1XMTA

X-ray structure of gene product from arabidopsis thaliana at1g77540
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative acetyltransferase
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1xmtA00
3G8WA 3TCVA 1XEBA 2PSWA 3R9GA 4EVYA 2GANA 2FT0A 1IB1E 2K5TA 4JD6A 5E96A 3BJ8A 1BO4A 2R7HA 1Z4EA 1GHEA 3JVNA 1R57A 5J8CA 2FXFA 4KOWA 2NMTA 2J8MA 3T9YA 1IICA 1RO5A 3N7ZA 2FS5A 3EFAA 1PUAA 1XF8A 3VWEA 3R1KA 4K30A 4U9ZA 1MJ9A 4II9A 5EBVA 4XPDB 2VI7A 4R87A 4MY0A 3ZJ0A 5IV0A 3RYOA 1KUYA 4HNYB 3TOBA 4UA3A 3QB8A 4IUSA 3GKRA 3BLNA 3DDDA 4KLWA 4AB7A 5JPHA 4H6ZA 2Q44A 1UFHA 5IX3A 4OADA 1PU9A 4PK3A 5H86A 2CNMA 4DNCA 2P6EA 5FVJA 3TO9A 4PK2A 2JEVA 1QSRA 3OWCA 2QIRA 3K9UA 1WWZA 4H6UA 4JLYA 3BJ7A 1KUVA 1CM0A 4KZTA 1U6MA 3CXQA 4E0AA 2B58A 1NSLA 4NSQA 1CJWA 5KTCA 1L0CA 2Q0YA 3ZZIA 4KORA 4KOXA 4NCZA 2FSRA 2I79A 1S7LA 4R3LA 5HMNA 4L89A 2REEA 4J3GA 4AVAA 1S7FA 2VQYA 5DWNA 2FL4A 3H4QA 4IF5A 3NE7A 4JJXA 1WK4A 3P2FA 3LODA 3R9FA 3P2HA 4KOUA 3EC4A 4PSXA 2QMLA 1Z9UA 2A4NA 4AG7A 1Q2YA 3PZJA 4AVCA 1KZFA 1M4IA 4B5OA 2R98A 3TOAA 3DR6A 1N71A 1S7NA 4JWPA 4CRYB 4U9YA 4MY3A 2FIAA 2BSWA 4OLLA 3CXSA 3W91A 3CXPA 1P4NA 4KVOE 3TE4A 4JXRA 3LD2A 2AJ6A 2D4OA 1YVKA 1M1DA 4KVXA 3DSBA 1Y9KA 4FD5A 3TO6A 4MJ8A 5C82A 2B4DA 3FRMA 4Y49C 3EY5A 1S3ZA 2VZYA 3VWDA 4E8OA 4KOTA 2D4PA 5H84A 1B6BA 3PGPA 1YGHA 2WPXA 2ZXVA 1XE4A 1I12A 4ONUA 1Z4RA 3G3SA 4ZBGA 3E0KA 4AG9A 2P0WA 4OAEA 3F5BA 4MHDA 4CAVA 3D2MA 2VZZA 1S60A 4QVTA 2EUIA 2B5GA 2HQYA 3MGDA 4RI1A 5EC4A 2OZGA 2HUZA 4U5YA 2VBQA 4KLVA 4RS2A 3FB3A 1SQHA 2FIWA 2OH1A 4H89A 4E2AA 3FNCA 4UWIA 3T90A 1VHSA 2DXQA 2ZW5A 3FBUA 3EO4A 4HNWB 1Q2CA 2ZW7A 3FYNA 3EXNA 4KOSA 4YFJA 3S6GA 2HV2A 2Q04A 4PSWA 2Q4VA 2IL4A 4B5PA 2VEZA 3F0AA 5KTDA 3FXTA 1YREA 5F47A 2P6GA 4R3KA 4QB9A 4KOYA 2R8VA 2P6FA 2ZW6A 2B4BA 1TIQA 2Q4YA 5KTAA 1J4JA 2G3TA 5IB0A 4CRZB 2FE7A 2I00A 3D8PA 1LRZA 2B4DB 3FIXA 4FD6A 2ARHA 4XPKA 4I49A 3QAHA 4Y49B 4ORFA 1BOBA 4BMHA 2FCKA 2VXKA 3R9EA 2PQ8A 4LX9A 2JDCA 3TO7A 1M4GA 1XMTA 4F6AA 4YGOA 1QSNA 3S6HA 4AVBA 1I1DA 4NEXA 2PRBA 2OZUA 1Y7RA 1FY7A 4NXYA 2QECA 4HKFA 4KUBA 2B5GB 5J8FA 4UBRA 4PV6A 4MI4A 1QSTA 2ATRA 1S7KA 3DNSA 1YVOA 1QSMA 3R95A 2KCWA 2G0BA 2BL1A 4B5PB 2WPWA 3S6FA 4CAWA 1YR0A 4XPLA 5F46A 2PDOA 2PC1A 3R96A 1IIDA 3F8KA 3I3GA 4R9MA 1OZPA 4QC6A 1NE9A 5GCNA 5F49A 3SXNA 1QSOA 3PP9A 2CNTA 1Y9WA 2C27A 3IWGA 3TT2A 4L8AA 3WR7A 1B87A 1I21A 2GE3A 2B3VA 1IYLA 2Y0MA 2BUEA 5HH1A 2OU2A 1V0CA 3TFYA 2J8NA 2REFA 3D3SA 3JUWA 2B3UA 4JXQA 4XNHC 5DWMA 3S6KA 1IYKA 4KVME 2AE6A 2CNSA 3I9SA 3GYAA 4M85A 3GY9A 4HNXB 4QBJA 1YK3A 2F5IA 4UWJA 3W6SA 2H5MA 3UY5A 2OB0A 3B8GA 4R57A 3V8IA 4FD4A 3SHPA 5F48A 4M3SA 4GS4A 1MK4A 3TTHA 4X5KA 2G3AA 1S5KA 1P0HA 1VKCA 5ISVA 1RXTA 2PR8A 2BEIA 1M4DA 1XIXA 4F0YA 2R1IA 5I0CA 2RC4A 4CS0B 3C26A 4XPDC 1K4JA 1ON0A 2ZPAA 2Z0ZA 1MJBA 2Q7BA 3IGRA 3W6XA 2X7BA 1KUXA 5JQ4A 2GIVA 2ZW4A 2CY2A 4KUAA 2Z10A 1Q2DA 1MJAA 2Z11A 5C88A 1YLEA 2O28A 2J8RA 2EVNA 2JDDA 2OZHA 1NMTA 4YRHA 4MBUA 1M44A 4FD7A 4LUAA 4CAXA 3KKWA 3SXOA 3DR8A 3D2PA 2JLMA 4XNHB 4KOVA 5CNPA 4QUSA 4NF1A 2PR1A 1YX0A
chains in the Genus database with same CATH superfamily
4IK2A 3G8WA 1Z8LA 2IQ6A 5HVHA 3B3VA 3TCVA 1XEBA 2XEJA 2PSWA 3R9GA 4NJQA 3V7ZA 1Z5RA 3NA6A 3NH5A 5LYIA 2GANA 4EVYA 4KSFA 2PJ0A 2PJBA 2FT0A 3K2KA 1IB1E 3DGVA 3JTKA 5CBMA 3CDXA 4A31A 2K5TA 3KL9A 4JD6A 5E96A 1TXRA 3BJ8A 1BO4A 2R7HA 1CP6A 1Z4EA 1GHEA 2QVPA 2PJ2A 3JVNA 3VH9A 1IOIA 3N5FA 1R57A 5J8CA 2FXFA 4KOWA 2NMTA 1TF8A 2J8MA 4DYOA 1Y0YA 3D7DA 3RZAA 4AXVA 3T9YA 1IICA 2JEWA 1RO5A 3N7ZA 4DJLA 4JZ0A 3FJUA 2FS5A 3EFAA 1AMPA 1PUAA 4F0XA 1ZG8A 2PRQA 3B3SA 2AFUA 6CPAA 1XF8A 1X10A 3IWWA 3CPXA 3VWEA 4P4FA 3R1KA 1BLLE 3B2YA 1F2OA 1Y7EA 2Q43A 4K30A 1MJ9A 4U9ZA 3SJEA 4II9A 3FECA 5EBVA 5LYLA 4XPDB 1NSAA 2VI7A 2IJZA 4R87A 4MY0A 4YU9A 3ZJ0A 4IHMA 1H8LA 1AUGA 2PJ1A 3QAYA 3RYOA 1LCPA 4CAEA 5IV0A 1LANA 1R43A 2PCUA 1KUYA 4HNYB 3TOBA 5BWAB 4MCSA 2V8DA 3QB8A 4UA3A 2BOAA 3VATA 2GREA 4OC0A 4IUSA 3GKRA 1YW4A 2RFHA 3BLNA 1DE4C 3DDDA 3KASA 3TC8A 4A37A 2ZEGA 4KLWA 4AB7A 4H6ZA 5JPHA 2Q44A 2PJ7A 3B7IA 3LMSA 1UFHA 3PBBA 5IX3A 4OADA 1PU9A 4PK3A 5H86A 2CNMA 2AFOA 5F09A 4DNCA 3VARA 2P6EA 1A2ZA 5FVJA 1Z2LA 3TO9A 4PK2A 4NGRA 2JEVA 2O4HA 4HPSA 1ELLP 1QSRA 4PPZA 2NSMA 2OR4A 3OWCA 2QIRA 3K9UA 1WWZA 4P4JA 1ELMP 1ZG9A 4H6UA 4JLYA 3BJ7A 1KUVA 4ZGYB 2V8HA 3RAMA 3SI0A 1TF9A 1CM0A 1JQGA 2EO8A 3GIUA 3SJFA 4UIBA 3HUVA 4CGMA 4KSIA 4UEZA 2PJ3A 2AFSA 4KZTA 3B3WA 3NE8A 1U6MA 3CXQA 4E0AA 2B58A 1NSLA 4NSQA 4Q38A 2VL1A 1CJWA 4MCRA 4X8IA 5KTCA 4A2ZA 1L0CA 1TKJA 2Q0YA 4C2XA 4Z65A 3BI0A 3ZZIA 4KORA 4CGOA 4FWUA 1YQEA 4KOXA 4JYWA 1Y0RA 4NCZA 4O23A 3RBUA 2FSRA 2I79A 1S7LA 4R3LA 5HMNA 4EWTA 2CIJA 2WSAA 4L89A 2REEA 4J3GA 4AVAA 1S7FA 2VQYA 5DWNA 4Q7AA 2FL4A 3H4QA 4OC3A 4UEEA 3BXMA 4IF5A 4YWYA 2GLFA 1TKFA 1ZLHA 1YLOA 4R7MA 3NH4A 3BHXA 3KHXA 3PEIA 2ABZA 2PJ9A 3ISZA 4GXHA 2Q51A 3NE7A 4JJXA 1WK4A 3P2FA 3LODA 3RNZA 3R9FA 2XEGA 3GUXA 3P2HA 4C2YA 1LAMA 1ZG7A 4KOUA 3D7HA 3EC4A 2PJ6A 4PSXA 2QMLA 3CPAA 1Z9UA 4WJBA 5G20A 2A4NA 4AG7A 1Q2YA 3PBEA 3PZJA 4AVCA 3H8FA 4MHYA 4Q36A 1KZFA 1M4IA 4LQ6A 4B5OA 3A9LA 2F8HA 4CGNA 4R76A 2PIZA 2R98A 1QQ9A 4B11A 4CPAA 1IGBA 3TOAA 3DR6A 3PB9X 1LOKA 4BBHA 1N71A 1S7NA 4JWPA 2ODFA 2ZEPA 3D68A 1KWMA 5HXDA 2QYVA 4ZX9A 4CRYB 4U9YA 3KQZA 4MY3A 1YSJA 2J9AA 2FIAA 3JRUA 2BSWA 4OLLA 3S9MA 3CXSA 3HLPA 4P6YA 2Z3PA 3I1UA 3W91A 3CXPA 1X12A 5LRJA 1P4NA 4DUKA 3KZWA 4KVOE 3TE4A 4FBEA 4JXRA 1RTQA 5K8PA 3LD2A 2AFZA 2AJ6A 2D4OA 1CPXA 4PXDA 4UIAA 1YVKA 2C6CA 3B3TA 1CP7A 1M1DA 4MCQA 4RN7A 3H8GA 4C68A 4KVXA 3DSBA 1Y9KA 5HVGA 4FD5A 3TO6A 4ZY1A 4MJ8A 3K9TA 1GYTA 3ISXA 5C82A 2B4DA 1Z8TA 2ZENA 3FRMA 4Y49C 5G21A 4A30A 3EY5A 1S3ZA 2VZYA 3VWDA 4E8OA 1TKHA 4KOTA 5K8OA 2D4PA 5CPAA 3MN8A 4NGQA 1ARLA 3PFOA 5H84A 1B6BA 4PXBA 3PGPA 4ONWA 1YGHA 3PB6X 2CF4A 2WPXA 3SI2A 4A39A 2ZXVA 5IB9A 1XE4A 1I12A 4ONUA 1Z4RA 4UEFA 1HDQA 2POKA 3G3SA 3LACA 4A38A 2BO9A 4ZBGA 5JH9A 3S9LA 3E0KA 3FMCA 4UFWA 3CZXA 4AG9A 2P0WA 4EFDA 3BI1A 4OAEA 3IU1A 5EMIA 3F5BA 4MHDA 4CAVA 2DF5A 3D2MA 2ANPA 2VZZA 1S60A 4BD9A 4QVTA 3WABA 2EUIA 2B5GA 2HQYA 3FEDA 3MGDA 4RI1A 5EC4A 2OZGA 2HUZA 4U5YA 2VBQA 4KLVA 5THWA 2V77A 4RS2A 3FB3A 4P10A 1SQHA 2FIWA 2QJ8A 3GLJA 2OH1A 2YGWA 4H89A 4E2AA 3FNCA 4UWIA 3T90A 1VHSA 4FAIA 2DXQA 2ZW5A 1Z8XA 3FBUA 3EO4A 2ZEEA 1XFOA 3KR5A 1Q2CA 2Z3MA 2ZW7A 3FYNA 3KGQA 3EXNA 3FVLA 3NH8A 2I3CA 2IMOA 5LRGA 5A28A 4KOSA 4YFJA 3S6GA 1FNOA 2HV2A 2Q04A 4KS9A 4MFZA 4PSWA 5JM6A 3D66A 3KR4A 2Q4VA 2IL4A 2JBKA 2C1CA 3H8EA 3WC6A 3KQXA 4B5PA 2VEZA 3F0AA 5KTDA 4MCPA 3FXTA 3IFEA 5HVFA 1YREA 5F47A 2P6GA 4R3KA 4QB9A 4P4IA 4B14A 4B6ZA 4KOYA 2R8VA 4OP4A 3V38A 2P6FA 2ZW6A 4MFJA 4RUHA 3IO1A 2B4BA 1TIQA 4UCMA 2Q4YA 4MHPA 2ZEMA 5KTAA 1J4JA 2G3TA 2Z3NA 5IB0A 4CRZB 1XJOA 5G22A 2FE7A 2I00A 3IU2A 3D8PA 1LRZA 2B4DB 3FIXA 4FD6A 2ARHA 4XPKA 3FH4A 3TX8A 4I49A 3QAHA 4IAVA 4Y49B 2BCOA 4M6IA 4ORFA 4CGPA 1XMBA 1BOBA 4BMHA 2ZOGA 1VHEA 2FCKA 4A94A 4W9YA 4WWVA 4EMEA 2VXKA 3R9EA 2PQ8A 4LX9A 4TNUA 2YNCC 2JDCA 2ZEHA 4OMEA 1XBUA 2XEIA 1M4GA 1XMTA 3TO7A 4LQGA 2YNCA 4HNWB 3S9NA 4F6AA 4NGTA 1QSNA 4YGOA 3S6HA 4AVBA 4M6HA 1I1DA 2PE3A 2PRBA 4GM5A 1BAVA 2ZELA 2OZUA 4NEXA 1Y7RA 2XEFA 3IEHA 1HDUA 4KSAA 5DS0A 2DPTA 4CAFA 1FY7A 4NXYA 4UCNA 2QECA 4X3RA 4ZYQA 5AG4A 4HKFA 4F9UA 4MHZA 2WYRA 4KUBA 2YNDA 5AG5A 4ZY0A 2B5GB 4OIWA 3WT4A 4CGLA 2PJ4A 4A95A 5J8FA 4UBRA 2G9DA 3PRTA 4PV6A 4MI4A 1VHOA 1PYTB 2CTCA 4P4BA 2JBJA 2EBJA 4F8ZA 3B3CA 2PJAA 2EK8A 4B13A 1QSTA 2ATRA 2GLJA 1S7KA 5G1ZA 3DNSA 4MFKA 5LRKA 1YVOA 4MFLA 2AFXA 1QSMA 2Z3OA 4OKOA 3R95A 2KCWA 3SJGA 4MFQA 4UFXA 5AGEA 4BINA 4OC2A 2G0BA 2BL1A 3D4UA 5AG6A 4A33A 5LYDA 5I4MA 1LFWA 4B5PB 1QMUA 4B10A 2WPWA 4P45A 3S6FA 4CAWA 1YR0A 4XPLA 5F46A 2PDOA 2PC1A 4MMOA 3R96A 2V8GA 1Q7LA 1F2PA 1IIDA 1DTDA 3F8KA 4P44A 1IU8A 5D8NA 4CYOA 2FVGA 4CYQA 1LAPA 3I3GA 4R9MA 1OZPA 4QC6A 1NE9A 5GCNA 5F49A 3SXNA 3T8WA 1QSOA 2Q7SA 4CYNA 3PP9A 4M6GA 2CNTA 1YMEA 1Y9WA 3MRUA 4OC1A 2C27A 3D7GA 3IWGA 3TT2A 3KI9A 1FT7A 4L8AA 5ELYA 3WR7A 3QNVA 1B87A 4ZX8A 2DPSA 1I21A 2GE3A 4NGSA 1CBXA 2B3VA 8CPAA 1ARMA 4MRIA 4NGNA 1IYLA 2Y0MA 2BUEA 4R6TA 5HH1A 2HC9A 2PIYA 2GU2A 2OU2A 1V0CA 3LWUA 3TFYA 2PJCA 2C6PA 4A32A 2J8NA 2REFA 2HB6A 3D3SA 1CG2A 1VIXA 3JUWA 4PQAA 2B3UA 4JXQA 4XNHC 5D29A 5DWMA 3S6KA 1IYKA 4KVME 4ZI6A 2AE6A 2CNSA 3I9SA 3WC5A 3GYAA 4UFVA 4X2TA 4M85A 1XOVA 7CPAA 4OIDA 5K8NA 3PFEA 4OC4A 4PXEA 1BPMA 3FF3A 1HEEA 3GY9A 4NFRA 4G1PA 5AG7A 2OOTA 4HNXB 4QBJA 4NJRA 1YK3A 2F5IA 4UWJA 3W6SA 2H5MA 4B12A 1OBRA 2NYQA 4R8FA 3UY5A 2OB0A 2CXAA 3B8GA 3CT9A 3NFZA 4C2ZA 4R57A 1R3NA 3D7FA 3V8IA 1IY7A 4MFPA 2ZEFA 4FD4A 3SHPA 1EE3P 3B35A 3H5ZA 5F48A 4M3SA 4UF4A 1CX8A 4GS4A 1MK4A 3TTHA 4X5KA 2G3AA 2RB7A 1S5KA 2F7VA 2ZOFA 1P0HA 1IOFA 3IWEA 2V8VA 3PB4X 1VKCA 5ISVA 2CTBA 3DLJA 1RXTA 5K8MA 4F9VA 2PR8A 2BEIA 4NGPA 3RO0A 1XRYA 2C6GA 1ZLIA 4FUUA 1M4DA 1XIXA 4F0YA 2WUUA 2EK9A 1ZO0A 2R1IA 1AYEA 5I0CA 2RC4A 3PB7X 4CS0B 5JGFA 3C26A 4XPDC 1PCAA 5J1QA 1K4JA 1ON0A 2ZPAA 2ZEOA 2Z0ZA 1MJBA 2Q7BA 3IGRA 3W6XA 2X7BA 2WZNA 1KUXA 4CYPA 2GFQA 2O53A 2PJ5A 4C7IA 5JQ4A 5LYFA 2GIVA 2ZW4A 4MXUA 4P4DA 2CY2A 5A27A 4P4EA 2AFWA 3FEEA 4KUAA 3WC7A 2Z10A 1Q2DA 1JWQA 3PB8X 3GB0A 1MJAA 1M4LA 2Z11A 5C88A 3SJXA 2Z3KA 1Z8WA 3IIBA 1YLEA 2Q4ZA 4PXCA 2O28A 2J8RA 2EVNA 2JDDA 2AFMA 2OZHA 3IJ3A 4K3NA 4C7HA 1NMTA 4YRHA 3L2NA 3IC1A 4UCPA 2Z3LA 1F57A 4TWEA 4MHNA 4MBUA 1M44A 1VGYA 2PJ8A 1BPNA 2ZEDA 4FD7A 4LUAA 3KKWA 4CAXA 1YW6A 1UWYA 3D67A 3DR8A 3FX6A 3SXOA 3D2PA 2DEAA 2JLMA 1CPSA 2PVWA 2PVVA 4OC5A 4NGMA 4KOVA 4XNHB 5CNPA 3KHZA 2EWBA 2YNEA 4QUSA 4ZY2A 4NF1A 2PR1A 4H2KA 3SI1A 1YX0A
chains in the Genus database with same CATH topology
3G8WA 3TCVA 1XEBA 2PSWA 3R9GA 4EVYA 2GANA 4KSFA 2FT0A 1IB1E 3JTKA 4A31A 2K5TA 4JD6A 5E96A 3BJ8A 1BO4A 2R7HA 1Z4EA 1GHEA 3JVNA 1R57A 5J8CA 2FXFA 4KOWA 2NMTA 2J8MA 3T9YA 1IICA 1RO5A 3N7ZA 2FS5A 3EFAA 1PUAA 4F0XA 1XF8A 3VWEA 3R1KA 4K30A 4U9ZA 1MJ9A 4II9A 5EBVA 4XPDB 2VI7A 4R87A 4MY0A 3ZJ0A 5IV0A 3RYOA 4CAEA 1KUYA 4HNYB 3TOBA 5BWAB 4UA3A 3QB8A 4IUSA 3GKRA 3BLNA 3DDDA 4KLWA 4AB7A 5JPHA 4H6ZA 2Q44A 1UFHA 5IX3A 4OADA 1PU9A 4PK3A 5H86A 2CNMA 4DNCA 2P6EA 5FVJA 3TO9A 4PK2A 2JEVA 1QSRA 3OWCA 2QIRA 3K9UA 1WWZA 4H6UA 4JLYA 3BJ7A 1KUVA 4ZGYB 1CM0A 4CGMA 4KZTA 1U6MA 3CXQA 4E0AA 2B58A 1NSLA 4NSQA 4Q38A 1CJWA 5KTCA 4A2ZA 1L0CA 2Q0YA 4C2XA 3ZZIA 4KORA 4CGOA 4KOXA 4NCZA 2FSRA 2I79A 1S7LA 4R3LA 5HMNA 2WSAA 4L89A 2REEA 4J3GA 4AVAA 1S7FA 2VQYA 5DWNA 2FL4A 3H4QA 4IF5A 3NE7A 4JJXA 1WK4A 3P2FA 3LODA 3R9FA 3P2HA 4C2YA 4KOUA 3EC4A 4PSXA 2QMLA 1Z9UA 5G20A 2A4NA 4AG7A 1Q2YA 3PZJA 4AVCA 4Q36A 1KZFA 1M4IA 4B5OA 3A9LA 4CGNA 2R98A 4B11A 3TOAA 3DR6A 4BBHA 1N71A 1S7NA 4JWPA 4CRYB 4U9YA 4MY3A 2FIAA 2BSWA 4OLLA 3CXSA 2Z3PA 3W91A 3CXPA 1P4NA 4KVOE 3TE4A 4JXRA 3LD2A 2AJ6A 2D4OA 1YVKA 1M1DA 4C68A 4KVXA 3DSBA 1Y9KA 4FD5A 3TO6A 4MJ8A 5C82A 2B4DA 3FRMA 4Y49C 5G21A 4A30A 3EY5A 1S3ZA 2VZYA 3VWDA 4E8OA 4KOTA 2D4PA 5H84A 1B6BA 3PGPA 1YGHA 2WPXA 2ZXVA 1XE4A 1I12A 4ONUA 1Z4RA 3G3SA 4ZBGA 3E0KA 4UFWA 4AG9A 2P0WA 4OAEA 3IU1A 3F5BA 4MHDA 4CAVA 3D2MA 2VZZA 1S60A 4QVTA 2EUIA 2B5GA 2HQYA 3MGDA 4RI1A 5EC4A 2OZGA 2HUZA 4U5YA 2VBQA 4KLVA 4RS2A 3FB3A 1SQHA 2FIWA 2OH1A 2YGWA 4H89A 4E2AA 3FNCA 4UWIA 3T90A 1VHSA 2DXQA 2ZW5A 3FBUA 3EO4A 4HNWB 1Q2CA 2Z3MA 2ZW7A 3FYNA 3EXNA 5A28A 4KOSA 4YFJA 3S6GA 2HV2A 2Q04A 4KS9A 4MFZA 4PSWA 2Q4VA 2IL4A 4B5PA 2VEZA 3F0AA 5KTDA 3FXTA 1YREA 5F47A 2P6GA 4R3KA 4QB9A 4B14A 4KOYA 2R8VA 2P6FA 2ZW6A 4MFJA 2B4BA 1TIQA 4UCMA 2Q4YA 5KTAA 1J4JA 2G3TA 2Z3NA 5IB0A 4CRZB 5G22A 2FE7A 2I00A 3IU2A 3D8PA 1LRZA 2B4DB 3FIXA 4FD6A 2ARHA 4XPKA 4I49A 3QAHA 4Y49B 4ORFA 4CGPA 1BOBA 4BMHA 2FCKA 2VXKA 3R9EA 2PQ8A 4LX9A 2YNCC 2JDCA 3TO7A 1M4GA 1XMTA 2YNCA 4F6AA 4YGOA 1QSNA 3S6HA 4AVBA 1I1DA 4NEXA 2PRBA 2OZUA 1Y7RA 4KSAA 2DPTA 4CAFA 1FY7A 4NXYA 4UCNA 2QECA 5AG4A 4HKFA 4KUBA 2YNDA 5AG5A 2B5GB 4CGLA 4A95A 5J8FA 4UBRA 4PV6A 4MI4A 4B13A 1QSTA 2ATRA 1S7KA 5G1ZA 3DNSA 4MFKA 1YVOA 4MFLA 2Z3OA 1QSMA 3R95A 2KCWA 4MFQA 4UFXA 5AGEA 5AG6A 2G0BA 2BL1A 4A33A 4B5PB 4B10A 2WPWA 3S6FA 4CAWA 1YR0A 4XPLA 5F46A 2PDOA 2PC1A 3R96A 1IIDA 3F8KA 4CYOA 4CYQA 3I3GA 4R9MA 1OZPA 4QC6A 1NE9A 5GCNA 5F49A 3SXNA 1QSOA 4CYNA 3PP9A 2CNTA 1Y9WA 2C27A 3IWGA 3TT2A 4L8AA 3WR7A 1B87A 2DPSA 1I21A 2GE3A 2B3VA 1IYLA 2Y0MA 2BUEA 5HH1A 2OU2A 1V0CA 3TFYA 4A32A 2J8NA 2REFA 3D3SA 3JUWA 2B3UA 4JXQA 4XNHC 5DWMA 3S6KA 1IYKA 4KVME 2AE6A 2CNSA 3I9SA 3GYAA 4UFVA 4M85A 3GY9A 5AG7A 4HNXB 4QBJA 1YK3A 2F5IA 4UWJA 3W6SA 2H5MA 4B12A 3UY5A 2OB0A 2CXAA 3B8GA 4C2ZA 4R57A 3V8IA 4MFPA 4FD4A 3SHPA 3H5ZA 5F48A 4M3SA 4GS4A 1MK4A 3TTHA 4X5KA 2G3AA 1S5KA 1P0HA 3IWEA 1VKCA 5ISVA 1RXTA 2PR8A 2BEIA 1M4DA 1XIXA 4F0YA 2WUUA 1ZO0A 2R1IA 5I0CA 2RC4A 4CS0B 3C26A 4XPDC 1K4JA 1ON0A 2ZPAA 2Z0ZA 1MJBA 2Q7BA 3IGRA 3W6XA 2X7BA 1KUXA 4CYPA 4C7IA 5JQ4A 2GIVA 2ZW4A 2CY2A 5A27A 4KUAA 2Z10A 1Q2DA 1MJAA 2Z11A 5C88A 2Z3KA 1YLEA 2O28A 2J8RA 2EVNA 2JDDA 2OZHA 4C7HA 1NMTA 4YRHA 4UCPA 2Z3LA 4MBUA 1M44A 4FD7A 4LUAA 4CAXA 3KKWA 3SXOA 3DR8A 3D2PA 2JLMA 4XNHB 4KOVA 5CNPA 2YNEA 4QUSA 4NF1A 2PR1A 1YX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G8W A;  3TCV A;  1XEB A;  2PSW A;  3R9G A;  4EVY A;  2GAN A;  2FT0 A;  1IB1 E;  2K5T A;  4JD6 A;  5E96 A;  3BJ8 A;  1BO4 A;  2R7H A;  1Z4E A;  1GHE A;  3JVN A;  1R57 A;  5J8C A;  2FXF A;  4KOW A;  2NMT A;  2J8M A;  3T9Y A;  1IIC A;  1RO5 A;  3N7Z A;  2FS5 A;  3EFA A;  1PUA A;  1XF8 A;  3VWE A;  3R1K A;  4K30 A;  4U9Z A;  1MJ9 A;  4II9 A;  5EBV A;  4XPD B;  2VI7 A;  4R87 A;  4MY0 A;  3ZJ0 A;  5IV0 A;  3RYO A;  1KUY A;  4HNY B;  3TOB A;  4UA3 A;  3QB8 A;  4IUS A;  3GKR A;  3BLN A;  3DDD A;  4KLW A;  4AB7 A;  5JPH A;  4H6Z A;  2Q44 A;  1UFH A;  5IX3 A;  4OAD A;  1PU9 A;  4PK3 A;  5H86 A;  2CNM A;  4DNC A;  2P6E A;  5FVJ A;  3TO9 A;  4PK2 A;  2JEV A;  1QSR A;  3OWC A;  2QIR A;  3K9U A;  1WWZ A;  4H6U A;  4JLY A;  3BJ7 A;  1KUV A;  1CM0 A;  4KZT A;  1U6M A;  3CXQ A;  4E0A A;  2B58 A;  1NSL A;  4NSQ A;  1CJW A;  5KTC A;  1L0C A;  2Q0Y A;  3ZZI A;  4KOR A;  4KOX A;  4NCZ A;  2FSR A;  2I79 A;  1S7L A;  4R3L A;  5HMN A;  4L89 A;  2REE A;  4J3G A;  4AVA A;  1S7F A;  2VQY A;  5DWN A;  2FL4 A;  3H4Q A;  4IF5 A;  3NE7 A;  4JJX A;  1WK4 A;  3P2F A;  3LOD A;  3R9F A;  3P2H A;  4KOU A;  3EC4 A;  4PSX A;  2QML A;  1Z9U A;  2A4N A;  4AG7 A;  1Q2Y A;  3PZJ A;  4AVC A;  1KZF A;  1M4I A;  4B5O A;  2R98 A;  3TOA A;  3DR6 A;  1N71 A;  1S7N A;  4JWP A;  4CRY B;  4U9Y A;  4MY3 A;  2FIA A;  2BSW A;  4OLL A;  3CXS A;  3W91 A;  3CXP A;  1P4N A;  4KVO E;  3TE4 A;  4JXR A;  3LD2 A;  2AJ6 A;  2D4O A;  1YVK A;  1M1D A;  4KVX A;  3DSB A;  1Y9K A;  4FD5 A;  3TO6 A;  4MJ8 A;  5C82 A;  2B4D A;  3FRM A;  4Y49 C;  3EY5 A;  1S3Z A;  2VZY A;  3VWD A;  4E8O A;  4KOT A;  2D4P A;  5H84 A;  1B6B A;  3PGP A;  1YGH A;  2WPX A;  2ZXV A;  1XE4 A;  1I12 A;  4ONU A;  1Z4R A;  3G3S A;  4ZBG A;  3E0K A;  4AG9 A;  2P0W A;  4OAE A;  3F5B A;  4MHD A;  4CAV A;  3D2M A;  2VZZ A;  1S60 A;  4QVT A;  2EUI A;  2B5G A;  2HQY A;  3MGD A;  4RI1 A;  5EC4 A;  2OZG A;  2HUZ A;  4U5Y A;  2VBQ A;  4KLV A;  4RS2 A;  3FB3 A;  1SQH A;  2FIW A;  2OH1 A;  4H89 A;  4E2A A;  3FNC A;  4UWI A;  3T90 A;  1VHS A;  2DXQ A;  2ZW5 A;  3FBU A;  3EO4 A;  4HNW B;  1Q2C A;  2ZW7 A;  3FYN A;  3EXN A;  4KOS A;  4YFJ A;  3S6G A;  2HV2 A;  2Q04 A;  4PSW A;  2Q4V A;  2IL4 A;  4B5P A;  2VEZ A;  3F0A A;  5KTD A;  3FXT A;  1YRE A;  5F47 A;  2P6G A;  4R3K A;  4QB9 A;  4KOY A;  2R8V A;  2P6F A;  2ZW6 A;  2B4B A;  1TIQ A;  2Q4Y A;  5KTA A;  1J4J A;  2G3T A;  5IB0 A;  4CRZ B;  2FE7 A;  2I00 A;  3D8P A;  1LRZ A;  2B4D B;  3FIX A;  4FD6 A;  2ARH A;  4XPK A;  4I49 A;  3QAH A;  4Y49 B;  4ORF A;  1BOB A;  4BMH A;  2FCK A;  2VXK A;  3R9E A;  2PQ8 A;  4LX9 A;  2JDC A;  3TO7 A;  1M4G A;  1XMT A;  4F6A A;  4YGO A;  1QSN A;  3S6H A;  4AVB A;  1I1D A;  4NEX A;  2PRB A;  2OZU A;  1Y7R A;  1FY7 A;  4NXY A;  2QEC A;  4HKF A;  4KUB A;  2B5G B;  5J8F A;  4UBR A;  4PV6 A;  4MI4 A;  1QST A;  2ATR A;  1S7K A;  3DNS A;  1YVO A;  1QSM A;  3R95 A;  2KCW A;  2G0B A;  2BL1 A;  4B5P B;  2WPW A;  3S6F A;  4CAW A;  1YR0 A;  4XPL A;  5F46 A;  2PDO A;  2PC1 A;  3R96 A;  1IID A;  3F8K A;  3I3G A;  4R9M A;  1OZP A;  4QC6 A;  1NE9 A;  5GCN A;  5F49 A;  3SXN A;  1QSO A;  3PP9 A;  2CNT A;  1Y9W A;  2C27 A;  3IWG A;  3TT2 A;  4L8A A;  3WR7 A;  1B87 A;  1I21 A;  2GE3 A;  2B3V A;  1IYL A;  2Y0M A;  2BUE A;  5HH1 A;  2OU2 A;  1V0C A;  3TFY A;  2J8N A;  2REF A;  3D3S A;  3JUW A;  2B3U A;  4JXQ A;  4XNH C;  5DWM A;  3S6K A;  1IYK A;  4KVM E;  2AE6 A;  2CNS A;  3I9S A;  3GYA A;  4M85 A;  3GY9 A;  4HNX B;  4QBJ A;  1YK3 A;  2F5I A;  4UWJ A;  3W6S A;  2H5M A;  3UY5 A;  2OB0 A;  3B8G A;  4R57 A;  3V8I A;  4FD4 A;  3SHP A;  5F48 A;  4M3S A;  4GS4 A;  1MK4 A;  3TTH A;  4X5K A;  2G3A A;  1S5K A;  1P0H A;  1VKC A;  5ISV A;  1RXT A;  2PR8 A;  2BEI A;  1M4D A;  1XIX A;  4F0Y A;  2R1I A;  5I0C A;  2RC4 A;  4CS0 B;  3C26 A;  4XPD C;  1K4J A;  1ON0 A;  2ZPA A;  2Z0Z A;  1MJB A;  2Q7B A;  3IGR A;  3W6X A;  2X7B A;  1KUX A;  5JQ4 A;  2GIV A;  2ZW4 A;  2CY2 A;  4KUA A;  2Z10 A;  1Q2D A;  1MJA A;  2Z11 A;  5C88 A;  1YLE A;  2O28 A;  2J8R A;  2EVN A;  2JDD A;  2OZH A;  1NMT A;  4YRH A;  4MBU A;  1M44 A;  4FD7 A;  4LUA A;  4CAX A;  3KKW A;  3SXO A;  3DR8 A;  3D2P A;  2JLM A;  4XNH B;  4KOV A;  5CNP A;  4QUS A;  4NF1 A;  2PR1 A;  1YX0 A; 
#chains in the Genus database with same CATH topology
 4IK2 A;  3G8W A;  1Z8L A;  2IQ6 A;  5HVH A;  3B3V A;  3TCV A;  1XEB A;  2XEJ A;  2PSW A;  3R9G A;  4NJQ A;  3V7Z A;  1Z5R A;  3NA6 A;  3NH5 A;  5LYI A;  2GAN A;  4EVY A;  4KSF A;  2PJ0 A;  2PJB A;  2FT0 A;  3K2K A;  1IB1 E;  3DGV A;  3JTK A;  5CBM A;  3CDX A;  4A31 A;  2K5T A;  3KL9 A;  4JD6 A;  5E96 A;  1TXR A;  3BJ8 A;  1BO4 A;  2R7H A;  1CP6 A;  1Z4E A;  1GHE A;  2QVP A;  2PJ2 A;  3JVN A;  3VH9 A;  1IOI A;  3N5F A;  1R57 A;  5J8C A;  2FXF A;  4KOW A;  2NMT A;  1TF8 A;  2J8M A;  4DYO A;  1Y0Y A;  3D7D A;  3RZA A;  4AXV A;  3T9Y A;  1IIC A;  2JEW A;  1RO5 A;  3N7Z A;  4DJL A;  4JZ0 A;  3FJU A;  2FS5 A;  3EFA A;  1AMP A;  1PUA A;  4F0X A;  1ZG8 A;  2PRQ A;  3B3S A;  2AFU A;  6CPA A;  1XF8 A;  1X10 A;  3IWW A;  3CPX A;  3VWE A;  4P4F A;  3R1K A;  1BLL E;  3B2Y A;  1F2O A;  1Y7E A;  2Q43 A;  4K30 A;  1MJ9 A;  4U9Z A;  3SJE A;  4II9 A;  3FEC A;  5EBV A;  5LYL A;  4XPD B;  1NSA A;  2VI7 A;  2IJZ A;  4R87 A;  4MY0 A;  4YU9 A;  3ZJ0 A;  4IHM A;  1H8L A;  1AUG A;  2PJ1 A;  3QAY A;  3RYO A;  1LCP A;  4CAE A;  5IV0 A;  1LAN A;  1R43 A;  2PCU A;  1KUY A;  4HNY B;  3TOB A;  5BWA B;  4MCS A;  2V8D A;  3QB8 A;  4UA3 A;  2BOA A;  3VAT A;  2GRE A;  4OC0 A;  4IUS A;  3GKR A;  1YW4 A;  2RFH A;  3BLN A;  1DE4 C;  3DDD A;  3KAS A;  3TC8 A;  4A37 A;  2ZEG A;  4KLW A;  4AB7 A;  4H6Z A;  5JPH A;  2Q44 A;  2PJ7 A;  3B7I A;  3LMS A;  1UFH A;  3PBB A;  5IX3 A;  4OAD A;  1PU9 A;  4PK3 A;  5H86 A;  2CNM A;  2AFO A;  5F09 A;  4DNC A;  3VAR A;  2P6E A;  1A2Z A;  5FVJ A;  1Z2L A;  3TO9 A;  4PK2 A;  4NGR A;  2JEV A;  2O4H A;  4HPS A;  1ELL P;  1QSR A;  4PPZ A;  2NSM A;  2OR4 A;  3OWC A;  2QIR A;  3K9U A;  1WWZ A;  4P4J A;  1ELM P;  1ZG9 A;  4H6U A;  4JLY A;  3BJ7 A;  1KUV A;  4ZGY B;  2V8H A;  3RAM A;  3SI0 A;  1TF9 A;  1CM0 A;  1JQG A;  2EO8 A;  3GIU A;  3SJF A;  4UIB A;  3HUV A;  4CGM A;  4KSI A;  4UEZ A;  2PJ3 A;  2AFS A;  4KZT A;  3B3W A;  3NE8 A;  1U6M A;  3CXQ A;  4E0A A;  2B58 A;  1NSL A;  4NSQ A;  4Q38 A;  2VL1 A;  1CJW A;  4MCR A;  4X8I A;  5KTC A;  4A2Z A;  1L0C A;  1TKJ A;  2Q0Y A;  4C2X A;  4Z65 A;  3BI0 A;  3ZZI A;  4KOR A;  4CGO A;  4FWU A;  1YQE A;  4KOX A;  4JYW A;  1Y0R A;  4NCZ A;  4O23 A;  3RBU A;  2FSR A;  2I79 A;  1S7L A;  4R3L A;  5HMN A;  4EWT A;  2CIJ A;  2WSA A;  4L89 A;  2REE A;  4J3G A;  4AVA A;  1S7F A;  2VQY A;  5DWN A;  4Q7A A;  2FL4 A;  3H4Q A;  4OC3 A;  4UEE A;  3BXM A;  4IF5 A;  4YWY A;  2GLF A;  1TKF A;  1ZLH A;  1YLO A;  4R7M A;  3NH4 A;  3BHX A;  3KHX A;  3PEI A;  2ABZ A;  2PJ9 A;  3ISZ A;  4GXH A;  2Q51 A;  3NE7 A;  4JJX A;  1WK4 A;  3P2F A;  3LOD A;  3RNZ A;  3R9F A;  2XEG A;  3GUX A;  3P2H A;  4C2Y A;  1LAM A;  1ZG7 A;  4KOU A;  3D7H A;  3EC4 A;  2PJ6 A;  4PSX A;  2QML A;  3CPA A;  1Z9U A;  4WJB A;  5G20 A;  2A4N A;  4AG7 A;  1Q2Y A;  3PBE A;  3PZJ A;  4AVC A;  3H8F A;  4MHY A;  4Q36 A;  1KZF A;  1M4I A;  4LQ6 A;  4B5O A;  3A9L A;  2F8H A;  4CGN A;  4R76 A;  2PIZ A;  2R98 A;  1QQ9 A;  4B11 A;  4CPA A;  1IGB A;  3TOA A;  3DR6 A;  3PB9 X;  1LOK A;  4BBH A;  1N71 A;  1S7N A;  4JWP A;  2ODF A;  2ZEP A;  3D68 A;  1KWM A;  5HXD A;  2QYV A;  4ZX9 A;  4CRY B;  4U9Y A;  3KQZ A;  4MY3 A;  1YSJ A;  2J9A A;  2FIA A;  3JRU A;  2BSW A;  4OLL A;  3S9M A;  3CXS A;  3HLP A;  4P6Y A;  2Z3P A;  3I1U A;  3W91 A;  3CXP A;  1X12 A;  5LRJ A;  1P4N A;  4DUK A;  3KZW A;  4KVO E;  3TE4 A;  4FBE A;  4JXR A;  1RTQ A;  5K8P A;  3LD2 A;  2AFZ A;  2AJ6 A;  2D4O A;  1CPX A;  4PXD A;  4UIA A;  1YVK A;  2C6C A;  3B3T A;  1CP7 A;  1M1D A;  4MCQ A;  4RN7 A;  3H8G A;  4C68 A;  4KVX A;  3DSB A;  1Y9K A;  5HVG A;  4FD5 A;  3TO6 A;  4ZY1 A;  4MJ8 A;  3K9T A;  1GYT A;  3ISX A;  5C82 A;  2B4D A;  1Z8T A;  2ZEN A;  3FRM A;  4Y49 C;  5G21 A;  4A30 A;  3EY5 A;  1S3Z A;  2VZY A;  3VWD A;  4E8O A;  1TKH A;  4KOT A;  5K8O A;  2D4P A;  5CPA A;  3MN8 A;  4NGQ A;  1ARL A;  3PFO A;  5H84 A;  1B6B A;  4PXB A;  3PGP A;  4ONW A;  1YGH A;  3PB6 X;  2CF4 A;  2WPX A;  3SI2 A;  4A39 A;  2ZXV A;  5IB9 A;  1XE4 A;  1I12 A;  4ONU A;  1Z4R A;  4UEF A;  1HDQ A;  2POK A;  3G3S A;  3LAC A;  4A38 A;  2BO9 A;  4ZBG A;  5JH9 A;  3S9L A;  3E0K A;  3FMC A;  4UFW A;  3CZX A;  4AG9 A;  2P0W A;  4EFD A;  3BI1 A;  4OAE A;  3IU1 A;  5EMI A;  3F5B A;  4MHD A;  4CAV A;  2DF5 A;  3D2M A;  2ANP A;  2VZZ A;  1S60 A;  4BD9 A;  4QVT A;  3WAB A;  2EUI A;  2B5G A;  2HQY A;  3FED A;  3MGD A;  4RI1 A;  5EC4 A;  2OZG A;  2HUZ A;  4U5Y A;  2VBQ A;  4KLV A;  5THW A;  2V77 A;  4RS2 A;  3FB3 A;  4P10 A;  1SQH A;  2FIW A;  2QJ8 A;  3GLJ A;  2OH1 A;  2YGW A;  4H89 A;  4E2A A;  3FNC A;  4UWI A;  3T90 A;  1VHS A;  4FAI A;  2DXQ A;  2ZW5 A;  1Z8X A;  3FBU A;  3EO4 A;  2ZEE A;  1XFO A;  3KR5 A;  1Q2C A;  2Z3M A;  2ZW7 A;  3FYN A;  3KGQ A;  3EXN A;  3FVL A;  3NH8 A;  2I3C A;  2IMO A;  5LRG A;  5A28 A;  4KOS A;  4YFJ A;  3S6G A;  1FNO A;  2HV2 A;  2Q04 A;  4KS9 A;  4MFZ A;  4PSW A;  5JM6 A;  3D66 A;  3KR4 A;  2Q4V A;  2IL4 A;  2JBK A;  2C1C A;  3H8E A;  3WC6 A;  3KQX A;  4B5P A;  2VEZ A;  3F0A A;  5KTD A;  4MCP A;  3FXT A;  3IFE A;  5HVF A;  1YRE A;  5F47 A;  2P6G A;  4R3K A;  4QB9 A;  4P4I A;  4B14 A;  4B6Z A;  4KOY A;  2R8V A;  4OP4 A;  3V38 A;  2P6F A;  2ZW6 A;  4MFJ A;  4RUH A;  3IO1 A;  2B4B A;  1TIQ A;  4UCM A;  2Q4Y A;  4MHP A;  2ZEM A;  5KTA A;  1J4J A;  2G3T A;  2Z3N A;  5IB0 A;  4CRZ B;  1XJO A;  5G22 A;  2FE7 A;  2I00 A;  3IU2 A;  3D8P A;  1LRZ A;  2B4D B;  3FIX A;  4FD6 A;  2ARH A;  4XPK A;  3FH4 A;  3TX8 A;  4I49 A;  3QAH A;  4IAV A;  4Y49 B;  2BCO A;  4M6I A;  4ORF A;  4CGP A;  1XMB A;  1BOB A;  4BMH A;  2ZOG A;  1VHE A;  2FCK A;  4A94 A;  4W9Y A;  4WWV A;  4EME A;  2VXK A;  3R9E A;  2PQ8 A;  4LX9 A;  4TNU A;  2YNC C;  2JDC A;  2ZEH A;  4OME A;  1XBU A;  2XEI A;  1M4G A;  1XMT A;  3TO7 A;  4LQG A;  2YNC A;  4HNW B;  3S9N A;  4F6A A;  4NGT A;  1QSN A;  4YGO A;  3S6H A;  4AVB A;  4M6H A;  1I1D A;  2PE3 A;  2PRB A;  4GM5 A;  1BAV A;  2ZEL A;  2OZU A;  4NEX A;  1Y7R A;  2XEF A;  3IEH A;  1HDU A;  4KSA A;  5DS0 A;  2DPT A;  4CAF A;  1FY7 A;  4NXY A;  4UCN A;  2QEC A;  4X3R A;  4ZYQ A;  5AG4 A;  4HKF A;  4F9U A;  4MHZ A;  2WYR A;  4KUB A;  2YND A;  5AG5 A;  4ZY0 A;  2B5G B;  4OIW A;  3WT4 A;  4CGL A;  2PJ4 A;  4A95 A;  5J8F A;  4UBR A;  2G9D A;  3PRT A;  4PV6 A;  4MI4 A;  1VHO A;  1PYT B;  2CTC A;  4P4B A;  2JBJ A;  2EBJ A;  4F8Z A;  3B3C A;  2PJA A;  2EK8 A;  4B13 A;  1QST A;  2ATR A;  2GLJ A;  1S7K A;  5G1Z A;  3DNS A;  4MFK A;  5LRK A;  1YVO A;  4MFL A;  2AFX A;  1QSM A;  2Z3O A;  4OKO A;  3R95 A;  2KCW A;  3SJG A;  4MFQ A;  4UFX A;  5AGE A;  4BIN A;  4OC2 A;  2G0B A;  2BL1 A;  3D4U A;  5AG6 A;  4A33 A;  5LYD A;  5I4M A;  1LFW A;  4B5P B;  1QMU A;  4B10 A;  2WPW A;  4P45 A;  3S6F A;  4CAW A;  1YR0 A;  4XPL A;  5F46 A;  2PDO A;  2PC1 A;  4MMO A;  3R96 A;  2V8G A;  1Q7L A;  1F2P A;  1IID A;  1DTD A;  3F8K A;  4P44 A;  1IU8 A;  5D8N A;  4CYO A;  2FVG A;  4CYQ A;  1LAP A;  3I3G A;  4R9M A;  1OZP A;  4QC6 A;  1NE9 A;  5GCN A;  5F49 A;  3SXN A;  3T8W A;  1QSO A;  2Q7S A;  4CYN A;  3PP9 A;  4M6G A;  2CNT A;  1YME A;  1Y9W A;  3MRU A;  4OC1 A;  2C27 A;  3D7G A;  3IWG A;  3TT2 A;  3KI9 A;  1FT7 A;  4L8A A;  5ELY A;  3WR7 A;  3QNV A;  1B87 A;  4ZX8 A;  2DPS A;  1I21 A;  2GE3 A;  4NGS A;  1CBX A;  2B3V A;  8CPA A;  1ARM A;  4MRI A;  4NGN A;  1IYL A;  2Y0M A;  2BUE A;  4R6T A;  5HH1 A;  2HC9 A;  2PIY A;  2GU2 A;  2OU2 A;  1V0C A;  3LWU A;  3TFY A;  2PJC A;  2C6P A;  4A32 A;  2J8N A;  2REF A;  2HB6 A;  3D3S A;  1CG2 A;  1VIX A;  3JUW A;  4PQA A;  2B3U A;  4JXQ A;  4XNH C;  5D29 A;  5DWM A;  3S6K A;  1IYK A;  4KVM E;  4ZI6 A;  2AE6 A;  2CNS A;  3I9S A;  3WC5 A;  3GYA A;  4UFV A;  4X2T A;  4M85 A;  1XOV A;  7CPA A;  4OID A;  5K8N A;  3PFE A;  4OC4 A;  4PXE A;  1BPM A;  3FF3 A;  1HEE A;  3GY9 A;  4NFR A;  4G1P A;  5AG7 A;  2OOT A;  4HNX B;  4QBJ A;  4NJR A;  1YK3 A;  2F5I A;  4UWJ A;  3W6S A;  2H5M A;  4B12 A;  1OBR A;  2NYQ A;  4R8F A;  3UY5 A;  2OB0 A;  2CXA A;  3B8G A;  3CT9 A;  3NFZ A;  4C2Z A;  4R57 A;  1R3N A;  3D7F A;  3V8I A;  1IY7 A;  4MFP A;  2ZEF A;  4FD4 A;  3SHP A;  1EE3 P;  3B35 A;  3H5Z A;  5F48 A;  4M3S A;  4UF4 A;  1CX8 A;  4GS4 A;  1MK4 A;  3TTH A;  4X5K A;  2G3A A;  2RB7 A;  1S5K A;  2F7V A;  2ZOF A;  1P0H A;  1IOF A;  3IWE A;  2V8V A;  3PB4 X;  1VKC A;  5ISV A;  2CTB A;  3DLJ A;  1RXT A;  5K8M A;  4F9V A;  2PR8 A;  2BEI A;  4NGP A;  3RO0 A;  1XRY A;  2C6G A;  1ZLI A;  4FUU A;  1M4D A;  1XIX A;  4F0Y A;  2WUU A;  2EK9 A;  1ZO0 A;  2R1I A;  1AYE A;  5I0C A;  2RC4 A;  3PB7 X;  4CS0 B;  5JGF A;  3C26 A;  4XPD C;  1PCA A;  5J1Q A;  1K4J A;  1ON0 A;  2ZPA A;  2ZEO A;  2Z0Z A;  1MJB A;  2Q7B A;  3IGR A;  3W6X A;  2X7B A;  2WZN A;  1KUX A;  4CYP A;  2GFQ A;  2O53 A;  2PJ5 A;  4C7I A;  5JQ4 A;  5LYF A;  2GIV A;  2ZW4 A;  4MXU A;  4P4D A;  2CY2 A;  5A27 A;  4P4E A;  2AFW A;  3FEE A;  4KUA A;  3WC7 A;  2Z10 A;  1Q2D A;  1JWQ A;  3PB8 X;  3GB0 A;  1MJA A;  1M4L A;  2Z11 A;  5C88 A;  3SJX A;  2Z3K A;  1Z8W A;  3IIB A;  1YLE A;  2Q4Z A;  4PXC A;  2O28 A;  2J8R A;  2EVN A;  2JDD A;  2AFM A;  2OZH A;  3IJ3 A;  4K3N A;  4C7H A;  1NMT A;  4YRH A;  3L2N A;  3IC1 A;  4UCP A;  2Z3L A;  1F57 A;  4TWE A;  4MHN A;  4MBU A;  1M44 A;  1VGY A;  2PJ8 A;  1BPN A;  2ZED A;  4FD7 A;  4LUA A;  3KKW A;  4CAX A;  1YW6 A;  1UWY A;  3D67 A;  3DR8 A;  3FX6 A;  3SXO A;  3D2P A;  2DEA A;  2JLM A;  1CPS A;  2PVW A;  2PVV A;  4OC5 A;  4NGM A;  4KOV A;  4XNH B;  5CNP A;  3KHZ A;  2EWB A;  2YNE A;  4QUS A;  4ZY2 A;  4NF1 A;  2PR1 A;  4H2K A;  3SI1 A;  1YX0 A; 
#chains in the Genus database with same CATH homology
 3G8W A;  3TCV A;  1XEB A;  2PSW A;  3R9G A;  4EVY A;  2GAN A;  4KSF A;  2FT0 A;  1IB1 E;  3JTK A;  4A31 A;  2K5T A;  4JD6 A;  5E96 A;  3BJ8 A;  1BO4 A;  2R7H A;  1Z4E A;  1GHE A;  3JVN A;  1R57 A;  5J8C A;  2FXF A;  4KOW A;  2NMT A;  2J8M A;  3T9Y A;  1IIC A;  1RO5 A;  3N7Z A;  2FS5 A;  3EFA A;  1PUA A;  4F0X A;  1XF8 A;  3VWE A;  3R1K A;  4K30 A;  4U9Z A;  1MJ9 A;  4II9 A;  5EBV A;  4XPD B;  2VI7 A;  4R87 A;  4MY0 A;  3ZJ0 A;  5IV0 A;  3RYO A;  4CAE A;  1KUY A;  4HNY B;  3TOB A;  5BWA B;  4UA3 A;  3QB8 A;  4IUS A;  3GKR A;  3BLN A;  3DDD A;  4KLW A;  4AB7 A;  5JPH A;  4H6Z A;  2Q44 A;  1UFH A;  5IX3 A;  4OAD A;  1PU9 A;  4PK3 A;  5H86 A;  2CNM A;  4DNC A;  2P6E A;  5FVJ A;  3TO9 A;  4PK2 A;  2JEV A;  1QSR A;  3OWC A;  2QIR A;  3K9U A;  1WWZ A;  4H6U A;  4JLY A;  3BJ7 A;  1KUV A;  4ZGY B;  1CM0 A;  4CGM A;  4KZT A;  1U6M A;  3CXQ A;  4E0A A;  2B58 A;  1NSL A;  4NSQ A;  4Q38 A;  1CJW A;  5KTC A;  4A2Z A;  1L0C A;  2Q0Y A;  4C2X A;  3ZZI A;  4KOR A;  4CGO A;  4KOX A;  4NCZ A;  2FSR A;  2I79 A;  1S7L A;  4R3L A;  5HMN A;  2WSA A;  4L89 A;  2REE A;  4J3G A;  4AVA A;  1S7F A;  2VQY A;  5DWN A;  2FL4 A;  3H4Q A;  4IF5 A;  3NE7 A;  4JJX A;  1WK4 A;  3P2F A;  3LOD A;  3R9F A;  3P2H A;  4C2Y A;  4KOU A;  3EC4 A;  4PSX A;  2QML A;  1Z9U A;  5G20 A;  2A4N A;  4AG7 A;  1Q2Y A;  3PZJ A;  4AVC A;  4Q36 A;  1KZF A;  1M4I A;  4B5O A;  3A9L A;  4CGN A;  2R98 A;  4B11 A;  3TOA A;  3DR6 A;  4BBH A;  1N71 A;  1S7N A;  4JWP A;  4CRY B;  4U9Y A;  4MY3 A;  2FIA A;  2BSW A;  4OLL A;  3CXS A;  2Z3P A;  3W91 A;  3CXP A;  1P4N A;  4KVO E;  3TE4 A;  4JXR A;  3LD2 A;  2AJ6 A;  2D4O A;  1YVK A;  1M1D A;  4C68 A;  4KVX A;  3DSB A;  1Y9K A;  4FD5 A;  3TO6 A;  4MJ8 A;  5C82 A;  2B4D A;  3FRM A;  4Y49 C;  5G21 A;  4A30 A;  3EY5 A;  1S3Z A;  2VZY A;  3VWD A;  4E8O A;  4KOT A;  2D4P A;  5H84 A;  1B6B A;  3PGP A;  1YGH A;  2WPX A;  2ZXV A;  1XE4 A;  1I12 A;  4ONU A;  1Z4R A;  3G3S A;  4ZBG A;  3E0K A;  4UFW A;  4AG9 A;  2P0W A;  4OAE A;  3IU1 A;  3F5B A;  4MHD A;  4CAV A;  3D2M A;  2VZZ A;  1S60 A;  4QVT A;  2EUI A;  2B5G A;  2HQY A;  3MGD A;  4RI1 A;  5EC4 A;  2OZG A;  2HUZ A;  4U5Y A;  2VBQ A;  4KLV A;  4RS2 A;  3FB3 A;  1SQH A;  2FIW A;  2OH1 A;  2YGW A;  4H89 A;  4E2A A;  3FNC A;  4UWI A;  3T90 A;  1VHS A;  2DXQ A;  2ZW5 A;  3FBU A;  3EO4 A;  4HNW B;  1Q2C A;  2Z3M A;  2ZW7 A;  3FYN A;  3EXN A;  5A28 A;  4KOS A;  4YFJ A;  3S6G A;  2HV2 A;  2Q04 A;  4KS9 A;  4MFZ A;  4PSW A;  2Q4V A;  2IL4 A;  4B5P A;  2VEZ A;  3F0A A;  5KTD A;  3FXT A;  1YRE A;  5F47 A;  2P6G A;  4R3K A;  4QB9 A;  4B14 A;  4KOY A;  2R8V A;  2P6F A;  2ZW6 A;  4MFJ A;  2B4B A;  1TIQ A;  4UCM A;  2Q4Y A;  5KTA A;  1J4J A;  2G3T A;  2Z3N A;  5IB0 A;  4CRZ B;  5G22 A;  2FE7 A;  2I00 A;  3IU2 A;  3D8P A;  1LRZ A;  2B4D B;  3FIX A;  4FD6 A;  2ARH A;  4XPK A;  4I49 A;  3QAH A;  4Y49 B;  4ORF A;  4CGP A;  1BOB A;  4BMH A;  2FCK A;  2VXK A;  3R9E A;  2PQ8 A;  4LX9 A;  2YNC C;  2JDC A;  3TO7 A;  1M4G A;  1XMT A;  2YNC A;  4F6A A;  4YGO A;  1QSN A;  3S6H A;  4AVB A;  1I1D A;  4NEX A;  2PRB A;  2OZU A;  1Y7R A;  4KSA A;  2DPT A;  4CAF A;  1FY7 A;  4NXY A;  4UCN A;  2QEC A;  5AG4 A;  4HKF A;  4KUB A;  2YND A;  5AG5 A;  2B5G B;  4CGL A;  4A95 A;  5J8F A;  4UBR A;  4PV6 A;  4MI4 A;  4B13 A;  1QST A;  2ATR A;  1S7K A;  5G1Z A;  3DNS A;  4MFK A;  1YVO A;  4MFL A;  2Z3O A;  1QSM A;  3R95 A;  2KCW A;  4MFQ A;  4UFX A;  5AGE A;  5AG6 A;  2G0B A;  2BL1 A;  4A33 A;  4B5P B;  4B10 A;  2WPW A;  3S6F A;  4CAW A;  1YR0 A;  4XPL A;  5F46 A;  2PDO A;  2PC1 A;  3R96 A;  1IID A;  3F8K A;  4CYO A;  4CYQ A;  3I3G A;  4R9M A;  1OZP A;  4QC6 A;  1NE9 A;  5GCN A;  5F49 A;  3SXN A;  1QSO A;  4CYN A;  3PP9 A;  2CNT A;  1Y9W A;  2C27 A;  3IWG A;  3TT2 A;  4L8A A;  3WR7 A;  1B87 A;  2DPS A;  1I21 A;  2GE3 A;  2B3V A;  1IYL A;  2Y0M A;  2BUE A;  5HH1 A;  2OU2 A;  1V0C A;  3TFY A;  4A32 A;  2J8N A;  2REF A;  3D3S A;  3JUW A;  2B3U A;  4JXQ A;  4XNH C;  5DWM A;  3S6K A;  1IYK A;  4KVM E;  2AE6 A;  2CNS A;  3I9S A;  3GYA A;  4UFV A;  4M85 A;  3GY9 A;  5AG7 A;  4HNX B;  4QBJ A;  1YK3 A;  2F5I A;  4UWJ A;  3W6S A;  2H5M A;  4B12 A;  3UY5 A;  2OB0 A;  2CXA A;  3B8G A;  4C2Z A;  4R57 A;  3V8I A;  4MFP A;  4FD4 A;  3SHP A;  3H5Z A;  5F48 A;  4M3S A;  4GS4 A;  1MK4 A;  3TTH A;  4X5K A;  2G3A A;  1S5K A;  1P0H A;  3IWE A;  1VKC A;  5ISV A;  1RXT A;  2PR8 A;  2BEI A;  1M4D A;  1XIX A;  4F0Y A;  2WUU A;  1ZO0 A;  2R1I A;  5I0C A;  2RC4 A;  4CS0 B;  3C26 A;  4XPD C;  1K4J A;  1ON0 A;  2ZPA A;  2Z0Z A;  1MJB A;  2Q7B A;  3IGR A;  3W6X A;  2X7B A;  1KUX A;  4CYP A;  4C7I A;  5JQ4 A;  2GIV A;  2ZW4 A;  2CY2 A;  5A27 A;  4KUA A;  2Z10 A;  1Q2D A;  1MJA A;  2Z11 A;  5C88 A;  2Z3K A;  1YLE A;  2O28 A;  2J8R A;  2EVN A;  2JDD A;  2OZH A;  4C7H A;  1NMT A;  4YRH A;  4UCP A;  2Z3L A;  4MBU A;  1M44 A;  4FD7 A;  4LUA A;  4CAX A;  3KKW A;  3SXO A;  3DR8 A;  3D2P A;  2JLM A;  4XNH B;  4KOV A;  5CNP A;  2YNE A;  4QUS A;  4NF1 A;  2PR1 A;  1YX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...