2B5GA

Wild type ssat- 1.7a structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
164
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 164
sequence length 168
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b5gA00
4JLYA 5IV0A 5C82A 2Q44A 2ATRA 2Z10A 4F6AA 5KTCA 2WPXA 1M1DA 1M4IA 1KUYA 3CXQA 4CAXA 1QSRA 2FIAA 1RXTA 3QAHA 4KOSA 3TCVA 2REEA 2B3UA 4CAWA 5KTAA 2PC1A 2EUIA 3T9YA 5CNPA 4AVBA 3FIXA 4ZBGA 1S5KA 2JDDA 4NF1A 1QSNA 3MGDA 4KLWA 4L89A 1YX0A 5F46A 1K4JA 1S7LA 3R9EA 1KUVA 4ONUA 4PV6A 4E8OA 2OZGA 2P6EA 3D2PA 4QVTA 4YGOA 4KOWA 1Z4EA 4FD6A 2ZXVA 5F47A 2PR1A 5GCNA 4KZTA 4OAEA 3FRMA 1MJAA 4XPDC 4E2AA 2KCWA 2CNMA 1PU9A 1IB1E 2OH1A 2Q0YA 4II9A 2I79A 3PZJA 2B5GA 4AVCA 5H86A 4MHDA 3R96A 2NMTA 2Z11A 1YR0A 3R9GA 2OZUA 3BLNA 1NMTA 2EVNA 2P0WA 4NEXA 1GHEA 3FBUA 2CNSA 5HH1A 3G3SA 4YRHA 3DSBA 1KUXA 3TO6A 3TTHA 2R98A 3R1KA 4MJ8A 3P2HA 3FXTA 5KTDA 1RO5A 3W6XA 4KOYA 1SQHA 4MY3A 2QMLA 5DWMA 1YREA 1P4NA 3ZJ0A 3TFYA 4YFJA 2ZW5A 3R95A 2FS5A 2I00A 3EY5A 4GS4A 1KZFA 3W6SA 1M4GA 1YGHA 2ZPAA 4QUSA 1S60A 1MK4A 2PDOA 5JQ4A 3P2FA 4B5OA 3EO4A 3JVNA 3D8PA 2D4PA 2JLMA 4JJXA 2CY2A 2D4OA 3SXOA 4OADA 2QECA 3DDDA 5JPHA 1Y9WA 1YLEA 2HV2A 4HNWB 2B4DB 4QBJA 2Y0MA 1IYLA 4KORA 1XMTA 2JEVA 4CRZB 3G8WA 2Q7BA 1WWZA 2Z0ZA 2J8NA 1VHSA 4NXYA 2GE3A 4PSXA 3F0AA 3S6FA 3F8KA 4M3SA 4L8AA 4PK3A 3DNSA 1M4DA 4KVXA 3K9UA 1OZPA 3TT2A 2J8RA 1BO4A 3S6KA 1P0HA 4RS2A 2FSRA 1L0CA 1Z9UA 5FVJA 3FYNA 2ZW4A 2FCKA 2BL1A 4AVAA 1XIXA 5HMNA 2B58A 2G3TA 1NSLA 2R1IA 4BMHA 4CS0B 1Z4RA 3S6HA 1N71A 1Q2CA 3JUWA 2IL4A 3IGRA 3FB3A 4KOXA 3EC4A 3DR8A 1S7FA 2DXQA 1B87A 2B4BA 4PK2A 3SHPA 1Y9KA 2K5TA 3GKRA 4QC6A 4R3LA 4H6UA 3E0KA 3TO9A 5IB0A 4I49A 4B5PB 1YVOA 3PP9A 2ARHA 2VZZA 1XF8A 1Y7RA 2CNTA 2P6FA 3PGPA 4UWIA 2VBQA 1IYKA 5C88A 1IICA 1CM0A 2PSWA 3B8GA 3N7ZA 4Y49B 4HNXB 4EVYA 4R87A 4AG7A 4U5YA 1I12A 4J3GA 2WPWA 4DNCA 4KUAA 4E0AA 4KOVA 4KVME 1I21A 3FNCA 1J4JA 1XEBA 1S3ZA 3WR7A 4CRYB 2X7BA 2GIVA 4H6ZA 2VXKA 4RI1A 4XNHB 4KOTA 5J8CA 3BJ7A 2QIRA 1B6BA 1QSTA 2JDCA 4KUBA 3NE7A 3VWDA 4R57A 2HUZA 3T90A 3W91A 4XPLA 4OLLA 2Q4YA 3D2MA 2C27A 3IWGA 1CJWA 3CXPA 1TIQA 4KLVA 2GANA 1BOBA 3TOBA 1V0CA 3BJ8A 1MJBA 2ZW7A 2Q04A 1I1DA 3EXNA 2PR8A 2B5GB 3I9SA 1S7KA 1ON0A 4LUAA 3TOAA 1S7NA 4HKFA 4JD6A 4XPKA 4HNYB 2REFA 5DWNA 1UFHA 1U6MA 1XE4A 3ZZIA 4LX9A 2PRBA 2FL4A 5F49A 3V8IA 4AG9A 4FD5A 4NCZA 2G0BA 2BUEA 3S6GA 4X5KA 3C26A 2ZW6A 3DR6A 3F5BA 3GY9A 3LODA 4R3KA 4H89A 1R57A 3LD2A 1YVKA 4JWPA 1NE9A 4KOUA 2FIWA 5ISVA 5J8FA 4U9ZA 1FY7A 4CAVA 4FD4A 2VI7A 2HQYA 3QB8A 3EFAA 1PUAA 2OZHA 2FE7A 4MBUA 2VZYA 4MI4A 3GYAA 1QSOA 2G3AA 4FD7A 4K30A 2OB0A 2VEZA 4XPDB 4PSWA 5F48A 2PQ8A 4ORFA 4Y49C 4R9MA 1Q2YA 1IIDA 5I0CA 3D3SA 1Q2DA 2P6GA 2B4DA 2F5IA 3KKWA 2A4NA 3OWCA 2AE6A 2H5MA 1M44A 5EC4A 4AB7A 4JXQA 1WK4A 2FT0A 1MJ9A 2AJ6A 2B3VA 3VWEA 4JXRA 1VKCA 4XNHC 4KVOE 5IX3A 3TE4A 2FXFA 3R9FA 2OU2A 3UY5A 2O28A 2R7HA 4IUSA 2Q4VA 1YK3A 3TO7A 3H4QA 4UWJA 2R8VA 5H84A 3SXNA 4F0YA 4MY0A 4UA3A 3I3GA 2VQYA 4NSQA 5EBVA 4IF5A 1QSMA 4UBRA 1LRZA 2BSWA 2J8MA 4M85A 5E96A 2RC4A 3CXSA 2BEIA 4B5PA 3RYOA 4QB9A 4U9YA
chains in the Genus database with same CATH superfamily
5HVHA 4JLYA 5IV0A 1HEEA 5C82A 4MFLA 1CG2A 4LQGA 4P4IA 2Q44A 1F2OA 2CTBA 2ATRA 3VARA 4C2YA 3A9LA 2Z10A 4F6AA 2WSAA 1TKFA 5KTCA 1CP6A 2WPXA 2YNDA 3B3VA 1M1DA 1FT7A 1KUYA 1M4IA 4Q36A 2RFHA 3CXQA 4MFPA 3WABA 4B13A 4CAXA 1QSRA 4CPAA 5JM6A 2GLJA 4GXHA 1HDQA 1RXTA 2FIAA 3QAHA 5D8NA 4KOSA 4CGLA 4MCSA 1ARMA 2REEA 2B3UA 3TCVA 3FX6A 2ZEFA 4CAWA 5HVGA 5KTAA 2PC1A 2EUIA 1A2ZA 2Z3OA 3PEIA 3T9YA 4CGPA 1YW4A 3LWUA 1Z5RA 5CNPA 2GU2A 4AVBA 4OKOA 3FIXA 4ZBGA 5LRKA 4MHPA 1HDUA 1S5KA 2JDDA 4NF1A 1QSNA 4HPSA 5JGFA 5J1QA 1Z8TA 4A94A 2GFQA 2ZEOA 5AG6A 3MGDA 4KLWA 3IO1A 4KSFA 4L89A 2V8DA 4EWTA 4RUHA 1YX0A 2EBJA 4UEFA 1VIXA 3ISZA 4RN7A 1BPNA 4W9YA 2ZEMA 5F46A 1K4JA 1S7LA 3R9EA 4CYPA 4H2KA 1KUVA 4NGSA 4ONUA 4P4FA 3RAMA 2Z3MA 2Z3KA 4IK2A 4PV6A 4P4EA 2PJ9A 3LACA 3CPXA 4ZGYB 2OR4A 4E8OA 4FUUA 2OZGA 2P6EA 3D4UA 3D2PA 4QVTA 4YGOA 3PFEA 4KOWA 4DYOA 1Z4EA 4FD6A 2ZXVA 1YSJA 4M6IA 2JBKA 3V38A 5F47A 2PR1A 4UIBA 4UEZA 4KZTA 4OAEA 3B3TA 3FRMA 5GCNA 3JRUA 1ELLP 1MJAA 4XPDC 3NH5A 4E2AA 2KCWA 1M4LA 2EWBA 1BPMA 2CNMA 4YWYA 3PRTA 1PU9A 1XRYA 2WYRA 1IB1E 3FF3A 2OH1A 4B14A 2Q0YA 4II9A 7CPAA 2CTCA 4MCPA 1CPXA 2I79A 3PZJA 2B5GA 4AVCA 1LOKA 4UCNA 4MHDA 5H86A 2RB7A 2Q43A 3R96A 2NMTA 1BAVA 2Z11A 5G1ZA 3IU2A 1YR0A 3B3SA 3R9GA 1F57A 4BD9A 4MHNA 1XMBA 2OZUA 4UFWA 3BLNA 1NMTA 1H8LA 2AFXA 2EVNA 2BCOA 2EO8A 2P0WA 3PFOA 4NEXA 5AG5A 3SJXA 4MCQA 1GHEA 2C1CA 3FBUA 2DF5A 2CNSA 5HH1A 3G3SA 5DS0A 3H8FA 4YRHA 4R76A 3DSBA 1KUXA 3TO6A 2F7VA 2XEFA 2R98A 3R1KA 4P44A 3TTHA 3LMSA 4MJ8A 1Y0YA 3P2HA 4BBHA 3FXTA 2PJAA 4O23A 2QYVA 5KTDA 1RO5A 3W6XA 4KOYA 1SQHA 3KI9A 2PIYA 4MY3A 2QMLA 1XFOA 3WC7A 3TX8A 2O53A 4MXUA 2J9AA 4PXEA 5DWMA 1YREA 1P4NA 3KGQA 3NA6A 4OC0A 2YNCC 3ZJ0A 5A28A 3TFYA 5CPAA 1Z8WA 2POKA 2ZW5A 3B3CA 3R95A 4YFJA 3B3WA 2FS5A 2I00A 3SI2A 3EY5A 1CPSA 1GYTA 1DE4C 4GS4A 1KZFA 3W6SA 4CYNA 2IMOA 2V8VA 2EK8A 3FEDA 4Z65A 1M4GA 1XJOA 1ELMP 4CGNA 1YGHA 2ZPAA 4QUSA 4A33A 1S60A 1MK4A 2PDOA 2Z3NA 5JQ4A 4DUKA 3IIBA 3P2FA 2XEJA 3EO4A 4B5OA 4OC2A 3K2KA 2C6CA 4MFKA 3DLJA 3JVNA 3IEHA 3RO0A 3KHXA 2Q51A 4KS9A 5LRJA 2AFOA 3D8PA 2ZEHA 5ELYA 3SJEA 4UCPA 1LANA 3KL9A 4X8IA 2D4PA 2AFWA 2JLMA 3H5ZA 1X10A 4JJXA 3IWEA 1ZG8A 3GB0A 4C2ZA 2GREA 3SI1A 3NFZA 1X12A 5G21A 4DJLA 2CY2A 2D4OA 3SXOA 4OADA 2QECA 4NFRA 4ZY2A 4OIWA 3FEEA 5JH9A 3S9LA 1NSAA 3DDDA 5JPHA 2F8HA 1Y9WA 1IY7A 1YLEA 2HV2A 2ZENA 4HNWB 6CPAA 2XEGA 2B4DB 2QJ8A 4CGOA 4CYOA 1BLLE 4MFZA 4UCMA 4QBJA 2Y0MA 1IYLA 4WJBA 4KORA 3SJFA 3PB8X 1XMTA 4UF4A 2JEVA 4CRZB 3G8WA 2Q7BA 1WWZA 2Z0ZA 2J8NA 4TWEA 1VHSA 4NXYA 2Q7SA 3CZXA 4A39A 1YW6A 3IFEA 2PVWA 2GE3A 4PSXA 3F0AA 2VL1A 4IAVA 3S6FA 5K8OA 3F8KA 2IJZA 1AMPA 4M3SA 1LCPA 4L8AA 4ZY1A 4PK3A 3K9TA 1IOFA 2G9DA 2ANPA 3DNSA 5LRGA 1ZO0A 3KR4A 4R7MA 1M4DA 4CAEA 3NH8A 4KVXA 4CAFA 3GUXA 1OZPA 3K9UA 4Q38A 3TT2A 2J8RA 1BO4A 3S6KA 1P0HA 4RS2A 2FSRA 5LYFA 1L0CA 1Z9UA 1ZLIA 2YNCA 2PVVA 2PRQA 5FVJA 1AUGA 3FYNA 4ZX9A 2ZW4A 4MRIA 3H8GA 2FCKA 2BL1A 1LFWA 4FAIA 1IU8A 8CPAA 4IHMA 4AVAA 4UFXA 1XIXA 3D67A 5A27A 5LYDA 5HMNA 2B58A 3GIUA 2G3TA 3D7DA 1NSLA 2R1IA 3V7ZA 4BMHA 4CS0B 1Z4RA 3S6HA 1N71A 2PE3A 2PJ8A 1Q2CA 3JUWA 3PB6X 2OOTA 2IL4A 3PBEA 3IGRA 3FB3A 4NGQA 4KOXA 3EC4A 3DR8A 2HB6A 4X2TA 1S7FA 2DXQA 1B87A 2B4BA 4PK2A 3SHPA 1Y9KA 1YLOA 2PJ1A 2K5TA 3GKRA 4QC6A 4R3LA 4H6UA 1Q7LA 4A37A 1ZG7A 2CIJA 3E0KA 4F9VA 2ZEPA 3TO9A 5IB0A 2ZOFA 3KQXA 4I49A 4B5PB 1YVOA 3PP9A 2ARHA 1PYTB 3D7FA 2VZZA 1XF8A 1Y7RA 2CNTA 2P6FA 3PGPA 4UWIA 4WWVA 1Y7EA 2VBQA 5AG7A 1IYKA 1XBUA 5C88A 1CM0A 1IICA 2PSWA 3B8GA 2O4HA 1DTDA 3N7ZA 4FWUA 4OP4A 4Y49B 4HNXB 4C2XA 4EVYA 4R87A 4AG7A 3I1UA 1TXRA 4U5YA 4F9UA 1PCAA 1VGYA 4X3RA 2ZEGA 1I12A 2DPTA 4ZX8A 2V8GA 4J3GA 5K8MA 2WPWA 4DNCA 1RTQA 2ZOGA 4KUAA 4E0AA 1EE3P 4R6TA 4KOVA 4KVME 3FVLA 4C68A 1Y0RA 1I21A 3FNCA 3PB4X 4P45A 1J4JA 1XEBA 4OC1A 1S3ZA 3N5FA 3WR7A 2FVGA 3BI0A 4CRYB 2X7BA 2GIVA 4H6ZA 4OIDA 2VXKA 1CBXA 3IC1A 3PBBA 4NGMA 4GM5A 3DGVA 4RI1A 2C6GA 4XNHB 5F09A 3BXMA 3FECA 4PXCA 1UWYA 4KOTA 5J8CA 3BJ7A 3JTKA 4ZI6A 1Z8LA 1B6BA 2QIRA 4B12A 1QSTA 1R3NA 2JDCA 4KUBA 3NE7A 2YGWA 3FJUA 3VWDA 3GLJA 1YQEA 5LYLA 4R57A 2HUZA 4MCRA 1QMUA 3T90A 4F0XA 1CX8A 3W91A 2Q4ZA 4OC3A 4XPLA 2CXAA 2Z3PA 2PJ5A 4OLLA 1TKJA 4KSAA 3S9NA 2EK9A 2Q4YA 2PJBA 4TNUA 3RZAA 3D2MA 2C27A 3IWGA 2JEWA 1CJWA 3IJ3A 3CXPA 1TIQA 4KLVA 1LAPA 2GANA 1BOBA 3FMCA 4ONWA 4LQ6A 2PJCA 4NGTA 3TOBA 2NSMA 3CDXA 5K8PA 1V0CA 1FNOA 3BJ8A 4PQAA 3WC5A 1MJBA 3L2NA 2ZW7A 2Q04A 4A2ZA 3D66A 1I1DA 1TKHA 3EXNA 2PCUA 2PR8A 2B5GB 3RBUA 3I9SA 1S7KA 4A31A 1ON0A 1YMEA 4UEEA 1Z2LA 4LUAA 3D7HA 3TOAA 1S7NA 4HKFA 5D29A 5THWA 4JD6A 4B6ZA 5HVFA 4EFDA 4XPKA 2PJ2A 4HNYB 2REFA 4AXVA 1JWQA 5DWNA 5AG4A 4Q7AA 4JYWA 1UFHA 5G22A 1U6MA 1XE4A 3ZZIA 4OC5A 4LX9A 2PRBA 3KASA 2FL4A 5F49A 3V8IA 4AG9A 4FD5A 4NCZA 2G0BA 2BUEA 3S6GA 2AFSA 2PJ4A 1AYEA 4X5KA 3C26A 4A32A 4FBEA 2ZW6A 1LAMA 3DR6A 2PJ7A 2ZEDA 4MHYA 3F5BA 5I4MA 3T8WA 3GY9A 3LODA 3QAYA 4R3KA 3MN8A 4H89A 4BINA 1ARLA 1R57A 3LD2A 1YVKA 4JWPA 4OMEA 4A38A 1NE9A 4KOUA 4C7IA 3TC8A 1ZLHA 2FIWA 5ISVA 5J8FA 4U9ZA 1FY7A 3CPAA 3H8EA 2BOAA 4OC4A 4CAVA 3B35A 4FD4A 2VI7A 2AFZA 2HQYA 2YNEA 2PJ6A 3B7IA 4A95A 1VHOA 3RNZA 5BWAB 3QB8A 3EFAA 4M6GA 5K8NA 1PUAA 2OZHA 4PXBA 3SJGA 3PB9X 2FE7A 4MBUA 5EMIA 2VZYA 4MI4A 4NGRA 2DEAA 2ABZA 4JZ0A 4K3NA 3GYAA 3IU1A 1JQGA 1QSOA 2ZELA 4NGNA 5CBMA 5HXDA 2G3AA 1XOVA 2AFUA 2AFMA 1IOIA 4FD7A 4K30A 2V8HA 1TF8A 4B11A 3HLPA 2OB0A 2VEZA 4XPDB 4G1PA 4PSWA 4R8FA 5F48A 2PQ8A 4P6YA 3MRUA 4ORFA 4Y49C 4R9MA 1Q2YA 1TF9A 1IIDA 1VHEA 1ZG9A 2QVPA 4PPZA 4UFVA 5I0CA 3D3SA 1Q2DA 4MMOA 2P6GA 2B4DA 2F5IA 3ISXA 3KKWA 3KR5A 2A4NA 2PJ0A 3OWCA 4KSIA 2AE6A 1OBRA 2H5MA 1M44A 3NE8A 5EC4A 1Z8XA 4MHZA 4AB7A 3KQZA 4P10A 4UIAA 4YU9A 2IQ6A 2V77A 4F8ZA 4M6HA 3FH4A 4JXQA 1WK4A 2FT0A 1MJ9A 1KWMA 2AJ6A 2B3VA 3WC6A 3VWEA 2HC9A 3D7GA 4JXRA 3D68A 1VKCA 4XNHC 2PIZA 4KVOE 5IX3A 3S9MA 3TE4A 2PJ3A 2FXFA 3IWWA 3PB7X 4P4DA 5AGEA 3R9FA 2C6PA 3HUVA 3KZWA 3NH4A 1CP7A 4NJQA 2OU2A 3UY5A 2O28A 2R7HA 4IUSA 4NGPA 2Q4VA 1YK3A 3WT4A 1IGBA 3TO7A 2DPSA 3H4QA 4B10A 2XEIA 5LYIA 4UWJA 3VATA 2R8VA 4EMEA 3CT9A 4CGMA 4PXDA 5H84A 1F2PA 2WZNA 3SXNA 5G20A 4C7HA 4F0YA 3SI0A 4MY0A 4UA3A 3BHXA 3I3GA 2VQYA 2CF4A 4NSQA 2Z3LA 4A30A 3QNVA 4MFJA 2GLFA 1QQ9A 5EBVA 2JBJA 3KHZA 4IF5A 4ZY0A 1QSMA 3B2YA 4UBRA 2BO9A 1LRZA 3VH9A 4P4JA 4ZYQA 2BSWA 4P4BA 2J8MA 4NJRA 2I3CA 2ZEEA 4CYQA 4M85A 1R43A 5E96A 2RC4A 4MFQA 3CXSA 3BI1A 2BEIA 2WUUA 4B5PA 2NYQA 3RYOA 5IB9A 2ODFA 4QB9A 4U9YA
chains in the Genus database with same CATH topology
4JLYA 5IV0A 5C82A 4MFLA 2Q44A 2ATRA 4C2YA 3A9LA 2Z10A 4F6AA 2WSAA 5KTCA 2WPXA 2YNDA 1M1DA 1M4IA 1KUYA 4Q36A 3CXQA 4MFPA 4B13A 4CAXA 1QSRA 2FIAA 1RXTA 3QAHA 4KOSA 4CGLA 3TCVA 2REEA 2B3UA 4CAWA 5KTAA 2PC1A 2EUIA 2Z3OA 3T9YA 4CGPA 5CNPA 4AVBA 3FIXA 4ZBGA 1S5KA 2JDDA 4NF1A 1QSNA 5AG6A 3MGDA 4KLWA 4KSFA 4L89A 1YX0A 5F46A 1K4JA 1S7LA 3R9EA 4CYPA 1KUVA 4ONUA 2Z3MA 2Z3KA 4PV6A 4ZGYB 4E8OA 2OZGA 2P6EA 3D2PA 4QVTA 4YGOA 4KOWA 1Z4EA 4FD6A 2ZXVA 5F47A 2PR1A 5GCNA 4KZTA 4OAEA 3FRMA 1MJAA 4XPDC 4E2AA 2KCWA 2CNMA 1PU9A 1IB1E 2OH1A 4B14A 2Q0YA 4II9A 2I79A 3PZJA 2B5GA 4AVCA 4UCNA 4MHDA 5H86A 3R96A 2NMTA 2Z11A 5G1ZA 3IU2A 1YR0A 3R9GA 2OZUA 4UFWA 3BLNA 1NMTA 2EVNA 2P0WA 4NEXA 5AG5A 1GHEA 3FBUA 2CNSA 5HH1A 3G3SA 4YRHA 3DSBA 1KUXA 3TO6A 3TTHA 2R98A 3R1KA 4MJ8A 3P2HA 4BBHA 3FXTA 5KTDA 1RO5A 3W6XA 4KOYA 1SQHA 4MY3A 2QMLA 5DWMA 1YREA 1P4NA 3ZJ0A 3TFYA 2YNCC 5A28A 4YFJA 2ZW5A 3R95A 2FS5A 2I00A 3EY5A 4GS4A 1KZFA 3W6SA 4CYNA 1M4GA 4CGNA 1YGHA 2ZPAA 4QUSA 4A33A 1S60A 1MK4A 2PDOA 2Z3NA 5JQ4A 3P2FA 4B5OA 3EO4A 4MFKA 3JVNA 4KS9A 3D8PA 4UCPA 2D4PA 2JLMA 3H5ZA 4JJXA 3IWEA 4C2ZA 5G21A 2CY2A 2D4OA 3SXOA 4OADA 2QECA 3DDDA 5JPHA 1Y9WA 1YLEA 2HV2A 4HNWB 2B4DB 4CGOA 4CYOA 4MFZA 4UCMA 4QBJA 2Y0MA 1IYLA 4KORA 1XMTA 2JEVA 4CRZB 3G8WA 2Q7BA 1WWZA 2Z0ZA 2J8NA 1VHSA 4NXYA 2GE3A 4PSXA 3F0AA 3S6FA 3F8KA 4M3SA 4L8AA 4PK3A 3DNSA 1ZO0A 1M4DA 4CAEA 4KVXA 4CAFA 3K9UA 1OZPA 4Q38A 3TT2A 2J8RA 1BO4A 3S6KA 1P0HA 4RS2A 2FSRA 1L0CA 1Z9UA 2YNCA 5FVJA 3FYNA 2ZW4A 2FCKA 2BL1A 4AVAA 4UFXA 1XIXA 5A27A 5HMNA 2B58A 2G3TA 1NSLA 2R1IA 4BMHA 4CS0B 1Z4RA 3S6HA 1N71A 1Q2CA 3JUWA 2IL4A 3IGRA 3FB3A 4KOXA 3EC4A 3DR8A 1S7FA 2DXQA 1B87A 2B4BA 4PK2A 3SHPA 1Y9KA 2K5TA 3GKRA 4QC6A 4R3LA 4H6UA 3E0KA 3TO9A 5IB0A 4I49A 4B5PB 1YVOA 3PP9A 2ARHA 2VZZA 1XF8A 1Y7RA 2CNTA 2P6FA 3PGPA 4UWIA 2VBQA 5AG7A 1IYKA 5C88A 1IICA 1CM0A 2PSWA 3B8GA 3N7ZA 4C2XA 4Y49B 4HNXB 4EVYA 4R87A 4AG7A 4U5YA 1I12A 2DPTA 4J3GA 2WPWA 4DNCA 4KUAA 4E0AA 4KOVA 4KVME 4C68A 1I21A 3FNCA 1J4JA 1XEBA 1S3ZA 3WR7A 4CRYB 2X7BA 2GIVA 4H6ZA 2VXKA 4RI1A 4XNHB 4KOTA 5J8CA 3BJ7A 3JTKA 2QIRA 1B6BA 4B12A 1QSTA 2JDCA 4KUBA 3NE7A 2YGWA 3VWDA 4R57A 2HUZA 3T90A 4F0XA 3W91A 4XPLA 2CXAA 2Z3PA 4OLLA 4KSAA 2Q4YA 3D2MA 2C27A 3IWGA 1CJWA 3CXPA 1TIQA 4KLVA 2GANA 1BOBA 3TOBA 1V0CA 3BJ8A 1MJBA 2ZW7A 2Q04A 4A2ZA 1I1DA 3EXNA 2PR8A 2B5GB 3I9SA 1S7KA 4A31A 1ON0A 4LUAA 3TOAA 1S7NA 4HKFA 4JD6A 4XPKA 4HNYB 2REFA 5DWNA 5AG4A 1UFHA 5G22A 1U6MA 1XE4A 3ZZIA 4LX9A 2PRBA 2FL4A 5F49A 3V8IA 4AG9A 4FD5A 4NCZA 2G0BA 2BUEA 3S6GA 4X5KA 3C26A 4A32A 2ZW6A 3DR6A 3F5BA 3GY9A 3LODA 4R3KA 4H89A 1R57A 3LD2A 1YVKA 4JWPA 1NE9A 4KOUA 4C7IA 2FIWA 5ISVA 5J8FA 4U9ZA 1FY7A 4CAVA 4FD4A 2VI7A 2HQYA 2YNEA 4A95A 5BWAB 3QB8A 3EFAA 1PUAA 2OZHA 2FE7A 4MBUA 2VZYA 4MI4A 3GYAA 3IU1A 1QSOA 2G3AA 4FD7A 4K30A 4B11A 2OB0A 2VEZA 4XPDB 4PSWA 5F48A 2PQ8A 4ORFA 4Y49C 4R9MA 1Q2YA 1IIDA 4UFVA 5I0CA 3D3SA 1Q2DA 2P6GA 2B4DA 2F5IA 3KKWA 2A4NA 3OWCA 2AE6A 2H5MA 1M44A 5EC4A 4AB7A 4JXQA 1WK4A 2FT0A 1MJ9A 2AJ6A 2B3VA 3VWEA 4JXRA 1VKCA 4XNHC 4KVOE 5IX3A 3TE4A 2FXFA 5AGEA 3R9FA 2OU2A 3UY5A 2O28A 2R7HA 4IUSA 2Q4VA 1YK3A 3TO7A 2DPSA 3H4QA 4B10A 4UWJA 2R8VA 4CGMA 5H84A 3SXNA 5G20A 4C7HA 4F0YA 4MY0A 4UA3A 3I3GA 2VQYA 4NSQA 2Z3LA 4A30A 4MFJA 5EBVA 4IF5A 1QSMA 4UBRA 1LRZA 2BSWA 2J8MA 4CYQA 4M85A 5E96A 2RC4A 4MFQA 3CXSA 2BEIA 2WUUA 4B5PA 3RYOA 4QB9A 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLY A;  5IV0 A;  5C82 A;  2Q44 A;  2ATR A;  2Z10 A;  4F6A A;  5KTC A;  2WPX A;  1M1D A;  1M4I A;  1KUY A;  3CXQ A;  4CAX A;  1QSR A;  2FIA A;  1RXT A;  3QAH A;  4KOS A;  3TCV A;  2REE A;  2B3U A;  4CAW A;  5KTA A;  2PC1 A;  2EUI A;  3T9Y A;  5CNP A;  4AVB A;  3FIX A;  4ZBG A;  1S5K A;  2JDD A;  4NF1 A;  1QSN A;  3MGD A;  4KLW A;  4L89 A;  1YX0 A;  5F46 A;  1K4J A;  1S7L A;  3R9E A;  1KUV A;  4ONU A;  4PV6 A;  4E8O A;  2OZG A;  2P6E A;  3D2P A;  4QVT A;  4YGO A;  4KOW A;  1Z4E A;  4FD6 A;  2ZXV A;  5F47 A;  2PR1 A;  5GCN A;  4KZT A;  4OAE A;  3FRM A;  1MJA A;  4XPD C;  4E2A A;  2KCW A;  2CNM A;  1PU9 A;  1IB1 E;  2OH1 A;  2Q0Y A;  4II9 A;  2I79 A;  3PZJ A;  2B5G A;  4AVC A;  5H86 A;  4MHD A;  3R96 A;  2NMT A;  2Z11 A;  1YR0 A;  3R9G A;  2OZU A;  3BLN A;  1NMT A;  2EVN A;  2P0W A;  4NEX A;  1GHE A;  3FBU A;  2CNS A;  5HH1 A;  3G3S A;  4YRH A;  3DSB A;  1KUX A;  3TO6 A;  3TTH A;  2R98 A;  3R1K A;  4MJ8 A;  3P2H A;  3FXT A;  5KTD A;  1RO5 A;  3W6X A;  4KOY A;  1SQH A;  4MY3 A;  2QML A;  5DWM A;  1YRE A;  1P4N A;  3ZJ0 A;  3TFY A;  4YFJ A;  2ZW5 A;  3R95 A;  2FS5 A;  2I00 A;  3EY5 A;  4GS4 A;  1KZF A;  3W6S A;  1M4G A;  1YGH A;  2ZPA A;  4QUS A;  1S60 A;  1MK4 A;  2PDO A;  5JQ4 A;  3P2F A;  4B5O A;  3EO4 A;  3JVN A;  3D8P A;  2D4P A;  2JLM A;  4JJX A;  2CY2 A;  2D4O A;  3SXO A;  4OAD A;  2QEC A;  3DDD A;  5JPH A;  1Y9W A;  1YLE A;  2HV2 A;  4HNW B;  2B4D B;  4QBJ A;  2Y0M A;  1IYL A;  4KOR A;  1XMT A;  2JEV A;  4CRZ B;  3G8W A;  2Q7B A;  1WWZ A;  2Z0Z A;  2J8N A;  1VHS A;  4NXY A;  2GE3 A;  4PSX A;  3F0A A;  3S6F A;  3F8K A;  4M3S A;  4L8A A;  4PK3 A;  3DNS A;  1M4D A;  4KVX A;  3K9U A;  1OZP A;  3TT2 A;  2J8R A;  1BO4 A;  3S6K A;  1P0H A;  4RS2 A;  2FSR A;  1L0C A;  1Z9U A;  5FVJ A;  3FYN A;  2ZW4 A;  2FCK A;  2BL1 A;  4AVA A;  1XIX A;  5HMN A;  2B58 A;  2G3T A;  1NSL A;  2R1I A;  4BMH A;  4CS0 B;  1Z4R A;  3S6H A;  1N71 A;  1Q2C A;  3JUW A;  2IL4 A;  3IGR A;  3FB3 A;  4KOX A;  3EC4 A;  3DR8 A;  1S7F A;  2DXQ A;  1B87 A;  2B4B A;  4PK2 A;  3SHP A;  1Y9K A;  2K5T A;  3GKR A;  4QC6 A;  4R3L A;  4H6U A;  3E0K A;  3TO9 A;  5IB0 A;  4I49 A;  4B5P B;  1YVO A;  3PP9 A;  2ARH A;  2VZZ A;  1XF8 A;  1Y7R A;  2CNT A;  2P6F A;  3PGP A;  4UWI A;  2VBQ A;  1IYK A;  5C88 A;  1IIC A;  1CM0 A;  2PSW A;  3B8G A;  3N7Z A;  4Y49 B;  4HNX B;  4EVY A;  4R87 A;  4AG7 A;  4U5Y A;  1I12 A;  4J3G A;  2WPW A;  4DNC A;  4KUA A;  4E0A A;  4KOV A;  4KVM E;  1I21 A;  3FNC A;  1J4J A;  1XEB A;  1S3Z A;  3WR7 A;  4CRY B;  2X7B A;  2GIV A;  4H6Z A;  2VXK A;  4RI1 A;  4XNH B;  4KOT A;  5J8C A;  3BJ7 A;  2QIR A;  1B6B A;  1QST A;  2JDC A;  4KUB A;  3NE7 A;  3VWD A;  4R57 A;  2HUZ A;  3T90 A;  3W91 A;  4XPL A;  4OLL A;  2Q4Y A;  3D2M A;  2C27 A;  3IWG A;  1CJW A;  3CXP A;  1TIQ A;  4KLV A;  2GAN A;  1BOB A;  3TOB A;  1V0C A;  3BJ8 A;  1MJB A;  2ZW7 A;  2Q04 A;  1I1D A;  3EXN A;  2PR8 A;  2B5G B;  3I9S A;  1S7K A;  1ON0 A;  4LUA A;  3TOA A;  1S7N A;  4HKF A;  4JD6 A;  4XPK A;  4HNY B;  2REF A;  5DWN A;  1UFH A;  1U6M A;  1XE4 A;  3ZZI A;  4LX9 A;  2PRB A;  2FL4 A;  5F49 A;  3V8I A;  4AG9 A;  4FD5 A;  4NCZ A;  2G0B A;  2BUE A;  3S6G A;  4X5K A;  3C26 A;  2ZW6 A;  3DR6 A;  3F5B A;  3GY9 A;  3LOD A;  4R3K A;  4H89 A;  1R57 A;  3LD2 A;  1YVK A;  4JWP A;  1NE9 A;  4KOU A;  2FIW A;  5ISV A;  5J8F A;  4U9Z A;  1FY7 A;  4CAV A;  4FD4 A;  2VI7 A;  2HQY A;  3QB8 A;  3EFA A;  1PUA A;  2OZH A;  2FE7 A;  4MBU A;  2VZY A;  4MI4 A;  3GYA A;  1QSO A;  2G3A A;  4FD7 A;  4K30 A;  2OB0 A;  2VEZ A;  4XPD B;  4PSW A;  5F48 A;  2PQ8 A;  4ORF A;  4Y49 C;  4R9M A;  1Q2Y A;  1IID A;  5I0C A;  3D3S A;  1Q2D A;  2P6G A;  2B4D A;  2F5I A;  3KKW A;  2A4N A;  3OWC A;  2AE6 A;  2H5M A;  1M44 A;  5EC4 A;  4AB7 A;  4JXQ A;  1WK4 A;  2FT0 A;  1MJ9 A;  2AJ6 A;  2B3V A;  3VWE A;  4JXR A;  1VKC A;  4XNH C;  4KVO E;  5IX3 A;  3TE4 A;  2FXF A;  3R9F A;  2OU2 A;  3UY5 A;  2O28 A;  2R7H A;  4IUS A;  2Q4V A;  1YK3 A;  3TO7 A;  3H4Q A;  4UWJ A;  2R8V A;  5H84 A;  3SXN A;  4F0Y A;  4MY0 A;  4UA3 A;  3I3G A;  2VQY A;  4NSQ A;  5EBV A;  4IF5 A;  1QSM A;  4UBR A;  1LRZ A;  2BSW A;  2J8M A;  4M85 A;  5E96 A;  2RC4 A;  3CXS A;  2BEI A;  4B5P A;  3RYO A;  4QB9 A;  4U9Y A; 
#chains in the Genus database with same CATH topology
 5HVH A;  4JLY A;  5IV0 A;  1HEE A;  5C82 A;  4MFL A;  1CG2 A;  4LQG A;  4P4I A;  2Q44 A;  1F2O A;  2CTB A;  2ATR A;  3VAR A;  4C2Y A;  3A9L A;  2Z10 A;  4F6A A;  2WSA A;  1TKF A;  5KTC A;  1CP6 A;  2WPX A;  2YND A;  3B3V A;  1M1D A;  1FT7 A;  1KUY A;  1M4I A;  4Q36 A;  2RFH A;  3CXQ A;  4MFP A;  3WAB A;  4B13 A;  4CAX A;  1QSR A;  4CPA A;  5JM6 A;  2GLJ A;  4GXH A;  1HDQ A;  1RXT A;  2FIA A;  3QAH A;  5D8N A;  4KOS A;  4CGL A;  4MCS A;  1ARM A;  2REE A;  2B3U A;  3TCV A;  3FX6 A;  2ZEF A;  4CAW A;  5HVG A;  5KTA A;  2PC1 A;  2EUI A;  1A2Z A;  2Z3O A;  3PEI A;  3T9Y A;  4CGP A;  1YW4 A;  3LWU A;  1Z5R A;  5CNP A;  2GU2 A;  4AVB A;  4OKO A;  3FIX A;  4ZBG A;  5LRK A;  4MHP A;  1HDU A;  1S5K A;  2JDD A;  4NF1 A;  1QSN A;  4HPS A;  5JGF A;  5J1Q A;  1Z8T A;  4A94 A;  2GFQ A;  2ZEO A;  5AG6 A;  3MGD A;  4KLW A;  3IO1 A;  4KSF A;  4L89 A;  2V8D A;  4EWT A;  4RUH A;  1YX0 A;  2EBJ A;  4UEF A;  1VIX A;  3ISZ A;  4RN7 A;  1BPN A;  4W9Y A;  2ZEM A;  5F46 A;  1K4J A;  1S7L A;  3R9E A;  4CYP A;  4H2K A;  1KUV A;  4NGS A;  4ONU A;  4P4F A;  3RAM A;  2Z3M A;  2Z3K A;  4IK2 A;  4PV6 A;  4P4E A;  2PJ9 A;  3LAC A;  3CPX A;  4ZGY B;  2OR4 A;  4E8O A;  4FUU A;  2OZG A;  2P6E A;  3D4U A;  3D2P A;  4QVT A;  4YGO A;  3PFE A;  4KOW A;  4DYO A;  1Z4E A;  4FD6 A;  2ZXV A;  1YSJ A;  4M6I A;  2JBK A;  3V38 A;  5F47 A;  2PR1 A;  4UIB A;  4UEZ A;  4KZT A;  4OAE A;  3B3T A;  3FRM A;  5GCN A;  3JRU A;  1ELL P;  1MJA A;  4XPD C;  3NH5 A;  4E2A A;  2KCW A;  1M4L A;  2EWB A;  1BPM A;  2CNM A;  4YWY A;  3PRT A;  1PU9 A;  1XRY A;  2WYR A;  1IB1 E;  3FF3 A;  2OH1 A;  4B14 A;  2Q0Y A;  4II9 A;  7CPA A;  2CTC A;  4MCP A;  1CPX A;  2I79 A;  3PZJ A;  2B5G A;  4AVC A;  1LOK A;  4UCN A;  4MHD A;  5H86 A;  2RB7 A;  2Q43 A;  3R96 A;  2NMT A;  1BAV A;  2Z11 A;  5G1Z A;  3IU2 A;  1YR0 A;  3B3S A;  3R9G A;  1F57 A;  4BD9 A;  4MHN A;  1XMB A;  2OZU A;  4UFW A;  3BLN A;  1NMT A;  1H8L A;  2AFX A;  2EVN A;  2BCO A;  2EO8 A;  2P0W A;  3PFO A;  4NEX A;  5AG5 A;  3SJX A;  4MCQ A;  1GHE A;  2C1C A;  3FBU A;  2DF5 A;  2CNS A;  5HH1 A;  3G3S A;  5DS0 A;  3H8F A;  4YRH A;  4R76 A;  3DSB A;  1KUX A;  3TO6 A;  2F7V A;  2XEF A;  2R98 A;  3R1K A;  4P44 A;  3TTH A;  3LMS A;  4MJ8 A;  1Y0Y A;  3P2H A;  4BBH A;  3FXT A;  2PJA A;  4O23 A;  2QYV A;  5KTD A;  1RO5 A;  3W6X A;  4KOY A;  1SQH A;  3KI9 A;  2PIY A;  4MY3 A;  2QML A;  1XFO A;  3WC7 A;  3TX8 A;  2O53 A;  4MXU A;  2J9A A;  4PXE A;  5DWM A;  1YRE A;  1P4N A;  3KGQ A;  3NA6 A;  4OC0 A;  2YNC C;  3ZJ0 A;  5A28 A;  3TFY A;  5CPA A;  1Z8W A;  2POK A;  2ZW5 A;  3B3C A;  3R95 A;  4YFJ A;  3B3W A;  2FS5 A;  2I00 A;  3SI2 A;  3EY5 A;  1CPS A;  1GYT A;  1DE4 C;  4GS4 A;  1KZF A;  3W6S A;  4CYN A;  2IMO A;  2V8V A;  2EK8 A;  3FED A;  4Z65 A;  1M4G A;  1XJO A;  1ELM P;  4CGN A;  1YGH A;  2ZPA A;  4QUS A;  4A33 A;  1S60 A;  1MK4 A;  2PDO A;  2Z3N A;  5JQ4 A;  4DUK A;  3IIB A;  3P2F A;  2XEJ A;  3EO4 A;  4B5O A;  4OC2 A;  3K2K A;  2C6C A;  4MFK A;  3DLJ A;  3JVN A;  3IEH A;  3RO0 A;  3KHX A;  2Q51 A;  4KS9 A;  5LRJ A;  2AFO A;  3D8P A;  2ZEH A;  5ELY A;  3SJE A;  4UCP A;  1LAN A;  3KL9 A;  4X8I A;  2D4P A;  2AFW A;  2JLM A;  3H5Z A;  1X10 A;  4JJX A;  3IWE A;  1ZG8 A;  3GB0 A;  4C2Z A;  2GRE A;  3SI1 A;  3NFZ A;  1X12 A;  5G21 A;  4DJL A;  2CY2 A;  2D4O A;  3SXO A;  4OAD A;  2QEC A;  4NFR A;  4ZY2 A;  4OIW A;  3FEE A;  5JH9 A;  3S9L A;  1NSA A;  3DDD A;  5JPH A;  2F8H A;  1Y9W A;  1IY7 A;  1YLE A;  2HV2 A;  2ZEN A;  4HNW B;  6CPA A;  2XEG A;  2B4D B;  2QJ8 A;  4CGO A;  4CYO A;  1BLL E;  4MFZ A;  4UCM A;  4QBJ A;  2Y0M A;  1IYL A;  4WJB A;  4KOR A;  3SJF A;  3PB8 X;  1XMT A;  4UF4 A;  2JEV A;  4CRZ B;  3G8W A;  2Q7B A;  1WWZ A;  2Z0Z A;  2J8N A;  4TWE A;  1VHS A;  4NXY A;  2Q7S A;  3CZX A;  4A39 A;  1YW6 A;  3IFE A;  2PVW A;  2GE3 A;  4PSX A;  3F0A A;  2VL1 A;  4IAV A;  3S6F A;  5K8O A;  3F8K A;  2IJZ A;  1AMP A;  4M3S A;  1LCP A;  4L8A A;  4ZY1 A;  4PK3 A;  3K9T A;  1IOF A;  2G9D A;  2ANP A;  3DNS A;  5LRG A;  1ZO0 A;  3KR4 A;  4R7M A;  1M4D A;  4CAE A;  3NH8 A;  4KVX A;  4CAF A;  3GUX A;  1OZP A;  3K9U A;  4Q38 A;  3TT2 A;  2J8R A;  1BO4 A;  3S6K A;  1P0H A;  4RS2 A;  2FSR A;  5LYF A;  1L0C A;  1Z9U A;  1ZLI A;  2YNC A;  2PVV A;  2PRQ A;  5FVJ A;  1AUG A;  3FYN A;  4ZX9 A;  2ZW4 A;  4MRI A;  3H8G A;  2FCK A;  2BL1 A;  1LFW A;  4FAI A;  1IU8 A;  8CPA A;  4IHM A;  4AVA A;  4UFX A;  1XIX A;  3D67 A;  5A27 A;  5LYD A;  5HMN A;  2B58 A;  3GIU A;  2G3T A;  3D7D A;  1NSL A;  2R1I A;  3V7Z A;  4BMH A;  4CS0 B;  1Z4R A;  3S6H A;  1N71 A;  2PE3 A;  2PJ8 A;  1Q2C A;  3JUW A;  3PB6 X;  2OOT A;  2IL4 A;  3PBE A;  3IGR A;  3FB3 A;  4NGQ A;  4KOX A;  3EC4 A;  3DR8 A;  2HB6 A;  4X2T A;  1S7F A;  2DXQ A;  1B87 A;  2B4B A;  4PK2 A;  3SHP A;  1Y9K A;  1YLO A;  2PJ1 A;  2K5T A;  3GKR A;  4QC6 A;  4R3L A;  4H6U A;  1Q7L A;  4A37 A;  1ZG7 A;  2CIJ A;  3E0K A;  4F9V A;  2ZEP A;  3TO9 A;  5IB0 A;  2ZOF A;  3KQX A;  4I49 A;  4B5P B;  1YVO A;  3PP9 A;  2ARH A;  1PYT B;  3D7F A;  2VZZ A;  1XF8 A;  1Y7R A;  2CNT A;  2P6F A;  3PGP A;  4UWI A;  4WWV A;  1Y7E A;  2VBQ A;  5AG7 A;  1IYK A;  1XBU A;  5C88 A;  1CM0 A;  1IIC A;  2PSW A;  3B8G A;  2O4H A;  1DTD A;  3N7Z A;  4FWU A;  4OP4 A;  4Y49 B;  4HNX B;  4C2X A;  4EVY A;  4R87 A;  4AG7 A;  3I1U A;  1TXR A;  4U5Y A;  4F9U A;  1PCA A;  1VGY A;  4X3R A;  2ZEG A;  1I12 A;  2DPT A;  4ZX8 A;  2V8G A;  4J3G A;  5K8M A;  2WPW A;  4DNC A;  1RTQ A;  2ZOG A;  4KUA A;  4E0A A;  1EE3 P;  4R6T A;  4KOV A;  4KVM E;  3FVL A;  4C68 A;  1Y0R A;  1I21 A;  3FNC A;  3PB4 X;  4P45 A;  1J4J A;  1XEB A;  4OC1 A;  1S3Z A;  3N5F A;  3WR7 A;  2FVG A;  3BI0 A;  4CRY B;  2X7B A;  2GIV A;  4H6Z A;  4OID A;  2VXK A;  1CBX A;  3IC1 A;  3PBB A;  4NGM A;  4GM5 A;  3DGV A;  4RI1 A;  2C6G A;  4XNH B;  5F09 A;  3BXM A;  3FEC A;  4PXC A;  1UWY A;  4KOT A;  5J8C A;  3BJ7 A;  3JTK A;  4ZI6 A;  1Z8L A;  1B6B A;  2QIR A;  4B12 A;  1QST A;  1R3N A;  2JDC A;  4KUB A;  3NE7 A;  2YGW A;  3FJU A;  3VWD A;  3GLJ A;  1YQE A;  5LYL A;  4R57 A;  2HUZ A;  4MCR A;  1QMU A;  3T90 A;  4F0X A;  1CX8 A;  3W91 A;  2Q4Z A;  4OC3 A;  4XPL A;  2CXA A;  2Z3P A;  2PJ5 A;  4OLL A;  1TKJ A;  4KSA A;  3S9N A;  2EK9 A;  2Q4Y A;  2PJB A;  4TNU A;  3RZA A;  3D2M A;  2C27 A;  3IWG A;  2JEW A;  1CJW A;  3IJ3 A;  3CXP A;  1TIQ A;  4KLV A;  1LAP A;  2GAN A;  1BOB A;  3FMC A;  4ONW A;  4LQ6 A;  2PJC A;  4NGT A;  3TOB A;  2NSM A;  3CDX A;  5K8P A;  1V0C A;  1FNO A;  3BJ8 A;  4PQA A;  3WC5 A;  1MJB A;  3L2N A;  2ZW7 A;  2Q04 A;  4A2Z A;  3D66 A;  1I1D A;  1TKH A;  3EXN A;  2PCU A;  2PR8 A;  2B5G B;  3RBU A;  3I9S A;  1S7K A;  4A31 A;  1ON0 A;  1YME A;  4UEE A;  1Z2L A;  4LUA A;  3D7H A;  3TOA A;  1S7N A;  4HKF A;  5D29 A;  5THW A;  4JD6 A;  4B6Z A;  5HVF A;  4EFD A;  4XPK A;  2PJ2 A;  4HNY B;  2REF A;  4AXV A;  1JWQ A;  5DWN A;  5AG4 A;  4Q7A A;  4JYW A;  1UFH A;  5G22 A;  1U6M A;  1XE4 A;  3ZZI A;  4OC5 A;  4LX9 A;  2PRB A;  3KAS A;  2FL4 A;  5F49 A;  3V8I A;  4AG9 A;  4FD5 A;  4NCZ A;  2G0B A;  2BUE A;  3S6G A;  2AFS A;  2PJ4 A;  1AYE A;  4X5K A;  3C26 A;  4A32 A;  4FBE A;  2ZW6 A;  1LAM A;  3DR6 A;  2PJ7 A;  2ZED A;  4MHY A;  3F5B A;  5I4M A;  3T8W A;  3GY9 A;  3LOD A;  3QAY A;  4R3K A;  3MN8 A;  4H89 A;  4BIN A;  1ARL A;  1R57 A;  3LD2 A;  1YVK A;  4JWP A;  4OME A;  4A38 A;  1NE9 A;  4KOU A;  4C7I A;  3TC8 A;  1ZLH A;  2FIW A;  5ISV A;  5J8F A;  4U9Z A;  1FY7 A;  3CPA A;  3H8E A;  2BOA A;  4OC4 A;  4CAV A;  3B35 A;  4FD4 A;  2VI7 A;  2AFZ A;  2HQY A;  2YNE A;  2PJ6 A;  3B7I A;  4A95 A;  1VHO A;  3RNZ A;  5BWA B;  3QB8 A;  3EFA A;  4M6G A;  5K8N A;  1PUA A;  2OZH A;  4PXB A;  3SJG A;  3PB9 X;  2FE7 A;  4MBU A;  5EMI A;  2VZY A;  4MI4 A;  4NGR A;  2DEA A;  2ABZ A;  4JZ0 A;  4K3N A;  3GYA A;  3IU1 A;  1JQG A;  1QSO A;  2ZEL A;  4NGN A;  5CBM A;  5HXD A;  2G3A A;  1XOV A;  2AFU A;  2AFM A;  1IOI A;  4FD7 A;  4K30 A;  2V8H A;  1TF8 A;  4B11 A;  3HLP A;  2OB0 A;  2VEZ A;  4XPD B;  4G1P A;  4PSW A;  4R8F A;  5F48 A;  2PQ8 A;  4P6Y A;  3MRU A;  4ORF A;  4Y49 C;  4R9M A;  1Q2Y A;  1TF9 A;  1IID A;  1VHE A;  1ZG9 A;  2QVP A;  4PPZ A;  4UFV A;  5I0C A;  3D3S A;  1Q2D A;  4MMO A;  2P6G A;  2B4D A;  2F5I A;  3ISX A;  3KKW A;  3KR5 A;  2A4N A;  2PJ0 A;  3OWC A;  4KSI A;  2AE6 A;  1OBR A;  2H5M A;  1M44 A;  3NE8 A;  5EC4 A;  1Z8X A;  4MHZ A;  4AB7 A;  3KQZ A;  4P10 A;  4UIA A;  4YU9 A;  2IQ6 A;  2V77 A;  4F8Z A;  4M6H A;  3FH4 A;  4JXQ A;  1WK4 A;  2FT0 A;  1MJ9 A;  1KWM A;  2AJ6 A;  2B3V A;  3WC6 A;  3VWE A;  2HC9 A;  3D7G A;  4JXR A;  3D68 A;  1VKC A;  4XNH C;  2PIZ A;  4KVO E;  5IX3 A;  3S9M A;  3TE4 A;  2PJ3 A;  2FXF A;  3IWW A;  3PB7 X;  4P4D A;  5AGE A;  3R9F A;  2C6P A;  3HUV A;  3KZW A;  3NH4 A;  1CP7 A;  4NJQ A;  2OU2 A;  3UY5 A;  2O28 A;  2R7H A;  4IUS A;  4NGP A;  2Q4V A;  1YK3 A;  3WT4 A;  1IGB A;  3TO7 A;  2DPS A;  3H4Q A;  4B10 A;  2XEI A;  5LYI A;  4UWJ A;  3VAT A;  2R8V A;  4EME A;  3CT9 A;  4CGM A;  4PXD A;  5H84 A;  1F2P A;  2WZN A;  3SXN A;  5G20 A;  4C7H A;  4F0Y A;  3SI0 A;  4MY0 A;  4UA3 A;  3BHX A;  3I3G A;  2VQY A;  2CF4 A;  4NSQ A;  2Z3L A;  4A30 A;  3QNV A;  4MFJ A;  2GLF A;  1QQ9 A;  5EBV A;  2JBJ A;  3KHZ A;  4IF5 A;  4ZY0 A;  1QSM A;  3B2Y A;  4UBR A;  2BO9 A;  1LRZ A;  3VH9 A;  4P4J A;  4ZYQ A;  2BSW A;  4P4B A;  2J8M A;  4NJR A;  2I3C A;  2ZEE A;  4CYQ A;  4M85 A;  1R43 A;  5E96 A;  2RC4 A;  4MFQ A;  3CXS A;  3BI1 A;  2BEI A;  2WUU A;  4B5P A;  2NYQ A;  3RYO A;  5IB9 A;  2ODF A;  4QB9 A;  4U9Y A; 
#chains in the Genus database with same CATH homology
 4JLY A;  5IV0 A;  5C82 A;  4MFL A;  2Q44 A;  2ATR A;  4C2Y A;  3A9L A;  2Z10 A;  4F6A A;  2WSA A;  5KTC A;  2WPX A;  2YND A;  1M1D A;  1M4I A;  1KUY A;  4Q36 A;  3CXQ A;  4MFP A;  4B13 A;  4CAX A;  1QSR A;  2FIA A;  1RXT A;  3QAH A;  4KOS A;  4CGL A;  3TCV A;  2REE A;  2B3U A;  4CAW A;  5KTA A;  2PC1 A;  2EUI A;  2Z3O A;  3T9Y A;  4CGP A;  5CNP A;  4AVB A;  3FIX A;  4ZBG A;  1S5K A;  2JDD A;  4NF1 A;  1QSN A;  5AG6 A;  3MGD A;  4KLW A;  4KSF A;  4L89 A;  1YX0 A;  5F46 A;  1K4J A;  1S7L A;  3R9E A;  4CYP A;  1KUV A;  4ONU A;  2Z3M A;  2Z3K A;  4PV6 A;  4ZGY B;  4E8O A;  2OZG A;  2P6E A;  3D2P A;  4QVT A;  4YGO A;  4KOW A;  1Z4E A;  4FD6 A;  2ZXV A;  5F47 A;  2PR1 A;  5GCN A;  4KZT A;  4OAE A;  3FRM A;  1MJA A;  4XPD C;  4E2A A;  2KCW A;  2CNM A;  1PU9 A;  1IB1 E;  2OH1 A;  4B14 A;  2Q0Y A;  4II9 A;  2I79 A;  3PZJ A;  2B5G A;  4AVC A;  4UCN A;  4MHD A;  5H86 A;  3R96 A;  2NMT A;  2Z11 A;  5G1Z A;  3IU2 A;  1YR0 A;  3R9G A;  2OZU A;  4UFW A;  3BLN A;  1NMT A;  2EVN A;  2P0W A;  4NEX A;  5AG5 A;  1GHE A;  3FBU A;  2CNS A;  5HH1 A;  3G3S A;  4YRH A;  3DSB A;  1KUX A;  3TO6 A;  3TTH A;  2R98 A;  3R1K A;  4MJ8 A;  3P2H A;  4BBH A;  3FXT A;  5KTD A;  1RO5 A;  3W6X A;  4KOY A;  1SQH A;  4MY3 A;  2QML A;  5DWM A;  1YRE A;  1P4N A;  3ZJ0 A;  3TFY A;  2YNC C;  5A28 A;  4YFJ A;  2ZW5 A;  3R95 A;  2FS5 A;  2I00 A;  3EY5 A;  4GS4 A;  1KZF A;  3W6S A;  4CYN A;  1M4G A;  4CGN A;  1YGH A;  2ZPA A;  4QUS A;  4A33 A;  1S60 A;  1MK4 A;  2PDO A;  2Z3N A;  5JQ4 A;  3P2F A;  4B5O A;  3EO4 A;  4MFK A;  3JVN A;  4KS9 A;  3D8P A;  4UCP A;  2D4P A;  2JLM A;  3H5Z A;  4JJX A;  3IWE A;  4C2Z A;  5G21 A;  2CY2 A;  2D4O A;  3SXO A;  4OAD A;  2QEC A;  3DDD A;  5JPH A;  1Y9W A;  1YLE A;  2HV2 A;  4HNW B;  2B4D B;  4CGO A;  4CYO A;  4MFZ A;  4UCM A;  4QBJ A;  2Y0M A;  1IYL A;  4KOR A;  1XMT A;  2JEV A;  4CRZ B;  3G8W A;  2Q7B A;  1WWZ A;  2Z0Z A;  2J8N A;  1VHS A;  4NXY A;  2GE3 A;  4PSX A;  3F0A A;  3S6F A;  3F8K A;  4M3S A;  4L8A A;  4PK3 A;  3DNS A;  1ZO0 A;  1M4D A;  4CAE A;  4KVX A;  4CAF A;  3K9U A;  1OZP A;  4Q38 A;  3TT2 A;  2J8R A;  1BO4 A;  3S6K A;  1P0H A;  4RS2 A;  2FSR A;  1L0C A;  1Z9U A;  2YNC A;  5FVJ A;  3FYN A;  2ZW4 A;  2FCK A;  2BL1 A;  4AVA A;  4UFX A;  1XIX A;  5A27 A;  5HMN A;  2B58 A;  2G3T A;  1NSL A;  2R1I A;  4BMH A;  4CS0 B;  1Z4R A;  3S6H A;  1N71 A;  1Q2C A;  3JUW A;  2IL4 A;  3IGR A;  3FB3 A;  4KOX A;  3EC4 A;  3DR8 A;  1S7F A;  2DXQ A;  1B87 A;  2B4B A;  4PK2 A;  3SHP A;  1Y9K A;  2K5T A;  3GKR A;  4QC6 A;  4R3L A;  4H6U A;  3E0K A;  3TO9 A;  5IB0 A;  4I49 A;  4B5P B;  1YVO A;  3PP9 A;  2ARH A;  2VZZ A;  1XF8 A;  1Y7R A;  2CNT A;  2P6F A;  3PGP A;  4UWI A;  2VBQ A;  5AG7 A;  1IYK A;  5C88 A;  1IIC A;  1CM0 A;  2PSW A;  3B8G A;  3N7Z A;  4C2X A;  4Y49 B;  4HNX B;  4EVY A;  4R87 A;  4AG7 A;  4U5Y A;  1I12 A;  2DPT A;  4J3G A;  2WPW A;  4DNC A;  4KUA A;  4E0A A;  4KOV A;  4KVM E;  4C68 A;  1I21 A;  3FNC A;  1J4J A;  1XEB A;  1S3Z A;  3WR7 A;  4CRY B;  2X7B A;  2GIV A;  4H6Z A;  2VXK A;  4RI1 A;  4XNH B;  4KOT A;  5J8C A;  3BJ7 A;  3JTK A;  2QIR A;  1B6B A;  4B12 A;  1QST A;  2JDC A;  4KUB A;  3NE7 A;  2YGW A;  3VWD A;  4R57 A;  2HUZ A;  3T90 A;  4F0X A;  3W91 A;  4XPL A;  2CXA A;  2Z3P A;  4OLL A;  4KSA A;  2Q4Y A;  3D2M A;  2C27 A;  3IWG A;  1CJW A;  3CXP A;  1TIQ A;  4KLV A;  2GAN A;  1BOB A;  3TOB A;  1V0C A;  3BJ8 A;  1MJB A;  2ZW7 A;  2Q04 A;  4A2Z A;  1I1D A;  3EXN A;  2PR8 A;  2B5G B;  3I9S A;  1S7K A;  4A31 A;  1ON0 A;  4LUA A;  3TOA A;  1S7N A;  4HKF A;  4JD6 A;  4XPK A;  4HNY B;  2REF A;  5DWN A;  5AG4 A;  1UFH A;  5G22 A;  1U6M A;  1XE4 A;  3ZZI A;  4LX9 A;  2PRB A;  2FL4 A;  5F49 A;  3V8I A;  4AG9 A;  4FD5 A;  4NCZ A;  2G0B A;  2BUE A;  3S6G A;  4X5K A;  3C26 A;  4A32 A;  2ZW6 A;  3DR6 A;  3F5B A;  3GY9 A;  3LOD A;  4R3K A;  4H89 A;  1R57 A;  3LD2 A;  1YVK A;  4JWP A;  1NE9 A;  4KOU A;  4C7I A;  2FIW A;  5ISV A;  5J8F A;  4U9Z A;  1FY7 A;  4CAV A;  4FD4 A;  2VI7 A;  2HQY A;  2YNE A;  4A95 A;  5BWA B;  3QB8 A;  3EFA A;  1PUA A;  2OZH A;  2FE7 A;  4MBU A;  2VZY A;  4MI4 A;  3GYA A;  3IU1 A;  1QSO A;  2G3A A;  4FD7 A;  4K30 A;  4B11 A;  2OB0 A;  2VEZ A;  4XPD B;  4PSW A;  5F48 A;  2PQ8 A;  4ORF A;  4Y49 C;  4R9M A;  1Q2Y A;  1IID A;  4UFV A;  5I0C A;  3D3S A;  1Q2D A;  2P6G A;  2B4D A;  2F5I A;  3KKW A;  2A4N A;  3OWC A;  2AE6 A;  2H5M A;  1M44 A;  5EC4 A;  4AB7 A;  4JXQ A;  1WK4 A;  2FT0 A;  1MJ9 A;  2AJ6 A;  2B3V A;  3VWE A;  4JXR A;  1VKC A;  4XNH C;  4KVO E;  5IX3 A;  3TE4 A;  2FXF A;  5AGE A;  3R9F A;  2OU2 A;  3UY5 A;  2O28 A;  2R7H A;  4IUS A;  2Q4V A;  1YK3 A;  3TO7 A;  2DPS A;  3H4Q A;  4B10 A;  4UWJ A;  2R8V A;  4CGM A;  5H84 A;  3SXN A;  5G20 A;  4C7H A;  4F0Y A;  4MY0 A;  4UA3 A;  3I3G A;  2VQY A;  4NSQ A;  2Z3L A;  4A30 A;  4MFJ A;  5EBV A;  4IF5 A;  1QSM A;  4UBR A;  1LRZ A;  2BSW A;  2J8M A;  4CYQ A;  4M85 A;  5E96 A;  2RC4 A;  4MFQ A;  3CXS A;  2BEI A;  2WUU A;  4B5P A;  3RYO A;  4QB9 A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...