2B5GA

Wild type ssat- 1.7a structure
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
164
Chain Sequence
b'AKFVIRPATAADCSDILRLIKELAKYEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
molecule tags Transferase
source organism Homo sapiens
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
total genus 35
structure length 164
sequence length 168
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b5gA00
3T9YA 2P6GA 3TO6A 1BOBA 3CXPA 2J8MA 2VI7A 4R87A 5F48A 1NE9A 1ON0A 1Q2DA 4L8AA 1S3ZA 2PDOA 3R1KA 4JD6A 2R1IA 2Q7BA 1KUXA 3TTHA 2QECA 2R7HA 2R98A 4B5OA 4QVTA 1VKCA 2OB0A 5FVJA 2FIAA 3TO9A 3UY5A 2B3UA 5F47A 4NSQA 4ZBGA 4OADA 3JVNA 5C88A 4KOSA 1K4JA 2FS5A 4CS0B 2ZW4A 1Q2YA 2GANA 3FIXA 1YLEA 3PGPA 4JWPA 2PR1A 4J3GA 1CM0A 3N7ZA 1Z4RA 3R9EA 1S60A 5HMNA 5HH1A 1CJWA 3VWDA 4H89A 4B5PA 4MY0A 3R9FA 1S7FA 1YVOA 2PQ8A 2ZPAA 4LX9A 5IX3A 3DR8A 2VZZA 2EUIA 3GYAA 4QUSA 5EC4A 5DWNA 3K9UA 4DNCA 2K5TA 2ZW7A 4PV6A 1BO4A 3G8WA 2AE6A 1IB1E 2G3TA 1Y7RA 4PK3A 4YGOA 2H5MA 1S7LA 4YFJA 1SQHA 4QBJA 4XNHB 4XPDC 4F0YA 3BJ7A 5KTAA 3FBUA 3R9GA 4RI1A 3VWEA 1I12A 2OU2A 4R3LA 3ZZIA 2FCKA 3PP9A 5KTDA 1MK4A 2OZGA 2REEA 2NMTA 2B4DA 3FYNA 3RYOA 4U9YA 2ZXVA 5J8CA 4CAXA 4HNWB 5H84A 4PSWA 4UA3A 4AG9A 2B4DB 4KZTA 2D4PA 4F6AA 1S7KA 1B87A 3D2MA 1P4NA 2VZYA 3W6XA 5JQ4A 5IB0A 5JPHA 2RC4A 3WR7A 2OZHA 1N71A 1S7NA 2P6FA 4M85A 1R57A 5GCNA 3F8KA 4FD5A 4AVCA 4XPKA 4NF1A 1S5KA 2AJ6A 3BJ8A 1Y9KA 2P0WA 2FE7A 4FD7A 3S6HA 3S6FA 3H4QA 2B3VA 2Y0MA 5I0CA 2A4NA 1V0CA 4KOVA 1Y9WA 3JUWA 4H6ZA 2Q4YA 3G3SA 2O28A 2JLMA 2BSWA 2OH1A 3P2FA 2FXFA 3QB8A 4JXRA 4E8OA 2KCWA 2F5IA 3DR6A 3C26A 1I1DA 5KTCA 5H86A 2Z0ZA 4B5PB 1XEBA 4QB9A 2B4BA 2PC1A 4R57A 4KOXA 2HUZA 4HKFA 4PSXA 1YR0A 4CRZB 4H6UA 4NCZA 2FSRA 1MJ9A 3DSBA 1M4IA 2Z10A 4E2AA 3IGRA 1XIXA 4QC6A 3TE4A 2GE3A 3TFYA 2Q0YA 3FRMA 1GHEA 3LODA 5ISVA 4ONUA 2JDDA 4KORA 4KUAA 1M44A 2G0BA 2VBQA 3EO4A 3LD2A 2BUEA 2EVNA 4HNXB 1YK3A 4CAWA 3GKRA 4Y49B 5F49A 3TO7A 3GY9A 4R3KA 2FL4A 4KOTA 4MI4A 2BEIA 1KUYA 4FD4A 3SHPA 4BMHA 4UBRA 1QSOA 4AG7A 1KUVA 1QSNA 2ARHA 2CNTA 3R96A 3OWCA 2JEVA 3EY5A 4KUBA 1XF8A 3PZJA 5IV0A 1L0CA 2PR8A 1WK4A 4CRYB 3E0KA 4EVYA 2IL4A 2VEZA 1IYKA 3DDDA 4U5YA 4ORFA 2REFA 5F46A 3P2HA 1FY7A 4KOWA 4CAVA 1NSLA 1QSTA 3QAHA 4JXQA 5EBVA 5DWMA 1IYLA 3D2PA 3TT2A 1J4JA 4UWIA 3SXNA 1PU9A 1KZFA 1YX0A 2P6EA 3W6SA 2OZUA 1XE4A 2J8RA 2I79A 4OLLA 1YREA 1M1DA 3IWGA 2FT0A 1P0HA 1LRZA 4AB7A 1B6BA 1IICA 2ATRA 5C82A 1Z9UA 3B8GA 4KLWA 4II9A 1QSRA 2CNSA 3FB3A 2BL1A 2VQYA 3I3GA 1XMTA 2X7BA 4UWJA 4KOYA 2WPWA 4M3SA 4KOUA 4OAEA 1IIDA 3S6KA 2ZW6A 1YGHA 2ZW5A 3T90A 1TIQA 2Z11A 3ZJ0A 4Y49C 3DNSA 3MGDA 4MJ8A 3EC4A 4MHDA 4XNHC 4XPDB 4R9MA 2B5GB 1RO5A 1I21A 1M4DA 2HV2A 4LUAA 1Q2CA 3EFAA 4KVME 4MY3A 4RS2A 3D8PA 1UFHA 4IF5A 4X5KA 2CNMA 2R8VA 2GIVA 4I49A 3I9SA 3EXNA 2CY2A 4AVBA 3SXOA 3FXTA 3KKWA 2FIWA 4NEXA 4KLVA 2J8NA 1NMTA 3NE7A 3V8IA 2Q4VA 5E96A 1M4GA 4XPLA 4U9ZA 3W91A 5J8FA 4JLYA 3CXQA 3FNCA 1VHSA 1Z4EA 4K30A 4IUSA 2QIRA 2B5GA 2VXKA 4MBUA 1YVKA 4KVXA 1OZPA 3TCVA 1RXTA 3R95A 2DXQA 3TOAA 2Q04A 2HQYA 1MJBA 3CXSA 3F0AA 1U6MA 1PUAA 4HNYB 4YRHA 4PK2A 4GS4A 2JDCA 4NXYA 3BLNA 4AVAA 4JJXA 4L89A 2WPXA 3TOBA 2Q44A 2PRBA 3F5BA 4KVOE 2D4OA 1MJAA 3D3SA 2B58A 1WWZA 2C27A 4E0AA 1QSMA 2QMLA 4FD6A 2I00A 3S6GA 5CNPA 2G3AA 2PSWA
chains in the Genus database with same CATH superfamily
3D7HA 3HUVA 1CX8A 5JH9A 3T9YA 2P6GA 3TO6A 4MCSA 2YNCC 1YMEA 1BOBA 3CXPA 5THWA 2J8MA 2VI7A 3FEDA 4R87A 2F8HA 5F48A 4HPSA 1NE9A 1ON0A 1Q2DA 4L8AA 1S3ZA 2Z3NA 2PDOA 3IWEA 3R1KA 3KQXA 4JD6A 2R1IA 2Q7BA 1KUXA 3TTHA 3LACA 5LYLA 2QECA 5LYDA 1CPXA 3B3CA 4MCQA 1AYEA 4YWYA 2R7HA 5JM6A 2R98A 4B5OA 2ZELA 2WYRA 4ZY0A 4KS9A 4QVTA 4BD9A 4NGSA 1VKCA 2OB0A 3WT4A 4DJLA 3I1UA 5FVJA 2FIAA 4B13A 3IU1A 3TO9A 3UY5A 2B3UA 1Z8TA 4ONWA 4MRIA 5F47A 2XEFA 4NSQA 3KHZA 4ZBGA 3KR4A 4OADA 4LQGA 5F09A 5G20A 3JVNA 5C88A 2QYVA 4KOSA 3B3VA 5G22A 1K4JA 1ZO0A 4UFWA 3IFEA 4DUKA 2FS5A 4CS0B 2ZW4A 1Q2YA 2GANA 2CTBA 4C7HA 3FIXA 4UFXA 1YLEA 2WZNA 1ZLHA 3PGPA 1BLLE 1TF8A 4JWPA 3ISXA 2DEAA 2PR1A 4Z65A 3BI0A 2HC9A 4J3GA 1CM0A 3N7ZA 3DGVA 4M6GA 4CPAA 3FJUA 1Z4RA 4KSIA 3V38A 3NE8A 4FBEA 4IK2A 4C7IA 3R9EA 4WWVA 1S60A 3KL9A 5HMNA 2ODFA 2V8HA 1R3NA 5HH1A 3GB0A 1CJWA 1ZG8A 3VWDA 1TKFA 2OR4A 2Z3KA 4ZX8A 2PJ8A 3NH4A 4H89A 4NGMA 4P4FA 3SI0A 4B5PA 4BINA 3PB7X 4MY0A 3R9FA 1S7FA 1YVOA 1JQGA 4P4EA 1XBUA 4A39A 2PQ8A 4B10A 5LRJA 2Z3MA 2V8DA 2ZPAA 4LX9A 5IX3A 3DR8A 2VZZA 4IHMA 2EUIA 1DE4C 2AFWA 1X12A 3GYAA 3K9UA 4QUSA 4UEEA 5DWNA 5EC4A 3TX8A 1BAVA 1QMUA 4DNCA 2K5TA 2ZW7A 4PXCA 2GFQA 3K9TA 4NFRA 1BO4A 3G8WA 4PV6A 2AE6A 3FH4A 4JYWA 1IB1E 2GU2A 2G3TA 1Y7RA 2O4HA 3QAYA 2Q43A 4PK3A 4NGTA 2RFHA 5LYIA 4YGOA 2H5MA 1S7LA 4YFJA 1SQHA 4QBJA 4ZY2A 4XNHB 4M6HA 4XPDC 4C2ZA 4CYNA 3BJ7A 3FVLA 2GREA 1PCAA 4F0YA 5KTAA 2Q4ZA 3FBUA 3R9GA 4RI1A 3VWEA 1I12A 2OU2A 4MFJA 4R3LA 4R76A 3BHXA 4EWTA 4MFQA 4P4IA 4RN7A 3ZZIA 2FCKA 3PP9A 4UEZA 4B11A 4Q38A 5KTDA 1MK4A 3B3SA 3S9NA 2OZGA 2REEA 2NMTA 2YNCA 2B4DA 3FYNA 3H5ZA 4ZYQA 4A30A 3RYOA 2CIJA 2EBJA 3DLJA 1YW4A 4U9YA 4A38A 2ZXVA 2ZEEA 4AXVA 2JBJA 4CAXA 1ZG7A 4MHYA 5J8CA 3D4UA 1CG2A 4HNWB 3GUXA 4OC0A 3SJEA 4OKOA 4OC3A 2PJ7A 5H84A 4PSWA 2PIZA 2C1CA 4UA3A 2B4DB 4KZTA 4NGPA 4AG9A 2GLFA 2D4PA 4F6AA 1S7KA 1B87A 4CGPA 3D2MA 3WC7A 1P4NA 2VZYA 3W6XA 5JQ4A 2ABZA 5CPAA 5IB0A 2RC4A 4P4BA 5JPHA 2C6PA 3IWWA 2PIYA 4X8IA 2OZHA 3WR7A 1JWQA 1N71A 1S7NA 2P6FA 2Q51A 4M85A 4YU9A 4PPZA 1IGBA 1R57A 1ZG9A 4EFDA 5GCNA 3PB4X 3NH5A 2G9DA 3D7DA 3F8KA 4FD5A 1Y0YA 4CAEA 1IOIA 4AVCA 4XPKA 2CTCA 4CGLA 1LAPA 4NF1A 4F9UA 4O23A 1Z5RA 3PB6X 3S9LA 1S5KA 2AJ6A 3BXMA 4FWUA 2IQ6A 3BJ8A 3KR5A 3WC5A 4F0XA 1Y9KA 2DPSA 4IAVA 2P0WA 2FE7A 4FD7A 3IJ3A 3S6HA 4C68A 3S6FA 2ZEDA 3H4QA 2B3VA 2Y0MA 5I0CA 2A4NA 1V0CA 5AG7A 4H2KA 4EMEA 3NA6A 4KOVA 4W9YA 1Y9WA 3JUWA 4H6ZA 2ZEMA 2Q4YA 4CYQA 2ZEPA 3G3SA 3T8WA 2V77A 2QVPA 2O28A 2JLMA 2Z3OA 1ZLIA 2BSWA 5AG4A 1XMBA 4Q7AA 2PJ3A 2OH1A 2YNEA 3P2FA 3NFZA 2FXFA 1LAMA 3QB8A 4JXRA 4E8OA 2I3CA 2KCWA 1Z8WA 5LYFA 2F5IA 3DR6A 8CPAA 3C26A 1I1DA 3B3TA 5KTCA 4UCNA 5H86A 1A2ZA 2Z0ZA 4B14A 1XRYA 4B5PB 2PJ9A 1F2OA 4A33A 1F2PA 1XEBA 1DTDA 4MCPA 4PXDA 4NJQA 1TXRA 1ARMA 4QB9A 4C2YA 3H8EA 4PXBA 2B4BA 2PC1A 4B6ZA 4R57A 2PJ1A 4TWEA 3D68A 4KOXA 4NGNA 3IO1A 2HUZA 4HKFA 4CGMA 4PSXA 3H8FA 3JTKA 3PBBA 1YR0A 2J9AA 4CRZB 3GIUA 3SI2A 4H6UA 2PJCA 4NCZA 1H8LA 4M6IA 2FSRA 1YLOA 1TF9A 1MJ9A 2EK9A 3DSBA 1M4IA 2Z10A 4E2AA 5K8OA 1VIXA 3IGRA 1XIXA 2BOAA 2ZOGA 3KGQA 4QC6A 1X10A 2Z3PA 5D8NA 3B2YA 7CPAA 3RZAA 1TKJA 2CXAA 1Y0RA 3D66A 4MHNA 3TE4A 2GE3A 1Q7LA 4MFKA 3TFYA 2C6CA 2Q0YA 3FRMA 1GHEA 4P10A 3LODA 3IU2A 5ISVA 1Z2LA 4ONUA 5IB9A 2JDDA 4KORA 4KUAA 5CBMA 1M44A 2G0BA 3LMSA 5LRGA 4ZY1A 2VBQA 3EO4A 4C2XA 3LD2A 2BUEA 3PBEA 2EVNA 3RAMA 4HNXB 5D29A 1YK3A 3PFOA 3VATA 3RNZA 4CAWA 3GKRA 4G1PA 4Y49B 5F49A 3TO7A 3RBUA 1NSAA 1CP6A 3GY9A 5HXDA 4R3KA 3IIBA 4X2TA 3CDXA 2DPTA 4K3NA 2FL4A 4KOTA 4MI4A 2BEIA 1KUYA 4FD4A 1HEEA 4F9VA 3SHPA 2AFXA 3K2KA 5BWAB 4BMHA 4UBRA 3PB9X 4MFLA 1QSOA 3B7IA 4AG7A 1FT7A 4KSFA 4OP4A 1F57A 4NGRA 2DF5A 1KUVA 1QSNA 2ARHA 4NGQA 2CNTA 3R96A 3OWCA 4CGNA 1CP7A 2JEVA 3EY5A 1IOFA 4KUBA 4PQAA 1XF8A 4A37A 3PZJA 5IV0A 1YSJA 5DS0A 1L0CA 4MFPA 2PR8A 4R8FA 4A94A 2PVVA 1WK4A 1GYTA 3FX6A 4CRYB 3TC8A 1RTQA 1XOVA 2ZEFA 2YNDA 3CZXA 3E0KA 4UCMA 1LFWA 1XFOA 4EVYA 3PRTA 2IL4A 2PJ6A 2VEZA 4P4DA 1IYKA 3DDDA 1YQEA 4U5YA 2IMOA 1AMPA 4ORFA 2REFA 4BBHA 1CPSA 5F46A 3P2HA 1OBRA 2EWBA 2FVGA 1FY7A 3N5FA 4KOWA 4CAVA 1NSLA 1QSTA 3QAHA 3WC6A 3FEEA 3D7FA 4JXQA 5HVHA 4OIWA 5EBVA 5DWMA 4A31A 3NH8A 1IYLA 3KI9A 4GM5A 2RB7A 5K8PA 4CYPA 1M4LA 3D2PA 3TT2A 1ELLP 1J4JA 4UWIA 3SXNA 2ANPA 1PU9A 4FAIA 1IU8A 3FF3A 4MMOA 1KZFA 3GLJA 1Y7EA 1TKHA 1ELMP 1YX0A 2P6EA 4OC4A 2CF4A 3W6SA 3ISZA 2OZUA 2ZEHA 4B12A 1XE4A 2WSAA 3A9LA 2J8RA 2I79A 1PYTB 1Z8XA 1VGYA 4OLLA 1YREA 1M1DA 3IWGA 2FT0A 3FECA 3H8GA 1P0HA 3JRUA 4MHZA 1LRZA 4P4JA 4AB7A 1B6BA 1IICA 1ARLA 2ATRA 3IEHA 5C82A 3SJGA 1Z9UA 2ZOFA 3B8GA 4OC2A 3D7GA 1LANA 3PEIA 4PXEA 2ZEGA 3S9MA 4RUHA 3KZWA 4JZ0A 4KLWA 1Z8LA 4II9A 1QSRA 2CNSA 3FB3A 4MFZA 4LQ6A 2BL1A 4UIBA 3PFEA 4FUUA 2VQYA 3I3GA 1XMTA 2HB6A 2X7BA 5AG5A 3IC1A 4MHPA 1FNOA 2POKA 4CGOA 3L2NA 4P6YA 4UWJA 4UCPA 4UF4A 3VARA 4KOYA 2WPWA 4M3SA 5EMIA 2AFSA 4KOUA 2NYQA 1IIDA 4OAEA 3S6KA 4A32A 2ZW6A 2PRQA 2XEGA 4OC1A 1YGHA 2ZW5A 3T90A 4A2ZA 4ZI6A 1TIQA 2Z11A 4GXHA 3PB8X 4Y49C 3ZJ0A 3DNSA 3MGDA 4MJ8A 4Q36A 3EC4A 4MHDA 4CAFA 4OIDA 5HVGA 4XNHC 4XPDB 1QQ9A 1AUGA 2F7VA 2PVWA 4MXUA 4CYOA 4R9MA 2XEIA 2B5GB 2AFMA 1RO5A 4OC5A 1I21A 1M4DA 2HV2A 2PJAA 6CPAA 4LUAA 5G21A 1VHOA 1Q2CA 3HLPA 3EFAA 2GLJA 4NJRA 4KVME 3D67A 4MY3A 3D8PA 4RS2A 5JGFA 1UFHA 4IF5A 5ELYA 2EK8A 4X5KA 3SJFA 2BO9A 2Q7SA 1XJOA 2CNMA 3CPXA 5I4MA 2PJ2A 3BI1A 5LRKA 2AFZA 2R8VA 2GIVA 4UEFA 3MRUA 1HDUA 2PJ5A 3B3WA 4I49A 3I9SA 2XEJA 5G1ZA 3EXNA 5AG6A 2CY2A 2AFOA 4OMEA 2YGWA 4AVBA 3SXOA 4ZGYB 3FXTA 3KKWA 3KASA 2FIWA 2PJBA 4NEXA 5HVFA 3KQZA 2OOTA 4KLVA 2J8NA 3KHXA 1NMTA 3NE7A 4X3RA 4F8ZA 2BCOA 2WUUA 3V8IA 2Q4VA 1IY7A 1HDQA 2PJ4A 5E96A 1M4GA 4WJBA 4XPLA 1R43A 4U9ZA 5K8MA 3W91A 5J1QA 5J8FA 4DYOA 2VL1A 4JLYA 4ZX9A 3CXQA 3MN8A 3FNCA 1VHSA 1Z4EA 5A28A 4K30A 3CT9A 4IUSA 4TNUA 4UIAA 2QJ8A 4R7MA 2QIRA 1UWYA 2B5GA 2VXKA 1YW6A 3QNVA 4MBUA 2Z3LA 3WABA 1YVKA 2NSMA 2PCUA 4KVXA 1OZPA 3V7ZA 3TCVA 4P44A 2ZEOA 4MCRA 1RXTA 3RO0A 3R95A 2DXQA 3TOAA 4P45A 2Q04A 2HQYA 4R6TA 1MJBA 1LCPA 3CXSA 3F0AA 2JEWA 4UFVA 1U6MA 4KSAA 2PJ0A 1PUAA 2V8GA 2PE3A 4HNYB 1CBXA 3B35A 4YRHA 4PK2A 3SJXA 4GS4A 5A27A 5K8NA 3VH9A 1KWMA 2AFUA 1BPNA 2JDCA 2O53A 4NXYA 3BLNA 4AVAA 4JJXA 2EO8A 3FMCA 4L89A 2WPXA 4A95A 3TOBA 2Q44A 1VHEA 2PRBA 3F5BA 2JBKA 4KVOE 2V8VA 2D4OA 1MJAA 1LOKA 3D3SA 2B58A 1WWZA 2C27A 2IJZA 1EE3P 3SI1A 4E0AA 5AGEA 1QSMA 2QMLA 4FD6A 2I00A 3S6GA 5CNPA 3LWUA 1BPMA 2C6GA 2G3AA 3CPAA 2PSWA 2ZENA
chains in the Genus database with same CATH topology
3T9YA 2P6GA 3TO6A 2YNCC 1BOBA 3CXPA 2J8MA 2VI7A 4R87A 5F48A 1NE9A 1ON0A 1Q2DA 4L8AA 1S3ZA 2Z3NA 2PDOA 3IWEA 3R1KA 4JD6A 2R1IA 2Q7BA 1KUXA 3TTHA 2QECA 2R7HA 2R98A 4B5OA 4KS9A 4QVTA 1VKCA 2OB0A 5FVJA 2FIAA 4B13A 3IU1A 3TO9A 3UY5A 2B3UA 5F47A 4NSQA 4ZBGA 4OADA 5G20A 3JVNA 5C88A 4KOSA 5G22A 1K4JA 1ZO0A 4UFWA 2FS5A 4CS0B 2ZW4A 1Q2YA 2GANA 4C7HA 3FIXA 4UFXA 1YLEA 3PGPA 4JWPA 2PR1A 4J3GA 1CM0A 3N7ZA 1Z4RA 4C7IA 3R9EA 1S60A 5HMNA 5HH1A 1CJWA 3VWDA 2Z3KA 4H89A 4B5PA 4MY0A 3R9FA 1S7FA 1YVOA 4B10A 2PQ8A 2Z3MA 2ZPAA 4LX9A 5IX3A 3DR8A 2VZZA 2EUIA 3GYAA 4QUSA 5EC4A 5DWNA 3K9UA 4DNCA 2K5TA 2ZW7A 4PV6A 1BO4A 3G8WA 2AE6A 1IB1E 2G3TA 1Y7RA 4PK3A 4YGOA 2H5MA 1S7LA 4YFJA 1SQHA 4QBJA 4C2ZA 4XNHB 4XPDC 4CYNA 4F0YA 3BJ7A 5KTAA 3FBUA 3R9GA 4RI1A 3VWEA 1I12A 2OU2A 4MFJA 4R3LA 4MFQA 3ZZIA 2FCKA 3PP9A 4B11A 4Q38A 5KTDA 1MK4A 2OZGA 2REEA 2NMTA 2YNCA 2B4DA 3FYNA 3H5ZA 4A30A 3RYOA 4U9YA 2ZXVA 5J8CA 4CAXA 4HNWB 5H84A 4PSWA 4UA3A 4AG9A 2B4DB 4KZTA 2D4PA 4F6AA 1S7KA 1B87A 4CGPA 3D2MA 1P4NA 2VZYA 3W6XA 5JQ4A 5IB0A 5JPHA 2RC4A 3WR7A 2OZHA 1N71A 1S7NA 2P6FA 4M85A 1R57A 5GCNA 3F8KA 4FD5A 4CAEA 4AVCA 4XPKA 4CGLA 4NF1A 1S5KA 2AJ6A 3BJ8A 4F0XA 1Y9KA 2DPSA 2P0WA 2FE7A 4FD7A 3S6HA 4C68A 3S6FA 3H4QA 2B3VA 2Y0MA 5I0CA 2A4NA 1V0CA 5AG7A 4KOVA 1Y9WA 3JUWA 4H6ZA 2Q4YA 4CYQA 3G3SA 2O28A 2JLMA 2Z3OA 2BSWA 5AG4A 2OH1A 2YNEA 3P2FA 2FXFA 3QB8A 4JXRA 4E8OA 2KCWA 2F5IA 3DR6A 3C26A 1I1DA 5KTCA 4UCNA 5H86A 2Z0ZA 4B14A 4B5PB 4A33A 1XEBA 4QB9A 4C2YA 2B4BA 2PC1A 4R57A 4KOXA 2HUZA 4HKFA 4CGMA 4PSXA 3JTKA 1YR0A 4CRZB 4H6UA 4NCZA 2FSRA 1MJ9A 3DSBA 1M4IA 2Z10A 4E2AA 3IGRA 1XIXA 4QC6A 2Z3PA 2CXAA 3TE4A 2GE3A 3TFYA 4MFKA 2Q0YA 3FRMA 1GHEA 3LODA 3IU2A 5ISVA 4ONUA 2JDDA 4KORA 4KUAA 1M44A 2G0BA 2VBQA 3EO4A 4C2XA 3LD2A 2BUEA 2EVNA 4HNXB 1YK3A 4CAWA 3GKRA 4Y49B 5F49A 3TO7A 3GY9A 4R3KA 2DPTA 2FL4A 4KOTA 4MI4A 2BEIA 1KUYA 4FD4A 3SHPA 5BWAB 4BMHA 4UBRA 4MFLA 1QSOA 4AG7A 4KSFA 1KUVA 1QSNA 2ARHA 2CNTA 3R96A 3OWCA 4CGNA 2JEVA 3EY5A 4KUBA 1XF8A 3PZJA 5IV0A 1L0CA 4MFPA 2PR8A 1WK4A 4CRYB 2YNDA 3E0KA 4UCMA 4EVYA 2IL4A 2VEZA 1IYKA 3DDDA 4U5YA 4ORFA 4BBHA 2REFA 5F46A 3P2HA 1FY7A 4KOWA 4CAVA 1NSLA 1QSTA 3QAHA 4JXQA 5EBVA 5DWMA 4A31A 1IYLA 4CYPA 3D2PA 3TT2A 1J4JA 4UWIA 3SXNA 1PU9A 1KZFA 1YX0A 2P6EA 4B12A 3W6SA 2OZUA 1XE4A 2WSAA 3A9LA 2J8RA 2I79A 4OLLA 1YREA 1M1DA 3IWGA 2FT0A 1P0HA 1LRZA 4AB7A 1B6BA 1IICA 2ATRA 5C82A 1Z9UA 3B8GA 4KLWA 4II9A 1QSRA 2CNSA 3FB3A 4MFZA 2BL1A 2VQYA 3I3GA 1XMTA 2X7BA 5AG5A 4CGOA 4UWJA 4UCPA 4KOYA 2WPWA 4M3SA 4KOUA 4OAEA 1IIDA 3S6KA 4A32A 2ZW6A 1YGHA 2ZW5A 3T90A 4A2ZA 1TIQA 2Z11A 3ZJ0A 4Y49C 4CAFA 3DNSA 3MGDA 4MJ8A 4Q36A 3EC4A 4MHDA 4XNHC 4XPDB 4CYOA 4R9MA 2B5GB 1RO5A 1I21A 1M4DA 2HV2A 4LUAA 5G21A 1Q2CA 3EFAA 4KVME 4MY3A 4RS2A 3D8PA 1UFHA 4IF5A 4X5KA 2CNMA 2R8VA 2GIVA 4I49A 5G1ZA 3I9SA 3EXNA 5AG6A 2CY2A 4AVBA 2YGWA 3SXOA 4ZGYB 3FXTA 3KKWA 2FIWA 4NEXA 4KLVA 2J8NA 1NMTA 3NE7A 2WUUA 3V8IA 2Q4VA 5E96A 1M4GA 4XPLA 4U9ZA 3W91A 5J8FA 4JLYA 3CXQA 3FNCA 1VHSA 1Z4EA 5A28A 4K30A 4IUSA 2QIRA 2B5GA 2VXKA 4MBUA 2Z3LA 1YVKA 4KVXA 1OZPA 3TCVA 1RXTA 3R95A 2DXQA 3TOAA 2Q04A 2HQYA 1MJBA 3CXSA 3F0AA 4UFVA 1U6MA 4KSAA 1PUAA 4HNYB 4YRHA 4PK2A 5A27A 4GS4A 2JDCA 4NXYA 3BLNA 4AVAA 4JJXA 4L89A 4A95A 2WPXA 3TOBA 2Q44A 2PRBA 3F5BA 4KVOE 2D4OA 1MJAA 3D3SA 2B58A 1WWZA 2C27A 4E0AA 5AGEA 1QSMA 2QMLA 4FD6A 2I00A 3S6GA 5CNPA 2G3AA 2PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9Y A;  2P6G A;  3TO6 A;  1BOB A;  3CXP A;  2J8M A;  2VI7 A;  4R87 A;  5F48 A;  1NE9 A;  1ON0 A;  1Q2D A;  4L8A A;  1S3Z A;  2PDO A;  3R1K A;  4JD6 A;  2R1I A;  2Q7B A;  1KUX A;  3TTH A;  2QEC A;  2R7H A;  2R98 A;  4B5O A;  4QVT A;  1VKC A;  2OB0 A;  5FVJ A;  2FIA A;  3TO9 A;  3UY5 A;  2B3U A;  5F47 A;  4NSQ A;  4ZBG A;  4OAD A;  3JVN A;  5C88 A;  4KOS A;  1K4J A;  2FS5 A;  4CS0 B;  2ZW4 A;  1Q2Y A;  2GAN A;  3FIX A;  1YLE A;  3PGP A;  4JWP A;  2PR1 A;  4J3G A;  1CM0 A;  3N7Z A;  1Z4R A;  3R9E A;  1S60 A;  5HMN A;  5HH1 A;  1CJW A;  3VWD A;  4H89 A;  4B5P A;  4MY0 A;  3R9F A;  1S7F A;  1YVO A;  2PQ8 A;  2ZPA A;  4LX9 A;  5IX3 A;  3DR8 A;  2VZZ A;  2EUI A;  3GYA A;  4QUS A;  5EC4 A;  5DWN A;  3K9U A;  4DNC A;  2K5T A;  2ZW7 A;  4PV6 A;  1BO4 A;  3G8W A;  2AE6 A;  1IB1 E;  2G3T A;  1Y7R A;  4PK3 A;  4YGO A;  2H5M A;  1S7L A;  4YFJ A;  1SQH A;  4QBJ A;  4XNH B;  4XPD C;  4F0Y A;  3BJ7 A;  5KTA A;  3FBU A;  3R9G A;  4RI1 A;  3VWE A;  1I12 A;  2OU2 A;  4R3L A;  3ZZI A;  2FCK A;  3PP9 A;  5KTD A;  1MK4 A;  2OZG A;  2REE A;  2NMT A;  2B4D A;  3FYN A;  3RYO A;  4U9Y A;  2ZXV A;  5J8C A;  4CAX A;  4HNW B;  5H84 A;  4PSW A;  4UA3 A;  4AG9 A;  2B4D B;  4KZT A;  2D4P A;  4F6A A;  1S7K A;  1B87 A;  3D2M A;  1P4N A;  2VZY A;  3W6X A;  5JQ4 A;  5IB0 A;  5JPH A;  2RC4 A;  3WR7 A;  2OZH A;  1N71 A;  1S7N A;  2P6F A;  4M85 A;  1R57 A;  5GCN A;  3F8K A;  4FD5 A;  4AVC A;  4XPK A;  4NF1 A;  1S5K A;  2AJ6 A;  3BJ8 A;  1Y9K A;  2P0W A;  2FE7 A;  4FD7 A;  3S6H A;  3S6F A;  3H4Q A;  2B3V A;  2Y0M A;  5I0C A;  2A4N A;  1V0C A;  4KOV A;  1Y9W A;  3JUW A;  4H6Z A;  2Q4Y A;  3G3S A;  2O28 A;  2JLM A;  2BSW A;  2OH1 A;  3P2F A;  2FXF A;  3QB8 A;  4JXR A;  4E8O A;  2KCW A;  2F5I A;  3DR6 A;  3C26 A;  1I1D A;  5KTC A;  5H86 A;  2Z0Z A;  4B5P B;  1XEB A;  4QB9 A;  2B4B A;  2PC1 A;  4R57 A;  4KOX A;  2HUZ A;  4HKF A;  4PSX A;  1YR0 A;  4CRZ B;  4H6U A;  4NCZ A;  2FSR A;  1MJ9 A;  3DSB A;  1M4I A;  2Z10 A;  4E2A A;  3IGR A;  1XIX A;  4QC6 A;  3TE4 A;  2GE3 A;  3TFY A;  2Q0Y A;  3FRM A;  1GHE A;  3LOD A;  5ISV A;  4ONU A;  2JDD A;  4KOR A;  4KUA A;  1M44 A;  2G0B A;  2VBQ A;  3EO4 A;  3LD2 A;  2BUE A;  2EVN A;  4HNX B;  1YK3 A;  4CAW A;  3GKR A;  4Y49 B;  5F49 A;  3TO7 A;  3GY9 A;  4R3K A;  2FL4 A;  4KOT A;  4MI4 A;  2BEI A;  1KUY A;  4FD4 A;  3SHP A;  4BMH A;  4UBR A;  1QSO A;  4AG7 A;  1KUV A;  1QSN A;  2ARH A;  2CNT A;  3R96 A;  3OWC A;  2JEV A;  3EY5 A;  4KUB A;  1XF8 A;  3PZJ A;  5IV0 A;  1L0C A;  2PR8 A;  1WK4 A;  4CRY B;  3E0K A;  4EVY A;  2IL4 A;  2VEZ A;  1IYK A;  3DDD A;  4U5Y A;  4ORF A;  2REF A;  5F46 A;  3P2H A;  1FY7 A;  4KOW A;  4CAV A;  1NSL A;  1QST A;  3QAH A;  4JXQ A;  5EBV A;  5DWM A;  1IYL A;  3D2P A;  3TT2 A;  1J4J A;  4UWI A;  3SXN A;  1PU9 A;  1KZF A;  1YX0 A;  2P6E A;  3W6S A;  2OZU A;  1XE4 A;  2J8R A;  2I79 A;  4OLL A;  1YRE A;  1M1D A;  3IWG A;  2FT0 A;  1P0H A;  1LRZ A;  4AB7 A;  1B6B A;  1IIC A;  2ATR A;  5C82 A;  1Z9U A;  3B8G A;  4KLW A;  4II9 A;  1QSR A;  2CNS A;  3FB3 A;  2BL1 A;  2VQY A;  3I3G A;  1XMT A;  2X7B A;  4UWJ A;  4KOY A;  2WPW A;  4M3S A;  4KOU A;  4OAE A;  1IID A;  3S6K A;  2ZW6 A;  1YGH A;  2ZW5 A;  3T90 A;  1TIQ A;  2Z11 A;  3ZJ0 A;  4Y49 C;  3DNS A;  3MGD A;  4MJ8 A;  3EC4 A;  4MHD A;  4XNH C;  4XPD B;  4R9M A;  2B5G B;  1RO5 A;  1I21 A;  1M4D A;  2HV2 A;  4LUA A;  1Q2C A;  3EFA A;  4KVM E;  4MY3 A;  4RS2 A;  3D8P A;  1UFH A;  4IF5 A;  4X5K A;  2CNM A;  2R8V A;  2GIV A;  4I49 A;  3I9S A;  3EXN A;  2CY2 A;  4AVB A;  3SXO A;  3FXT A;  3KKW A;  2FIW A;  4NEX A;  4KLV A;  2J8N A;  1NMT A;  3NE7 A;  3V8I A;  2Q4V A;  5E96 A;  1M4G A;  4XPL A;  4U9Z A;  3W91 A;  5J8F A;  4JLY A;  3CXQ A;  3FNC A;  1VHS A;  1Z4E A;  4K30 A;  4IUS A;  2QIR A;  2B5G A;  2VXK A;  4MBU A;  1YVK A;  4KVX A;  1OZP A;  3TCV A;  1RXT A;  3R95 A;  2DXQ A;  3TOA A;  2Q04 A;  2HQY A;  1MJB A;  3CXS A;  3F0A A;  1U6M A;  1PUA A;  4HNY B;  4YRH A;  4PK2 A;  4GS4 A;  2JDC A;  4NXY A;  3BLN A;  4AVA A;  4JJX A;  4L89 A;  2WPX A;  3TOB A;  2Q44 A;  2PRB A;  3F5B A;  4KVO E;  2D4O A;  1MJA A;  3D3S A;  2B58 A;  1WWZ A;  2C27 A;  4E0A A;  1QSM A;  2QML A;  4FD6 A;  2I00 A;  3S6G A;  5CNP A;  2G3A A;  2PSW A; 
#chains in the Genus database with same CATH topology
 3D7H A;  3HUV A;  1CX8 A;  5JH9 A;  3T9Y A;  2P6G A;  3TO6 A;  4MCS A;  2YNC C;  1YME A;  1BOB A;  3CXP A;  5THW A;  2J8M A;  2VI7 A;  3FED A;  4R87 A;  2F8H A;  5F48 A;  4HPS A;  1NE9 A;  1ON0 A;  1Q2D A;  4L8A A;  1S3Z A;  2Z3N A;  2PDO A;  3IWE A;  3R1K A;  3KQX A;  4JD6 A;  2R1I A;  2Q7B A;  1KUX A;  3TTH A;  3LAC A;  5LYL A;  2QEC A;  5LYD A;  1CPX A;  3B3C A;  4MCQ A;  1AYE A;  4YWY A;  2R7H A;  5JM6 A;  2R98 A;  4B5O A;  2ZEL A;  2WYR A;  4ZY0 A;  4KS9 A;  4QVT A;  4BD9 A;  4NGS A;  1VKC A;  2OB0 A;  3WT4 A;  4DJL A;  3I1U A;  5FVJ A;  2FIA A;  4B13 A;  3IU1 A;  3TO9 A;  3UY5 A;  2B3U A;  1Z8T A;  4ONW A;  4MRI A;  5F47 A;  2XEF A;  4NSQ A;  3KHZ A;  4ZBG A;  3KR4 A;  4OAD A;  4LQG A;  5F09 A;  5G20 A;  3JVN A;  5C88 A;  2QYV A;  4KOS A;  3B3V A;  5G22 A;  1K4J A;  1ZO0 A;  4UFW A;  3IFE A;  4DUK A;  2FS5 A;  4CS0 B;  2ZW4 A;  1Q2Y A;  2GAN A;  2CTB A;  4C7H A;  3FIX A;  4UFX A;  1YLE A;  2WZN A;  1ZLH A;  3PGP A;  1BLL E;  1TF8 A;  4JWP A;  3ISX A;  2DEA A;  2PR1 A;  4Z65 A;  3BI0 A;  2HC9 A;  4J3G A;  1CM0 A;  3N7Z A;  3DGV A;  4M6G A;  4CPA A;  3FJU A;  1Z4R A;  4KSI A;  3V38 A;  3NE8 A;  4FBE A;  4IK2 A;  4C7I A;  3R9E A;  4WWV A;  1S60 A;  3KL9 A;  5HMN A;  2ODF A;  2V8H A;  1R3N A;  5HH1 A;  3GB0 A;  1CJW A;  1ZG8 A;  3VWD A;  1TKF A;  2OR4 A;  2Z3K A;  4ZX8 A;  2PJ8 A;  3NH4 A;  4H89 A;  4NGM A;  4P4F A;  3SI0 A;  4B5P A;  4BIN A;  3PB7 X;  4MY0 A;  3R9F A;  1S7F A;  1YVO A;  1JQG A;  4P4E A;  1XBU A;  4A39 A;  2PQ8 A;  4B10 A;  5LRJ A;  2Z3M A;  2V8D A;  2ZPA A;  4LX9 A;  5IX3 A;  3DR8 A;  2VZZ A;  4IHM A;  2EUI A;  1DE4 C;  2AFW A;  1X12 A;  3GYA A;  3K9U A;  4QUS A;  4UEE A;  5DWN A;  5EC4 A;  3TX8 A;  1BAV A;  1QMU A;  4DNC A;  2K5T A;  2ZW7 A;  4PXC A;  2GFQ A;  3K9T A;  4NFR A;  1BO4 A;  3G8W A;  4PV6 A;  2AE6 A;  3FH4 A;  4JYW A;  1IB1 E;  2GU2 A;  2G3T A;  1Y7R A;  2O4H A;  3QAY A;  2Q43 A;  4PK3 A;  4NGT A;  2RFH A;  5LYI A;  4YGO A;  2H5M A;  1S7L A;  4YFJ A;  1SQH A;  4QBJ A;  4ZY2 A;  4XNH B;  4M6H A;  4XPD C;  4C2Z A;  4CYN A;  3BJ7 A;  3FVL A;  2GRE A;  1PCA A;  4F0Y A;  5KTA A;  2Q4Z A;  3FBU A;  3R9G A;  4RI1 A;  3VWE A;  1I12 A;  2OU2 A;  4MFJ A;  4R3L A;  4R76 A;  3BHX A;  4EWT A;  4MFQ A;  4P4I A;  4RN7 A;  3ZZI A;  2FCK A;  3PP9 A;  4UEZ A;  4B11 A;  4Q38 A;  5KTD A;  1MK4 A;  3B3S A;  3S9N A;  2OZG A;  2REE A;  2NMT A;  2YNC A;  2B4D A;  3FYN A;  3H5Z A;  4ZYQ A;  4A30 A;  3RYO A;  2CIJ A;  2EBJ A;  3DLJ A;  1YW4 A;  4U9Y A;  4A38 A;  2ZXV A;  2ZEE A;  4AXV A;  2JBJ A;  4CAX A;  1ZG7 A;  4MHY A;  5J8C A;  3D4U A;  1CG2 A;  4HNW B;  3GUX A;  4OC0 A;  3SJE A;  4OKO A;  4OC3 A;  2PJ7 A;  5H84 A;  4PSW A;  2PIZ A;  2C1C A;  4UA3 A;  2B4D B;  4KZT A;  4NGP A;  4AG9 A;  2GLF A;  2D4P A;  4F6A A;  1S7K A;  1B87 A;  4CGP A;  3D2M A;  3WC7 A;  1P4N A;  2VZY A;  3W6X A;  5JQ4 A;  2ABZ A;  5CPA A;  5IB0 A;  2RC4 A;  4P4B A;  5JPH A;  2C6P A;  3IWW A;  2PIY A;  4X8I A;  2OZH A;  3WR7 A;  1JWQ A;  1N71 A;  1S7N A;  2P6F A;  2Q51 A;  4M85 A;  4YU9 A;  4PPZ A;  1IGB A;  1R57 A;  1ZG9 A;  4EFD A;  5GCN A;  3PB4 X;  3NH5 A;  2G9D A;  3D7D A;  3F8K A;  4FD5 A;  1Y0Y A;  4CAE A;  1IOI A;  4AVC A;  4XPK A;  2CTC A;  4CGL A;  1LAP A;  4NF1 A;  4F9U A;  4O23 A;  1Z5R A;  3PB6 X;  3S9L A;  1S5K A;  2AJ6 A;  3BXM A;  4FWU A;  2IQ6 A;  3BJ8 A;  3KR5 A;  3WC5 A;  4F0X A;  1Y9K A;  2DPS A;  4IAV A;  2P0W A;  2FE7 A;  4FD7 A;  3IJ3 A;  3S6H A;  4C68 A;  3S6F A;  2ZED A;  3H4Q A;  2B3V A;  2Y0M A;  5I0C A;  2A4N A;  1V0C A;  5AG7 A;  4H2K A;  4EME A;  3NA6 A;  4KOV A;  4W9Y A;  1Y9W A;  3JUW A;  4H6Z A;  2ZEM A;  2Q4Y A;  4CYQ A;  2ZEP A;  3G3S A;  3T8W A;  2V77 A;  2QVP A;  2O28 A;  2JLM A;  2Z3O A;  1ZLI A;  2BSW A;  5AG4 A;  1XMB A;  4Q7A A;  2PJ3 A;  2OH1 A;  2YNE A;  3P2F A;  3NFZ A;  2FXF A;  1LAM A;  3QB8 A;  4JXR A;  4E8O A;  2I3C A;  2KCW A;  1Z8W A;  5LYF A;  2F5I A;  3DR6 A;  8CPA A;  3C26 A;  1I1D A;  3B3T A;  5KTC A;  4UCN A;  5H86 A;  1A2Z A;  2Z0Z A;  4B14 A;  1XRY A;  4B5P B;  2PJ9 A;  1F2O A;  4A33 A;  1F2P A;  1XEB A;  1DTD A;  4MCP A;  4PXD A;  4NJQ A;  1TXR A;  1ARM A;  4QB9 A;  4C2Y A;  3H8E A;  4PXB A;  2B4B A;  2PC1 A;  4B6Z A;  4R57 A;  2PJ1 A;  4TWE A;  3D68 A;  4KOX A;  4NGN A;  3IO1 A;  2HUZ A;  4HKF A;  4CGM A;  4PSX A;  3H8F A;  3JTK A;  3PBB A;  1YR0 A;  2J9A A;  4CRZ B;  3GIU A;  3SI2 A;  4H6U A;  2PJC A;  4NCZ A;  1H8L A;  4M6I A;  2FSR A;  1YLO A;  1TF9 A;  1MJ9 A;  2EK9 A;  3DSB A;  1M4I A;  2Z10 A;  4E2A A;  5K8O A;  1VIX A;  3IGR A;  1XIX A;  2BOA A;  2ZOG A;  3KGQ A;  4QC6 A;  1X10 A;  2Z3P A;  5D8N A;  3B2Y A;  7CPA A;  3RZA A;  1TKJ A;  2CXA A;  1Y0R A;  3D66 A;  4MHN A;  3TE4 A;  2GE3 A;  1Q7L A;  4MFK A;  3TFY A;  2C6C A;  2Q0Y A;  3FRM A;  1GHE A;  4P10 A;  3LOD A;  3IU2 A;  5ISV A;  1Z2L A;  4ONU A;  5IB9 A;  2JDD A;  4KOR A;  4KUA A;  5CBM A;  1M44 A;  2G0B A;  3LMS A;  5LRG A;  4ZY1 A;  2VBQ A;  3EO4 A;  4C2X A;  3LD2 A;  2BUE A;  3PBE A;  2EVN A;  3RAM A;  4HNX B;  5D29 A;  1YK3 A;  3PFO A;  3VAT A;  3RNZ A;  4CAW A;  3GKR A;  4G1P A;  4Y49 B;  5F49 A;  3TO7 A;  3RBU A;  1NSA A;  1CP6 A;  3GY9 A;  5HXD A;  4R3K A;  3IIB A;  4X2T A;  3CDX A;  2DPT A;  4K3N A;  2FL4 A;  4KOT A;  4MI4 A;  2BEI A;  1KUY A;  4FD4 A;  1HEE A;  4F9V A;  3SHP A;  2AFX A;  3K2K A;  5BWA B;  4BMH A;  4UBR A;  3PB9 X;  4MFL A;  1QSO A;  3B7I A;  4AG7 A;  1FT7 A;  4KSF A;  4OP4 A;  1F57 A;  4NGR A;  2DF5 A;  1KUV A;  1QSN A;  2ARH A;  4NGQ A;  2CNT A;  3R96 A;  3OWC A;  4CGN A;  1CP7 A;  2JEV A;  3EY5 A;  1IOF A;  4KUB A;  4PQA A;  1XF8 A;  4A37 A;  3PZJ A;  5IV0 A;  1YSJ A;  5DS0 A;  1L0C A;  4MFP A;  2PR8 A;  4R8F A;  4A94 A;  2PVV A;  1WK4 A;  1GYT A;  3FX6 A;  4CRY B;  3TC8 A;  1RTQ A;  1XOV A;  2ZEF A;  2YND A;  3CZX A;  3E0K A;  4UCM A;  1LFW A;  1XFO A;  4EVY A;  3PRT A;  2IL4 A;  2PJ6 A;  2VEZ A;  4P4D A;  1IYK A;  3DDD A;  1YQE A;  4U5Y A;  2IMO A;  1AMP A;  4ORF A;  2REF A;  4BBH A;  1CPS A;  5F46 A;  3P2H A;  1OBR A;  2EWB A;  2FVG A;  1FY7 A;  3N5F A;  4KOW A;  4CAV A;  1NSL A;  1QST A;  3QAH A;  3WC6 A;  3FEE A;  3D7F A;  4JXQ A;  5HVH A;  4OIW A;  5EBV A;  5DWM A;  4A31 A;  3NH8 A;  1IYL A;  3KI9 A;  4GM5 A;  2RB7 A;  5K8P A;  4CYP A;  1M4L A;  3D2P A;  3TT2 A;  1ELL P;  1J4J A;  4UWI A;  3SXN A;  2ANP A;  1PU9 A;  4FAI A;  1IU8 A;  3FF3 A;  4MMO A;  1KZF A;  3GLJ A;  1Y7E A;  1TKH A;  1ELM P;  1YX0 A;  2P6E A;  4OC4 A;  2CF4 A;  3W6S A;  3ISZ A;  2OZU A;  2ZEH A;  4B12 A;  1XE4 A;  2WSA A;  3A9L A;  2J8R A;  2I79 A;  1PYT B;  1Z8X A;  1VGY A;  4OLL A;  1YRE A;  1M1D A;  3IWG A;  2FT0 A;  3FEC A;  3H8G A;  1P0H A;  3JRU A;  4MHZ A;  1LRZ A;  4P4J A;  4AB7 A;  1B6B A;  1IIC A;  1ARL A;  2ATR A;  3IEH A;  5C82 A;  3SJG A;  1Z9U A;  2ZOF A;  3B8G A;  4OC2 A;  3D7G A;  1LAN A;  3PEI A;  4PXE A;  2ZEG A;  3S9M A;  4RUH A;  3KZW A;  4JZ0 A;  4KLW A;  1Z8L A;  4II9 A;  1QSR A;  2CNS A;  3FB3 A;  4MFZ A;  4LQ6 A;  2BL1 A;  4UIB A;  3PFE A;  4FUU A;  2VQY A;  3I3G A;  1XMT A;  2HB6 A;  2X7B A;  5AG5 A;  3IC1 A;  4MHP A;  1FNO A;  2POK A;  4CGO A;  3L2N A;  4P6Y A;  4UWJ A;  4UCP A;  4UF4 A;  3VAR A;  4KOY A;  2WPW A;  4M3S A;  5EMI A;  2AFS A;  4KOU A;  2NYQ A;  1IID A;  4OAE A;  3S6K A;  4A32 A;  2ZW6 A;  2PRQ A;  2XEG A;  4OC1 A;  1YGH A;  2ZW5 A;  3T90 A;  4A2Z A;  4ZI6 A;  1TIQ A;  2Z11 A;  4GXH A;  3PB8 X;  4Y49 C;  3ZJ0 A;  3DNS A;  3MGD A;  4MJ8 A;  4Q36 A;  3EC4 A;  4MHD A;  4CAF A;  4OID A;  5HVG A;  4XNH C;  4XPD B;  1QQ9 A;  1AUG A;  2F7V A;  2PVW A;  4MXU A;  4CYO A;  4R9M A;  2XEI A;  2B5G B;  2AFM A;  1RO5 A;  4OC5 A;  1I21 A;  1M4D A;  2HV2 A;  2PJA A;  6CPA A;  4LUA A;  5G21 A;  1VHO A;  1Q2C A;  3HLP A;  3EFA A;  2GLJ A;  4NJR A;  4KVM E;  3D67 A;  4MY3 A;  3D8P A;  4RS2 A;  5JGF A;  1UFH A;  4IF5 A;  5ELY A;  2EK8 A;  4X5K A;  3SJF A;  2BO9 A;  2Q7S A;  1XJO A;  2CNM A;  3CPX A;  5I4M A;  2PJ2 A;  3BI1 A;  5LRK A;  2AFZ A;  2R8V A;  2GIV A;  4UEF A;  3MRU A;  1HDU A;  2PJ5 A;  3B3W A;  4I49 A;  3I9S A;  2XEJ A;  5G1Z A;  3EXN A;  5AG6 A;  2CY2 A;  2AFO A;  4OME A;  2YGW A;  4AVB A;  3SXO A;  4ZGY B;  3FXT A;  3KKW A;  3KAS A;  2FIW A;  2PJB A;  4NEX A;  5HVF A;  3KQZ A;  2OOT A;  4KLV A;  2J8N A;  3KHX A;  1NMT A;  3NE7 A;  4X3R A;  4F8Z A;  2BCO A;  2WUU A;  3V8I A;  2Q4V A;  1IY7 A;  1HDQ A;  2PJ4 A;  5E96 A;  1M4G A;  4WJB A;  4XPL A;  1R43 A;  4U9Z A;  5K8M A;  3W91 A;  5J1Q A;  5J8F A;  4DYO A;  2VL1 A;  4JLY A;  4ZX9 A;  3CXQ A;  3MN8 A;  3FNC A;  1VHS A;  1Z4E A;  5A28 A;  4K30 A;  3CT9 A;  4IUS A;  4TNU A;  4UIA A;  2QJ8 A;  4R7M A;  2QIR A;  1UWY A;  2B5G A;  2VXK A;  1YW6 A;  3QNV A;  4MBU A;  2Z3L A;  3WAB A;  1YVK A;  2NSM A;  2PCU A;  4KVX A;  1OZP A;  3V7Z A;  3TCV A;  4P44 A;  2ZEO A;  4MCR A;  1RXT A;  3RO0 A;  3R95 A;  2DXQ A;  3TOA A;  4P45 A;  2Q04 A;  2HQY A;  4R6T A;  1MJB A;  1LCP A;  3CXS A;  3F0A A;  2JEW A;  4UFV A;  1U6M A;  4KSA A;  2PJ0 A;  1PUA A;  2V8G A;  2PE3 A;  4HNY B;  1CBX A;  3B35 A;  4YRH A;  4PK2 A;  3SJX A;  4GS4 A;  5A27 A;  5K8N A;  3VH9 A;  1KWM A;  2AFU A;  1BPN A;  2JDC A;  2O53 A;  4NXY A;  3BLN A;  4AVA A;  4JJX A;  2EO8 A;  3FMC A;  4L89 A;  2WPX A;  4A95 A;  3TOB A;  2Q44 A;  1VHE A;  2PRB A;  3F5B A;  2JBK A;  4KVO E;  2V8V A;  2D4O A;  1MJA A;  1LOK A;  3D3S A;  2B58 A;  1WWZ A;  2C27 A;  2IJZ A;  1EE3 P;  3SI1 A;  4E0A A;  5AGE A;  1QSM A;  2QML A;  4FD6 A;  2I00 A;  3S6G A;  5CNP A;  3LWU A;  1BPM A;  2C6G A;  2G3A A;  3CPA A;  2PSW A;  2ZEN A; 
#chains in the Genus database with same CATH homology
 3T9Y A;  2P6G A;  3TO6 A;  2YNC C;  1BOB A;  3CXP A;  2J8M A;  2VI7 A;  4R87 A;  5F48 A;  1NE9 A;  1ON0 A;  1Q2D A;  4L8A A;  1S3Z A;  2Z3N A;  2PDO A;  3IWE A;  3R1K A;  4JD6 A;  2R1I A;  2Q7B A;  1KUX A;  3TTH A;  2QEC A;  2R7H A;  2R98 A;  4B5O A;  4KS9 A;  4QVT A;  1VKC A;  2OB0 A;  5FVJ A;  2FIA A;  4B13 A;  3IU1 A;  3TO9 A;  3UY5 A;  2B3U A;  5F47 A;  4NSQ A;  4ZBG A;  4OAD A;  5G20 A;  3JVN A;  5C88 A;  4KOS A;  5G22 A;  1K4J A;  1ZO0 A;  4UFW A;  2FS5 A;  4CS0 B;  2ZW4 A;  1Q2Y A;  2GAN A;  4C7H A;  3FIX A;  4UFX A;  1YLE A;  3PGP A;  4JWP A;  2PR1 A;  4J3G A;  1CM0 A;  3N7Z A;  1Z4R A;  4C7I A;  3R9E A;  1S60 A;  5HMN A;  5HH1 A;  1CJW A;  3VWD A;  2Z3K A;  4H89 A;  4B5P A;  4MY0 A;  3R9F A;  1S7F A;  1YVO A;  4B10 A;  2PQ8 A;  2Z3M A;  2ZPA A;  4LX9 A;  5IX3 A;  3DR8 A;  2VZZ A;  2EUI A;  3GYA A;  4QUS A;  5EC4 A;  5DWN A;  3K9U A;  4DNC A;  2K5T A;  2ZW7 A;  4PV6 A;  1BO4 A;  3G8W A;  2AE6 A;  1IB1 E;  2G3T A;  1Y7R A;  4PK3 A;  4YGO A;  2H5M A;  1S7L A;  4YFJ A;  1SQH A;  4QBJ A;  4C2Z A;  4XNH B;  4XPD C;  4CYN A;  4F0Y A;  3BJ7 A;  5KTA A;  3FBU A;  3R9G A;  4RI1 A;  3VWE A;  1I12 A;  2OU2 A;  4MFJ A;  4R3L A;  4MFQ A;  3ZZI A;  2FCK A;  3PP9 A;  4B11 A;  4Q38 A;  5KTD A;  1MK4 A;  2OZG A;  2REE A;  2NMT A;  2YNC A;  2B4D A;  3FYN A;  3H5Z A;  4A30 A;  3RYO A;  4U9Y A;  2ZXV A;  5J8C A;  4CAX A;  4HNW B;  5H84 A;  4PSW A;  4UA3 A;  4AG9 A;  2B4D B;  4KZT A;  2D4P A;  4F6A A;  1S7K A;  1B87 A;  4CGP A;  3D2M A;  1P4N A;  2VZY A;  3W6X A;  5JQ4 A;  5IB0 A;  5JPH A;  2RC4 A;  3WR7 A;  2OZH A;  1N71 A;  1S7N A;  2P6F A;  4M85 A;  1R57 A;  5GCN A;  3F8K A;  4FD5 A;  4CAE A;  4AVC A;  4XPK A;  4CGL A;  4NF1 A;  1S5K A;  2AJ6 A;  3BJ8 A;  4F0X A;  1Y9K A;  2DPS A;  2P0W A;  2FE7 A;  4FD7 A;  3S6H A;  4C68 A;  3S6F A;  3H4Q A;  2B3V A;  2Y0M A;  5I0C A;  2A4N A;  1V0C A;  5AG7 A;  4KOV A;  1Y9W A;  3JUW A;  4H6Z A;  2Q4Y A;  4CYQ A;  3G3S A;  2O28 A;  2JLM A;  2Z3O A;  2BSW A;  5AG4 A;  2OH1 A;  2YNE A;  3P2F A;  2FXF A;  3QB8 A;  4JXR A;  4E8O A;  2KCW A;  2F5I A;  3DR6 A;  3C26 A;  1I1D A;  5KTC A;  4UCN A;  5H86 A;  2Z0Z A;  4B14 A;  4B5P B;  4A33 A;  1XEB A;  4QB9 A;  4C2Y A;  2B4B A;  2PC1 A;  4R57 A;  4KOX A;  2HUZ A;  4HKF A;  4CGM A;  4PSX A;  3JTK A;  1YR0 A;  4CRZ B;  4H6U A;  4NCZ A;  2FSR A;  1MJ9 A;  3DSB A;  1M4I A;  2Z10 A;  4E2A A;  3IGR A;  1XIX A;  4QC6 A;  2Z3P A;  2CXA A;  3TE4 A;  2GE3 A;  3TFY A;  4MFK A;  2Q0Y A;  3FRM A;  1GHE A;  3LOD A;  3IU2 A;  5ISV A;  4ONU A;  2JDD A;  4KOR A;  4KUA A;  1M44 A;  2G0B A;  2VBQ A;  3EO4 A;  4C2X A;  3LD2 A;  2BUE A;  2EVN A;  4HNX B;  1YK3 A;  4CAW A;  3GKR A;  4Y49 B;  5F49 A;  3TO7 A;  3GY9 A;  4R3K A;  2DPT A;  2FL4 A;  4KOT A;  4MI4 A;  2BEI A;  1KUY A;  4FD4 A;  3SHP A;  5BWA B;  4BMH A;  4UBR A;  4MFL A;  1QSO A;  4AG7 A;  4KSF A;  1KUV A;  1QSN A;  2ARH A;  2CNT A;  3R96 A;  3OWC A;  4CGN A;  2JEV A;  3EY5 A;  4KUB A;  1XF8 A;  3PZJ A;  5IV0 A;  1L0C A;  4MFP A;  2PR8 A;  1WK4 A;  4CRY B;  2YND A;  3E0K A;  4UCM A;  4EVY A;  2IL4 A;  2VEZ A;  1IYK A;  3DDD A;  4U5Y A;  4ORF A;  4BBH A;  2REF A;  5F46 A;  3P2H A;  1FY7 A;  4KOW A;  4CAV A;  1NSL A;  1QST A;  3QAH A;  4JXQ A;  5EBV A;  5DWM A;  4A31 A;  1IYL A;  4CYP A;  3D2P A;  3TT2 A;  1J4J A;  4UWI A;  3SXN A;  1PU9 A;  1KZF A;  1YX0 A;  2P6E A;  4B12 A;  3W6S A;  2OZU A;  1XE4 A;  2WSA A;  3A9L A;  2J8R A;  2I79 A;  4OLL A;  1YRE A;  1M1D A;  3IWG A;  2FT0 A;  1P0H A;  1LRZ A;  4AB7 A;  1B6B A;  1IIC A;  2ATR A;  5C82 A;  1Z9U A;  3B8G A;  4KLW A;  4II9 A;  1QSR A;  2CNS A;  3FB3 A;  4MFZ A;  2BL1 A;  2VQY A;  3I3G A;  1XMT A;  2X7B A;  5AG5 A;  4CGO A;  4UWJ A;  4UCP A;  4KOY A;  2WPW A;  4M3S A;  4KOU A;  4OAE A;  1IID A;  3S6K A;  4A32 A;  2ZW6 A;  1YGH A;  2ZW5 A;  3T90 A;  4A2Z A;  1TIQ A;  2Z11 A;  3ZJ0 A;  4Y49 C;  4CAF A;  3DNS A;  3MGD A;  4MJ8 A;  4Q36 A;  3EC4 A;  4MHD A;  4XNH C;  4XPD B;  4CYO A;  4R9M A;  2B5G B;  1RO5 A;  1I21 A;  1M4D A;  2HV2 A;  4LUA A;  5G21 A;  1Q2C A;  3EFA A;  4KVM E;  4MY3 A;  4RS2 A;  3D8P A;  1UFH A;  4IF5 A;  4X5K A;  2CNM A;  2R8V A;  2GIV A;  4I49 A;  5G1Z A;  3I9S A;  3EXN A;  5AG6 A;  2CY2 A;  4AVB A;  2YGW A;  3SXO A;  4ZGY B;  3FXT A;  3KKW A;  2FIW A;  4NEX A;  4KLV A;  2J8N A;  1NMT A;  3NE7 A;  2WUU A;  3V8I A;  2Q4V A;  5E96 A;  1M4G A;  4XPL A;  4U9Z A;  3W91 A;  5J8F A;  4JLY A;  3CXQ A;  3FNC A;  1VHS A;  1Z4E A;  5A28 A;  4K30 A;  4IUS A;  2QIR A;  2B5G A;  2VXK A;  4MBU A;  2Z3L A;  1YVK A;  4KVX A;  1OZP A;  3TCV A;  1RXT A;  3R95 A;  2DXQ A;  3TOA A;  2Q04 A;  2HQY A;  1MJB A;  3CXS A;  3F0A A;  4UFV A;  1U6M A;  4KSA A;  1PUA A;  4HNY B;  4YRH A;  4PK2 A;  5A27 A;  4GS4 A;  2JDC A;  4NXY A;  3BLN A;  4AVA A;  4JJX A;  4L89 A;  4A95 A;  2WPX A;  3TOB A;  2Q44 A;  2PRB A;  3F5B A;  4KVO E;  2D4O A;  1MJA A;  3D3S A;  2B58 A;  1WWZ A;  2C27 A;  4E0A A;  5AGE A;  1QSM A;  2QML A;  4FD6 A;  2I00 A;  3S6G A;  5CNP A;  2G3A A;  2PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...