4A31A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 121
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a31A00
2WSAA 5AG7A 4CGMA 4B11A 4B13A 4UFXA 4CGLA 4A33A 3IU2A 4BBHA 4CYPA 4UFWA 2YNCA 3IU1A 4UCPA 4A95A 4B10A 4A30A 4CYOA 4CGOA 2YNEA 4CGPA 4CGNA 4CAFA 3IWEA 3JTKA 4A2ZA 5G1ZA 4C7IA 4UCMA 4B14A 4CYNA 2YNDA 3H5ZA 5AG4A 5AGEA 4A31A 4CYQA 5G21A 5A28A 4UFVA 4C7HA 4UCNA 4C2YA 4A32A 2YNCC 4B12A 5G22A 2WUUA 5AG5A 5A27A 4CAEA 4C68A 5G20A 5AG6A 4C2XA 4C2ZA
chains in the Genus database with same CATH superfamily
2V77A 3KASA 1S5KA 1RTQA 3RNZA 3K2KA 1Y9WA 5I4MA 3R1KA 1OZPA 5LRGA 4MFJA 2Z0ZA 4JWPA 4L89A 2PVVA 2K5TA 3JRUA 2Q51A 4NF1A 4Q36A 2RB7A 4FAIA 4RI1A 2F8HA 3DR8A 3T9YA 2J8MA 4PXCA 2PC1A 3A9LA 4IK2A 4UWIA 4FD6A 4R76A 4CPAA 2V8VA 3IEHA 1V0CA 5DWMA 3RZAA 4A32A 2GREA 2ZEPA 4NJRA 2ZEDA 1CP7A 3SXNA 4B6ZA 2AFMA 3IGRA 4PPZA 3S9NA 1QSNA 2HV2A 3IJ3A 1XOVA 3FVLA 3OWCA 2HUZA 2QYVA 3VWDA 2PQ8A 1FT7A 3PB6X 4H6UA 4NEXA 2QMLA 3R96A 1RO5A 3L2NA 4FWUA 3T8WA 3G3SA 1VHEA 1M4DA 4CAFA 2B5GA 1ARMA 1XRYA 3N5FA 2B3VA 4OC2A 2VL1A 2EUIA 2XEFA 3JVNA 4R6TA 2ZELA 5K8OA 4A31A 2CY2A 1CM0A 4KOUA 4MY3A 1BPNA 4CRYB 4UCNA 2BO9A 4P4BA 4OP4A 3VARA 2ZEGA 4JJXA 1LAPA 3KZWA 1IYLA 5KTAA 3V7ZA 2DF5A 1ZO0A 4L8AA 3D67A 2OU2A 2GLFA 4OC3A 3B3SA 2OZHA 4HNYB 1LRZA 3D8PA 4XNHB 4KUAA 2OZUA 5LYFA 4A95A 1KUYA 4CGOA 3FIXA 4X3RA 4MBUA 1JQGA 4H6ZA 1AMPA 2FT0A 3B3CA 5G1ZA 2PJ8A 3D7HA 3FB3A 1JWQA 3EFAA 4KVXA 5EBVA 4F0YA 1QMUA 1TKHA 2CXAA 2G3AA 2BL1A 3H8FA 5G21A 4ZX8A 4CYQA 3MN8A 3NH8A 4A94A 1CPXA 1HDQA 2O28A 1L0CA 5G22A 4MCQA 1PCAA 4ZGYB 5LYDA 2Z3MA 4P4DA 4F8ZA 2DEAA 2PJCA 1S7FA 2PSWA 4B13A 3FMCA 4AG9A 2VZYA 4MCSA 1ARLA 4KOYA 5F48A 3DNSA 2FCKA 2Z3LA 1M4IA 1KUXA 3NFZA 2BCOA 4CYPA 5HXDA 2O4HA 3QAHA 1X10A 5H86A 3EXNA 3FX6A 3IWGA 4OLLA 1KUVA 3LACA 2AE6A 3LMSA 4Q38A 2Q43A 2Z11A 3DGVA 4X8IA 5F49A 2EO8A 4MXUA 4NGQA 1OBRA 5JGFA 2DPTA 1XIXA 4LQ6A 3KQZA 1TF9A 5D29A 1EE3P 1ELMP 1LANA 1CX8A 1R57A 2QECA 4OC4A 5K8NA 4U9YA 1IOIA 1XE4A 2PDOA 4X2TA 5JQ4A 3FBUA 5AG6A 3BJ7A 2Q7BA 3VATA 5HMNA 3S6GA 2EK8A 2ZENA 4GM5A 2Q04A 4MRIA 4CGLA 1CP6A 2JDDA 4XPDB 1R43A 2GLJA 3F0AA 4RUHA 3RBUA 3IC1A 5F46A 5HVGA 1CPSA 3CPXA 4MCRA 4CYOA 3H8GA 3GYAA 2YGWA 2Z3NA 4PK3A 4ZY1A 1QSMA 3I1UA 2ARHA 4J3GA 4C7IA 1YGHA 4YU9A 2DXQA 4UEEA 1YREA 4ONWA 2XEJA 4Y49B 4AVCA 3S6KA 2KCWA 2C6CA 4AVBA 2REFA 2ZXVA 4C2YA 5EMIA 4LQGA 1VIXA 3S6FA 1M4GA 1YX0A 5FVJA 1IGBA 3TO6A 2JLMA 4B5PB 4UEZA 1M4LA 2ZOGA 3BI0A 1YVOA 5HH1A 3FYNA 3CXPA 4IAVA 2FSRA 2FIAA 4K30A 4KZTA 3VWEA 3PB7X 4CGPA 2BOAA 3CT9A 4MFLA 3RO0A 1LCPA 1QSRA 4M6HA 4A2ZA 2B4DB 1PYTB 4II9A 2BEIA 1Y7RA 1VHSA 3H5ZA 2C6GA 2FXFA 3W6XA 3GKRA 2Q44A 2ATRA 1B87A 1B6BA 3KGQA 1CJWA 1J4JA 2VBQA 2IMOA 3D68A 3SHPA 2JEVA 3SI2A 4KOTA 4F0XA 3TE4A 1XF8A 3WR7A 2WUUA 4QBJA 4OAEA 4R87A 2PJBA 1NSAA 3PFOA 5IB0A 1IB1E 4M85A 1P4NA 3KR5A 2WPXA 4KOXA 2XEGA 7CPAA 1IY7A 4OADA 1WK4A 2JBKA 3E0KA 5HVFA 2D4OA 1XBUA 4MHPA 1WWZA 3PGPA 4BINA 4X5KA 3PEIA 4U5YA 4CAXA 1Y9KA 4NGMA 4DJLA 2V8GA 3PRTA 2Q4ZA 2FVGA 4WWVA 1A2ZA 1K4JA 4NXYA 4R8FA 3QAYA 3H4QA 2CNMA 3F5BA 2OB0A 3PP9A 5F47A 4RN7A 1YR0A 2FS5A 3TO9A 4LX9A 2Q4VA 1Z2LA 4MJ8A 3R9FA 2NSMA 2H5MA 2P6EA 3B35A 3B2YA 3BXMA 2IQ6A 3CXQA 6CPAA 5LYLA 4H2KA 3IO1A 5ISVA 1F57A 4MFKA 3B3VA 4C68A 2ABZA 2ZEHA 4R57A 3BHXA 3RYOA 1XJOA 1UFHA 1UWYA 3IWWA 2PCUA 2R98A 1MJAA 2BUEA 3EC4A 1Z8WA 4HKFA 4KVME 3CDXA 1I12A 2XEIA 4P45A 4HNXB 2AFSA 3D7DA 4CGNA 1BOBA 4NGRA 3PBEA 3D4UA 3IWEA 4FD5A 4MY0A 3GLJA 1N71A 2J8NA 2HQYA 5DS0A 4MHZA 2A4NA 3GB0A 2GANA 4KLVA 5A28A 2FE7A 3D2PA 1TXRA 4MHNA 2C1CA 2DPSA 4QUSA 2Z3KA 3S6HA 1NE9A 3ISXA 4P10A 3WC5A 4EMEA 3ISZA 2ZEEA 4YWYA 2P0WA 5HVHA 5F09A 3SI0A 2PJ5A 4ZI6A 2EVNA 3KHZA 2Q4YA 3VH9A 2JDCA 2GU2A 1IYKA 2F7VA 2WSAA 2ZPAA 2PJ0A 1FY7A 2IJZA 4JXRA 2V8HA 2PJAA 3QB8A 1Q2YA 4KVOE 4MHDA 1Z4RA 4KSAA 5C88A 3DR6A 2JEWA 2G3TA 4JZ0A 5ELYA 3IU1A 3B8GA 4A30A 3KQXA 1CBXA 1NMTA 2YNEA 5LYIA 3TC8A 3W6SA 4FBEA 2P6FA 2Y0MA 4KS9A 5JH9A 4YRHA 4M6IA 3WC6A 1IOFA 4ONUA 3WABA 3I3GA 4UCMA 4TWEA 4KLWA 2YNDA 4KUBA 1PU9A 4E2AA 3HLPA 3KR4A 4A38A 3MRUA 4C7HA 4DYOA 3JUWA 4MCPA 4R3KA 1GYTA 2OR4A 2AFOA 4M6GA 4XPKA 1AUGA 1DTDA 3DSBA 4R3LA 4TNUA 1ON0A 2PIZA 4UF4A 2OH1A 4MMOA 4H89A 1YW6A 2B5GB 2PE3A 3IU2A 2ZOFA 3P2FA 2AFWA 2B3UA 3D7FA 4OIDA 5C82A 5J1QA 3WC7A 2CNTA 1ZLHA 2Z3PA 4BD9A 2J8RA 3QNVA 2C6PA 3EO4A 3TCVA 1IU8A 1F2OA 1ZG8A 4P4IA 1Z8XA 2BSWA 4GXHA 4PQAA 5IX3A 2AFXA 2GIVA 4FUUA 1ZLIA 2FL4A 3R95A 1BLLE 3PFEA 4JD6A 4KOSA 1S7NA 4E0AA 4DNCA 3NE7A 4JLYA 5THWA 5J8FA 3R9GA 5KTCA 2J9AA 5IB9A 3MGDA 5DWNA 4CAEA 5K8MA 4QC6A 2F5IA 3FRMA 1KWMA 1YQEA 2PJ4A 1LAMA 4OC1A 4UFXA 2VI7A 4AG7A 4CGMA 1XEBA 4ZY2A 2ZEMA 3FNCA 4PSXA 3D3SA 4F9VA 2ZEOA 3LWUA 3R9EA 4QB9A 2CNSA 2IL4A 2PR8A 3KKWA 4KOVA 2I79A 1HEEA 4R9MA 3G8WA 3NE8A 4CYNA 3P2HA 4MFQA 2P6GA 4KSFA 4F9UA 4KSIA 5AG4A 2AFZA 1LOKA 2PJ1A 2WYRA 3TO7A 1P0HA 1M1DA 1U6MA 4Z65A 5BWAB 1TKJA 4W9YA 2HB6A 3DDDA 4MFPA 4Q7AA 4ZYQA 1YSJA 4EFDA 1QSTA 2REEA 3GY9A 1XMBA 4I49A 4KOWA 4UBRA 5KTDA 5LRKA 2ZW4A 2VZZA 4A39A 2RFHA 2ANPA 4G1PA 1DE4C 3N7ZA 3FEDA 4UIBA 1IIDA 1Z5RA 1PUAA 1Z8LA 3D2MA 3BJ8A 1HDUA 4HPSA 1S3ZA 4XNHC 3TOBA 2G0BA 2GE3A 4KORA 3IIBA 3B7IA 4A37A 4CAWA 5GCNA 1I21A 1H8LA 4NCZA 3SJXA 3FECA 4OC0A 1SQHA 3D66A 5AGEA 1Q7LA 3BLNA 4P4FA 5LRJA 3S9LA 3D7GA 4CAVA 4ZX9A 1VKCA 1TF8A 2PJ6A 3CXSA 4AXVA 5EC4A 5H84A 1ZG9A 2JBJA 2X7BA 1RXTA 1YLOA 5D8NA 5G20A 1Z4EA 4NFRA 1XFOA 3UY5A 4C2ZA 2Z10A 1YW4A 2D4PA 3F8KA 3ZZIA 4MHYA 4RS2A 1YMEA 2G9DA 4DUKA 4B5OA 4O23A 3SI1A 2PJ9A 5CBMA 4NGNA 3GUXA 4PK2A 4JXQA 4EVYA 3B3WA 3I9SA 3GIUA 4UCPA 3TFYA 1TIQA 1Y0RA 4MI4A 2CF4A 2EWBA 3RAMA 5IV0A 2ZEFA 4AB7A 2PJ3A 1XMTA 2PRQA 1S7KA 4FD4A 4BMHA 3FXTA 3NA6A 4UIAA 2B4BA 4YGOA 4IF5A 1I1DA 3K9UA 2I00A 4NGPA 5E96A 2QVPA 2VXKA 4NGSA 1S7LA 1MK4A 2RC4A 4P4JA 2OZGA 1Y7EA 1NSLA 2GFQA 5JM6A 1Z9UA 4MFZA 2ZW7A 3C26A 4K3NA 4CS0B 2B58A 3SJGA 3S9MA 3PBBA 4C2XA 4E8OA 1MJ9A 3B3TA 3PB4X 4LUAA 1BAVA 4WJBA 5AG7A 3WT4A 2EK9A 4B11A 4XPLA 4PXBA 1R3NA 1FNOA 4B5PA 4PV6A 2OOTA 3TT2A 4XPDC 1S60A 3BI1A 4F6AA 1F2PA 3KI9A 3FF3A 2NMTA 4UEFA 3SXOA 2Z3OA 2I3CA 3JTKA 3LODA 2QJ8A 3PZJA 1VHOA 2Q0YA 4AVAA 3FJUA 2AJ6A 4QVTA 3V8IA 2HC9A 3TX8A 3ZJ0A 2ZW6A 2PIYA 4PXEA 3H8EA 4CRZB 4Y49C 2B4DA 4NGTA 1YVKA 4ZBGA 2R7HA 3SJFA 4B12A 3TOAA 4UA3A 2PJ2A 2V8DA 2PR1A 2YNCA 1QSOA 3KHXA 3LD2A 4P4EA 3SJEA 4A33A 4NSQA 3CZXA 2ODFA 3FEEA 2CTCA 4EWTA 1AYEA 2VEZA 2EBJA 5CPAA 5K8PA 5I0CA 1QQ9A 1Q2CA 1Y0YA 2R1IA 4U9ZA 4IUSA 3CPAA 5JPHA 2R8VA 1ELLP 4OKOA 8CPAA 1Q2DA 1GHEA 1VGYA 3V38A 4P44A 2PJ7A 4UFVA 4ORFA 4R7MA 3HUVA 2YNCC 2CTBA 3TTHA 5A27A 4GS4A 5AG5A 1X12A 1IICA 2O53A 4FD7A 2CIJA 4PXDA 1YK3A 3EY5A 1CG2A 1BO4A 2NYQA 1KZFA 4OIWA 4P6YA 1TKFA 2Q7SA 3NH4A 2FIWA 4UWJA 4BBHA 1BPMA 1LFWA 1M44A 4UFWA 2PVWA 2ZW5A 4B10A 4PSWA 4NJQA 4OC5A 2QIRA 2WPWA 1ZG7A 3NH5A 4ZY0A 4JYWA 4M3SA 3W91A 4B14A 3PB8X 3T90A 2POKA 2WZNA 3PB9X 4HNWB 3K9TA 1Z8TA 2VQYA 5CNPA 5J8CA 3KL9A 3DLJA 2PRBA 4YFJA 4IHMA 2AFUA 4OMEA 3FH4A 2C27A 3IFEA 1YLEA 1MJBA
chains in the Genus database with same CATH topology
1S5KA 1Y9WA 3R1KA 1OZPA 4MFJA 2Z0ZA 4JWPA 4L89A 2K5TA 4NF1A 4Q36A 4RI1A 3DR8A 3T9YA 2J8MA 2PC1A 3A9LA 4UWIA 4FD6A 1V0CA 5DWMA 4A32A 3SXNA 3IGRA 1QSNA 2HV2A 3OWCA 2HUZA 3VWDA 2PQ8A 4H6UA 4NEXA 2QMLA 3R96A 1RO5A 3G3SA 1M4DA 4CAFA 2B5GA 2B3VA 2EUIA 3JVNA 4A31A 2CY2A 1CM0A 4KOUA 4MY3A 4CRYB 4UCNA 4JJXA 1IYLA 5KTAA 1ZO0A 4L8AA 2OU2A 2OZHA 4HNYB 1LRZA 3D8PA 4XNHB 4KUAA 2OZUA 4A95A 1KUYA 4CGOA 3FIXA 4MBUA 4H6ZA 2FT0A 5G1ZA 3FB3A 3EFAA 4KVXA 5EBVA 4F0YA 2CXAA 2G3AA 4CYQA 2BL1A 5G21A 2O28A 1L0CA 5G22A 4ZGYB 2Z3MA 1S7FA 2PSWA 4B13A 4AG9A 2VZYA 5F48A 4KOYA 3DNSA 2FCKA 2Z3LA 1M4IA 1KUXA 4CYPA 3QAHA 5H86A 3EXNA 3IWGA 4OLLA 1KUVA 5F49A 2AE6A 4Q38A 2Z11A 2DPTA 1XIXA 1R57A 2QECA 4U9YA 1XE4A 5JQ4A 2PDOA 3FBUA 5AG6A 3BJ7A 2Q7BA 5HMNA 3S6GA 2Q04A 4CGLA 2JDDA 4XPDB 3F0AA 5F46A 4CYOA 3GYAA 2YGWA 2Z3NA 4PK3A 1QSMA 2ARHA 4J3GA 4C7IA 1YGHA 2DXQA 1YREA 4Y49B 4AVCA 3S6KA 2KCWA 4AVBA 2REFA 2ZXVA 4C2YA 3S6FA 1M4GA 1YX0A 5FVJA 3TO6A 4B5PB 2JLMA 5HH1A 1YVOA 3FYNA 3CXPA 2FSRA 2FIAA 4K30A 4KZTA 3VWEA 4CGPA 4MFLA 1QSRA 4A2ZA 2B4DB 4II9A 2BEIA 1Y7RA 1VHSA 3H5ZA 2FXFA 3W6XA 3GKRA 2Q44A 2ATRA 1B87A 1B6BA 3SHPA 1CJWA 1J4JA 2VBQA 4F0XA 2JEVA 4KOTA 3TE4A 1XF8A 3WR7A 2WUUA 4QBJA 4OAEA 4R87A 5IB0A 1IB1E 4M85A 1P4NA 4KOXA 2WPXA 4OADA 1WK4A 3E0KA 2D4OA 1WWZA 3PGPA 4X5KA 4CAXA 4U5YA 1Y9KA 1K4JA 4NXYA 3H4QA 2CNMA 3F5BA 2OB0A 3PP9A 5F47A 1YR0A 2FS5A 3TO9A 4LX9A 2Q4VA 3R9FA 4MJ8A 2H5MA 2P6EA 3CXQA 5ISVA 4MFKA 4C68A 4R57A 3RYOA 1UFHA 2R98A 1MJAA 2BUEA 3EC4A 4HKFA 4KVME 1I12A 4CGNA 1BOBA 3IWEA 4FD5A 4MY0A 1N71A 2J8NA 2HQYA 2A4NA 2GANA 4KLVA 5A28A 2FE7A 3D2PA 2DPSA 4QUSA 2Z3KA 3S6HA 1NE9A 2P0WA 2EVNA 2Q4YA 2JDCA 1IYKA 2WSAA 2ZPAA 1FY7A 4MHDA 4JXRA 3QB8A 4KVOE 1Q2YA 5C88A 1Z4RA 4KSAA 3DR6A 2G3TA 3IU1A 3B8GA 4A30A 1NMTA 2YNEA 3W6SA 2P6FA 2Y0MA 4KS9A 4YRHA 4ONUA 3I3GA 4UCMA 4KLWA 2YNDA 4KUBA 1PU9A 4E2AA 4C7HA 3JUWA 4R3KA 4XPKA 3DSBA 4R3LA 1ON0A 2OH1A 4H89A 2B5GB 3IU2A 3P2FA 2B3UA 5C82A 2CNTA 2Z3PA 2J8RA 3EO4A 3TCVA 2BSWA 5IX3A 2GIVA 2FL4A 3R95A 4E0AA 4JD6A 4KOSA 1S7NA 4DNCA 3NE7A 4JLYA 5KTCA 5J8FA 3R9GA 3MGDA 5DWNA 4CAEA 4QC6A 2F5IA 3FRMA 4AG7A 4CGMA 4UFXA 2VI7A 1XEBA 4PSXA 3FNCA 3D3SA 3R9EA 4QB9A 2CNSA 2IL4A 2PR8A 3KKWA 4KOVA 2I79A 4R9MA 3G8WA 4CYNA 3P2HA 4MFQA 2P6GA 4KSFA 5AG4A 5BWAB 3TO7A 1P0HA 1M1DA 1U6MA 4MFPA 3DDDA 1QSTA 2REEA 3GY9A 4I49A 4KOWA 4UBRA 5KTDA 2ZW4A 2VZZA 3N7ZA 1IIDA 1PUAA 3D2MA 3BJ8A 1S3ZA 4XNHC 3TOBA 2G0BA 2GE3A 4KORA 4CAWA 5GCNA 1I21A 4NCZA 1SQHA 5AGEA 3BLNA 4CAVA 1VKCA 3CXSA 5EC4A 5H84A 2X7BA 1RXTA 5G20A 1Z4EA 3UY5A 4C2ZA 2Z10A 2D4PA 3F8KA 3ZZIA 4RS2A 4B5OA 4EVYA 4PK2A 4JXQA 3I9SA 4UCPA 3TFYA 1TIQA 4MI4A 5IV0A 4AB7A 1XMTA 1S7KA 4FD4A 4BMHA 3FXTA 4YGOA 2B4BA 4IF5A 1I1DA 3K9UA 2I00A 5E96A 1NSLA 2VXKA 1S7LA 1MK4A 2RC4A 2OZGA 1Z9UA 4MFZA 2ZW7A 3C26A 4CS0B 2B58A 4C2XA 4E8OA 1MJ9A 4LUAA 5AG7A 4B11A 4XPLA 4B5PA 4PV6A 3TT2A 4XPDC 1S60A 4F6AA 2NMTA 3SXOA 2Z3OA 3JTKA 3LODA 3PZJA 2Q0YA 4AVAA 2AJ6A 4QVTA 3V8IA 3ZJ0A 2ZW6A 4CRZB 4Y49C 2B4DA 1YVKA 4ZBGA 2R7HA 4B12A 3TOAA 4UA3A 2PR1A 2YNCA 1QSOA 3LD2A 4A33A 4NSQA 2VEZA 5I0CA 1Q2CA 2R1IA 4U9ZA 4IUSA 5JPHA 2R8VA 1Q2DA 1GHEA 4UFVA 4ORFA 2YNCC 1YLEA 3TTHA 5A27A 4GS4A 5AG5A 1IICA 4FD7A 1YK3A 3EY5A 1BO4A 1KZFA 4UWJA 2FIWA 4BBHA 1M44A 4UFWA 2ZW5A 4B10A 4PSWA 2QIRA 2WPWA 4M3SA 3W91A 4B14A 3T90A 4HNWB 2VQYA 5CNPA 5J8CA 2PRBA 4YFJA 2C27A 4HNXB 1MJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSA A;  5AG7 A;  4CGM A;  4B11 A;  4B13 A;  4UFX A;  4CGL A;  4A33 A;  3IU2 A;  4BBH A;  4CYP A;  4UFW A;  2YNC A;  3IU1 A;  4UCP A;  4A95 A;  4B10 A;  4A30 A;  4CYO A;  4CGO A;  2YNE A;  4CGP A;  4CGN A;  4CAF A;  3IWE A;  3JTK A;  4A2Z A;  5G1Z A;  4C7I A;  4UCM A;  4B14 A;  4CYN A;  2YND A;  3H5Z A;  5AG4 A;  5AGE A;  4A31 A;  4CYQ A;  5G21 A;  5A28 A;  4UFV A;  4C7H A;  4UCN A;  4C2Y A;  4A32 A;  2YNC C;  4B12 A;  5G22 A;  2WUU A;  5AG5 A;  5A27 A;  4CAE A;  4C68 A;  5G20 A;  5AG6 A;  4C2X A;  4C2Z A; 
#chains in the Genus database with same CATH topology
 2V77 A;  3KAS A;  1S5K A;  1RTQ A;  3RNZ A;  3K2K A;  1Y9W A;  5I4M A;  3R1K A;  1OZP A;  5LRG A;  4MFJ A;  2Z0Z A;  4JWP A;  4L89 A;  2PVV A;  2K5T A;  3JRU A;  2Q51 A;  4NF1 A;  4Q36 A;  2RB7 A;  4FAI A;  4RI1 A;  2F8H A;  3DR8 A;  3T9Y A;  2J8M A;  4PXC A;  2PC1 A;  3A9L A;  4IK2 A;  4UWI A;  4FD6 A;  4R76 A;  4CPA A;  2V8V A;  3IEH A;  1V0C A;  5DWM A;  3RZA A;  4A32 A;  2GRE A;  2ZEP A;  4NJR A;  2ZED A;  1CP7 A;  3SXN A;  4B6Z A;  2AFM A;  3IGR A;  4PPZ A;  3S9N A;  1QSN A;  2HV2 A;  3IJ3 A;  1XOV A;  3FVL A;  3OWC A;  2HUZ A;  2QYV A;  3VWD A;  2PQ8 A;  1FT7 A;  3PB6 X;  4H6U A;  4NEX A;  2QML A;  3R96 A;  1RO5 A;  3L2N A;  4FWU A;  3T8W A;  3G3S A;  1VHE A;  1M4D A;  4CAF A;  2B5G A;  1ARM A;  1XRY A;  3N5F A;  2B3V A;  4OC2 A;  2VL1 A;  2EUI A;  2XEF A;  3JVN A;  4R6T A;  2ZEL A;  5K8O A;  4A31 A;  2CY2 A;  1CM0 A;  4KOU A;  4MY3 A;  1BPN A;  4CRY B;  4UCN A;  2BO9 A;  4P4B A;  4OP4 A;  3VAR A;  2ZEG A;  4JJX A;  1LAP A;  3KZW A;  1IYL A;  5KTA A;  3V7Z A;  2DF5 A;  1ZO0 A;  4L8A A;  3D67 A;  2OU2 A;  2GLF A;  4OC3 A;  3B3S A;  2OZH A;  4HNY B;  1LRZ A;  3D8P A;  4XNH B;  4KUA A;  2OZU A;  5LYF A;  4A95 A;  1KUY A;  4CGO A;  3FIX A;  4X3R A;  4MBU A;  1JQG A;  4H6Z A;  1AMP A;  2FT0 A;  3B3C A;  5G1Z A;  2PJ8 A;  3D7H A;  3FB3 A;  1JWQ A;  3EFA A;  4KVX A;  5EBV A;  4F0Y A;  1QMU A;  1TKH A;  2CXA A;  2G3A A;  2BL1 A;  3H8F A;  5G21 A;  4ZX8 A;  4CYQ A;  3MN8 A;  3NH8 A;  4A94 A;  1CPX A;  1HDQ A;  2O28 A;  1L0C A;  5G22 A;  4MCQ A;  1PCA A;  4ZGY B;  5LYD A;  2Z3M A;  4P4D A;  4F8Z A;  2DEA A;  2PJC A;  1S7F A;  2PSW A;  4B13 A;  3FMC A;  4AG9 A;  2VZY A;  4MCS A;  1ARL A;  4KOY A;  5F48 A;  3DNS A;  2FCK A;  2Z3L A;  1M4I A;  1KUX A;  3NFZ A;  2BCO A;  4CYP A;  5HXD A;  2O4H A;  3QAH A;  1X10 A;  5H86 A;  3EXN A;  3FX6 A;  3IWG A;  4OLL A;  1KUV A;  3LAC A;  2AE6 A;  3LMS A;  4Q38 A;  2Q43 A;  2Z11 A;  3DGV A;  4X8I A;  5F49 A;  2EO8 A;  4MXU A;  4NGQ A;  1OBR A;  5JGF A;  2DPT A;  1XIX A;  4LQ6 A;  3KQZ A;  1TF9 A;  5D29 A;  1EE3 P;  1ELM P;  1LAN A;  1CX8 A;  1R57 A;  2QEC A;  4OC4 A;  5K8N A;  4U9Y A;  1IOI A;  1XE4 A;  2PDO A;  4X2T A;  5JQ4 A;  3FBU A;  5AG6 A;  3BJ7 A;  2Q7B A;  3VAT A;  5HMN A;  3S6G A;  2EK8 A;  2ZEN A;  4GM5 A;  2Q04 A;  4MRI A;  4CGL A;  1CP6 A;  2JDD A;  4XPD B;  1R43 A;  2GLJ A;  3F0A A;  4RUH A;  3RBU A;  3IC1 A;  5F46 A;  5HVG A;  1CPS A;  3CPX A;  4MCR A;  4CYO A;  3H8G A;  3GYA A;  2YGW A;  2Z3N A;  4PK3 A;  4ZY1 A;  1QSM A;  3I1U A;  2ARH A;  4J3G A;  4C7I A;  1YGH A;  4YU9 A;  2DXQ A;  4UEE A;  1YRE A;  4ONW A;  2XEJ A;  4Y49 B;  4AVC A;  3S6K A;  2KCW A;  2C6C A;  4AVB A;  2REF A;  2ZXV A;  4C2Y A;  5EMI A;  4LQG A;  1VIX A;  3S6F A;  1M4G A;  1YX0 A;  5FVJ A;  1IGB A;  3TO6 A;  2JLM A;  4B5P B;  4UEZ A;  1M4L A;  2ZOG A;  3BI0 A;  1YVO A;  5HH1 A;  3FYN A;  3CXP A;  4IAV A;  2FSR A;  2FIA A;  4K30 A;  4KZT A;  3VWE A;  3PB7 X;  4CGP A;  2BOA A;  3CT9 A;  4MFL A;  3RO0 A;  1LCP A;  1QSR A;  4M6H A;  4A2Z A;  2B4D B;  1PYT B;  4II9 A;  2BEI A;  1Y7R A;  1VHS A;  3H5Z A;  2C6G A;  2FXF A;  3W6X A;  3GKR A;  2Q44 A;  2ATR A;  1B87 A;  1B6B A;  3KGQ A;  1CJW A;  1J4J A;  2VBQ A;  2IMO A;  3D68 A;  3SHP A;  2JEV A;  3SI2 A;  4KOT A;  4F0X A;  3TE4 A;  1XF8 A;  3WR7 A;  2WUU A;  4QBJ A;  4OAE A;  4R87 A;  2PJB A;  1NSA A;  3PFO A;  5IB0 A;  1IB1 E;  4M85 A;  1P4N A;  3KR5 A;  2WPX A;  4KOX A;  2XEG A;  7CPA A;  1IY7 A;  4OAD A;  1WK4 A;  2JBK A;  3E0K A;  5HVF A;  2D4O A;  1XBU A;  4MHP A;  1WWZ A;  3PGP A;  4BIN A;  4X5K A;  3PEI A;  4U5Y A;  4CAX A;  1Y9K A;  4NGM A;  4DJL A;  2V8G A;  3PRT A;  2Q4Z A;  2FVG A;  4WWV A;  1A2Z A;  1K4J A;  4NXY A;  4R8F A;  3QAY A;  3H4Q A;  2CNM A;  3F5B A;  2OB0 A;  3PP9 A;  5F47 A;  4RN7 A;  1YR0 A;  2FS5 A;  3TO9 A;  4LX9 A;  2Q4V A;  1Z2L A;  4MJ8 A;  3R9F A;  2NSM A;  2H5M A;  2P6E A;  3B35 A;  3B2Y A;  3BXM A;  2IQ6 A;  3CXQ A;  6CPA A;  5LYL A;  4H2K A;  3IO1 A;  5ISV A;  1F57 A;  4MFK A;  3B3V A;  4C68 A;  2ABZ A;  2ZEH A;  4R57 A;  3BHX A;  3RYO A;  1XJO A;  1UFH A;  1UWY A;  3IWW A;  2PCU A;  2R98 A;  1MJA A;  2BUE A;  3EC4 A;  1Z8W A;  4HKF A;  4KVM E;  3CDX A;  1I12 A;  2XEI A;  4P45 A;  4HNX B;  2AFS A;  3D7D A;  4CGN A;  1BOB A;  4NGR A;  3PBE A;  3D4U A;  3IWE A;  4FD5 A;  4MY0 A;  3GLJ A;  1N71 A;  2J8N A;  2HQY A;  5DS0 A;  4MHZ A;  2A4N A;  3GB0 A;  2GAN A;  4KLV A;  5A28 A;  2FE7 A;  3D2P A;  1TXR A;  4MHN A;  2C1C A;  2DPS A;  4QUS A;  2Z3K A;  3S6H A;  1NE9 A;  3ISX A;  4P10 A;  3WC5 A;  4EME A;  3ISZ A;  2ZEE A;  4YWY A;  2P0W A;  5HVH A;  5F09 A;  3SI0 A;  2PJ5 A;  4ZI6 A;  2EVN A;  3KHZ A;  2Q4Y A;  3VH9 A;  2JDC A;  2GU2 A;  1IYK A;  2F7V A;  2WSA A;  2ZPA A;  2PJ0 A;  1FY7 A;  2IJZ A;  4JXR A;  2V8H A;  2PJA A;  3QB8 A;  1Q2Y A;  4KVO E;  4MHD A;  1Z4R A;  4KSA A;  5C88 A;  3DR6 A;  2JEW A;  2G3T A;  4JZ0 A;  5ELY A;  3IU1 A;  3B8G A;  4A30 A;  3KQX A;  1CBX A;  1NMT A;  2YNE A;  5LYI A;  3TC8 A;  3W6S A;  4FBE A;  2P6F A;  2Y0M A;  4KS9 A;  5JH9 A;  4YRH A;  4M6I A;  3WC6 A;  1IOF A;  4ONU A;  3WAB A;  3I3G A;  4UCM A;  4TWE A;  4KLW A;  2YND A;  4KUB A;  1PU9 A;  4E2A A;  3HLP A;  3KR4 A;  4A38 A;  3MRU A;  4C7H A;  4DYO A;  3JUW A;  4MCP A;  4R3K A;  1GYT A;  2OR4 A;  2AFO A;  4M6G A;  4XPK A;  1AUG A;  1DTD A;  3DSB A;  4R3L A;  4TNU A;  1ON0 A;  2PIZ A;  4UF4 A;  2OH1 A;  4MMO A;  4H89 A;  1YW6 A;  2B5G B;  2PE3 A;  3IU2 A;  2ZOF A;  3P2F A;  2AFW A;  2B3U A;  3D7F A;  4OID A;  5C82 A;  5J1Q A;  3WC7 A;  2CNT A;  1ZLH A;  2Z3P A;  4BD9 A;  2J8R A;  3QNV A;  2C6P A;  3EO4 A;  3TCV A;  1IU8 A;  1F2O A;  1ZG8 A;  4P4I A;  1Z8X A;  2BSW A;  4GXH A;  4PQA A;  5IX3 A;  2AFX A;  2GIV A;  4FUU A;  1ZLI A;  2FL4 A;  3R95 A;  1BLL E;  3PFE A;  4JD6 A;  4KOS A;  1S7N A;  4E0A A;  4DNC A;  3NE7 A;  4JLY A;  5THW A;  5J8F A;  3R9G A;  5KTC A;  2J9A A;  5IB9 A;  3MGD A;  5DWN A;  4CAE A;  5K8M A;  4QC6 A;  2F5I A;  3FRM A;  1KWM A;  1YQE A;  2PJ4 A;  1LAM A;  4OC1 A;  4UFX A;  2VI7 A;  4AG7 A;  4CGM A;  1XEB A;  4ZY2 A;  2ZEM A;  3FNC A;  4PSX A;  3D3S A;  4F9V A;  2ZEO A;  3LWU A;  3R9E A;  4QB9 A;  2CNS A;  2IL4 A;  2PR8 A;  3KKW A;  4KOV A;  2I79 A;  1HEE A;  4R9M A;  3G8W A;  3NE8 A;  4CYN A;  3P2H A;  4MFQ A;  2P6G A;  4KSF A;  4F9U A;  4KSI A;  5AG4 A;  2AFZ A;  1LOK A;  2PJ1 A;  2WYR A;  3TO7 A;  1P0H A;  1M1D A;  1U6M A;  4Z65 A;  5BWA B;  1TKJ A;  4W9Y A;  2HB6 A;  3DDD A;  4MFP A;  4Q7A A;  4ZYQ A;  1YSJ A;  4EFD A;  1QST A;  2REE A;  3GY9 A;  1XMB A;  4I49 A;  4KOW A;  4UBR A;  5KTD A;  5LRK A;  2ZW4 A;  2VZZ A;  4A39 A;  2RFH A;  2ANP A;  4G1P A;  1DE4 C;  3N7Z A;  3FED A;  4UIB A;  1IID A;  1Z5R A;  1PUA A;  1Z8L A;  3D2M A;  3BJ8 A;  1HDU A;  4HPS A;  1S3Z A;  4XNH C;  3TOB A;  2G0B A;  2GE3 A;  4KOR A;  3IIB A;  3B7I A;  4A37 A;  4CAW A;  5GCN A;  1I21 A;  1H8L A;  4NCZ A;  3SJX A;  3FEC A;  4OC0 A;  1SQH A;  3D66 A;  5AGE A;  1Q7L A;  3BLN A;  4P4F A;  5LRJ A;  3S9L A;  3D7G A;  4CAV A;  4ZX9 A;  1VKC A;  1TF8 A;  2PJ6 A;  3CXS A;  4AXV A;  5EC4 A;  5H84 A;  1ZG9 A;  2JBJ A;  2X7B A;  1RXT A;  1YLO A;  5D8N A;  5G20 A;  1Z4E A;  4NFR A;  1XFO A;  3UY5 A;  4C2Z A;  2Z10 A;  1YW4 A;  2D4P A;  3F8K A;  3ZZI A;  4MHY A;  4RS2 A;  1YME A;  2G9D A;  4DUK A;  4B5O A;  4O23 A;  3SI1 A;  2PJ9 A;  5CBM A;  4NGN A;  3GUX A;  4PK2 A;  4JXQ A;  4EVY A;  3B3W A;  3I9S A;  3GIU A;  4UCP A;  3TFY A;  1TIQ A;  1Y0R A;  4MI4 A;  2CF4 A;  2EWB A;  3RAM A;  5IV0 A;  2ZEF A;  4AB7 A;  2PJ3 A;  1XMT A;  2PRQ A;  1S7K A;  4FD4 A;  4BMH A;  3FXT A;  3NA6 A;  4UIA A;  2B4B A;  4YGO A;  4IF5 A;  1I1D A;  3K9U A;  2I00 A;  4NGP A;  5E96 A;  2QVP A;  2VXK A;  4NGS A;  1S7L A;  1MK4 A;  2RC4 A;  4P4J A;  2OZG A;  1Y7E A;  1NSL A;  2GFQ A;  5JM6 A;  1Z9U A;  4MFZ A;  2ZW7 A;  3C26 A;  4K3N A;  4CS0 B;  2B58 A;  3SJG A;  3S9M A;  3PBB A;  4C2X A;  4E8O A;  1MJ9 A;  3B3T A;  3PB4 X;  4LUA A;  1BAV A;  4WJB A;  5AG7 A;  3WT4 A;  2EK9 A;  4B11 A;  4XPL A;  4PXB A;  1R3N A;  1FNO A;  4B5P A;  4PV6 A;  2OOT A;  3TT2 A;  4XPD C;  1S60 A;  3BI1 A;  4F6A A;  1F2P A;  3KI9 A;  3FF3 A;  2NMT A;  4UEF A;  3SXO A;  2Z3O A;  2I3C A;  3JTK A;  3LOD A;  2QJ8 A;  3PZJ A;  1VHO A;  2Q0Y A;  4AVA A;  3FJU A;  2AJ6 A;  4QVT A;  3V8I A;  2HC9 A;  3TX8 A;  3ZJ0 A;  2ZW6 A;  2PIY A;  4PXE A;  3H8E A;  4CRZ B;  4Y49 C;  2B4D A;  4NGT A;  1YVK A;  4ZBG A;  2R7H A;  3SJF A;  4B12 A;  3TOA A;  4UA3 A;  2PJ2 A;  2V8D A;  2PR1 A;  2YNC A;  1QSO A;  3KHX A;  3LD2 A;  4P4E A;  3SJE A;  4A33 A;  4NSQ A;  3CZX A;  2ODF A;  3FEE A;  2CTC A;  4EWT A;  1AYE A;  2VEZ A;  2EBJ A;  5CPA A;  5K8P A;  5I0C A;  1QQ9 A;  1Q2C A;  1Y0Y A;  2R1I A;  4U9Z A;  4IUS A;  3CPA A;  5JPH A;  2R8V A;  1ELL P;  4OKO A;  8CPA A;  1Q2D A;  1GHE A;  1VGY A;  3V38 A;  4P44 A;  2PJ7 A;  4UFV A;  4ORF A;  4R7M A;  3HUV A;  2YNC C;  2CTB A;  3TTH A;  5A27 A;  4GS4 A;  5AG5 A;  1X12 A;  1IIC A;  2O53 A;  4FD7 A;  2CIJ A;  4PXD A;  1YK3 A;  3EY5 A;  1CG2 A;  1BO4 A;  2NYQ A;  1KZF A;  4OIW A;  4P6Y A;  1TKF A;  2Q7S A;  3NH4 A;  2FIW A;  4UWJ A;  4BBH A;  1BPM A;  1LFW A;  1M44 A;  4UFW A;  2PVW A;  2ZW5 A;  4B10 A;  4PSW A;  4NJQ A;  4OC5 A;  2QIR A;  2WPW A;  1ZG7 A;  3NH5 A;  4ZY0 A;  4JYW A;  4M3S A;  3W91 A;  4B14 A;  3PB8 X;  3T90 A;  2POK A;  2WZN A;  3PB9 X;  4HNW B;  3K9T A;  1Z8T A;  2VQY A;  5CNP A;  5J8C A;  3KL9 A;  3DLJ A;  2PRB A;  4YFJ A;  4IHM A;  2AFU A;  4OME A;  3FH4 A;  2C27 A;  3IFE A;  1YLE A;  1MJB A; 
#chains in the Genus database with same CATH homology
 1S5K A;  1Y9W A;  3R1K A;  1OZP A;  4MFJ A;  2Z0Z A;  4JWP A;  4L89 A;  2K5T A;  4NF1 A;  4Q36 A;  4RI1 A;  3DR8 A;  3T9Y A;  2J8M A;  2PC1 A;  3A9L A;  4UWI A;  4FD6 A;  1V0C A;  5DWM A;  4A32 A;  3SXN A;  3IGR A;  1QSN A;  2HV2 A;  3OWC A;  2HUZ A;  3VWD A;  2PQ8 A;  4H6U A;  4NEX A;  2QML A;  3R96 A;  1RO5 A;  3G3S A;  1M4D A;  4CAF A;  2B5G A;  2B3V A;  2EUI A;  3JVN A;  4A31 A;  2CY2 A;  1CM0 A;  4KOU A;  4MY3 A;  4CRY B;  4UCN A;  4JJX A;  1IYL A;  5KTA A;  1ZO0 A;  4L8A A;  2OU2 A;  2OZH A;  4HNY B;  1LRZ A;  3D8P A;  4XNH B;  4KUA A;  2OZU A;  4A95 A;  1KUY A;  4CGO A;  3FIX A;  4MBU A;  4H6Z A;  2FT0 A;  5G1Z A;  3FB3 A;  3EFA A;  4KVX A;  5EBV A;  4F0Y A;  2CXA A;  2G3A A;  4CYQ A;  2BL1 A;  5G21 A;  2O28 A;  1L0C A;  5G22 A;  4ZGY B;  2Z3M A;  1S7F A;  2PSW A;  4B13 A;  4AG9 A;  2VZY A;  5F48 A;  4KOY A;  3DNS A;  2FCK A;  2Z3L A;  1M4I A;  1KUX A;  4CYP A;  3QAH A;  5H86 A;  3EXN A;  3IWG A;  4OLL A;  1KUV A;  5F49 A;  2AE6 A;  4Q38 A;  2Z11 A;  2DPT A;  1XIX A;  1R57 A;  2QEC A;  4U9Y A;  1XE4 A;  5JQ4 A;  2PDO A;  3FBU A;  5AG6 A;  3BJ7 A;  2Q7B A;  5HMN A;  3S6G A;  2Q04 A;  4CGL A;  2JDD A;  4XPD B;  3F0A A;  5F46 A;  4CYO A;  3GYA A;  2YGW A;  2Z3N A;  4PK3 A;  1QSM A;  2ARH A;  4J3G A;  4C7I A;  1YGH A;  2DXQ A;  1YRE A;  4Y49 B;  4AVC A;  3S6K A;  2KCW A;  4AVB A;  2REF A;  2ZXV A;  4C2Y A;  3S6F A;  1M4G A;  1YX0 A;  5FVJ A;  3TO6 A;  4B5P B;  2JLM A;  5HH1 A;  1YVO A;  3FYN A;  3CXP A;  2FSR A;  2FIA A;  4K30 A;  4KZT A;  3VWE A;  4CGP A;  4MFL A;  1QSR A;  4A2Z A;  2B4D B;  4II9 A;  2BEI A;  1Y7R A;  1VHS A;  3H5Z A;  2FXF A;  3W6X A;  3GKR A;  2Q44 A;  2ATR A;  1B87 A;  1B6B A;  3SHP A;  1CJW A;  1J4J A;  2VBQ A;  4F0X A;  2JEV A;  4KOT A;  3TE4 A;  1XF8 A;  3WR7 A;  2WUU A;  4QBJ A;  4OAE A;  4R87 A;  5IB0 A;  1IB1 E;  4M85 A;  1P4N A;  4KOX A;  2WPX A;  4OAD A;  1WK4 A;  3E0K A;  2D4O A;  1WWZ A;  3PGP A;  4X5K A;  4CAX A;  4U5Y A;  1Y9K A;  1K4J A;  4NXY A;  3H4Q A;  2CNM A;  3F5B A;  2OB0 A;  3PP9 A;  5F47 A;  1YR0 A;  2FS5 A;  3TO9 A;  4LX9 A;  2Q4V A;  3R9F A;  4MJ8 A;  2H5M A;  2P6E A;  3CXQ A;  5ISV A;  4MFK A;  4C68 A;  4R57 A;  3RYO A;  1UFH A;  2R98 A;  1MJA A;  2BUE A;  3EC4 A;  4HKF A;  4KVM E;  1I12 A;  4CGN A;  1BOB A;  3IWE A;  4FD5 A;  4MY0 A;  1N71 A;  2J8N A;  2HQY A;  2A4N A;  2GAN A;  4KLV A;  5A28 A;  2FE7 A;  3D2P A;  2DPS A;  4QUS A;  2Z3K A;  3S6H A;  1NE9 A;  2P0W A;  2EVN A;  2Q4Y A;  2JDC A;  1IYK A;  2WSA A;  2ZPA A;  1FY7 A;  4MHD A;  4JXR A;  3QB8 A;  4KVO E;  1Q2Y A;  5C88 A;  1Z4R A;  4KSA A;  3DR6 A;  2G3T A;  3IU1 A;  3B8G A;  4A30 A;  1NMT A;  2YNE A;  3W6S A;  2P6F A;  2Y0M A;  4KS9 A;  4YRH A;  4ONU A;  3I3G A;  4UCM A;  4KLW A;  2YND A;  4KUB A;  1PU9 A;  4E2A A;  4C7H A;  3JUW A;  4R3K A;  4XPK A;  3DSB A;  4R3L A;  1ON0 A;  2OH1 A;  4H89 A;  2B5G B;  3IU2 A;  3P2F A;  2B3U A;  5C82 A;  2CNT A;  2Z3P A;  2J8R A;  3EO4 A;  3TCV A;  2BSW A;  5IX3 A;  2GIV A;  2FL4 A;  3R95 A;  4E0A A;  4JD6 A;  4KOS A;  1S7N A;  4DNC A;  3NE7 A;  4JLY A;  5KTC A;  5J8F A;  3R9G A;  3MGD A;  5DWN A;  4CAE A;  4QC6 A;  2F5I A;  3FRM A;  4AG7 A;  4CGM A;  4UFX A;  2VI7 A;  1XEB A;  4PSX A;  3FNC A;  3D3S A;  3R9E A;  4QB9 A;  2CNS A;  2IL4 A;  2PR8 A;  3KKW A;  4KOV A;  2I79 A;  4R9M A;  3G8W A;  4CYN A;  3P2H A;  4MFQ A;  2P6G A;  4KSF A;  5AG4 A;  5BWA B;  3TO7 A;  1P0H A;  1M1D A;  1U6M A;  4MFP A;  3DDD A;  1QST A;  2REE A;  3GY9 A;  4I49 A;  4KOW A;  4UBR A;  5KTD A;  2ZW4 A;  2VZZ A;  3N7Z A;  1IID A;  1PUA A;  3D2M A;  3BJ8 A;  1S3Z A;  4XNH C;  3TOB A;  2G0B A;  2GE3 A;  4KOR A;  4CAW A;  5GCN A;  1I21 A;  4NCZ A;  1SQH A;  5AGE A;  3BLN A;  4CAV A;  1VKC A;  3CXS A;  5EC4 A;  5H84 A;  2X7B A;  1RXT A;  5G20 A;  1Z4E A;  3UY5 A;  4C2Z A;  2Z10 A;  2D4P A;  3F8K A;  3ZZI A;  4RS2 A;  4B5O A;  4EVY A;  4PK2 A;  4JXQ A;  3I9S A;  4UCP A;  3TFY A;  1TIQ A;  4MI4 A;  5IV0 A;  4AB7 A;  1XMT A;  1S7K A;  4FD4 A;  4BMH A;  3FXT A;  4YGO A;  2B4B A;  4IF5 A;  1I1D A;  3K9U A;  2I00 A;  5E96 A;  1NSL A;  2VXK A;  1S7L A;  1MK4 A;  2RC4 A;  2OZG A;  1Z9U A;  4MFZ A;  2ZW7 A;  3C26 A;  4CS0 B;  2B58 A;  4C2X A;  4E8O A;  1MJ9 A;  4LUA A;  5AG7 A;  4B11 A;  4XPL A;  4B5P A;  4PV6 A;  3TT2 A;  4XPD C;  1S60 A;  4F6A A;  2NMT A;  3SXO A;  2Z3O A;  3JTK A;  3LOD A;  3PZJ A;  2Q0Y A;  4AVA A;  2AJ6 A;  4QVT A;  3V8I A;  3ZJ0 A;  2ZW6 A;  4CRZ B;  4Y49 C;  2B4D A;  1YVK A;  4ZBG A;  2R7H A;  4B12 A;  3TOA A;  4UA3 A;  2PR1 A;  2YNC A;  1QSO A;  3LD2 A;  4A33 A;  4NSQ A;  2VEZ A;  5I0C A;  1Q2C A;  2R1I A;  4U9Z A;  4IUS A;  5JPH A;  2R8V A;  1Q2D A;  1GHE A;  4UFV A;  4ORF A;  2YNC C;  1YLE A;  3TTH A;  5A27 A;  4GS4 A;  5AG5 A;  1IIC A;  4FD7 A;  1YK3 A;  3EY5 A;  1BO4 A;  1KZF A;  4UWJ A;  2FIW A;  4BBH A;  1M44 A;  4UFW A;  2ZW5 A;  4B10 A;  4PSW A;  2QIR A;  2WPW A;  4M3S A;  3W91 A;  4B14 A;  3T90 A;  4HNW B;  2VQY A;  5CNP A;  5J8C A;  2PRB A;  4YFJ A;  2C27 A;  4HNX B;  1MJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...