1S7KA 3ISZA 2ATRA 1CPSA 4BINA 4MY0A 4ZX8A 3GY9A 4NFRA 4MXUA 4CGOA 2ZEDA 2GLJA 2FL4A 4PV6A 2JEWA 4CAWA 2JBJA 3FXTA 1M4LA 3F5BA 2ZEPA 3IJ3A 4UIAA 2ZPAA 4NGSA 5DWNA 2I00A 4QUSA 4CS0B 3TE4A 4PPZA 5FVJA 1QQ9A 4G1PA 1Q2YA 4KOTA 3PRTA 4CGNA 4E2AA 4PSWA 1ELLP 1DE4C 3IIBA 1BAVA 2CIJA 5D29A 4X2TA 3PB9X 1IIDA 1TKJA 1PCAA 1R43A 1XMTA 4FD6A 4MCSA 4P45A 4UCPA 4DUKA 2X7BA 4LX9A 4O23A 1JQGA 1XIXA 2PJ6A 1LRZA 3EY5A 4R57A 5E96A 3V7ZA 3WT4A 4P10A 1PUAA 1VIXA 1B87A 5HH1A 3SXNA 5G22A 3QAYA 2HB6A 5JGFA 3UY5A 3VWDA 4B6ZA 2Q04A 4QVTA 4GXHA 4IUSA 2PJ1A 3T9YA 1ARLA 2GIVA 2Z3OA 4BBHA 2OZUA 4IAVA 5LRJA 3S9MA 4F0YA 3I1UA 3N7ZA 1S60A 2FIAA 4AVBA 1CG2A 3VWEA 1S7LA 4NSQA 4M6IA 3QNVA 4MI4A 4CPAA 2YNCC 3CPXA 2V8DA 5JH9A 3TO7A 2NMTA 2VL1A 1BLLE 2P0WA 4NGMA 4M6GA 3RBUA 3TT2A 3VH9A 3D2MA 1L0CA 1NSAA 2ZW6A 3R9EA 4ZY0A 3KHXA 2I79A 1Q2DA 4MY3A 4MHZA 5IB9A 5IB0A 2EBJA 1HEEA 4OP4A 3PB6X 1IY7A 4A2ZA 4QBJA 3IWGA 3LD2A 3TX8A 3DNSA 3DDDA 2BL1A 4AXVA 2QVPA 3JVNA 4H6UA 3GLJA 4JWPA 5D8NA 3FYNA 4KOXA 1I1DA 3S6HA 2R8VA 1M4IA 2ZEGA 4EMEA 4W9YA 1YR0A 2RFHA 2B3UA 1Y7EA 2V77A 4Q7AA 2WYRA 4IHMA 5JPHA 1ZLIA 4UFWA 4CAFA 4MFKA 2HC9A 3FB3A 3EFAA 2PJAA 5HVGA 2PDOA 3D68A 4MFLA 4ZY1A 1JWQA 3W6SA 5KTCA 2VEZA 1GHEA 4UEFA 1ZG8A 2QMLA 1BO4A 3P2HA 3NH4A 3T90A 5F49A 3DSBA 4HNWB 4NXYA 2Q0YA 2AFWA 3D7GA 4MHYA 2FVGA 6CPAA 4A30A 5IX3A 4TWEA 2PR1A 1LAMA 1X12A 4RS2A 1TXRA 2R7HA 1Z4EA 4KSAA 1IOFA 4OMEA 1Z2LA 3SHPA 3HLPA 4PSXA 4EVYA 1ZG9A 2YNEA 3NFZA 3D4UA 2OH1A 2ABZA 1H8LA 3D8PA 2PJCA 4YFJA 5CBMA 1IGBA 2EWBA 3D67A 1LOKA 2JEVA 2PC1A 5G21A 4MHNA 4K3NA 1YW6A 2REFA 5IV0A 2J9AA 1KUVA 1LCPA 3DR8A 2I3CA 3IWWA 4M6HA 2FE7A 4LQGA 4ONWA 3IU1A 4OC5A 4P4EA 4UEZA 4A39A 4AG9A 5DS0A 2F5IA 2EK9A 4MJ8A 2BSWA 4OC1A 1IICA 3S6GA 2ZW5A 2Q7BA 5HXDA 2R1IA 2F7VA 4MHDA 2KCWA 1X10A 3FX6A 5JQ4A 3F0AA 3TFYA 3C26A 4JXRA 3EXNA 5C82A 2PJ2A 2RC4A 4FBEA 2FSRA 1GYTA 3B3CA 1YX0A 1YMEA 4KUAA 4JYWA 4X5KA 3V8IA 2ZW4A 4DYOA 2Z0ZA 3DLJA 3OWCA 3QB8A 2B4DB 4KVOE 3KR5A 3BLNA 4B5PB 5I0CA 4LQ6A 2DF5A 2REEA 2P6GA 3PB4X 4K30A 4HNXB 4KVME 3GUXA 4UEEA 5K8PA 3CT9A 1YLEA 2C6PA 2PJ7A 1ON0A 3LWUA 4KOYA 3CXQA 1CP6A 2PIZA 4OAEA 3R96A 2Q4YA 3DGVA 3MN8A 5AG6A 4HKFA 1R57A 4XNHB 3KZWA 1M1DA 2DPSA 2G3AA 2PVVA 4C7IA 4B5OA 4R6TA 1I12A 3KI9A 2H5MA 3B8GA 3HUVA 4KS9A 2PCUA 1B6BA 1Z8XA 1ZO0A 5AG4A 4M3SA 3EC4A 4MFZA 1YVOA 4JLYA 3BI0A 3KL9A 2F8HA 1QMUA 2K5TA 4CRZB 1LFWA 1TKHA 5K8OA 1ZG7A 3GYAA 2CTBA 3KASA 3KKWA 5JM6A 3D3SA 3K2KA 3N5FA 4C2XA 1MJBA 2C1CA 2ZEFA 3PP9A 3W91A 1R3NA 4AVCA 3PBBA 1F2PA 2ZW7A 3CXSA 4RN7A 2G3TA 4P4BA 4A33A 1XF8A 4CAVA 4NGQA 4IF5A 4XPKA 4FAIA 5J1QA 1QSOA 2ANPA 5F09A 3K9TA 5K8NA 5DWMA 4KOWA 3TO6A 4GM5A 1FNOA 2BEIA 5K8MA 1KUXA 1XRYA 3VATA 3CXPA 2Z10A 2PIYA 4CGLA 2OB0A 3IFEA 2GE3A 3PB7X 4CYNA 1Y0YA 3TCVA 2XEIA 5EC4A 4A95A 4J3GA 4ZY2A 3RAMA 4PQAA 4Z65A 5KTDA 2OOTA 1CM0A 1TKFA 4IK2A 1F2OA 4YU9A 1J4JA 3LACA 1Z8LA 1VHOA 1KZFA 3BJ7A 1V0CA 3R95A 1BPMA 2ZEHA 4MCPA 4E8OA 2PJBA 5GCNA 1XE4A 3RYOA 1RXTA 2P6EA 3NH5A 1QSMA 5HVHA 1IOIA 1WK4A 4MMOA 4P4FA 4UFXA 1K4JA 1YSJA 1SQHA 5G1ZA 5H84A 3KGQA 4C7HA 1EE3P 2Q51A 3FIXA 3FEEA 4F6AA 4R87A 4YRHA 4U9YA 1KWMA 3CZXA 3PFEA 2QJ8A 3H8EA 5CPAA 4UA3A 2V8GA 2JBKA 3BXMA 1RO5A 3R9GA 2PR8A 2VZZA 4YGOA 2G0BA 3JUWA 1IYLA 1TIQA 4MFJA 2GANA 1QSRA 1I21A 4FD4A 3IEHA 1Z8TA 2ZEOA 3IGRA 2AFOA 4NGPA 3G3SA 3RZAA 2CY2A 4U9ZA 4PXDA 1NSLA 2PVWA 1FY7A 4JZ0A 1CP7A 1CBXA 4ONUA 1S7NA 4II9A 4DNCA 2HQYA 2C6CA 2EUIA 3B3SA 4CYOA 4NGTA 4FWUA 5G20A 1MK4A 4R3KA 5LYIA 2YNDA 3SJFA 2Q4VA 4XPDB 4OC0A 3T8WA 3VARA 2Z11A 2XEGA 4MBUA 3S9LA 3FJUA 1XBUA 3TTHA 4EFDA 5BWAB 1NMTA 1AYEA 1VGYA 4NGNA 1M4DA 4R7MA 2GLFA 2BUEA 2GU2A 4KSFA 3WC5A 2OZGA 3CPAA 4P4JA 2PRBA 4R8FA 1ARMA 4KLWA 4MFPA 4MHPA 4LUAA 4KOSA 2AFSA 4UCMA 4Y49B
chains in the Genus database with same CATH topology
4H6ZA 4JD6A 4UFVA 4HNYB 2VBQA 2IL4A 3G8WA 2ZXVA 4R3LA 1VHSA 2B5GB 2FIWA 1IYKA 2CNTA 2Q44A 2B4DA 3F8KA 4B5PA 2OZHA 2JDCA 3ZZIA 4A32A 1UFHA 2CXAA 4MFQA 4JXQA 3TOBA 3ZJ0A 3IU2A 2Z3LA 4C2YA 4I49A 2EVNA 4H89A 2VZYA 2VXKA 1YREA 2B58A 4M85A 3GKRA 3S6FA 1Q2CA 3W6XA 1Z4RA 2CNSA 3H5ZA 4JJXA 5F47A 4CAEA 5AG7A 1QSNA 2D4PA 3IWEA 2B3VA 4NEXA 4UCNA 4L8AA 4C68A 4KOVA 4AVAA 1Y7RA 4KVXA 4UBRA 4PK2A 3FBUA 3R9FA 4B12A 2YGWA 2Z3NA 4KORA 2FCKA 4E0AA 1M4GA 4CRYB 3PGPA 3QAHA 4UWJA 3EO4A 4KZTA 2Z3KA 3FRMA 1IB1E 4CAXA 4NCZA 1QSTA 2VQYA 4R9MA 5ISVA 1M44A 2C27A 4ORFA 1WWZA 4C2ZA 1P0HA 1MJ9A 4CGPA 4XNHC 1S5KA 3I9SA 2J8RA 2WPXA 3TOAA 2OU2A 2J8NA 3K9UA 5AGEA 4CYQA 3E0KA 1MJAA 3I3GA 2AE6A 1YVKA 2VI7A 4PK3A 4KOUA 5C88A 1N71A 2QIRA 2ARHA 2DXQA 2J8MA 2P6FA 2HV2A 2WSAA 2Y0MA 2FXFA 2A4NA 2R98A 3DR6A 4RI1A 4F0XA 3D2PA 3H4QA 4UWIA 1S7FA 2QECA 4KLVA 1Z9UA 5A27A 1YK3A 2AJ6A 3WR7A 1OZPA 2D4OA 4U5YA 4OADA 1CJWA 2Z3PA 5H86A 1KUYA 4A31A 4FD5A 4ZGYB 1VKCA 1Y9KA 1U6MA 1NE9A 2FS5A 2JLMA 3A9LA 2CNMA 2FT0A 1P4NA 4AB7A 3PZJA 4CYPA 4B14A 5EBVA 2DPTA 3LODA 1YGHA 4QC6A 4FD7A 5A28A 3FNCA 2HUZA 5F46A 2PSWA 1BOBA 2B4BA 3MGDA 2PQ8A 4BMHA 2B5GA 2Z3MA 4ZBGA 3R1KA 4Q36A 4KUBA 2WUUA 5HMNA 4L89A 5F48A 3JTKA 3NE7A 1PU9A 5J8CA 1XEBA 4B11A 1S3ZA 4AG7A 4B10A 3P2FA 3BJ8A 3S6KA 4XPDC 1Y9WA 5CNPA 4NF1A 5J8FA 3TO9A 4QB9A 4Q38A 2O28A 4GS4A 2JDDA 2WPWA 2YNCA 5KTAA 3SXOA 5AG5A 4Y49C 4CGMA 4XPLA 4OLLA 1S7KA 2ATRA 4MY0A 3GY9A 4CGOA 2FL4A 4PV6A 4CAWA 3FXTA 3F5BA 2ZPAA 5DWNA 2I00A 4QUSA 4CS0B 3TE4A 5FVJA 1Q2YA 4KOTA 4CGNA 4E2AA 4PSWA 1IIDA 4FD6A 4UCPA 1XMTA 2X7BA 4LX9A 1XIXA 3EY5A 1LRZA 4R57A 5E96A 1PUAA 1B87A 5HH1A 3SXNA 5G22A 3UY5A 3VWDA 2Q04A 4QVTA 4IUSA 3T9YA 2GIVA 2Z3OA 4BBHA 2OZUA 4F0YA 3N7ZA 1S60A 2FIAA 4AVBA 3VWEA 1S7LA 4NSQA 4MI4A 2YNCC 3TO7A 2NMTA 2P0WA 3TT2A 3D2MA 1L0CA 2ZW6A 3R9EA 2I79A 1Q2DA 4MY3A 5IB0A 4A2ZA 4QBJA 3IWGA 3LD2A 3DNSA 3DDDA 2BL1A 3JVNA 4H6UA 4JWPA 3FYNA 4KOXA 1I1DA 3S6HA 2R8VA 1M4IA 1YR0A 2B3UA 5JPHA 4UFWA 4CAFA 4MFKA 3FB3A 3EFAA 2PDOA 4MFLA 3W6SA 5KTCA 2VEZA 1GHEA 2QMLA 1BO4A 3P2HA 3T90A 5F49A 3DSBA 4HNWB 4NXYA 2Q0YA 4A30A 5IX3A 2PR1A 4RS2A 2R7HA 1Z4EA 4KSAA 3SHPA 4EVYA 4PSXA 2YNEA 2OH1A 3D8PA 4YFJA 2JEVA 2PC1A 5G21A 2REFA 5IV0A 1KUVA 3DR8A 2FE7A 3IU1A 4AG9A 2F5IA 4MJ8A 2BSWA 3S6GA 1IICA 2ZW5A 2Q7BA 2R1IA 4MHDA 2KCWA 5JQ4A 3F0AA 3TFYA 3C26A 4JXRA 3EXNA 5C82A 2RC4A 2FSRA 1YX0A 4KUAA 4X5KA 3V8IA 2ZW4A 2Z0ZA 3OWCA 3QB8A 4KVOE 2B4DB 4B5PB 5I0CA 3BLNA 2REEA 2P6GA 4K30A 4HNXB 4KVME 1YLEA 1ON0A 4KOYA 4OAEA 3CXQA 3R96A 2Q4YA 5AG6A 4HKFA 1R57A 4XNHB 1M1DA 2DPSA 2G3AA 4C7IA 4B5OA 1I12A 2H5MA 3B8GA 4KS9A 1B6BA 1ZO0A 5AG4A 4M3SA 3EC4A 4MFZA 1YVOA 4JLYA 4CRZB 2K5TA 3GYAA 3KKWA 3D3SA 4C2XA 1MJBA 3PP9A 3W91A 4B13A 4AVCA 2ZW7A 3CXSA 4A33A 2G3TA 1XF8A 4CAVA 4IF5A 4XPKA 1QSOA 5DWMA 4KOWA 3TO6A 2BEIA 1KUXA 3CXPA 2Z10A 4CGLA 2OB0A 2GE3A 4CYNA 3TCVA 5EC4A 4A95A 4J3GA 5KTDA 1CM0A 1J4JA 1KZFA 3BJ7A 1V0CA 3R95A 4E8OA 5GCNA 1XE4A 3RYOA 1RXTA 2P6EA 1QSMA 1WK4A 4UFXA 1K4JA 1SQHA 5G1ZA 5H84A 4C7HA 3FIXA 4F6AA 4R87A 4YRHA 4U9YA 4UA3A 3R9GA 1RO5A 2PR8A 2VZZA 4YGOA 2G0BA 3JUWA 1IYLA 1TIQA 4MFJA 2GANA 1QSRA 1I21A 4FD4A 3IGRA 3G3SA 2CY2A 4U9ZA 1NSLA 1FY7A 4ONUA 1S7NA 4II9A 4DNCA 2HQYA 2EUIA 4CYOA 5G20A 1MK4A 4R3KA 2YNDA 2Q4VA 4XPDB 2Z11A 4MBUA 3TTHA 5BWAB 1NMTA 1M4DA 4KSFA 2BUEA 2OZGA 2PRBA 4KLWA 4MFPA 4LUAA 4KOSA 4UCMA 4Y49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6Z A;  4JD6 A;  4HNY B;  2VBQ A;  2IL4 A;  3G8W A;  2ZXV A;  4R3L A;  1VHS A;  2B5G B;  2FIW A;  1IYK A;  2CNT A;  2Q44 A;  2B4D A;  3F8K A;  4B5P A;  2OZH A;  2JDC A;  3ZZI A;  1UFH A;  4JXQ A;  3TOB A;  3ZJ0 A;  4I49 A;  2EVN A;  4H89 A;  2VZY A;  2VXK A;  1YRE A;  2B58 A;  4M85 A;  3GKR A;  3S6F A;  1Q2C A;  3W6X A;  1Z4R A;  2CNS A;  4JJX A;  5F47 A;  1QSN A;  2D4P A;  2B3V A;  4NEX A;  4L8A A;  4KOV A;  4AVA A;  1Y7R A;  4KVX A;  4UBR A;  4PK2 A;  3FBU A;  3R9F A;  4KOR A;  2FCK A;  4E0A A;  1M4G A;  4CRY B;  3PGP A;  3QAH A;  4UWJ A;  3EO4 A;  4KZT A;  3FRM A;  1IB1 E;  4CAX A;  4NCZ A;  1QST A;  2VQY A;  4R9M A;  5ISV A;  1M44 A;  2C27 A;  4ORF A;  1WWZ A;  1P0H A;  1MJ9 A;  4XNH C;  1S5K A;  3I9S A;  2J8R A;  2WPX A;  3TOA A;  2OU2 A;  2J8N A;  3K9U A;  3E0K A;  1MJA A;  3I3G A;  2AE6 A;  1YVK A;  2VI7 A;  4PK3 A;  4KOU A;  5C88 A;  1N71 A;  2QIR A;  2ARH A;  2DXQ A;  2J8M A;  2P6F A;  2HV2 A;  2Y0M A;  2FXF A;  2A4N A;  2R98 A;  3DR6 A;  4RI1 A;  3D2P A;  3H4Q A;  4UWI A;  1S7F A;  4KLV A;  2QEC A;  1Z9U A;  1YK3 A;  2AJ6 A;  3WR7 A;  1OZP A;  2D4O A;  4U5Y A;  4OAD A;  1CJW A;  5H86 A;  1KUY A;  4FD5 A;  1VKC A;  1Y9K A;  1U6M A;  1NE9 A;  2FS5 A;  2JLM A;  2CNM A;  2FT0 A;  1P4N A;  4AB7 A;  3PZJ A;  5EBV A;  3LOD A;  1YGH A;  4QC6 A;  4FD7 A;  5F46 A;  3FNC A;  2HUZ A;  2PSW A;  1BOB A;  2B4B A;  3MGD A;  2PQ8 A;  4BMH A;  2B5G A;  4ZBG A;  3R1K A;  4KUB A;  5HMN A;  4L89 A;  5F48 A;  3NE7 A;  1PU9 A;  5J8C A;  1XEB A;  1S3Z A;  4AG7 A;  3P2F A;  3BJ8 A;  3S6K A;  4XPD C;  1Y9W A;  5CNP A;  4NF1 A;  5J8F A;  3TO9 A;  4QB9 A;  2O28 A;  4GS4 A;  2JDD A;  2WPW A;  5KTA A;  3SXO A;  4Y49 C;  4XPL A;  4OLL A;  1S7K A;  2ATR A;  4MY0 A;  3GY9 A;  2FL4 A;  4PV6 A;  4CAW A;  3FXT A;  3F5B A;  2ZPA A;  5DWN A;  2I00 A;  4QUS A;  4CS0 B;  3TE4 A;  5FVJ A;  1Q2Y A;  4KOT A;  4E2A A;  4PSW A;  1IID A;  4FD6 A;  1XMT A;  2X7B A;  4LX9 A;  1XIX A;  3EY5 A;  1LRZ A;  4R57 A;  5E96 A;  1PUA A;  1B87 A;  5HH1 A;  3SXN A;  3UY5 A;  3VWD A;  2Q04 A;  4QVT A;  4IUS A;  3T9Y A;  2GIV A;  2OZU A;  4F0Y A;  3N7Z A;  1S60 A;  2FIA A;  4AVB A;  3VWE A;  1S7L A;  4NSQ A;  4MI4 A;  3TO7 A;  2NMT A;  2P0W A;  3TT2 A;  3D2M A;  1L0C A;  2ZW6 A;  3R9E A;  2I79 A;  1Q2D A;  4MY3 A;  5IB0 A;  4QBJ A;  3IWG A;  3LD2 A;  3DNS A;  3DDD A;  2BL1 A;  3JVN A;  4H6U A;  4JWP A;  3FYN A;  4KOX A;  1I1D A;  3S6H A;  2R8V A;  1M4I A;  1YR0 A;  2B3U A;  5JPH A;  3FB3 A;  3EFA A;  2PDO A;  3W6S A;  5KTC A;  2VEZ A;  1GHE A;  2QML A;  1BO4 A;  3P2H A;  3T90 A;  5F49 A;  3DSB A;  4HNW B;  4NXY A;  2Q0Y A;  5IX3 A;  2PR1 A;  4RS2 A;  2R7H A;  1Z4E A;  3SHP A;  4EVY A;  4PSX A;  2OH1 A;  3D8P A;  4YFJ A;  2JEV A;  2PC1 A;  2REF A;  5IV0 A;  1KUV A;  3DR8 A;  2FE7 A;  4AG9 A;  2F5I A;  4MJ8 A;  2BSW A;  3S6G A;  1IIC A;  2ZW5 A;  2Q7B A;  2R1I A;  4MHD A;  2KCW A;  5JQ4 A;  3F0A A;  3TFY A;  3C26 A;  4JXR A;  3EXN A;  5C82 A;  2RC4 A;  2FSR A;  1YX0 A;  4KUA A;  4X5K A;  3V8I A;  2ZW4 A;  2Z0Z A;  4KVO E;  3OWC A;  3QB8 A;  2B4D B;  4B5P B;  5I0C A;  3BLN A;  2REE A;  2P6G A;  4K30 A;  4HNX B;  4KVM E;  1YLE A;  1ON0 A;  4KOY A;  4OAE A;  3CXQ A;  3R96 A;  2Q4Y A;  4HKF A;  1R57 A;  4XNH B;  1M1D A;  2G3A A;  4B5O A;  1I12 A;  2H5M A;  3B8G A;  1B6B A;  4M3S A;  3EC4 A;  1YVO A;  4JLY A;  4CRZ B;  2K5T A;  3GYA A;  3KKW A;  3D3S A;  1MJB A;  3PP9 A;  3W91 A;  4AVC A;  2ZW7 A;  3CXS A;  2G3T A;  1XF8 A;  4CAV A;  4IF5 A;  4XPK A;  1QSO A;  5DWM A;  4KOW A;  3TO6 A;  2BEI A;  1KUX A;  3CXP A;  2Z10 A;  2OB0 A;  2GE3 A;  3TCV A;  5EC4 A;  4J3G A;  5KTD A;  1CM0 A;  1J4J A;  1KZF A;  3BJ7 A;  1V0C A;  3R95 A;  4E8O A;  5GCN A;  1XE4 A;  3RYO A;  1RXT A;  2P6E A;  1QSM A;  1WK4 A;  1K4J A;  1SQH A;  5H84 A;  3FIX A;  4F6A A;  4R87 A;  4YRH A;  4U9Y A;  4UA3 A;  3R9G A;  1RO5 A;  2PR8 A;  2VZZ A;  4YGO A;  2G0B A;  3JUW A;  1IYL A;  1TIQ A;  2GAN A;  1QSR A;  1I21 A;  4FD4 A;  3IGR A;  3G3S A;  2CY2 A;  4U9Z A;  1NSL A;  1FY7 A;  4ONU A;  1S7N A;  4II9 A;  4DNC A;  2HQY A;  2EUI A;  1MK4 A;  4R3K A;  2Q4V A;  4XPD B;  2Z11 A;  4MBU A;  3TTH A;  1NMT A;  1M4D A;  2BUE A;  2OZG A;  2PRB A;  4KLW A;  4LUA A;  4KOS A;  4Y49 B; 
#chains in the Genus database with same CATH topology
 4H6Z A;  4R76 A;  1Z5R A;  4JD6 A;  4UFV A;  2Q7S A;  2VBQ A;  4HNY B;  2IL4 A;  3G8W A;  2ZXV A;  4MCQ A;  4R3L A;  1VHS A;  4MCR A;  3SJE A;  2B5G B;  2FIW A;  1IYK A;  2CNT A;  2GRE A;  2Q44 A;  2B4D A;  3F8K A;  4B5P A;  2OZH A;  3H8G A;  2JDC A;  3ZZI A;  3IO1 A;  3IC1 A;  3RO0 A;  1UFH A;  4A32 A;  3BI1 A;  1TF8 A;  2CXA A;  3FMC A;  3BHX A;  4JXQ A;  4MFQ A;  3IU2 A;  3TOB A;  1RTQ A;  2Z3L A;  3ZJ0 A;  1HDQ A;  4P6Y A;  4C2Y A;  4I49 A;  4P4I A;  2PJ4 A;  2EVN A;  4H89 A;  3FEC A;  1XJO A;  2VZY A;  2ZEM A;  2VXK A;  1YRE A;  1F57 A;  1AUG A;  2B58 A;  4M85 A;  5THW A;  5LYL A;  2EO8 A;  3GKR A;  3S6F A;  1Q2C A;  3W6X A;  1Z4R A;  2CNS A;  3H5Z A;  4JJX A;  5F47 A;  4CAE A;  2EK8 A;  5AG7 A;  4UF4 A;  1QSN A;  2D4P A;  3D7H A;  2AFU A;  3IWE A;  3H8F A;  3NH8 A;  2B3V A;  2BCO A;  3D7F A;  1CX8 A;  4L8A A;  4NEX A;  4UCN A;  4KOV A;  3WC6 A;  1Y7R A;  3NE8 A;  4AVA A;  4KVX A;  4B13 A;  4C68 A;  4UBR A;  4A37 A;  2ZOG A;  2NSM A;  4PK2 A;  3V38 A;  1XMB A;  4OIW A;  3FBU A;  3R9F A;  5ELY A;  4RUH A;  3FED A;  1OBR A;  2ZEL A;  1AMP A;  1YLO A;  2YGW A;  2Q4Z A;  2Z3N A;  1ZLH A;  4KOR A;  2FCK A;  3TC8 A;  4B12 A;  4E0A A;  4EWT A;  1A2Z A;  1M4G A;  4CRY B;  1IU8 A;  2PJ9 A;  3PGP A;  2IMO A;  1Y0R A;  1XOV A;  3RNZ A;  2ZOF A;  3QAH A;  4UWJ A;  2V8V A;  3EO4 A;  4KZT A;  2Z3K A;  3FRM A;  3S9N A;  1IB1 E;  3KQZ A;  4CAX A;  4NCZ A;  1HDU A;  2G9D A;  5LYD A;  1QST A;  2VQY A;  4R9M A;  2BO9 A;  4WJB A;  5ISV A;  1M44 A;  2C27 A;  4ORF A;  1WWZ A;  4C2Z A;  3KQX A;  2V8H A;  1P0H A;  5I4M A;  1Z8W A;  1CPX A;  1MJ9 A;  4CGP A;  4XNH C;  1S5K A;  3I9S A;  3L2N A;  2J8R A;  2WPX A;  2ZEE A;  3TOA A;  3FH4 A;  2OU2 A;  2J8N A;  3K9U A;  5AGE A;  1ELM P;  4CYQ A;  3E0K A;  1YW4 A;  4WWV A;  3MRU A;  1MJA A;  3I3G A;  3FF3 A;  2AE6 A;  1YVK A;  1VHE A;  2VI7 A;  4PK3 A;  1TF9 A;  5LRK A;  2PRQ A;  4KOU A;  5C88 A;  1N71 A;  2O4H A;  3FVL A;  2QIR A;  3ISX A;  2PJ3 A;  3WC7 A;  4A94 A;  2ARH A;  1DTD A;  2DXQ A;  2J8M A;  2ODF A;  2P6F A;  2HV2 A;  2BOA A;  4YWY A;  2WSA A;  2Y0M A;  3PBE A;  3SJG A;  2FXF A;  2A4N A;  2R98 A;  3B2Y A;  3DR6 A;  4PXB A;  4RI1 A;  4F0X A;  5LRG A;  4FUU A;  3D2P A;  3H4Q A;  2AFM A;  3D66 A;  4UWI A;  1S7F A;  3SI2 A;  3PFO A;  2QEC A;  4KLV A;  1Z9U A;  5A27 A;  2OR4 A;  1YK3 A;  4OKO A;  2AJ6 A;  3WR7 A;  1OZP A;  2D4O A;  3SI0 A;  4U5Y A;  4OAD A;  1FT7 A;  1CJW A;  2O53 A;  2DEA A;  8CPA A;  1Q7L A;  2IQ6 A;  2Z3P A;  1KUY A;  5H86 A;  2WZN A;  4A31 A;  3B3V A;  4FD5 A;  2POK A;  4ZX9 A;  4F8Z A;  4ZGY B;  1LAP A;  1VKC A;  1Y9K A;  4OID A;  3CDX A;  1U6M A;  1NE9 A;  2FS5 A;  4OC3 A;  2JLM A;  3A9L A;  2GFQ A;  2CNM A;  3D7D A;  3NA6 A;  2FT0 A;  5LYF A;  1P4N A;  4AB7 A;  1UWY A;  1LAN A;  3LMS A;  2AFX A;  3PZJ A;  4MRI A;  5EBV A;  5HVF A;  4B14 A;  2DPT A;  3LOD A;  4CYP A;  2C6G A;  3GIU A;  3PB8 X;  1YGH A;  4QC6 A;  2PJ5 A;  2AFZ A;  3FNC A;  2HUZ A;  3KHZ A;  2PSW A;  4FD7 A;  5A28 A;  5F46 A;  1BOB A;  4ZYQ A;  2B4B A;  2Q43 A;  3MGD A;  2PQ8 A;  2QYV A;  4NGR A;  2RB7 A;  4BMH A;  4X8I A;  1XFO A;  3B3W A;  4NJQ A;  2B5G A;  2Z3M A;  4ZBG A;  4F9V A;  3R1K A;  4Q36 A;  4P44 A;  4KUB A;  2XEF A;  2WUU A;  5HMN A;  4L89 A;  5F48 A;  2ZEN A;  3JTK A;  1PU9 A;  3NE7 A;  4HPS A;  3SI1 A;  3B7I A;  2IJZ A;  1PYT B;  3B35 A;  5J8C A;  3GB0 A;  1XEB A;  4OC2 A;  3PEI A;  3WAB A;  2XEJ A;  4B11 A;  4H2K A;  4ZI6 A;  1S3Z A;  5EMI A;  4TNU A;  4AG7 A;  4PXE A;  4B10 A;  3P2F A;  4P4D A;  3BJ8 A;  4KSI A;  3S6K A;  4XPD C;  1BPN A;  1Y9W A;  4X3R A;  5CNP A;  4NF1 A;  4A38 A;  4UIB A;  4OC4 A;  5J8F A;  4PXC A;  3JRU A;  3TO9 A;  2CTC A;  3B3T A;  4Q38 A;  4QB9 A;  4DJL A;  2O28 A;  3SJX A;  2CF4 A;  2PJ0 A;  4F9U A;  4NJR A;  2PE3 A;  7CPA A;  2NYQ A;  2PJ8 A;  4GS4 A;  2JDD A;  2WPW A;  2YNC A;  5KTA A;  1YQE A;  3SXO A;  3KR4 A;  5AG5 A;  4Y49 C;  4BD9 A;  4CGM A;  4XPL A;  4OLL A;  1S7K A;  3ISZ A;  2ATR A;  1CPS A;  4BIN A;  4MY0 A;  4ZX8 A;  3GY9 A;  4NFR A;  4MXU A;  4CGO A;  2ZED A;  2GLJ A;  2FL4 A;  4PV6 A;  2JEW A;  4CAW A;  2JBJ A;  3FXT A;  1M4L A;  3F5B A;  2ZEP A;  3IJ3 A;  4UIA A;  2ZPA A;  4NGS A;  5DWN A;  2I00 A;  4QUS A;  4CS0 B;  3TE4 A;  4PPZ A;  5FVJ A;  1QQ9 A;  4G1P A;  1Q2Y A;  4KOT A;  3PRT A;  4CGN A;  4E2A A;  4PSW A;  1ELL P;  1DE4 C;  3IIB A;  1BAV A;  2CIJ A;  5D29 A;  4X2T A;  3PB9 X;  1IID A;  1TKJ A;  1PCA A;  1R43 A;  1XMT A;  4FD6 A;  4MCS A;  4P45 A;  4UCP A;  4DUK A;  2X7B A;  4LX9 A;  4O23 A;  1JQG A;  1XIX A;  2PJ6 A;  1LRZ A;  3EY5 A;  4R57 A;  5E96 A;  3V7Z A;  3WT4 A;  4P10 A;  1PUA A;  1VIX A;  1B87 A;  5HH1 A;  3SXN A;  5G22 A;  3QAY A;  2HB6 A;  5JGF A;  3UY5 A;  3VWD A;  4B6Z A;  2Q04 A;  4QVT A;  4GXH A;  4IUS A;  2PJ1 A;  3T9Y A;  1ARL A;  2GIV A;  2Z3O A;  4BBH A;  2OZU A;  4IAV A;  5LRJ A;  3S9M A;  4F0Y A;  3I1U A;  3N7Z A;  1S60 A;  2FIA A;  4AVB A;  1CG2 A;  3VWE A;  1S7L A;  4NSQ A;  4M6I A;  3QNV A;  4MI4 A;  4CPA A;  2YNC C;  3CPX A;  2V8D A;  5JH9 A;  3TO7 A;  2NMT A;  2VL1 A;  1BLL E;  2P0W A;  4NGM A;  4M6G A;  3RBU A;  3TT2 A;  3VH9 A;  3D2M A;  1L0C A;  1NSA A;  2ZW6 A;  3R9E A;  4ZY0 A;  3KHX A;  2I79 A;  1Q2D A;  4MY3 A;  4MHZ A;  5IB9 A;  5IB0 A;  2EBJ A;  1HEE A;  4OP4 A;  3PB6 X;  1IY7 A;  4A2Z A;  4QBJ A;  3IWG A;  3LD2 A;  3TX8 A;  3DNS A;  3DDD A;  2BL1 A;  4AXV A;  2QVP A;  3JVN A;  4H6U A;  3GLJ A;  4JWP A;  5D8N A;  3FYN A;  4KOX A;  1I1D A;  3S6H A;  2R8V A;  1M4I A;  2ZEG A;  4EME A;  4W9Y A;  1YR0 A;  2RFH A;  2B3U A;  1Y7E A;  2V77 A;  4Q7A A;  2WYR A;  4IHM A;  5JPH A;  1ZLI A;  4UFW A;  4CAF A;  4MFK A;  2HC9 A;  3FB3 A;  3EFA A;  2PJA A;  5HVG A;  2PDO A;  3D68 A;  4MFL A;  4ZY1 A;  1JWQ A;  3W6S A;  5KTC A;  2VEZ A;  1GHE A;  4UEF A;  1ZG8 A;  2QML A;  1BO4 A;  3P2H A;  3NH4 A;  3T90 A;  5F49 A;  3DSB A;  4HNW B;  4NXY A;  2Q0Y A;  2AFW A;  3D7G A;  4MHY A;  2FVG A;  6CPA A;  4A30 A;  5IX3 A;  4TWE A;  2PR1 A;  1LAM A;  1X12 A;  4RS2 A;  1TXR A;  2R7H A;  1Z4E A;  4KSA A;  1IOF A;  4OME A;  1Z2L A;  3SHP A;  3HLP A;  4PSX A;  4EVY A;  1ZG9 A;  2YNE A;  3NFZ A;  3D4U A;  2OH1 A;  2ABZ A;  1H8L A;  3D8P A;  2PJC A;  4YFJ A;  5CBM A;  1IGB A;  2EWB A;  3D67 A;  1LOK A;  2JEV A;  2PC1 A;  5G21 A;  4MHN A;  4K3N A;  1YW6 A;  2REF A;  5IV0 A;  2J9A A;  1KUV A;  1LCP A;  3DR8 A;  2I3C A;  3IWW A;  4M6H A;  2FE7 A;  4LQG A;  4ONW A;  3IU1 A;  4OC5 A;  4P4E A;  4UEZ A;  4A39 A;  4AG9 A;  5DS0 A;  2F5I A;  2EK9 A;  4MJ8 A;  2BSW A;  4OC1 A;  1IIC A;  3S6G A;  2ZW5 A;  2Q7B A;  5HXD A;  2R1I A;  2F7V A;  4MHD A;  2KCW A;  1X10 A;  3FX6 A;  5JQ4 A;  3F0A A;  3TFY A;  3C26 A;  4JXR A;  3EXN A;  5C82 A;  2PJ2 A;  2RC4 A;  4FBE A;  2FSR A;  1GYT A;  3B3C A;  1YX0 A;  1YME A;  4KUA A;  4JYW A;  4X5K A;  3V8I A;  2ZW4 A;  4DYO A;  2Z0Z A;  3DLJ A;  3OWC A;  3QB8 A;  2B4D B;  4KVO E;  3KR5 A;  3BLN A;  4B5P B;  5I0C A;  4LQ6 A;  2DF5 A;  2REE A;  2P6G A;  3PB4 X;  4K30 A;  4HNX B;  4KVM E;  3GUX A;  4UEE A;  5K8P A;  3CT9 A;  1YLE A;  2C6P A;  2PJ7 A;  1ON0 A;  3LWU A;  4KOY A;  3CXQ A;  1CP6 A;  2PIZ A;  4OAE A;  3R96 A;  2Q4Y A;  3DGV A;  3MN8 A;  5AG6 A;  4HKF A;  1R57 A;  4XNH B;  3KZW A;  1M1D A;  2DPS A;  2G3A A;  2PVV A;  4C7I A;  4B5O A;  4R6T A;  1I12 A;  3KI9 A;  2H5M A;  3B8G A;  3HUV A;  4KS9 A;  2PCU A;  1B6B A;  1Z8X A;  1ZO0 A;  5AG4 A;  4M3S A;  3EC4 A;  4MFZ A;  1YVO A;  4JLY A;  3BI0 A;  3KL9 A;  2F8H A;  1QMU A;  2K5T A;  4CRZ B;  1LFW A;  1TKH A;  5K8O A;  1ZG7 A;  3GYA A;  2CTB A;  3KAS A;  3KKW A;  5JM6 A;  3D3S A;  3K2K A;  3N5F A;  4C2X A;  1MJB A;  2C1C A;  2ZEF A;  3PP9 A;  3W91 A;  1R3N A;  4AVC A;  3PBB A;  1F2P A;  2ZW7 A;  3CXS A;  4RN7 A;  2G3T A;  4P4B A;  4A33 A;  1XF8 A;  4CAV A;  4NGQ A;  4IF5 A;  4XPK A;  4FAI A;  5J1Q A;  1QSO A;  2ANP A;  5F09 A;  3K9T A;  5K8N A;  5DWM A;  4KOW A;  3TO6 A;  4GM5 A;  1FNO A;  2BEI A;  5K8M A;  1KUX A;  1XRY A;  3VAT A;  3CXP A;  2Z10 A;  2PIY A;  4CGL A;  2OB0 A;  3IFE A;  2GE3 A;  3PB7 X;  4CYN A;  1Y0Y A;  3TCV A;  2XEI A;  5EC4 A;  4A95 A;  4J3G A;  4ZY2 A;  3RAM A;  4PQA A;  4Z65 A;  5KTD A;  2OOT A;  1CM0 A;  1TKF A;  4IK2 A;  1F2O A;  4YU9 A;  1J4J A;  3LAC A;  1Z8L A;  1VHO A;  1KZF A;  3BJ7 A;  1V0C A;  3R95 A;  1BPM A;  2ZEH A;  4MCP A;  4E8O A;  2PJB A;  5GCN A;  1XE4 A;  3RYO A;  1RXT A;  2P6E A;  3NH5 A;  1QSM A;  5HVH A;  1IOI A;  1WK4 A;  4MMO A;  4P4F A;  4UFX A;  1K4J A;  1YSJ A;  1SQH A;  5G1Z A;  5H84 A;  3KGQ A;  4C7H A;  1EE3 P;  2Q51 A;  3FIX A;  3FEE A;  4F6A A;  4R87 A;  4YRH A;  4U9Y A;  1KWM A;  3CZX A;  3PFE A;  2QJ8 A;  3H8E A;  5CPA A;  4UA3 A;  2V8G A;  2JBK A;  3BXM A;  1RO5 A;  3R9G A;  2PR8 A;  2VZZ A;  4YGO A;  2G0B A;  3JUW A;  1IYL A;  1TIQ A;  4MFJ A;  2GAN A;  1QSR A;  1I21 A;  4FD4 A;  3IEH A;  1Z8T A;  2ZEO A;  3IGR A;  2AFO A;  4NGP A;  3G3S A;  3RZA A;  2CY2 A;  4U9Z A;  4PXD A;  1NSL A;  2PVW A;  1FY7 A;  4JZ0 A;  1CP7 A;  1CBX A;  4ONU A;  1S7N A;  4II9 A;  4DNC A;  2HQY A;  2C6C A;  2EUI A;  3B3S A;  4CYO A;  4NGT A;  4FWU A;  5G20 A;  1MK4 A;  4R3K A;  5LYI A;  2YND A;  3SJF A;  2Q4V A;  4XPD B;  4OC0 A;  3T8W A;  3VAR A;  2Z11 A;  2XEG A;  4MBU A;  3S9L A;  3FJU A;  1XBU A;  3TTH A;  4EFD A;  5BWA B;  1NMT A;  1AYE A;  1VGY A;  4NGN A;  1M4D A;  4R7M A;  2GLF A;  2BUE A;  2GU2 A;  4KSF A;  3WC5 A;  2OZG A;  3CPA A;  4P4J A;  2PRB A;  4R8F A;  1ARM A;  4KLW A;  4MFP A;  4MHP A;  4LUA A;  4KOS A;  2AFS A;  4UCM A;  4Y49 B; 
#chains in the Genus database with same CATH homology
 4H6Z A;  4JD6 A;  4UFV A;  4HNY B;  2VBQ A;  2IL4 A;  3G8W A;  2ZXV A;  4R3L A;  1VHS A;  2B5G B;  2FIW A;  1IYK A;  2CNT A;  2Q44 A;  2B4D A;  3F8K A;  4B5P A;  2OZH A;  2JDC A;  3ZZI A;  4A32 A;  1UFH A;  2CXA A;  4MFQ A;  4JXQ A;  3TOB A;  3ZJ0 A;  3IU2 A;  2Z3L A;  4C2Y A;  4I49 A;  2EVN A;  4H89 A;  2VZY A;  2VXK A;  1YRE A;  2B58 A;  4M85 A;  3GKR A;  3S6F A;  1Q2C A;  3W6X A;  1Z4R A;  2CNS A;  3H5Z A;  4JJX A;  5F47 A;  4CAE A;  5AG7 A;  1QSN A;  2D4P A;  3IWE A;  2B3V A;  4NEX A;  4UCN A;  4L8A A;  4C68 A;  4KOV A;  4AVA A;  1Y7R A;  4KVX A;  4UBR A;  4PK2 A;  3FBU A;  3R9F A;  4B12 A;  2YGW A;  2Z3N A;  4KOR A;  2FCK A;  4E0A A;  1M4G A;  4CRY B;  3PGP A;  3QAH A;  4UWJ A;  3EO4 A;  4KZT A;  2Z3K A;  3FRM A;  1IB1 E;  4CAX A;  4NCZ A;  1QST A;  2VQY A;  4R9M A;  5ISV A;  1M44 A;  2C27 A;  4ORF A;  1WWZ A;  4C2Z A;  1P0H A;  1MJ9 A;  4CGP A;  4XNH C;  1S5K A;  3I9S A;  2J8R A;  2WPX A;  3TOA A;  2OU2 A;  2J8N A;  3K9U A;  5AGE A;  4CYQ A;  3E0K A;  1MJA A;  3I3G A;  2AE6 A;  1YVK A;  2VI7 A;  4PK3 A;  4KOU A;  5C88 A;  1N71 A;  2QIR A;  2ARH A;  2DXQ A;  2J8M A;  2P6F A;  2HV2 A;  2WSA A;  2Y0M A;  2FXF A;  2A4N A;  2R98 A;  3DR6 A;  4RI1 A;  4F0X A;  3D2P A;  3H4Q A;  4UWI A;  1S7F A;  2QEC A;  4KLV A;  1Z9U A;  5A27 A;  1YK3 A;  2AJ6 A;  3WR7 A;  1OZP A;  2D4O A;  4U5Y A;  4OAD A;  1CJW A;  2Z3P A;  5H86 A;  1KUY A;  4A31 A;  4FD5 A;  4ZGY B;  1VKC A;  1Y9K A;  1U6M A;  1NE9 A;  2FS5 A;  2JLM A;  3A9L A;  2CNM A;  2FT0 A;  1P4N A;  4AB7 A;  3PZJ A;  4CYP A;  4B14 A;  5EBV A;  2DPT A;  3LOD A;  1YGH A;  4QC6 A;  4FD7 A;  5A28 A;  3FNC A;  2HUZ A;  5F46 A;  2PSW A;  1BOB A;  2B4B A;  3MGD A;  2PQ8 A;  4BMH A;  2B5G A;  2Z3M A;  4ZBG A;  3R1K A;  4Q36 A;  4KUB A;  2WUU A;  5HMN A;  4L89 A;  5F48 A;  3JTK A;  3NE7 A;  1PU9 A;  5J8C A;  1XEB A;  4B11 A;  1S3Z A;  4AG7 A;  4B10 A;  3P2F A;  3BJ8 A;  3S6K A;  4XPD C;  1Y9W A;  5CNP A;  4NF1 A;  5J8F A;  3TO9 A;  4QB9 A;  4Q38 A;  2O28 A;  4GS4 A;  2JDD A;  2WPW A;  2YNC A;  5KTA A;  3SXO A;  5AG5 A;  4Y49 C;  4CGM A;  4XPL A;  4OLL A;  1S7K A;  2ATR A;  4MY0 A;  3GY9 A;  4CGO A;  2FL4 A;  4PV6 A;  4CAW A;  3FXT A;  3F5B A;  2ZPA A;  5DWN A;  2I00 A;  4QUS A;  4CS0 B;  3TE4 A;  5FVJ A;  1Q2Y A;  4KOT A;  4CGN A;  4E2A A;  4PSW A;  1IID A;  4FD6 A;  4UCP A;  1XMT A;  2X7B A;  4LX9 A;  1XIX A;  3EY5 A;  1LRZ A;  4R57 A;  5E96 A;  1PUA A;  1B87 A;  5HH1 A;  3SXN A;  5G22 A;  3UY5 A;  3VWD A;  2Q04 A;  4QVT A;  4IUS A;  3T9Y A;  2GIV A;  2Z3O A;  4BBH A;  2OZU A;  4F0Y A;  3N7Z A;  1S60 A;  2FIA A;  4AVB A;  3VWE A;  1S7L A;  4NSQ A;  4MI4 A;  2YNC C;  3TO7 A;  2NMT A;  2P0W A;  3TT2 A;  3D2M A;  1L0C A;  2ZW6 A;  3R9E A;  2I79 A;  1Q2D A;  4MY3 A;  5IB0 A;  4A2Z A;  4QBJ A;  3IWG A;  3LD2 A;  3DNS A;  3DDD A;  2BL1 A;  3JVN A;  4H6U A;  4JWP A;  3FYN A;  4KOX A;  1I1D A;  3S6H A;  2R8V A;  1M4I A;  1YR0 A;  2B3U A;  5JPH A;  4UFW A;  4CAF A;  4MFK A;  3FB3 A;  3EFA A;  2PDO A;  4MFL A;  3W6S A;  5KTC A;  2VEZ A;  1GHE A;  2QML A;  1BO4 A;  3P2H A;  3T90 A;  5F49 A;  3DSB A;  4HNW B;  4NXY A;  2Q0Y A;  4A30 A;  5IX3 A;  2PR1 A;  4RS2 A;  2R7H A;  1Z4E A;  4KSA A;  3SHP A;  4EVY A;  4PSX A;  2YNE A;  2OH1 A;  3D8P A;  4YFJ A;  2JEV A;  2PC1 A;  5G21 A;  2REF A;  5IV0 A;  1KUV A;  3DR8 A;  2FE7 A;  3IU1 A;  4AG9 A;  2F5I A;  4MJ8 A;  2BSW A;  3S6G A;  1IIC A;  2ZW5 A;  2Q7B A;  2R1I A;  4MHD A;  2KCW A;  5JQ4 A;  3F0A A;  3TFY A;  3C26 A;  4JXR A;  3EXN A;  5C82 A;  2RC4 A;  2FSR A;  1YX0 A;  4KUA A;  4X5K A;  3V8I A;  2ZW4 A;  2Z0Z A;  3OWC A;  3QB8 A;  4KVO E;  2B4D B;  4B5P B;  5I0C A;  3BLN A;  2REE A;  2P6G A;  4K30 A;  4HNX B;  4KVM E;  1YLE A;  1ON0 A;  4KOY A;  4OAE A;  3CXQ A;  3R96 A;  2Q4Y A;  5AG6 A;  4HKF A;  1R57 A;  4XNH B;  1M1D A;  2DPS A;  2G3A A;  4C7I A;  4B5O A;  1I12 A;  2H5M A;  3B8G A;  4KS9 A;  1B6B A;  1ZO0 A;  5AG4 A;  4M3S A;  3EC4 A;  4MFZ A;  1YVO A;  4JLY A;  4CRZ B;  2K5T A;  3GYA A;  3KKW A;  3D3S A;  4C2X A;  1MJB A;  3PP9 A;  3W91 A;  4B13 A;  4AVC A;  2ZW7 A;  3CXS A;  4A33 A;  2G3T A;  1XF8 A;  4CAV A;  4IF5 A;  4XPK A;  1QSO A;  5DWM A;  4KOW A;  3TO6 A;  2BEI A;  1KUX A;  3CXP A;  2Z10 A;  4CGL A;  2OB0 A;  2GE3 A;  4CYN A;  3TCV A;  5EC4 A;  4A95 A;  4J3G A;  5KTD A;  1CM0 A;  1J4J A;  1KZF A;  3BJ7 A;  1V0C A;  3R95 A;  4E8O A;  5GCN A;  1XE4 A;  3RYO A;  1RXT A;  2P6E A;  1QSM A;  1WK4 A;  4UFX A;  1K4J A;  1SQH A;  5G1Z A;  5H84 A;  4C7H A;  3FIX A;  4F6A A;  4R87 A;  4YRH A;  4U9Y A;  4UA3 A;  3R9G A;  1RO5 A;  2PR8 A;  2VZZ A;  4YGO A;  2G0B A;  3JUW A;  1IYL A;  1TIQ A;  4MFJ A;  2GAN A;  1QSR A;  1I21 A;  4FD4 A;  3IGR A;  3G3S A;  2CY2 A;  4U9Z A;  1NSL A;  1FY7 A;  4ONU A;  1S7N A;  4II9 A;  4DNC A;  2HQY A;  2EUI A;  4CYO A;  5G20 A;  1MK4 A;  4R3K A;  2YND A;  2Q4V A;  4XPD B;  2Z11 A;  4MBU A;  3TTH A;  5BWA B;  1NMT A;  1M4D A;  4KSF A;  2BUE A;  2OZG A;  2PRB A;  4KLW A;  4MFP A;  4LUA A;  4KOS A;  4UCM A;  4Y49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...