3SI1A

Structure of glycosylated murine glutaminyl cyclase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
327
structure length
323
Chain Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 323
sequence length 327
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si1A00
2QVPA 2ABZA 3B2YA 1Q7LA 3PBEA 5HVGA 1IGBA 2ZOGA 5K8PA 2QYVA 1YMEA 3FX6A 1XJOA 2PJ0A 1DTDA 1BAVA 4TWEA 3KR4A 2GU2A 1ELLP 3SI1A 1Y0RA 2PVWA 4OIDA 3SI0A 2EK8A 2J9AA 4EFDA 4TNUA 2C6GA 2V8DA 3ISXA 1ZLIA 1YSJA 4P4JA 2ZEEA 5LYDA 4CPAA 3QNVA 1CP7A 3B7IA 4JYWA 4P4IA 5D8NA 5CPAA 3BXMA 3D66A 2PJ1A 3N5FA 5LYIA 3HUVA 3PB8X 4IAVA 2FVGA 3TX8A 1Z5RA 2G9DA 2WZNA 4PXCA 4G1PA 3PFEA 5THWA 3WT4A 3L2NA 2Q4ZA 1BPNA 3KASA 5CBMA 1VGYA 3B3VA 4P10A 1BLLE 3HLPA 4PPZA 1ARLA 4ZX8A 4AXVA 2HB6A 4MRIA 4P45A 3RBUA 3PB9X 4X3RA 2OOTA 1HDUA 3GB0A 5JH9A 3NFZA 4R7MA 4P6YA 4UIBA 1XFOA 4PQAA 3IFEA 4RUHA 1AYEA 2AFZA 3WABA 1PYTB 2PCUA 2BCOA 2ZEOA 4NGPA 2ANPA 1Z2LA 3PB7X 3ISZA 3KHZA 3D67A 1Y0YA 2BOAA 3H8FA 1XBUA 1ELMP 1GYTA 3BI0A 3K2KA 4ZX9A 1RTQA 2C6CA 3B35A 4LQGA 1H8LA 4FUUA 4OC4A 4WJBA 2EWBA 2ZEFA 4OC3A 2PJAA 4MCRA 5LRGA 3SJEA 3CPAA 2V8HA 1F57A 2VL1A 4A39A 4FBEA 3H8EA 4NGNA 2AFWA 1CX8A 2CTBA 2V8GA 2WYRA 4O23A 3GUXA 3CT9A 2PE3A 4R8FA 4H2KA 4P4DA 3KI9A 4UEEA 4Z65A 5F09A 3D4UA 3PB4X 1Y7EA 1VIXA 2XEIA 4MXUA 1VHOA 1UWYA 2Q51A 3D7DA 3NH4A 1TKHA 3TC8A 4FWUA 4WWVA 3RZAA 3S9NA 4OIWA 2ZEDA 1XRYA 2HC9A 3B3CA 2IJZA 1IY7A 2RB7A 3CPXA 4EWTA 3PEIA 1ZG7A 1TF9A 4NFRA 4F9VA 3LMSA 2C6PA 5I4MA 2DEAA 2JBJA 2ZEHA 4ZY0A 1F2OA 1YW6A 4MCSA 4PXBA 4W9YA 3DLJA 3S9LA 2JBKA 3B3SA 3WC6A 1FNOA 2CF4A 4NGSA 4P44A 3SJFA 2AFXA 3BHXA 1HEEA 3PRTA 3WC7A 3NA6A 4ONWA 4R76A 3RAMA 4DYOA 3BI1A 3SJXA 1LANA 4KSIA 3SI2A 4IK2A 3VATA 2Q43A 4A94A 4EMEA 2EK9A 1XMBA 4OC2A 2PIZA 1ARMA 2BO9A 3KQZA 1HDQA 1M4LA 3FJUA 2QJ8A 5LRKA 4UIAA 3D68A 2PJ4A 2V8VA 1LOKA 3MN8A 2PJ8A 2O53A 4MMOA 3H8GA 5LYLA 5J1QA 2RFHA 5IB9A 2PRQA 2ZOFA 2CIJA 2CTCA 3IIBA 4K3NA 1DE4C 2PJ7A 2NYQA 3V7ZA 2PJBA 4OC1A 5K8OA 4MCQA 2PJ2A 4A38A 2V77A 4DUKA 4NGMA 1R3NA 1YLOA 1LFWA 1JQGA 3S9MA 2XEJA 5ELYA 3FMCA 5LRJA 4X8IA 3B3WA 3FEDA 2F8HA 2PJ6A 1ZLHA 4NGQA 2F7VA 3CDXA 1TKJA 4MHYA 2IQ6A 5D29A 1BPMA 4MHPA 4UF4A 4OMEA 2AFUA 4PXDA 2PJ3A 4NJQA 3D7FA 1OBRA 1QQ9A 4IHMA 5JGFA 4X2TA 3FF3A 2I3CA 1LAPA 3PBBA 2ZENA 1VHEA 2NSMA 5DS0A 8CPAA 1CBXA 4PXEA 1YW4A 4P4FA 3KL9A 1PCAA 3FEEA 3IWWA 2PJCA 1KWMA 2AFSA 3D7HA 4OC0A 3JRUA 2ZELA 1FT7A 3IC1A 4MCPA 4OP4A 3KZWA 3FECA 3IJ3A 2PJ5A 1ZG9A 5K8NA 3T8WA 2IMOA 2O4HA 3KQXA 2AFOA 3WC5A 3KGQA 1QMUA 4ZYQA 3KR5A 3K9TA 4MHNA 3IO1A 3D7GA 4OC5A 5HXDA 3NH5A 5JM6A 4UEZA 2C1CA 4NGTA 2GLFA 1CPXA 3I1UA 2JEWA 1F2PA 2ZEMA 4F9UA 3VARA 4P4BA 4R6TA 2PJ9A 4P4EA 3VH9A 4B6ZA 3V38A 1LAMA 4YWYA 4OKOA 3FH4A 4NGRA 2OR4A 2GLJA 1TF8A 1Z8LA 3PB6X 5HVHA 3FVLA 2ZEPA 2ZEGA 5LYFA 1CP6A 4ZI6A 4ZY2A 1CPSA 2POKA 5HVFA 2AFMA 2PIYA 3MRUA 1TXRA 4BD9A 2XEFA 2PVVA 4Q7AA 1NSAA 4UEFA 1ZG8A 4F8ZA 4FAIA 3KHXA 6CPAA 3SJGA 1LCPA 1TKFA 3IEHA 1CG2A 4GM5A 4MHZA 3PFOA 4JZ0A 4ZY1A 3DGVA 3NH8A 4DJLA 2GREA 7CPAA 1AMPA 5K8MA 3B3TA 4A37A 4YU9A 4NJRA 2XEGA 1EE3P 1R43A 3GLJA 3LWUA
chains in the Genus database with same CATH superfamily
2PC1A 2QVPA 2ABZA 2CY2A 3B2YA 1Q7LA 3H5ZA 3PBEA 5HVGA 1IGBA 4LQ6A 2PR1A 2Q44A 2ZOGA 4DNCA 4QUSA 5K8PA 2QYVA 3RYOA 5KTDA 1YMEA 3DR6A 3FX6A 2Z10A 3FBUA 1MK4A 1XJOA 1YVOA 2PJ0A 1IICA 1DTDA 1BAVA 3BJ7A 2VZZA 4TWEA 2J8RA 3PGPA 3RO0A 3KR4A 2FSRA 2GU2A 4NXYA 4B10A 1ELLP 4M6GA 3SI1A 4GXHA 4FD6A 4A95A 1Y0RA 2PVWA 4OIDA 3SI0A 1J4JA 2EK8A 1ZO0A 2J9AA 2DF5A 5AG6A 4EFDA 4M3SA 4K30A 4TNUA 4NEXA 2C6GA 2V8DA 2J8NA 3ISXA 1ZLIA 2YNEA 3SXNA 5HMNA 1YSJA 4P4JA 4AB7A 4NSQA 2ZEEA 5AG5A 5LYDA 2JDDA 1FY7A 2Q4YA 1S7KA 4CPAA 4FD5A 3QNVA 1CP7A 1YGHA 2AE6A 2Z3OA 4MI4A 4UBRA 4XNHC 2Q7BA 4C2XA 3B7IA 4C7IA 1M4DA 5IV0A 4KLWA 4JYWA 4P4IA 4B5PB 3I9SA 2WSAA 4KVXA 5CPAA 5D8NA 3BXMA 2B58A 2JDCA 1YLEA 2YNCC 3D66A 3DDDA 3MGDA 4XPDC 1IOIA 2PJ1A 3N5FA 4PV6A 2GANA 4KLVA 4B14A 5IX3A 5LYIA 3C26A 3HUVA 3TT2A 2HQYA 3PB8X 3EO4A 4IAVA 2FVGA 2PSWA 3TX8A 1Z5RA 2G9DA 4KVME 4CRYB 1CM0A 2I00A 2WZNA 4PXCA 4CGOA 4G1PA 3PFEA 4AG7A 5THWA 4B5OA 3WT4A 2DPSA 3LD2A 3IWEA 4X5KA 3L2NA 2ATRA 1Z8XA 2Q4ZA 4UCMA 3S6KA 4JWPA 4LX9A 3GKRA 1BPNA 3KASA 3IU1A 5CBMA 1VGYA 2B4BA 3B3VA 4R57A 3EFAA 4P10A 3NE7A 1BLLE 4U5YA 3FIXA 3HLPA 4PPZA 1ARLA 1MJ9A 3K9UA 3PZJA 4ZX8A 4AXVA 2HB6A 4MRIA 3D2PA 4P45A 1U6MA 3P2FA 3RBUA 4F6AA 3PB9X 3R1KA 3S6FA 4X3RA 4L8AA 3T9YA 4B12A 2OOTA 2HUZA 1HDUA 3GB0A 2Q04A 4AVCA 5JH9A 5J8FA 3NFZA 4MHDA 1YR0A 3D3SA 4R7MA 2Z3NA 4EVYA 3FRMA 4P6YA 4UIBA 1XFOA 3F5BA 4PQAA 3IFEA 4RUHA 1AYEA 1X10A 2AFZA 1Q2YA 2B3UA 1NE9A 3R9GA 3WABA 3TE4A 2WPWA 1PYTB 4ORFA 1NSLA 1M44A 2BEIA 4CAEA 2PCUA 4CYPA 2BCOA 1ON0A 2B3VA 5C82A 2ZEOA 4MFKA 2JLMA 4UWIA 4NGPA 2EO8A 2ANPA 1Z2LA 2VBQA 2WUUA 2ZW7A 3ISZA 3PB7X 4PSXA 4ZGYB 1YK3A 3KHZA 3D67A 1Y0YA 2BOAA 2BSWA 1XBUA 3H8FA 1ELMP 3PP9A 4MFQA 4C2YA 1GYTA 3BI0A 3DNSA 3K2KA 4ZX9A 3TO7A 1RTQA 2C6CA 1IOFA 3B35A 4LQGA 1KZFA 1H8LA 1YREA 4FUUA 1K4JA 4OC4A 4WJBA 5KTAA 2EWBA 3BJ8A 2ZEFA 4OC3A 2DXQA 2PJAA 4MCRA 5LRGA 3R96A 3SJEA 2FL4A 2O28A 3CPAA 2V8HA 5E96A 4B13A 4C7HA 4M6IA 1F57A 1N71A 1Z4RA 2B5GB 1IU8A 2VL1A 4A39A 4FBEA 2PR8A 4QC6A 4A2ZA 3H8EA 4CYNA 2H5MA 4NGNA 5J8CA 2AFWA 1CX8A 4JXRA 1P4NA 5EBVA 2CTBA 3F0AA 4MFZA 2V8GA 2WYRA 2R98A 3EY5A 4O23A 3GUXA 3CT9A 2PE3A 3G8WA 4R8FA 4BINA 1XF8A 4C68A 5EC4A 4H2KA 4P4DA 3KI9A 4UEEA 4YRHA 4Z65A 5F09A 3D4UA 3PB4X 1Y7EA 3NE8A 1VIXA 1Z4EA 2XEIA 4MXUA 4QVTA 5F48A 1VHOA 3S6HA 4H89A 3TO6A 4CYOA 1OZPA 1UWYA 1Y7RA 2Q51A 4UCNA 3CXPA 2FE7A 3D7DA 3NH4A 1TKHA 3TC8A 4FWUA 4UFVA 1RXTA 2D4OA 4MY0A 4WWVA 4E2AA 3RZAA 2GIVA 2I79A 4UCPA 4MFPA 5CNPA 3S9NA 4OIWA 2KCWA 4F0XA 2ZEDA 1XRYA 5KTCA 2P0WA 2HC9A 4KOYA 1RO5A 2FCKA 3ZJ0A 3B3CA 2IJZA 3EXNA 1IY7A 2RB7A 4R87A 3W91A 4BMHA 4OADA 4UA3A 4C2ZA 3CPXA 2QMLA 4EWTA 2Q7SA 3PEIA 1ZG7A 1TF9A 4NFRA 4KVOE 4CS0B 2AJ6A 4KORA 5AGEA 3LMSA 4F9VA 1P0HA 2C6PA 2RC4A 2DEAA 2B4DA 2JBJA 5I4MA 2ZEHA 2PRBA 1UFHA 3VWDA 4ZY0A 1F2OA 1M1DA 4A31A 1V0CA 2EVNA 1YW6A 4MCSA 1BOBA 4PXBA 4W9YA 3FYNA 3DLJA 2YNDA 2P6GA 3GY9A 3S9LA 2JBKA 2REFA 3B3SA 1WWZA 1Q2CA 3WC6A 4OLLA 4ZBGA 1FNOA 2CNMA 5JPHA 2CF4A 4NGSA 4P44A 2VQYA 3SJFA 3OWCA 4PSWA 4JD6A 1XMTA 3G3SA 2AFXA 1VHSA 3BHXA 2B4DB 1HEEA 2Z3LA 3QAHA 2GFQA 1XOVA 3PRTA 4IF5A 3WC7A 4NF1A 3NA6A 4ONWA 4R76A 4A30A 5JQ4A 2EUIA 3RAMA 4DYOA 4R3KA 4R3LA 3BI1A 2G0BA 3SJXA 1I21A 4CRZB 1LANA 3DR8A 4KSIA 3SI2A 4IUSA 2CNSA 4IK2A 4KSFA 3VATA 2Q43A 4A94A 2QECA 5C88A 4EMEA 2EK9A 1XMBA 3LACA 2J8MA 4OC2A 1Q2DA 2PIZA 4HNXB 1ARMA 2BO9A 3KQZA 4HPSA 4XPKA 1HDQA 1M4LA 3FJUA 2QJ8A 3ZZIA 1IYLA 4CGMA 5LRKA 4UIAA 3D68A 4UFXA 3KKWA 1Z9UA 5G1ZA 1VKCA 2PJ4A 3R95A 2V8VA 4MY3A 1LOKA 2YNCA 4L89A 2JEVA 4KUBA 3MN8A 2OU2A 2PJ8A 2IL4A 4KOSA 2O53A 5A27A 1X12A 4MMOA 2ZW5A 3H8GA 3N7ZA 5G22A 1M4IA 5LYLA 5J1QA 2R1IA 2RFHA 5IB9A 2BL1A 2PRQA 4I49A 3VWEA 1YX0A 2ZW6A 2ZOFA 5BWAB 2CIJA 1SQHA 2CTCA 2A4NA 4JJXA 4KUAA 3IIBA 4K3NA 4KZTA 4E8OA 1GHEA 3A9LA 1DE4C 2EBJA 2PJ7A 2NYQA 3V7ZA 2PJBA 4OC1A 3R9FA 3TCVA 5K8OA 5IB0A 4MCQA 2C27A 4KOVA 3CXSA 2PJ2A 1S7NA 5H84A 2CNTA 2Q0YA 4A38A 5ISVA 1MJBA 2V77A 3IWGA 4A32A 4DUKA 5FVJA 4YFJA 4CGPA 2Z3KA 1IYKA 4NGMA 4CGNA 1I12A 1R3NA 2ZW4A 1YVKA 1NMTA 2Y0MA 4KOXA 2Z11A 1YLOA 1B6BA 4PK3A 3DSBA 1LFWA 2G3AA 2HV2A 4RI1A 1JQGA 4MBUA 2K5TA 2ODFA 3S9MA 2XEJA 4FD7A 4HNYB 5ELYA 4B11A 1QSNA 1IB1E 2R7HA 4F0YA 3FMCA 5LRJA 3BLNA 1WK4A 5GCNA 1I1DA 3TFYA 4RN7A 4X8IA 3W6XA 3B3WA 3FEDA 2F8HA 2PJ6A 1ZLHA 2QIRA 4NGQA 2F7VA 3CDXA 4Y49C 1KUVA 1TKJA 4MHYA 5F49A 2VEZA 4KOUA 1XE4A 2IQ6A 4AVAA 4JLYA 5D29A 4UWJA 1BPMA 4MHPA 4UF4A 3GIUA 4M85A 1A2ZA 2FIAA 4OMEA 2Z3MA 2AFUA 4PXDA 2PJ3A 3QAYA 4NJQA 3D7FA 5I0CA 1OBRA 1QQ9A 2Z3PA 3GYAA 4IHMA 2NMTA 1R57A 4CAWA 4X2TA 4B5PA 3FF3A 4CAXA 3CXQA 3I3GA 5JGFA 3FB3A 4II9A 2I3CA 1LAPA 3PBBA 1CJWA 1XEBA 2ZENA 1VHEA 5H86A 5HH1A 2NSMA 4XPLA 1Z8TA 5DS0A 8CPAA 2ARHA 1CBXA 4CYQA 3D8PA 2R8VA 4PXEA 1YW4A 3EC4A 4P4FA 1QSRA 1PCAA 3KL9A 1LRZA 1YQEA 3FEEA 5G21A 1Z8WA 2OZHA 1KUXA 2P6EA 3IWWA 4AVBA 1KWMA 2PJCA 2AFSA 3D7HA 1Y9KA 4OC0A 3JRUA 2YGWA 1L0CA 2ZELA 1FT7A 2OZGA 4YGOA 3IC1A 3IGRA 4MCPA 4OP4A 2VXKA 3KZWA 3FECA 4A33A 3V8IA 4KSAA 5F46A 3IJ3A 2PJ5A 1ZG9A 5K8NA 2ZXVA 2IMOA 4NCZA 3R9EA 3T8WA 2O4HA 1PU9A 3KQXA 2Q4VA 3TOAA 1B87A 1BO4A 2AFOA 5AG4A 1XIXA 2OB0A 3TO9A 4ONUA 3P2HA 3S6GA 3SHPA 3FNCA 3WC5A 2F5IA 2FXFA 3KGQA 1QMUA 4ZYQA 3KR5A 3K9TA 4FD4A 3IU2A 4MHNA 2GE3A 3IO1A 3D7GA 1KUYA 4OC5A 3NH5A 4QB9A 4Y49B 5HXDA 5JM6A 2X7BA 1QSTA 4UEZA 2C1CA 1S5KA 4NGTA 4JXQA 3QB8A 4QBJA 2GLFA 4CAFA 5A28A 1CPXA 3I1UA 2JEWA 1F2PA 1QSOA 1S7FA 2ZEMA 4CGLA 4F9UA 3T90A 3FXTA 3VARA 4P4BA 4R6TA 1AUGA 4M6HA 2PJ9A 2OH1A 4Q38A 2ZPAA 4P4EA 4UFWA 2VI7A 4MFJA 3SXOA 3VH9A 4AG9A 1MJAA 4KS9A 5AG7A 4B6ZA 4H6UA 4J3GA 3V38A 1LAMA 4YWYA 4OKOA 3E0KA 2REEA 2PQ8A 3FH4A 4NGRA 3JUWA 2OR4A 3JVNA 2GLJA 4U9ZA 1TF8A 1Z8LA 3PB6X 5HVHA 4MFLA 3CZXA 3D2MA 3FVLA 3WR7A 2FIWA 2ZEPA 3LODA 2G3TA 2ZEGA 1S60A 1IIDA 1CP6A 5LYFA 4ZI6A 2B5GA 1PUAA 2Z0ZA 3F8KA 4ZY2A 1JWQA 1CPSA 2POKA 3H4QA 5DWMA 5HVFA 4LUAA 3B8GA 5G20A 2AFMA 4CAVA 4Q36A 2FT0A 2PIYA 3MRUA 1TXRA 3W6SA 4XNHB 4BBHA 4BD9A 1QSMA 4R9MA 2XEFA 2PVVA 1S7LA 4Q7AA 2OZUA 3RNZA 1NSAA 4UEFA 1ZG8A 2DPTA 3JTKA 4F8ZA 4FAIA 3KHXA 2FS5A 2P6FA 6CPAA 3SJGA 1LCPA 1TIQA 1TKFA 2D4PA 2BUEA 1S3ZA 1CG2A 2WPXA 3IEHA 4GM5A 4XPDB 4MHZA 3PFOA 4JZ0A 4U9YA 5F47A 4KOTA 2PDOA 4RS2A 4ZY1A 3DGVA 3NH8A 1Y9WA 4DJLA 2GREA 7CPAA 1AMPA 4PK2A 5EMIA 4E0AA 5K8MA 3B3TA 4A37A 4OAEA 1M4GA 3TOBA 3UY5A 3TTHA 4H6ZA 4HKFA 4YU9A 4MJ8A 4NJRA 5DWNA 2XEGA 2CXAA 1EE3P 2VZYA 1R43A 4KOWA 4GS4A 4HNWB 3GLJA 3LWUA
chains in the Genus database with same CATH topology
2QVPA 2ABZA 3B2YA 1Q7LA 3PBEA 5HVGA 1IGBA 2ZOGA 5K8PA 2QYVA 1YMEA 3FX6A 1XJOA 2PJ0A 1DTDA 1BAVA 4TWEA 3KR4A 2GU2A 1ELLP 3SI1A 1Y0RA 2PVWA 4OIDA 3SI0A 2EK8A 2J9AA 4EFDA 4TNUA 2C6GA 2V8DA 3ISXA 1ZLIA 1YSJA 4P4JA 2ZEEA 5LYDA 4CPAA 3QNVA 1CP7A 3B7IA 4JYWA 4P4IA 5D8NA 5CPAA 3BXMA 3D66A 2PJ1A 3N5FA 5LYIA 3HUVA 3PB8X 4IAVA 2FVGA 3TX8A 1Z5RA 2G9DA 2WZNA 4PXCA 4G1PA 3PFEA 5THWA 3WT4A 3L2NA 2Q4ZA 1BPNA 3KASA 5CBMA 1VGYA 3B3VA 4P10A 1BLLE 3HLPA 4PPZA 1ARLA 4ZX8A 4AXVA 2HB6A 4MRIA 4P45A 3RBUA 3PB9X 4X3RA 2OOTA 1HDUA 3GB0A 5JH9A 3NFZA 4R7MA 4P6YA 4UIBA 1XFOA 4PQAA 3IFEA 4RUHA 1AYEA 2AFZA 3WABA 1PYTB 2PCUA 2BCOA 2ZEOA 4NGPA 2ANPA 1Z2LA 3PB7X 3ISZA 3KHZA 3D67A 1Y0YA 2BOAA 3H8FA 1XBUA 1ELMP 1GYTA 3BI0A 3K2KA 4ZX9A 1RTQA 2C6CA 3B35A 4LQGA 1H8LA 4FUUA 4OC4A 4WJBA 2EWBA 2ZEFA 4OC3A 2PJAA 4MCRA 5LRGA 3SJEA 3CPAA 2V8HA 1F57A 2VL1A 4A39A 4FBEA 3H8EA 4NGNA 2AFWA 1CX8A 2CTBA 2V8GA 2WYRA 4O23A 3GUXA 3CT9A 2PE3A 4R8FA 4H2KA 4P4DA 3KI9A 4UEEA 4Z65A 5F09A 3D4UA 3PB4X 1Y7EA 1VIXA 2XEIA 4MXUA 1VHOA 1UWYA 2Q51A 3D7DA 3NH4A 1TKHA 3TC8A 4FWUA 4WWVA 3RZAA 3S9NA 4OIWA 2ZEDA 1XRYA 2HC9A 3B3CA 2IJZA 1IY7A 2RB7A 3CPXA 4EWTA 3PEIA 1ZG7A 1TF9A 4NFRA 4F9VA 3LMSA 2C6PA 5I4MA 2DEAA 2JBJA 2ZEHA 4ZY0A 1F2OA 1YW6A 4MCSA 4PXBA 4W9YA 3DLJA 3S9LA 2JBKA 3B3SA 3WC6A 1FNOA 2CF4A 4NGSA 4P44A 3SJFA 2AFXA 3BHXA 1HEEA 3PRTA 3WC7A 3NA6A 4ONWA 4R76A 3RAMA 4DYOA 3BI1A 3SJXA 1LANA 4KSIA 3SI2A 4IK2A 3VATA 2Q43A 4A94A 4EMEA 2EK9A 1XMBA 4OC2A 2PIZA 1ARMA 2BO9A 3KQZA 1HDQA 1M4LA 3FJUA 2QJ8A 5LRKA 4UIAA 3D68A 2PJ4A 2V8VA 1LOKA 3MN8A 2PJ8A 2O53A 4MMOA 3H8GA 5LYLA 5J1QA 2RFHA 5IB9A 2PRQA 2ZOFA 2CIJA 2CTCA 3IIBA 4K3NA 1DE4C 2PJ7A 2NYQA 3V7ZA 2PJBA 4OC1A 5K8OA 4MCQA 2PJ2A 4A38A 2V77A 4DUKA 4NGMA 1R3NA 1YLOA 1LFWA 1JQGA 3S9MA 2XEJA 5ELYA 3FMCA 5LRJA 4X8IA 3B3WA 3FEDA 2F8HA 2PJ6A 1ZLHA 4NGQA 2F7VA 3CDXA 1TKJA 4MHYA 2IQ6A 5D29A 1BPMA 4MHPA 4UF4A 4OMEA 2AFUA 4PXDA 2PJ3A 4NJQA 3D7FA 1OBRA 1QQ9A 4IHMA 5JGFA 4X2TA 3FF3A 2I3CA 1LAPA 3PBBA 2ZENA 1VHEA 2NSMA 5DS0A 8CPAA 1CBXA 4PXEA 1YW4A 4P4FA 3KL9A 1PCAA 3FEEA 3IWWA 2PJCA 1KWMA 2AFSA 3D7HA 4OC0A 3JRUA 2ZELA 1FT7A 3IC1A 4MCPA 4OP4A 3KZWA 3FECA 3IJ3A 2PJ5A 1ZG9A 5K8NA 3T8WA 2IMOA 2O4HA 3KQXA 2AFOA 3WC5A 3KGQA 1QMUA 4ZYQA 3KR5A 3K9TA 4MHNA 3IO1A 3D7GA 4OC5A 5HXDA 3NH5A 5JM6A 4UEZA 2C1CA 4NGTA 2GLFA 1CPXA 3I1UA 2JEWA 1F2PA 2ZEMA 4F9UA 3VARA 4P4BA 4R6TA 2PJ9A 4P4EA 3VH9A 4B6ZA 3V38A 1LAMA 4YWYA 4OKOA 3FH4A 4NGRA 2OR4A 2GLJA 1TF8A 1Z8LA 3PB6X 5HVHA 3FVLA 2ZEPA 2ZEGA 5LYFA 1CP6A 4ZI6A 4ZY2A 1CPSA 2POKA 5HVFA 2AFMA 2PIYA 3MRUA 1TXRA 4BD9A 2XEFA 2PVVA 4Q7AA 1NSAA 4UEFA 1ZG8A 4F8ZA 4FAIA 3KHXA 6CPAA 3SJGA 1LCPA 1TKFA 3IEHA 1CG2A 4GM5A 4MHZA 3PFOA 4JZ0A 4ZY1A 3DGVA 3NH8A 4DJLA 2GREA 7CPAA 1AMPA 5K8MA 3B3TA 4A37A 4YU9A 4NJRA 2XEGA 1EE3P 1R43A 3GLJA 3LWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVP A;  2ABZ A;  3B2Y A;  1Q7L A;  3PBE A;  5HVG A;  1IGB A;  2ZOG A;  5K8P A;  2QYV A;  1YME A;  3FX6 A;  1XJO A;  2PJ0 A;  1DTD A;  1BAV A;  4TWE A;  3KR4 A;  2GU2 A;  1ELL P;  3SI1 A;  1Y0R A;  2PVW A;  4OID A;  3SI0 A;  2EK8 A;  2J9A A;  4EFD A;  4TNU A;  2C6G A;  2V8D A;  3ISX A;  1ZLI A;  1YSJ A;  4P4J A;  2ZEE A;  5LYD A;  4CPA A;  3QNV A;  1CP7 A;  3B7I A;  4JYW A;  4P4I A;  5D8N A;  5CPA A;  3BXM A;  3D66 A;  2PJ1 A;  3N5F A;  5LYI A;  3HUV A;  3PB8 X;  4IAV A;  2FVG A;  3TX8 A;  1Z5R A;  2G9D A;  2WZN A;  4PXC A;  4G1P A;  3PFE A;  5THW A;  3WT4 A;  3L2N A;  2Q4Z A;  1BPN A;  3KAS A;  5CBM A;  1VGY A;  3B3V A;  4P10 A;  1BLL E;  3HLP A;  4PPZ A;  1ARL A;  4ZX8 A;  4AXV A;  2HB6 A;  4MRI A;  4P45 A;  3RBU A;  3PB9 X;  4X3R A;  2OOT A;  1HDU A;  3GB0 A;  5JH9 A;  3NFZ A;  4R7M A;  4P6Y A;  4UIB A;  1XFO A;  4PQA A;  3IFE A;  4RUH A;  1AYE A;  2AFZ A;  3WAB A;  1PYT B;  2PCU A;  2BCO A;  2ZEO A;  4NGP A;  2ANP A;  1Z2L A;  3PB7 X;  3ISZ A;  3KHZ A;  3D67 A;  1Y0Y A;  2BOA A;  3H8F A;  1XBU A;  1ELM P;  1GYT A;  3BI0 A;  3K2K A;  4ZX9 A;  1RTQ A;  2C6C A;  3B35 A;  4LQG A;  1H8L A;  4FUU A;  4OC4 A;  4WJB A;  2EWB A;  2ZEF A;  4OC3 A;  2PJA A;  4MCR A;  5LRG A;  3SJE A;  3CPA A;  2V8H A;  1F57 A;  2VL1 A;  4A39 A;  4FBE A;  3H8E A;  4NGN A;  2AFW A;  1CX8 A;  2CTB A;  2V8G A;  2WYR A;  4O23 A;  3GUX A;  3CT9 A;  2PE3 A;  4R8F A;  4H2K A;  4P4D A;  3KI9 A;  4UEE A;  4Z65 A;  5F09 A;  3D4U A;  3PB4 X;  1Y7E A;  1VIX A;  2XEI A;  4MXU A;  1VHO A;  1UWY A;  2Q51 A;  3D7D A;  3NH4 A;  1TKH A;  3TC8 A;  4FWU A;  4WWV A;  3RZA A;  3S9N A;  4OIW A;  2ZED A;  1XRY A;  2HC9 A;  3B3C A;  2IJZ A;  1IY7 A;  2RB7 A;  3CPX A;  4EWT A;  3PEI A;  1ZG7 A;  1TF9 A;  4NFR A;  4F9V A;  3LMS A;  2C6P A;  5I4M A;  2DEA A;  2JBJ A;  2ZEH A;  4ZY0 A;  1F2O A;  1YW6 A;  4MCS A;  4PXB A;  4W9Y A;  3DLJ A;  3S9L A;  2JBK A;  3B3S A;  3WC6 A;  1FNO A;  2CF4 A;  4NGS A;  4P44 A;  3SJF A;  2AFX A;  3BHX A;  1HEE A;  3PRT A;  3WC7 A;  3NA6 A;  4ONW A;  4R76 A;  3RAM A;  4DYO A;  3BI1 A;  3SJX A;  1LAN A;  4KSI A;  3SI2 A;  4IK2 A;  3VAT A;  2Q43 A;  4A94 A;  4EME A;  2EK9 A;  1XMB A;  4OC2 A;  2PIZ A;  1ARM A;  2BO9 A;  3KQZ A;  1HDQ A;  1M4L A;  3FJU A;  2QJ8 A;  5LRK A;  4UIA A;  3D68 A;  2PJ4 A;  2V8V A;  1LOK A;  3MN8 A;  2PJ8 A;  2O53 A;  4MMO A;  3H8G A;  5LYL A;  5J1Q A;  2RFH A;  5IB9 A;  2PRQ A;  2ZOF A;  2CIJ A;  2CTC A;  3IIB A;  4K3N A;  1DE4 C;  2PJ7 A;  2NYQ A;  3V7Z A;  2PJB A;  4OC1 A;  5K8O A;  4MCQ A;  2PJ2 A;  4A38 A;  2V77 A;  4DUK A;  4NGM A;  1R3N A;  1YLO A;  1LFW A;  1JQG A;  3S9M A;  2XEJ A;  5ELY A;  3FMC A;  5LRJ A;  4X8I A;  3B3W A;  3FED A;  2F8H A;  2PJ6 A;  1ZLH A;  4NGQ A;  2F7V A;  3CDX A;  1TKJ A;  4MHY A;  2IQ6 A;  5D29 A;  1BPM A;  4MHP A;  4UF4 A;  4OME A;  2AFU A;  4PXD A;  2PJ3 A;  4NJQ A;  3D7F A;  1OBR A;  1QQ9 A;  4IHM A;  5JGF A;  4X2T A;  3FF3 A;  2I3C A;  1LAP A;  3PBB A;  2ZEN A;  1VHE A;  2NSM A;  5DS0 A;  8CPA A;  1CBX A;  4PXE A;  1YW4 A;  4P4F A;  3KL9 A;  1PCA A;  3FEE A;  3IWW A;  2PJC A;  1KWM A;  2AFS A;  3D7H A;  4OC0 A;  3JRU A;  2ZEL A;  1FT7 A;  3IC1 A;  4MCP A;  4OP4 A;  3KZW A;  3FEC A;  3IJ3 A;  2PJ5 A;  1ZG9 A;  5K8N A;  3T8W A;  2IMO A;  2O4H A;  3KQX A;  2AFO A;  3WC5 A;  3KGQ A;  1QMU A;  4ZYQ A;  3KR5 A;  3K9T A;  4MHN A;  3IO1 A;  3D7G A;  4OC5 A;  5HXD A;  3NH5 A;  5JM6 A;  4UEZ A;  2C1C A;  4NGT A;  2GLF A;  1CPX A;  3I1U A;  2JEW A;  1F2P A;  2ZEM A;  4F9U A;  3VAR A;  4P4B A;  4R6T A;  2PJ9 A;  4P4E A;  3VH9 A;  4B6Z A;  3V38 A;  1LAM A;  4YWY A;  4OKO A;  3FH4 A;  4NGR A;  2OR4 A;  2GLJ A;  1TF8 A;  1Z8L A;  3PB6 X;  5HVH A;  3FVL A;  2ZEP A;  2ZEG A;  5LYF A;  1CP6 A;  4ZI6 A;  4ZY2 A;  1CPS A;  2POK A;  5HVF A;  2AFM A;  2PIY A;  3MRU A;  1TXR A;  4BD9 A;  2XEF A;  2PVV A;  4Q7A A;  1NSA A;  4UEF A;  1ZG8 A;  4F8Z A;  4FAI A;  3KHX A;  6CPA A;  3SJG A;  1LCP A;  1TKF A;  3IEH A;  1CG2 A;  4GM5 A;  4MHZ A;  3PFO A;  4JZ0 A;  4ZY1 A;  3DGV A;  3NH8 A;  4DJL A;  2GRE A;  7CPA A;  1AMP A;  5K8M A;  3B3T A;  4A37 A;  4YU9 A;  4NJR A;  2XEG A;  1EE3 P;  1R43 A;  3GLJ A;  3LWU A; 
#chains in the Genus database with same CATH topology
 2PC1 A;  2QVP A;  2ABZ A;  2CY2 A;  3B2Y A;  1Q7L A;  3H5Z A;  3PBE A;  5HVG A;  1IGB A;  4LQ6 A;  2PR1 A;  2Q44 A;  2ZOG A;  4DNC A;  4QUS A;  5K8P A;  2QYV A;  3RYO A;  5KTD A;  1YME A;  3DR6 A;  3FX6 A;  2Z10 A;  3FBU A;  1MK4 A;  1XJO A;  1YVO A;  2PJ0 A;  1IIC A;  1DTD A;  1BAV A;  3BJ7 A;  2VZZ A;  4TWE A;  2J8R A;  3PGP A;  3RO0 A;  3KR4 A;  2FSR A;  2GU2 A;  4NXY A;  4B10 A;  1ELL P;  4M6G A;  3SI1 A;  4GXH A;  4FD6 A;  4A95 A;  1Y0R A;  2PVW A;  4OID A;  3SI0 A;  1J4J A;  2EK8 A;  1ZO0 A;  2J9A A;  2DF5 A;  5AG6 A;  4EFD A;  4M3S A;  4K30 A;  4TNU A;  4NEX A;  2C6G A;  2V8D A;  2J8N A;  3ISX A;  1ZLI A;  2YNE A;  3SXN A;  5HMN A;  1YSJ A;  4P4J A;  4AB7 A;  4NSQ A;  2ZEE A;  5AG5 A;  5LYD A;  2JDD A;  1FY7 A;  2Q4Y A;  1S7K A;  4CPA A;  4FD5 A;  3QNV A;  1CP7 A;  1YGH A;  2AE6 A;  2Z3O A;  4MI4 A;  4UBR A;  4XNH C;  2Q7B A;  4C2X A;  3B7I A;  4C7I A;  1M4D A;  5IV0 A;  4KLW A;  4JYW A;  4P4I A;  4B5P B;  3I9S A;  2WSA A;  4KVX A;  5CPA A;  5D8N A;  3BXM A;  2B58 A;  2JDC A;  1YLE A;  2YNC C;  3D66 A;  3DDD A;  3MGD A;  4XPD C;  1IOI A;  2PJ1 A;  3N5F A;  4PV6 A;  2GAN A;  4KLV A;  4B14 A;  5IX3 A;  5LYI A;  3C26 A;  3HUV A;  3TT2 A;  2HQY A;  3PB8 X;  3EO4 A;  4IAV A;  2FVG A;  2PSW A;  3TX8 A;  1Z5R A;  2G9D A;  4KVM E;  4CRY B;  1CM0 A;  2I00 A;  2WZN A;  4PXC A;  4CGO A;  4G1P A;  3PFE A;  4AG7 A;  5THW A;  4B5O A;  3WT4 A;  2DPS A;  3LD2 A;  3IWE A;  4X5K A;  3L2N A;  2ATR A;  1Z8X A;  2Q4Z A;  4UCM A;  3S6K A;  4JWP A;  4LX9 A;  3GKR A;  1BPN A;  3KAS A;  3IU1 A;  5CBM A;  1VGY A;  2B4B A;  3B3V A;  4R57 A;  3EFA A;  4P10 A;  3NE7 A;  1BLL E;  4U5Y A;  3FIX A;  3HLP A;  4PPZ A;  1ARL A;  1MJ9 A;  3K9U A;  3PZJ A;  4ZX8 A;  4AXV A;  2HB6 A;  4MRI A;  3D2P A;  4P45 A;  1U6M A;  3P2F A;  3RBU A;  4F6A A;  3PB9 X;  3R1K A;  3S6F A;  4X3R A;  4L8A A;  3T9Y A;  4B12 A;  2OOT A;  2HUZ A;  1HDU A;  3GB0 A;  2Q04 A;  4AVC A;  5JH9 A;  5J8F A;  3NFZ A;  4MHD A;  1YR0 A;  3D3S A;  4R7M A;  2Z3N A;  4EVY A;  3FRM A;  4P6Y A;  4UIB A;  1XFO A;  3F5B A;  4PQA A;  3IFE A;  4RUH A;  1AYE A;  1X10 A;  2AFZ A;  1Q2Y A;  2B3U A;  1NE9 A;  3R9G A;  3WAB A;  3TE4 A;  2WPW A;  1PYT B;  4ORF A;  1NSL A;  1M44 A;  2BEI A;  4CAE A;  2PCU A;  4CYP A;  2BCO A;  1ON0 A;  2B3V A;  5C82 A;  2ZEO A;  4MFK A;  2JLM A;  4UWI A;  4NGP A;  2EO8 A;  2ANP A;  1Z2L A;  2VBQ A;  2WUU A;  2ZW7 A;  3ISZ A;  3PB7 X;  4PSX A;  4ZGY B;  1YK3 A;  3KHZ A;  3D67 A;  1Y0Y A;  2BOA A;  2BSW A;  1XBU A;  3H8F A;  1ELM P;  3PP9 A;  4MFQ A;  4C2Y A;  1GYT A;  3BI0 A;  3DNS A;  3K2K A;  4ZX9 A;  3TO7 A;  1RTQ A;  2C6C A;  1IOF A;  3B35 A;  4LQG A;  1KZF A;  1H8L A;  1YRE A;  4FUU A;  1K4J A;  4OC4 A;  4WJB A;  5KTA A;  2EWB A;  3BJ8 A;  2ZEF A;  4OC3 A;  2DXQ A;  2PJA A;  4MCR A;  5LRG A;  3R96 A;  3SJE A;  2FL4 A;  2O28 A;  3CPA A;  2V8H A;  5E96 A;  4B13 A;  4C7H A;  4M6I A;  1F57 A;  1N71 A;  1Z4R A;  2B5G B;  1IU8 A;  2VL1 A;  4A39 A;  4FBE A;  2PR8 A;  4QC6 A;  4A2Z A;  3H8E A;  4CYN A;  2H5M A;  4NGN A;  5J8C A;  2AFW A;  1CX8 A;  4JXR A;  1P4N A;  5EBV A;  2CTB A;  3F0A A;  4MFZ A;  2V8G A;  2WYR A;  2R98 A;  3EY5 A;  4O23 A;  3GUX A;  3CT9 A;  2PE3 A;  3G8W A;  4R8F A;  4BIN A;  1XF8 A;  4C68 A;  5EC4 A;  4H2K A;  4P4D A;  3KI9 A;  4UEE A;  4YRH A;  4Z65 A;  5F09 A;  3D4U A;  3PB4 X;  1Y7E A;  3NE8 A;  1VIX A;  1Z4E A;  2XEI A;  4MXU A;  4QVT A;  5F48 A;  1VHO A;  3S6H A;  4H89 A;  3TO6 A;  4CYO A;  1OZP A;  1UWY A;  1Y7R A;  2Q51 A;  4UCN A;  3CXP A;  2FE7 A;  3D7D A;  3NH4 A;  1TKH A;  3TC8 A;  4FWU A;  4UFV A;  1RXT A;  2D4O A;  4MY0 A;  4WWV A;  4E2A A;  3RZA A;  2GIV A;  2I79 A;  4UCP A;  4MFP A;  5CNP A;  3S9N A;  4OIW A;  2KCW A;  4F0X A;  2ZED A;  1XRY A;  5KTC A;  2P0W A;  2HC9 A;  4KOY A;  1RO5 A;  2FCK A;  3ZJ0 A;  3B3C A;  2IJZ A;  3EXN A;  1IY7 A;  2RB7 A;  4R87 A;  3W91 A;  4BMH A;  4OAD A;  4UA3 A;  4C2Z A;  3CPX A;  2QML A;  4EWT A;  2Q7S A;  3PEI A;  1ZG7 A;  1TF9 A;  4NFR A;  4KVO E;  4CS0 B;  2AJ6 A;  4KOR A;  5AGE A;  3LMS A;  4F9V A;  1P0H A;  2C6P A;  2RC4 A;  2DEA A;  2B4D A;  2JBJ A;  5I4M A;  2ZEH A;  2PRB A;  1UFH A;  3VWD A;  4ZY0 A;  1F2O A;  1M1D A;  4A31 A;  1V0C A;  2EVN A;  1YW6 A;  4MCS A;  1BOB A;  4PXB A;  4W9Y A;  3FYN A;  3DLJ A;  2YND A;  2P6G A;  3GY9 A;  3S9L A;  2JBK A;  2REF A;  3B3S A;  1WWZ A;  1Q2C A;  3WC6 A;  4OLL A;  4ZBG A;  1FNO A;  2CNM A;  5JPH A;  2CF4 A;  4NGS A;  4P44 A;  2VQY A;  3SJF A;  3OWC A;  4PSW A;  4JD6 A;  1XMT A;  3G3S A;  2AFX A;  1VHS A;  3BHX A;  2B4D B;  1HEE A;  2Z3L A;  3QAH A;  2GFQ A;  1XOV A;  3PRT A;  4IF5 A;  3WC7 A;  4NF1 A;  3NA6 A;  4ONW A;  4R76 A;  4A30 A;  5JQ4 A;  2EUI A;  3RAM A;  4DYO A;  4R3K A;  4R3L A;  3BI1 A;  2G0B A;  3SJX A;  1I21 A;  4CRZ B;  1LAN A;  3DR8 A;  4KSI A;  3SI2 A;  4IUS A;  2CNS A;  4IK2 A;  4KSF A;  3VAT A;  2Q43 A;  4A94 A;  2QEC A;  5C88 A;  4EME A;  2EK9 A;  1XMB A;  3LAC A;  2J8M A;  4OC2 A;  1Q2D A;  2PIZ A;  4HNX B;  1ARM A;  2BO9 A;  3KQZ A;  4HPS A;  4XPK A;  1HDQ A;  1M4L A;  3FJU A;  2QJ8 A;  3ZZI A;  1IYL A;  4CGM A;  5LRK A;  4UIA A;  3D68 A;  4UFX A;  3KKW A;  1Z9U A;  5G1Z A;  1VKC A;  2PJ4 A;  3R95 A;  2V8V A;  4MY3 A;  1LOK A;  2YNC A;  4L89 A;  2JEV A;  4KUB A;  3MN8 A;  2OU2 A;  2PJ8 A;  2IL4 A;  4KOS A;  2O53 A;  5A27 A;  1X12 A;  4MMO A;  2ZW5 A;  3H8G A;  3N7Z A;  5G22 A;  1M4I A;  5LYL A;  5J1Q A;  2R1I A;  2RFH A;  5IB9 A;  2BL1 A;  2PRQ A;  4I49 A;  3VWE A;  1YX0 A;  2ZW6 A;  2ZOF A;  5BWA B;  2CIJ A;  1SQH A;  2CTC A;  2A4N A;  4JJX A;  4KUA A;  3IIB A;  4K3N A;  4KZT A;  4E8O A;  1GHE A;  3A9L A;  1DE4 C;  2EBJ A;  2PJ7 A;  2NYQ A;  3V7Z A;  2PJB A;  4OC1 A;  3R9F A;  3TCV A;  5K8O A;  5IB0 A;  4MCQ A;  2C27 A;  4KOV A;  3CXS A;  2PJ2 A;  1S7N A;  5H84 A;  2CNT A;  2Q0Y A;  4A38 A;  5ISV A;  1MJB A;  2V77 A;  3IWG A;  4A32 A;  4DUK A;  5FVJ A;  4YFJ A;  4CGP A;  2Z3K A;  1IYK A;  4NGM A;  4CGN A;  1I12 A;  1R3N A;  2ZW4 A;  1YVK A;  1NMT A;  2Y0M A;  4KOX A;  2Z11 A;  1YLO A;  1B6B A;  4PK3 A;  3DSB A;  1LFW A;  2G3A A;  2HV2 A;  4RI1 A;  1JQG A;  4MBU A;  2K5T A;  2ODF A;  3S9M A;  2XEJ A;  4FD7 A;  4HNY B;  5ELY A;  4B11 A;  1QSN A;  1IB1 E;  2R7H A;  4F0Y A;  3FMC A;  5LRJ A;  3BLN A;  1WK4 A;  5GCN A;  1I1D A;  3TFY A;  4RN7 A;  4X8I A;  3W6X A;  3B3W A;  3FED A;  2F8H A;  2PJ6 A;  1ZLH A;  2QIR A;  4NGQ A;  2F7V A;  3CDX A;  4Y49 C;  1KUV A;  1TKJ A;  4MHY A;  5F49 A;  2VEZ A;  4KOU A;  1XE4 A;  2IQ6 A;  4AVA A;  4JLY A;  5D29 A;  4UWJ A;  1BPM A;  4MHP A;  4UF4 A;  3GIU A;  4M85 A;  1A2Z A;  2FIA A;  4OME A;  2Z3M A;  2AFU A;  4PXD A;  2PJ3 A;  3QAY A;  4NJQ A;  3D7F A;  5I0C A;  1OBR A;  1QQ9 A;  2Z3P A;  3GYA A;  4IHM A;  2NMT A;  1R57 A;  4CAW A;  4X2T A;  4B5P A;  3FF3 A;  4CAX A;  3CXQ A;  3I3G A;  5JGF A;  3FB3 A;  4II9 A;  2I3C A;  1LAP A;  3PBB A;  1CJW A;  1XEB A;  2ZEN A;  1VHE A;  5H86 A;  5HH1 A;  2NSM A;  4XPL A;  1Z8T A;  5DS0 A;  8CPA A;  2ARH A;  1CBX A;  4CYQ A;  3D8P A;  2R8V A;  4PXE A;  1YW4 A;  3EC4 A;  4P4F A;  1QSR A;  1PCA A;  3KL9 A;  1LRZ A;  1YQE A;  3FEE A;  5G21 A;  1Z8W A;  2OZH A;  1KUX A;  2P6E A;  3IWW A;  4AVB A;  1KWM A;  2PJC A;  2AFS A;  3D7H A;  1Y9K A;  4OC0 A;  3JRU A;  2YGW A;  1L0C A;  2ZEL A;  1FT7 A;  2OZG A;  4YGO A;  3IC1 A;  3IGR A;  4MCP A;  4OP4 A;  2VXK A;  3KZW A;  3FEC A;  4A33 A;  3V8I A;  4KSA A;  5F46 A;  3IJ3 A;  2PJ5 A;  1ZG9 A;  5K8N A;  2ZXV A;  2IMO A;  4NCZ A;  3R9E A;  3T8W A;  2O4H A;  1PU9 A;  3KQX A;  2Q4V A;  3TOA A;  1B87 A;  1BO4 A;  2AFO A;  5AG4 A;  1XIX A;  2OB0 A;  3TO9 A;  4ONU A;  3P2H A;  3S6G A;  3SHP A;  3FNC A;  3WC5 A;  2F5I A;  2FXF A;  3KGQ A;  1QMU A;  4ZYQ A;  3KR5 A;  3K9T A;  4FD4 A;  3IU2 A;  4MHN A;  2GE3 A;  3IO1 A;  3D7G A;  1KUY A;  4OC5 A;  3NH5 A;  4QB9 A;  4Y49 B;  5HXD A;  5JM6 A;  2X7B A;  1QST A;  4UEZ A;  2C1C A;  1S5K A;  4NGT A;  4JXQ A;  3QB8 A;  4QBJ A;  2GLF A;  4CAF A;  5A28 A;  1CPX A;  3I1U A;  2JEW A;  1F2P A;  1QSO A;  1S7F A;  2ZEM A;  4CGL A;  4F9U A;  3T90 A;  3FXT A;  3VAR A;  4P4B A;  4R6T A;  1AUG A;  4M6H A;  2PJ9 A;  2OH1 A;  4Q38 A;  2ZPA A;  4P4E A;  4UFW A;  2VI7 A;  4MFJ A;  3SXO A;  3VH9 A;  4AG9 A;  1MJA A;  4KS9 A;  5AG7 A;  4B6Z A;  4H6U A;  4J3G A;  3V38 A;  1LAM A;  4YWY A;  4OKO A;  3E0K A;  2REE A;  2PQ8 A;  3FH4 A;  4NGR A;  3JUW A;  2OR4 A;  3JVN A;  2GLJ A;  4U9Z A;  1TF8 A;  1Z8L A;  3PB6 X;  5HVH A;  4MFL A;  3CZX A;  3D2M A;  3FVL A;  3WR7 A;  2FIW A;  2ZEP A;  3LOD A;  2G3T A;  2ZEG A;  1S60 A;  1IID A;  1CP6 A;  5LYF A;  4ZI6 A;  2B5G A;  1PUA A;  2Z0Z A;  3F8K A;  4ZY2 A;  1JWQ A;  1CPS A;  2POK A;  3H4Q A;  5DWM A;  5HVF A;  4LUA A;  3B8G A;  5G20 A;  2AFM A;  4CAV A;  4Q36 A;  2FT0 A;  2PIY A;  3MRU A;  1TXR A;  3W6S A;  4XNH B;  4BBH A;  4BD9 A;  1QSM A;  4R9M A;  2XEF A;  2PVV A;  1S7L A;  4Q7A A;  2OZU A;  3RNZ A;  1NSA A;  4UEF A;  1ZG8 A;  2DPT A;  3JTK A;  4F8Z A;  4FAI A;  3KHX A;  2FS5 A;  2P6F A;  6CPA A;  3SJG A;  1LCP A;  1TIQ A;  1TKF A;  2D4P A;  2BUE A;  1S3Z A;  1CG2 A;  2WPX A;  3IEH A;  4GM5 A;  4XPD B;  4MHZ A;  3PFO A;  4JZ0 A;  4U9Y A;  5F47 A;  4KOT A;  2PDO A;  4RS2 A;  4ZY1 A;  3DGV A;  3NH8 A;  1Y9W A;  4DJL A;  2GRE A;  7CPA A;  1AMP A;  4PK2 A;  5EMI A;  4E0A A;  5K8M A;  3B3T A;  4A37 A;  4OAE A;  1M4G A;  3TOB A;  3UY5 A;  3TTH A;  4H6Z A;  4HKF A;  4YU9 A;  4MJ8 A;  4NJR A;  5DWN A;  2XEG A;  2CXA A;  1EE3 P;  2VZY A;  1R43 A;  4KOW A;  4GS4 A;  4HNW B;  3GLJ A;  3LWU A; 
#chains in the Genus database with same CATH homology
 2QVP A;  2ABZ A;  3B2Y A;  1Q7L A;  3PBE A;  5HVG A;  1IGB A;  2ZOG A;  5K8P A;  2QYV A;  1YME A;  3FX6 A;  1XJO A;  2PJ0 A;  1DTD A;  1BAV A;  4TWE A;  3KR4 A;  2GU2 A;  1ELL P;  3SI1 A;  1Y0R A;  2PVW A;  4OID A;  3SI0 A;  2EK8 A;  2J9A A;  4EFD A;  4TNU A;  2C6G A;  2V8D A;  3ISX A;  1ZLI A;  1YSJ A;  4P4J A;  2ZEE A;  5LYD A;  4CPA A;  3QNV A;  1CP7 A;  3B7I A;  4JYW A;  4P4I A;  5D8N A;  5CPA A;  3BXM A;  3D66 A;  2PJ1 A;  3N5F A;  5LYI A;  3HUV A;  3PB8 X;  4IAV A;  2FVG A;  3TX8 A;  1Z5R A;  2G9D A;  2WZN A;  4PXC A;  4G1P A;  3PFE A;  5THW A;  3WT4 A;  3L2N A;  2Q4Z A;  1BPN A;  3KAS A;  5CBM A;  1VGY A;  3B3V A;  4P10 A;  1BLL E;  3HLP A;  4PPZ A;  1ARL A;  4ZX8 A;  4AXV A;  2HB6 A;  4MRI A;  4P45 A;  3RBU A;  3PB9 X;  4X3R A;  2OOT A;  1HDU A;  3GB0 A;  5JH9 A;  3NFZ A;  4R7M A;  4P6Y A;  4UIB A;  1XFO A;  4PQA A;  3IFE A;  4RUH A;  1AYE A;  2AFZ A;  3WAB A;  1PYT B;  2PCU A;  2BCO A;  2ZEO A;  4NGP A;  2ANP A;  1Z2L A;  3PB7 X;  3ISZ A;  3KHZ A;  3D67 A;  1Y0Y A;  2BOA A;  3H8F A;  1XBU A;  1ELM P;  1GYT A;  3BI0 A;  3K2K A;  4ZX9 A;  1RTQ A;  2C6C A;  3B35 A;  4LQG A;  1H8L A;  4FUU A;  4OC4 A;  4WJB A;  2EWB A;  2ZEF A;  4OC3 A;  2PJA A;  4MCR A;  5LRG A;  3SJE A;  3CPA A;  2V8H A;  1F57 A;  2VL1 A;  4A39 A;  4FBE A;  3H8E A;  4NGN A;  2AFW A;  1CX8 A;  2CTB A;  2V8G A;  2WYR A;  4O23 A;  3GUX A;  3CT9 A;  2PE3 A;  4R8F A;  4H2K A;  4P4D A;  3KI9 A;  4UEE A;  4Z65 A;  5F09 A;  3D4U A;  3PB4 X;  1Y7E A;  1VIX A;  2XEI A;  4MXU A;  1VHO A;  1UWY A;  2Q51 A;  3D7D A;  3NH4 A;  1TKH A;  3TC8 A;  4FWU A;  4WWV A;  3RZA A;  3S9N A;  4OIW A;  2ZED A;  1XRY A;  2HC9 A;  3B3C A;  2IJZ A;  1IY7 A;  2RB7 A;  3CPX A;  4EWT A;  3PEI A;  1ZG7 A;  1TF9 A;  4NFR A;  4F9V A;  3LMS A;  2C6P A;  5I4M A;  2DEA A;  2JBJ A;  2ZEH A;  4ZY0 A;  1F2O A;  1YW6 A;  4MCS A;  4PXB A;  4W9Y A;  3DLJ A;  3S9L A;  2JBK A;  3B3S A;  3WC6 A;  1FNO A;  2CF4 A;  4NGS A;  4P44 A;  3SJF A;  2AFX A;  3BHX A;  1HEE A;  3PRT A;  3WC7 A;  3NA6 A;  4ONW A;  4R76 A;  3RAM A;  4DYO A;  3BI1 A;  3SJX A;  1LAN A;  4KSI A;  3SI2 A;  4IK2 A;  3VAT A;  2Q43 A;  4A94 A;  4EME A;  2EK9 A;  1XMB A;  4OC2 A;  2PIZ A;  1ARM A;  2BO9 A;  3KQZ A;  1HDQ A;  1M4L A;  3FJU A;  2QJ8 A;  5LRK A;  4UIA A;  3D68 A;  2PJ4 A;  2V8V A;  1LOK A;  3MN8 A;  2PJ8 A;  2O53 A;  4MMO A;  3H8G A;  5LYL A;  5J1Q A;  2RFH A;  5IB9 A;  2PRQ A;  2ZOF A;  2CIJ A;  2CTC A;  3IIB A;  4K3N A;  1DE4 C;  2PJ7 A;  2NYQ A;  3V7Z A;  2PJB A;  4OC1 A;  5K8O A;  4MCQ A;  2PJ2 A;  4A38 A;  2V77 A;  4DUK A;  4NGM A;  1R3N A;  1YLO A;  1LFW A;  1JQG A;  3S9M A;  2XEJ A;  5ELY A;  3FMC A;  5LRJ A;  4X8I A;  3B3W A;  3FED A;  2F8H A;  2PJ6 A;  1ZLH A;  4NGQ A;  2F7V A;  3CDX A;  1TKJ A;  4MHY A;  2IQ6 A;  5D29 A;  1BPM A;  4MHP A;  4UF4 A;  4OME A;  2AFU A;  4PXD A;  2PJ3 A;  4NJQ A;  3D7F A;  1OBR A;  1QQ9 A;  4IHM A;  5JGF A;  4X2T A;  3FF3 A;  2I3C A;  1LAP A;  3PBB A;  2ZEN A;  1VHE A;  2NSM A;  5DS0 A;  8CPA A;  1CBX A;  4PXE A;  1YW4 A;  4P4F A;  3KL9 A;  1PCA A;  3FEE A;  3IWW A;  2PJC A;  1KWM A;  2AFS A;  3D7H A;  4OC0 A;  3JRU A;  2ZEL A;  1FT7 A;  3IC1 A;  4MCP A;  4OP4 A;  3KZW A;  3FEC A;  3IJ3 A;  2PJ5 A;  1ZG9 A;  5K8N A;  3T8W A;  2IMO A;  2O4H A;  3KQX A;  2AFO A;  3WC5 A;  3KGQ A;  1QMU A;  4ZYQ A;  3KR5 A;  3K9T A;  4MHN A;  3IO1 A;  3D7G A;  4OC5 A;  5HXD A;  3NH5 A;  5JM6 A;  4UEZ A;  2C1C A;  4NGT A;  2GLF A;  1CPX A;  3I1U A;  2JEW A;  1F2P A;  2ZEM A;  4F9U A;  3VAR A;  4P4B A;  4R6T A;  2PJ9 A;  4P4E A;  3VH9 A;  4B6Z A;  3V38 A;  1LAM A;  4YWY A;  4OKO A;  3FH4 A;  4NGR A;  2OR4 A;  2GLJ A;  1TF8 A;  1Z8L A;  3PB6 X;  5HVH A;  3FVL A;  2ZEP A;  2ZEG A;  5LYF A;  1CP6 A;  4ZI6 A;  4ZY2 A;  1CPS A;  2POK A;  5HVF A;  2AFM A;  2PIY A;  3MRU A;  1TXR A;  4BD9 A;  2XEF A;  2PVV A;  4Q7A A;  1NSA A;  4UEF A;  1ZG8 A;  4F8Z A;  4FAI A;  3KHX A;  6CPA A;  3SJG A;  1LCP A;  1TKF A;  3IEH A;  1CG2 A;  4GM5 A;  4MHZ A;  3PFO A;  4JZ0 A;  4ZY1 A;  3DGV A;  3NH8 A;  4DJL A;  2GRE A;  7CPA A;  1AMP A;  5K8M A;  3B3T A;  4A37 A;  4YU9 A;  4NJR A;  2XEG A;  1EE3 P;  1R43 A;  3GLJ A;  3LWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...