1XMTA

X-ray structure of gene product from arabidopsis thaliana at1g77540
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords putative acetyltransferase
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1xmtA00
1NE9A 2CY2A 3TO6A 4KZTA 2WPWA 2EVNA 1IYLA 1M1DA 2JDDA 4XPKA 3W6SA 3T90A 2HV2A 2VZZA 3I9SA 1YVKA 5F46A 3EXNA 3LD2A 1VHSA 1YLEA 4HNXB 2C27A 2OH1A 3R95A 4KUAA 4E2AA 2PSWA 5DWMA 5IX3A 2KCWA 2QECA 1Y9WA 2HUZA 1WK4A 4GS4A 1YVOA 2K5TA 1PU9A 4R87A 4H89A 1S7KA 3FBUA 1M44A 1IIDA 3R9EA 1PUAA 3D8PA 3R9GA 2NMTA 4AVAA 4KOXA 3UY5A 4KVME 1Q2CA 4OLLA 3G8WA 4MY3A 1K4JA 5F47A 4AVCA 3TTHA 4OAEA 4HNYB 5EBVA 3TO7A 2Q7BA 3PZJA 1MK4A 4KOUA 3TFYA 1UFHA 5I0CA 5C88A 1MJ9A 1P0HA 4MBUA 4AVBA 3PGPA 2Q4YA 2VXKA 4KOSA 3WR7A 4JLYA 2ZXVA 2RC4A 4KUBA 4M3SA 3R96A 4L8AA 1QSOA 5IB0A 4UBRA 2Q44A 2Z0ZA 2R8VA 3DNSA 1N71A 2J8MA 4IF5A 1YX0A 3GKRA 3EO4A 1B87A 3D2PA 4X5KA 3P2FA 2FT0A 2J8NA 5DWNA 4R3LA 4IUSA 3QB8A 1BO4A 1WWZA 3E0KA 2QMLA 4AG7A 2B4DA 3DSBA 3FYNA 4JD6A 2Q4VA 4NXYA 4UWJA 4UWIA 3SXNA 1CJWA 1YR0A 3TCVA 3OWCA 1M4IA 2WPXA 1BOBA 2Z10A 2REEA 4MY0A 1U6MA 4HNWB 4FD6A 4XNHC 1Z4RA 2R98A 3BJ8A 4JXQA 2DXQA 2B3UA 4YGOA 1KUVA 2CNMA 4H6UA 5J8FA 3S6HA 5KTCA 2B58A 4QVTA 2BL1A 4XPDC 3BJ7A 2P6GA 4FD4A 2FL4A 4DNCA 3R9FA 1S60A 4KOYA 4NEXA 1M4DA 3FRMA 1Z4EA 3D2MA 5IV0A 5JPHA 2ZPAA 1SQHA 3VWEA 2JDCA 4PK3A 4KORA 4KLVA 3K9UA 2CNSA 3SHPA 4R9MA 2FS5A 4PSXA 2R1IA 3W6XA 4AG9A 1YGHA 1IICA 1KUXA 4II9A 3T9YA 2VZYA 1GHEA 1S7LA 5ISVA 1Q2YA 3JVNA 4F0YA 2AJ6A 4EVYA 2PDOA 4BMHA 3V8IA 1NMTA 2BEIA 5F49A 1IB1E 1KUYA 2OZGA 2G0BA 2FIWA 1I12A 4E8OA 2REFA 4MJ8A 1L0CA 4QB9A 2OZUA 1RO5A 2P6EA 2Z11A 3FB3A 4R3KA 2ATRA 1J4JA 5H86A 3TOAA 5GCNA 2JEVA 2B5GA 4KVXA 2D4PA 1QSNA 4CRYB 4CS0B 2I00A 2PQ8A 4B5PB 2IL4A 4E0AA 3LODA 3EC4A 4PK2A 4U9ZA 2D4OA 3W91A 3IGRA 1XMTA 2PR8A 1OZPA 2FIAA 5KTAA 5F48A 3ZJ0A 2P6FA 3FXTA 3TE4A 1CM0A 3NE7A 1XE4A 3FNCA 4NCZA 2Y0MA 2R7HA 1YREA 2VI7A 4KOTA 4CAVA 2FXFA 4AB7A 2AE6A 3DR8A 2JLMA 1TIQA 3EY5A 4UA3A 1LRZA 5J8CA 2Q0YA 3B8GA 3F8KA 3BLNA 1QSRA 5C82A 4JJXA 2I79A 4HKFA 3S6GA 5FVJA 4JWPA 4XPLA 4QC6A 1MJBA 4JXRA 4QUSA 4KLWA 5HH1A 2FSRA 4PSWA 1Z9UA 3RYOA 4RI1A 1QSMA 3JUWA 4K30A 2B4DB 2HQYA 2GANA 1Q2DA 2H5MA 1NSLA 4YRHA 4CAWA 4RS2A 3G3SA 4U9YA 1R57A 1KZFA 4FD5A 4Y49C 1M4GA 3VWDA 1XF8A 3R1KA 2ZW5A 2B5GB 1S7FA 2GE3A 2GIVA 5HMNA 2PR1A 3F5BA 2O28A 3CXPA 2PC1A 2ZW6A 3TT2A 4LUAA 1S3ZA 4CRZB 1MJAA 1S7NA 5EC4A 4J3GA 1P4NA 3DDDA 2F5IA 2PRBA 3TOBA 3GY9A 4I49A 2G3TA 3CXQA 3D3SA 5E96A 2A4NA 4KOVA 3FIXA 3S6FA 2ZW7A 4LX9A 1Y9KA 4F6AA 1RXTA 4MI4A 4XNHB 2J8RA 3IWGA 1S5KA 4M85A 4YFJA 1FY7A 2FE7A 3PP9A 4ORFA 4NSQA 2EUIA 4H6ZA 2VEZA 3SXOA 3CXSA 2ARHA 4NF1A 3GYAA 1ON0A 1V0CA 4Y49B 3MGDA 1VKCA 1Y7RA 3I3GA 2OU2A 2BUEA 2FCKA 4MHDA 3F0AA 2BSWA 1I21A 4B5OA 4CAXA 2VBQA 2G3AA 2CNTA 1XIXA 4OADA 1I1DA 3N7ZA 4L89A 2OZHA 3C26A 1YK3A 3KKWA 2P0WA 3S6KA 3P2HA 1IYKA 4KVOE 4XPDB 4B5PA 4R57A 4ONUA 3DR6A 1XEBA 3EFAA 1B6BA 2ZW4A 1QSTA 4KOWA 3ZZIA 4ZBGA 3QAHA 2B3VA 5JQ4A 4PV6A 3TO9A 5KTDA 2X7BA 4FD7A 4U5YA 2OB0A 2VQYA 5CNPA 2B4BA 2Q04A 5H84A 2QIRA 3H4QA 4QBJA
chains in the Genus database with same CATH superfamily
1NE9A 2CY2A 1JQGA 1CX8A 8CPAA 4F9UA 2HB6A 2WUUA 3TO6A 4KZTA 2WPWA 2PCUA 3NH5A 2EVNA 1IYLA 4OIWA 1M1DA 2JDDA 4XPKA 3W6SA 1NSAA 2V77A 4TNUA 2HV2A 2VZZA 3FECA 3T90A 4ZI6A 3I9SA 2NYQA 1YVKA 3NE8A 4OC0A 5F46A 2GREA 5K8OA 3EXNA 2ZOGA 4F8ZA 4NGPA 3FX6A 2NSMA 3LD2A 1VHSA 1YLEA 4A38A 2V8HA 4MFZA 5LYDA 5LRKA 4MHYA 3B3VA 4HNXB 2ZEPA 2C27A 2OH1A 3R95A 4B14A 1F2PA 2EK8A 3GIUA 4KUAA 4E2AA 4EFDA 2PSWA 2FVGA 4P4IA 5DWMA 5IX3A 3K2KA 2KCWA 4JYWA 2PJ0A 2QECA 3V7ZA 1Y9WA 2HUZA 1WK4A 4GS4A 4OC4A 4NGTA 4ZGYB 1YVOA 2K5TA 1PU9A 4R87A 4H89A 4CGPA 4DUKA 3PB6X 1S7KA 1YW4A 4UF4A 3FBUA 1M44A 3CDXA 4PXDA 4B12A 4MHNA 1IIDA 3R9EA 1PUAA 2AFMA 3D8PA 1IY7A 2NMTA 3R9GA 4AVAA 5I4MA 4KOXA 3IWEA 4C2XA 4X2TA 1TKJA 4C7IA 3UY5A 4KVME 1ARLA 2EK9A 5K8MA 2ZEEA 1Q2CA 1UWYA 4NGNA 4OLLA 3G8WA 2PIYA 4G1PA 4MY3A 1K4JA 5F47A 5CBMA 4AVCA 2PVVA 4NGMA 3TTHA 4OAEA 2CIJA 4PXCA 2CXAA 2ODFA 2GU2A 2YGWA 4HNYB 5EBVA 5HVFA 2YNCA 4UEZA 2AFZA 3N5FA 4BD9A 3TO7A 5JGFA 2PIZA 2OOTA 2Q7BA 3PZJA 1MK4A 4KOUA 4AXVA 2BCOA 1UFHA 2V8VA 1QQ9A 4MXUA 3SI2A 5C88A 5I0CA 1MJ9A 1P0HA 4LQ6A 4ZY2A 4NGRA 1RTQA 4MBUA 2VL1A 4K3NA 4PQAA 2QVPA 4AVBA 7CPAA 3PGPA 5AG5A 3RNZA 1FT7A 2Q4YA 1AYEA 4UFWA 2VXKA 1LANA 4KOSA 3WR7A 4CAFA 4JLYA 4OMEA 3RAMA 1IOIA 2ZXVA 2RC4A 4MCPA 4KUBA 1PYTB 4M3SA 3KASA 4L8AA 2ZEGA 1QSOA 3R96A 3RZAA 3GB0A 4KSFA 1Z5RA 4UBRA 3WABA 4M6HA 5IB0A 1XBUA 4A94A 2Q44A 2Z0ZA 2R8VA 1BPMA 3DNSA 2OR4A 1N71A 2J8MA 1HDUA 4IF5A 1JWQA 3PBBA 1YX0A 5D29A 3GKRA 4FBEA 2PJ4A 3EO4A 3CT9A 3KGQA 1ELMP 2C1CA 1F57A 5JH9A 2Q43A 1B87A 3D2PA 4X5KA 3CPAA 3PB7X 2YNCC 3IJ3A 3P2FA 4Q38A 2FT0A 2J8NA 1TKHA 5DWNA 4UCMA 4R3LA 2G9DA 4IUSA 4EMEA 3QB8A 4ZYQA 1BO4A 2WSAA 1WWZA 3S9LA 2PVWA 2Q4ZA 3E0KA 4MHPA 4A31A 2QMLA 4AG7A 5J1QA 2IMOA 5AG4A 2B4DA 3HLPA 3DSBA 3FYNA 4JD6A 5HVHA 2Q4VA 4CYQA 4MCRA 4NXYA 4UWJA 2J9AA 4KS9A 1TKFA 4UWIA 3SXNA 1CJWA 1YR0A 4WWVA 4CGMA 1QMUA 3CZXA 5DS0A 1A2ZA 3TCVA 3B2YA 3OWCA 1M4IA 1YW6A 2WPXA 3NH4A 2GFQA 4UFXA 4PXBA 4F9VA 1BOBA 2Z10A 5LYIA 2REEA 3I1UA 4MY0A 1U6MA 5LRGA 4HNWB 4FD6A 4XNHC 1DTDA 1Y0RA 1Z4RA 2R98A 2PJ9A 3A9LA 3BJ8A 4MCQA 4B13A 1X10A 3KL9A 5F09A 3PBEA 3WC7A 1AUGA 4MCSA 4JXQA 2DXQA 4CGOA 1IGBA 2B3UA 4YGOA 5A27A 3QAYA 4CYOA 1KUVA 2CNMA 2Z3PA 3IEHA 4H6UA 3S6HA 2B58A 5J8FA 5KTCA 1ZG7A 4QVTA 2BL1A 4XPDC 3D66A 1VGYA 3BJ7A 2P6GA 4UIAA 2PJ1A 1EE3P 4Q36A 3D7FA 4FD4A 2FL4A 4DNCA 3R9FA 1S60A 1XRYA 3B3TA 4KOYA 4KSIA 2RB7A 2Z3MA 4NEXA 5HVGA 2PJ5A 3D7DA 1M4DA 3FRMA 4MFJA 5LRJA 3TX8A 3JTKA 2JBJA 1Z4EA 2O53A 3WT4A 3D2MA 4NGSA 5IV0A 5JPHA 2ZPAA 1VHEA 1SQHA 3VWEA 2JDCA 2BO9A 2PJCA 4PK3A 4KORA 4KLVA 3K9UA 3ISXA 4IHMA 2XEFA 1Z8TA 3GUXA 2CNSA 4NFRA 1Z2LA 3SHPA 4FUUA 2FS5A 3FEEA 4R9MA 4PSXA 2R1IA 4FWUA 3W6XA 1YGHA 4AG9A 1TXRA 1IICA 1KUXA 1F2OA 3NA6A 4II9A 4MFQA 4UCPA 4P6YA 3T9YA 2V8GA 2VZYA 1GHEA 1S7LA 3PB9X 3T8WA 4F0XA 5ISVA 1Q2YA 3D7GA 1XJOA 3JVNA 2AJ6A 2Z3LA 4A2ZA 4F0YA 4EVYA 1BLLE 2PDOA 5THWA 4BMHA 4O23A 2PJAA 4P4DA 3V8IA 4Q7AA 1NMTA 2BEIA 2XEJA 5F49A 4RUHA 3S9NA 2ABZA 1IB1E 1OBRA 2PJ2A 1KUYA 2OZGA 1LAPA 2G0BA 4UEFA 2O4HA 2FIWA 5EMIA 1I12A 4E8OA 2REFA 4MJ8A 3FH4A 4ONWA 5G21A 2QJ8A 1L0CA 2POKA 4QB9A 2OZUA 4YWYA 4BINA 2QYVA 4ZY0A 1RO5A 2P6EA 2Z11A 5G22A 4X8IA 5G20A 3SI0A 3FB3A 4IAVA 3FJUA 4R3KA 2ATRA 1CPSA 4Y49B 4OC1A 1J4JA 1YMEA 4OP4A 6CPAA 5H86A 3B7IA 3IWWA 2PJBA 3TOAA 5GCNA 2JEVA 2B5GA 4KVXA 5AGEA 3PB4X 2D4PA 1M4LA 1QSNA 4CRYB 3IU1A 4CS0B 3DLJA 2CTCA 2I00A 2PQ8A 4B5PB 2IL4A 4E0AA 3LACA 3VH9A 3LODA 3EC4A 4PK2A 2C6CA 4IK2A 4U9ZA 4CGLA 2D4OA 4P4JA 5K8PA 3W91A 3IGRA 3D4UA 1Z8XA 1XMTA 2PR8A 1OZPA 3B35A 3SJXA 2FIAA 2ZEDA 1TF9A 2ZENA 3PB8X 5KTAA 5F48A 3FMCA 3ZJ0A 2P6FA 4P4BA 3FXTA 2C6GA 3TE4A 1CM0A 3NE7A 1XE4A 2IQ6A 4HPSA 4A33A 3FNCA 4NCZA 2Y0MA 3NFZA 2R7HA 1YREA 1ZLHA 2VI7A 4UIBA 4CAEA 4KOTA 4CPAA 3BHXA 4CAVA 5JM6A 3H8GA 2FXFA 5D8NA 4AB7A 4YU9A 1BAVA 2AE6A 3DR8A 2JLMA 1TIQA 3EY5A 4UA3A 1LRZA 3D67A 5J8CA 2Q0YA 3B8GA 4NJQA 4PXEA 3F8KA 1DE4C 3KR5A 2AFWA 2YNEA 3BLNA 3PRTA 1LOKA 1QSRA 2YNDA 4B11A 5C82A 1LFWA 3FVLA 4W9YA 4JJXA 4ZX9A 2I79A 2WZNA 4HKFA 1R3NA 2ANPA 3S6GA 4OC3A 2DPTA 4C2ZA 2DF5A 3KQZA 2DPSA 1FNOA 4ZY1A 2PJ6A 1KWMA 4M6GA 5FVJA 4JWPA 4XPLA 5BWAB 4QC6A 1MJBA 1XOVA 2PJ3A 3B3CA 3TC8A 3MN8A 4JXRA 4QUSA 1Q7LA 1ZG8A 2Z3NA 4KLWA 1YSJA 2I3CA 2F8HA 5HH1A 3H8FA 2FSRA 2HC9A 3LWUA 4PSWA 4A32A 1CPXA 3WC5A 3H5ZA 1Z9UA 3RYOA 4B6ZA 4X3RA 4OKOA 2EO8A 1Z8LA 1YQEA 1ZG9A 4RI1A 1QSMA 3FF3A 3JUWA 4BBHA 3KQXA 2EBJA 4K30A 2EWBA 2B4DB 2HQYA 2GANA 1Q2DA 3MRUA 3L2NA 2H5MA 4UFVA 1NSLA 4YRHA 4CAWA 3KZWA 3QNVA 2PJ7A 1CP6A 3S9MA 3FEDA 1TF8A 4RS2A 4GM5A 3G3SA 4U9YA 4ZX8A 3V38A 1R57A 1YLOA 2Q7SA 1KZFA 4FD5A 3BI0A 4Y49C 1M4GA 3VWDA 1XF8A 3H8EA 3R1KA 1HDQA 2ZW5A 1Z8WA 2B5GB 3IC1A 3KHZA 5IB9A 1S7FA 2GE3A 2GIVA 4MRIA 5HMNA 2PR1A 4RN7A 4MFPA 4PPZA 3F5BA 2O28A 3CXPA 1Y7EA 4P4EA 4B10A 1LCPA 2PC1A 2ZW6A 2CF4A 2RFHA 3TT2A 4LUAA 1S3ZA 4CRZB 1ELLP 3KHXA 1MJAA 1CBXA 1S7NA 2DEAA 5EC4A 5CPAA 2ZOFA 4MMOA 1XMBA 4Z65A 3PEIA 1ZLIA 2C6PA 4J3GA 1P4NA 4FAIA 3NH8A 2PE3A 4A95A 3DDDA 3IO1A 4P45A 4MFKA 4C7HA 3SJEA 4R7MA 3SJGA 2F5IA 2Z3KA 2JEWA 2PRBA 5K8NA 2ZEFA 3TOBA 4R76A 3GY9A 4R6TA 4I49A 2G3TA 3RO0A 3K9TA 3CXQA 2XEGA 3D3SA 5E96A 2A4NA 4KOVA 2Z3OA 3FIXA 3S6FA 2ZW7A 4LX9A 1Y9KA 2ZELA 4UCNA 3SI1A 4WJBA 3VATA 4A39A 4F6AA 1RXTA 4MI4A 4XNHB 5AG6A 4A37A 1LAMA 2CTBA 2J8RA 4KSAA 1ARMA 3IWGA 4OIDA 1S5KA 3GLJA 1IOFA 3PFOA 4M85A 3BI1A 1FY7A 2FE7A 5ELYA 3WC6A 4YFJA 5HXDA 4LQGA 1Y0YA 2XEIA 1R43A 3PP9A 4ORFA 2EUIA 4H6ZA 4NSQA 3SJFA 2VEZA 3SXOA 2IJZA 4DJLA 2AFXA 3CXSA 2ARHA 4M6IA 2V8DA 1XFOA 3GYAA 4NF1A 1V0CA 2F7VA 2GLJA 3MGDA 1VKCA 1Y7RA 3B3WA 3I3GA 4H2KA 1H8LA 2OU2A 4OC5A 4UEEA 4A30A 4DYOA 2BUEA 4CYPA 2FCKA 5A28A 5LYLA 4MHDA 3BXMA 3F0AA 2BSWA 1I21A 4B5OA 5LYFA 4OC2A 4CAXA 3IIBA 2VBQA 1BPNA 2G3AA 2CNTA 4NGQA 4R8FA 1XIXA 2PJ8A 3LMSA 4OADA 4CGNA 1I1DA 3IFEA 3N7ZA 3VARA 3KR4A 4L89A 2OZHA 3C26A 1YK3A 4C2YA 3KKWA 5AG7A 1PCAA 2P0WA 4JZ0A 5G1ZA 3S6KA 3P2HA 3DGVA 1IYKA 4KVOE 4XPDB 4B5PA 4GXHA 3B3SA 3ISZA 3D68A 2ZEOA 3PFEA 4R57A 2AFSA 4NJRA 3IU2A 4ONUA 3DR6A 1XEBA 3CPXA 3EFAA 1B6BA 3HUVA 4MHZA 1AMPA 2ZW4A 3KI9A 2ZEHA 1QSTA 4KOWA 3ZZIA 1ZO0A 4ZBGA 3H4QA 3QAHA 2WYRA 2B3VA 2Q51A 5JQ4A 2AFOA 4PV6A 2ZEMA 3TO9A 3JRUA 1IU8A 4C68A 5KTDA 1VIXA 2X7BA 1X12A 2PRQA 2AFUA 4MFLA 4P4FA 3TFYA 2JBKA 1CG2A 4FD7A 4EWTA 4U5YA 1GYTA 1CP7A 2BOAA 2OB0A 4TWEA 3RBUA 4CYNA 1HEEA 2GLFA 2VQYA 4P44A 5CNPA 2B4BA 2Q04A 1VHOA 3D7HA 5H84A 2QIRA 1ON0A 4QBJA 4P10A
chains in the Genus database with same CATH topology
1NE9A 2CY2A 3TO6A 2WUUA 4KZTA 2WPWA 2EVNA 1IYLA 1M1DA 2JDDA 4XPKA 3W6SA 3T90A 2HV2A 2VZZA 3I9SA 1YVKA 5F46A 3EXNA 3LD2A 1VHSA 1YLEA 4MFZA 4HNXB 2C27A 2OH1A 3R95A 4B14A 4KUAA 4E2AA 2PSWA 5DWMA 5IX3A 2KCWA 2QECA 1Y9WA 2HUZA 1WK4A 4GS4A 4ZGYB 1YVOA 2K5TA 1PU9A 4R87A 4H89A 4CGPA 1S7KA 3FBUA 1M44A 4B12A 1IIDA 3R9EA 1PUAA 3D8PA 3R9GA 2NMTA 4AVAA 4KOXA 3IWEA 4C2XA 4C7IA 3UY5A 4KVME 1Q2CA 4OLLA 3G8WA 4MY3A 1K4JA 5F47A 4AVCA 3TTHA 4OAEA 2CXAA 2YGWA 4HNYB 5EBVA 2YNCA 3TO7A 2Q7BA 3PZJA 1MK4A 4KOUA 3TFYA 1UFHA 5I0CA 5C88A 1MJ9A 1P0HA 4MBUA 4AVBA 3PGPA 5AG5A 2Q4YA 4UFWA 2VXKA 4KOSA 3WR7A 4CAFA 4JLYA 2ZXVA 2RC4A 4KUBA 4M3SA 3R96A 4L8AA 1QSOA 4KSFA 5IB0A 4UBRA 2Q44A 2Z0ZA 2R8VA 3DNSA 1N71A 2J8MA 4IF5A 1YX0A 3GKRA 3EO4A 1B87A 3D2PA 4X5KA 4Q38A 3P2FA 2YNCC 2FT0A 2J8NA 5DWNA 4UCMA 4R3LA 4IUSA 3QB8A 1BO4A 2WSAA 1WWZA 3E0KA 4A31A 2QMLA 4AG7A 5AG4A 2B4DA 3DSBA 3FYNA 4JD6A 2Q4VA 4CYQA 4NXYA 4UWJA 4KS9A 4UWIA 3SXNA 1CJWA 1YR0A 4CGMA 3TCVA 3OWCA 1M4IA 2WPXA 4UFXA 1BOBA 2Z10A 2REEA 4MY0A 1U6MA 4HNWB 4FD6A 4XNHC 1Z4RA 2R98A 3A9LA 3BJ8A 4B13A 4JXQA 2DXQA 4CGOA 2B3UA 4YGOA 5A27A 4CYOA 1KUVA 2CNMA 2Z3PA 4H6UA 3S6HA 5J8FA 2B58A 5KTCA 4QVTA 2BL1A 4XPDC 3BJ7A 2P6GA 4Q36A 4FD4A 2FL4A 4DNCA 3R9FA 1S60A 4KOYA 2Z3MA 4NEXA 1M4DA 3FRMA 4MFJA 3JTKA 1Z4EA 3D2MA 5IV0A 5JPHA 2ZPAA 1SQHA 3VWEA 2JDCA 4PK3A 4KORA 4KLVA 3K9UA 2CNSA 3SHPA 4R9MA 2FS5A 4PSXA 2R1IA 3W6XA 4AG9A 1YGHA 1IICA 1KUXA 4II9A 4MFQA 4UCPA 3T9YA 2VZYA 1GHEA 1S7LA 4F0XA 5ISVA 1Q2YA 3JVNA 4F0YA 2AJ6A 2Z3LA 4A2ZA 4EVYA 2PDOA 4BMHA 3V8IA 1NMTA 2BEIA 5F49A 1IB1E 1KUYA 2OZGA 2G0BA 2FIWA 1I12A 4E8OA 2REFA 4MJ8A 5G21A 1L0CA 4QB9A 2OZUA 1RO5A 2P6EA 2Z11A 5G22A 5G20A 3FB3A 4R3KA 2ATRA 1J4JA 5H86A 3TOAA 5GCNA 2JEVA 2B5GA 4KVXA 5AGEA 2D4PA 1QSNA 4CRYB 3IU1A 4CS0B 2I00A 2PQ8A 4B5PB 2IL4A 4E0AA 3LODA 3EC4A 4PK2A 4CGLA 4U9ZA 2D4OA 3W91A 3IGRA 1XMTA 2PR8A 1OZPA 2FIAA 5KTAA 5F48A 3ZJ0A 2P6FA 3FXTA 3TE4A 1CM0A 3NE7A 1XE4A 4A33A 3FNCA 4NCZA 2Y0MA 2R7HA 1YREA 2VI7A 4CAEA 4KOTA 4CAVA 2FXFA 4AB7A 2AE6A 3DR8A 2JLMA 1TIQA 3EY5A 4UA3A 1LRZA 5J8CA 2Q0YA 3B8GA 3F8KA 2YNEA 3BLNA 1QSRA 2YNDA 4B11A 5C82A 4JJXA 2I79A 4HKFA 3S6GA 2DPTA 4C2ZA 2DPSA 5FVJA 4JWPA 4XPLA 5BWAB 4QC6A 1MJBA 4JXRA 4QUSA 2Z3NA 4KLWA 5HH1A 2FSRA 4A32A 4PSWA 3H5ZA 1Z9UA 3RYOA 4BBHA 4RI1A 1QSMA 3JUWA 4K30A 2B4DB 2HQYA 2GANA 1Q2DA 2H5MA 4UFVA 1NSLA 4YRHA 4CAWA 4RS2A 3G3SA 4U9YA 1R57A 1KZFA 4FD5A 4Y49C 1M4GA 3VWDA 1XF8A 3R1KA 2ZW5A 2B5GB 1S7FA 2GE3A 2GIVA 5HMNA 2PR1A 4MFPA 3F5BA 2O28A 3CXPA 4B10A 2PC1A 2ZW6A 3TT2A 4LUAA 1S3ZA 4CRZB 1MJAA 1S7NA 5EC4A 4J3GA 1P4NA 4A95A 3DDDA 4MFKA 4C7HA 2F5IA 2Z3KA 2PRBA 3TOBA 3GY9A 4I49A 2G3TA 3CXQA 3D3SA 5E96A 2A4NA 4KOVA 2Z3OA 3FIXA 3S6FA 2ZW7A 4LX9A 1Y9KA 4UCNA 4F6AA 1RXTA 4MI4A 4XNHB 5AG6A 2J8RA 4KSAA 3IWGA 1S5KA 4M85A 4YFJA 1FY7A 2FE7A 3PP9A 4ORFA 2EUIA 4H6ZA 4NSQA 2VEZA 3SXOA 3CXSA 2ARHA 4NF1A 3GYAA 1ON0A 1V0CA 4Y49B 3MGDA 1VKCA 1Y7RA 3I3GA 2OU2A 4A30A 2BUEA 4CYPA 2FCKA 5A28A 4MHDA 3F0AA 2BSWA 1I21A 4B5OA 4CAXA 2VBQA 2G3AA 2CNTA 1XIXA 4OADA 4CGNA 1I1DA 3N7ZA 4L89A 2OZHA 3C26A 1YK3A 4C2YA 3KKWA 5AG7A 2P0WA 5G1ZA 3S6KA 3P2HA 1IYKA 4KVOE 4XPDB 4B5PA 4R57A 3IU2A 4ONUA 3DR6A 1XEBA 3EFAA 1B6BA 2ZW4A 1QSTA 4KOWA 3ZZIA 1ZO0A 4ZBGA 3QAHA 2B3VA 5JQ4A 4PV6A 3TO9A 4C68A 5KTDA 2X7BA 4MFLA 4FD7A 4U5YA 2OB0A 4CYNA 2VQYA 5CNPA 2B4BA 2Q04A 5H84A 2QIRA 3H4QA 4QBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE9 A;  2CY2 A;  3TO6 A;  4KZT A;  2WPW A;  2EVN A;  1IYL A;  1M1D A;  2JDD A;  4XPK A;  3W6S A;  3T90 A;  2HV2 A;  2VZZ A;  3I9S A;  1YVK A;  5F46 A;  3EXN A;  3LD2 A;  1VHS A;  1YLE A;  4HNX B;  2C27 A;  2OH1 A;  3R95 A;  4KUA A;  4E2A A;  2PSW A;  5DWM A;  5IX3 A;  2KCW A;  2QEC A;  1Y9W A;  2HUZ A;  1WK4 A;  4GS4 A;  1YVO A;  2K5T A;  1PU9 A;  4R87 A;  4H89 A;  1S7K A;  3FBU A;  1M44 A;  1IID A;  3R9E A;  1PUA A;  3D8P A;  3R9G A;  2NMT A;  4AVA A;  4KOX A;  3UY5 A;  4KVM E;  1Q2C A;  4OLL A;  3G8W A;  4MY3 A;  1K4J A;  5F47 A;  4AVC A;  3TTH A;  4OAE A;  4HNY B;  5EBV A;  3TO7 A;  2Q7B A;  3PZJ A;  1MK4 A;  4KOU A;  3TFY A;  1UFH A;  5I0C A;  5C88 A;  1MJ9 A;  1P0H A;  4MBU A;  4AVB A;  3PGP A;  2Q4Y A;  2VXK A;  4KOS A;  3WR7 A;  4JLY A;  2ZXV A;  2RC4 A;  4KUB A;  4M3S A;  3R96 A;  4L8A A;  1QSO A;  5IB0 A;  4UBR A;  2Q44 A;  2Z0Z A;  2R8V A;  3DNS A;  1N71 A;  2J8M A;  4IF5 A;  1YX0 A;  3GKR A;  3EO4 A;  1B87 A;  3D2P A;  4X5K A;  3P2F A;  2FT0 A;  2J8N A;  5DWN A;  4R3L A;  4IUS A;  3QB8 A;  1BO4 A;  1WWZ A;  3E0K A;  2QML A;  4AG7 A;  2B4D A;  3DSB A;  3FYN A;  4JD6 A;  2Q4V A;  4NXY A;  4UWJ A;  4UWI A;  3SXN A;  1CJW A;  1YR0 A;  3TCV A;  3OWC A;  1M4I A;  2WPX A;  1BOB A;  2Z10 A;  2REE A;  4MY0 A;  1U6M A;  4HNW B;  4FD6 A;  4XNH C;  1Z4R A;  2R98 A;  3BJ8 A;  4JXQ A;  2DXQ A;  2B3U A;  4YGO A;  1KUV A;  2CNM A;  4H6U A;  5J8F A;  3S6H A;  5KTC A;  2B58 A;  4QVT A;  2BL1 A;  4XPD C;  3BJ7 A;  2P6G A;  4FD4 A;  2FL4 A;  4DNC A;  3R9F A;  1S60 A;  4KOY A;  4NEX A;  1M4D A;  3FRM A;  1Z4E A;  3D2M A;  5IV0 A;  5JPH A;  2ZPA A;  1SQH A;  3VWE A;  2JDC A;  4PK3 A;  4KOR A;  4KLV A;  3K9U A;  2CNS A;  3SHP A;  4R9M A;  2FS5 A;  4PSX A;  2R1I A;  3W6X A;  4AG9 A;  1YGH A;  1IIC A;  1KUX A;  4II9 A;  3T9Y A;  2VZY A;  1GHE A;  1S7L A;  5ISV A;  1Q2Y A;  3JVN A;  4F0Y A;  2AJ6 A;  4EVY A;  2PDO A;  4BMH A;  3V8I A;  1NMT A;  2BEI A;  5F49 A;  1IB1 E;  1KUY A;  2OZG A;  2G0B A;  2FIW A;  1I12 A;  4E8O A;  2REF A;  4MJ8 A;  1L0C A;  4QB9 A;  2OZU A;  1RO5 A;  2P6E A;  2Z11 A;  3FB3 A;  4R3K A;  2ATR A;  1J4J A;  5H86 A;  3TOA A;  5GCN A;  2JEV A;  2B5G A;  4KVX A;  2D4P A;  1QSN A;  4CRY B;  4CS0 B;  2I00 A;  2PQ8 A;  4B5P B;  2IL4 A;  4E0A A;  3LOD A;  3EC4 A;  4PK2 A;  4U9Z A;  2D4O A;  3W91 A;  3IGR A;  1XMT A;  2PR8 A;  1OZP A;  2FIA A;  5KTA A;  5F48 A;  3ZJ0 A;  2P6F A;  3FXT A;  3TE4 A;  1CM0 A;  3NE7 A;  1XE4 A;  3FNC A;  4NCZ A;  2Y0M A;  2R7H A;  1YRE A;  2VI7 A;  4KOT A;  4CAV A;  2FXF A;  4AB7 A;  2AE6 A;  3DR8 A;  2JLM A;  1TIQ A;  3EY5 A;  4UA3 A;  1LRZ A;  5J8C A;  2Q0Y A;  3B8G A;  3F8K A;  3BLN A;  1QSR A;  5C82 A;  4JJX A;  2I79 A;  4HKF A;  3S6G A;  5FVJ A;  4JWP A;  4XPL A;  4QC6 A;  1MJB A;  4JXR A;  4QUS A;  4KLW A;  5HH1 A;  2FSR A;  4PSW A;  1Z9U A;  3RYO A;  4RI1 A;  1QSM A;  3JUW A;  4K30 A;  2B4D B;  2HQY A;  2GAN A;  1Q2D A;  2H5M A;  1NSL A;  4YRH A;  4CAW A;  4RS2 A;  3G3S A;  4U9Y A;  1R57 A;  1KZF A;  4FD5 A;  4Y49 C;  1M4G A;  3VWD A;  1XF8 A;  3R1K A;  2ZW5 A;  2B5G B;  1S7F A;  2GE3 A;  2GIV A;  5HMN A;  2PR1 A;  3F5B A;  2O28 A;  3CXP A;  2PC1 A;  2ZW6 A;  3TT2 A;  4LUA A;  1S3Z A;  4CRZ B;  1MJA A;  1S7N A;  5EC4 A;  4J3G A;  1P4N A;  3DDD A;  2F5I A;  2PRB A;  3TOB A;  3GY9 A;  4I49 A;  2G3T A;  3CXQ A;  3D3S A;  5E96 A;  2A4N A;  4KOV A;  3FIX A;  3S6F A;  2ZW7 A;  4LX9 A;  1Y9K A;  4F6A A;  1RXT A;  4MI4 A;  4XNH B;  2J8R A;  3IWG A;  1S5K A;  4M85 A;  4YFJ A;  1FY7 A;  2FE7 A;  3PP9 A;  4ORF A;  4NSQ A;  2EUI A;  4H6Z A;  2VEZ A;  3SXO A;  3CXS A;  2ARH A;  4NF1 A;  3GYA A;  1ON0 A;  1V0C A;  4Y49 B;  3MGD A;  1VKC A;  1Y7R A;  3I3G A;  2OU2 A;  2BUE A;  2FCK A;  4MHD A;  3F0A A;  2BSW A;  1I21 A;  4B5O A;  4CAX A;  2VBQ A;  2G3A A;  2CNT A;  1XIX A;  4OAD A;  1I1D A;  3N7Z A;  4L89 A;  2OZH A;  3C26 A;  1YK3 A;  3KKW A;  2P0W A;  3S6K A;  3P2H A;  1IYK A;  4KVO E;  4XPD B;  4B5P A;  4R57 A;  4ONU A;  3DR6 A;  1XEB A;  3EFA A;  1B6B A;  2ZW4 A;  1QST A;  4KOW A;  3ZZI A;  4ZBG A;  3QAH A;  2B3V A;  5JQ4 A;  4PV6 A;  3TO9 A;  5KTD A;  2X7B A;  4FD7 A;  4U5Y A;  2OB0 A;  2VQY A;  5CNP A;  2B4B A;  2Q04 A;  5H84 A;  2QIR A;  3H4Q A;  4QBJ A; 
#chains in the Genus database with same CATH topology
 1NE9 A;  2CY2 A;  1JQG A;  1CX8 A;  8CPA A;  4F9U A;  2HB6 A;  2WUU A;  3TO6 A;  4KZT A;  2WPW A;  2PCU A;  3NH5 A;  2EVN A;  1IYL A;  4OIW A;  1M1D A;  2JDD A;  4XPK A;  3W6S A;  1NSA A;  2V77 A;  4TNU A;  2HV2 A;  2VZZ A;  3FEC A;  3T90 A;  4ZI6 A;  3I9S A;  2NYQ A;  1YVK A;  3NE8 A;  4OC0 A;  5F46 A;  2GRE A;  5K8O A;  3EXN A;  2ZOG A;  4F8Z A;  4NGP A;  3FX6 A;  2NSM A;  3LD2 A;  1VHS A;  1YLE A;  4A38 A;  2V8H A;  4MFZ A;  5LYD A;  5LRK A;  4MHY A;  3B3V A;  4HNX B;  2ZEP A;  2C27 A;  2OH1 A;  3R95 A;  4B14 A;  1F2P A;  2EK8 A;  3GIU A;  4KUA A;  4E2A A;  4EFD A;  2PSW A;  2FVG A;  4P4I A;  5DWM A;  5IX3 A;  3K2K A;  2KCW A;  4JYW A;  2PJ0 A;  2QEC A;  3V7Z A;  1Y9W A;  2HUZ A;  1WK4 A;  4GS4 A;  4OC4 A;  4NGT A;  4ZGY B;  1YVO A;  2K5T A;  1PU9 A;  4R87 A;  4H89 A;  4CGP A;  4DUK A;  3PB6 X;  1S7K A;  1YW4 A;  4UF4 A;  3FBU A;  1M44 A;  3CDX A;  4PXD A;  4B12 A;  4MHN A;  1IID A;  3R9E A;  1PUA A;  2AFM A;  3D8P A;  1IY7 A;  2NMT A;  3R9G A;  4AVA A;  5I4M A;  4KOX A;  3IWE A;  4C2X A;  4X2T A;  1TKJ A;  4C7I A;  3UY5 A;  4KVM E;  1ARL A;  2EK9 A;  5K8M A;  2ZEE A;  1Q2C A;  1UWY A;  4NGN A;  4OLL A;  3G8W A;  2PIY A;  4G1P A;  4MY3 A;  1K4J A;  5F47 A;  5CBM A;  4AVC A;  2PVV A;  4NGM A;  3TTH A;  4OAE A;  2CIJ A;  4PXC A;  2CXA A;  2ODF A;  2GU2 A;  2YGW A;  4HNY B;  5EBV A;  5HVF A;  2YNC A;  4UEZ A;  2AFZ A;  3N5F A;  4BD9 A;  3TO7 A;  5JGF A;  2PIZ A;  2OOT A;  2Q7B A;  3PZJ A;  1MK4 A;  4KOU A;  4AXV A;  2BCO A;  1UFH A;  2V8V A;  1QQ9 A;  4MXU A;  3SI2 A;  5C88 A;  5I0C A;  1MJ9 A;  1P0H A;  4LQ6 A;  4ZY2 A;  4NGR A;  1RTQ A;  4MBU A;  2VL1 A;  4K3N A;  4PQA A;  2QVP A;  4AVB A;  7CPA A;  3PGP A;  5AG5 A;  3RNZ A;  1FT7 A;  2Q4Y A;  1AYE A;  4UFW A;  2VXK A;  1LAN A;  4KOS A;  3WR7 A;  4CAF A;  4JLY A;  4OME A;  3RAM A;  1IOI A;  2ZXV A;  2RC4 A;  4MCP A;  4KUB A;  1PYT B;  4M3S A;  3KAS A;  4L8A A;  2ZEG A;  1QSO A;  3R96 A;  3RZA A;  3GB0 A;  4KSF A;  1Z5R A;  4UBR A;  3WAB A;  4M6H A;  5IB0 A;  1XBU A;  4A94 A;  2Q44 A;  2Z0Z A;  2R8V A;  1BPM A;  3DNS A;  2OR4 A;  1N71 A;  2J8M A;  1HDU A;  4IF5 A;  1JWQ A;  3PBB A;  1YX0 A;  5D29 A;  3GKR A;  4FBE A;  2PJ4 A;  3EO4 A;  3CT9 A;  3KGQ A;  1ELM P;  2C1C A;  1F57 A;  5JH9 A;  2Q43 A;  1B87 A;  3D2P A;  4X5K A;  3CPA A;  3PB7 X;  2YNC C;  3IJ3 A;  3P2F A;  4Q38 A;  2FT0 A;  2J8N A;  1TKH A;  5DWN A;  4UCM A;  4R3L A;  2G9D A;  4IUS A;  4EME A;  3QB8 A;  4ZYQ A;  1BO4 A;  2WSA A;  1WWZ A;  3S9L A;  2PVW A;  2Q4Z A;  3E0K A;  4MHP A;  4A31 A;  2QML A;  4AG7 A;  5J1Q A;  2IMO A;  5AG4 A;  2B4D A;  3HLP A;  3DSB A;  3FYN A;  4JD6 A;  5HVH A;  2Q4V A;  4CYQ A;  4MCR A;  4NXY A;  4UWJ A;  2J9A A;  4KS9 A;  1TKF A;  4UWI A;  3SXN A;  1CJW A;  1YR0 A;  4WWV A;  4CGM A;  1QMU A;  3CZX A;  5DS0 A;  1A2Z A;  3TCV A;  3B2Y A;  3OWC A;  1M4I A;  1YW6 A;  2WPX A;  3NH4 A;  2GFQ A;  4UFX A;  4PXB A;  4F9V A;  1BOB A;  2Z10 A;  5LYI A;  2REE A;  3I1U A;  4MY0 A;  1U6M A;  5LRG A;  4HNW B;  4FD6 A;  4XNH C;  1DTD A;  1Y0R A;  1Z4R A;  2R98 A;  2PJ9 A;  3A9L A;  3BJ8 A;  4MCQ A;  4B13 A;  1X10 A;  3KL9 A;  5F09 A;  3PBE A;  3WC7 A;  1AUG A;  4MCS A;  4JXQ A;  2DXQ A;  4CGO A;  1IGB A;  2B3U A;  4YGO A;  5A27 A;  3QAY A;  4CYO A;  1KUV A;  2CNM A;  2Z3P A;  3IEH A;  4H6U A;  3S6H A;  2B58 A;  5J8F A;  5KTC A;  1ZG7 A;  4QVT A;  2BL1 A;  4XPD C;  3D66 A;  1VGY A;  3BJ7 A;  2P6G A;  4UIA A;  2PJ1 A;  1EE3 P;  4Q36 A;  3D7F A;  4FD4 A;  2FL4 A;  4DNC A;  3R9F A;  1S60 A;  1XRY A;  3B3T A;  4KOY A;  4KSI A;  2RB7 A;  2Z3M A;  4NEX A;  5HVG A;  2PJ5 A;  3D7D A;  1M4D A;  3FRM A;  4MFJ A;  5LRJ A;  3TX8 A;  3JTK A;  2JBJ A;  1Z4E A;  2O53 A;  3WT4 A;  3D2M A;  4NGS A;  5IV0 A;  5JPH A;  2ZPA A;  1VHE A;  1SQH A;  3VWE A;  2JDC A;  2BO9 A;  2PJC A;  4PK3 A;  4KOR A;  4KLV A;  3K9U A;  3ISX A;  4IHM A;  2XEF A;  1Z8T A;  3GUX A;  2CNS A;  4NFR A;  1Z2L A;  3SHP A;  4FUU A;  2FS5 A;  3FEE A;  4R9M A;  4PSX A;  2R1I A;  4FWU A;  3W6X A;  1YGH A;  4AG9 A;  1TXR A;  1IIC A;  1KUX A;  1F2O A;  3NA6 A;  4II9 A;  4MFQ A;  4UCP A;  4P6Y A;  3T9Y A;  2V8G A;  2VZY A;  1GHE A;  1S7L A;  3PB9 X;  3T8W A;  4F0X A;  5ISV A;  1Q2Y A;  3D7G A;  1XJO A;  3JVN A;  2AJ6 A;  2Z3L A;  4A2Z A;  4F0Y A;  4EVY A;  1BLL E;  2PDO A;  5THW A;  4BMH A;  4O23 A;  2PJA A;  4P4D A;  3V8I A;  4Q7A A;  1NMT A;  2BEI A;  2XEJ A;  5F49 A;  4RUH A;  3S9N A;  2ABZ A;  1IB1 E;  1OBR A;  2PJ2 A;  1KUY A;  2OZG A;  1LAP A;  2G0B A;  4UEF A;  2O4H A;  2FIW A;  5EMI A;  1I12 A;  4E8O A;  2REF A;  4MJ8 A;  3FH4 A;  4ONW A;  5G21 A;  2QJ8 A;  1L0C A;  2POK A;  4QB9 A;  2OZU A;  4YWY A;  4BIN A;  2QYV A;  4ZY0 A;  1RO5 A;  2P6E A;  2Z11 A;  5G22 A;  4X8I A;  5G20 A;  3SI0 A;  3FB3 A;  4IAV A;  3FJU A;  4R3K A;  2ATR A;  1CPS A;  4Y49 B;  4OC1 A;  1J4J A;  1YME A;  4OP4 A;  6CPA A;  5H86 A;  3B7I A;  3IWW A;  2PJB A;  3TOA A;  5GCN A;  2JEV A;  2B5G A;  4KVX A;  5AGE A;  3PB4 X;  2D4P A;  1M4L A;  1QSN A;  4CRY B;  3IU1 A;  4CS0 B;  3DLJ A;  2CTC A;  2I00 A;  2PQ8 A;  4B5P B;  2IL4 A;  4E0A A;  3LAC A;  3VH9 A;  3LOD A;  3EC4 A;  4PK2 A;  2C6C A;  4IK2 A;  4U9Z A;  4CGL A;  2D4O A;  4P4J A;  5K8P A;  3W91 A;  3IGR A;  3D4U A;  1Z8X A;  1XMT A;  2PR8 A;  1OZP A;  3B35 A;  3SJX A;  2FIA A;  2ZED A;  1TF9 A;  2ZEN A;  3PB8 X;  5KTA A;  5F48 A;  3FMC A;  3ZJ0 A;  2P6F A;  4P4B A;  3FXT A;  2C6G A;  3TE4 A;  1CM0 A;  3NE7 A;  1XE4 A;  2IQ6 A;  4HPS A;  4A33 A;  3FNC A;  4NCZ A;  2Y0M A;  3NFZ A;  2R7H A;  1YRE A;  1ZLH A;  2VI7 A;  4UIB A;  4CAE A;  4KOT A;  4CPA A;  3BHX A;  4CAV A;  5JM6 A;  3H8G A;  2FXF A;  5D8N A;  4AB7 A;  4YU9 A;  1BAV A;  2AE6 A;  3DR8 A;  2JLM A;  1TIQ A;  3EY5 A;  4UA3 A;  1LRZ A;  3D67 A;  5J8C A;  2Q0Y A;  3B8G A;  4NJQ A;  4PXE A;  3F8K A;  1DE4 C;  3KR5 A;  2AFW A;  2YNE A;  3BLN A;  3PRT A;  1LOK A;  1QSR A;  2YND A;  4B11 A;  5C82 A;  1LFW A;  3FVL A;  4W9Y A;  4JJX A;  4ZX9 A;  2I79 A;  2WZN A;  4HKF A;  1R3N A;  2ANP A;  3S6G A;  4OC3 A;  2DPT A;  4C2Z A;  2DF5 A;  3KQZ A;  2DPS A;  1FNO A;  4ZY1 A;  2PJ6 A;  1KWM A;  4M6G A;  5FVJ A;  4JWP A;  4XPL A;  5BWA B;  4QC6 A;  1MJB A;  1XOV A;  2PJ3 A;  3B3C A;  3TC8 A;  3MN8 A;  4JXR A;  4QUS A;  1Q7L A;  1ZG8 A;  2Z3N A;  4KLW A;  1YSJ A;  2I3C A;  2F8H A;  5HH1 A;  3H8F A;  2FSR A;  2HC9 A;  3LWU A;  4PSW A;  4A32 A;  1CPX A;  3WC5 A;  3H5Z A;  1Z9U A;  3RYO A;  4B6Z A;  4X3R A;  4OKO A;  2EO8 A;  1Z8L A;  1YQE A;  1ZG9 A;  4RI1 A;  1QSM A;  3FF3 A;  3JUW A;  4BBH A;  3KQX A;  2EBJ A;  4K30 A;  2EWB A;  2B4D B;  2HQY A;  2GAN A;  1Q2D A;  3MRU A;  3L2N A;  2H5M A;  4UFV A;  1NSL A;  4YRH A;  4CAW A;  3KZW A;  3QNV A;  2PJ7 A;  1CP6 A;  3S9M A;  3FED A;  1TF8 A;  4RS2 A;  4GM5 A;  3G3S A;  4U9Y A;  4ZX8 A;  3V38 A;  1R57 A;  1YLO A;  2Q7S A;  1KZF A;  4FD5 A;  3BI0 A;  4Y49 C;  1M4G A;  3VWD A;  1XF8 A;  3H8E A;  3R1K A;  1HDQ A;  2ZW5 A;  1Z8W A;  2B5G B;  3IC1 A;  3KHZ A;  5IB9 A;  1S7F A;  2GE3 A;  2GIV A;  4MRI A;  5HMN A;  2PR1 A;  4RN7 A;  4MFP A;  4PPZ A;  3F5B A;  2O28 A;  3CXP A;  1Y7E A;  4P4E A;  4B10 A;  1LCP A;  2PC1 A;  2ZW6 A;  2CF4 A;  2RFH A;  3TT2 A;  4LUA A;  1S3Z A;  4CRZ B;  1ELL P;  3KHX A;  1MJA A;  1CBX A;  1S7N A;  2DEA A;  5EC4 A;  5CPA A;  2ZOF A;  4MMO A;  1XMB A;  4Z65 A;  3PEI A;  1ZLI A;  2C6P A;  4J3G A;  1P4N A;  4FAI A;  3NH8 A;  2PE3 A;  4A95 A;  3DDD A;  3IO1 A;  4P45 A;  4MFK A;  4C7H A;  3SJE A;  4R7M A;  3SJG A;  2F5I A;  2Z3K A;  2JEW A;  2PRB A;  5K8N A;  2ZEF A;  3TOB A;  4R76 A;  3GY9 A;  4R6T A;  4I49 A;  2G3T A;  3RO0 A;  3K9T A;  3CXQ A;  2XEG A;  3D3S A;  5E96 A;  2A4N A;  4KOV A;  2Z3O A;  3FIX A;  3S6F A;  2ZW7 A;  4LX9 A;  1Y9K A;  2ZEL A;  4UCN A;  3SI1 A;  4WJB A;  3VAT A;  4A39 A;  4F6A A;  1RXT A;  4MI4 A;  4XNH B;  5AG6 A;  4A37 A;  1LAM A;  2CTB A;  2J8R A;  4KSA A;  1ARM A;  3IWG A;  4OID A;  1S5K A;  3GLJ A;  1IOF A;  3PFO A;  4M85 A;  3BI1 A;  1FY7 A;  2FE7 A;  5ELY A;  3WC6 A;  4YFJ A;  5HXD A;  4LQG A;  1Y0Y A;  2XEI A;  1R43 A;  3PP9 A;  4ORF A;  2EUI A;  4H6Z A;  4NSQ A;  3SJF A;  2VEZ A;  3SXO A;  2IJZ A;  4DJL A;  2AFX A;  3CXS A;  2ARH A;  4M6I A;  2V8D A;  1XFO A;  3GYA A;  4NF1 A;  1V0C A;  2F7V A;  2GLJ A;  3MGD A;  1VKC A;  1Y7R A;  3B3W A;  3I3G A;  4H2K A;  1H8L A;  2OU2 A;  4OC5 A;  4UEE A;  4A30 A;  4DYO A;  2BUE A;  4CYP A;  2FCK A;  5A28 A;  5LYL A;  4MHD A;  3BXM A;  3F0A A;  2BSW A;  1I21 A;  4B5O A;  5LYF A;  4OC2 A;  4CAX A;  3IIB A;  2VBQ A;  1BPN A;  2G3A A;  2CNT A;  4NGQ A;  4R8F A;  1XIX A;  2PJ8 A;  3LMS A;  4OAD A;  4CGN A;  1I1D A;  3IFE A;  3N7Z A;  3VAR A;  3KR4 A;  4L89 A;  2OZH A;  3C26 A;  1YK3 A;  4C2Y A;  3KKW A;  5AG7 A;  1PCA A;  2P0W A;  4JZ0 A;  5G1Z A;  3S6K A;  3P2H A;  3DGV A;  1IYK A;  4KVO E;  4XPD B;  4B5P A;  4GXH A;  3B3S A;  3ISZ A;  3D68 A;  2ZEO A;  3PFE A;  4R57 A;  2AFS A;  4NJR A;  3IU2 A;  4ONU A;  3DR6 A;  1XEB A;  3CPX A;  3EFA A;  1B6B A;  3HUV A;  4MHZ A;  1AMP A;  2ZW4 A;  3KI9 A;  2ZEH A;  1QST A;  4KOW A;  3ZZI A;  1ZO0 A;  4ZBG A;  3H4Q A;  3QAH A;  2WYR A;  2B3V A;  2Q51 A;  5JQ4 A;  2AFO A;  4PV6 A;  2ZEM A;  3TO9 A;  3JRU A;  1IU8 A;  4C68 A;  5KTD A;  1VIX A;  2X7B A;  1X12 A;  2PRQ A;  2AFU A;  4MFL A;  4P4F A;  3TFY A;  2JBK A;  1CG2 A;  4FD7 A;  4EWT A;  4U5Y A;  1GYT A;  1CP7 A;  2BOA A;  2OB0 A;  4TWE A;  3RBU A;  4CYN A;  1HEE A;  2GLF A;  2VQY A;  4P44 A;  5CNP A;  2B4B A;  2Q04 A;  1VHO A;  3D7H A;  5H84 A;  2QIR A;  1ON0 A;  4QBJ A;  4P10 A; 
#chains in the Genus database with same CATH homology
 1NE9 A;  2CY2 A;  3TO6 A;  2WUU A;  4KZT A;  2WPW A;  2EVN A;  1IYL A;  1M1D A;  2JDD A;  4XPK A;  3W6S A;  3T90 A;  2HV2 A;  2VZZ A;  3I9S A;  1YVK A;  5F46 A;  3EXN A;  3LD2 A;  1VHS A;  1YLE A;  4MFZ A;  4HNX B;  2C27 A;  2OH1 A;  3R95 A;  4B14 A;  4KUA A;  4E2A A;  2PSW A;  5DWM A;  5IX3 A;  2KCW A;  2QEC A;  1Y9W A;  2HUZ A;  1WK4 A;  4GS4 A;  4ZGY B;  1YVO A;  2K5T A;  1PU9 A;  4R87 A;  4H89 A;  4CGP A;  1S7K A;  3FBU A;  1M44 A;  4B12 A;  1IID A;  3R9E A;  1PUA A;  3D8P A;  3R9G A;  2NMT A;  4AVA A;  4KOX A;  3IWE A;  4C2X A;  4C7I A;  3UY5 A;  4KVM E;  1Q2C A;  4OLL A;  3G8W A;  4MY3 A;  1K4J A;  5F47 A;  4AVC A;  3TTH A;  4OAE A;  2CXA A;  2YGW A;  4HNY B;  5EBV A;  2YNC A;  3TO7 A;  2Q7B A;  3PZJ A;  1MK4 A;  4KOU A;  3TFY A;  1UFH A;  5I0C A;  5C88 A;  1MJ9 A;  1P0H A;  4MBU A;  4AVB A;  3PGP A;  5AG5 A;  2Q4Y A;  4UFW A;  2VXK A;  4KOS A;  3WR7 A;  4CAF A;  4JLY A;  2ZXV A;  2RC4 A;  4KUB A;  4M3S A;  3R96 A;  4L8A A;  1QSO A;  4KSF A;  5IB0 A;  4UBR A;  2Q44 A;  2Z0Z A;  2R8V A;  3DNS A;  1N71 A;  2J8M A;  4IF5 A;  1YX0 A;  3GKR A;  3EO4 A;  1B87 A;  3D2P A;  4X5K A;  4Q38 A;  3P2F A;  2YNC C;  2FT0 A;  2J8N A;  5DWN A;  4UCM A;  4R3L A;  4IUS A;  3QB8 A;  1BO4 A;  2WSA A;  1WWZ A;  3E0K A;  4A31 A;  2QML A;  4AG7 A;  5AG4 A;  2B4D A;  3DSB A;  3FYN A;  4JD6 A;  2Q4V A;  4CYQ A;  4NXY A;  4UWJ A;  4KS9 A;  4UWI A;  3SXN A;  1CJW A;  1YR0 A;  4CGM A;  3TCV A;  3OWC A;  1M4I A;  2WPX A;  4UFX A;  1BOB A;  2Z10 A;  2REE A;  4MY0 A;  1U6M A;  4HNW B;  4FD6 A;  4XNH C;  1Z4R A;  2R98 A;  3A9L A;  3BJ8 A;  4B13 A;  4JXQ A;  2DXQ A;  4CGO A;  2B3U A;  4YGO A;  5A27 A;  4CYO A;  1KUV A;  2CNM A;  2Z3P A;  4H6U A;  3S6H A;  5J8F A;  2B58 A;  5KTC A;  4QVT A;  2BL1 A;  4XPD C;  3BJ7 A;  2P6G A;  4Q36 A;  4FD4 A;  2FL4 A;  4DNC A;  3R9F A;  1S60 A;  4KOY A;  2Z3M A;  4NEX A;  1M4D A;  3FRM A;  4MFJ A;  3JTK A;  1Z4E A;  3D2M A;  5IV0 A;  5JPH A;  2ZPA A;  1SQH A;  3VWE A;  2JDC A;  4PK3 A;  4KOR A;  4KLV A;  3K9U A;  2CNS A;  3SHP A;  4R9M A;  2FS5 A;  4PSX A;  2R1I A;  3W6X A;  4AG9 A;  1YGH A;  1IIC A;  1KUX A;  4II9 A;  4MFQ A;  4UCP A;  3T9Y A;  2VZY A;  1GHE A;  1S7L A;  4F0X A;  5ISV A;  1Q2Y A;  3JVN A;  4F0Y A;  2AJ6 A;  2Z3L A;  4A2Z A;  4EVY A;  2PDO A;  4BMH A;  3V8I A;  1NMT A;  2BEI A;  5F49 A;  1IB1 E;  1KUY A;  2OZG A;  2G0B A;  2FIW A;  1I12 A;  4E8O A;  2REF A;  4MJ8 A;  5G21 A;  1L0C A;  4QB9 A;  2OZU A;  1RO5 A;  2P6E A;  2Z11 A;  5G22 A;  5G20 A;  3FB3 A;  4R3K A;  2ATR A;  1J4J A;  5H86 A;  3TOA A;  5GCN A;  2JEV A;  2B5G A;  4KVX A;  5AGE A;  2D4P A;  1QSN A;  4CRY B;  3IU1 A;  4CS0 B;  2I00 A;  2PQ8 A;  4B5P B;  2IL4 A;  4E0A A;  3LOD A;  3EC4 A;  4PK2 A;  4CGL A;  4U9Z A;  2D4O A;  3W91 A;  3IGR A;  1XMT A;  2PR8 A;  1OZP A;  2FIA A;  5KTA A;  5F48 A;  3ZJ0 A;  2P6F A;  3FXT A;  3TE4 A;  1CM0 A;  3NE7 A;  1XE4 A;  4A33 A;  3FNC A;  4NCZ A;  2Y0M A;  2R7H A;  1YRE A;  2VI7 A;  4CAE A;  4KOT A;  4CAV A;  2FXF A;  4AB7 A;  2AE6 A;  3DR8 A;  2JLM A;  1TIQ A;  3EY5 A;  4UA3 A;  1LRZ A;  5J8C A;  2Q0Y A;  3B8G A;  3F8K A;  2YNE A;  3BLN A;  1QSR A;  2YND A;  4B11 A;  5C82 A;  4JJX A;  2I79 A;  4HKF A;  3S6G A;  2DPT A;  4C2Z A;  2DPS A;  5FVJ A;  4JWP A;  4XPL A;  5BWA B;  4QC6 A;  1MJB A;  4JXR A;  4QUS A;  2Z3N A;  4KLW A;  5HH1 A;  2FSR A;  4A32 A;  4PSW A;  3H5Z A;  1Z9U A;  3RYO A;  4BBH A;  4RI1 A;  1QSM A;  3JUW A;  4K30 A;  2B4D B;  2HQY A;  2GAN A;  1Q2D A;  2H5M A;  4UFV A;  1NSL A;  4YRH A;  4CAW A;  4RS2 A;  3G3S A;  4U9Y A;  1R57 A;  1KZF A;  4FD5 A;  4Y49 C;  1M4G A;  3VWD A;  1XF8 A;  3R1K A;  2ZW5 A;  2B5G B;  1S7F A;  2GE3 A;  2GIV A;  5HMN A;  2PR1 A;  4MFP A;  3F5B A;  2O28 A;  3CXP A;  4B10 A;  2PC1 A;  2ZW6 A;  3TT2 A;  4LUA A;  1S3Z A;  4CRZ B;  1MJA A;  1S7N A;  5EC4 A;  4J3G A;  1P4N A;  4A95 A;  3DDD A;  4MFK A;  4C7H A;  2F5I A;  2Z3K A;  2PRB A;  3TOB A;  3GY9 A;  4I49 A;  2G3T A;  3CXQ A;  3D3S A;  5E96 A;  2A4N A;  4KOV A;  2Z3O A;  3FIX A;  3S6F A;  2ZW7 A;  4LX9 A;  1Y9K A;  4UCN A;  4F6A A;  1RXT A;  4MI4 A;  4XNH B;  5AG6 A;  2J8R A;  4KSA A;  3IWG A;  1S5K A;  4M85 A;  4YFJ A;  1FY7 A;  2FE7 A;  3PP9 A;  4ORF A;  2EUI A;  4H6Z A;  4NSQ A;  2VEZ A;  3SXO A;  3CXS A;  2ARH A;  4NF1 A;  3GYA A;  1ON0 A;  1V0C A;  4Y49 B;  3MGD A;  1VKC A;  1Y7R A;  3I3G A;  2OU2 A;  4A30 A;  2BUE A;  4CYP A;  2FCK A;  5A28 A;  4MHD A;  3F0A A;  2BSW A;  1I21 A;  4B5O A;  4CAX A;  2VBQ A;  2G3A A;  2CNT A;  1XIX A;  4OAD A;  4CGN A;  1I1D A;  3N7Z A;  4L89 A;  2OZH A;  3C26 A;  1YK3 A;  4C2Y A;  3KKW A;  5AG7 A;  2P0W A;  5G1Z A;  3S6K A;  3P2H A;  1IYK A;  4KVO E;  4XPD B;  4B5P A;  4R57 A;  3IU2 A;  4ONU A;  3DR6 A;  1XEB A;  3EFA A;  1B6B A;  2ZW4 A;  1QST A;  4KOW A;  3ZZI A;  1ZO0 A;  4ZBG A;  3QAH A;  2B3V A;  5JQ4 A;  4PV6 A;  3TO9 A;  4C68 A;  5KTD A;  2X7B A;  4MFL A;  4FD7 A;  4U5Y A;  2OB0 A;  4CYN A;  2VQY A;  5CNP A;  2B4B A;  2Q04 A;  5H84 A;  2QIR A;  3H4Q A;  4QBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...