2B5GA

Wild type ssat- 1.7a structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
164
Chain Sequence
AKFVIRPATAADCSDILRLIKELAKYEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 164
sequence length 168
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b5gA00
2FL4A 2Q04A 4FD6A 4F6AA 1KZFA 4DNCA 5E96A 2Q7BA 1VKCA 1S7KA 2ZW4A 3FYNA 2Q4VA 3EC4A 2JEVA 4R57A 1VHSA 3S6KA 4KVXA 1XMTA 4KOVA 2G3TA 1XIXA 5CNPA 4U9ZA 2REFA 3D3SA 1SQHA 1Q2DA 3NE7A 2PC1A 4X5KA 1I1DA 1IB1E 3CXQA 4ZBGA 2J8RA 2GANA 4ONUA 4R87A 2HQYA 2GIVA 3H4QA 1RXTA 3TO7A 1LRZA 3TO6A 3D8PA 2BSWA 2GE3A 3CXPA 1Z4RA 1Y9WA 3TE4A 4PK2A 2WPWA 3P2HA 3VWEA 4YRHA 4PV6A 4JLYA 4QUSA 2ARHA 2RC4A 4QBJA 4YFJA 3R1KA 4F0YA 3P2FA 4PSWA 4Y49B 1YR0A 1V0CA 5KTCA 2I00A 3K9UA 2KCWA 4PSXA 4Y49C 4FD7A 1KUVA 4H6UA 1S3ZA 4AG9A 5IV0A 3DR8A 2Z10A 1KUYA 1K4JA 4E0AA 5GCNA 4GS4A 2P6FA 1RO5A 2VZYA 2REEA 4KOYA 3F0AA 4XPDB 4KOTA 2B5GA 2Q44A 4J3GA 1S60A 1S5KA 4XPDC 4NF1A 4UA3A 2CNTA 4KZTA 3JUWA 2EVNA 3T9YA 1YREA 3R95A 4AB7A 3QB8A 4RI1A 1S7NA 4MI4A 1FY7A 4KLWA 3R9FA 1XF8A 4MHDA 4NSQA 2OZHA 3S6GA 1M4IA 2P0WA 4KVOE 4IUSA 3DNSA 4MY0A 3W6SA 3DDDA 4XPLA 4JWPA 2Y0MA 3BJ7A 4H6ZA 2P6EA 2PDOA 4KOUA 2PQ8A 3S6FA 2Z0ZA 3RYOA 3ZZIA 1R57A 4HNWB 2R8VA 2ZW6A 4LX9A 2CNMA 3FNCA 5F47A 1YGHA 2FS5A 2FSRA 4RS2A 1M4DA 1NMTA 2F5IA 3UY5A 1NSLA 5H84A 4JXRA 2Z11A 3TT2A 3B8GA 2B58A 5J8CA 2BL1A 1Q2YA 4L89A 2ZW7A 3LD2A 2QIRA 2OZUA 1Y7RA 1Q2CA 1U6MA 2OH1A 2VI7A 2WPXA 3G3SA 4KOWA 1B87A 4UWJA 1KUXA 2VQYA 4AVAA 2B3VA 4LUAA 2ZW5A 5KTDA 4MY3A 1NE9A 2JDCA 1CM0A 3PGPA 1MJ9A 2FCKA 4ORFA 3IGRA 3BLNA 2QMLA 3W91A 2PR8A 2ZXVA 2BEIA 1BO4A 4M3SA 2O28A 4E2AA 1M1DA 4KUBA 4OLLA 4B5PA 1J4JA 5HH1A 3EFAA 4AVCA 3BJ8A 4CRZB 4U9YA 4FD5A 1Z9UA 4KORA 1YVOA 3TTHA 4UBRA 4OAEA 3TCVA 1OZPA 1QSNA 4L8AA 5J8FA 1N71A 2H5MA 3W6XA 2I79A 3PZJA 5KTAA 1QSTA 3D2PA 3WR7A 5ISVA 3OWCA 3EXNA 1S7LA 3F5BA 1P4NA 1IYKA 2CY2A 4JD6A 5IX3A 3LODA 3DSBA 3N7ZA 2FIWA 4MBUA 4AVBA 1BOBA 4KVME 4EVYA 4R3KA 3IWGA 5EC4A 2G0BA 4FD4A 4HNXB 4E8OA 3FBUA 3R9EA 2AE6A 3SXOA 2FIAA 1UFHA 2BUEA 4JXQA 4NCZA 4PK3A 4CAVA 1CJWA 2G3AA 4QB9A 4B5PB 3FB3A 2PSWA 2B3UA 1QSMA 3KKWA 4QC6A 4CAWA 5JQ4A 4KUAA 3TFYA 1S7FA 2J8MA 2VZZA 2EUIA 2JDDA 1QSOA 4BMHA 3G8WA 3GY9A 3QAHA 2A4NA 3GKRA 4IF5A 1YLEA 3GYAA 3TOBA 2B5GB 4CRYB 2OU2A 1YX0A 2HV2A 2QECA 2VBQA 3MGDA 3SHPA 3TOAA 3T90A 3FIXA 2HUZA 3DR6A 1M4GA 3S6HA 4AG7A 3VWDA 1XE4A 2JLMA 2ATRA 1Y9KA 5DWNA 2D4OA 2NMTA 4CAXA 4R9MA 4UWIA 3F8KA 5EBVA 4XNHB 5I0CA 2B4DA 4R3LA 1YVKA 5JPHA 3SXNA 4NXYA 1B6BA 1Z4EA 4XNHC 2FXFA 4MJ8A 2Q4YA 3E0KA 4H89A 3R96A 3TO9A 5HMNA 1I12A 4B5OA 1MJBA 3C26A 1MJAA 3EY5A 5FVJA 5IB0A 2J8NA 3D2MA 1YK3A 1I21A 2P6GA 1M44A 2VXKA 4KOXA 4NEXA 1IIDA 4JJXA 3R9GA 1ON0A 1MK4A 5F48A 2CNSA 4K30A 2K5TA 1IYLA 2ZPAA 3JVNA 5DWMA 1TIQA 1IICA 3CXSA 2D4PA 4QVTA 3EO4A 2B4DB 1GHEA 5C88A 2PRBA 2IL4A 2OZGA 4HKFA 2DXQA 5H86A 3I3GA 4OADA 1PUAA 2C27A 5F49A 4KLVA 2OB0A 2FT0A 3I9SA 3V8IA 4II9A 2R7HA 5F46A 4YGOA 4M85A 5C82A 4XPKA 4KOSA 2AJ6A 1L0CA 4CS0B 3PP9A 2R1IA 2FE7A 3ZJ0A 1WWZA 4U5YA 4HNYB 1XEBA 2Q0YA 1QSRA 2PR1A 2VEZA 3FXTA 1P0HA 1WK4A 1PU9A 2X7BA 4I49A 2R98A 3FRMA 2B4BA
chains in the Genus database with same CATH superfamily
2FL4A 2Q04A 4FD6A 4F6AA 4P45A 1KZFA 4DNCA 5G20A 4PXEA 1LAPA 5E96A 2Q7BA 4ZX8A 4OP4A 1VKCA 3S9LA 1S7KA 2ZW4A 3GB0A 3FYNA 2Q4VA 3EC4A 4A39A 2JEVA 1M4LA 4R57A 1VHSA 2AFUA 4G1PA 3S6KA 1VHOA 4X3RA 4KVXA 3SJFA 3JRUA 1TKFA 1Z8WA 1XMTA 4KOVA 4P4BA 2G3TA 4M6IA 2PRQA 4MHPA 4OKOA 1XIXA 5CNPA 4U9ZA 2REFA 4C68A 1ZLIA 3D3SA 2EK9A 4F9VA 1SQHA 1FT7A 1BLLE 4B14A 1Q2DA 3TC8A 2O4HA 2PIZA 2PC1A 3NE7A 3IU2A 2F7VA 4X5KA 2PJ1A 3CPAA 4A31A 1I1DA 4ZYQA 1Z8TA 4NGRA 1IB1E 2DF5A 3D7HA 3CXQA 3PBEA 2HB6A 2PVVA 4UIAA 4ZBGA 2J8RA 4P6YA 1Z5RA 4A33A 2GANA 2ZEOA 1CP7A 2JBJA 3MRUA 4ONUA 3D68A 3NH8A 1KWMA 4R87A 4R7MA 5I4MA 3A9LA 2HQYA 3D7DA 1DE4C 2JBKA 2GIVA 4MCQA 3SI1A 3H4QA 3IEHA 4FBEA 1RXTA 2OR4A 3TO7A 1LRZA 3TO6A 3D8PA 1HDUA 2BSWA 1XOVA 2RFHA 1TXRA 2I3CA 2GE3A 2PJ7A 3CXPA 1Z4RA 2QJ8A 1Y9WA 3B3WA 3TE4A 4PK2A 2WPWA 3P2HA 1A2ZA 1TF8A 2GLJA 3JTKA 3PFEA 3VWEA 3D7GA 2PJ9A 4MFZA 4YRHA 5K8MA 4PV6A 1X12A 4CYOA 4JLYA 4QUSA 2ARHA 2RC4A 2IQ6A 4ONWA 3D7FA 4UCMA 5G21A 4CGMA 4JZ0A 4QBJA 1Y0YA 4YFJA 3R1KA 4F0YA 4JYWA 3P2FA 4W9YA 4PSWA 4RUHA 4Y49B 1ARLA 1YR0A 1V0CA 4X8IA 4FUUA 5KTCA 2I00A 3K9UA 3PFOA 2KCWA 4PSXA 4Y49C 1AUGA 2Q7SA 3GUXA 3IC1A 3V38A 1JQGA 1CX8A 4FD7A 4KSIA 6CPAA 1VHEA 1KUVA 1S3ZA 4H6UA 4AG9A 5IV0A 4P44A 3IIBA 3DR8A 3WC6A 1XBUA 2Z10A 4OC5A 1KUYA 1K4JA 3RZAA 4E0AA 4P4DA 4P4FA 5GCNA 2POKA 3NFZA 4GS4A 2P6FA 2ANPA 2ZEFA 3H5ZA 1RO5A 1CPXA 1ARMA 2VZYA 2ZEDA 5CBMA 4MMOA 2REEA 4KOYA 3F0AA 4XPDB 4KOTA 2B5GA 4NJRA 3PB4X 5AGEA 2Q44A 4J3GA 1FNOA 5HVGA 2CIJA 1S60A 1S5KA 4XPDC 4BD9A 4NF1A 4UA3A 2CNTA 2Z3NA 1IGBA 3JUWA 4KZTA 4TWEA 2EVNA 4ZI6A 5BWAB 4R6TA 4CPAA 3T9YA 3PB9X 1YREA 1ELLP 3R95A 2PJCA 2Z3LA 3LWUA 1LCPA 2AFOA 2PVWA 4NJQA 4AB7A 3QB8A 4RI1A 2BCOA 1S7NA 4MI4A 4P4EA 1FY7A 5CPAA 2XEJA 4KLWA 4PXCA 1YW4A 2EK8A 1EE3P 4C2YA 3BI1A 3R9FA 1XF8A 5DS0A 4MHDA 4NSQA 1LAMA 4UFXA 2OZHA 3FX6A 4OC0A 3KQXA 3S6GA 3RNZA 3IU1A 1ZG7A 3D67A 1M4IA 2P0WA 4KVOE 4IUSA 3DNSA 4K3NA 4ZGYB 2PIYA 1ELMP 4MY0A 3CT9A 5A28A 3W6SA 5HVFA 3DDDA 4XPLA 1ZO0A 3S9MA 4P4IA 4JWPA 2Y0MA 3BJ7A 3NE8A 4CYQA 4NFRA 3B7IA 4H6ZA 2P6EA 2PDOA 4KOUA 1IU8A 2PQ8A 4NGNA 5AG5A 2Z0ZA 3B3TA 3RYOA 3S6FA 2YNCA 3ZZIA 5I0CA 1R57A 4UCPA 4MFKA 4HNWB 2R8VA 4ZY1A 2GREA 5AG4A 4F0XA 2ZW6A 4LX9A 4UIBA 4YU9A 2CNMA 3IWEA 4B12A 3FNCA 5F47A 1YGHA 1Y0RA 5LYIA 2FS5A 4H2KA 2FSRA 2G9DA 3SJXA 4RS2A 4A94A 1M4DA 1NMTA 2F5IA 3UY5A 4UEEA 4A32A 1NSLA 5H84A 4JXRA 2Z11A 4KSFA 3ISZA 3PB8X 4NGPA 3TT2A 1Z8LA 3B8GA 2AFXA 4ZY2A 2B58A 5G22A 5J8CA 2BL1A 1Q2YA 3CDXA 3BXMA 4UFWA 2DPSA 4L89A 4B6ZA 2ZW7A 3RBUA 3LD2A 2QIRA 2OZUA 1Y7RA 4A30A 2ZOGA 1Q2CA 4X2TA 1PYTB 3B3SA 3VH9A 1U6MA 2OH1A 4MFQA 2VI7A 2WPXA 3FECA 4OC3A 3G3SA 4KOWA 3FEEA 1XMBA 1B87A 1JWQA 4UWJA 4DYOA 1KUXA 2PJ8A 4BBHA 2VQYA 4AVAA 2B3VA 1YMEA 4LUAA 4EFDA 2F8HA 2J9AA 2XEIA 2DEAA 2ZW5A 5KTDA 4MY3A 1NE9A 2JDCA 1CM0A 2GU2A 2PJBA 3PGPA 1MJ9A 2FCKA 4ORFA 2BOAA 3IGRA 4YWYA 2AFSA 2ZELA 2EWBA 3CPXA 2NSMA 3BLNA 2PJ3A 2QMLA 5G1ZA 4C2ZA 3W91A 2PR8A 4IAVA 3SJGA 2ZXVA 4MRIA 4KS9A 2BEIA 1BO4A 2O28A 3KHZA 4M3SA 4E2AA 1M1DA 4KUBA 4OLLA 4B5PA 1J4JA 1R3NA 2QYVA 2WSAA 2V8GA 5HH1A 3EFAA 2Q51A 3FEDA 4AVCA 2GLFA 3BJ8A 4M6GA 4U9YA 4B11A 4CRZB 5J1QA 4FD5A 1Z9UA 4KORA 2VL1A 1YVOA 3TTHA 1F57A 2GFQA 1HEEA 4A38A 4UBRA 1YSJA 4ZX9A 4OAEA 3TCVA 1OZPA 3RAMA 2ABZA 4LQ6A 4MHZA 1QSNA 3KHXA 4L8AA 1N71A 2H5MA 4CAFA 3W6XA 5J8FA 2I79A 2V77A 2ZEGA 2Z3KA 3PZJA 1Z2LA 5KTAA 1DTDA 2O53A 1QSTA 3D2PA 4PQAA 4OC4A 3WR7A 5K8NA 5ISVA 5HXDA 3OWCA 4MFPA 3EXNA 1S7LA 2ZOFA 3F5BA 3QNVA 4M6HA 3VARA 1P4NA 4CGOA 4TNUA 1IYKA 2CY2A 4JD6A 5IX3A 3LODA 3DSBA 3N7ZA 2FIWA 2NYQA 3LACA 3H8GA 2HC9A 4MBUA 2ODFA 1BOBA 4AVBA 2CXAA 4KVME 4OC2A 2XEGA 4WJBA 4EVYA 2C1CA 3IWGA 4R3KA 3KR4A 1NSAA 1CG2A 4RN7A 4UEFA 2G0BA 2JEWA 5EC4A 5LYLA 3N5FA 3WC7A 4FD4A 4HNXB 2Z3PA 2WUUA 3K2KA 3RO0A 3FBUA 3R9EA 4E8OA 5LRKA 5LRJA 2AE6A 3KR5A 1LANA 3SXOA 1AYEA 2FIAA 2FVGA 3D66A 3GLJA 4F9UA 1UFHA 2BUEA 3HUVA 3CZXA 3H8FA 1Y7EA 2AFZA 3WABA 4JXQA 4NCZA 4PK3A 4ZY0A 4CAVA 3V7ZA 1CJWA 2G3AA 3DLJA 5AG6A 4Q38A 4QB9A 1YW6A 4B5PB 3L2NA 1OBRA 3B3VA 4CGPA 2V8HA 3FB3A 3HLPA 4OC1A 5THWA 4A37A 2PSWA 2B3UA 4C7HA 4CGNA 3FRMA 5EMIA 1QSMA 3KKWA 4QC6A 4CAWA 3KI9A 2V8DA 5JQ4A 1LOKA 2C6PA 4KUAA 2ZEPA 3ISXA 3TFYA 2C6GA 4C2XA 3PBBA 3WC5A 1S7FA 2J8MA 1CP6A 5LRGA 2VZZA 2EUIA 2JDDA 1QSOA 2Q43A 2PJ2A 4P4JA 3SI2A 1RTQA 3G8WA 3GY9A 3QAHA 3SJEA 2A4NA 3GKRA 4BMHA 4IF5A 3IO1A 1YLEA 3GYAA 3TOBA 1F2OA 4UF4A 4AXVA 2B5GB 4CRYB 2OU2A 1YX0A 2AFMA 1R43A 2HV2A 2YNEA 3FJUA 2QECA 2VBQA 3MGDA 3SHPA 3TOAA 4MXUA 3T90A 1TF9A 5F09A 4GXHA 1VGYA 3FIXA 3FVLA 2PJ6A 2HUZA 3DR6A 1M4GA 7CPAA 2YNDA 1X10A 3S6HA 4AG7A 3VWDA 1XE4A 2JLMA 2ATRA 5A27A 1Y9KA 5DWNA 4OIDA 4F8ZA 3NH5A 2D4OA 2NMTA 5JGFA 2YGWA 3KZWA 3QAYA 4O23A 4CAXA 4DUKA 4R9MA 1BPNA 4UWIA 3F8KA 3FF3A 4XNHB 5EBVA 4NGMA 2BO9A 2B4DA 1YVKA 1F2PA 4MHYA 4PXDA 4R3LA 4Q36A 3SXNA 4NXYA 5IB9A 5JPHA 1B6BA 1Z4EA 4PPZA 2FXFA 4XNHC 2CTCA 1ZLHA 4MJ8A 2Q4YA 3IJ3A 3E0KA 4Z65A 4H89A 5K8OA 1BAVA 1Z8XA 1CPSA 3B35A 4FWUA 1YLOA 4LQGA 3GIUA 2DPTA 3WT4A 4OIWA 5AG7A 4HPSA 3PRTA 3R96A 3NA6A 4KSAA 1BPMA 4MFJA 2Q4ZA 4MCPA 2CF4A 3TO9A 5HMNA 1I12A 4B5OA 4EWTA 3D4UA 1MJBA 3C26A 1GYTA 4BINA 2Z3OA 1MJAA 2WYRA 4B10A 5HVHA 4DJLA 3EY5A 5FVJA 5IB0A 4CYNA 3KL9A 2ZEEA 2J8NA 3D2MA 3NH4A 4Q7AA 1YK3A 1I21A 1Q7LA 4UEZA 1IY7A 2P6GA 1YQEA 2YNCC 1XRYA 4MFLA 4NGSA 1ZG8A 1IOIA 2CTBA 2PCUA 1TKJA 4NGQA 1M44A 2C6CA 1PCAA 3I1UA 1AMPA 2VXKA 3VATA 4KOXA 5D29A 1ZG9A 4NEXA 5LYDA 1IIDA 1HDQA 4JJXA 3R9GA 1ON0A 2EBJA 5K8PA 1MK4A 4MHNA 4P10A 3FMCA 2CNSA 5F48A 8CPAA 2IJZA 4IK2A 4FAIA 2Z3MA 4K30A 3IFEA 3LMSA 2K5TA 2AFWA 1IYLA 4C7IA 1QQ9A 2ZPAA 4R8FA 1H8LA 3MN8A 3K9TA 3JVNA 5DWMA 2PJAA 3KGQA 1TIQA 2QVPA 2V8VA 1CBXA 3KQZA 2WZNA 4EMEA 1IICA 3IWWA 3B2YA 2EO8A 3CXSA 2D4PA 1XFOA 4QVTA 3EO4A 4A95A 2B4DB 3B3CA 3TX8A 1GHEA 4A2ZA 4B13A 5C88A 2PRBA 1LFWA 2IL4A 3DGVA 5ELYA 5JM6A 2OZGA 3S9NA 4HKFA 4UFVA 5H86A 3I3GA 1VIXA 1TKHA 2PJ5A 4OADA 1PUAA 2C27A 4CAEA 4CGLA 5F49A 4KLVA 4MCRA 3FH4A 2OB0A 3BHXA 4CYPA 2FT0A 2PJ4A 4IHMA 3I9SA 3V8IA 4II9A 1XJOA 3PEIA 5D8NA 2R7HA 5F46A 3H8EA 2IMOA 2PJ0A 5LYFA 4YGOA 4M85A 4WWVA 4XPKA 5C82A 1QMUA 4KOSA 5JH9A 2OOTA 2AJ6A 1L0CA 3PB6X 4CS0B 3T8WA 4GM5A 3PP9A 4NGTA 2R1IA 4OMEA 2FE7A 3KASA 3ZJ0A 3SI0A 3BI0A 3PB7X 2XEFA 1WWZA 2RB7A 4U5YA 2PE3A 4R76A 4MCSA 4HNYB 1XEBA 2Q0YA 1QSRA 2PR1A 2VEZA 2ZEMA 3FXTA 2ZENA 2ZEHA 4PXBA 1P0HA 4UCNA 1PU9A 1WK4A 2X7BA 1UWYA 4I49A 2R98A 1IOFA 2DXQA 2B4BA
chains in the Genus database with same CATH topology
2FL4A 2Q04A 4FD6A 4F6AA 1KZFA 4DNCA 5G20A 5E96A 2Q7BA 1VKCA 1S7KA 2ZW4A 3FYNA 2Q4VA 3EC4A 2JEVA 4R57A 1VHSA 3S6KA 4KVXA 1XMTA 4KOVA 2G3TA 1XIXA 5CNPA 4U9ZA 2REFA 4C68A 3D3SA 1SQHA 4B14A 1Q2DA 3NE7A 2PC1A 3IU2A 4X5KA 4A31A 1I1DA 1IB1E 3CXQA 4ZBGA 2J8RA 4A33A 2GANA 4ONUA 4R87A 3A9LA 2HQYA 2GIVA 3H4QA 1RXTA 3TO7A 1LRZA 3TO6A 3D8PA 2BSWA 2GE3A 3CXPA 1Z4RA 1Y9WA 3TE4A 4PK2A 2WPWA 3P2HA 3VWEA 3JTKA 4MFZA 4YRHA 4PV6A 4CYOA 4JLYA 4QUSA 2ARHA 2RC4A 5G21A 4UCMA 4CGMA 4QBJA 4YFJA 3R1KA 4F0YA 3P2FA 4PSWA 4Y49B 1YR0A 1V0CA 5KTCA 2I00A 3K9UA 2KCWA 4PSXA 4Y49C 4FD7A 1KUVA 4H6UA 1S3ZA 4AG9A 5IV0A 3DR8A 2Z10A 1KUYA 1K4JA 4E0AA 5GCNA 4GS4A 2P6FA 3H5ZA 1RO5A 2VZYA 2REEA 4KOYA 3F0AA 4XPDB 4KOTA 2B5GA 5AGEA 2Q44A 4J3GA 1S60A 1S5KA 4XPDC 4NF1A 4UA3A 2CNTA 2Z3NA 4KZTA 3JUWA 2EVNA 5BWAB 3T9YA 1YREA 3R95A 2Z3LA 4AB7A 3QB8A 4RI1A 1S7NA 4MI4A 1FY7A 4KLWA 4C2YA 3R9FA 1XF8A 4MHDA 4NSQA 4UFXA 2OZHA 3S6GA 3IU1A 1M4IA 2P0WA 4KVOE 4IUSA 3DNSA 4ZGYB 4MY0A 5A28A 3W6SA 3DDDA 4XPLA 1ZO0A 4JWPA 2Y0MA 3BJ7A 4CYQA 4H6ZA 2P6EA 2PDOA 4KOUA 2PQ8A 5AG5A 3S6FA 2Z0ZA 3RYOA 3ZZIA 2YNCA 1R57A 4UCPA 4MFKA 4HNWB 2R8VA 5AG4A 4F0XA 2ZW6A 4LX9A 2CNMA 3IWEA 4B12A 3FNCA 5F47A 1YGHA 2FS5A 2FSRA 4RS2A 1M4DA 1NMTA 2F5IA 3UY5A 4A32A 1NSLA 5H84A 4JXRA 2Z11A 4KSFA 3TT2A 3B8GA 2B58A 5G22A 5J8CA 2BL1A 1Q2YA 4UFWA 2DPSA 4L89A 2ZW7A 3LD2A 2QIRA 2OZUA 1Y7RA 4A30A 1Q2CA 1U6MA 2OH1A 4MFQA 2VI7A 2WPXA 3G3SA 4KOWA 1B87A 4UWJA 1KUXA 4BBHA 2VQYA 4AVAA 2B3VA 4LUAA 2ZW5A 5KTDA 4MY3A 1NE9A 2JDCA 1CM0A 3PGPA 1MJ9A 2FCKA 4ORFA 3IGRA 3BLNA 5G1ZA 2QMLA 3W91A 2PR8A 2ZXVA 4KS9A 2BEIA 1BO4A 2O28A 4M3SA 4E2AA 1M1DA 4KUBA 4OLLA 4B5PA 1J4JA 2WSAA 5HH1A 3EFAA 4AVCA 3BJ8A 4CRZB 4U9YA 4B11A 4FD5A 1Z9UA 4KORA 1YVOA 3TTHA 4UBRA 4OAEA 3TCVA 1OZPA 1QSNA 4L8AA 4CAFA 1N71A 2H5MA 5J8FA 3W6XA 2I79A 2Z3KA 3PZJA 5KTAA 1QSTA 3D2PA 3WR7A 5ISVA 3OWCA 4MFPA 3EXNA 1S7LA 3F5BA 1P4NA 4CGOA 1IYKA 2CY2A 4JD6A 5IX3A 3LODA 3DSBA 3N7ZA 2FIWA 4MBUA 4AVBA 1BOBA 2CXAA 4KVME 4EVYA 4R3KA 3IWGA 5EC4A 2G0BA 4FD4A 4HNXB 2Z3PA 2WUUA 4E8OA 3FBUA 3R9EA 2AE6A 3SXOA 2FIAA 1UFHA 2BUEA 4JXQA 4NCZA 4PK3A 4CAVA 1CJWA 2G3AA 5AG6A 4Q38A 4QB9A 4B5PB 4CGPA 3FB3A 2PSWA 2B3UA 4C7HA 4CGNA 1QSMA 3KKWA 4QC6A 4CAWA 5JQ4A 4KUAA 3TFYA 4C2XA 1S7FA 2J8MA 2VZZA 2EUIA 2JDDA 1QSOA 4C2ZA 4BMHA 3G8WA 3GY9A 3QAHA 2A4NA 3GKRA 4IF5A 1YLEA 3GYAA 3TOBA 2B5GB 4CRYB 2OU2A 1YX0A 2HV2A 2YNEA 2QECA 2VBQA 3MGDA 3SHPA 3TOAA 3T90A 3FIXA 2HUZA 3DR6A 1M4GA 2YNDA 3S6HA 4AG7A 3VWDA 1XE4A 2JLMA 2ATRA 5A27A 1Y9KA 5DWNA 2D4OA 2NMTA 2YGWA 4CAXA 4R9MA 4UWIA 3F8KA 5EBVA 4XNHB 5I0CA 2B4DA 4R3LA 1YVKA 5JPHA 4Q36A 3SXNA 4NXYA 1B6BA 1Z4EA 4XNHC 2FXFA 4MJ8A 2Q4YA 3E0KA 4H89A 2DPTA 5AG7A 3R96A 4KSAA 4MFJA 3TO9A 5HMNA 1I12A 4B5OA 1MJBA 3C26A 2Z3OA 1MJAA 4B10A 3EY5A 5FVJA 5IB0A 4CYNA 2J8NA 3D2MA 1YK3A 1I21A 2YNCC 2P6GA 4MFLA 1M44A 2VXKA 4KOXA 4NEXA 1IIDA 4JJXA 3R9GA 1ON0A 1MK4A 5F48A 2CNSA 2Z3MA 4K30A 2K5TA 1IYLA 4C7IA 2ZPAA 3JVNA 5DWMA 1TIQA 1IICA 3CXSA 2D4PA 4QVTA 3EO4A 4A95A 2B4DB 1GHEA 4A2ZA 4B13A 5C88A 2PRBA 2IL4A 2OZGA 4HKFA 2DXQA 4UFVA 5H86A 3I3GA 4OADA 1PUAA 2C27A 4CAEA 4CGLA 5F49A 4KLVA 2OB0A 4CYPA 2FT0A 3I9SA 3V8IA 4II9A 2R7HA 5F46A 4YGOA 4M85A 5C82A 4XPKA 4KOSA 2AJ6A 1L0CA 4CS0B 3PP9A 2R1IA 2FE7A 3ZJ0A 1WWZA 4U5YA 4HNYB 1XEBA 2Q0YA 1QSRA 2PR1A 2VEZA 3FXTA 1P0HA 4UCNA 1WK4A 1PU9A 2X7BA 4I49A 2R98A 3FRMA 2B4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FL4 A;  2Q04 A;  4FD6 A;  4F6A A;  1KZF A;  4DNC A;  5E96 A;  2Q7B A;  1VKC A;  1S7K A;  2ZW4 A;  3FYN A;  2Q4V A;  3EC4 A;  2JEV A;  4R57 A;  1VHS A;  3S6K A;  4KVX A;  1XMT A;  4KOV A;  2G3T A;  1XIX A;  5CNP A;  4U9Z A;  2REF A;  3D3S A;  1SQH A;  1Q2D A;  3NE7 A;  2PC1 A;  4X5K A;  1I1D A;  1IB1 E;  3CXQ A;  4ZBG A;  2J8R A;  2GAN A;  4ONU A;  4R87 A;  2HQY A;  2GIV A;  3H4Q A;  1RXT A;  3TO7 A;  1LRZ A;  3TO6 A;  3D8P A;  2BSW A;  2GE3 A;  3CXP A;  1Z4R A;  1Y9W A;  3TE4 A;  4PK2 A;  2WPW A;  3P2H A;  3VWE A;  4YRH A;  4PV6 A;  4JLY A;  4QUS A;  2ARH A;  2RC4 A;  4QBJ A;  4YFJ A;  3R1K A;  4F0Y A;  3P2F A;  4PSW A;  4Y49 B;  1YR0 A;  1V0C A;  5KTC A;  2I00 A;  3K9U A;  2KCW A;  4PSX A;  4Y49 C;  4FD7 A;  1KUV A;  4H6U A;  1S3Z A;  4AG9 A;  5IV0 A;  3DR8 A;  2Z10 A;  1KUY A;  1K4J A;  4E0A A;  5GCN A;  4GS4 A;  2P6F A;  1RO5 A;  2VZY A;  2REE A;  4KOY A;  3F0A A;  4XPD B;  4KOT A;  2B5G A;  2Q44 A;  4J3G A;  1S60 A;  1S5K A;  4XPD C;  4NF1 A;  4UA3 A;  2CNT A;  4KZT A;  3JUW A;  2EVN A;  3T9Y A;  1YRE A;  3R95 A;  4AB7 A;  3QB8 A;  4RI1 A;  1S7N A;  4MI4 A;  1FY7 A;  4KLW A;  3R9F A;  1XF8 A;  4MHD A;  4NSQ A;  2OZH A;  3S6G A;  1M4I A;  2P0W A;  4KVO E;  4IUS A;  3DNS A;  4MY0 A;  3W6S A;  3DDD A;  4XPL A;  4JWP A;  2Y0M A;  3BJ7 A;  4H6Z A;  2P6E A;  2PDO A;  4KOU A;  2PQ8 A;  3S6F A;  2Z0Z A;  3RYO A;  3ZZI A;  1R57 A;  4HNW B;  2R8V A;  2ZW6 A;  4LX9 A;  2CNM A;  3FNC A;  5F47 A;  1YGH A;  2FS5 A;  2FSR A;  4RS2 A;  1M4D A;  1NMT A;  2F5I A;  3UY5 A;  1NSL A;  5H84 A;  4JXR A;  2Z11 A;  3TT2 A;  3B8G A;  2B58 A;  5J8C A;  2BL1 A;  1Q2Y A;  4L89 A;  2ZW7 A;  3LD2 A;  2QIR A;  2OZU A;  1Y7R A;  1Q2C A;  1U6M A;  2OH1 A;  2VI7 A;  2WPX A;  3G3S A;  4KOW A;  1B87 A;  4UWJ A;  1KUX A;  2VQY A;  4AVA A;  2B3V A;  4LUA A;  2ZW5 A;  5KTD A;  4MY3 A;  1NE9 A;  2JDC A;  1CM0 A;  3PGP A;  1MJ9 A;  2FCK A;  4ORF A;  3IGR A;  3BLN A;  2QML A;  3W91 A;  2PR8 A;  2ZXV A;  2BEI A;  1BO4 A;  4M3S A;  2O28 A;  4E2A A;  1M1D A;  4KUB A;  4OLL A;  4B5P A;  1J4J A;  5HH1 A;  3EFA A;  4AVC A;  3BJ8 A;  4CRZ B;  4U9Y A;  4FD5 A;  1Z9U A;  4KOR A;  1YVO A;  3TTH A;  4UBR A;  4OAE A;  3TCV A;  1OZP A;  1QSN A;  4L8A A;  5J8F A;  1N71 A;  2H5M A;  3W6X A;  2I79 A;  3PZJ A;  5KTA A;  1QST A;  3D2P A;  3WR7 A;  5ISV A;  3OWC A;  3EXN A;  1S7L A;  3F5B A;  1P4N A;  1IYK A;  2CY2 A;  4JD6 A;  5IX3 A;  3LOD A;  3DSB A;  3N7Z A;  2FIW A;  4MBU A;  4AVB A;  1BOB A;  4KVM E;  4EVY A;  4R3K A;  3IWG A;  5EC4 A;  2G0B A;  4FD4 A;  4HNX B;  4E8O A;  3FBU A;  3R9E A;  2AE6 A;  3SXO A;  2FIA A;  1UFH A;  2BUE A;  4JXQ A;  4NCZ A;  4PK3 A;  4CAV A;  1CJW A;  2G3A A;  4QB9 A;  4B5P B;  3FB3 A;  2PSW A;  2B3U A;  1QSM A;  3KKW A;  4QC6 A;  4CAW A;  5JQ4 A;  4KUA A;  3TFY A;  1S7F A;  2J8M A;  2VZZ A;  2EUI A;  2JDD A;  1QSO A;  4BMH A;  3G8W A;  3GY9 A;  3QAH A;  2A4N A;  3GKR A;  4IF5 A;  1YLE A;  3GYA A;  3TOB A;  2B5G B;  4CRY B;  2OU2 A;  1YX0 A;  2HV2 A;  2QEC A;  2VBQ A;  3MGD A;  3SHP A;  3TOA A;  3T90 A;  3FIX A;  2HUZ A;  3DR6 A;  1M4G A;  3S6H A;  4AG7 A;  3VWD A;  1XE4 A;  2JLM A;  2ATR A;  1Y9K A;  5DWN A;  2D4O A;  2NMT A;  4CAX A;  4R9M A;  4UWI A;  3F8K A;  5EBV A;  4XNH B;  5I0C A;  2B4D A;  4R3L A;  1YVK A;  5JPH A;  3SXN A;  4NXY A;  1B6B A;  1Z4E A;  4XNH C;  2FXF A;  4MJ8 A;  2Q4Y A;  3E0K A;  4H89 A;  3R96 A;  3TO9 A;  5HMN A;  1I12 A;  4B5O A;  1MJB A;  3C26 A;  1MJA A;  3EY5 A;  5FVJ A;  5IB0 A;  2J8N A;  3D2M A;  1YK3 A;  1I21 A;  2P6G A;  1M44 A;  2VXK A;  4KOX A;  4NEX A;  1IID A;  4JJX A;  3R9G A;  1ON0 A;  1MK4 A;  5F48 A;  2CNS A;  4K30 A;  2K5T A;  1IYL A;  2ZPA A;  3JVN A;  5DWM A;  1TIQ A;  1IIC A;  3CXS A;  2D4P A;  4QVT A;  3EO4 A;  2B4D B;  1GHE A;  5C88 A;  2PRB A;  2IL4 A;  2OZG A;  4HKF A;  2DXQ A;  5H86 A;  3I3G A;  4OAD A;  1PUA A;  2C27 A;  5F49 A;  4KLV A;  2OB0 A;  2FT0 A;  3I9S A;  3V8I A;  4II9 A;  2R7H A;  5F46 A;  4YGO A;  4M85 A;  5C82 A;  4XPK A;  4KOS A;  2AJ6 A;  1L0C A;  4CS0 B;  3PP9 A;  2R1I A;  2FE7 A;  3ZJ0 A;  1WWZ A;  4U5Y A;  4HNY B;  1XEB A;  2Q0Y A;  1QSR A;  2PR1 A;  2VEZ A;  3FXT A;  1P0H A;  1WK4 A;  1PU9 A;  2X7B A;  4I49 A;  2R98 A;  3FRM A;  2B4B A; 
#chains in the Genus database with same CATH topology
 2FL4 A;  2Q04 A;  4FD6 A;  4F6A A;  4P45 A;  1KZF A;  4DNC A;  5G20 A;  4PXE A;  1LAP A;  5E96 A;  2Q7B A;  4ZX8 A;  4OP4 A;  1VKC A;  3S9L A;  1S7K A;  2ZW4 A;  3GB0 A;  3FYN A;  2Q4V A;  3EC4 A;  4A39 A;  2JEV A;  1M4L A;  4R57 A;  1VHS A;  2AFU A;  4G1P A;  3S6K A;  1VHO A;  4X3R A;  4KVX A;  3SJF A;  3JRU A;  1TKF A;  1Z8W A;  1XMT A;  4KOV A;  4P4B A;  2G3T A;  4M6I A;  2PRQ A;  4MHP A;  4OKO A;  1XIX A;  5CNP A;  4U9Z A;  2REF A;  4C68 A;  1ZLI A;  3D3S A;  2EK9 A;  4F9V A;  1SQH A;  1FT7 A;  1BLL E;  4B14 A;  1Q2D A;  3TC8 A;  2O4H A;  2PIZ A;  2PC1 A;  3NE7 A;  3IU2 A;  2F7V A;  4X5K A;  2PJ1 A;  3CPA A;  4A31 A;  1I1D A;  4ZYQ A;  1Z8T A;  4NGR A;  1IB1 E;  2DF5 A;  3D7H A;  3CXQ A;  3PBE A;  2HB6 A;  2PVV A;  4UIA A;  4ZBG A;  2J8R A;  4P6Y A;  1Z5R A;  4A33 A;  2GAN A;  2ZEO A;  1CP7 A;  2JBJ A;  3MRU A;  4ONU A;  3D68 A;  3NH8 A;  1KWM A;  4R87 A;  4R7M A;  5I4M A;  3A9L A;  2HQY A;  3D7D A;  1DE4 C;  2JBK A;  2GIV A;  4MCQ A;  3SI1 A;  3H4Q A;  3IEH A;  4FBE A;  1RXT A;  2OR4 A;  3TO7 A;  1LRZ A;  3TO6 A;  3D8P A;  1HDU A;  2BSW A;  1XOV A;  2RFH A;  1TXR A;  2I3C A;  2GE3 A;  2PJ7 A;  3CXP A;  1Z4R A;  2QJ8 A;  1Y9W A;  3B3W A;  3TE4 A;  4PK2 A;  2WPW A;  3P2H A;  1A2Z A;  1TF8 A;  2GLJ A;  3JTK A;  3PFE A;  3VWE A;  3D7G A;  2PJ9 A;  4MFZ A;  4YRH A;  5K8M A;  4PV6 A;  1X12 A;  4CYO A;  4JLY A;  4QUS A;  2ARH A;  2RC4 A;  2IQ6 A;  4ONW A;  3D7F A;  4UCM A;  5G21 A;  4CGM A;  4JZ0 A;  4QBJ A;  1Y0Y A;  4YFJ A;  3R1K A;  4F0Y A;  4JYW A;  3P2F A;  4W9Y A;  4PSW A;  4RUH A;  4Y49 B;  1ARL A;  1YR0 A;  1V0C A;  4X8I A;  4FUU A;  5KTC A;  2I00 A;  3K9U A;  3PFO A;  2KCW A;  4PSX A;  4Y49 C;  1AUG A;  2Q7S A;  3GUX A;  3IC1 A;  3V38 A;  1JQG A;  1CX8 A;  4FD7 A;  4KSI A;  6CPA A;  1VHE A;  1KUV A;  1S3Z A;  4H6U A;  4AG9 A;  5IV0 A;  4P44 A;  3IIB A;  3DR8 A;  3WC6 A;  1XBU A;  2Z10 A;  4OC5 A;  1KUY A;  1K4J A;  3RZA A;  4E0A A;  4P4D A;  4P4F A;  5GCN A;  2POK A;  3NFZ A;  4GS4 A;  2P6F A;  2ANP A;  2ZEF A;  3H5Z A;  1RO5 A;  1CPX A;  1ARM A;  2VZY A;  2ZED A;  5CBM A;  4MMO A;  2REE A;  4KOY A;  3F0A A;  4XPD B;  4KOT A;  2B5G A;  4NJR A;  3PB4 X;  5AGE A;  2Q44 A;  4J3G A;  1FNO A;  5HVG A;  2CIJ A;  1S60 A;  1S5K A;  4XPD C;  4BD9 A;  4NF1 A;  4UA3 A;  2CNT A;  2Z3N A;  1IGB A;  3JUW A;  4KZT A;  4TWE A;  2EVN A;  4ZI6 A;  5BWA B;  4R6T A;  4CPA A;  3T9Y A;  3PB9 X;  1YRE A;  1ELL P;  3R95 A;  2PJC A;  2Z3L A;  3LWU A;  1LCP A;  2AFO A;  2PVW A;  4NJQ A;  4AB7 A;  3QB8 A;  4RI1 A;  2BCO A;  1S7N A;  4MI4 A;  4P4E A;  1FY7 A;  5CPA A;  2XEJ A;  4KLW A;  4PXC A;  1YW4 A;  2EK8 A;  1EE3 P;  4C2Y A;  3BI1 A;  3R9F A;  1XF8 A;  5DS0 A;  4MHD A;  4NSQ A;  1LAM A;  4UFX A;  2OZH A;  3FX6 A;  4OC0 A;  3KQX A;  3S6G A;  3RNZ A;  3IU1 A;  1ZG7 A;  3D67 A;  1M4I A;  2P0W A;  4KVO E;  4IUS A;  3DNS A;  4K3N A;  4ZGY B;  2PIY A;  1ELM P;  4MY0 A;  3CT9 A;  5A28 A;  3W6S A;  5HVF A;  3DDD A;  4XPL A;  1ZO0 A;  3S9M A;  4P4I A;  4JWP A;  2Y0M A;  3BJ7 A;  3NE8 A;  4CYQ A;  4NFR A;  3B7I A;  4H6Z A;  2P6E A;  2PDO A;  4KOU A;  1IU8 A;  2PQ8 A;  4NGN A;  5AG5 A;  2Z0Z A;  3B3T A;  3RYO A;  3S6F A;  2YNC A;  3ZZI A;  5I0C A;  1R57 A;  4UCP A;  4MFK A;  4HNW B;  2R8V A;  4ZY1 A;  2GRE A;  5AG4 A;  4F0X A;  2ZW6 A;  4LX9 A;  4UIB A;  4YU9 A;  2CNM A;  3IWE A;  4B12 A;  3FNC A;  5F47 A;  1YGH A;  1Y0R A;  5LYI A;  2FS5 A;  4H2K A;  2FSR A;  2G9D A;  3SJX A;  4RS2 A;  4A94 A;  1M4D A;  1NMT A;  2F5I A;  3UY5 A;  4UEE A;  4A32 A;  1NSL A;  5H84 A;  4JXR A;  2Z11 A;  4KSF A;  3ISZ A;  3PB8 X;  4NGP A;  3TT2 A;  1Z8L A;  3B8G A;  2AFX A;  4ZY2 A;  2B58 A;  5G22 A;  5J8C A;  2BL1 A;  1Q2Y A;  3CDX A;  3BXM A;  4UFW A;  2DPS A;  4L89 A;  4B6Z A;  2ZW7 A;  3RBU A;  3LD2 A;  2QIR A;  2OZU A;  1Y7R A;  4A30 A;  2ZOG A;  1Q2C A;  4X2T A;  1PYT B;  3B3S A;  3VH9 A;  1U6M A;  2OH1 A;  4MFQ A;  2VI7 A;  2WPX A;  3FEC A;  4OC3 A;  3G3S A;  4KOW A;  3FEE A;  1XMB A;  1B87 A;  1JWQ A;  4UWJ A;  4DYO A;  1KUX A;  2PJ8 A;  4BBH A;  2VQY A;  4AVA A;  2B3V A;  1YME A;  4LUA A;  4EFD A;  2F8H A;  2J9A A;  2XEI A;  2DEA A;  2ZW5 A;  5KTD A;  4MY3 A;  1NE9 A;  2JDC A;  1CM0 A;  2GU2 A;  2PJB A;  3PGP A;  1MJ9 A;  2FCK A;  4ORF A;  2BOA A;  3IGR A;  4YWY A;  2AFS A;  2ZEL A;  2EWB A;  3CPX A;  2NSM A;  3BLN A;  2PJ3 A;  2QML A;  5G1Z A;  4C2Z A;  3W91 A;  2PR8 A;  4IAV A;  3SJG A;  2ZXV A;  4MRI A;  4KS9 A;  2BEI A;  1BO4 A;  2O28 A;  3KHZ A;  4M3S A;  4E2A A;  1M1D A;  4KUB A;  4OLL A;  4B5P A;  1J4J A;  1R3N A;  2QYV A;  2WSA A;  2V8G A;  5HH1 A;  3EFA A;  2Q51 A;  3FED A;  4AVC A;  2GLF A;  3BJ8 A;  4M6G A;  4U9Y A;  4B11 A;  4CRZ B;  5J1Q A;  4FD5 A;  1Z9U A;  4KOR A;  2VL1 A;  1YVO A;  3TTH A;  1F57 A;  2GFQ A;  1HEE A;  4A38 A;  4UBR A;  1YSJ A;  4ZX9 A;  4OAE A;  3TCV A;  1OZP A;  3RAM A;  2ABZ A;  4LQ6 A;  4MHZ A;  1QSN A;  3KHX A;  4L8A A;  1N71 A;  2H5M A;  4CAF A;  3W6X A;  5J8F A;  2I79 A;  2V77 A;  2ZEG A;  2Z3K A;  3PZJ A;  1Z2L A;  5KTA A;  1DTD A;  2O53 A;  1QST A;  3D2P A;  4PQA A;  4OC4 A;  3WR7 A;  5K8N A;  5ISV A;  5HXD A;  3OWC A;  4MFP A;  3EXN A;  1S7L A;  2ZOF A;  3F5B A;  3QNV A;  4M6H A;  3VAR A;  1P4N A;  4CGO A;  4TNU A;  1IYK A;  2CY2 A;  4JD6 A;  5IX3 A;  3LOD A;  3DSB A;  3N7Z A;  2FIW A;  2NYQ A;  3LAC A;  3H8G A;  2HC9 A;  4MBU A;  2ODF A;  1BOB A;  4AVB A;  2CXA A;  4KVM E;  4OC2 A;  2XEG A;  4WJB A;  4EVY A;  2C1C A;  3IWG A;  4R3K A;  3KR4 A;  1NSA A;  1CG2 A;  4RN7 A;  4UEF A;  2G0B A;  2JEW A;  5EC4 A;  5LYL A;  3N5F A;  3WC7 A;  4FD4 A;  4HNX B;  2Z3P A;  2WUU A;  3K2K A;  3RO0 A;  3FBU A;  3R9E A;  4E8O A;  5LRK A;  5LRJ A;  2AE6 A;  3KR5 A;  1LAN A;  3SXO A;  1AYE A;  2FIA A;  2FVG A;  3D66 A;  3GLJ A;  4F9U A;  1UFH A;  2BUE A;  3HUV A;  3CZX A;  3H8F A;  1Y7E A;  2AFZ A;  3WAB A;  4JXQ A;  4NCZ A;  4PK3 A;  4ZY0 A;  4CAV A;  3V7Z A;  1CJW A;  2G3A A;  3DLJ A;  5AG6 A;  4Q38 A;  4QB9 A;  1YW6 A;  4B5P B;  3L2N A;  1OBR A;  3B3V A;  4CGP A;  2V8H A;  3FB3 A;  3HLP A;  4OC1 A;  5THW A;  4A37 A;  2PSW A;  2B3U A;  4C7H A;  4CGN A;  3FRM A;  5EMI A;  1QSM A;  3KKW A;  4QC6 A;  4CAW A;  3KI9 A;  2V8D A;  5JQ4 A;  1LOK A;  2C6P A;  4KUA A;  2ZEP A;  3ISX A;  3TFY A;  2C6G A;  4C2X A;  3PBB A;  3WC5 A;  1S7F A;  2J8M A;  1CP6 A;  5LRG A;  2VZZ A;  2EUI A;  2JDD A;  1QSO A;  2Q43 A;  2PJ2 A;  4P4J A;  3SI2 A;  1RTQ A;  3G8W A;  3GY9 A;  3QAH A;  3SJE A;  2A4N A;  3GKR A;  4BMH A;  4IF5 A;  3IO1 A;  1YLE A;  3GYA A;  3TOB A;  1F2O A;  4UF4 A;  4AXV A;  2B5G B;  4CRY B;  2OU2 A;  1YX0 A;  2AFM A;  1R43 A;  2HV2 A;  2YNE A;  3FJU A;  2QEC A;  2VBQ A;  3MGD A;  3SHP A;  3TOA A;  4MXU A;  3T90 A;  1TF9 A;  5F09 A;  4GXH A;  1VGY A;  3FIX A;  3FVL A;  2PJ6 A;  2HUZ A;  3DR6 A;  1M4G A;  7CPA A;  2YND A;  1X10 A;  3S6H A;  4AG7 A;  3VWD A;  1XE4 A;  2JLM A;  2ATR A;  5A27 A;  1Y9K A;  5DWN A;  4OID A;  4F8Z A;  3NH5 A;  2D4O A;  2NMT A;  5JGF A;  2YGW A;  3KZW A;  3QAY A;  4O23 A;  4CAX A;  4DUK A;  4R9M A;  1BPN A;  4UWI A;  3F8K A;  3FF3 A;  4XNH B;  5EBV A;  4NGM A;  2BO9 A;  2B4D A;  1YVK A;  1F2P A;  4MHY A;  4PXD A;  4R3L A;  4Q36 A;  3SXN A;  4NXY A;  5IB9 A;  5JPH A;  1B6B A;  1Z4E A;  4PPZ A;  2FXF A;  4XNH C;  2CTC A;  1ZLH A;  4MJ8 A;  2Q4Y A;  3IJ3 A;  3E0K A;  4Z65 A;  4H89 A;  5K8O A;  1BAV A;  1Z8X A;  1CPS A;  3B35 A;  4FWU A;  1YLO A;  4LQG A;  3GIU A;  2DPT A;  3WT4 A;  4OIW A;  5AG7 A;  4HPS A;  3PRT A;  3R96 A;  3NA6 A;  4KSA A;  1BPM A;  4MFJ A;  2Q4Z A;  4MCP A;  2CF4 A;  3TO9 A;  5HMN A;  1I12 A;  4B5O A;  4EWT A;  3D4U A;  1MJB A;  3C26 A;  1GYT A;  4BIN A;  2Z3O A;  1MJA A;  2WYR A;  4B10 A;  5HVH A;  4DJL A;  3EY5 A;  5FVJ A;  5IB0 A;  4CYN A;  3KL9 A;  2ZEE A;  2J8N A;  3D2M A;  3NH4 A;  4Q7A A;  1YK3 A;  1I21 A;  1Q7L A;  4UEZ A;  1IY7 A;  2P6G A;  1YQE A;  2YNC C;  1XRY A;  4MFL A;  4NGS A;  1ZG8 A;  1IOI A;  2CTB A;  2PCU A;  1TKJ A;  4NGQ A;  1M44 A;  2C6C A;  1PCA A;  3I1U A;  1AMP A;  2VXK A;  3VAT A;  4KOX A;  5D29 A;  1ZG9 A;  4NEX A;  5LYD A;  1IID A;  1HDQ A;  4JJX A;  3R9G A;  1ON0 A;  2EBJ A;  5K8P A;  1MK4 A;  4MHN A;  4P10 A;  3FMC A;  2CNS A;  5F48 A;  8CPA A;  2IJZ A;  4IK2 A;  4FAI A;  2Z3M A;  4K30 A;  3IFE A;  3LMS A;  2K5T A;  2AFW A;  1IYL A;  4C7I A;  1QQ9 A;  2ZPA A;  4R8F A;  1H8L A;  3MN8 A;  3K9T A;  3JVN A;  5DWM A;  2PJA A;  3KGQ A;  1TIQ A;  2QVP A;  2V8V A;  1CBX A;  3KQZ A;  2WZN A;  4EME A;  1IIC A;  3IWW A;  3B2Y A;  2EO8 A;  3CXS A;  2D4P A;  1XFO A;  4QVT A;  3EO4 A;  4A95 A;  2B4D B;  3B3C A;  3TX8 A;  1GHE A;  4A2Z A;  4B13 A;  5C88 A;  2PRB A;  1LFW A;  2IL4 A;  3DGV A;  5ELY A;  5JM6 A;  2OZG A;  3S9N A;  4HKF A;  4UFV A;  5H86 A;  3I3G A;  1VIX A;  1TKH A;  2PJ5 A;  4OAD A;  1PUA A;  2C27 A;  4CAE A;  4CGL A;  5F49 A;  4KLV A;  4MCR A;  3FH4 A;  2OB0 A;  3BHX A;  4CYP A;  2FT0 A;  2PJ4 A;  4IHM A;  3I9S A;  3V8I A;  4II9 A;  1XJO A;  3PEI A;  5D8N A;  2R7H A;  5F46 A;  3H8E A;  2IMO A;  2PJ0 A;  5LYF A;  4YGO A;  4M85 A;  4WWV A;  4XPK A;  5C82 A;  1QMU A;  4KOS A;  5JH9 A;  2OOT A;  2AJ6 A;  1L0C A;  3PB6 X;  4CS0 B;  3T8W A;  4GM5 A;  3PP9 A;  4NGT A;  2R1I A;  4OME A;  2FE7 A;  3KAS A;  3ZJ0 A;  3SI0 A;  3BI0 A;  3PB7 X;  2XEF A;  1WWZ A;  2RB7 A;  4U5Y A;  2PE3 A;  4R76 A;  4MCS A;  4HNY B;  1XEB A;  2Q0Y A;  1QSR A;  2PR1 A;  2VEZ A;  2ZEM A;  3FXT A;  2ZEN A;  2ZEH A;  4PXB A;  1P0H A;  4UCN A;  1PU9 A;  1WK4 A;  2X7B A;  1UWY A;  4I49 A;  2R98 A;  1IOF A;  2DXQ A;  2B4B A; 
#chains in the Genus database with same CATH homology
 2FL4 A;  2Q04 A;  4FD6 A;  4F6A A;  1KZF A;  4DNC A;  5G20 A;  5E96 A;  2Q7B A;  1VKC A;  1S7K A;  2ZW4 A;  3FYN A;  2Q4V A;  3EC4 A;  2JEV A;  4R57 A;  1VHS A;  3S6K A;  4KVX A;  1XMT A;  4KOV A;  2G3T A;  1XIX A;  5CNP A;  4U9Z A;  2REF A;  4C68 A;  3D3S A;  1SQH A;  4B14 A;  1Q2D A;  3NE7 A;  2PC1 A;  3IU2 A;  4X5K A;  4A31 A;  1I1D A;  1IB1 E;  3CXQ A;  4ZBG A;  2J8R A;  4A33 A;  2GAN A;  4ONU A;  4R87 A;  3A9L A;  2HQY A;  2GIV A;  3H4Q A;  1RXT A;  3TO7 A;  1LRZ A;  3TO6 A;  3D8P A;  2BSW A;  2GE3 A;  3CXP A;  1Z4R A;  1Y9W A;  3TE4 A;  4PK2 A;  2WPW A;  3P2H A;  3VWE A;  3JTK A;  4MFZ A;  4YRH A;  4PV6 A;  4CYO A;  4JLY A;  4QUS A;  2ARH A;  2RC4 A;  5G21 A;  4UCM A;  4CGM A;  4QBJ A;  4YFJ A;  3R1K A;  4F0Y A;  3P2F A;  4PSW A;  4Y49 B;  1YR0 A;  1V0C A;  5KTC A;  2I00 A;  3K9U A;  2KCW A;  4PSX A;  4Y49 C;  4FD7 A;  1KUV A;  4H6U A;  1S3Z A;  4AG9 A;  5IV0 A;  3DR8 A;  2Z10 A;  1KUY A;  1K4J A;  4E0A A;  5GCN A;  4GS4 A;  2P6F A;  3H5Z A;  1RO5 A;  2VZY A;  2REE A;  4KOY A;  3F0A A;  4XPD B;  4KOT A;  2B5G A;  5AGE A;  2Q44 A;  4J3G A;  1S60 A;  1S5K A;  4XPD C;  4NF1 A;  4UA3 A;  2CNT A;  2Z3N A;  4KZT A;  3JUW A;  2EVN A;  5BWA B;  3T9Y A;  1YRE A;  3R95 A;  2Z3L A;  4AB7 A;  3QB8 A;  4RI1 A;  1S7N A;  4MI4 A;  1FY7 A;  4KLW A;  4C2Y A;  3R9F A;  1XF8 A;  4MHD A;  4NSQ A;  4UFX A;  2OZH A;  3S6G A;  3IU1 A;  1M4I A;  2P0W A;  4KVO E;  4IUS A;  3DNS A;  4ZGY B;  4MY0 A;  5A28 A;  3W6S A;  3DDD A;  4XPL A;  1ZO0 A;  4JWP A;  2Y0M A;  3BJ7 A;  4CYQ A;  4H6Z A;  2P6E A;  2PDO A;  4KOU A;  2PQ8 A;  5AG5 A;  3S6F A;  2Z0Z A;  3RYO A;  3ZZI A;  2YNC A;  1R57 A;  4UCP A;  4MFK A;  4HNW B;  2R8V A;  5AG4 A;  4F0X A;  2ZW6 A;  4LX9 A;  2CNM A;  3IWE A;  4B12 A;  3FNC A;  5F47 A;  1YGH A;  2FS5 A;  2FSR A;  4RS2 A;  1M4D A;  1NMT A;  2F5I A;  3UY5 A;  4A32 A;  1NSL A;  5H84 A;  4JXR A;  2Z11 A;  4KSF A;  3TT2 A;  3B8G A;  2B58 A;  5G22 A;  5J8C A;  2BL1 A;  1Q2Y A;  4UFW A;  2DPS A;  4L89 A;  2ZW7 A;  3LD2 A;  2QIR A;  2OZU A;  1Y7R A;  4A30 A;  1Q2C A;  1U6M A;  2OH1 A;  4MFQ A;  2VI7 A;  2WPX A;  3G3S A;  4KOW A;  1B87 A;  4UWJ A;  1KUX A;  4BBH A;  2VQY A;  4AVA A;  2B3V A;  4LUA A;  2ZW5 A;  5KTD A;  4MY3 A;  1NE9 A;  2JDC A;  1CM0 A;  3PGP A;  1MJ9 A;  2FCK A;  4ORF A;  3IGR A;  3BLN A;  5G1Z A;  2QML A;  3W91 A;  2PR8 A;  2ZXV A;  4KS9 A;  2BEI A;  1BO4 A;  2O28 A;  4M3S A;  4E2A A;  1M1D A;  4KUB A;  4OLL A;  4B5P A;  1J4J A;  2WSA A;  5HH1 A;  3EFA A;  4AVC A;  3BJ8 A;  4CRZ B;  4U9Y A;  4B11 A;  4FD5 A;  1Z9U A;  4KOR A;  1YVO A;  3TTH A;  4UBR A;  4OAE A;  3TCV A;  1OZP A;  1QSN A;  4L8A A;  4CAF A;  1N71 A;  2H5M A;  5J8F A;  3W6X A;  2I79 A;  2Z3K A;  3PZJ A;  5KTA A;  1QST A;  3D2P A;  3WR7 A;  5ISV A;  3OWC A;  4MFP A;  3EXN A;  1S7L A;  3F5B A;  1P4N A;  4CGO A;  1IYK A;  2CY2 A;  4JD6 A;  5IX3 A;  3LOD A;  3DSB A;  3N7Z A;  2FIW A;  4MBU A;  4AVB A;  1BOB A;  2CXA A;  4KVM E;  4EVY A;  4R3K A;  3IWG A;  5EC4 A;  2G0B A;  4FD4 A;  4HNX B;  2Z3P A;  2WUU A;  4E8O A;  3FBU A;  3R9E A;  2AE6 A;  3SXO A;  2FIA A;  1UFH A;  2BUE A;  4JXQ A;  4NCZ A;  4PK3 A;  4CAV A;  1CJW A;  2G3A A;  5AG6 A;  4Q38 A;  4QB9 A;  4B5P B;  4CGP A;  3FB3 A;  2PSW A;  2B3U A;  4C7H A;  4CGN A;  1QSM A;  3KKW A;  4QC6 A;  4CAW A;  5JQ4 A;  4KUA A;  3TFY A;  4C2X A;  1S7F A;  2J8M A;  2VZZ A;  2EUI A;  2JDD A;  1QSO A;  4C2Z A;  4BMH A;  3G8W A;  3GY9 A;  3QAH A;  2A4N A;  3GKR A;  4IF5 A;  1YLE A;  3GYA A;  3TOB A;  2B5G B;  4CRY B;  2OU2 A;  1YX0 A;  2HV2 A;  2YNE A;  2QEC A;  2VBQ A;  3MGD A;  3SHP A;  3TOA A;  3T90 A;  3FIX A;  2HUZ A;  3DR6 A;  1M4G A;  2YND A;  3S6H A;  4AG7 A;  3VWD A;  1XE4 A;  2JLM A;  2ATR A;  5A27 A;  1Y9K A;  5DWN A;  2D4O A;  2NMT A;  2YGW A;  4CAX A;  4R9M A;  4UWI A;  3F8K A;  5EBV A;  4XNH B;  5I0C A;  2B4D A;  4R3L A;  1YVK A;  5JPH A;  4Q36 A;  3SXN A;  4NXY A;  1B6B A;  1Z4E A;  4XNH C;  2FXF A;  4MJ8 A;  2Q4Y A;  3E0K A;  4H89 A;  2DPT A;  5AG7 A;  3R96 A;  4KSA A;  4MFJ A;  3TO9 A;  5HMN A;  1I12 A;  4B5O A;  1MJB A;  3C26 A;  2Z3O A;  1MJA A;  4B10 A;  3EY5 A;  5FVJ A;  5IB0 A;  4CYN A;  2J8N A;  3D2M A;  1YK3 A;  1I21 A;  2YNC C;  2P6G A;  4MFL A;  1M44 A;  2VXK A;  4KOX A;  4NEX A;  1IID A;  4JJX A;  3R9G A;  1ON0 A;  1MK4 A;  5F48 A;  2CNS A;  2Z3M A;  4K30 A;  2K5T A;  1IYL A;  4C7I A;  2ZPA A;  3JVN A;  5DWM A;  1TIQ A;  1IIC A;  3CXS A;  2D4P A;  4QVT A;  3EO4 A;  4A95 A;  2B4D B;  1GHE A;  4A2Z A;  4B13 A;  5C88 A;  2PRB A;  2IL4 A;  2OZG A;  4HKF A;  2DXQ A;  4UFV A;  5H86 A;  3I3G A;  4OAD A;  1PUA A;  2C27 A;  4CAE A;  4CGL A;  5F49 A;  4KLV A;  2OB0 A;  4CYP A;  2FT0 A;  3I9S A;  3V8I A;  4II9 A;  2R7H A;  5F46 A;  4YGO A;  4M85 A;  5C82 A;  4XPK A;  4KOS A;  2AJ6 A;  1L0C A;  4CS0 B;  3PP9 A;  2R1I A;  2FE7 A;  3ZJ0 A;  1WWZ A;  4U5Y A;  4HNY B;  1XEB A;  2Q0Y A;  1QSR A;  2PR1 A;  2VEZ A;  3FXT A;  1P0H A;  4UCN A;  1WK4 A;  1PU9 A;  2X7B A;  4I49 A;  2R98 A;  3FRM A;  2B4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...