4A31A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 121
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a31A00
5G20A 4B10A 4C68A 4B13A 4UFVA 4C7IA 4A33A 4CGPA 4CYNA 5AGEA 4UCMA 4CGLA 4C2XA 5G21A 4C2ZA 2WUUA 5A27A 4CAFA 5A28A 4UCPA 5G1ZA 5G22A 4A31A 4B14A 4B11A 4CGNA 4CYQA 4UFWA 5AG7A 4UFXA 2YNDA 4C2YA 4CGMA 4A30A 3IU1A 3IU2A 4C7HA 3JTKA 3H5ZA 2YNCC 5AG4A 5AG5A 4CAEA 5AG6A 2YNCA 4A95A 4CYOA 3IWEA 4CYPA 4UCNA 2WSAA 4CGOA 4A2ZA 4B12A 4A32A 4BBHA 2YNEA
chains in the Genus database with same CATH superfamily
3D8PA 3KR5A 4JLYA 5LRKA 5CBMA 3TO9A 4DNCA 2ABZA 3N7ZA 4FWUA 4K30A 4KOYA 4LQGA 4TWEA 4C2ZA 5LYFA 3D3SA 3IJ3A 3JVNA 3LODA 4H89A 1X12A 2CTCA 4MXUA 1YVOA 2VQYA 4B11A 3R96A 4OC5A 5JM6A 1JQGA 1CPXA 4P4JA 2CXAA 4HNYB 3JUWA 1QMUA 4P4DA 2I79A 3PEIA 2ARHA 3IU1A 3K9TA 1CP6A 1MJ9A 2B3UA 1XOVA 4MI4A 2Q04A 5JH9A 2C6GA 1XFOA 1YK3A 4QBJA 1BO4A 4EMEA 4CGOA 1CM0A 2GANA 3BHXA 1IOIA 4G1PA 4NGQA 2V8HA 4RI1A 4B13A 4JYWA 3KHZA 1N71A 4UCMA 4UA3A 2ZOFA 2ZEGA 4P6YA 3KQXA 5G21A 1BOBA 1XMTA 3D7DA 3K9UA 2AFXA 4CAFA 2B5GB 4MMOA 4E0AA 1Z8LA 1KWMA 4B6ZA 3BJ7A 3PB9X 1HDQA 3TO7A 4PXDA 1NMTA 1XEBA 3PBEA 4MFQA 5EC4A 1K4JA 3QAHA 2J8NA 2O4HA 1RTQA 4A39A 1CX8A 4NJQA 4OADA 5AG5A 1B6BA 1YW4A 3VARA 4ZY0A 5JPHA 2YNCA 1LFWA 3V38A 2JBKA 1YQEA 2CF4A 4KOWA 1XF8A 2GU2A 3CXQA 4B12A 1KUXA 5IV0A 4A32A 4UIBA 2PJ3A 3WR7A 3IIBA 4A37A 2CNMA 4LUAA 4NGTA 3B3WA 3D4UA 3DSBA 1S5KA 3TE4A 3TOBA 4ZX8A 2OR4A 1ZO0A 2HB6A 1NE9A 2HQYA 4UEFA 3S6FA 2PR1A 4LQ6A 2XEJA 3FECA 3GKRA 3GYAA 3UY5A 3S9NA 1RO5A 3WC5A 4UFXA 5FVJA 1R3NA 4I49A 1YLOA 5DS0A 3SI0A 2DPTA 3JTKA 4CAXA 1H8LA 2WZNA 3PP9A 4CAEA 3PFOA 4JXQA 1I21A 4M3SA 2BSWA 3VH9A 1M1DA 3BI0A 5D29A 5I0CA 3CXSA 2PIZA 5F46A 1BAVA 2IJZA 3D2PA 2ZEEA 3IEHA 4BINA 2PCUA 4CGPA 5HVHA 2B4DA 2KCWA 2QIRA 2P6GA 4YFJA 1XE4A 4QC6A 5DWNA 2BL1A 3KZWA 3R9FA 4B5PA 1LAPA 1OZPA 3B3VA 5HVGA 2ZELA 2G0BA 4OKOA 3D68A 1PU9A 3I9SA 4Q7AA 2JDCA 3R1KA 4II9A 4B5OA 3WC7A 4KSAA 4X5KA 4HKFA 4NEXA 4XPKA 4MHYA 1IIDA 3RAMA 5HMNA 3PBBA 5AG4A 2WPWA 2GLFA 1IGBA 1Q7LA 2VXKA 4M6HA 3TO6A 1X10A 4A95A 3VATA 2NSMA 3EFAA 5BWAB 2PIYA 3F5BA 5HVFA 1V0CA 3SJEA 4OIDA 4PSXA 2GLJA 2WPXA 3KHXA 4KVXA 5F48A 4C7IA 5EMIA 5C88A 4EVYA 4UWIA 4FD4A 5H86A 2OZHA 3FNCA 3H4QA 2NMTA 3B2YA 2BOAA 4AVCA 1YX0A 4NGSA 2OB0A 2ZEFA 4HPSA 5CNPA 4IHMA 4H6UA 3TFYA 4PXEA 1FT7A 3I3GA 1EE3P 1TF9A 3PB6X 4KVOE 2HV2A 4PK3A 1CBXA 2J8RA 4NXYA 4L89A 2VBQA 4MY3A 4JD6A 3BXMA 1Y9WA 2ZW6A 4UCNA 4AG9A 1TKJA 1F2PA 3QNVA 1M44A 2PJ9A 3LACA 5G20A 2CTBA 1BPNA 2AFMA 2FXFA 4MHDA 2H5MA 4OP4A 4E2AA 5K8NA 4FD5A 2Y0MA 2JLMA 2PRQA 3FIXA 1R43A 4NJRA 4UCPA 3RYOA 4P4BA 3D7HA 4CRYB 4CPAA 1IYKA 3QB8A 4KSIA 4RS2A 2IL4A 2PDOA 4M85A 2I00A 2ZEHA 2XEFA 4O23A 2B5GA 3IU2A 4GS4A 1VHEA 1MJBA 2V8VA 5EBVA 2ATRA 2HUZA 4C7HA 5IX3A 4AG7A 4NGNA 5LYLA 2ZW4A 2EO8A 2P6FA 3PZJA 4AB7A 4PPZA 3NH4A 2REEA 4NCZA 4CYOA 4CYPA 3KKWA 1IICA 3NE8A 2B4BA 1XBUA 1B87A 1M4IA 2EWBA 2VL1A 4UF4A 1IOFA 4P4FA 2ZEMA 5F49A 1JWQA 1IY7A 3OWCA 4J3GA 1LRZA 2ODFA 4R9MA 2PJ8A 3ZZIA 1XIXA 2Z11A 5G1ZA 1LANA 2ZEDA 1SQHA 3SXOA 1QSOA 4OC2A 4KOTA 3FEDA 3GIUA 2Z0ZA 2ZW7A 4CYQA 2EUIA 4EFDA 5HXDA 1TF8A 4QUSA 4CGMA 2ZXVA 2XEIA 1U6MA 4R57A 5HH1A 4MFZA 4XPLA 2OOTA 5J1QA 4YWYA 5LYDA 4OC4A 4F9UA 4NGRA 4UEZA 4YRHA 1UWYA 3IWEA 2VEZA 3R95A 2OU2A 3D2MA 3SHPA 3IGRA 3TOAA 1CG2A 1WK4A 4U9ZA 1HDUA 2C6CA 2PSWA 3KR4A 4GXHA 2PJCA 4X3RA 1BLLE 5JGFA 4ZI6A 3P2FA 1YLEA 1Z4EA 2Q43A 1QQ9A 4ORFA 3S6GA 2DEAA 4C2XA 1S3ZA 2WYRA 3TT2A 5K8PA 4R3LA 1RXTA 3TC8A 2BEIA 2Z3KA 2FVGA 4KORA 3B3CA 3DLJA 4MFKA 3NA6A 2Z3NA 4UFWA 4PXCA 2VI7A 4DYOA 3KASA 3I1UA 4ZBGA 4RUHA 1Z9UA 3NFZA 1DTDA 3B35A 3DR6A 1WWZA 2ZPAA 3T9YA 5IB0A 4U5YA 3K2KA 2YGWA 4OC3A 1KZFA 2RFHA 3PFEA 4GM5A 4TNUA 4PV6A 1QSNA 4AXVA 5A28A 4UIAA 4BBHA 4JZ0A 4A30A 1ZG8A 1Z8XA 4QVTA 1I12A 3TCVA 1VKCA 4KOUA 2B3VA 2PE3A 4UFVA 4NFRA 1YGHA 4XNHC 2CNSA 4Q36A 2K5TA 4IF5A 4NF1A 3S9MA 1ON0A 2BCOA 1IYLA 1ZLHA 3QAYA 3SI2A 3ZJ0A 4B14A 4F0XA 2B58A 4IK2A 4U9YA 4DJLA 4Y49C 2EK9A 2PJ5A 4BD9A 4DUKA 3FMCA 4ONWA 4CS0B 3HLPA 4A94A 4ZY1A 3S9LA 3FVLA 2DXQA 2OZUA 3CZXA 4PK2A 4W9YA 4KLVA 3TTHA 3FF3A 5AG6A 5K8MA 4R87A 4KOSA 3TX8A 2FSRA 2WSAA 3DGVA 4FUUA 2AE6A 4A38A 4MHZA 1ZLIA 3S6KA 4FD6A 4WWVA 4XNHB 1YR0A 2YNEA 4OMEA 2FCKA 4P4IA 4QB9A 2ZW5A 1HEEA 4KLWA 3JRUA 2FIAA 1S7LA 4CGLA 1FNOA 2QYVA 4XPDC 1J4JA 1KUVA 4IAVA 1L0CA 4F8ZA 4K3NA 4EWTA 3NH5A 5THWA 4Y49B 4OAEA 1S7FA 2V77A 5D8NA 4CGNA 1GHEA 1Y0YA 4H6ZA 5ISVA 4LX9A 2BO9A 3FH4A 3SJGA 3WT4A 5J8CA 4PSWA 1ZG9A 3BLNA 3FJUA 5E96A 4AVAA 1VHOA 4MFPA 5DWMA 2A4NA 1Z2LA 4MCRA 2F7VA 4H2KA 4MRIA 5J8FA 4AVBA 3D67A 4XPDB 5LRGA 4KVME 3NH8A 2J8MA 4KS9A 2QECA 5AGEA 3R9GA 2AJ6A 2PJBA 4P45A 2CNTA 4MFLA 1TIQA 3EO4A 5C82A 2Q4ZA 4WJBA 4R8FA 1AUGA 2AFZA 1YREA 3FRMA 3H8GA 3PB7X 4MBUA 4F0YA 3KI9A 2PVVA 1OBRA 3LWUA 1Z8TA 2Q51A 3BI1A 2BUEA 4NGMA 2PJ2A 2CY2A 2GE3A 4ZYQA 4L8AA 2QVPA 3H8EA 4BMHA 3KGQA 2EVNA 2GREA 2XEGA 4PQAA 3RO0A 3KL9A 1F2OA 2R8VA 4KUAA 1QSTA 2Q0YA 2Q7SA 2AFUA 2EBJA 1GYTA 1M4LA 5LYIA 3F0AA 4R3KA 1KUYA 1UFHA 1XMBA 3W91A 2QMLA 2OH1A 3MRUA 1Q2DA 3FB3A 3MGDA 1S7KA 3EY5A 4R6TA 4MHPA 1YW6A 2OZGA 2Q4VA 3FEEA 3W6SA 2JBJA 2WUUA 2ZEOA 2RB7A 3EXNA 4MJ8A 3SI1A 3WC6A 4JJXA 4M6IA 4OLLA 2CIJA 2P6EA 2JEVA 4UBRA 5F47A 3F8KA 3VWEA 2DF5A 2C27A 2PJAA 2YNDA 2R7HA 2Z3LA 4NGPA 1XJOA 6CPAA 1TKHA 4YU9A 3N5FA 3B3SA 2PVWA 1XRYA 3LMSA 3WABA 5KTAA 1BPMA 4KSFA 1F57A 4PXBA 1YMEA 1PCAA 2V8GA 3B7IA 2AFSA 2C6PA 2HC9A 3B3TA 3PB4X 3IFEA 1AMPA 4KOVA 1NSLA 3KQZA 1ZG7A 2Z3OA 2X7BA 2FE7A 3FX6A 4HNWB 3T90A 1Q2YA 3IO1A 5ELYA 1ARLA 4X8IA 2ANPA 1PYTB 2F8HA 1P0HA 1DE4C 3D7FA 1LCPA 2POKA 3VWDA 5KTCA 4OC1A 2FIWA 4UEEA 5K8OA 2PJ7A 1Y7RA 1Q2CA 2D4OA 3GY9A 5KTDA 1TXRA 4OIWA 1Y0RA 3RBUA 2YNCC 3ISXA 2D4PA 2Z3PA 1IU8A 2GFQA 2QJ8A 3GUXA 2FT0A 4HNXB 2IMOA 1ELMP 2C1CA 1Z8WA 4P44A 3R9EA 3EC4A 3CPXA 3RNZA 2G9DA 4CRZB 1ELLP 2V8DA 2PQ8A 4ZGYB 2ZEPA 4KUBA 2F5IA 5CPAA 3FXTA 1IB1E 1P4NA 4X2TA 1Z4RA 4B10A 3FYNA 4FAIA 2FS5A 2O28A 2GIVA 3CT9A 1YVKA 2JEWA 5A27A 1CJWA 3G3SA 5I4MA 1FY7A 3BJ8A 4IUSA 3T8WA 1Y9KA 2PC1A 1ARMA 1CP7A 1VIXA 2PRBA 3H8FA 5F09A 1MK4A 2AFOA 1QSMA 3PB8X 2J9AA 2DPSA 3IWGA 4MFJA 2EK8A 3FBUA 1PUAA 3C26A 1M4GA 3PRTA 4MHNA 4MCSA 4MCQA 3W6XA 3GLJA 4ONUA 1LOKA 1LAMA 3NE7A 3S6HA 4R76A 2PJ4A 2REFA 4Q38A 1I1DA 3CXPA 4RN7A 3HUVA 2FL4A 2ZENA 2PJ1A 4P10A 3DNSA 2Z10A 8CPAA 4JWPA 4P4EA 2ZOGA 4ZX9A 5IB9A 5JQ4A 2NYQA 4KZTA 1A2ZA 3MN8A 5G22A 3B8GA 1NSAA 3L2NA 5H84A 4NSQA 1CPSA 1MJAA 5AG7A 1Y7EA 1R57A 1QSRA 1VHSA 3GB0A 1S7NA 3P2HA 3H5ZA 3ISZA 2P0WA 2I3CA 2PJ0A 3G8WA 4CAVA 1YSJA 2B4DB 1AYEA 2G3AA 4UWJA 4ZY2A 2Q4YA 3IC1A 7CPAA 1M4DA 3RZAA 4A2ZA 3D66A 4MCPA 3DDDA 4B5PB 2JDDA 5GCNA 4C68A 4A33A 4JXRA 4CYNA 4CAWA 2Z3MA 3E0KA 2IQ6A 2G3TA 4R7MA 2O53A 3A9LA 4A31A 1Z5RA 4Z65A 2VZZA 4FBEA 4FD7A 4OC0A 2RC4A 3LD2A 2PJ6A 4C2YA 3SJFA 4KOXA 3V8IA 2PR8A 2R98A 1S60A 3D7GA 3IWWA 1TKFA 2Q44A 3V7ZA 3PGPA 5LRJA 4M6GA 4YGOA 2Q7BA 2AFWA 3DR8A 3SJXA 2R1IA 3CDXA 3CPAA 3SXNA 4E8OA 1VGYA 4F6AA 4F9VA 2VZYA 4MY0A
chains in the Genus database with same CATH topology
3D8PA 4JLYA 3TO9A 4DNCA 3N7ZA 4K30A 4KOYA 4C2ZA 3D3SA 3JVNA 3LODA 4H89A 1YVOA 2VQYA 4B11A 3R96A 2CXAA 4HNYB 3JUWA 2I79A 2ARHA 3IU1A 1MJ9A 2B3UA 4MI4A 2Q04A 1YK3A 4QBJA 1BO4A 4CGOA 1CM0A 2GANA 4RI1A 4B13A 4UCMA 1N71A 4UA3A 5G21A 1BOBA 1XMTA 3K9UA 4E0AA 4CAFA 2B5GB 3BJ7A 3TO7A 1NMTA 1XEBA 4MFQA 5EC4A 1K4JA 3QAHA 2J8NA 4OADA 5AG5A 1B6BA 5JPHA 2YNCA 4KOWA 1XF8A 3CXQA 4B12A 1KUXA 5IV0A 4A32A 3WR7A 2CNMA 4LUAA 3DSBA 1S5KA 3TE4A 3TOBA 1ZO0A 2HQYA 1NE9A 3S6FA 2PR1A 3UY5A 3GKRA 3GYAA 1RO5A 4UFXA 5FVJA 4I49A 4CAXA 2DPTA 3JTKA 3PP9A 4CAEA 4JXQA 1I21A 4M3SA 2BSWA 1M1DA 5I0CA 3CXSA 5F46A 3D2PA 4CGPA 2B4DA 2KCWA 2QIRA 2P6GA 4YFJA 1XE4A 4QC6A 5DWNA 2BL1A 3R9FA 4B5PA 1OZPA 2G0BA 1PU9A 3I9SA 2JDCA 3R1KA 4II9A 4B5OA 4KSAA 4X5KA 4HKFA 4NEXA 4XPKA 5HMNA 1IIDA 5AG4A 2WPWA 2VXKA 3TO6A 4A95A 5BWAB 3EFAA 3F5BA 1V0CA 4PSXA 2WPXA 4KVXA 5F48A 5C88A 4C7IA 4EVYA 4UWIA 4FD4A 5H86A 2OZHA 3FNCA 3H4QA 2NMTA 4AVCA 1YX0A 2OB0A 5CNPA 4H6UA 3TFYA 3I3GA 4KVOE 2HV2A 4PK3A 2J8RA 4NXYA 4L89A 2VBQA 4MY3A 4JD6A 1Y9WA 2ZW6A 4UCNA 4AG9A 1M44A 5G20A 4MHDA 2FXFA 2H5MA 4E2AA 4FD5A 2Y0MA 2JLMA 3FIXA 4UCPA 3RYOA 4CRYB 1IYKA 3QB8A 4RS2A 2IL4A 2PDOA 4M85A 2I00A 2B5GA 3IU2A 4GS4A 5EBVA 1MJBA 4C7HA 2ATRA 2HUZA 5IX3A 4AG7A 2ZW4A 4AB7A 2P6FA 3PZJA 2REEA 4NCZA 4CYOA 4CYPA 3KKWA 1IICA 2B4BA 1B87A 1M4IA 5F49A 3OWCA 4J3GA 1LRZA 4R9MA 3ZZIA 1XIXA 2Z11A 5G1ZA 3SXOA 1SQHA 1QSOA 4KOTA 2Z0ZA 2ZW7A 4CYQA 2EUIA 4QUSA 4CGMA 2ZXVA 1U6MA 4R57A 5HH1A 4MFZA 4XPLA 4YRHA 3IWEA 2VEZA 3R95A 2OU2A 3D2MA 3SHPA 3IGRA 3TOAA 1WK4A 4U9ZA 2PSWA 3P2FA 1YLEA 1Z4EA 4ORFA 3S6GA 4C2XA 1S3ZA 3TT2A 4R3LA 1RXTA 2BEIA 2Z3KA 4KORA 4MFKA 2Z3NA 4UFWA 2VI7A 4ZBGA 1Z9UA 3DR6A 1WWZA 2ZPAA 3T9YA 5IB0A 4U5YA 2YGWA 1KZFA 4PV6A 1QSNA 4BBHA 4A30A 4QVTA 1I12A 3TCVA 1VKCA 4KOUA 2B3VA 4UFVA 1YGHA 4XNHC 2CNSA 4Q36A 2K5TA 4IF5A 4NF1A 1ON0A 3ZJ0A 1IYLA 4F0XA 4B14A 2B58A 4U9YA 4Y49C 4CS0B 2DXQA 2OZUA 4PK2A 3TTHA 4KLVA 5AG6A 4R87A 4KOSA 2FSRA 2WSAA 2AE6A 3S6KA 4FD6A 4XNHB 1YR0A 2YNEA 2FCKA 4QB9A 2ZW5A 4KLWA 2FIAA 1S7LA 4CGLA 4XPDC 1J4JA 1KUVA 1L0CA 4Y49B 4OAEA 1S7FA 4CGNA 1GHEA 4H6ZA 5ISVA 4LX9A 5J8CA 4PSWA 3BLNA 5E96A 4AVAA 4MFPA 5DWMA 2A4NA 5J8FA 4AVBA 4XPDB 4KVME 2J8MA 4KS9A 2QECA 5AGEA 3R9GA 2AJ6A 2CNTA 4MFLA 1TIQA 3EO4A 5C82A 4F0YA 5A28A 1YREA 3FRMA 4MBUA 2BUEA 2CY2A 2GE3A 4L8AA 4BMHA 2EVNA 2R8VA 4KUAA 1QSTA 2Q0YA 3F0AA 4R3KA 1KUYA 1UFHA 3W91A 2QMLA 2OH1A 1Q2DA 3FB3A 3MGDA 3EY5A 1S7KA 2OZGA 2Q4VA 3W6SA 2WUUA 3EXNA 4MJ8A 4JJXA 4OLLA 2P6EA 2JEVA 4UBRA 5F47A 3F8KA 3VWEA 2YNDA 2C27A 2R7HA 2Z3LA 5KTAA 4KSFA 4KOVA 1NSLA 2Z3OA 2X7BA 2FE7A 4HNWB 3T90A 1Q2YA 1P0HA 3VWDA 5KTCA 2FIWA 1Y7RA 1Q2CA 2D4OA 3GY9A 5KTDA 2YNCC 2D4PA 2Z3PA 2FT0A 4HNXB 3R9EA 3EC4A 4CRZB 2PQ8A 4ZGYB 4KUBA 2F5IA 3FXTA 1IB1E 1P4NA 4B10A 1Z4RA 3FYNA 2FS5A 2O28A 2GIVA 1YVKA 5A27A 1CJWA 3G3SA 1FY7A 3BJ8A 4IUSA 1Y9KA 2PC1A 2PRBA 1MK4A 1QSMA 2DPSA 3IWGA 4MFJA 3FBUA 1PUAA 3C26A 1M4GA 3W6XA 4ONUA 3NE7A 3S6HA 2REFA 4Q38A 1I1DA 3CXPA 2FL4A 3DNSA 2Z10A 4JWPA 5JQ4A 4KZTA 5G22A 3B8GA 5H84A 4NSQA 1MJAA 5AG7A 1R57A 1QSRA 1VHSA 1S7NA 3P2HA 3H5ZA 2P0WA 3G8WA 4CAVA 2B4DB 2G3AA 4UWJA 2Q4YA 1M4DA 4A2ZA 3DDDA 4B5PB 2JDDA 5GCNA 4C68A 4A33A 4JXRA 4CYNA 4CAWA 2Z3MA 3E0KA 2G3TA 3A9LA 4A31A 2VZZA 4FD7A 2RC4A 3LD2A 4C2YA 4KOXA 3V8IA 2PR8A 2R98A 1S60A 2Q44A 3PGPA 4YGOA 2Q7BA 3DR8A 3SXNA 2R1IA 4E8OA 4F6AA 2VZYA 4MY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G20 A;  4B10 A;  4C68 A;  4B13 A;  4UFV A;  4C7I A;  4A33 A;  4CGP A;  4CYN A;  5AGE A;  4UCM A;  4CGL A;  4C2X A;  5G21 A;  4C2Z A;  2WUU A;  5A27 A;  4CAF A;  5A28 A;  4UCP A;  5G1Z A;  5G22 A;  4A31 A;  4B14 A;  4B11 A;  4CGN A;  4CYQ A;  4UFW A;  5AG7 A;  4UFX A;  2YND A;  4C2Y A;  4CGM A;  4A30 A;  3IU1 A;  3IU2 A;  4C7H A;  3JTK A;  3H5Z A;  2YNC C;  5AG4 A;  5AG5 A;  4CAE A;  5AG6 A;  2YNC A;  4A95 A;  4CYO A;  3IWE A;  4CYP A;  4UCN A;  2WSA A;  4CGO A;  4A2Z A;  4B12 A;  4A32 A;  4BBH A;  2YNE A; 
#chains in the Genus database with same CATH topology
 3D8P A;  3KR5 A;  4JLY A;  5LRK A;  5CBM A;  3TO9 A;  4DNC A;  2ABZ A;  3N7Z A;  4FWU A;  4K30 A;  4KOY A;  4LQG A;  4TWE A;  4C2Z A;  5LYF A;  3D3S A;  3IJ3 A;  3JVN A;  3LOD A;  4H89 A;  1X12 A;  2CTC A;  4MXU A;  1YVO A;  2VQY A;  4B11 A;  3R96 A;  4OC5 A;  5JM6 A;  1JQG A;  1CPX A;  4P4J A;  2CXA A;  4HNY B;  3JUW A;  1QMU A;  4P4D A;  2I79 A;  3PEI A;  2ARH A;  3IU1 A;  3K9T A;  1CP6 A;  1MJ9 A;  2B3U A;  1XOV A;  4MI4 A;  2Q04 A;  5JH9 A;  2C6G A;  1XFO A;  1YK3 A;  4QBJ A;  1BO4 A;  4EME A;  4CGO A;  1CM0 A;  2GAN A;  3BHX A;  1IOI A;  4G1P A;  4NGQ A;  2V8H A;  4RI1 A;  4B13 A;  4JYW A;  3KHZ A;  1N71 A;  4UCM A;  4UA3 A;  2ZOF A;  2ZEG A;  4P6Y A;  3KQX A;  5G21 A;  1BOB A;  1XMT A;  3D7D A;  3K9U A;  2AFX A;  4CAF A;  2B5G B;  4MMO A;  4E0A A;  1Z8L A;  1KWM A;  4B6Z A;  3BJ7 A;  3PB9 X;  1HDQ A;  3TO7 A;  4PXD A;  1NMT A;  1XEB A;  3PBE A;  4MFQ A;  5EC4 A;  1K4J A;  3QAH A;  2J8N A;  2O4H A;  1RTQ A;  4A39 A;  1CX8 A;  4NJQ A;  4OAD A;  5AG5 A;  1B6B A;  1YW4 A;  3VAR A;  4ZY0 A;  5JPH A;  2YNC A;  1LFW A;  3V38 A;  2JBK A;  1YQE A;  2CF4 A;  4KOW A;  1XF8 A;  2GU2 A;  3CXQ A;  4B12 A;  1KUX A;  5IV0 A;  4A32 A;  4UIB A;  2PJ3 A;  3WR7 A;  3IIB A;  4A37 A;  2CNM A;  4LUA A;  4NGT A;  3B3W A;  3D4U A;  3DSB A;  1S5K A;  3TE4 A;  3TOB A;  4ZX8 A;  2OR4 A;  1ZO0 A;  2HB6 A;  1NE9 A;  2HQY A;  4UEF A;  3S6F A;  2PR1 A;  4LQ6 A;  2XEJ A;  3FEC A;  3GKR A;  3GYA A;  3UY5 A;  3S9N A;  1RO5 A;  3WC5 A;  4UFX A;  5FVJ A;  1R3N A;  4I49 A;  1YLO A;  5DS0 A;  3SI0 A;  2DPT A;  3JTK A;  4CAX A;  1H8L A;  2WZN A;  3PP9 A;  4CAE A;  3PFO A;  4JXQ A;  1I21 A;  4M3S A;  2BSW A;  3VH9 A;  1M1D A;  3BI0 A;  5D29 A;  5I0C A;  3CXS A;  2PIZ A;  5F46 A;  1BAV A;  2IJZ A;  3D2P A;  2ZEE A;  3IEH A;  4BIN A;  2PCU A;  4CGP A;  5HVH A;  2B4D A;  2KCW A;  2QIR A;  2P6G A;  4YFJ A;  1XE4 A;  4QC6 A;  5DWN A;  2BL1 A;  3KZW A;  3R9F A;  4B5P A;  1LAP A;  1OZP A;  3B3V A;  5HVG A;  2ZEL A;  2G0B A;  4OKO A;  3D68 A;  1PU9 A;  3I9S A;  4Q7A A;  2JDC A;  3R1K A;  4II9 A;  4B5O A;  3WC7 A;  4KSA A;  4X5K A;  4HKF A;  4NEX A;  4XPK A;  4MHY A;  1IID A;  3RAM A;  5HMN A;  3PBB A;  5AG4 A;  2WPW A;  2GLF A;  1IGB A;  1Q7L A;  2VXK A;  4M6H A;  3TO6 A;  1X10 A;  4A95 A;  3VAT A;  2NSM A;  3EFA A;  5BWA B;  2PIY A;  3F5B A;  5HVF A;  1V0C A;  3SJE A;  4OID A;  4PSX A;  2GLJ A;  2WPX A;  3KHX A;  4KVX A;  5F48 A;  4C7I A;  5EMI A;  5C88 A;  4EVY A;  4UWI A;  4FD4 A;  5H86 A;  2OZH A;  3FNC A;  3H4Q A;  2NMT A;  3B2Y A;  2BOA A;  4AVC A;  1YX0 A;  4NGS A;  2OB0 A;  2ZEF A;  4HPS A;  5CNP A;  4IHM A;  4H6U A;  3TFY A;  4PXE A;  1FT7 A;  3I3G A;  1EE3 P;  1TF9 A;  3PB6 X;  4KVO E;  2HV2 A;  4PK3 A;  1CBX A;  2J8R A;  4NXY A;  4L89 A;  2VBQ A;  4MY3 A;  4JD6 A;  3BXM A;  1Y9W A;  2ZW6 A;  4UCN A;  4AG9 A;  1TKJ A;  1F2P A;  3QNV A;  1M44 A;  2PJ9 A;  3LAC A;  5G20 A;  2CTB A;  1BPN A;  2AFM A;  2FXF A;  4MHD A;  2H5M A;  4OP4 A;  4E2A A;  5K8N A;  4FD5 A;  2Y0M A;  2JLM A;  2PRQ A;  3FIX A;  1R43 A;  4NJR A;  4UCP A;  3RYO A;  4P4B A;  3D7H A;  4CRY B;  4CPA A;  1IYK A;  3QB8 A;  4KSI A;  4RS2 A;  2IL4 A;  2PDO A;  4M85 A;  2I00 A;  2ZEH A;  2XEF A;  4O23 A;  2B5G A;  3IU2 A;  4GS4 A;  1VHE A;  1MJB A;  2V8V A;  5EBV A;  2ATR A;  2HUZ A;  4C7H A;  5IX3 A;  4AG7 A;  4NGN A;  5LYL A;  2ZW4 A;  2EO8 A;  2P6F A;  3PZJ A;  4AB7 A;  4PPZ A;  3NH4 A;  2REE A;  4NCZ A;  4CYO A;  4CYP A;  3KKW A;  1IIC A;  3NE8 A;  2B4B A;  1XBU A;  1B87 A;  1M4I A;  2EWB A;  2VL1 A;  4UF4 A;  1IOF A;  4P4F A;  2ZEM A;  5F49 A;  1JWQ A;  1IY7 A;  3OWC A;  4J3G A;  1LRZ A;  2ODF A;  4R9M A;  2PJ8 A;  3ZZI A;  1XIX A;  2Z11 A;  5G1Z A;  1LAN A;  2ZED A;  1SQH A;  3SXO A;  1QSO A;  4OC2 A;  4KOT A;  3FED A;  3GIU A;  2Z0Z A;  2ZW7 A;  4CYQ A;  2EUI A;  4EFD A;  5HXD A;  1TF8 A;  4QUS A;  4CGM A;  2ZXV A;  2XEI A;  1U6M A;  4R57 A;  5HH1 A;  4MFZ A;  4XPL A;  2OOT A;  5J1Q A;  4YWY A;  5LYD A;  4OC4 A;  4F9U A;  4NGR A;  4UEZ A;  4YRH A;  1UWY A;  3IWE A;  2VEZ A;  3R95 A;  2OU2 A;  3D2M A;  3SHP A;  3IGR A;  3TOA A;  1CG2 A;  1WK4 A;  4U9Z A;  1HDU A;  2C6C A;  2PSW A;  3KR4 A;  4GXH A;  2PJC A;  4X3R A;  1BLL E;  5JGF A;  4ZI6 A;  3P2F A;  1YLE A;  1Z4E A;  2Q43 A;  1QQ9 A;  4ORF A;  3S6G A;  2DEA A;  4C2X A;  1S3Z A;  2WYR A;  3TT2 A;  5K8P A;  4R3L A;  1RXT A;  3TC8 A;  2BEI A;  2Z3K A;  2FVG A;  4KOR A;  3B3C A;  3DLJ A;  4MFK A;  3NA6 A;  2Z3N A;  4UFW A;  4PXC A;  2VI7 A;  4DYO A;  3KAS A;  3I1U A;  4ZBG A;  4RUH A;  1Z9U A;  3NFZ A;  1DTD A;  3B35 A;  3DR6 A;  1WWZ A;  2ZPA A;  3T9Y A;  5IB0 A;  4U5Y A;  3K2K A;  2YGW A;  4OC3 A;  1KZF A;  2RFH A;  3PFE A;  4GM5 A;  4TNU A;  4PV6 A;  1QSN A;  4AXV A;  5A28 A;  4UIA A;  4BBH A;  4JZ0 A;  4A30 A;  1ZG8 A;  1Z8X A;  4QVT A;  1I12 A;  3TCV A;  1VKC A;  4KOU A;  2B3V A;  2PE3 A;  4UFV A;  4NFR A;  1YGH A;  4XNH C;  2CNS A;  4Q36 A;  2K5T A;  4IF5 A;  4NF1 A;  3S9M A;  1ON0 A;  2BCO A;  1IYL A;  1ZLH A;  3QAY A;  3SI2 A;  3ZJ0 A;  4B14 A;  4F0X A;  2B58 A;  4IK2 A;  4U9Y A;  4DJL A;  4Y49 C;  2EK9 A;  2PJ5 A;  4BD9 A;  4DUK A;  3FMC A;  4ONW A;  4CS0 B;  3HLP A;  4A94 A;  4ZY1 A;  3S9L A;  3FVL A;  2DXQ A;  2OZU A;  3CZX A;  4PK2 A;  4W9Y A;  4KLV A;  3TTH A;  3FF3 A;  5AG6 A;  5K8M A;  4R87 A;  4KOS A;  3TX8 A;  2FSR A;  2WSA A;  3DGV A;  4FUU A;  2AE6 A;  4A38 A;  4MHZ A;  1ZLI A;  3S6K A;  4FD6 A;  4WWV A;  4XNH B;  1YR0 A;  2YNE A;  4OME A;  2FCK A;  4P4I A;  4QB9 A;  2ZW5 A;  1HEE A;  4KLW A;  3JRU A;  2FIA A;  1S7L A;  4CGL A;  1FNO A;  2QYV A;  4XPD C;  1J4J A;  1KUV A;  4IAV A;  1L0C A;  4F8Z A;  4K3N A;  4EWT A;  3NH5 A;  5THW A;  4Y49 B;  4OAE A;  1S7F A;  2V77 A;  5D8N A;  4CGN A;  1GHE A;  1Y0Y A;  4H6Z A;  5ISV A;  4LX9 A;  2BO9 A;  3FH4 A;  3SJG A;  3WT4 A;  5J8C A;  4PSW A;  1ZG9 A;  3BLN A;  3FJU A;  5E96 A;  4AVA A;  1VHO A;  4MFP A;  5DWM A;  2A4N A;  1Z2L A;  4MCR A;  2F7V A;  4H2K A;  4MRI A;  5J8F A;  4AVB A;  3D67 A;  4XPD B;  5LRG A;  4KVM E;  3NH8 A;  2J8M A;  4KS9 A;  2QEC A;  5AGE A;  3R9G A;  2AJ6 A;  2PJB A;  4P45 A;  2CNT A;  4MFL A;  1TIQ A;  3EO4 A;  5C82 A;  2Q4Z A;  4WJB A;  4R8F A;  1AUG A;  2AFZ A;  1YRE A;  3FRM A;  3H8G A;  3PB7 X;  4MBU A;  4F0Y A;  3KI9 A;  2PVV A;  1OBR A;  3LWU A;  1Z8T A;  2Q51 A;  3BI1 A;  2BUE A;  4NGM A;  2PJ2 A;  2CY2 A;  2GE3 A;  4ZYQ A;  4L8A A;  2QVP A;  3H8E A;  4BMH A;  3KGQ A;  2EVN A;  2GRE A;  2XEG A;  4PQA A;  3RO0 A;  3KL9 A;  1F2O A;  2R8V A;  4KUA A;  1QST A;  2Q0Y A;  2Q7S A;  2AFU A;  2EBJ A;  1GYT A;  1M4L A;  5LYI A;  3F0A A;  4R3K A;  1KUY A;  1UFH A;  1XMB A;  3W91 A;  2QML A;  2OH1 A;  3MRU A;  1Q2D A;  3FB3 A;  3MGD A;  1S7K A;  3EY5 A;  4R6T A;  4MHP A;  1YW6 A;  2OZG A;  2Q4V A;  3FEE A;  3W6S A;  2JBJ A;  2WUU A;  2ZEO A;  2RB7 A;  3EXN A;  4MJ8 A;  3SI1 A;  3WC6 A;  4JJX A;  4M6I A;  4OLL A;  2CIJ A;  2P6E A;  2JEV A;  4UBR A;  5F47 A;  3F8K A;  3VWE A;  2DF5 A;  2C27 A;  2PJA A;  2YND A;  2R7H A;  2Z3L A;  4NGP A;  1XJO A;  6CPA A;  1TKH A;  4YU9 A;  3N5F A;  3B3S A;  2PVW A;  1XRY A;  3LMS A;  3WAB A;  5KTA A;  1BPM A;  4KSF A;  1F57 A;  4PXB A;  1YME A;  1PCA A;  2V8G A;  3B7I A;  2AFS A;  2C6P A;  2HC9 A;  3B3T A;  3PB4 X;  3IFE A;  1AMP A;  4KOV A;  1NSL A;  3KQZ A;  1ZG7 A;  2Z3O A;  2X7B A;  2FE7 A;  3FX6 A;  4HNW B;  3T90 A;  1Q2Y A;  3IO1 A;  5ELY A;  1ARL A;  4X8I A;  2ANP A;  1PYT B;  2F8H A;  1P0H A;  1DE4 C;  3D7F A;  1LCP A;  2POK A;  3VWD A;  5KTC A;  4OC1 A;  2FIW A;  4UEE A;  5K8O A;  2PJ7 A;  1Y7R A;  1Q2C A;  2D4O A;  3GY9 A;  5KTD A;  1TXR A;  4OIW A;  1Y0R A;  3RBU A;  2YNC C;  3ISX A;  2D4P A;  2Z3P A;  1IU8 A;  2GFQ A;  2QJ8 A;  3GUX A;  2FT0 A;  4HNX B;  2IMO A;  1ELM P;  2C1C A;  1Z8W A;  4P44 A;  3R9E A;  3EC4 A;  3CPX A;  3RNZ A;  2G9D A;  4CRZ B;  1ELL P;  2V8D A;  2PQ8 A;  4ZGY B;  2ZEP A;  4KUB A;  2F5I A;  5CPA A;  3FXT A;  1IB1 E;  1P4N A;  4X2T A;  1Z4R A;  4B10 A;  3FYN A;  4FAI A;  2FS5 A;  2O28 A;  2GIV A;  3CT9 A;  1YVK A;  2JEW A;  5A27 A;  1CJW A;  3G3S A;  5I4M A;  1FY7 A;  3BJ8 A;  4IUS A;  3T8W A;  1Y9K A;  2PC1 A;  1ARM A;  1CP7 A;  1VIX A;  2PRB A;  3H8F A;  5F09 A;  1MK4 A;  2AFO A;  1QSM A;  3PB8 X;  2J9A A;  2DPS A;  3IWG A;  4MFJ A;  2EK8 A;  3FBU A;  1PUA A;  3C26 A;  1M4G A;  3PRT A;  4MHN A;  4MCS A;  4MCQ A;  3W6X A;  3GLJ A;  4ONU A;  1LOK A;  1LAM A;  3NE7 A;  3S6H A;  4R76 A;  2PJ4 A;  2REF A;  4Q38 A;  1I1D A;  3CXP A;  4RN7 A;  3HUV A;  2FL4 A;  2ZEN A;  2PJ1 A;  4P10 A;  3DNS A;  2Z10 A;  8CPA A;  4JWP A;  4P4E A;  2ZOG A;  4ZX9 A;  5IB9 A;  5JQ4 A;  2NYQ A;  4KZT A;  1A2Z A;  3MN8 A;  5G22 A;  3B8G A;  1NSA A;  3L2N A;  5H84 A;  4NSQ A;  1CPS A;  1MJA A;  5AG7 A;  1Y7E A;  1R57 A;  1QSR A;  1VHS A;  3GB0 A;  1S7N A;  3P2H A;  3H5Z A;  3ISZ A;  2P0W A;  2I3C A;  2PJ0 A;  3G8W A;  4CAV A;  1YSJ A;  2B4D B;  1AYE A;  2G3A A;  4UWJ A;  4ZY2 A;  2Q4Y A;  3IC1 A;  7CPA A;  1M4D A;  3RZA A;  4A2Z A;  3D66 A;  4MCP A;  3DDD A;  4B5P B;  2JDD A;  5GCN A;  4C68 A;  4A33 A;  4JXR A;  4CYN A;  4CAW A;  2Z3M A;  3E0K A;  2IQ6 A;  2G3T A;  4R7M A;  2O53 A;  3A9L A;  4A31 A;  1Z5R A;  4Z65 A;  2VZZ A;  4FBE A;  4FD7 A;  4OC0 A;  2RC4 A;  3LD2 A;  2PJ6 A;  4C2Y A;  3SJF A;  4KOX A;  3V8I A;  2PR8 A;  2R98 A;  1S60 A;  3D7G A;  3IWW A;  1TKF A;  2Q44 A;  3V7Z A;  3PGP A;  5LRJ A;  4M6G A;  4YGO A;  2Q7B A;  2AFW A;  3DR8 A;  3SJX A;  2R1I A;  3CDX A;  3CPA A;  3SXN A;  4E8O A;  1VGY A;  4F6A A;  4F9V A;  2VZY A;  4MY0 A; 
#chains in the Genus database with same CATH homology
 3D8P A;  4JLY A;  3TO9 A;  4DNC A;  3N7Z A;  4K30 A;  4KOY A;  4C2Z A;  3D3S A;  3JVN A;  3LOD A;  4H89 A;  1YVO A;  2VQY A;  4B11 A;  3R96 A;  2CXA A;  4HNY B;  3JUW A;  2I79 A;  2ARH A;  3IU1 A;  1MJ9 A;  2B3U A;  4MI4 A;  2Q04 A;  1YK3 A;  4QBJ A;  1BO4 A;  4CGO A;  1CM0 A;  2GAN A;  4RI1 A;  4B13 A;  4UCM A;  1N71 A;  4UA3 A;  5G21 A;  1BOB A;  1XMT A;  3K9U A;  4E0A A;  4CAF A;  2B5G B;  3BJ7 A;  3TO7 A;  1NMT A;  1XEB A;  4MFQ A;  5EC4 A;  1K4J A;  3QAH A;  2J8N A;  4OAD A;  5AG5 A;  1B6B A;  5JPH A;  2YNC A;  4KOW A;  1XF8 A;  3CXQ A;  4B12 A;  1KUX A;  5IV0 A;  4A32 A;  3WR7 A;  2CNM A;  4LUA A;  3DSB A;  1S5K A;  3TE4 A;  3TOB A;  1ZO0 A;  2HQY A;  1NE9 A;  3S6F A;  2PR1 A;  3UY5 A;  3GKR A;  3GYA A;  1RO5 A;  4UFX A;  5FVJ A;  4I49 A;  4CAX A;  2DPT A;  3JTK A;  3PP9 A;  4CAE A;  4JXQ A;  1I21 A;  4M3S A;  2BSW A;  1M1D A;  5I0C A;  3CXS A;  5F46 A;  3D2P A;  4CGP A;  2B4D A;  2KCW A;  2QIR A;  2P6G A;  4YFJ A;  1XE4 A;  4QC6 A;  5DWN A;  2BL1 A;  3R9F A;  4B5P A;  1OZP A;  2G0B A;  1PU9 A;  3I9S A;  2JDC A;  3R1K A;  4II9 A;  4B5O A;  4KSA A;  4X5K A;  4HKF A;  4NEX A;  4XPK A;  5HMN A;  1IID A;  5AG4 A;  2WPW A;  2VXK A;  3TO6 A;  4A95 A;  5BWA B;  3EFA A;  3F5B A;  1V0C A;  4PSX A;  2WPX A;  4KVX A;  5F48 A;  5C88 A;  4C7I A;  4EVY A;  4UWI A;  4FD4 A;  5H86 A;  2OZH A;  3FNC A;  3H4Q A;  2NMT A;  4AVC A;  1YX0 A;  2OB0 A;  5CNP A;  4H6U A;  3TFY A;  3I3G A;  4KVO E;  2HV2 A;  4PK3 A;  2J8R A;  4NXY A;  4L89 A;  2VBQ A;  4MY3 A;  4JD6 A;  1Y9W A;  2ZW6 A;  4UCN A;  4AG9 A;  1M44 A;  5G20 A;  4MHD A;  2FXF A;  2H5M A;  4E2A A;  4FD5 A;  2Y0M A;  2JLM A;  3FIX A;  4UCP A;  3RYO A;  4CRY B;  1IYK A;  3QB8 A;  4RS2 A;  2IL4 A;  2PDO A;  4M85 A;  2I00 A;  2B5G A;  3IU2 A;  4GS4 A;  5EBV A;  1MJB A;  4C7H A;  2ATR A;  2HUZ A;  5IX3 A;  4AG7 A;  2ZW4 A;  4AB7 A;  2P6F A;  3PZJ A;  2REE A;  4NCZ A;  4CYO A;  4CYP A;  3KKW A;  1IIC A;  2B4B A;  1B87 A;  1M4I A;  5F49 A;  3OWC A;  4J3G A;  1LRZ A;  4R9M A;  3ZZI A;  1XIX A;  2Z11 A;  5G1Z A;  3SXO A;  1SQH A;  1QSO A;  4KOT A;  2Z0Z A;  2ZW7 A;  4CYQ A;  2EUI A;  4QUS A;  4CGM A;  2ZXV A;  1U6M A;  4R57 A;  5HH1 A;  4MFZ A;  4XPL A;  4YRH A;  3IWE A;  2VEZ A;  3R95 A;  2OU2 A;  3D2M A;  3SHP A;  3IGR A;  3TOA A;  1WK4 A;  4U9Z A;  2PSW A;  3P2F A;  1YLE A;  1Z4E A;  4ORF A;  3S6G A;  4C2X A;  1S3Z A;  3TT2 A;  4R3L A;  1RXT A;  2BEI A;  2Z3K A;  4KOR A;  4MFK A;  2Z3N A;  4UFW A;  2VI7 A;  4ZBG A;  1Z9U A;  3DR6 A;  1WWZ A;  2ZPA A;  3T9Y A;  5IB0 A;  4U5Y A;  2YGW A;  1KZF A;  4PV6 A;  1QSN A;  4BBH A;  4A30 A;  4QVT A;  1I12 A;  3TCV A;  1VKC A;  4KOU A;  2B3V A;  4UFV A;  1YGH A;  4XNH C;  2CNS A;  4Q36 A;  2K5T A;  4IF5 A;  4NF1 A;  1ON0 A;  3ZJ0 A;  1IYL A;  4F0X A;  4B14 A;  2B58 A;  4U9Y A;  4Y49 C;  4CS0 B;  2DXQ A;  2OZU A;  4PK2 A;  3TTH A;  4KLV A;  5AG6 A;  4R87 A;  4KOS A;  2FSR A;  2WSA A;  2AE6 A;  3S6K A;  4FD6 A;  4XNH B;  1YR0 A;  2YNE A;  2FCK A;  4QB9 A;  2ZW5 A;  4KLW A;  2FIA A;  1S7L A;  4CGL A;  4XPD C;  1J4J A;  1KUV A;  1L0C A;  4Y49 B;  4OAE A;  1S7F A;  4CGN A;  1GHE A;  4H6Z A;  5ISV A;  4LX9 A;  5J8C A;  4PSW A;  3BLN A;  5E96 A;  4AVA A;  4MFP A;  5DWM A;  2A4N A;  5J8F A;  4AVB A;  4XPD B;  4KVM E;  2J8M A;  4KS9 A;  2QEC A;  5AGE A;  3R9G A;  2AJ6 A;  2CNT A;  4MFL A;  1TIQ A;  3EO4 A;  5C82 A;  4F0Y A;  5A28 A;  1YRE A;  3FRM A;  4MBU A;  2BUE A;  2CY2 A;  2GE3 A;  4L8A A;  4BMH A;  2EVN A;  2R8V A;  4KUA A;  1QST A;  2Q0Y A;  3F0A A;  4R3K A;  1KUY A;  1UFH A;  3W91 A;  2QML A;  2OH1 A;  1Q2D A;  3FB3 A;  3MGD A;  3EY5 A;  1S7K A;  2OZG A;  2Q4V A;  3W6S A;  2WUU A;  3EXN A;  4MJ8 A;  4JJX A;  4OLL A;  2P6E A;  2JEV A;  4UBR A;  5F47 A;  3F8K A;  3VWE A;  2YND A;  2C27 A;  2R7H A;  2Z3L A;  5KTA A;  4KSF A;  4KOV A;  1NSL A;  2Z3O A;  2X7B A;  2FE7 A;  4HNW B;  3T90 A;  1Q2Y A;  1P0H A;  3VWD A;  5KTC A;  2FIW A;  1Y7R A;  1Q2C A;  2D4O A;  3GY9 A;  5KTD A;  2YNC C;  2D4P A;  2Z3P A;  2FT0 A;  4HNX B;  3R9E A;  3EC4 A;  4CRZ B;  2PQ8 A;  4ZGY B;  4KUB A;  2F5I A;  3FXT A;  1IB1 E;  1P4N A;  4B10 A;  1Z4R A;  3FYN A;  2FS5 A;  2O28 A;  2GIV A;  1YVK A;  5A27 A;  1CJW A;  3G3S A;  1FY7 A;  3BJ8 A;  4IUS A;  1Y9K A;  2PC1 A;  2PRB A;  1MK4 A;  1QSM A;  2DPS A;  3IWG A;  4MFJ A;  3FBU A;  1PUA A;  3C26 A;  1M4G A;  3W6X A;  4ONU A;  3NE7 A;  3S6H A;  2REF A;  4Q38 A;  1I1D A;  3CXP A;  2FL4 A;  3DNS A;  2Z10 A;  4JWP A;  5JQ4 A;  4KZT A;  5G22 A;  3B8G A;  5H84 A;  4NSQ A;  1MJA A;  5AG7 A;  1R57 A;  1QSR A;  1VHS A;  1S7N A;  3P2H A;  3H5Z A;  2P0W A;  3G8W A;  4CAV A;  2B4D B;  2G3A A;  4UWJ A;  2Q4Y A;  1M4D A;  4A2Z A;  3DDD A;  4B5P B;  2JDD A;  5GCN A;  4C68 A;  4A33 A;  4JXR A;  4CYN A;  4CAW A;  2Z3M A;  3E0K A;  2G3T A;  3A9L A;  4A31 A;  2VZZ A;  4FD7 A;  2RC4 A;  3LD2 A;  4C2Y A;  4KOX A;  3V8I A;  2PR8 A;  2R98 A;  1S60 A;  2Q44 A;  3PGP A;  4YGO A;  2Q7B A;  3DR8 A;  3SXN A;  2R1I A;  4E8O A;  4F6A A;  2VZY A;  4MY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...