1XMTA

X-ray structure of gene product from arabidopsis thaliana at1g77540
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative acetyltransferase
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1xmtA00
4FD7A 4PK3A 2WPWA 2AE6A 2B4BA 4UA3A 4XPDC 3C26A 4DNCA 3FIXA 2GE3A 3GKRA 3K9UA 2I79A 3S6FA 1MJAA 2ZW4A 3R9GA 4IF5A 5EBVA 1M1DA 2Z0ZA 4II9A 1S3ZA 1QSRA 1B87A 1M4DA 1K4JA 2R98A 4L8AA 1CM0A 4I49A 3KKWA 4R3KA 3EO4A 4UBRA 2G3TA 4M3SA 3S6KA 2OZUA 4YGOA 3PZJA 4J3GA 2OZHA 2G3AA 4E8OA 1Q2YA 3BJ7A 2F5IA 2R7HA 3W6XA 5F48A 3LODA 4XNHB 3TFYA 2REFA 3E0KA 2PDOA 4H6ZA 4HKFA 1XF8A 4OADA 1LRZA 4KOXA 4MJ8A 1S7NA 4KORA 3CXSA 5JQ4A 2VZYA 4OLLA 3ZZIA 4CAXA 3DDDA 1UFHA 2Y0MA 3DNSA 1I21A 4OAEA 4KOWA 4QB9A 4B5PB 4AG7A 1NMTA 5IX3A 2EUIA 1YVKA 2CNSA 2R8VA 2DXQA 2FL4A 1KZFA 3NE7A 3RYOA 2B58A 1S7KA 4MI4A 3W91A 2QIRA 1N71A 4QBJA 1V0CA 1Z9UA 2OU2A 5F49A 4K30A 4KOUA 1KUYA 2ARHA 1QSTA 2ZW5A 3EFAA 4QUSA 3T90A 5KTAA 2PSWA 3W6SA 4E0AA 2O28A 2CNMA 5DWMA 4PSXA 3GYAA 1PU9A 4KVOE 2JLMA 1IIDA 4CAVA 3N7ZA 1YREA 5GCNA 1NE9A 2B5GB 3MGDA 4EVYA 2B5GA 2FIAA 5I0CA 4H89A 4F0YA 1IYLA 2JDCA 3H4QA 4H6UA 4KVXA 1M44A 2Q04A 3R96A 3QAHA 5KTCA 4AG9A 3F5BA 4MBUA 4F6AA 5KTDA 3PP9A 4FD6A 2I00A 2JDDA 2PQ8A 5IV0A 3EY5A 4Y49B 2Z11A 2FIWA 2BL1A 3DR6A 5F47A 4YFJA 1MK4A 1XMTA 3BLNA 3GY9A 2NMTA 2CY2A 3S6GA 2B3UA 2D4PA 1I12A 1L0CA 2D4OA 3R9FA 4QC6A 1MJ9A 3JUWA 4AVBA 1YX0A 3JVNA 4YRHA 1ON0A 2HQYA 2CNTA 1P4NA 5E96A 5H86A 3FYNA 2X7BA 3TO9A 2BEIA 4HNYB 4CAWA 2QECA 1CJWA 2H5MA 2FS5A 4RI1A 4UWIA 4AVAA 4KLWA 2C27A 1Q2DA 3PGPA 4AB7A 3P2FA 5HH1A 3G8WA 4MHDA 2Z10A 2VQYA 1XE4A 4XPLA 2IL4A 3D2MA 4CRYB 3WR7A 5HMNA 3CXQA 2FE7A 4KUBA 3EXNA 2WPXA 1S7FA 5C88A 5FVJA 1B6BA 4BMHA 3TO6A 4HNXB 3TTHA 3BJ8A 5IB0A 1BOBA 2QMLA 2GANA 2J8MA 3TOBA 2ZW6A 3G3SA 3TT2A 4MY0A 4NXYA 2EVNA 4U9ZA 1Z4RA 4ORFA 1SQHA 2AJ6A 2Q7BA 2P6EA 2HV2A 2VZZA 1Q2CA 1GHEA 5ISVA 3FB3A 2B4DA 1R57A 3FNCA 2Q4VA 4LUAA 1VKCA 3TCVA 2GIVA 4FD4A 3FBUA 1S5KA 1IICA 2J8NA 1TIQA 1FY7A 1P0HA 4KVME 2VEZA 3S6HA 1M4IA 2OZGA 4KOTA 2PC1A 4Y49C 4ONUA 3LD2A 4U5YA 4R87A 4KZTA 3SHPA 4X5KA 1XIXA 1RXTA 3I3GA 1NSLA 4AVCA 3I9SA 2J8RA 4XNHC 1M4GA 4L89A 2RC4A 3SXNA 1QSNA 2OH1A 5EC4A 1XEBA 3CXPA 1YLEA 2FSRA 2Q4YA 3OWCA 3QB8A 3T9YA 4JXRA 1IYKA 3R95A 2PRBA 5DWNA 4M85A 1VHSA 1Y7RA 5F46A 1YGHA 4GS4A 4XPDB 4E2AA 3TE4A 4PSWA 1KUXA 4QVTA 4KOVA 2P0WA 2FCKA 4LX9A 4JWPA 1WK4A 4R9MA 3R9EA 2K5TA 4ZBGA 1QSMA 3IWGA 3FRMA 2A4NA 4NSQA 4XPKA 2JEVA 5H84A 2VI7A 4KUAA 4JLYA 1S7LA 2ZW7A 4KOYA 1IB1E 4NF1A 3IGRA 3TOAA 1Y9WA 1S60A 1YK3A 4PV6A 3F0AA 4KLVA 2PR1A 2VXKA 1RO5A 2R1IA 1YVOA 1QSOA 2G0BA 5JPHA 3D3SA 2PR8A 3SXOA 1U6MA 2ATRA 2P6FA 2B3VA 4B5PA 1Z4EA 1Y9KA 2Q44A 1PUAA 1MJBA 3ZJ0A 4CS0B 2KCWA 2HUZA 2ZXVA 3D2PA 3VWDA 4R57A 2FT0A 3F8KA 3DR8A 3FXTA 5J8CA 4NCZA 4KOSA 3B8GA 1KUVA 3V8IA 4JXQA 4MY3A 2REEA 2FXFA 3D8PA 4R3LA 1I1DA 4JD6A 2B4DB 2BSWA 4CRZB 1BO4A 4FD5A 2P6GA 4U9YA 3TO7A 5J8FA 4PK2A 2OB0A 4RS2A 4NEXA 3VWEA 2BUEA 2VBQA 4UWJA 3DSBA 1WWZA 2Q0YA 3P2HA 2ZPAA 1OZPA 1YR0A 1J4JA 5CNPA 4JJXA 5C82A 3UY5A 3R1KA 3EC4A 4IUSA 4B5OA 4HNWB
chains in the Genus database with same CATH superfamily
4FD7A 1TF9A 2GU2A 1HDQA 2WPWA 3IFEA 4PK3A 2AE6A 2B4BA 4UA3A 3B3VA 3VATA 4UIBA 2PJ1A 3C26A 4UFXA 4X2TA 4XPDC 4DNCA 3FIXA 3DLJA 1LOKA 2GE3A 3D66A 3GKRA 4CGLA 3K9UA 2I79A 3S6FA 1MJAA 2ZW4A 3H5ZA 4MXUA 3R9GA 3VH9A 1X12A 4IF5A 5EBVA 3B7IA 1JQGA 1XJOA 3LWUA 3L2NA 1M1DA 2WUUA 2Z0ZA 4OC5A 4BBHA 3D7GA 1NSAA 5AG4A 4II9A 1LFWA 2EK9A 2O4HA 4MFJA 1S3ZA 2V8GA 4MFKA 1QSRA 2PJ8A 5D29A 1B87A 1M4DA 4P4DA 1K4JA 2R98A 1TKFA 5EMIA 4CYPA 4L8AA 5LYFA 5JH9A 1EE3P 3BI1A 1CM0A 2Z3OA 4I49A 4ZX8A 3KKWA 4R3KA 3EO4A 4UBRA 4A30A 2G3TA 2JEWA 4CGPA 4M3SA 3S6KA 3IWEA 2POKA 2OZUA 4DJLA 4YGOA 3PZJA 1FT7A 2OZHA 3PBEA 4J3GA 2G3AA 3PFEA 2IQ6A 4B12A 4E8OA 5I4MA 1Q2YA 3BJ7A 2F5IA 3B35A 2R7HA 3W6XA 1CG2A 4P45A 5IB9A 5F48A 3LODA 4BD9A 2EO8A 2J9AA 4NJQA 2C6PA 4NGNA 4R6TA 4XNHB 4YWYA 4A37A 2REFA 3E0KA 3TFYA 2PDOA 4H6ZA 4HKFA 4JYWA 2HC9A 2VL1A 1XF8A 4OADA 1BPNA 1LRZA 2CTBA 4KOXA 4MJ8A 4B10A 1S7NA 4KORA 2Z3NA 3CXSA 1IOFA 2F8HA 1F57A 5JQ4A 4C2ZA 1DTDA 2VZYA 3NE8A 3IU2A 2JBJA 3D7DA 4OLLA 4PQAA 3ZZIA 4CAXA 3DDDA 2ABZA 1UFHA 2Y0MA 4MHNA 3DNSA 1I21A 2V77A 2I3CA 4F9VA 4ZGYB 4MMOA 3ISXA 4A39A 4OAEA 4KOWA 4QB9A 4B5PB 1LAPA 2ZELA 1VHOA 2PJ4A 3PBBA 2IJZA 1YMEA 4TNUA 4EFDA 4AG7A 3FVLA 3HLPA 4A2ZA 1NMTA 5IX3A 2EUIA 1YVKA 1QMUA 2CNSA 2R8VA 4MCPA 2GLJA 2EK8A 3NH5A 1BAVA 2DXQA 2FL4A 4ZY1A 1KZFA 4C7IA 3KQZA 3NE7A 3KGQA 4OIDA 3RYOA 4BINA 2B58A 4CPAA 1S7KA 4MI4A 3W91A 4NGQA 2QIRA 1N71A 4UEFA 5AG7A 3B3SA 4ZX9A 3S9MA 4QBJA 4B13A 1V0CA 1Z9UA 2OU2A 5F49A 3K9TA 3CDXA 4K30A 4NGRA 4KOUA 2PCUA 1KUYA 2ARHA 3RBUA 1QSTA 2ZW5A 3EFAA 4QUSA 5G22A 3T90A 3QNVA 1XBUA 1A2ZA 2BOAA 2PJ3A 2PSWA 4MHPA 3W6SA 5KTAA 4MFQA 4P4IA 4CGNA 1R3NA 2F7VA 4C7HA 2GREA 3SI2A 4E0AA 2O28A 1Y0RA 3GB0A 4Q36A 4R8FA 1ELLP 5HXDA 1IY7A 4UFVA 3PFOA 1VIXA 4GM5A 2O53A 7CPAA 2CNMA 5DWMA 2BCOA 4KS9A 1XMBA 4PSXA 5HVFA 3GYAA 1PU9A 4KVOE 4DYOA 2JLMA 4Z65A 1IIDA 4CYNA 4CAVA 3N7ZA 4NJRA 4TWEA 1YREA 5GCNA 3SJEA 1NE9A 2B5GB 3PEIA 3GLJA 3MGDA 4P4JA 4EVYA 2B5GA 3IIBA 5LYIA 3T8WA 4B14A 2FIAA 1AMPA 5A28A 2YNDA 3PB4X 1R43A 4H89A 5I0CA 4F0YA 1IYLA 2JDCA 1TKHA 4PXEA 2Q43A 3H4QA 3PRTA 2QJ8A 3IWWA 3N5FA 1LANA 1ZG7A 4H6UA 2ZOFA 1M44A 4KVXA 2Q04A 4X3RA 3R96A 3QAHA 1ZLIA 5J1QA 1XFOA 2XEJA 5KTCA 4CAFA 4Q7AA 4AG9A 2G9DA 4FBEA 2PJ0A 2ZOGA 4A33A 3F5BA 2XEIA 5LRGA 4MBUA 4F6AA 5KTDA 3PP9A 4FD6A 2I00A 2JDDA 3FJUA 2ODFA 2PQ8A 5LYDA 2PJ9A 5HVGA 5IV0A 4WJBA 3D67A 3QAYA 3EY5A 1Y0YA 1ARMA 3WT4A 4K3NA 2Q4ZA 3BXMA 1AUGA 3KHXA 4Y49B 2Z11A 4CGMA 2FIWA 1QQ9A 2BL1A 1CP6A 3DR6A 1BLLE 1FNOA 1MK4A 1XMTA 1Z5RA 3BLNA 3GY9A 3LMSA 4OKOA 2NMTA 2CY2A 2PVWA 3S6GA 2B3UA 2ZEHA 3WC6A 2D4PA 4EWTA 4HNWB 3DGVA 2C6CA 4UEZA 1YSJA 1I12A 1L0CA 4MFPA 5LYLA 2D4OA 3B3CA 3FF3A 4NGPA 3KASA 1Z2LA 3SJGA 2DEAA 3CZXA 5BWAB 3R9FA 4QC6A 1MJ9A 3JUWA 1OBRA 4AVBA 1YX0A 3JVNA 3NA6A 4YRHA 3IU1A 4OC3A 3D68A 2NSMA 2V8DA 2AFMA 1M4LA 4C2XA 1GYTA 3SJFA 1ON0A 2HQYA 2Z3LA 2JBKA 4FUUA 2CNTA 1P4NA 4OIWA 5E96A 3FYNA 2X7BA 4P4EA 5H86A 3TO9A 2BEIA 2YNCC 3NH8A 4HNYB 4M6GA 3H8EA 3RAMA 4F0XA 4CAWA 2QECA 2ZENA 3IEHA 1CJWA 2H5MA 5K8NA 1CPSA 2FS5A 4RI1A 5CPAA 1CPXA 4UWIA 4AVAA 4KLWA 2C27A 1Q2DA 4A38A 3PGPA 4AB7A 3P2FA 5HH1A 4NGSA 4F8ZA 3G8WA 1DE4C 2DPSA 4MHDA 5K8PA 4UCPA 2Z10A 3D7FA 5ELYA 3PB9X 2VQYA 1TF8A 3I1UA 4FWUA 5AG6A 1XE4A 4XPLA 2IL4A 3D2MA 3WABA 4CRYB 2PJ5A 5HVHA 3FEEA 4IK2A 3WR7A 3CXQA 5HMNA 5LRKA 4X8IA 5G1ZA 2FE7A 4KUBA 3EXNA 3ISZA 2WPXA 4CYQA 3CT9A 4MFLA 4ZY2A 5DS0A 2ZEEA 3FH4A 1S7FA 2CF4A 2AFZA 5C88A 5FVJA 3FECA 5G21A 2FVGA 1B6BA 1AYEA 4CGOA 5A27A 3FMCA 4A31A 4BMHA 2YGWA 4PXDA 2ZEMA 1TKJA 3NFZA 5F47A 3TO6A 4HNXB 1UWYA 3TTHA 3V7ZA 3PB6X 1VHEA 3HUVA 2ZEGA 3BJ8A 5IB0A 1BOBA 2QMLA 2GANA 2XEGA 2J8MA 2PJBA 4M6HA 3TOBA 2ZEPA 2ZW6A 3G3SA 1IGBA 5AG5A 3TT2A 1LCPA 4MHYA 4MY0A 6CPAA 1PYTB 4NXYA 1YQEA 2EVNA 4U9ZA 1Z4RA 4ORFA 1SQHA 3BI0A 4EMEA 2AJ6A 3B3TA 1YW4A 1VGYA 2P6EA 1F2PA 2PE3A 3CPAA 2Q7BA 2HV2A 4FAIA 2VZZA 1Q2CA 1GHEA 5ISVA 3FB3A 4B11A 2B4DA 4RN7A 1R57A 3FNCA 4W9YA 1ZG8A 3KHZA 4OC2A 2Q4VA 4LUAA 4MHZA 4C2YA 1VKCA 3TCVA 4ZY0A 3D4UA 2GIVA 4FD4A 4LQGA 3S9LA 3FBUA 2CIJA 1S5KA 1IU8A 1IICA 1KWMA 4LQ6A 2J8NA 4A32A 8CPAA 1TIQA 3JTKA 3WC5A 1FY7A 1P0HA 2VEZA 2NYQA 4KVME 3S6HA 1M4IA 2OZGA 4KOTA 1ARLA 2PC1A 4Y49C 4ONUA 3MN8A 2EWBA 1H8LA 2PVVA 3D7HA 3LD2A 3KQXA 1HEEA 4U5YA 4P6YA 1ELMP 4R87A 4KZTA 3SHPA 4CYOA 4X5KA 1ZG9A 2IMOA 2WSAA 1XIXA 5THWA 1XOVA 2CTCA 4A95A 1F2OA 1RXTA 2V8VA 3I3GA 1NSLA 4Q38A 1Y7EA 2ZEOA 4P4BA 4ZYQA 4AVCA 5LRJA 4YU9A 3I9SA 4KSIA 2J8RA 4XNHC 2GFQA 1M4GA 3KR4A 4P10A 4L89A 2RC4A 4UIAA 3SXNA 4MRIA 1QSNA 3RZAA 2OH1A 5EC4A 1XEBA 3CXPA 4PPZA 1YLEA 4KSAA 2PJCA 2FSRA 2ANPA 2Q4YA 3OWCA 3QB8A 3T9YA 4JXRA 4MCQA 3SI1A 4P4FA 3PB7X 1IYKA 3R95A 2HB6A 2PRBA 4PXBA 3TC8A 2CXAA 5DWNA 2WZNA 4M85A 5K8OA 1Y7RA 1VHSA 1ZO0A 2AFUA 2PJ7A 4O23A 5F46A 1YGHA 4GS4A 4XPDB 4E2AA 5F09A 3TE4A 3CPXA 3A9LA 4UF4A 4PSWA 1KUXA 5JM6A 4QVTA 5CBMA 4KOVA 2DPTA 4MCRA 1YLOA 2P0WA 2FCKA 4GXHA 4LX9A 4AXVA 4JWPA 1WK4A 4R9MA 3K2KA 3R9EA 2K5TA 2PJ6A 4ZBGA 1QSMA 1YW6A 2C6GA 3TX8A 3IWGA 2AFOA 4NFRA 3FRMA 2A4NA 3LACA 4NSQA 4NGMA 3WC7A 4F9UA 4XPKA 4OMEA 2JEVA 5H84A 4OC0A 2ZEDA 2EBJA 1BPMA 2PIZA 3H8GA 2BO9A 2Z3KA 2VI7A 2YNEA 4KUAA 4JLYA 1S7LA 2ZW7A 3GIUA 4KOYA 1IB1E 4NF1A 1Z8TA 3IGRA 3TOAA 4NGTA 3GUXA 4OP4A 1TXRA 1Y9WA 1S60A 2AFXA 4OC4A 1CBXA 4MCSA 1YK3A 5JGFA 2RFHA 4CAEA 3KZWA 3NH4A 4PV6A 3IO1A 3F0AA 4KLVA 2PR1A 4P44A 2AFSA 4KSFA 4R7MA 2VXKA 1RO5A 2R1IA 3B3WA 1YVOA 3FX6A 1QSOA 4B6ZA 2G0BA 3IC1A 5JPHA 3D3SA 1X10A 2XEFA 2GLFA 1JWQA 2PR8A 3SXOA 2PJAA 3VARA 1U6MA 2ATRA 2P6FA 2B3VA 2OR4A 3KI9A 3KR5A 1LAMA 4B5PA 4UCNA 1Z4EA 2WYRA 1Y9KA 2Q44A 5K8MA 4R76A 1CX8A 1PUAA 1MJBA 1IOIA 1Z8WA 3RO0A 3ZJ0A 2OOTA 4CS0B 2KCWA 4M6IA 3H8FA 1Q7LA 2HUZA 3BHXA 5D8NA 2ZEFA 3SJXA 4ONWA 2ZXVA 3D2PA 2C1CA 2PJ2A 3VWDA 2YNCA 1Z8LA 4R57A 2FT0A 1Z8XA 2RB7A 2DF5A 4UFWA 2QYVA 2Z3MA 4C68A 3F8KA 3DR8A 3FXTA 2AFWA 2PRQA 5AGEA 5J8CA 4NCZA 4WWVA 5G20A 4IAVA 3B8GA 1KUVA 4KOSA 4JXQA 3V8IA 3S9NA 4MY3A 4RUHA 2REEA 2QVPA 2FXFA 4H2KA 2Z3PA 3D8PA 4ZI6A 3IJ3A 2Q51A 4R3LA 1I1DA 4JD6A 2B4DB 2BSWA 4OC1A 4CRZB 1BO4A 4FD5A 2P6GA 4HPSA 1HDUA 4U9YA 3RNZA 3TO7A 4YFJA 5J8FA 4PK2A 4PXCA 3FEDA 2OB0A 4RS2A 4NEXA 4UCMA 1PCAA 2Q7SA 4MFZA 3VWEA 3V38A 2BUEA 1ZLHA 3SI0A 1XRYA 2PIYA 2VBQA 3KL9A 4UWJA 4DUKA 3DSBA 1WWZA 3MRUA 4G1PA 2Q0YA 3JRUA 3P2HA 2ZPAA 1OZPA 4JZ0A 1YR0A 1CP7A 4IHMA 3PB8X 1J4JA 5CNPA 3B2YA 4JJXA 5C82A 3UY5A 4A94A 2V8HA 3R1KA 3EC4A 4IUSA 4B5OA 4UEEA 1RTQA
chains in the Genus database with same CATH topology
4FD7A 4PK3A 2WPWA 2AE6A 2B4BA 4UA3A 4XPDC 3C26A 4UFXA 4DNCA 3FIXA 2GE3A 3GKRA 4CGLA 3K9UA 2I79A 3S6FA 1MJAA 2ZW4A 3H5ZA 3R9GA 4IF5A 5EBVA 1M1DA 2WUUA 2Z0ZA 4BBHA 4II9A 5AG4A 4MFJA 1S3ZA 4MFKA 1QSRA 1B87A 1M4DA 1K4JA 2R98A 4CYPA 4L8AA 1CM0A 2Z3OA 4I49A 3KKWA 4R3KA 3EO4A 4UBRA 4A30A 2G3TA 4CGPA 4M3SA 3S6KA 3IWEA 2OZUA 4YGOA 3PZJA 4J3GA 2OZHA 4B12A 2G3AA 4E8OA 1Q2YA 3BJ7A 2F5IA 2R7HA 3W6XA 5F48A 3LODA 4XNHB 3TFYA 2REFA 3E0KA 2PDOA 4H6ZA 4HKFA 1XF8A 4OADA 1LRZA 4KOXA 4MJ8A 4B10A 1S7NA 4KORA 2Z3NA 3CXSA 5JQ4A 4C2ZA 2VZYA 3IU2A 4OLLA 3ZZIA 4CAXA 3DDDA 1UFHA 2Y0MA 3DNSA 1I21A 4ZGYB 4OAEA 4KOWA 4QB9A 4B5PB 4AG7A 4A2ZA 1NMTA 5IX3A 2EUIA 1YVKA 2CNSA 2R8VA 2DXQA 2FL4A 1KZFA 4C7IA 3NE7A 3RYOA 2B58A 1S7KA 4MI4A 3W91A 2QIRA 1N71A 5AG7A 4QBJA 4B13A 1V0CA 1Z9UA 2OU2A 5F49A 4K30A 4KOUA 1KUYA 2ARHA 1QSTA 2ZW5A 3EFAA 4QUSA 5G22A 3T90A 5KTAA 2PSWA 3W6SA 4MFQA 4CGNA 4C7HA 4E0AA 2O28A 4Q36A 4UFVA 2CNMA 5DWMA 4KS9A 4PSXA 3GYAA 1PU9A 4KVOE 2JLMA 1IIDA 4CYNA 4CAVA 3N7ZA 1YREA 5GCNA 1NE9A 2B5GB 3MGDA 4EVYA 2B5GA 4B14A 2FIAA 5A28A 2YNDA 5I0CA 4H89A 4F0YA 1IYLA 2JDCA 3H4QA 4H6UA 4KVXA 1M44A 2Q04A 3R96A 3QAHA 5KTCA 4CAFA 4AG9A 4A33A 3F5BA 4MBUA 4F6AA 5KTDA 3PP9A 4FD6A 2I00A 2JDDA 2PQ8A 5IV0A 3EY5A 4Y49B 2Z11A 4CGMA 2FIWA 2BL1A 3DR6A 5F47A 4YFJA 1MK4A 1XMTA 3BLNA 3GY9A 2NMTA 2CY2A 3S6GA 2B3UA 2D4PA 1I12A 1L0CA 4MFPA 2D4OA 5BWAB 3R9FA 4QC6A 1MJ9A 3JUWA 4AVBA 1YX0A 3JVNA 4YRHA 3IU1A 4C2XA 1ON0A 2HQYA 2Z3LA 2CNTA 1P4NA 5E96A 5H86A 3FYNA 2X7BA 3TO9A 2BEIA 2YNCC 4HNYB 4F0XA 4CAWA 2QECA 1CJWA 2H5MA 2FS5A 4RI1A 4UWIA 4AVAA 4KLWA 2C27A 1Q2DA 3PGPA 4AB7A 3P2FA 5HH1A 3G8WA 2DPSA 4MHDA 4UCPA 2Z10A 2VQYA 5AG6A 1XE4A 4XPLA 2IL4A 3D2MA 4CRYB 3WR7A 5HMNA 3CXQA 5G1ZA 2FE7A 4KUBA 3EXNA 4CYQA 2WPXA 4MFLA 1S7FA 5C88A 5FVJA 5G21A 1B6BA 4CGOA 5A27A 4A31A 4BMHA 2YGWA 3TO6A 4HNXB 3TTHA 3BJ8A 5IB0A 1BOBA 2QMLA 2GANA 2J8MA 3TOBA 2ZW6A 3G3SA 5AG5A 3TT2A 4MY0A 4NXYA 2EVNA 4U9ZA 1Z4RA 4ORFA 1SQHA 2AJ6A 2Q7BA 2P6EA 2HV2A 2VZZA 1Q2CA 1GHEA 5ISVA 3FB3A 4B11A 2B4DA 1R57A 3FNCA 2Q4VA 4LUAA 4C2YA 1VKCA 3TCVA 2GIVA 4FD4A 3FBUA 1S5KA 1IICA 2J8NA 4A32A 1TIQA 3JTKA 1FY7A 1P0HA 2VEZA 4KVME 3S6HA 1M4IA 2OZGA 4KOTA 2PC1A 4Y49C 4ONUA 3LD2A 4U5YA 4R87A 4KZTA 3SHPA 4CYOA 4X5KA 2WSAA 1XIXA 4A95A 1RXTA 3I3GA 1NSLA 4Q38A 4AVCA 3I9SA 2J8RA 4XNHC 1M4GA 4L89A 2RC4A 3SXNA 1QSNA 2OH1A 5EC4A 1XEBA 3CXPA 1YLEA 4KSAA 2FSRA 2Q4YA 3OWCA 3QB8A 3T9YA 4JXRA 1IYKA 3R95A 2PRBA 2CXAA 5DWNA 4M85A 1VHSA 1Y7RA 1ZO0A 5F46A 1YGHA 4GS4A 4XPDB 4E2AA 3TE4A 3A9LA 4PSWA 1KUXA 4QVTA 4KOVA 2DPTA 2P0WA 2FCKA 4LX9A 4JWPA 1WK4A 4R9MA 3R9EA 2K5TA 4ZBGA 1QSMA 3IWGA 3FRMA 2A4NA 4NSQA 4XPKA 2JEVA 5H84A 2Z3KA 2VI7A 2YNEA 4KUAA 4JLYA 1S7LA 2ZW7A 4KOYA 1IB1E 4NF1A 3IGRA 3TOAA 1Y9WA 1S60A 1YK3A 4CAEA 4PV6A 3F0AA 4KLVA 2PR1A 4KSFA 2VXKA 1RO5A 2R1IA 1YVOA 1QSOA 2G0BA 5JPHA 3D3SA 2PR8A 3SXOA 1U6MA 2ATRA 2P6FA 2B3VA 4B5PA 4UCNA 1Z4EA 1Y9KA 2Q44A 1PUAA 1MJBA 3ZJ0A 4CS0B 2KCWA 2HUZA 2ZXVA 3D2PA 3VWDA 2YNCA 4R57A 2FT0A 4UFWA 2Z3MA 4C68A 3F8KA 3DR8A 3FXTA 5AGEA 5J8CA 4NCZA 5G20A 4KOSA 3B8GA 1KUVA 3V8IA 4JXQA 4MY3A 2REEA 2FXFA 2Z3PA 3D8PA 4R3LA 1I1DA 4JD6A 2B4DB 2BSWA 4CRZB 1BO4A 4FD5A 2P6GA 4U9YA 3TO7A 5J8FA 4PK2A 2OB0A 4RS2A 4NEXA 4UCMA 4MFZA 3VWEA 2BUEA 2VBQA 4UWJA 3DSBA 1WWZA 2Q0YA 3P2HA 2ZPAA 1OZPA 1YR0A 1J4JA 5CNPA 4JJXA 5C82A 3UY5A 3R1KA 3EC4A 4IUSA 4B5OA 4HNWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FD7 A;  4PK3 A;  2WPW A;  2AE6 A;  2B4B A;  4UA3 A;  4XPD C;  3C26 A;  4DNC A;  3FIX A;  2GE3 A;  3GKR A;  3K9U A;  2I79 A;  3S6F A;  1MJA A;  2ZW4 A;  3R9G A;  4IF5 A;  5EBV A;  1M1D A;  2Z0Z A;  4II9 A;  1S3Z A;  1QSR A;  1B87 A;  1M4D A;  1K4J A;  2R98 A;  4L8A A;  1CM0 A;  4I49 A;  3KKW A;  4R3K A;  3EO4 A;  4UBR A;  2G3T A;  4M3S A;  3S6K A;  2OZU A;  4YGO A;  3PZJ A;  4J3G A;  2OZH A;  2G3A A;  4E8O A;  1Q2Y A;  3BJ7 A;  2F5I A;  2R7H A;  3W6X A;  5F48 A;  3LOD A;  4XNH B;  3TFY A;  2REF A;  3E0K A;  2PDO A;  4H6Z A;  4HKF A;  1XF8 A;  4OAD A;  1LRZ A;  4KOX A;  4MJ8 A;  1S7N A;  4KOR A;  3CXS A;  5JQ4 A;  2VZY A;  4OLL A;  3ZZI A;  4CAX A;  3DDD A;  1UFH A;  2Y0M A;  3DNS A;  1I21 A;  4OAE A;  4KOW A;  4QB9 A;  4B5P B;  4AG7 A;  1NMT A;  5IX3 A;  2EUI A;  1YVK A;  2CNS A;  2R8V A;  2DXQ A;  2FL4 A;  1KZF A;  3NE7 A;  3RYO A;  2B58 A;  1S7K A;  4MI4 A;  3W91 A;  2QIR A;  1N71 A;  4QBJ A;  1V0C A;  1Z9U A;  2OU2 A;  5F49 A;  4K30 A;  4KOU A;  1KUY A;  2ARH A;  1QST A;  2ZW5 A;  3EFA A;  4QUS A;  3T90 A;  5KTA A;  2PSW A;  3W6S A;  4E0A A;  2O28 A;  2CNM A;  5DWM A;  4PSX A;  3GYA A;  1PU9 A;  4KVO E;  2JLM A;  1IID A;  4CAV A;  3N7Z A;  1YRE A;  5GCN A;  1NE9 A;  2B5G B;  3MGD A;  4EVY A;  2B5G A;  2FIA A;  5I0C A;  4H89 A;  4F0Y A;  1IYL A;  2JDC A;  3H4Q A;  4H6U A;  4KVX A;  1M44 A;  2Q04 A;  3R96 A;  3QAH A;  5KTC A;  4AG9 A;  3F5B A;  4MBU A;  4F6A A;  5KTD A;  3PP9 A;  4FD6 A;  2I00 A;  2JDD A;  2PQ8 A;  5IV0 A;  3EY5 A;  4Y49 B;  2Z11 A;  2FIW A;  2BL1 A;  3DR6 A;  5F47 A;  4YFJ A;  1MK4 A;  1XMT A;  3BLN A;  3GY9 A;  2NMT A;  2CY2 A;  3S6G A;  2B3U A;  2D4P A;  1I12 A;  1L0C A;  2D4O A;  3R9F A;  4QC6 A;  1MJ9 A;  3JUW A;  4AVB A;  1YX0 A;  3JVN A;  4YRH A;  1ON0 A;  2HQY A;  2CNT A;  1P4N A;  5E96 A;  5H86 A;  3FYN A;  2X7B A;  3TO9 A;  2BEI A;  4HNY B;  4CAW A;  2QEC A;  1CJW A;  2H5M A;  2FS5 A;  4RI1 A;  4UWI A;  4AVA A;  4KLW A;  2C27 A;  1Q2D A;  3PGP A;  4AB7 A;  3P2F A;  5HH1 A;  3G8W A;  4MHD A;  2Z10 A;  2VQY A;  1XE4 A;  4XPL A;  2IL4 A;  3D2M A;  4CRY B;  3WR7 A;  5HMN A;  3CXQ A;  2FE7 A;  4KUB A;  3EXN A;  2WPX A;  1S7F A;  5C88 A;  5FVJ A;  1B6B A;  4BMH A;  3TO6 A;  4HNX B;  3TTH A;  3BJ8 A;  5IB0 A;  1BOB A;  2QML A;  2GAN A;  2J8M A;  3TOB A;  2ZW6 A;  3G3S A;  3TT2 A;  4MY0 A;  4NXY A;  2EVN A;  4U9Z A;  1Z4R A;  4ORF A;  1SQH A;  2AJ6 A;  2Q7B A;  2P6E A;  2HV2 A;  2VZZ A;  1Q2C A;  1GHE A;  5ISV A;  3FB3 A;  2B4D A;  1R57 A;  3FNC A;  2Q4V A;  4LUA A;  1VKC A;  3TCV A;  2GIV A;  4FD4 A;  3FBU A;  1S5K A;  1IIC A;  2J8N A;  1TIQ A;  1FY7 A;  1P0H A;  4KVM E;  2VEZ A;  3S6H A;  1M4I A;  2OZG A;  4KOT A;  2PC1 A;  4Y49 C;  4ONU A;  3LD2 A;  4U5Y A;  4R87 A;  4KZT A;  3SHP A;  4X5K A;  1XIX A;  1RXT A;  3I3G A;  1NSL A;  4AVC A;  3I9S A;  2J8R A;  4XNH C;  1M4G A;  4L89 A;  2RC4 A;  3SXN A;  1QSN A;  2OH1 A;  5EC4 A;  1XEB A;  3CXP A;  1YLE A;  2FSR A;  2Q4Y A;  3OWC A;  3QB8 A;  3T9Y A;  4JXR A;  1IYK A;  3R95 A;  2PRB A;  5DWN A;  4M85 A;  1VHS A;  1Y7R A;  5F46 A;  1YGH A;  4GS4 A;  4XPD B;  4E2A A;  3TE4 A;  4PSW A;  1KUX A;  4QVT A;  4KOV A;  2P0W A;  2FCK A;  4LX9 A;  4JWP A;  1WK4 A;  4R9M A;  3R9E A;  2K5T A;  4ZBG A;  1QSM A;  3IWG A;  3FRM A;  2A4N A;  4NSQ A;  4XPK A;  2JEV A;  5H84 A;  2VI7 A;  4KUA A;  4JLY A;  1S7L A;  2ZW7 A;  4KOY A;  1IB1 E;  4NF1 A;  3IGR A;  3TOA A;  1Y9W A;  1S60 A;  1YK3 A;  4PV6 A;  3F0A A;  4KLV A;  2PR1 A;  2VXK A;  1RO5 A;  2R1I A;  1YVO A;  1QSO A;  2G0B A;  5JPH A;  3D3S A;  2PR8 A;  3SXO A;  1U6M A;  2ATR A;  2P6F A;  2B3V A;  4B5P A;  1Z4E A;  1Y9K A;  2Q44 A;  1PUA A;  1MJB A;  3ZJ0 A;  4CS0 B;  2KCW A;  2HUZ A;  2ZXV A;  3D2P A;  3VWD A;  4R57 A;  2FT0 A;  3F8K A;  3DR8 A;  3FXT A;  5J8C A;  4NCZ A;  4KOS A;  3B8G A;  1KUV A;  3V8I A;  4JXQ A;  4MY3 A;  2REE A;  2FXF A;  3D8P A;  4R3L A;  1I1D A;  4JD6 A;  2B4D B;  2BSW A;  4CRZ B;  1BO4 A;  4FD5 A;  2P6G A;  4U9Y A;  3TO7 A;  5J8F A;  4PK2 A;  2OB0 A;  4RS2 A;  4NEX A;  3VWE A;  2BUE A;  2VBQ A;  4UWJ A;  3DSB A;  1WWZ A;  2Q0Y A;  3P2H A;  2ZPA A;  1OZP A;  1YR0 A;  1J4J A;  5CNP A;  4JJX A;  5C82 A;  3UY5 A;  3R1K A;  3EC4 A;  4IUS A;  4B5O A;  4HNW B; 
#chains in the Genus database with same CATH topology
 4FD7 A;  1TF9 A;  2GU2 A;  1HDQ A;  2WPW A;  3IFE A;  4PK3 A;  2AE6 A;  2B4B A;  4UA3 A;  3B3V A;  3VAT A;  4UIB A;  2PJ1 A;  3C26 A;  4UFX A;  4X2T A;  4XPD C;  4DNC A;  3FIX A;  3DLJ A;  1LOK A;  2GE3 A;  3D66 A;  3GKR A;  4CGL A;  3K9U A;  2I79 A;  3S6F A;  1MJA A;  2ZW4 A;  3H5Z A;  4MXU A;  3R9G A;  3VH9 A;  1X12 A;  4IF5 A;  5EBV A;  3B7I A;  1JQG A;  1XJO A;  3LWU A;  3L2N A;  1M1D A;  2WUU A;  2Z0Z A;  4OC5 A;  4BBH A;  3D7G A;  1NSA A;  5AG4 A;  4II9 A;  1LFW A;  2EK9 A;  2O4H A;  4MFJ A;  1S3Z A;  2V8G A;  4MFK A;  1QSR A;  2PJ8 A;  5D29 A;  1B87 A;  1M4D A;  4P4D A;  1K4J A;  2R98 A;  1TKF A;  5EMI A;  4CYP A;  4L8A A;  5LYF A;  5JH9 A;  1EE3 P;  3BI1 A;  1CM0 A;  2Z3O A;  4I49 A;  4ZX8 A;  3KKW A;  4R3K A;  3EO4 A;  4UBR A;  4A30 A;  2G3T A;  2JEW A;  4CGP A;  4M3S A;  3S6K A;  3IWE A;  2POK A;  2OZU A;  4DJL A;  4YGO A;  3PZJ A;  1FT7 A;  2OZH A;  3PBE A;  4J3G A;  2G3A A;  3PFE A;  2IQ6 A;  4B12 A;  4E8O A;  5I4M A;  1Q2Y A;  3BJ7 A;  2F5I A;  3B35 A;  2R7H A;  3W6X A;  1CG2 A;  4P45 A;  5IB9 A;  5F48 A;  3LOD A;  4BD9 A;  2EO8 A;  2J9A A;  4NJQ A;  2C6P A;  4NGN A;  4R6T A;  4XNH B;  4YWY A;  4A37 A;  2REF A;  3E0K A;  3TFY A;  2PDO A;  4H6Z A;  4HKF A;  4JYW A;  2HC9 A;  2VL1 A;  1XF8 A;  4OAD A;  1BPN A;  1LRZ A;  2CTB A;  4KOX A;  4MJ8 A;  4B10 A;  1S7N A;  4KOR A;  2Z3N A;  3CXS A;  1IOF A;  2F8H A;  1F57 A;  5JQ4 A;  4C2Z A;  1DTD A;  2VZY A;  3NE8 A;  3IU2 A;  2JBJ A;  3D7D A;  4OLL A;  4PQA A;  3ZZI A;  4CAX A;  3DDD A;  2ABZ A;  1UFH A;  2Y0M A;  4MHN A;  3DNS A;  1I21 A;  2V77 A;  2I3C A;  4F9V A;  4ZGY B;  4MMO A;  3ISX A;  4A39 A;  4OAE A;  4KOW A;  4QB9 A;  4B5P B;  1LAP A;  2ZEL A;  1VHO A;  2PJ4 A;  3PBB A;  2IJZ A;  1YME A;  4TNU A;  4EFD A;  4AG7 A;  3FVL A;  3HLP A;  4A2Z A;  1NMT A;  5IX3 A;  2EUI A;  1YVK A;  1QMU A;  2CNS A;  2R8V A;  4MCP A;  2GLJ A;  2EK8 A;  3NH5 A;  1BAV A;  2DXQ A;  2FL4 A;  4ZY1 A;  1KZF A;  4C7I A;  3KQZ A;  3NE7 A;  3KGQ A;  4OID A;  3RYO A;  4BIN A;  2B58 A;  4CPA A;  1S7K A;  4MI4 A;  3W91 A;  4NGQ A;  2QIR A;  1N71 A;  4UEF A;  5AG7 A;  3B3S A;  4ZX9 A;  3S9M A;  4QBJ A;  4B13 A;  1V0C A;  1Z9U A;  2OU2 A;  5F49 A;  3K9T A;  3CDX A;  4K30 A;  4NGR A;  4KOU A;  2PCU A;  1KUY A;  2ARH A;  3RBU A;  1QST A;  2ZW5 A;  3EFA A;  4QUS A;  5G22 A;  3T90 A;  3QNV A;  1XBU A;  1A2Z A;  2BOA A;  2PJ3 A;  2PSW A;  4MHP A;  3W6S A;  5KTA A;  4MFQ A;  4P4I A;  4CGN A;  1R3N A;  2F7V A;  4C7H A;  2GRE A;  3SI2 A;  4E0A A;  2O28 A;  1Y0R A;  3GB0 A;  4Q36 A;  4R8F A;  1ELL P;  5HXD A;  1IY7 A;  4UFV A;  3PFO A;  1VIX A;  4GM5 A;  2O53 A;  7CPA A;  2CNM A;  5DWM A;  2BCO A;  4KS9 A;  1XMB A;  4PSX A;  5HVF A;  3GYA A;  1PU9 A;  4KVO E;  4DYO A;  2JLM A;  4Z65 A;  1IID A;  4CYN A;  4CAV A;  3N7Z A;  4NJR A;  4TWE A;  1YRE A;  5GCN A;  3SJE A;  1NE9 A;  2B5G B;  3PEI A;  3GLJ A;  3MGD A;  4P4J A;  4EVY A;  2B5G A;  3IIB A;  5LYI A;  3T8W A;  4B14 A;  2FIA A;  1AMP A;  5A28 A;  2YND A;  3PB4 X;  1R43 A;  4H89 A;  5I0C A;  4F0Y A;  1IYL A;  2JDC A;  1TKH A;  4PXE A;  2Q43 A;  3H4Q A;  3PRT A;  2QJ8 A;  3IWW A;  3N5F A;  1LAN A;  1ZG7 A;  4H6U A;  2ZOF A;  1M44 A;  4KVX A;  2Q04 A;  4X3R A;  3R96 A;  3QAH A;  1ZLI A;  5J1Q A;  1XFO A;  2XEJ A;  5KTC A;  4CAF A;  4Q7A A;  4AG9 A;  2G9D A;  4FBE A;  2PJ0 A;  2ZOG A;  4A33 A;  3F5B A;  2XEI A;  5LRG A;  4MBU A;  4F6A A;  5KTD A;  3PP9 A;  4FD6 A;  2I00 A;  2JDD A;  3FJU A;  2ODF A;  2PQ8 A;  5LYD A;  2PJ9 A;  5HVG A;  5IV0 A;  4WJB A;  3D67 A;  3QAY A;  3EY5 A;  1Y0Y A;  1ARM A;  3WT4 A;  4K3N A;  2Q4Z A;  3BXM A;  1AUG A;  3KHX A;  4Y49 B;  2Z11 A;  4CGM A;  2FIW A;  1QQ9 A;  2BL1 A;  1CP6 A;  3DR6 A;  1BLL E;  1FNO A;  1MK4 A;  1XMT A;  1Z5R A;  3BLN A;  3GY9 A;  3LMS A;  4OKO A;  2NMT A;  2CY2 A;  2PVW A;  3S6G A;  2B3U A;  2ZEH A;  3WC6 A;  2D4P A;  4EWT A;  4HNW B;  3DGV A;  2C6C A;  4UEZ A;  1YSJ A;  1I12 A;  1L0C A;  4MFP A;  5LYL A;  2D4O A;  3B3C A;  3FF3 A;  4NGP A;  3KAS A;  1Z2L A;  3SJG A;  2DEA A;  3CZX A;  5BWA B;  3R9F A;  4QC6 A;  1MJ9 A;  3JUW A;  1OBR A;  4AVB A;  1YX0 A;  3JVN A;  3NA6 A;  4YRH A;  3IU1 A;  4OC3 A;  3D68 A;  2NSM A;  2V8D A;  2AFM A;  1M4L A;  4C2X A;  1GYT A;  3SJF A;  1ON0 A;  2HQY A;  2Z3L A;  2JBK A;  4FUU A;  2CNT A;  1P4N A;  4OIW A;  5E96 A;  3FYN A;  2X7B A;  4P4E A;  5H86 A;  3TO9 A;  2BEI A;  2YNC C;  3NH8 A;  4HNY B;  4M6G A;  3H8E A;  3RAM A;  4F0X A;  4CAW A;  2QEC A;  2ZEN A;  3IEH A;  1CJW A;  2H5M A;  5K8N A;  1CPS A;  2FS5 A;  4RI1 A;  5CPA A;  1CPX A;  4UWI A;  4AVA A;  4KLW A;  2C27 A;  1Q2D A;  4A38 A;  3PGP A;  4AB7 A;  3P2F A;  5HH1 A;  4NGS A;  4F8Z A;  3G8W A;  1DE4 C;  2DPS A;  4MHD A;  5K8P A;  4UCP A;  2Z10 A;  3D7F A;  5ELY A;  3PB9 X;  2VQY A;  1TF8 A;  3I1U A;  4FWU A;  5AG6 A;  1XE4 A;  4XPL A;  2IL4 A;  3D2M A;  3WAB A;  4CRY B;  2PJ5 A;  5HVH A;  3FEE A;  4IK2 A;  3WR7 A;  3CXQ A;  5HMN A;  5LRK A;  4X8I A;  5G1Z A;  2FE7 A;  4KUB A;  3EXN A;  3ISZ A;  2WPX A;  4CYQ A;  3CT9 A;  4MFL A;  4ZY2 A;  5DS0 A;  2ZEE A;  3FH4 A;  1S7F A;  2CF4 A;  2AFZ A;  5C88 A;  5FVJ A;  3FEC A;  5G21 A;  2FVG A;  1B6B A;  1AYE A;  4CGO A;  5A27 A;  3FMC A;  4A31 A;  4BMH A;  2YGW A;  4PXD A;  2ZEM A;  1TKJ A;  3NFZ A;  5F47 A;  3TO6 A;  4HNX B;  1UWY A;  3TTH A;  3V7Z A;  3PB6 X;  1VHE A;  3HUV A;  2ZEG A;  3BJ8 A;  5IB0 A;  1BOB A;  2QML A;  2GAN A;  2XEG A;  2J8M A;  2PJB A;  4M6H A;  3TOB A;  2ZEP A;  2ZW6 A;  3G3S A;  1IGB A;  5AG5 A;  3TT2 A;  1LCP A;  4MHY A;  4MY0 A;  6CPA A;  1PYT B;  4NXY A;  1YQE A;  2EVN A;  4U9Z A;  1Z4R A;  4ORF A;  1SQH A;  3BI0 A;  4EME A;  2AJ6 A;  3B3T A;  1YW4 A;  1VGY A;  2P6E A;  1F2P A;  2PE3 A;  3CPA A;  2Q7B A;  2HV2 A;  4FAI A;  2VZZ A;  1Q2C A;  1GHE A;  5ISV A;  3FB3 A;  4B11 A;  2B4D A;  4RN7 A;  1R57 A;  3FNC A;  4W9Y A;  1ZG8 A;  3KHZ A;  4OC2 A;  2Q4V A;  4LUA A;  4MHZ A;  4C2Y A;  1VKC A;  3TCV A;  4ZY0 A;  3D4U A;  2GIV A;  4FD4 A;  4LQG A;  3S9L A;  3FBU A;  2CIJ A;  1S5K A;  1IU8 A;  1IIC A;  1KWM A;  4LQ6 A;  2J8N A;  4A32 A;  8CPA A;  1TIQ A;  3JTK A;  3WC5 A;  1FY7 A;  1P0H A;  2VEZ A;  2NYQ A;  4KVM E;  3S6H A;  1M4I A;  2OZG A;  4KOT A;  1ARL A;  2PC1 A;  4Y49 C;  4ONU A;  3MN8 A;  2EWB A;  1H8L A;  2PVV A;  3D7H A;  3LD2 A;  3KQX A;  1HEE A;  4U5Y A;  4P6Y A;  1ELM P;  4R87 A;  4KZT A;  3SHP A;  4CYO A;  4X5K A;  1ZG9 A;  2IMO A;  2WSA A;  1XIX A;  5THW A;  1XOV A;  2CTC A;  4A95 A;  1F2O A;  1RXT A;  2V8V A;  3I3G A;  1NSL A;  4Q38 A;  1Y7E A;  2ZEO A;  4P4B A;  4ZYQ A;  4AVC A;  5LRJ A;  4YU9 A;  3I9S A;  4KSI A;  2J8R A;  4XNH C;  2GFQ A;  1M4G A;  3KR4 A;  4P10 A;  4L89 A;  2RC4 A;  4UIA A;  3SXN A;  4MRI A;  1QSN A;  3RZA A;  2OH1 A;  5EC4 A;  1XEB A;  3CXP A;  4PPZ A;  1YLE A;  4KSA A;  2PJC A;  2FSR A;  2ANP A;  2Q4Y A;  3OWC A;  3QB8 A;  3T9Y A;  4JXR A;  4MCQ A;  3SI1 A;  4P4F A;  3PB7 X;  1IYK A;  3R95 A;  2HB6 A;  2PRB A;  4PXB A;  3TC8 A;  2CXA A;  5DWN A;  2WZN A;  4M85 A;  5K8O A;  1Y7R A;  1VHS A;  1ZO0 A;  2AFU A;  2PJ7 A;  4O23 A;  5F46 A;  1YGH A;  4GS4 A;  4XPD B;  4E2A A;  5F09 A;  3TE4 A;  3CPX A;  3A9L A;  4UF4 A;  4PSW A;  1KUX A;  5JM6 A;  4QVT A;  5CBM A;  4KOV A;  2DPT A;  4MCR A;  1YLO A;  2P0W A;  2FCK A;  4GXH A;  4LX9 A;  4AXV A;  4JWP A;  1WK4 A;  4R9M A;  3K2K A;  3R9E A;  2K5T A;  2PJ6 A;  4ZBG A;  1QSM A;  1YW6 A;  2C6G A;  3TX8 A;  3IWG A;  2AFO A;  4NFR A;  3FRM A;  2A4N A;  3LAC A;  4NSQ A;  4NGM A;  3WC7 A;  4F9U A;  4XPK A;  4OME A;  2JEV A;  5H84 A;  4OC0 A;  2ZED A;  2EBJ A;  1BPM A;  2PIZ A;  3H8G A;  2BO9 A;  2Z3K A;  2VI7 A;  2YNE A;  4KUA A;  4JLY A;  1S7L A;  2ZW7 A;  3GIU A;  4KOY A;  1IB1 E;  4NF1 A;  1Z8T A;  3IGR A;  3TOA A;  4NGT A;  3GUX A;  4OP4 A;  1TXR A;  1Y9W A;  1S60 A;  2AFX A;  4OC4 A;  1CBX A;  4MCS A;  1YK3 A;  5JGF A;  2RFH A;  4CAE A;  3KZW A;  3NH4 A;  4PV6 A;  3IO1 A;  3F0A A;  4KLV A;  2PR1 A;  4P44 A;  2AFS A;  4KSF A;  4R7M A;  2VXK A;  1RO5 A;  2R1I A;  3B3W A;  1YVO A;  3FX6 A;  1QSO A;  4B6Z A;  2G0B A;  3IC1 A;  5JPH A;  3D3S A;  1X10 A;  2XEF A;  2GLF A;  1JWQ A;  2PR8 A;  3SXO A;  2PJA A;  3VAR A;  1U6M A;  2ATR A;  2P6F A;  2B3V A;  2OR4 A;  3KI9 A;  3KR5 A;  1LAM A;  4B5P A;  4UCN A;  1Z4E A;  2WYR A;  1Y9K A;  2Q44 A;  5K8M A;  4R76 A;  1CX8 A;  1PUA A;  1MJB A;  1IOI A;  1Z8W A;  3RO0 A;  3ZJ0 A;  2OOT A;  4CS0 B;  2KCW A;  4M6I A;  3H8F A;  1Q7L A;  2HUZ A;  3BHX A;  5D8N A;  2ZEF A;  3SJX A;  4ONW A;  2ZXV A;  3D2P A;  2C1C A;  2PJ2 A;  3VWD A;  2YNC A;  1Z8L A;  4R57 A;  2FT0 A;  1Z8X A;  2RB7 A;  2DF5 A;  4UFW A;  2QYV A;  2Z3M A;  4C68 A;  3F8K A;  3DR8 A;  3FXT A;  2AFW A;  2PRQ A;  5AGE A;  5J8C A;  4NCZ A;  4WWV A;  5G20 A;  4IAV A;  3B8G A;  1KUV A;  4KOS A;  4JXQ A;  3V8I A;  3S9N A;  4MY3 A;  4RUH A;  2REE A;  2QVP A;  2FXF A;  4H2K A;  2Z3P A;  3D8P A;  4ZI6 A;  3IJ3 A;  2Q51 A;  4R3L A;  1I1D A;  4JD6 A;  2B4D B;  2BSW A;  4OC1 A;  4CRZ B;  1BO4 A;  4FD5 A;  2P6G A;  4HPS A;  1HDU A;  4U9Y A;  3RNZ A;  3TO7 A;  4YFJ A;  5J8F A;  4PK2 A;  4PXC A;  3FED A;  2OB0 A;  4RS2 A;  4NEX A;  4UCM A;  1PCA A;  2Q7S A;  4MFZ A;  3VWE A;  3V38 A;  2BUE A;  1ZLH A;  3SI0 A;  1XRY A;  2PIY A;  2VBQ A;  3KL9 A;  4UWJ A;  4DUK A;  3DSB A;  1WWZ A;  3MRU A;  4G1P A;  2Q0Y A;  3JRU A;  3P2H A;  2ZPA A;  1OZP A;  4JZ0 A;  1YR0 A;  1CP7 A;  4IHM A;  3PB8 X;  1J4J A;  5CNP A;  3B2Y A;  4JJX A;  5C82 A;  3UY5 A;  4A94 A;  2V8H A;  3R1K A;  3EC4 A;  4IUS A;  4B5O A;  4UEE A;  1RTQ A; 
#chains in the Genus database with same CATH homology
 4FD7 A;  4PK3 A;  2WPW A;  2AE6 A;  2B4B A;  4UA3 A;  4XPD C;  3C26 A;  4UFX A;  4DNC A;  3FIX A;  2GE3 A;  3GKR A;  4CGL A;  3K9U A;  2I79 A;  3S6F A;  1MJA A;  2ZW4 A;  3H5Z A;  3R9G A;  4IF5 A;  5EBV A;  1M1D A;  2WUU A;  2Z0Z A;  4BBH A;  4II9 A;  5AG4 A;  4MFJ A;  1S3Z A;  4MFK A;  1QSR A;  1B87 A;  1M4D A;  1K4J A;  2R98 A;  4CYP A;  4L8A A;  1CM0 A;  2Z3O A;  4I49 A;  3KKW A;  4R3K A;  3EO4 A;  4UBR A;  4A30 A;  2G3T A;  4CGP A;  4M3S A;  3S6K A;  3IWE A;  2OZU A;  4YGO A;  3PZJ A;  4J3G A;  2OZH A;  4B12 A;  2G3A A;  4E8O A;  1Q2Y A;  3BJ7 A;  2F5I A;  2R7H A;  3W6X A;  5F48 A;  3LOD A;  4XNH B;  3TFY A;  2REF A;  3E0K A;  2PDO A;  4H6Z A;  4HKF A;  1XF8 A;  4OAD A;  1LRZ A;  4KOX A;  4MJ8 A;  4B10 A;  1S7N A;  4KOR A;  2Z3N A;  3CXS A;  5JQ4 A;  4C2Z A;  2VZY A;  3IU2 A;  4OLL A;  3ZZI A;  4CAX A;  3DDD A;  1UFH A;  2Y0M A;  3DNS A;  1I21 A;  4ZGY B;  4OAE A;  4KOW A;  4QB9 A;  4B5P B;  4AG7 A;  4A2Z A;  1NMT A;  5IX3 A;  2EUI A;  1YVK A;  2CNS A;  2R8V A;  2DXQ A;  2FL4 A;  1KZF A;  4C7I A;  3NE7 A;  3RYO A;  2B58 A;  1S7K A;  4MI4 A;  3W91 A;  2QIR A;  1N71 A;  5AG7 A;  4QBJ A;  4B13 A;  1V0C A;  1Z9U A;  2OU2 A;  5F49 A;  4K30 A;  4KOU A;  1KUY A;  2ARH A;  1QST A;  2ZW5 A;  3EFA A;  4QUS A;  5G22 A;  3T90 A;  5KTA A;  2PSW A;  3W6S A;  4MFQ A;  4CGN A;  4C7H A;  4E0A A;  2O28 A;  4Q36 A;  4UFV A;  2CNM A;  5DWM A;  4KS9 A;  4PSX A;  3GYA A;  1PU9 A;  4KVO E;  2JLM A;  1IID A;  4CYN A;  4CAV A;  3N7Z A;  1YRE A;  5GCN A;  1NE9 A;  2B5G B;  3MGD A;  4EVY A;  2B5G A;  4B14 A;  2FIA A;  5A28 A;  2YND A;  5I0C A;  4H89 A;  4F0Y A;  1IYL A;  2JDC A;  3H4Q A;  4H6U A;  4KVX A;  1M44 A;  2Q04 A;  3R96 A;  3QAH A;  5KTC A;  4CAF A;  4AG9 A;  4A33 A;  3F5B A;  4MBU A;  4F6A A;  5KTD A;  3PP9 A;  4FD6 A;  2I00 A;  2JDD A;  2PQ8 A;  5IV0 A;  3EY5 A;  4Y49 B;  2Z11 A;  4CGM A;  2FIW A;  2BL1 A;  3DR6 A;  5F47 A;  4YFJ A;  1MK4 A;  1XMT A;  3BLN A;  3GY9 A;  2NMT A;  2CY2 A;  3S6G A;  2B3U A;  2D4P A;  1I12 A;  1L0C A;  4MFP A;  2D4O A;  5BWA B;  3R9F A;  4QC6 A;  1MJ9 A;  3JUW A;  4AVB A;  1YX0 A;  3JVN A;  4YRH A;  3IU1 A;  4C2X A;  1ON0 A;  2HQY A;  2Z3L A;  2CNT A;  1P4N A;  5E96 A;  5H86 A;  3FYN A;  2X7B A;  3TO9 A;  2BEI A;  2YNC C;  4HNY B;  4F0X A;  4CAW A;  2QEC A;  1CJW A;  2H5M A;  2FS5 A;  4RI1 A;  4UWI A;  4AVA A;  4KLW A;  2C27 A;  1Q2D A;  3PGP A;  4AB7 A;  3P2F A;  5HH1 A;  3G8W A;  2DPS A;  4MHD A;  4UCP A;  2Z10 A;  2VQY A;  5AG6 A;  1XE4 A;  4XPL A;  2IL4 A;  3D2M A;  4CRY B;  3WR7 A;  5HMN A;  3CXQ A;  5G1Z A;  2FE7 A;  4KUB A;  3EXN A;  4CYQ A;  2WPX A;  4MFL A;  1S7F A;  5C88 A;  5FVJ A;  5G21 A;  1B6B A;  4CGO A;  5A27 A;  4A31 A;  4BMH A;  2YGW A;  3TO6 A;  4HNX B;  3TTH A;  3BJ8 A;  5IB0 A;  1BOB A;  2QML A;  2GAN A;  2J8M A;  3TOB A;  2ZW6 A;  3G3S A;  5AG5 A;  3TT2 A;  4MY0 A;  4NXY A;  2EVN A;  4U9Z A;  1Z4R A;  4ORF A;  1SQH A;  2AJ6 A;  2Q7B A;  2P6E A;  2HV2 A;  2VZZ A;  1Q2C A;  1GHE A;  5ISV A;  3FB3 A;  4B11 A;  2B4D A;  1R57 A;  3FNC A;  2Q4V A;  4LUA A;  4C2Y A;  1VKC A;  3TCV A;  2GIV A;  4FD4 A;  3FBU A;  1S5K A;  1IIC A;  2J8N A;  4A32 A;  1TIQ A;  3JTK A;  1FY7 A;  1P0H A;  2VEZ A;  4KVM E;  3S6H A;  1M4I A;  2OZG A;  4KOT A;  2PC1 A;  4Y49 C;  4ONU A;  3LD2 A;  4U5Y A;  4R87 A;  4KZT A;  3SHP A;  4CYO A;  4X5K A;  2WSA A;  1XIX A;  4A95 A;  1RXT A;  3I3G A;  1NSL A;  4Q38 A;  4AVC A;  3I9S A;  2J8R A;  4XNH C;  1M4G A;  4L89 A;  2RC4 A;  3SXN A;  1QSN A;  2OH1 A;  5EC4 A;  1XEB A;  3CXP A;  1YLE A;  4KSA A;  2FSR A;  2Q4Y A;  3OWC A;  3QB8 A;  3T9Y A;  4JXR A;  1IYK A;  3R95 A;  2PRB A;  2CXA A;  5DWN A;  4M85 A;  1VHS A;  1Y7R A;  1ZO0 A;  5F46 A;  1YGH A;  4GS4 A;  4XPD B;  4E2A A;  3TE4 A;  3A9L A;  4PSW A;  1KUX A;  4QVT A;  4KOV A;  2DPT A;  2P0W A;  2FCK A;  4LX9 A;  4JWP A;  1WK4 A;  4R9M A;  3R9E A;  2K5T A;  4ZBG A;  1QSM A;  3IWG A;  3FRM A;  2A4N A;  4NSQ A;  4XPK A;  2JEV A;  5H84 A;  2Z3K A;  2VI7 A;  2YNE A;  4KUA A;  4JLY A;  1S7L A;  2ZW7 A;  4KOY A;  1IB1 E;  4NF1 A;  3IGR A;  3TOA A;  1Y9W A;  1S60 A;  1YK3 A;  4CAE A;  4PV6 A;  3F0A A;  4KLV A;  2PR1 A;  4KSF A;  2VXK A;  1RO5 A;  2R1I A;  1YVO A;  1QSO A;  2G0B A;  5JPH A;  3D3S A;  2PR8 A;  3SXO A;  1U6M A;  2ATR A;  2P6F A;  2B3V A;  4B5P A;  4UCN A;  1Z4E A;  1Y9K A;  2Q44 A;  1PUA A;  1MJB A;  3ZJ0 A;  4CS0 B;  2KCW A;  2HUZ A;  2ZXV A;  3D2P A;  3VWD A;  2YNC A;  4R57 A;  2FT0 A;  4UFW A;  2Z3M A;  4C68 A;  3F8K A;  3DR8 A;  3FXT A;  5AGE A;  5J8C A;  4NCZ A;  5G20 A;  4KOS A;  3B8G A;  1KUV A;  3V8I A;  4JXQ A;  4MY3 A;  2REE A;  2FXF A;  2Z3P A;  3D8P A;  4R3L A;  1I1D A;  4JD6 A;  2B4D B;  2BSW A;  4CRZ B;  1BO4 A;  4FD5 A;  2P6G A;  4U9Y A;  3TO7 A;  5J8F A;  4PK2 A;  2OB0 A;  4RS2 A;  4NEX A;  4UCM A;  4MFZ A;  3VWE A;  2BUE A;  2VBQ A;  4UWJ A;  3DSB A;  1WWZ A;  2Q0Y A;  3P2H A;  2ZPA A;  1OZP A;  1YR0 A;  1J4J A;  5CNP A;  4JJX A;  5C82 A;  3UY5 A;  3R1K A;  3EC4 A;  4IUS A;  4B5O A;  4HNW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...